1WJTA

Solution structure of the n-terminal domain i of mouse transcription elongation factor s-ii protein 3
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
GSSGSSGMGLEEELLRIAKKLEKMVSRKKTEGALDLLKKLNSCQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPRTTKGERESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal Domain I of mouse transcription elongation factor S-II protein 3
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Transcription elongation factor S-II protein 3
total genus 24
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1wjtA00
3OAKA 2XPLA 3F9KC 3NFQA 1EO0A 1Z9EA 3HPGG 2N3AB 3O8ZA 3HPHE 2B4JC 2XPOA 1WJTA 3U88C 2XPNA 2XPPA
chains in the Genus database with same CATH superfamily
4MCQA 3HMJG 4A4BA 3PT1A 5F09A 3HPHE 4W9YA 3SJGA 3SJEA 1YVHA 4NGRA 2Y1NA 4GPLB 3BI0A 1Z9EA 3HPGG 3VRRA 5HKYA 4JYWA 3O8ZA 4NGTA 4NGNA 2JBKA 3PLFB 2CIJA 4P45A 2PVWA 3S9LA 2CBLA 1B47A 4MCPA 3ZNIA 4X3RA 2C6CA 4P4JA 3OP0A 4RR2B 3PFVA 3OAKA 4BTFA 4BPXB 1FBVA 4NGPA 3F9KC 3KASA 3BUWB 3FEDA 2OOTA 5J3XA 3SJXA 2DLAA 3D7HA 4BPWB 4OC4A 4MCSA 4P4EA 4MCRA 4OMEA 3OB2B 2C6PA 2C6GA 3IWWA 2XPLA 5HKWA 3D7DA 4LQGA 3S9NA 2XPOA 4A4CA 3U88C 1Z8LA 2VKZG 3BUMB 1EO0A 5D29A 1WJTA 3BUOB 4P4FA 2XPPA 3BXMA 3D7FA 4P4DA 3FF3A 3NFQA 3BHXA 3VROA 2XEJA 4OC3A 2Y1MA 3D7GA 4JZ0A 2JBJA 2UV8G 3VRQA 2XEFA 4OC1A 2N3AB 3BUXB 1DE4C 2XPNA 3VRNA 5AXIA 4NGMA 2B4JC 1CX8A 4BPUB 5BY0A 4P4IA 4P44A 4P4BA 3OB1B 4NGQA 3VGOA 3VRPA 5ELYA 3S9MA 2XEGA 5HKZA 3FEEA 3FECA 4OC2A 3SJFA 5F13A 2XEIA 4NGSA 2PVVA 3RBUA 3BI1A 3BUNB 4OC5A 2OR4A 4OC0A
chains in the Genus database with same CATH topology
3OAKA 2XPLA 3F9KC 3NFQA 1EO0A 1Z9EA 3HPGG 2N3AB 3O8ZA 3HPHE 2B4JC 2XPOA 1WJTA 3U88C 2XPNA 2XPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OAK A;  2XPL A;  3F9K C;  3NFQ A;  1EO0 A;  1Z9E A;  3HPG G;  2N3A B;  3O8Z A;  3HPH E;  2B4J C;  2XPO A;  1WJT A;  3U88 C;  2XPN A;  2XPP A; 
#chains in the Genus database with same CATH topology
 4MCQ A;  3HMJ G;  4A4B A;  3PT1 A;  5F09 A;  3HPH E;  4W9Y A;  3SJG A;  3SJE A;  1YVH A;  4NGR A;  2Y1N A;  4GPL B;  3BI0 A;  1Z9E A;  3HPG G;  3VRR A;  5HKY A;  4JYW A;  3O8Z A;  4NGT A;  4NGN A;  2JBK A;  3PLF B;  2CIJ A;  4P45 A;  2PVW A;  3S9L A;  2CBL A;  1B47 A;  4MCP A;  3ZNI A;  4X3R A;  2C6C A;  4P4J A;  3OP0 A;  4RR2 B;  3PFV A;  3OAK A;  4BTF A;  4BPX B;  1FBV A;  4NGP A;  3F9K C;  3KAS A;  3BUW B;  3FED A;  2OOT A;  5J3X A;  3SJX A;  2DLA A;  3D7H A;  4BPW B;  4OC4 A;  4MCS A;  4P4E A;  4MCR A;  4OME A;  3OB2 B;  2C6P A;  2C6G A;  3IWW A;  2XPL A;  5HKW A;  3D7D A;  4LQG A;  3S9N A;  2XPO A;  4A4C A;  3U88 C;  1Z8L A;  2VKZ G;  3BUM B;  1EO0 A;  5D29 A;  1WJT A;  3BUO B;  4P4F A;  2XPP A;  3BXM A;  3D7F A;  4P4D A;  3FF3 A;  3NFQ A;  3BHX A;  3VRO A;  2XEJ A;  4OC3 A;  2Y1M A;  3D7G A;  4JZ0 A;  2JBJ A;  2UV8 G;  3VRQ A;  2XEF A;  4OC1 A;  2N3A B;  3BUX B;  1DE4 C;  2XPN A;  3VRN A;  5AXI A;  4NGM A;  2B4J C;  1CX8 A;  4BPU B;  5BY0 A;  4P4I A;  4P44 A;  4P4B A;  3OB1 B;  4NGQ A;  3VGO A;  3VRP A;  5ELY A;  3S9M A;  2XEG A;  5HKZ A;  3FEE A;  3FEC A;  4OC2 A;  3SJF A;  5F13 A;  2XEI A;  4NGS A;  2PVV A;  3RBU A;  3BI1 A;  3BUN B;  4OC5 A;  2OR4 A;  4OC0 A; 
#chains in the Genus database with same CATH homology
 3OAK A;  2XPL A;  3F9K C;  3NFQ A;  1EO0 A;  1Z9E A;  3HPG G;  2N3A B;  3O8Z A;  3HPH E;  2B4J C;  2XPO A;  1WJT A;  3U88 C;  2XPN A;  2XPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...