2JBKA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with quisqualic acid (quisqualate, alpha-amino-3,5-dioxo-1,2,4- oxadiazolidine-2-propanoic acid)
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
694
structure length
687
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title Human Glutamate Carboxypeptidase II Inhibition: Structures of Gcpii in Complex with Two Potent Inhibitors, Quisqualate and 2-Pmpa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 238
structure length 687
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2jbkA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2jbkA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2jbkA02
2O53A 4OIWA 4P4DA 1HEEA 1YMEA 3LMSA 4ZX8A 2ZEDA 4UIBA 1YW6A 4P45A 1CP6A 1XFOA 3VH9A 1ZG9A 5K8OA 1R3NA 3H8GA 4TNUA 4X2TA 4C86A 2HB6A 1DTDA 3WC7A 3TX8A 3BI0A 4NFRA 4ZY1A 4UIAA 5D8NA 3RAMA 4JYWA 3I1UA 3RZAA 2CF4A 1ZLIA 3PB4X 3PB9X 2AFWA 2V8DA 4C9VA 4G1PA 4OMEA 2Q43A 4ZYQA 5JH9A 4Q7AA 3B3CA 2ANPA 2EK9A 3IEHA 3SJEA 3S9LA 3PBEA 3GLJA 4JZ0A 4W9YA 1BLLE 4FWUA 3JRUA 4OKOA 1HDQA 4Z65A 2ZEMA 4ZX9A 2ZEOA 5JGFA 2C6CA 3PEIA 5HVGA 3IJ3A 2XEGA 4YWYA 2BOAA 3B7IA 3MN8A 1TF8A 4DUKA 2XEJA 1TKJA 3FH4A 5K8MA 4PQAA 1VHOA 1XMBA 1JQGA 2PCUA 2IMOA 3V7ZA 4MMOA 2EWBA 4ZI6A 3D66A 2QJ8A 3K2KA 2PJ6A 4P10A 2BO9A 1PCAA 3FEDA 1LOKA 3KR5A 2DEAA 3EIFA 4CPAA 5CBMA 2V8GA 3CPAA 3D68A 5LRGA 4OC3A 2JBKA 1QMUA 2ZEHA 3WC6A 2PJ2A 1V6CA 3WT4A 1AMPA 2I3CA 4C8TA 3S9NA 5LYLA 3I6SA 4TJXA 2ZEPA 3KI9A 3TC8A 3B3SA 3KZWA 4MHYA 4OIDA 2CIJA 4AXVA 3FEEA 5D29A 4MCPA 1BPMA 2HC9A 2PJAA 3V38A 1NSAA 4F9VA 1KWMA 3D7HA 1GYTA 3NFZA 7CPAA 4PXEA 3DLJA 5F09A 2PJ7A 2JEWA 2AFOA 2AFZA 3PB6X 3SI0A 1ZG7A 1AYEA 2V8VA 3D7FA 1Y0RA 4NJRA 2QVPA 1ZG8A 4X8IA 1LANA 2PJ5A 3NA6A 2ZEGA 2PJ9A 3ISXA 4K3NA 4O23A 1TF9A 1Z5RA 5J1QA 3D7DA 1XBUA 1TKFA 4MXUA 4OP4A 2J9AA 4P4IA 1VHEA 2QYVA 2C1CA 1HDUA 3PFOA 4MHPA 3H8EA 3SI2A 3FX6A 3HUVA 4MCSA 3ISZA 4UEEA 2EK8A 1YSJA 1CX8A 4PXCA 3VARA 4C8PA 2AFUA 3NH5A 3NH8A 4C99A 1ZLHA 2PVWA 4MHZA 1F2OA 1FT7A 4OC4A 4IAVA 4KSIA 2ZENA 1XRYA 4R76A 5ELYA 4C9AA 2WYRA 3FECA 3DGVA 4R6TA 2F8HA 2CTBA 3D7GA 1Y9ZA 1LAMA 3WABA 3KL9A 3CPXA 1Z8LA 5IB9A 3BI1A 1UWYA 4C85A 1CBXA 4PPZA 4DJLA 1ARMA 1IY7A 3FMCA 4P44A 3PFEA 4NGQA 3SJFA 3GB0A 4FBEA 4YN3A 4P4JA 3T8WA 5HVHA 3CT9A 1BAVA 4X3RA 1TKHA 3FVLA 4R8FA 1ARLA 4YU9A 3KHXA 4A38A 1VGYA 3B3VA 4NGSA 2PJ3A 3IO1A 4PXBA 3BHXA 3KQZA 1ELMP 2BCOA 3H8FA 2GREA 1IGBA 2V77A 1WVMA 1Z2LA 3B35A 1XJOA 4H2KA 4CDKA 2FVGA 1M4LA 4P6YA 4C8UA 2O4HA 2C6GA 4C9UA 2CTCA 2NYQA 4KNGE 1VIXA 3KGQA 4DYOA 3LWUA 2GU2A 2ZELA 3KR4A 5LYIA 4EWTA 2PJBA 2POKA 2PE3A 2PJ8A 5DS0A 4OC1A 1XF1A 3N5FA 2PVVA 4EMEA 1H8LA 3PB8X 1LAPA 2XEIA 2Q51A 4WJBA 3D4UA 2OOTA 2ZEEA 4CDJA 4UEFA 2PJ4A 3VTAA 5LRKA 3SI1A 4NGRA 1OBRA 4MHNA 2AFXA 2ZOGA 2NSMA 4ZY0A 3I74A 2ZEFA 3IFEA 3BXMA 3B2YA 2VL1A 4ONWA 1Y7EA 4C8AA 1EE3P 6CPAA 2RB7A 4MCQA 1CP7A 4FUUA 3VATA 4TJVA 2PJ0A 4LQGA 2G9DA 8CPAA 4NGTA 1CG2A 3D67A 1Q7LA 2PJCA 2GLFA 4C9EA 5HXDA 4NGPA 1QQ9A 4C8FA 1R43A 4R7MA 3SJGA 3IC1A 4OC0A 3NH4A 3KASA 1ELLP 1TXRA 1RTQA 3K9TA 2PIYA 2RFHA 4NJQA 4OC2A 2PJ1A 4BD9A 2ABZA 2WZNA 1DE4C 5JM6A 3PRTA 2IQ6A 5THWA 3S9MA 1Y0YA 1YLOA 4F8ZA 3CDXA 3L2NA 4EFDA 4C84A 1LCPA 4C8CA 3FJUA 3QNVA 1BPNA 2AFSA 4IK2A 4OC5A 2AFMA 4PXDA 2ZOFA 4A94A 4MRIA 3B3TA 1F57A 2OR4A 3GUXA 4P4BA 4P4FA 2JBJA 3HLPA 4RUHA 3RBUA 4A39A 4NGMA 5K8PA 4UEZA 3IWWA 2IJZA 3PB7X 1F2PA 4IHMA 1PYTB 4FAIA 2PIZA 4GM5A 2GLJA 5CPAA 5LYDA 4NGNA 3IIBA 2F7VA 4WWVA 4A37A 4MCRA 3KQXA 5LRJA 3PBBA 3ICUA 2C6PA 3B3WA 4TWEA 4P4EA 1YW4A 2PRQA 3WC5A 1CPSA 2Q4ZA 5K8NA 5HVFA 4B6ZA 2V8HA 4ZY2A 3KHZA 1FNOA 5I4MA 5LYFA 4F9UA 4C9RA 3FF3A 2XEFA 4UF4A 1LFWA 3MRUA 3SJXA 1CPXA
chains in the Genus database with same CATH superfamily
3T5MA 3TLGB 2FS5A 2O53A 4OIWA 4P4DA 1HEEA 2HUZA 1YMEA 1Z8XA 2PRBA 3C26A 3EZBA 2VBQA 2VZYA 4AVCA 4BPXB 3LMSA 2JEVA 4ZX8A 2BEIA 2ZEDA 3NFQA 2JDCA 4IIXA 4UIBA 1YW6A 4P45A 1GGOA 3FNCA 1CP6A 1UFHA 2B4JC 1XFOA 3VH9A 2X0SA 2BL1A 1ZG9A 5K8OA 1R3NA 3H8GA 5AG5A 3H5ZA 3ZNIA 3EXNA 1Q2DA 4UCPA 4TNUA 1NSLA 3TOAA 4X2TA 4COGA 1MJ9A 4C86A 3TYXA 3SHPA 1JDEA 2HB6A 1DTDA 3WC7A 3JTKA 3BI0A 4NFRA 3TX8A 4ZY1A 4UIAA 3TE4A 5D8NA 3U1BA 4JJXA 3RAMA 3TLAA 5F48A 4A95A 4JYWA 3VRNA 4J3GA 4M85A 4OLLA 1M4IA 2ARHA 5F46A 5J8CA 4C8UA 3I1UA 4MJXA 3RZAA 2FE7A 2CF4A 1ZLIA 3PB4X 3PB9X 4KLVA 4MI1A 2B58A 2AFWA 2V8DA 3IWGA 4KSAA 3T9YA 4B5PA 4C9VA 3DDDA 5HKWA 4G1PA 4OMEA 4UWJA 4CO9A 2Q43A 4ZGYB 4ZYQA 5JH9A 1Q2YA 4Q38A 2UV8G 4C7IA 4Q7AA 2FSRA 3B3CA 4RR2B 2ANPA 2Q4VA 2EK9A 3IEHA 3SJEA 3S9LA 2WSAA 1YGHA 2FL4A 2P6GA 3PBEA 1KBLA 2CBLA 2XPLA 3GLJA 4JZ0A 4W9YA 1BLLE 1XF8A 4FWUA 1QSRA 3JRUA 4OKOA 1HDQA 2CXAA 2REEA 2BSWA 2ZEMA 4KZTA 5G21A 1YX0A 4ZX9A 2ZEOA 4B12A 4Z65A 1Q5XA 5JGFA 5K99A 2C6CA 1A9XB 3W6SA 1X12A 4OAEA 3PEIA 2YNEA 5JQ4A 5HVGA 3IJ3A 4MFJA 1IOFA 2OZHA 1V0CA 4MFKA 3VRPA 2XEGA 4QUSA 4R3LA 1NE9A 4XPKA 4JXRA 2P6FA 3G3SA 4YWYA 2BOAA 2Z3PA 3B7IA 3MN8A 1TF8A 2NMTA 3NE8A 2Q7BA 3R96A 5HKZA 2QMLA 4DUKA 3O8ZA 3CZXA 3I3GA 2XEJA 1TKJA 2YNCC 3F8KA 3FH4A 5K8MA 1VBGA 4PQAA 4A4CA 1VHOA 1M1DA 1XMBA 2Z3LA 3FB3A 1JQGA 3R9FA 2PCUA 2AUNA 3FBUA 2IMOA 5AXIA 4KOVA 4AVBA 2B5GB 3V7ZA 4MMOA 2EWBA 1NXJA 4CDKA 3H4QA 4FD7A 3TCVA 3N7ZA 5FVJA 4ZI6A 4CAWA 3D66A 2QJ8A 3K2KA 4RI1A 2PJ6A 4P10A 4IF5A 2BO9A 1B6BA 4KOXA 1IB1E 1PCAA 1R61A 3FEDA 1LOKA 4PK2A 3KR5A 3JVNA 4QBJA 2VI7A 2DEAA 2YNCA 3EIFA 4CPAA 4Y49B 2J8RA 3FXTA 2XPPA 4KS9A 4CRZB 2GIVA 5CBMA 2V8GA 3CPAA 5C88A 3D68A 3GYAA 5LRGA 5FD8A 4OC3A 1I12A 5KTDA 3S6KA 3PT1A 2JBKA 1QMUA 2ZEHA 2DPSA 3WC6A 4AB7A 2PJ2A 1V6CA 1KUVA 1S5KA 3WT4A 1AMPA 4MFQA 5AGEA 2I3CA 1K4JA 1VKCA 3U88C 4C8TA 5I0CA 2R1IA 3S9NA 4XPLA 4COBA 5LYLA 2R82A 2AJ6A 1IYLA 2Z0ZA 3I6SA 5E96A 4FD4A 4A30A 4F6AA 4TJXA 1Z8WA 1Z4RA 1IICA 2ZEPA 3B3SA 3EC4A 3KI9A 3KZWA 4MHYA 3TC8A 4HNYB 1KZFA 3T0TA 4OIDA 2CIJA 3BUMB 1U6MA 4KOYA 4AXVA 2PC1A 3FEEA 2K5TA 5D29A 2DF5A 4MCPA 4HKFA 1BPMA 2HC9A 2PJAA 5EMIA 3OB2B 2H5MA 3V38A 5F5XA 3W91A 2PDOA 2R7HA 1NSAA 1SQHA 3NE7A 4F9VA 1KWMA 3D7HA 1GYTA 2P6EA 3NFZA 2GFQA 4UFWA 7CPAA 5F49A 4PXEA 4CAFA 1VI4A 4C8FA 2QIRA 3DLJA 1BO4A 5BY0A 5F09A 4NXYA 2PJ7A 2JEWA 1QSNA 2AFOA 2AFZA 4ZBGA 3S6GA 2ZW7A 2Q0YA 1XEBA 4II9A 3PB6X 4H89A 3SI0A 1ZG7A 5F1YA 3BUNB 1M6VB 1AYEA 4H6ZA 2E28A 2B4DB 1DIKA 2CNSA 4UA3A 2V8VA 3D7FA 4HNWB 1Y0RA 2FCKA 4NF1A 2QVPA 1ZG8A 4MFZA 4NJRA 5A28A 4X8IA 1C30B 1LANA 3G23A 4H6UA 2PJ5A 3NA6A 2ZEGA 1T36B 1LRZA 2PJ9A 1CJWA 3IWEA 3ISXA 1L0CA 4K3NA 5G20A 4O23A 3PFVA 1TF9A 2Q04A 1Z5RA 2YNDA 3WR7A 5J1QA 1ZYMA 3TLZA 3D7DA 1XBUA 3KRVA 3E0KA 4CAXA 3TLGA 1EO0A 5HMNA 4J0NA 1JWQA 1TKFA 4MXUA 4OP4A 3TO7A 2PSWA 2J9AA 5AG6A 2Z11A 1J3LA 4P4IA 2D4OA 2IL4A 1VHEA 2QYVA 2ZW6A 2C1CA 4KVME 1HDUA 4L8AA 4IIYA 3TLYA 3HPHE 2P0WA 1YVHA 1YREA 1Z8TA 3PFOA 4MHPA 3BUWB 3H8EA 1AUGA 3SI2A 3FX6A 3HUVA 4MCSA 4KOUA 5IX3A 3ISZA 4JLYA 1KUYA 2KCWA 2A4NA 4UEEA 2EK8A 4RN7A 1YSJA 1CX8A 4GS4A 4H1HA 1J4JA 4PXCA 3VARA 4C8PA 2AFUA 1FBVA 3NH5A 3NH8A 4JXQA 3RYOA 4C99A 2HROA 4U9ZA 1B87A 3I9SA 4A32A 2MP0A 1ZLHA 3HPGG 5F9MA 2PVWA 2ZW4A 3P2HA 4KOSA 2DLAA 4MHZA 2FM4A 1F2OA 3T90A 3W6XA 1FT7A 4OC4A 1P4NA 2GE3A 2RC4A 3QB8A 4IAVA 4KSIA 5JVLA 2REFA 2ZENA 2HQYA 3V8IA 4MFLA 1XRYA 2ZPAA 4R9MA 4R76A 5ELYA 2Z10A 4MFPA 5ISVA 4C9AA 4F0YA 5F13A 3FRMA 2WYRA 3FECA 3DGVA 4R6TA 2FXFA 2F8HA 2CTBA 3D7GA 2HV2A 1Y9ZA 1LAMA 3PGPA 4KUAA 4PSXA 3WABA 3GJZA 1ZL0A 3KL9A 3VRQA 1MJAA 2WUUA 4UCNA 2C5QA 1GHEA 2Y1MA 3CPXA 1Z8LA 3FYNA 5IB9A 3BI1A 1UWYA 4C85A 1CBXA 1QSOA 2CY2A 4PPZA 2Z3OA 4DJLA 2GP4A 4CGLA 1ARMA 4B10A 1IY7A 1S7KA 3FMCA 3DR6A 4BPUB 3PLFB 4P44A 3PFEA 3D2MA 4NGQA 3SJFA 2GANA 3EFAA 3GB0A 4FBEA 4YN3A 4P4JA 1S7FA 4XPDB 2Z3MA 1TIQA 2Q7SA 5AG7A 3T8WA 4U9YA 2XPOA 4AG7A 3CT9A 5HVHA 1BAVA 4X3RA 1TKHA 3FVLA 4BTFA 2FIWA 2ZW5A 4R8FA 4B11A 1ARLA 4YU9A 3MGDA 3KHXA 1I21A 4A38A 4CGPA 3T07A 1R57A 4Y49C 1VGYA 5HKYA 1ZRSA 3IU1A 4INJA 4FD6A 3B3VA 4NGSA 2PCNA 1N71A 3TO9A 3EZEA 4CYQA 2PJ3A 2PQ8A 3IO1A 4LX9A 3D8PA 1B47A 1Y9KA 4PXBA 2B5GA 3BHXA 4IUSA 1XIXA 4A4BA 1I1DA 1YR0A 2VXKA 3R9EA 2VQYA 3KQZA 3CXQA 1BOBA 3EZAA 4I49A 3P2FA 2AUMA 2HWGA 1ELMP 2BCOA 3H8FA 4M6IA 2GREA 4QC6A 2Y1NA 3TO6A 2EO8A 3SXOA 1IGBA 1XMTA 1OZPA 1IIDA 2ODFA 2V77A 3QAHA 1WVMA 4CZ1A 1Z2LA 4LQ6A 2EBJA 3B35A 3LACA 2Z3KA 2D4PA 3D2PA 1XJOA 4H2KA 4KOWA 5J3XA 1M4LA 2FVGA 4MY3A 2O4HA 4P6YA 4QB9A 4YGOA 4CRYB 5IR2A 4UWIA 2YJVA 3TLCA 3HMJG 4PV6A 2C6GA 1JDBC 4C9UA 2CTCA 2NYQA 3EO4A 1VIXA 1XOVA 4KNGE 5AG4A 3BJ8A 3KGQA 4NSQA 2C27A 4B5OA 4MHDA 4B13A 2VKZG 2GU2A 2Z3NA 3LWUA 4A2ZA 4DYOA 2ZELA 2G3TA 3QAYA 5C82A 3KR4A 4QVTA 5LYIA 4CYNA 4EWTA 3UY5A 3SR3A 2Q4YA 4LUAA 4EVYA 2OZUA 3BLNA 4KSFA 4X5KA 3VGOA 1RO5A 3TOBA 3TLBA 2PJBA 2POKA 1Y9WA 2PE3A 3RO0A 2PJ8A 4R3KA 1EZBA 2JDDA 5DS0A 4OC1A 1M44A 1XF1A 4XNHB 3CXSA 3DSBA 1C3OB 1KC7A 3N5FA 2PVVA 4CYOA 1H8LA 4EMEA 3PB8X 2HI6A 1LAPA 2XEIA 2Q51A 4WJBA 3D4UA 2D0OA 2OOTA 2ZEEA 4UFXA 5H84A 4JVOA 2J8MA 4UEFA 3ZZIA 4E0AA 2PJ4A 4CDJA 3VTAA 5LRKA 3SI1A 4NGRA 3GIUA 1OBRA 1PUAA 3S6HA 3S6FA 4RS2A 4KUBA 4MHNA 2Q44A 2AFXA 3GKRA 1S3ZA 2ZOGA 3SXNA 2NSMA 4ZY0A 4MY0A 4C7HA 1X10A 3I74A 3DNSA 4UFVA 2ZEFA 1IYKA 3G8WA 3IFEA 4AG9A 4KORA 3VROA 3NOJA 4BBHA 4MI4A 3BXMA 3B2YA 2VL1A 5DWNA 3TFYA 3F5BA 5CNPA 2DPTA 4ONWA 1RXTA 1PU9A 1Y7EA 2B3VA 4B5PB 1VBHA 4C8AA 1EE3P 2ATRA 6CPAA 2J8NA 2RB7A 5G22A 3R9GA 5JPHA 4MCQA 1CP7A 2EUIA 2B4DA 3K9UA 4K30A 4PK3A 4FUUA 4KVOE 3VATA 4TJVA 2PJ0A 2N3AB 4LQGA 2G9DA 8CPAA 1M4GA 4NEXA 3JUWA 4NGTA 3DR8A 1VHSA 1CG2A 3D67A 1Q7LA 2PJCA 3TT2A 2GLFA 1MK4A 2CNMA 5IB0A 4C9EA 2XPNA 5HXDA 1ON0A 2B4BA 4R87A 4NGPA 3VWEA 4E2AA 1WWZA 1QQ9A 2CNTA 4KLWA 2FIAA 3ZJ0A 4B14A 3OAKA 4CAEA 1R43A 4CS0B 3PP9A 4R7MA 2OLSA 3SJGA 1IOIA 3C8OA 4U5YA 3IC1A 3VRRA 3IGRA 3RNZA 4OC0A 3NH4A 3PZJA 3KASA 1ELLP 1TXRA 4A33A 1RTQA 4BPWB 3K9TA 3OP0A 2G0BA 2PIYA 2RFHA 2YGWA 4M6GA 4NJQA 4F0XA 4OC2A 4FD5A 4E94A 2PJ1A 1CM0A 4MBUA 2ABZA 2WZNA 4BD9A 1DE4C 2G3AA 5JM6A 3IU2A 4GXHA 3PRTA 2IQ6A 5THWA 3S9MA 2AE6A 3A9LA 1Y0YA 3KKWA 2DXQA 3BUOB 3K4IA 5EBVA 1A2ZA 1YLOA 2BUEA 2FT0A 2PR1A 3CDXA 4F8ZA 3VWDA 3T05A 3L2NA 1BXRB 4EFDA 4C84A 1YVOA 1QSMA 4PSWA 4MJ8A 1LCPA 3OWCA 1S7NA 5KTCA 4C8CA 1MJBA 2Y0MA 4ORFA 3R1KA 4Q36A 4CYPA 1KUXA 4BINA 3FJUA 4JD6A 1YLEA 2EZAA 4CGOA 2I79A 2OU2A 3QNVA 4UCMA 2VZZA 3R95A 4A31A 1FY7A 5F47A 3TLEA 4CAVA 1BPNA 2AFSA 3BJ7A 4IK2A 4OC5A 2AFMA 4PXDA 2ZOFA 4E5SA 4A94A 4R57A 3LD2A 4MRIA 3B3TA 3FIXA 2F5IA 1F57A 2OR4A 4XPDC 3GUXA 4C68A 1NMTA 2DIKA 1QSTA 4P4BA 4P4FA 2JBJA 2ZXVA 3HLPA 4DNCA 4KOTA 4RUHA 5JYBA 4C2YA 1S7LA 1CE8B 3RBUA 2EZCA 3D3SA 4A39A 2R98A 2R8VA 4NGMA 5K8PA 1NBWA 1M4DA 1Y7RA 2QECA 4C2ZA 1YK3A 4UEZA 1Z9UA 3IWWA 2IJZA 3PB7X 1F2PA 4IHMA 2PR8A 2X7BA 5H86A 5KTAA 4M8DA 2JLMA 4HNXB 1PYTB 4FAIA 2PIZA 1P0HA 2VEZA 1Z4EA 4GM5A 2EVNA 4JWPA 4AVAA 1S60A 2YJTA 2GLJA 3OB1B 2I00A 3CXPA 1CS0B 1WK4A 5HH1A 4ONUA 5CPAA 4NGNA 3IIBA 5LYDA 4HPSA 2F7VA 5EC4A 4WWVA 4BMHA 4A37A 3BUXB 4MCRA 3KQXA 1EZAA 4M6HA 5LRJA 2OZGA 4OADA 3PBBA 3LODA 4KVXA 5A27A 3ICUA 2C6PA 5J8FA 3B3WA 4TWEA 4P4EA 1YW4A 2PRQA 2EZBA 4L89A 3WC5A 1CPSA 2Q4ZA 3GY9A 5K8NA 5BWAB 1XE4A 4M3SA 5HVFA 5DWMA 4B6ZA 2V8HA 1IU8A 3EY5A 4ZY2A 1KEEB 1Q2CA 4UBRA 3F9KC 2B0AA 2OB0A 1ZO0A 5G1ZA 3KHZA 1FNOA 2OH1A 4GPLB 5GCNA 1Z9EA 4YRHA 5I4MA 5LYFA 4F9UA 4EYSA 4C2XA 2D0PA 3B8GA 4C9RA 3FF3A 1YVKA 3TTHA 4CGNA 3F0AA 4NCZA 4CGMA 5IV0A 2XEFA 2WPWA 4UF4A 2B3UA 4YFJA 1LFWA 4XNHC 3MRUA 3SJXA 2O28A 1WJTA 2WPXA 1CPXA 1YQEA 4E8OA
chains in the Genus database with same CATH topology
2O53A 4OIWA 4P4DA 1HEEA 1YMEA 3LMSA 4ZX8A 2ZEDA 4UIBA 1YW6A 4P45A 1CP6A 1XFOA 3VH9A 1ZG9A 5K8OA 1R3NA 3H8GA 4TNUA 4X2TA 4C86A 2HB6A 1DTDA 3WC7A 3TX8A 3BI0A 4NFRA 4ZY1A 4UIAA 5D8NA 3RAMA 4JYWA 3I1UA 3RZAA 2CF4A 1ZLIA 3PB4X 3PB9X 2AFWA 2V8DA 4C9VA 4G1PA 4OMEA 2Q43A 4ZYQA 5JH9A 4Q7AA 3B3CA 2ANPA 2EK9A 3IEHA 3SJEA 3S9LA 3PBEA 3GLJA 4JZ0A 4W9YA 1BLLE 4FWUA 3JRUA 4OKOA 1HDQA 4Z65A 2ZEMA 4ZX9A 2ZEOA 5JGFA 2C6CA 3PEIA 5HVGA 3IJ3A 2XEGA 4YWYA 2BOAA 3B7IA 3MN8A 1TF8A 4DUKA 2XEJA 1TKJA 3FH4A 5K8MA 4PQAA 1VHOA 1XMBA 1JQGA 2PCUA 2IMOA 3V7ZA 4MMOA 2EWBA 4ZI6A 3D66A 2QJ8A 3K2KA 2PJ6A 4P10A 2BO9A 1PCAA 3FEDA 1LOKA 3KR5A 2DEAA 3EIFA 4CPAA 5CBMA 2V8GA 3CPAA 3D68A 5LRGA 4OC3A 2JBKA 1QMUA 2ZEHA 3WC6A 2PJ2A 1V6CA 3WT4A 1AMPA 2I3CA 4C8TA 3S9NA 5LYLA 3I6SA 4TJXA 2ZEPA 3KI9A 3TC8A 3B3SA 3KZWA 4MHYA 4OIDA 2CIJA 4AXVA 3FEEA 5D29A 4MCPA 1BPMA 2HC9A 2PJAA 3V38A 1NSAA 4F9VA 1KWMA 3D7HA 1GYTA 3NFZA 7CPAA 4PXEA 3DLJA 5F09A 2PJ7A 2JEWA 2AFOA 2AFZA 3PB6X 3SI0A 1ZG7A 1AYEA 2V8VA 3D7FA 1Y0RA 4NJRA 2QVPA 1ZG8A 4X8IA 1LANA 2PJ5A 3NA6A 2ZEGA 2PJ9A 3ISXA 4K3NA 4O23A 1TF9A 1Z5RA 5J1QA 3D7DA 1XBUA 1TKFA 4MXUA 4OP4A 2J9AA 4P4IA 1VHEA 2QYVA 2C1CA 1HDUA 3PFOA 4MHPA 3H8EA 3SI2A 3FX6A 3HUVA 4MCSA 3ISZA 4UEEA 2EK8A 1YSJA 1CX8A 4PXCA 3VARA 4C8PA 2AFUA 3NH5A 3NH8A 4C99A 1ZLHA 2PVWA 4MHZA 1F2OA 1FT7A 4OC4A 4IAVA 4KSIA 2ZENA 1XRYA 4R76A 5ELYA 4C9AA 2WYRA 3FECA 3DGVA 4R6TA 2F8HA 2CTBA 3D7GA 1Y9ZA 1LAMA 3WABA 2C5QA 3KL9A 3CPXA 1Z8LA 5IB9A 3BI1A 1UWYA 4C85A 1CBXA 4PPZA 2GP4A 4DJLA 1ARMA 1IY7A 3FMCA 4P44A 3PFEA 4NGQA 3SJFA 3GB0A 4FBEA 4YN3A 4P4JA 3T8WA 5HVHA 3CT9A 1BAVA 4X3RA 1TKHA 3FVLA 4R8FA 1ARLA 4YU9A 3KHXA 4A38A 1VGYA 3B3VA 4NGSA 2PJ3A 3IO1A 4PXBA 3BHXA 3KQZA 1ELMP 2BCOA 3H8FA 2GREA 1IGBA 2V77A 1WVMA 1Z2LA 3B35A 1XJOA 4H2KA 4CDKA 2FVGA 1M4LA 4P6YA 4C8UA 2O4HA 5IR2A 2C6GA 4C9UA 2CTCA 2NYQA 4KNGE 1VIXA 3KGQA 4DYOA 3LWUA 2GU2A 2ZELA 3KR4A 5LYIA 4EWTA 2PJBA 2POKA 2PE3A 2PJ8A 5DS0A 4OC1A 1XF1A 3N5FA 2PVVA 4EMEA 1H8LA 3PB8X 1LAPA 2XEIA 2Q51A 4WJBA 3D4UA 2OOTA 2ZEEA 4CDJA 4UEFA 2PJ4A 3VTAA 5LRKA 3SI1A 4NGRA 1OBRA 4MHNA 2AFXA 2ZOGA 2NSMA 4ZY0A 3I74A 2ZEFA 3IFEA 3BXMA 3B2YA 2VL1A 4ONWA 1Y7EA 4C8AA 1EE3P 6CPAA 2RB7A 4MCQA 1CP7A 4FUUA 3VATA 4TJVA 2PJ0A 4LQGA 2G9DA 8CPAA 4NGTA 1CG2A 3D67A 1Q7LA 2PJCA 2GLFA 4C9EA 5HXDA 4NGPA 1QQ9A 4C8FA 1R43A 4R7MA 3SJGA 3IC1A 4OC0A 3NH4A 3KASA 1ELLP 1TXRA 1RTQA 3K9TA 2PIYA 2RFHA 4NJQA 4OC2A 2PJ1A 4BD9A 2ABZA 2WZNA 1DE4C 5JM6A 3PRTA 2IQ6A 5THWA 3S9MA 1Y0YA 1YLOA 4F8ZA 3CDXA 3L2NA 4EFDA 4C84A 1LCPA 4C8CA 3FJUA 3QNVA 1BPNA 2AFSA 4IK2A 4OC5A 2AFMA 4PXDA 2ZOFA 4A94A 4MRIA 3B3TA 1F57A 2OR4A 3GUXA 4P4BA 4P4FA 2JBJA 3HLPA 4RUHA 3RBUA 4A39A 4NGMA 5K8PA 4UEZA 3IWWA 2IJZA 3PB7X 1F2PA 4IHMA 1PYTB 4FAIA 2PIZA 4GM5A 2GLJA 5CPAA 5LYDA 4NGNA 3IIBA 2F7VA 4WWVA 4A37A 4MCRA 3KQXA 5LRJA 3PBBA 3ICUA 2C6PA 3B3WA 4TWEA 4P4EA 1YW4A 2PRQA 3WC5A 1CPSA 2Q4ZA 5K8NA 5HVFA 4B6ZA 2V8HA 4ZY2A 3KHZA 1FNOA 5I4MA 5LYFA 4F9UA 4C9RA 3FF3A 2XEFA 4UF4A 1LFWA 3MRUA 3SJXA 1CPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O53 A;  4OIW A;  4P4D A;  1HEE A;  1YME A;  3LMS A;  4ZX8 A;  2ZED A;  4UIB A;  1YW6 A;  4P45 A;  1CP6 A;  1XFO A;  3VH9 A;  1ZG9 A;  5K8O A;  1R3N A;  3H8G A;  4TNU A;  4X2T A;  4C86 A;  2HB6 A;  1DTD A;  3WC7 A;  3TX8 A;  3BI0 A;  4NFR A;  4ZY1 A;  4UIA A;  5D8N A;  3RAM A;  4JYW A;  3I1U A;  3RZA A;  2CF4 A;  1ZLI A;  3PB4 X;  3PB9 X;  2AFW A;  2V8D A;  4C9V A;  4G1P A;  4OME A;  2Q43 A;  4ZYQ A;  5JH9 A;  4Q7A A;  3B3C A;  2ANP A;  2EK9 A;  3IEH A;  3SJE A;  3S9L A;  3PBE A;  3GLJ A;  4JZ0 A;  4W9Y A;  1BLL E;  4FWU A;  3JRU A;  4OKO A;  1HDQ A;  4Z65 A;  2ZEM A;  4ZX9 A;  2ZEO A;  5JGF A;  2C6C A;  3PEI A;  5HVG A;  3IJ3 A;  2XEG A;  4YWY A;  2BOA A;  3B7I A;  3MN8 A;  1TF8 A;  4DUK A;  2XEJ A;  1TKJ A;  3FH4 A;  5K8M A;  4PQA A;  1VHO A;  1XMB A;  1JQG A;  2PCU A;  2IMO A;  3V7Z A;  4MMO A;  2EWB A;  4ZI6 A;  3D66 A;  2QJ8 A;  3K2K A;  2PJ6 A;  4P10 A;  2BO9 A;  1PCA A;  3FED A;  1LOK A;  3KR5 A;  2DEA A;  3EIF A;  4CPA A;  5CBM A;  2V8G A;  3CPA A;  3D68 A;  5LRG A;  4OC3 A;  2JBK A;  1QMU A;  2ZEH A;  3WC6 A;  2PJ2 A;  1V6C A;  3WT4 A;  1AMP A;  2I3C A;  4C8T A;  3S9N A;  5LYL A;  3I6S A;  4TJX A;  2ZEP A;  3KI9 A;  3TC8 A;  3B3S A;  3KZW A;  4MHY A;  4OID A;  2CIJ A;  4AXV A;  3FEE A;  5D29 A;  4MCP A;  1BPM A;  2HC9 A;  2PJA A;  3V38 A;  1NSA A;  4F9V A;  1KWM A;  3D7H A;  1GYT A;  3NFZ A;  7CPA A;  4PXE A;  3DLJ A;  5F09 A;  2PJ7 A;  2JEW A;  2AFO A;  2AFZ A;  3PB6 X;  3SI0 A;  1ZG7 A;  1AYE A;  2V8V A;  3D7F A;  1Y0R A;  4NJR A;  2QVP A;  1ZG8 A;  4X8I A;  1LAN A;  2PJ5 A;  3NA6 A;  2ZEG A;  2PJ9 A;  3ISX A;  4K3N A;  4O23 A;  1TF9 A;  1Z5R A;  5J1Q A;  3D7D A;  1XBU A;  1TKF A;  4MXU A;  4OP4 A;  2J9A A;  4P4I A;  1VHE A;  2QYV A;  2C1C A;  1HDU A;  3PFO A;  4MHP A;  3H8E A;  3SI2 A;  3FX6 A;  3HUV A;  4MCS A;  3ISZ A;  4UEE A;  2EK8 A;  1YSJ A;  1CX8 A;  4PXC A;  3VAR A;  4C8P A;  2AFU A;  3NH5 A;  3NH8 A;  4C99 A;  1ZLH A;  2PVW A;  4MHZ A;  1F2O A;  1FT7 A;  4OC4 A;  4IAV A;  4KSI A;  2ZEN A;  1XRY A;  4R76 A;  5ELY A;  4C9A A;  2WYR A;  3FEC A;  3DGV A;  4R6T A;  2F8H A;  2CTB A;  3D7G A;  1Y9Z A;  1LAM A;  3WAB A;  3KL9 A;  3CPX A;  1Z8L A;  5IB9 A;  3BI1 A;  1UWY A;  4C85 A;  1CBX A;  4PPZ A;  4DJL A;  1ARM A;  1IY7 A;  3FMC A;  4P44 A;  3PFE A;  4NGQ A;  3SJF A;  3GB0 A;  4FBE A;  4YN3 A;  4P4J A;  3T8W A;  5HVH A;  3CT9 A;  1BAV A;  4X3R A;  1TKH A;  3FVL A;  4R8F A;  1ARL A;  4YU9 A;  3KHX A;  4A38 A;  1VGY A;  3B3V A;  4NGS A;  2PJ3 A;  3IO1 A;  4PXB A;  3BHX A;  3KQZ A;  1ELM P;  2BCO A;  3H8F A;  2GRE A;  1IGB A;  2V77 A;  1WVM A;  1Z2L A;  3B35 A;  1XJO A;  4H2K A;  4CDK A;  2FVG A;  1M4L A;  4P6Y A;  4C8U A;  2O4H A;  2C6G A;  4C9U A;  2CTC A;  2NYQ A;  4KNG E;  1VIX A;  3KGQ A;  4DYO A;  3LWU A;  2GU2 A;  2ZEL A;  3KR4 A;  5LYI A;  4EWT A;  2PJB A;  2POK A;  2PE3 A;  2PJ8 A;  5DS0 A;  4OC1 A;  1XF1 A;  3N5F A;  2PVV A;  4EME A;  1H8L A;  3PB8 X;  1LAP A;  2XEI A;  2Q51 A;  4WJB A;  3D4U A;  2OOT A;  2ZEE A;  4CDJ A;  4UEF A;  2PJ4 A;  3VTA A;  5LRK A;  3SI1 A;  4NGR A;  1OBR A;  4MHN A;  2AFX A;  2ZOG A;  2NSM A;  4ZY0 A;  3I74 A;  2ZEF A;  3IFE A;  3BXM A;  3B2Y A;  2VL1 A;  4ONW A;  1Y7E A;  4C8A A;  1EE3 P;  6CPA A;  2RB7 A;  4MCQ A;  1CP7 A;  4FUU A;  3VAT A;  4TJV A;  2PJ0 A;  4LQG A;  2G9D A;  8CPA A;  4NGT A;  1CG2 A;  3D67 A;  1Q7L A;  2PJC A;  2GLF A;  4C9E A;  5HXD A;  4NGP A;  1QQ9 A;  4C8F A;  1R43 A;  4R7M A;  3SJG A;  3IC1 A;  4OC0 A;  3NH4 A;  3KAS A;  1ELL P;  1TXR A;  1RTQ A;  3K9T A;  2PIY A;  2RFH A;  4NJQ A;  4OC2 A;  2PJ1 A;  4BD9 A;  2ABZ A;  2WZN A;  1DE4 C;  5JM6 A;  3PRT A;  2IQ6 A;  5THW A;  3S9M A;  1Y0Y A;  1YLO A;  4F8Z A;  3CDX A;  3L2N A;  4EFD A;  4C84 A;  1LCP A;  4C8C A;  3FJU A;  3QNV A;  1BPN A;  2AFS A;  4IK2 A;  4OC5 A;  2AFM A;  4PXD A;  2ZOF A;  4A94 A;  4MRI A;  3B3T A;  1F57 A;  2OR4 A;  3GUX A;  4P4B A;  4P4F A;  2JBJ A;  3HLP A;  4RUH A;  3RBU A;  4A39 A;  4NGM A;  5K8P A;  4UEZ A;  3IWW A;  2IJZ A;  3PB7 X;  1F2P A;  4IHM A;  1PYT B;  4FAI A;  2PIZ A;  4GM5 A;  2GLJ A;  5CPA A;  5LYD A;  4NGN A;  3IIB A;  2F7V A;  4WWV A;  4A37 A;  4MCR A;  3KQX A;  5LRJ A;  3PBB A;  3ICU A;  2C6P A;  3B3W A;  4TWE A;  4P4E A;  1YW4 A;  2PRQ A;  3WC5 A;  1CPS A;  2Q4Z A;  5K8N A;  5HVF A;  4B6Z A;  2V8H A;  4ZY2 A;  3KHZ A;  1FNO A;  5I4M A;  5LYF A;  4F9U A;  4C9R A;  3FF3 A;  2XEF A;  4UF4 A;  1LFW A;  3MRU A;  3SJX A;  1CPX A; 
#chains in the Genus database with same CATH topology
 3T5M A;  3TLG B;  2FS5 A;  2O53 A;  4OIW A;  4P4D A;  1HEE A;  2HUZ A;  1YME A;  1Z8X A;  2PRB A;  3C26 A;  3EZB A;  2VBQ A;  2VZY A;  4AVC A;  4BPX B;  3LMS A;  2JEV A;  4ZX8 A;  2BEI A;  2ZED A;  3NFQ A;  2JDC A;  4IIX A;  4UIB A;  1YW6 A;  4P45 A;  1GGO A;  3FNC A;  1CP6 A;  1UFH A;  2B4J C;  1XFO A;  3VH9 A;  2X0S A;  2BL1 A;  1ZG9 A;  5K8O A;  1R3N A;  3H8G A;  5AG5 A;  3H5Z A;  3ZNI A;  3EXN A;  1Q2D A;  4UCP A;  4TNU A;  1NSL A;  3TOA A;  4X2T A;  4COG A;  1MJ9 A;  4C86 A;  3TYX A;  3SHP A;  1JDE A;  2HB6 A;  1DTD A;  3WC7 A;  3JTK A;  3BI0 A;  4NFR A;  3TX8 A;  4ZY1 A;  4UIA A;  3TE4 A;  5D8N A;  3U1B A;  4JJX A;  3RAM A;  3TLA A;  5F48 A;  4A95 A;  4JYW A;  3VRN A;  4J3G A;  4M85 A;  4OLL A;  1M4I A;  2ARH A;  5F46 A;  5J8C A;  4C8U A;  3I1U A;  4MJX A;  3RZA A;  2FE7 A;  2CF4 A;  1ZLI A;  3PB4 X;  3PB9 X;  4KLV A;  4MI1 A;  2B58 A;  2AFW A;  2V8D A;  3IWG A;  4KSA A;  3T9Y A;  4B5P A;  4C9V A;  3DDD A;  5HKW A;  4G1P A;  4OME A;  4UWJ A;  4CO9 A;  2Q43 A;  4ZGY B;  4ZYQ A;  5JH9 A;  1Q2Y A;  4Q38 A;  2UV8 G;  4C7I A;  4Q7A A;  2FSR A;  3B3C A;  4RR2 B;  2ANP A;  2Q4V A;  2EK9 A;  3IEH A;  3SJE A;  3S9L A;  2WSA A;  1YGH A;  2FL4 A;  2P6G A;  3PBE A;  1KBL A;  2CBL A;  2XPL A;  3GLJ A;  4JZ0 A;  4W9Y A;  1BLL E;  1XF8 A;  4FWU A;  1QSR A;  3JRU A;  4OKO A;  1HDQ A;  2CXA A;  2REE A;  2BSW A;  2ZEM A;  4KZT A;  5G21 A;  1YX0 A;  4ZX9 A;  2ZEO A;  4B12 A;  4Z65 A;  1Q5X A;  5JGF A;  5K99 A;  2C6C A;  1A9X B;  3W6S A;  1X12 A;  4OAE A;  3PEI A;  2YNE A;  5JQ4 A;  5HVG A;  3IJ3 A;  4MFJ A;  1IOF A;  2OZH A;  1V0C A;  4MFK A;  3VRP A;  2XEG A;  4QUS A;  4R3L A;  1NE9 A;  4XPK A;  4JXR A;  2P6F A;  3G3S A;  4YWY A;  2BOA A;  2Z3P A;  3B7I A;  3MN8 A;  1TF8 A;  2NMT A;  3NE8 A;  2Q7B A;  3R96 A;  5HKZ A;  2QML A;  4DUK A;  3O8Z A;  3CZX A;  3I3G A;  2XEJ A;  1TKJ A;  2YNC C;  3F8K A;  3FH4 A;  5K8M A;  1VBG A;  4PQA A;  4A4C A;  1VHO A;  1M1D A;  1XMB A;  2Z3L A;  3FB3 A;  1JQG A;  3R9F A;  2PCU A;  2AUN A;  3FBU A;  2IMO A;  5AXI A;  4KOV A;  4AVB A;  2B5G B;  3V7Z A;  4MMO A;  2EWB A;  1NXJ A;  4CDK A;  3H4Q A;  4FD7 A;  3TCV A;  3N7Z A;  5FVJ A;  4ZI6 A;  4CAW A;  3D66 A;  2QJ8 A;  3K2K A;  4RI1 A;  2PJ6 A;  4P10 A;  4IF5 A;  2BO9 A;  1B6B A;  4KOX A;  1IB1 E;  1PCA A;  1R61 A;  3FED A;  1LOK A;  4PK2 A;  3KR5 A;  3JVN A;  4QBJ A;  2VI7 A;  2DEA A;  2YNC A;  3EIF A;  4CPA A;  4Y49 B;  2J8R A;  3FXT A;  2XPP A;  4KS9 A;  4CRZ B;  2GIV A;  5CBM A;  2V8G A;  3CPA A;  5C88 A;  3D68 A;  3GYA A;  5LRG A;  5FD8 A;  4OC3 A;  1I12 A;  5KTD A;  3S6K A;  3PT1 A;  2JBK A;  1QMU A;  2ZEH A;  2DPS A;  3WC6 A;  4AB7 A;  2PJ2 A;  1V6C A;  1KUV A;  1S5K A;  3WT4 A;  1AMP A;  4MFQ A;  5AGE A;  2I3C A;  1K4J A;  1VKC A;  3U88 C;  4C8T A;  5I0C A;  2R1I A;  3S9N A;  4XPL A;  4COB A;  5LYL A;  2R82 A;  2AJ6 A;  1IYL A;  2Z0Z A;  3I6S A;  5E96 A;  4FD4 A;  4A30 A;  4F6A A;  4TJX A;  1Z8W A;  1Z4R A;  1IIC A;  2ZEP A;  3B3S A;  3EC4 A;  3KI9 A;  3KZW A;  4MHY A;  3TC8 A;  4HNY B;  1KZF A;  3T0T A;  4OID A;  2CIJ A;  3BUM B;  1U6M A;  4KOY A;  4AXV A;  2PC1 A;  3FEE A;  2K5T A;  5D29 A;  2DF5 A;  4MCP A;  4HKF A;  1BPM A;  2HC9 A;  2PJA A;  5EMI A;  3OB2 B;  2H5M A;  3V38 A;  5F5X A;  3W91 A;  2PDO A;  2R7H A;  1NSA A;  1SQH A;  3NE7 A;  4F9V A;  1KWM A;  3D7H A;  1GYT A;  2P6E A;  3NFZ A;  2GFQ A;  4UFW A;  7CPA A;  5F49 A;  4PXE A;  4CAF A;  1VI4 A;  4C8F A;  2QIR A;  3DLJ A;  1BO4 A;  5BY0 A;  5F09 A;  4NXY A;  2PJ7 A;  2JEW A;  1QSN A;  2AFO A;  2AFZ A;  4ZBG A;  3S6G A;  2ZW7 A;  2Q0Y A;  1XEB A;  4II9 A;  3PB6 X;  4H89 A;  3SI0 A;  1ZG7 A;  5F1Y A;  3BUN B;  1M6V B;  1AYE A;  4H6Z A;  2E28 A;  2B4D B;  1DIK A;  2CNS A;  4UA3 A;  2V8V A;  3D7F A;  4HNW B;  1Y0R A;  2FCK A;  4NF1 A;  2QVP A;  1ZG8 A;  4MFZ A;  4NJR A;  5A28 A;  4X8I A;  1C30 B;  1LAN A;  3G23 A;  4H6U A;  2PJ5 A;  3NA6 A;  2ZEG A;  1T36 B;  1LRZ A;  2PJ9 A;  1CJW A;  3IWE A;  3ISX A;  1L0C A;  4K3N A;  5G20 A;  4O23 A;  3PFV A;  1TF9 A;  2Q04 A;  1Z5R A;  2YND A;  3WR7 A;  5J1Q A;  1ZYM A;  3TLZ A;  3D7D A;  1XBU A;  3KRV A;  3E0K A;  4CAX A;  3TLG A;  1EO0 A;  5HMN A;  4J0N A;  1JWQ A;  1TKF A;  4MXU A;  4OP4 A;  3TO7 A;  2PSW A;  2J9A A;  5AG6 A;  2Z11 A;  1J3L A;  4P4I A;  2D4O A;  2IL4 A;  1VHE A;  2QYV A;  2ZW6 A;  2C1C A;  4KVM E;  1HDU A;  4L8A A;  4IIY A;  3TLY A;  3HPH E;  2P0W A;  1YVH A;  1YRE A;  1Z8T A;  3PFO A;  4MHP A;  3BUW B;  3H8E A;  1AUG A;  3SI2 A;  3FX6 A;  3HUV A;  4MCS A;  4KOU A;  5IX3 A;  3ISZ A;  4JLY A;  1KUY A;  2KCW A;  2A4N A;  4UEE A;  2EK8 A;  4RN7 A;  1YSJ A;  1CX8 A;  4GS4 A;  4H1H A;  1J4J A;  4PXC A;  3VAR A;  4C8P A;  2AFU A;  1FBV A;  3NH5 A;  3NH8 A;  4JXQ A;  3RYO A;  4C99 A;  2HRO A;  4U9Z A;  1B87 A;  3I9S A;  4A32 A;  2MP0 A;  1ZLH A;  3HPG G;  5F9M A;  2PVW A;  2ZW4 A;  3P2H A;  4KOS A;  2DLA A;  4MHZ A;  2FM4 A;  1F2O A;  3T90 A;  3W6X A;  1FT7 A;  4OC4 A;  1P4N A;  2GE3 A;  2RC4 A;  3QB8 A;  4IAV A;  4KSI A;  5JVL A;  2REF A;  2ZEN A;  2HQY A;  3V8I A;  4MFL A;  1XRY A;  2ZPA A;  4R9M A;  4R76 A;  5ELY A;  2Z10 A;  4MFP A;  5ISV A;  4C9A A;  4F0Y A;  5F13 A;  3FRM A;  2WYR A;  3FEC A;  3DGV A;  4R6T A;  2FXF A;  2F8H A;  2CTB A;  3D7G A;  2HV2 A;  1Y9Z A;  1LAM A;  3PGP A;  4KUA A;  4PSX A;  3WAB A;  3GJZ A;  1ZL0 A;  3KL9 A;  3VRQ A;  1MJA A;  2WUU A;  4UCN A;  2C5Q A;  1GHE A;  2Y1M A;  3CPX A;  1Z8L A;  3FYN A;  5IB9 A;  3BI1 A;  1UWY A;  4C85 A;  1CBX A;  1QSO A;  2CY2 A;  4PPZ A;  2Z3O A;  4DJL A;  2GP4 A;  4CGL A;  1ARM A;  4B10 A;  1IY7 A;  1S7K A;  3FMC A;  3DR6 A;  4BPU B;  3PLF B;  4P44 A;  3PFE A;  3D2M A;  4NGQ A;  3SJF A;  2GAN A;  3EFA A;  3GB0 A;  4FBE A;  4YN3 A;  4P4J A;  1S7F A;  4XPD B;  2Z3M A;  1TIQ A;  2Q7S A;  5AG7 A;  3T8W A;  4U9Y A;  2XPO A;  4AG7 A;  3CT9 A;  5HVH A;  1BAV A;  4X3R A;  1TKH A;  3FVL A;  4BTF A;  2FIW A;  2ZW5 A;  4R8F A;  4B11 A;  1ARL A;  4YU9 A;  3MGD A;  3KHX A;  1I21 A;  4A38 A;  4CGP A;  3T07 A;  1R57 A;  4Y49 C;  1VGY A;  5HKY A;  1ZRS A;  3IU1 A;  4INJ A;  4FD6 A;  3B3V A;  4NGS A;  2PCN A;  1N71 A;  3TO9 A;  3EZE A;  4CYQ A;  2PJ3 A;  2PQ8 A;  3IO1 A;  4LX9 A;  3D8P A;  1B47 A;  1Y9K A;  4PXB A;  2B5G A;  3BHX A;  4IUS A;  1XIX A;  4A4B A;  1I1D A;  1YR0 A;  2VXK A;  3R9E A;  2VQY A;  3KQZ A;  3CXQ A;  1BOB A;  3EZA A;  4I49 A;  3P2F A;  2AUM A;  2HWG A;  1ELM P;  2BCO A;  3H8F A;  4M6I A;  2GRE A;  4QC6 A;  2Y1N A;  3TO6 A;  2EO8 A;  3SXO A;  1IGB A;  1XMT A;  1OZP A;  1IID A;  2ODF A;  2V77 A;  3QAH A;  1WVM A;  4CZ1 A;  1Z2L A;  4LQ6 A;  2EBJ A;  3B35 A;  3LAC A;  2Z3K A;  2D4P A;  3D2P A;  1XJO A;  4H2K A;  4KOW A;  5J3X A;  1M4L A;  2FVG A;  4MY3 A;  2O4H A;  4P6Y A;  4QB9 A;  4YGO A;  4CRY B;  5IR2 A;  4UWI A;  2YJV A;  3TLC A;  3HMJ G;  4PV6 A;  2C6G A;  1JDB C;  4C9U A;  2CTC A;  2NYQ A;  3EO4 A;  1VIX A;  1XOV A;  4KNG E;  5AG4 A;  3BJ8 A;  3KGQ A;  4NSQ A;  2C27 A;  4B5O A;  4MHD A;  4B13 A;  2VKZ G;  2GU2 A;  2Z3N A;  3LWU A;  4A2Z A;  4DYO A;  2ZEL A;  2G3T A;  3QAY A;  5C82 A;  3KR4 A;  4QVT A;  5LYI A;  4CYN A;  4EWT A;  3UY5 A;  3SR3 A;  2Q4Y A;  4LUA A;  4EVY A;  2OZU A;  3BLN A;  4KSF A;  4X5K A;  3VGO A;  1RO5 A;  3TOB A;  3TLB A;  2PJB A;  2POK A;  1Y9W A;  2PE3 A;  3RO0 A;  2PJ8 A;  4R3K A;  1EZB A;  2JDD A;  5DS0 A;  4OC1 A;  1M44 A;  1XF1 A;  4XNH B;  3CXS A;  3DSB A;  1C3O B;  1KC7 A;  3N5F A;  2PVV A;  4CYO A;  1H8L A;  4EME A;  3PB8 X;  2HI6 A;  1LAP A;  2XEI A;  2Q51 A;  4WJB A;  3D4U A;  2D0O A;  2OOT A;  2ZEE A;  4UFX A;  5H84 A;  4JVO A;  2J8M A;  4UEF A;  3ZZI A;  4E0A A;  2PJ4 A;  4CDJ A;  3VTA A;  5LRK A;  3SI1 A;  4NGR A;  3GIU A;  1OBR A;  1PUA A;  3S6H A;  3S6F A;  4RS2 A;  4KUB A;  4MHN A;  2Q44 A;  2AFX A;  3GKR A;  1S3Z A;  2ZOG A;  3SXN A;  2NSM A;  4ZY0 A;  4MY0 A;  4C7H A;  1X10 A;  3I74 A;  3DNS A;  4UFV A;  2ZEF A;  1IYK A;  3G8W A;  3IFE A;  4AG9 A;  4KOR A;  3VRO A;  3NOJ A;  4BBH A;  4MI4 A;  3BXM A;  3B2Y A;  2VL1 A;  5DWN A;  3TFY A;  3F5B A;  5CNP A;  2DPT A;  4ONW A;  1RXT A;  1PU9 A;  1Y7E A;  2B3V A;  4B5P B;  1VBH A;  4C8A A;  1EE3 P;  2ATR A;  6CPA A;  2J8N A;  2RB7 A;  5G22 A;  3R9G A;  5JPH A;  4MCQ A;  1CP7 A;  2EUI A;  2B4D A;  3K9U A;  4K30 A;  4PK3 A;  4FUU A;  4KVO E;  3VAT A;  4TJV A;  2PJ0 A;  2N3A B;  4LQG A;  2G9D A;  8CPA A;  1M4G A;  4NEX A;  3JUW A;  4NGT A;  3DR8 A;  1VHS A;  1CG2 A;  3D67 A;  1Q7L A;  2PJC A;  3TT2 A;  2GLF A;  1MK4 A;  2CNM A;  5IB0 A;  4C9E A;  2XPN A;  5HXD A;  1ON0 A;  2B4B A;  4R87 A;  4NGP A;  3VWE A;  4E2A A;  1WWZ A;  1QQ9 A;  2CNT A;  4KLW A;  2FIA A;  3ZJ0 A;  4B14 A;  3OAK A;  4CAE A;  1R43 A;  4CS0 B;  3PP9 A;  4R7M A;  2OLS A;  3SJG A;  1IOI A;  3C8O A;  4U5Y A;  3IC1 A;  3VRR A;  3IGR A;  3RNZ A;  4OC0 A;  3NH4 A;  3PZJ A;  3KAS A;  1ELL P;  1TXR A;  4A33 A;  1RTQ A;  4BPW B;  3K9T A;  3OP0 A;  2G0B A;  2PIY A;  2RFH A;  2YGW A;  4M6G A;  4NJQ A;  4F0X A;  4OC2 A;  4FD5 A;  4E94 A;  2PJ1 A;  1CM0 A;  4MBU A;  2ABZ A;  2WZN A;  4BD9 A;  1DE4 C;  2G3A A;  5JM6 A;  3IU2 A;  4GXH A;  3PRT A;  2IQ6 A;  5THW A;  3S9M A;  2AE6 A;  3A9L A;  1Y0Y A;  3KKW A;  2DXQ A;  3BUO B;  3K4I A;  5EBV A;  1A2Z A;  1YLO A;  2BUE A;  2FT0 A;  2PR1 A;  3CDX A;  4F8Z A;  3VWD A;  3T05 A;  3L2N A;  1BXR B;  4EFD A;  4C84 A;  1YVO A;  1QSM A;  4PSW A;  4MJ8 A;  1LCP A;  3OWC A;  1S7N A;  5KTC A;  4C8C A;  1MJB A;  2Y0M A;  4ORF A;  3R1K A;  4Q36 A;  4CYP A;  1KUX A;  4BIN A;  3FJU A;  4JD6 A;  1YLE A;  2EZA A;  4CGO A;  2I79 A;  2OU2 A;  3QNV A;  4UCM A;  2VZZ A;  3R95 A;  4A31 A;  1FY7 A;  5F47 A;  3TLE A;  4CAV A;  1BPN A;  2AFS A;  3BJ7 A;  4IK2 A;  4OC5 A;  2AFM A;  4PXD A;  2ZOF A;  4E5S A;  4A94 A;  4R57 A;  3LD2 A;  4MRI A;  3B3T A;  3FIX A;  2F5I A;  1F57 A;  2OR4 A;  4XPD C;  3GUX A;  4C68 A;  1NMT A;  2DIK A;  1QST A;  4P4B A;  4P4F A;  2JBJ A;  2ZXV A;  3HLP A;  4DNC A;  4KOT A;  4RUH A;  5JYB A;  4C2Y A;  1S7L A;  1CE8 B;  3RBU A;  2EZC A;  3D3S A;  4A39 A;  2R98 A;  2R8V A;  4NGM A;  5K8P A;  1NBW A;  1M4D A;  1Y7R A;  2QEC A;  4C2Z A;  1YK3 A;  4UEZ A;  1Z9U A;  3IWW A;  2IJZ A;  3PB7 X;  1F2P A;  4IHM A;  2PR8 A;  2X7B A;  5H86 A;  5KTA A;  4M8D A;  2JLM A;  4HNX B;  1PYT B;  4FAI A;  2PIZ A;  1P0H A;  2VEZ A;  1Z4E A;  4GM5 A;  2EVN A;  4JWP A;  4AVA A;  1S60 A;  2YJT A;  2GLJ A;  3OB1 B;  2I00 A;  3CXP A;  1CS0 B;  1WK4 A;  5HH1 A;  4ONU A;  5CPA A;  4NGN A;  3IIB A;  5LYD A;  4HPS A;  2F7V A;  5EC4 A;  4WWV A;  4BMH A;  4A37 A;  3BUX B;  4MCR A;  3KQX A;  1EZA A;  4M6H A;  5LRJ A;  2OZG A;  4OAD A;  3PBB A;  3LOD A;  4KVX A;  5A27 A;  3ICU A;  2C6P A;  5J8F A;  3B3W A;  4TWE A;  4P4E A;  1YW4 A;  2PRQ A;  2EZB A;  4L89 A;  3WC5 A;  1CPS A;  2Q4Z A;  3GY9 A;  5K8N A;  5BWA B;  1XE4 A;  4M3S A;  5HVF A;  5DWM A;  4B6Z A;  2V8H A;  1IU8 A;  3EY5 A;  4ZY2 A;  1KEE B;  1Q2C A;  4UBR A;  3F9K C;  2B0A A;  2OB0 A;  1ZO0 A;  5G1Z A;  3KHZ A;  1FNO A;  2OH1 A;  4GPL B;  5GCN A;  1Z9E A;  4YRH A;  5I4M A;  5LYF A;  4F9U A;  4EYS A;  4C2X A;  2D0P A;  3B8G A;  4C9R A;  3FF3 A;  1YVK A;  3TTH A;  4CGN A;  3F0A A;  4NCZ A;  4CGM A;  5IV0 A;  2XEF A;  2WPW A;  4UF4 A;  2B3U A;  4YFJ A;  1LFW A;  4XNH C;  3MRU A;  3SJX A;  2O28 A;  1WJT A;  2WPX A;  1CPX A;  1YQE A;  4E8O A; 
#chains in the Genus database with same CATH homology
 2O53 A;  4OIW A;  4P4D A;  1HEE A;  1YME A;  3LMS A;  4ZX8 A;  2ZED A;  4UIB A;  1YW6 A;  4P45 A;  1CP6 A;  1XFO A;  3VH9 A;  1ZG9 A;  5K8O A;  1R3N A;  3H8G A;  4TNU A;  4X2T A;  4C86 A;  2HB6 A;  1DTD A;  3WC7 A;  3TX8 A;  3BI0 A;  4NFR A;  4ZY1 A;  4UIA A;  5D8N A;  3RAM A;  4JYW A;  3I1U A;  3RZA A;  2CF4 A;  1ZLI A;  3PB4 X;  3PB9 X;  2AFW A;  2V8D A;  4C9V A;  4G1P A;  4OME A;  2Q43 A;  4ZYQ A;  5JH9 A;  4Q7A A;  3B3C A;  2ANP A;  2EK9 A;  3IEH A;  3SJE A;  3S9L A;  3PBE A;  3GLJ A;  4JZ0 A;  4W9Y A;  1BLL E;  4FWU A;  3JRU A;  4OKO A;  1HDQ A;  4Z65 A;  2ZEM A;  4ZX9 A;  2ZEO A;  5JGF A;  2C6C A;  3PEI A;  5HVG A;  3IJ3 A;  2XEG A;  4YWY A;  2BOA A;  3B7I A;  3MN8 A;  1TF8 A;  4DUK A;  2XEJ A;  1TKJ A;  3FH4 A;  5K8M A;  4PQA A;  1VHO A;  1XMB A;  1JQG A;  2PCU A;  2IMO A;  3V7Z A;  4MMO A;  2EWB A;  4ZI6 A;  3D66 A;  2QJ8 A;  3K2K A;  2PJ6 A;  4P10 A;  2BO9 A;  1PCA A;  3FED A;  1LOK A;  3KR5 A;  2DEA A;  3EIF A;  4CPA A;  5CBM A;  2V8G A;  3CPA A;  3D68 A;  5LRG A;  4OC3 A;  2JBK A;  1QMU A;  2ZEH A;  3WC6 A;  2PJ2 A;  1V6C A;  3WT4 A;  1AMP A;  2I3C A;  4C8T A;  3S9N A;  5LYL A;  3I6S A;  4TJX A;  2ZEP A;  3KI9 A;  3TC8 A;  3B3S A;  3KZW A;  4MHY A;  4OID A;  2CIJ A;  4AXV A;  3FEE A;  5D29 A;  4MCP A;  1BPM A;  2HC9 A;  2PJA A;  3V38 A;  1NSA A;  4F9V A;  1KWM A;  3D7H A;  1GYT A;  3NFZ A;  7CPA A;  4PXE A;  3DLJ A;  5F09 A;  2PJ7 A;  2JEW A;  2AFO A;  2AFZ A;  3PB6 X;  3SI0 A;  1ZG7 A;  1AYE A;  2V8V A;  3D7F A;  1Y0R A;  4NJR A;  2QVP A;  1ZG8 A;  4X8I A;  1LAN A;  2PJ5 A;  3NA6 A;  2ZEG A;  2PJ9 A;  3ISX A;  4K3N A;  4O23 A;  1TF9 A;  1Z5R A;  5J1Q A;  3D7D A;  1XBU A;  1TKF A;  4MXU A;  4OP4 A;  2J9A A;  4P4I A;  1VHE A;  2QYV A;  2C1C A;  1HDU A;  3PFO A;  4MHP A;  3H8E A;  3SI2 A;  3FX6 A;  3HUV A;  4MCS A;  3ISZ A;  4UEE A;  2EK8 A;  1YSJ A;  1CX8 A;  4PXC A;  3VAR A;  4C8P A;  2AFU A;  3NH5 A;  3NH8 A;  4C99 A;  1ZLH A;  2PVW A;  4MHZ A;  1F2O A;  1FT7 A;  4OC4 A;  4IAV A;  4KSI A;  2ZEN A;  1XRY A;  4R76 A;  5ELY A;  4C9A A;  2WYR A;  3FEC A;  3DGV A;  4R6T A;  2F8H A;  2CTB A;  3D7G A;  1Y9Z A;  1LAM A;  3WAB A;  2C5Q A;  3KL9 A;  3CPX A;  1Z8L A;  5IB9 A;  3BI1 A;  1UWY A;  4C85 A;  1CBX A;  4PPZ A;  2GP4 A;  4DJL A;  1ARM A;  1IY7 A;  3FMC A;  4P44 A;  3PFE A;  4NGQ A;  3SJF A;  3GB0 A;  4FBE A;  4YN3 A;  4P4J A;  3T8W A;  5HVH A;  3CT9 A;  1BAV A;  4X3R A;  1TKH A;  3FVL A;  4R8F A;  1ARL A;  4YU9 A;  3KHX A;  4A38 A;  1VGY A;  3B3V A;  4NGS A;  2PJ3 A;  3IO1 A;  4PXB A;  3BHX A;  3KQZ A;  1ELM P;  2BCO A;  3H8F A;  2GRE A;  1IGB A;  2V77 A;  1WVM A;  1Z2L A;  3B35 A;  1XJO A;  4H2K A;  4CDK A;  2FVG A;  1M4L A;  4P6Y A;  4C8U A;  2O4H A;  5IR2 A;  2C6G A;  4C9U A;  2CTC A;  2NYQ A;  4KNG E;  1VIX A;  3KGQ A;  4DYO A;  3LWU A;  2GU2 A;  2ZEL A;  3KR4 A;  5LYI A;  4EWT A;  2PJB A;  2POK A;  2PE3 A;  2PJ8 A;  5DS0 A;  4OC1 A;  1XF1 A;  3N5F A;  2PVV A;  4EME A;  1H8L A;  3PB8 X;  1LAP A;  2XEI A;  2Q51 A;  4WJB A;  3D4U A;  2OOT A;  2ZEE A;  4CDJ A;  4UEF A;  2PJ4 A;  3VTA A;  5LRK A;  3SI1 A;  4NGR A;  1OBR A;  4MHN A;  2AFX A;  2ZOG A;  2NSM A;  4ZY0 A;  3I74 A;  2ZEF A;  3IFE A;  3BXM A;  3B2Y A;  2VL1 A;  4ONW A;  1Y7E A;  4C8A A;  1EE3 P;  6CPA A;  2RB7 A;  4MCQ A;  1CP7 A;  4FUU A;  3VAT A;  4TJV A;  2PJ0 A;  4LQG A;  2G9D A;  8CPA A;  4NGT A;  1CG2 A;  3D67 A;  1Q7L A;  2PJC A;  2GLF A;  4C9E A;  5HXD A;  4NGP A;  1QQ9 A;  4C8F A;  1R43 A;  4R7M A;  3SJG A;  3IC1 A;  4OC0 A;  3NH4 A;  3KAS A;  1ELL P;  1TXR A;  1RTQ A;  3K9T A;  2PIY A;  2RFH A;  4NJQ A;  4OC2 A;  2PJ1 A;  4BD9 A;  2ABZ A;  2WZN A;  1DE4 C;  5JM6 A;  3PRT A;  2IQ6 A;  5THW A;  3S9M A;  1Y0Y A;  1YLO A;  4F8Z A;  3CDX A;  3L2N A;  4EFD A;  4C84 A;  1LCP A;  4C8C A;  3FJU A;  3QNV A;  1BPN A;  2AFS A;  4IK2 A;  4OC5 A;  2AFM A;  4PXD A;  2ZOF A;  4A94 A;  4MRI A;  3B3T A;  1F57 A;  2OR4 A;  3GUX A;  4P4B A;  4P4F A;  2JBJ A;  3HLP A;  4RUH A;  3RBU A;  4A39 A;  4NGM A;  5K8P A;  4UEZ A;  3IWW A;  2IJZ A;  3PB7 X;  1F2P A;  4IHM A;  1PYT B;  4FAI A;  2PIZ A;  4GM5 A;  2GLJ A;  5CPA A;  5LYD A;  4NGN A;  3IIB A;  2F7V A;  4WWV A;  4A37 A;  4MCR A;  3KQX A;  5LRJ A;  3PBB A;  3ICU A;  2C6P A;  3B3W A;  4TWE A;  4P4E A;  1YW4 A;  2PRQ A;  3WC5 A;  1CPS A;  2Q4Z A;  5K8N A;  5HVF A;  4B6Z A;  2V8H A;  4ZY2 A;  3KHZ A;  1FNO A;  5I4M A;  5LYF A;  4F9U A;  4C9R A;  3FF3 A;  2XEF A;  4UF4 A;  1LFW A;  3MRU A;  3SJX A;  1CPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...