1WJTA

Solution structure of the n-terminal domain i of mouse transcription elongation factor s-ii protein 3
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
GSSGSSGMGLEEELLRIAKKLEKMVSRKKTEGALDLLKKLNSCQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPRTTKGERESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor S-II protein 3
publication title Solution structure of the N-terminal Domain I of mouse transcription elongation factor S-II protein 3
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 24
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1wjtA00
2XPPA 1Z9EA 2N3AB 2B4JC 3HPGG 3NFQA 2XPNA 3HPHE 3O8ZA 2XPOA 3U88C 1EO0A 1WJTA 2XPLA 3OAKA 3F9KC
chains in the Genus database with same CATH superfamily
3SJEA 4X3RA 2XPOA 4OC5A 4JYWA 1Z9EA 5AXIA 4OC3A 5HKZA 3HPHE 4P4BA 4OC1A 3VGOA 3S9LA 4MCPA 3D7FA 3BI0A 3VRRA 4P4DA 2PVVA 2JBKA 4LQGA 2VKZG 4NGQA 3SJGA 3OB2B 4MCQA 2N3AB 2CIJA 5HKYA 3NFQA 4P44A 2XEIA 3OB1B 3HMJG 2CBLA 1WJTA 4P4IA 4P4JA 3D7GA 3KASA 2Y1NA 3HPGG 3FECA 4NGRA 4W9YA 3OAKA 4JZ0A 4GPLB 4P4FA 3VRPA 2C6GA 3BUWB 3VRQA 3ZNIA 3BUXB 3BUOB 3BUMB 2PVWA 3IWWA 3FF3A 5F13A 2OOTA 5HKWA 3S9MA 3BUNB 1Z8LA 5J3XA 1YVHA 2OR4A 3FEDA 1CX8A 4NGNA 4OC0A 3OP0A 1EO0A 3S9NA 5F09A 3PFVA 2DLAA 2XEJA 4NGSA 4P4EA 3SJXA 3VROA 3D7DA 3FEEA 1DE4C 4P45A 4BPXB 2Y1MA 4MCSA 3SJFA 3O8ZA 3D7HA 1FBVA 4MCRA 4BPUB 4NGPA 3BXMA 4NGTA 4OMEA 3PT1A 2XEGA 2C6PA 5BY0A 1B47A 2XEFA 4OC4A 2B4JC 3PLFB 4RR2B 4A4BA 4BPWB 3RBUA 2XPLA 3BHXA 2UV8G 2JBJA 3VRNA 4OC2A 2C6CA 5ELYA 5D29A 2XPPA 4NGMA 2XPNA 3U88C 3BI1A 4BTFA 3F9KC 4A4CA
chains in the Genus database with same CATH topology
2XPPA 1Z9EA 2N3AB 2B4JC 3HPGG 3NFQA 2XPNA 3HPHE 3O8ZA 2XPOA 3U88C 1EO0A 1WJTA 2XPLA 3OAKA 3F9KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPP A;  1Z9E A;  2N3A B;  2B4J C;  3HPG G;  3NFQ A;  2XPN A;  3HPH E;  3O8Z A;  2XPO A;  3U88 C;  1EO0 A;  1WJT A;  2XPL A;  3OAK A;  3F9K C; 
#chains in the Genus database with same CATH topology
 3SJE A;  4X3R A;  2XPO A;  4OC5 A;  4JYW A;  1Z9E A;  5AXI A;  4OC3 A;  5HKZ A;  3HPH E;  4P4B A;  4OC1 A;  3VGO A;  3S9L A;  4MCP A;  3D7F A;  3BI0 A;  3VRR A;  4P4D A;  2PVV A;  2JBK A;  4LQG A;  2VKZ G;  4NGQ A;  3SJG A;  3OB2 B;  4MCQ A;  2N3A B;  2CIJ A;  5HKY A;  3NFQ A;  4P44 A;  2XEI A;  3OB1 B;  3HMJ G;  2CBL A;  1WJT A;  4P4I A;  4P4J A;  3D7G A;  3KAS A;  2Y1N A;  3HPG G;  3FEC A;  4NGR A;  4W9Y A;  3OAK A;  4JZ0 A;  4GPL B;  4P4F A;  3VRP A;  2C6G A;  3BUW B;  3VRQ A;  3ZNI A;  3BUX B;  3BUO B;  3BUM B;  2PVW A;  3IWW A;  3FF3 A;  5F13 A;  2OOT A;  5HKW A;  3S9M A;  3BUN B;  1Z8L A;  5J3X A;  1YVH A;  2OR4 A;  3FED A;  1CX8 A;  4NGN A;  4OC0 A;  3OP0 A;  1EO0 A;  3S9N A;  5F09 A;  3PFV A;  2DLA A;  2XEJ A;  4NGS A;  4P4E A;  3SJX A;  3VRO A;  3D7D A;  3FEE A;  1DE4 C;  4P45 A;  4BPX B;  2Y1M A;  4MCS A;  3SJF A;  3O8Z A;  3D7H A;  1FBV A;  4MCR A;  4BPU B;  4NGP A;  3BXM A;  4NGT A;  4OME A;  3PT1 A;  2XEG A;  2C6P A;  5BY0 A;  1B47 A;  2XEF A;  4OC4 A;  2B4J C;  3PLF B;  4RR2 B;  4A4B A;  4BPW B;  3RBU A;  2XPL A;  3BHX A;  2UV8 G;  2JBJ A;  3VRN A;  4OC2 A;  2C6C A;  5ELY A;  5D29 A;  2XPP A;  4NGM A;  2XPN A;  3U88 C;  3BI1 A;  4BTF A;  3F9K C;  4A4C A; 
#chains in the Genus database with same CATH homology
 2XPP A;  1Z9E A;  2N3A B;  2B4J C;  3HPG G;  3NFQ A;  2XPN A;  3HPH E;  3O8Z A;  2XPO A;  3U88 C;  1EO0 A;  1WJT A;  2XPL A;  3OAK A;  3F9K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...