1WJTA

Solution structure of the n-terminal domain i of mouse transcription elongation factor s-ii protein 3
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
GSSGSSGMGLEEELLRIAKKLEKMVSRKKTEGALDLLKKLNSCQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPRTTKGERESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription elongation factor S-II protein 3
publication title Solution structure of the N-terminal Domain I of mouse transcription elongation factor S-II protein 3
rcsb
source organism Mus musculus
total genus 24
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1wjtA00
2XPLA 1WJTA 3HPGG 2N3AB 2XPOA 2XPPA 2B4JC 1Z9EA 2XPNA 3O8ZA 3U88C 3NFQA 3F9KC 3HPHE 1EO0A 3OAKA
chains in the Genus database with same CATH superfamily
1WJTA 3RBUA 2B4JC 4NGRA 3NFQA 2XEIA 2XEFA 3VRRA 4OMEA 5HKWA 2CIJA 3BI0A 4P4EA 2PVVA 3SJGA 2UV8G 2JBKA 2DLAA 3S9NA 3S9LA 1FBVA 4BTFA 4NGMA 4BPXB 3HMJG 3FECA 2XPLA 2JBJA 2XEJA 4A4CA 5BY0A 4X3RA 5D29A 4OC4A 1DE4C 2N3AB 3PLFB 3SJEA 4BPUB 2OR4A 4OC0A 4NGSA 3BUNB 2VKZG 2XEGA 3OB1B 3SJXA 2C6PA 4NGNA 4P4IA 2CBLA 5AXIA 1CX8A 3OAKA 1Z9EA 3O8ZA 5J3XA 4OC1A 4W9YA 4A4BA 3BUWB 3BUXB 2XPOA 2XPPA 1Z8LA 1B47A 3OP0A 3VROA 3VRQA 3FEDA 4P4BA 4NGPA 3U88C 3SJFA 4P4FA 4NGQA 3S9MA 3ZNIA 4OC5A 5HKZA 3VRNA 3KASA 4MCSA 2XPNA 4LQGA 5F09A 3VRPA 5ELYA 3BHXA 3BXMA 5F13A 3BUOB 3BI1A 4GPLB 4MCPA 4P4DA 4JZ0A 2OOTA 3D7HA 4RR2B 1YVHA 3D7DA 4OC2A 2Y1MA 4BPWB 4JYWA 2C6CA 3PFVA 3FF3A 3VGOA 3F9KC 3HPHE 1EO0A 3FEEA 3HPGG 3OB2B 3PT1A 4MCQA 4P44A 2Y1NA 4MCRA 4NGTA 4P4JA 3D7GA 3IWWA 2PVWA 5HKYA 4OC3A 4P45A 2C6GA 3BUMB 3D7FA
chains in the Genus database with same CATH topology
2XPLA 1WJTA 3HPGG 2N3AB 2XPOA 2XPPA 2B4JC 1Z9EA 2XPNA 3O8ZA 3U88C 3NFQA 3F9KC 3HPHE 1EO0A 3OAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPL A;  1WJT A;  3HPG G;  2N3A B;  2XPO A;  2XPP A;  2B4J C;  1Z9E A;  2XPN A;  3O8Z A;  3U88 C;  3NFQ A;  3F9K C;  3HPH E;  1EO0 A;  3OAK A; 
#chains in the Genus database with same CATH topology
 1WJT A;  3RBU A;  2B4J C;  4NGR A;  3NFQ A;  2XEI A;  2XEF A;  3VRR A;  4OME A;  5HKW A;  2CIJ A;  3BI0 A;  4P4E A;  2PVV A;  3SJG A;  2UV8 G;  2JBK A;  2DLA A;  3S9N A;  3S9L A;  1FBV A;  4BTF A;  4NGM A;  4BPX B;  3HMJ G;  3FEC A;  2XPL A;  2JBJ A;  2XEJ A;  4A4C A;  5BY0 A;  4X3R A;  5D29 A;  4OC4 A;  1DE4 C;  2N3A B;  3PLF B;  3SJE A;  4BPU B;  2OR4 A;  4OC0 A;  4NGS A;  3BUN B;  2VKZ G;  2XEG A;  3OB1 B;  3SJX A;  2C6P A;  4NGN A;  4P4I A;  2CBL A;  5AXI A;  1CX8 A;  3OAK A;  1Z9E A;  3O8Z A;  5J3X A;  4OC1 A;  4W9Y A;  4A4B A;  3BUW B;  3BUX B;  2XPO A;  2XPP A;  1Z8L A;  1B47 A;  3OP0 A;  3VRO A;  3VRQ A;  3FED A;  4P4B A;  4NGP A;  3U88 C;  3SJF A;  4P4F A;  4NGQ A;  3S9M A;  3ZNI A;  4OC5 A;  5HKZ A;  3VRN A;  3KAS A;  4MCS A;  2XPN A;  4LQG A;  5F09 A;  3VRP A;  5ELY A;  3BHX A;  3BXM A;  5F13 A;  3BUO B;  3BI1 A;  4GPL B;  4MCP A;  4P4D A;  4JZ0 A;  2OOT A;  3D7H A;  4RR2 B;  1YVH A;  3D7D A;  4OC2 A;  2Y1M A;  4BPW B;  4JYW A;  2C6C A;  3PFV A;  3FF3 A;  3VGO A;  3F9K C;  3HPH E;  1EO0 A;  3FEE A;  3HPG G;  3OB2 B;  3PT1 A;  4MCQ A;  4P44 A;  2Y1N A;  4MCR A;  4NGT A;  4P4J A;  3D7G A;  3IWW A;  2PVW A;  5HKY A;  4OC3 A;  4P45 A;  2C6G A;  3BUM B;  3D7F A; 
#chains in the Genus database with same CATH homology
 2XPL A;  1WJT A;  3HPG G;  2N3A B;  2XPO A;  2XPP A;  2B4J C;  1Z9E A;  2XPN A;  3O8Z A;  3U88 C;  3NFQ A;  3F9K C;  3HPH E;  1EO0 A;  3OAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...