1WJTA

Solution structure of the n-terminal domain i of mouse transcription elongation factor s-ii protein 3
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
b'GSSGSSGMGLEEELLRIAKKLEKMVSRKKTEGALDLLKKLNSCQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPRTTKGERESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor S-II protein 3
publication title Solution structure of the N-terminal Domain I of mouse transcription elongation factor S-II protein 3
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 24
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1wjtA00
2B4JC 2XPOA 3U88C 2XPNA 1WJTA 2N3AB 3NFQA 3O8ZA 1EO0A 2XPPA 3OAKA 3F9KC 3HPHE 2XPLA 3HPGG 1Z9EA
chains in the Genus database with same CATH superfamily
2XEIA 3BUXB 4JYWA 3PFVA 2XEJA 2XEGA 3VRQA 4P4IA 2XPNA 3S9NA 3BHXA 4OC2A 5HKWA 4OC4A 4BPUB 1CX8A 3OAKA 3BXMA 3F9KC 3S9MA 3HMJG 3D7DA 1FBVA 5AXIA 2UV8G 4NGNA 3PT1A 4OC3A 4OC1A 2DLAA 3VRRA 4MCRA 2JBKA 3BUWB 4MCQA 3OB1B 3BUOB 3SJEA 3D7FA 4W9YA 2C6CA 1WJTA 2VKZG 3SJXA 4NGPA 4NGSA 2PVVA 3O8ZA 4P4DA 3BI1A 4GPLB 2XPLA 1Z9EA 4MCSA 2C6GA 3VRNA 3KASA 2CIJA 4P4EA 5F13A 3FECA 4MCPA 3SJFA 3SJGA 2N3AB 2Y1NA 4OMEA 1DE4C 5D29A 3VROA 5F09A 3BUMB 3IWWA 1Z8LA 3FEEA 4LQGA 2Y1MA 3NFQA 4P44A 1B47A 3D7GA 5ELYA 4JZ0A 4NGTA 3OB2B 5HKZA 2XEFA 4NGQA 4A4BA 3OP0A 4NGMA 2XPOA 4P4JA 2JBJA 3U88C 4P4BA 5J3XA 3BUNB 3FF3A 4BPXB 3VGOA 3ZNIA 3BI0A 1EO0A 4OC0A 4P4FA 3D7HA 3FEDA 3S9LA 5BY0A 3RBUA 5HKYA 3HPHE 4P45A 2B4JC 2XPPA 4A4CA 2OOTA 2CBLA 4BTFA 1YVHA 3VRPA 2C6PA 4X3RA 4RR2B 3HPGG 2OR4A 4BPWB 4OC5A 2PVWA 3PLFB 4NGRA
chains in the Genus database with same CATH topology
2B4JC 2XPOA 3U88C 2XPNA 1WJTA 2N3AB 3NFQA 3O8ZA 1EO0A 2XPPA 3OAKA 3F9KC 3HPHE 2XPLA 3HPGG 1Z9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4J C;  2XPO A;  3U88 C;  2XPN A;  1WJT A;  2N3A B;  3NFQ A;  3O8Z A;  1EO0 A;  2XPP A;  3OAK A;  3F9K C;  3HPH E;  2XPL A;  3HPG G;  1Z9E A; 
#chains in the Genus database with same CATH topology
 2XEI A;  3BUX B;  4JYW A;  3PFV A;  2XEJ A;  2XEG A;  3VRQ A;  4P4I A;  2XPN A;  3S9N A;  3BHX A;  4OC2 A;  5HKW A;  4OC4 A;  4BPU B;  1CX8 A;  3OAK A;  3BXM A;  3F9K C;  3S9M A;  3HMJ G;  3D7D A;  1FBV A;  5AXI A;  2UV8 G;  4NGN A;  3PT1 A;  4OC3 A;  4OC1 A;  2DLA A;  3VRR A;  4MCR A;  2JBK A;  3BUW B;  4MCQ A;  3OB1 B;  3BUO B;  3SJE A;  3D7F A;  4W9Y A;  2C6C A;  1WJT A;  2VKZ G;  3SJX A;  4NGP A;  4NGS A;  2PVV A;  3O8Z A;  4P4D A;  3BI1 A;  4GPL B;  2XPL A;  1Z9E A;  4MCS A;  2C6G A;  3VRN A;  3KAS A;  2CIJ A;  4P4E A;  5F13 A;  3FEC A;  4MCP A;  3SJF A;  3SJG A;  2N3A B;  2Y1N A;  4OME A;  1DE4 C;  5D29 A;  3VRO A;  5F09 A;  3BUM B;  3IWW A;  1Z8L A;  3FEE A;  4LQG A;  2Y1M A;  3NFQ A;  4P44 A;  1B47 A;  3D7G A;  5ELY A;  4JZ0 A;  4NGT A;  3OB2 B;  5HKZ A;  2XEF A;  4NGQ A;  4A4B A;  3OP0 A;  4NGM A;  2XPO A;  4P4J A;  2JBJ A;  3U88 C;  4P4B A;  5J3X A;  3BUN B;  3FF3 A;  4BPX B;  3VGO A;  3ZNI A;  3BI0 A;  1EO0 A;  4OC0 A;  4P4F A;  3D7H A;  3FED A;  3S9L A;  5BY0 A;  3RBU A;  5HKY A;  3HPH E;  4P45 A;  2B4J C;  2XPP A;  4A4C A;  2OOT A;  2CBL A;  4BTF A;  1YVH A;  3VRP A;  2C6P A;  4X3R A;  4RR2 B;  3HPG G;  2OR4 A;  4BPW B;  4OC5 A;  2PVW A;  3PLF B;  4NGR A; 
#chains in the Genus database with same CATH homology
 2B4J C;  2XPO A;  3U88 C;  2XPN A;  1WJT A;  2N3A B;  3NFQ A;  3O8Z A;  1EO0 A;  2XPP A;  3OAK A;  3F9K C;  3HPH E;  2XPL A;  3HPG G;  1Z9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...