2JBKA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with quisqualic acid (quisqualate, alpha-amino-3,5-dioxo-1,2,4- oxadiazolidine-2-propanoic acid)
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
694
structure length
687
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title Human Glutamate Carboxypeptidase II Inhibition: Structures of Gcpii in Complex with Two Potent Inhibitors, Quisqualate and 2-Pmpa.
pubmed doi rcsb
source organism Homo sapiens
total genus 238
structure length 687
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2jbkA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2jbkA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2jbkA02
5LYFA 4C9VA 4TJVA 2PJ4A 4OC5A 1LFWA 4TWEA 3CT9A 4F8ZA 4EWTA 3SI2A 4UEFA 4NGMA 4FBEA 3RBUA 1HDUA 1KWMA 3WC5A 4P10A 5D29A 2QJ8A 3S9MA 4R76A 2ZEGA 1Y0YA 4NFRA 2V8HA 4EMEA 3EIFA 2PRQA 3H8GA 1Y7EA 3IC1A 3BI1A 2V8DA 5JH9A 1LCPA 3B3WA 4C86A 3D7GA 4EFDA 4H2KA 1XRYA 2XEIA 3CPAA 3CDXA 2JBKA 2GREA 4UIAA 4F9VA 4C8FA 1R43A 3PEIA 3I74A 4OC2A 5K8OA 2ZEHA 3ISXA 1TXRA 2PIZA 2PCUA 3KQZA 1Y9ZA 4R7MA 1LOKA 2IJZA 4YU9A 1PCAA 1QMUA 1YLOA 4UIBA 3BI0A 4JZ0A 2V8GA 3BXMA 2Q4ZA 1FT7A 2BOAA 2POKA 2ZEMA 4AXVA 1ELMP 3WABA 1PYTB 1VGYA 1ZLIA 3HUVA 7CPAA 1TKJA 4IHMA 4MXUA 5J1QA 1YW4A 3KR4A 2AFSA 2PJ5A 2CF4A 3LMSA 3B2YA 4ZY1A 3PB6X 2XEFA 3KASA 4MHNA 1CG2A 2GU2A 3KGQA 4P4IA 3VARA 4MCRA 3RZAA 4X3RA 4NGNA 1AMPA 3S9NA 3B35A 4A94A 4MHYA 5D8NA 2ZEPA 4C9AA 3SJXA 3GLJA 1HDQA 2PVWA 1ZG7A 3D4UA 4OKOA 2EWBA 3FH4A 3VTAA 4IK2A 4WJBA 1YW6A 3IFEA 1XBUA 1UWYA 1F2OA 3KQXA 4DJLA 4OC4A 4MMOA 5LYLA 3PB9X 2AFZA 1DTDA 2GLJA 4KNGE 2PJCA 5LRGA 2XEGA 5I4MA 3QNVA 3H8EA 3IJ3A 4ZX9A 4LQGA 5CPAA 4OC3A 4PQAA 3ICUA 4X2TA 4OC0A 3SI0A 1NSAA 4PXBA 2O53A 3KI9A 2ZEFA 2I3CA 5IB9A 1XMBA 4PXEA 4UEZA 4TNUA 2RFHA 1DE4C 3GUXA 3MN8A 4C84A 1XF1A 2G9DA 2PIYA 3H8FA 2ZEEA 2CTCA 1ZLHA 1R3NA 3SJGA 4PXCA 3D66A 2QVPA 3FEDA 3IWWA 4MCPA 3PRTA 1Y0RA 4NGPA 3CPXA 3PB4X 3RAMA 2PJ9A 2HB6A 2ZEDA 1Z5RA 3K2KA 4P6YA 4P44A 2IQ6A 5JGFA 4NGSA 3N5FA 1Q7LA 3NH4A 4G1PA 1VHOA 5LRKA 5CBMA 2PE3A 3L2NA 3B3TA 2HC9A 2F8HA 2F7VA 2V77A 3LWUA 3VH9A 4ZY2A 2ZENA 2PVVA 5F09A 2GLFA 4YN3A 3WC7A 2PJ3A 3SJEA 1BAVA 3TX8A 1TKFA 1F2PA 1V6CA 2C6GA 2EK8A 2JEWA 1TF8A 2J9AA 4WWVA 4NGRA 2AFUA 3BHXA 4UEEA 3B3CA 2PJ1A 3KZWA 4UF4A 4OMEA 3KHZA 4Q7AA 4P4JA 2BCOA 4GM5A 3I1UA 1BPMA 4X8IA 4MCQA 3TC8A 2O4HA 4NGTA 4OIWA 1GYTA 2Q43A 3ISZA 4FWUA 4P4DA 3MRUA 3DGVA 3IO1A 1VIXA 3NH8A 4R8FA 3D7DA 3PB8X 3V38A 4MHPA 1BPNA 4MHZA 1RTQA 3PB7X 2PJAA 4DUKA 2AFXA 1HEEA 3FJUA 1IY7A 2AFWA 1CP6A 1ZG8A 1Z8LA 5DS0A 4ZX8A 4C8PA 4NJRA 3WC6A 4C9EA 4DYOA 3FX6A 4C8TA 4P4BA 4C85A 5HVFA 3PBEA 2AFMA 2AFOA 4RUHA 5HVGA 2WZNA 3JRUA 1TF9A 2BO9A 4A37A 3PFOA 1CP7A 4ZY0A 5LRJA 3SI1A 1CX8A 2RB7A 3S9LA 4CDJA 2NSMA 1FNOA 5K8NA 3SJFA 4ZI6A 1CBXA 5K8PA 2WYRA 1WVMA 5HVHA 4OIDA 2JBJA 3IIBA 1AYEA 3FECA 4CPAA 3PFEA 3NH5A 2NYQA 4MCSA 2CTBA 4A39A 3FMCA 4C8UA 2PJBA 4C8CA 3KL9A 2PJ7A 1XJOA 1ARMA 2VL1A 2FVGA 3PBBA 2C6PA 5LYIA 4C9UA 4FUUA 2ZELA 3K9TA 1TKHA 1EE3P 4P45A 3FF3A 1CPXA 1F57A 5ELYA 2DEAA 4ONWA 3FVLA 3WT4A 4B6ZA 2ZOGA 3KR5A 3D7FA 2Q51A 1OBRA 1XFOA 2PJ2A 3B7IA 1ZG9A 4OC1A 1YSJA 1ARLA 4TJXA 3DLJA 2PJ0A 1JQGA 3D68A 3VATA 3B3SA 4CDKA 2C6CA 2C1CA 4A38A 2OR4A 1ELLP 5K8MA 2ANPA 4IAVA 4JYWA 2ZEOA 2ZOFA 5LYDA 4Z65A 2IMOA 2XEJA 1IGBA 1VHEA 2EK9A 3T8WA 5HXDA 3B3VA 3I6SA 1LAPA 1YMEA 4FAIA 4KSIA 3NA6A 3D67A 2V8VA 5JM6A 4F9UA 4OP4A 5THWA 1QQ9A 4W9YA 1Z2LA 1LAMA 3KHXA 4PPZA 4R6TA 4YWYA 4K3NA 4P4FA 8CPAA 4P4EA 4PXDA 3FEEA 4ZYQA 6CPAA 2PJ6A 4C8AA 4O23A 3IEHA 2OOTA 1BLLE 3NFZA 2QYVA 1CPSA 4MRIA 4NJQA 4BD9A 4C99A 3GB0A 3D7HA 2CIJA 1H8LA 3V7ZA 4C9RA 3HLPA 1LANA 1M4LA 2ABZA 4NGQA 2PJ8A
chains in the Genus database with same CATH superfamily
5JVLA 5LYFA 2R82A 4C9VA 4OADA 5JPHA 2FE7A 5BY0A 4U9ZA 4TJVA 1M4DA 4ORFA 5A28A 2PJ4A 4OC5A 4C68A 5IV0A 1LFWA 4TWEA 1S7NA 3CT9A 1Q2DA 4XNHB 1JDEA 2HI6A 4NF1A 2OU2A 2FIAA 4F8ZA 1YQEA 4EWTA 1VHSA 3SI2A 2DXQA 1QSOA 4UEFA 4COGA 4NGMA 4FBEA 3HPHE 2Z10A 4IUSA 4XPDC 3RBUA 1HDUA 1KWMA 4H89A 3WC5A 1GGOA 1VI4A 4YRHA 4P10A 5D29A 2QJ8A 4A30A 2OZUA 4YFJA 4AVBA 2AUMA 3S9MA 4KZTA 4R76A 3VWEA 2HROA 2O28A 2ZEGA 1YR0A 1Y0YA 1DIKA 4NFRA 2V8HA 3NE8A 4CAEA 1M6VB 4H6UA 4M85A 4R9MA 2ZW7A 4E2AA 4MJXA 4EMEA 3TLBA 1X12A 2XPPA 3SHPA 4DNCA 3TLZA 3EIFA 1RXTA 5F5XA 4QVTA 1YVHA 2PRQA 3BUWB 1Y7RA 1Y7EA 3H8GA 3IC1A 3BI1A 4UA3A 3TT2A 3TO9A 4JXRA 4MJ8A 1BOBA 2YNCC 2R98A 2V8DA 4HNXB 2XPNA 3VROA 5JH9A 3T9YA 2YJTA 4KLVA 2Q7SA 4FD4A 1LCPA 3B3WA 2CBLA 4C86A 3D7GA 4EFDA 4H2KA 1XRYA 5IR2A 3G8WA 2XEIA 3CPAA 1QSMA 2I00A 3PT1A 3CDXA 5DWMA 3T90A 2JBKA 2GREA 4UIAA 4F9VA 3TYXA 4PV6A 4MFPA 2EZCA 1YLEA 4C8FA 4NEXA 3IGRA 1R43A 3PEIA 1CS0B 3I74A 1XEBA 4OC2A 5K8OA 2ATRA 1XMTA 2ZEHA 3ISXA 3BUMB 3BUNB 1NE9A 1TXRA 3CXQA 2G3AA 1Z8XA 4CYQA 2N3AB 2PIZA 2PCUA 4KS9A 4JJXA 1Z9EA 3KQZA 2J8RA 4KSAA 1Y9ZA 2EO8A 2HV2A 2Q4VA 4R7MA 1Z4RA 3H4QA 4Q36A 3TOBA 1LOKA 2IJZA 5HKZA 2XPOA 5CNPA 4YU9A 1PCAA 4PK3A 1QMUA 3NOJA 1YLOA 4UIBA 3BI0A 4JZ0A 3FXTA 2V8GA 4KOSA 2DPSA 2KCWA 4YGOA 4L8AA 4U5YA 3KRVA 3BXMA 3PP9A 2Q4ZA 1GHEA 3DR6A 1FT7A 4IIYA 2BOAA 1KUYA 1S5KA 5KTDA 2POKA 2ZEMA 2PQ8A 4AXVA 1ELMP 3WABA 1PYTB 1R57A 1VGYA 1ZLIA 3HUVA 5EC4A 2PR8A 1QSNA 3VRQA 4GPLB 3O8ZA 4E5SA 5H84A 3R95A 1WWZA 2GIVA 3D8PA 2Q04A 3TLAA 1CE8B 3JTKA 3S6FA 3LD2A 1IOFA 2Z11A 1FY7A 1TKJA 4CZ1A 4AVAA 4BPXB 4IHMA 2EUIA 3DNSA 4HKFA 4MXUA 5H86A 5IX3A 5J1QA 4QUSA 4F0XA 1NSLA 4C2YA 1YW4A 4BPUB 1JDBC 2FSRA 4BINA 3KR4A 4KORA 4LQ6A 2AFSA 4BBHA 2PJ5A 2CF4A 2OZGA 3LMSA 2Z3LA 3B2YA 4ZY1A 3PB6X 3QAYA 1Y9WA 3G3SA 2XEFA 3KASA 4MHNA 4KSFA 1CG2A 2GU2A 3TE4A 2P6FA 4C8PA 1I21A 3KGQA 5AXIA 4P4IA 1LRZA 4KOUA 4B14A 1Z9UA 2B5GA 1IYKA 2ARHA 5F47A 3VARA 2E28A 1XOVA 4UCNA 3RO0A 4MCRA 1XE4A 3RZAA 4X3RA 2VXKA 4NGNA 2VEZA 3DSBA 3CZXA 4PSXA 1AMPA 4CGMA 3S9NA 3B35A 4AG7A 4CYOA 4A94A 2PSWA 1XIXA 1NBWA 1KC7A 4Q38A 1IICA 4MHYA 4COBA 3GJZA 3TLYA 5D8NA 3D2PA 2ZEPA 2NMTA 1P4NA 5EBVA 4C9AA 4OLLA 3SJXA 2Z3KA 3GLJA 7CPAA 1U6MA 1HDQA 5F1YA 3BJ8A 2PVWA 1ZG7A 3D4UA 5HH1A 1I1DA 3OAKA 4OKOA 2EWBA 3FH4A 5C82A 1MJ9A 1V0CA 1YVOA 4IK2A 3VTAA 4KOXA 4WJBA 4A31A 1YW6A 3I9SA 4QB9A 3DR8A 3EFAA 1T36B 3IFEA 3IWGA 1MK4A 1XBUA 3PZJA 1UWYA 2ZW6A 1F2OA 3CXPA 2GANA 4A95A 2B4BA 3KQXA 4DJLA 4OC4A 1M4GA 4MMOA 5J8FA 5LYLA 3PB9X 2AFZA 2B0AA 3LACA 1DTDA 2GLJA 3OB2B 2PRBA 2QMLA 4UFXA 4KNGE 2PJCA 3D2MA 4B10A 5LRGA 2XEGA 5I4MA 3QNVA 4XPDB 3H8EA 3IJ3A 4ZX9A 2YJVA 2BEIA 3FYNA 1SQHA 1M4IA 4LQGA 5CPAA 2ZW4A 5F9MA 4JVOA 4OC3A 4PQAA 4UBRA 3ICUA 2FS5A 4CGOA 4CRYB 4X2TA 3EZBA 4OC0A 2D4PA 3SI0A 4C7HA 4R3KA 5HMNA 4GXHA 1NSAA 4PXBA 5G20A 3F0AA 2O53A 3RYOA 2OLSA 3R9FA 3TLGB 3QAHA 4KVXA 3KI9A 2ZEFA 2I3CA 5IB9A 4MFZA 1XMBA 4PXEA 4UEZA 2B4DB 4TNUA 2RFHA 3FIXA 4HNWB 4A32A 2FL4A 4MY0A 2BUEA 1DE4C 3GUXA 3MN8A 4M6IA 4CYPA 3HMJG 5I0CA 4II9A 4C84A 1XF1A 4UWIA 2A4NA 2G9DA 5F46A 2JEVA 3SR3A 2PIYA 1ZYMA 4A2ZA 4A33A 2Y1MA 3H8FA 2ZEEA 3ZZIA 1K4JA 3FBUA 4CGNA 2CTCA 1ZLHA 1R3NA 2GFQA 3F8KA 5GCNA 3SJGA 4PXCA 2VQYA 3PGPA 2Q44A 3D66A 1C30B 2QVPA 4UFWA 4Y49B 3FEDA 3IWWA 4MCPA 3PRTA 1Y0RA 5C88A 2IL4A 4NGPA 3CPXA 5F48A 3PB4X 3ZNIA 5K99A 3RAMA 3VWDA 4F6AA 2PJ9A 1S3ZA 2HWGA 4ONUA 3GY9A 2HB6A 1VBHA 4R87A 3VRNA 2ZEDA 1Z5RA 3K2KA 4P6YA 4JXQA 3FRMA 4CAFA 4P44A 2IQ6A 2ODFA 5JGFA 4NGSA 3DDDA 3N5FA 1Q7LA 3NH4A 1IB1E 4MHDA 4PSWA 4G1PA 4NCZA 1VHOA 3W6XA 5LRKA 1ZO0A 1B87A 2R8VA 5CBMA 2PE3A 1A9XB 3LODA 3L2NA 4NSQA 3B3TA 3FB3A 4RR2B 2P0WA 2ZXVA 1X10A 3NFQA 5AG4A 2HC9A 3VGOA 2F8HA 1EZAA 2F7VA 5KTCA 1QSRA 3V8IA 2V77A 2AUNA 3ZJ0A 1FBVA 1YGHA 2WPWA 3LWUA 4A4CA 4ZY2A 3VH9A 1YK3A 2ZENA 4RN7A 2PVVA 1RO5A 2X7BA 3EO4A 5F09A 2GLFA 2Z3OA 3S6KA 4CO9A 4CGPA 2P6GA 2Q4YA 4YN3A 3WC7A 2CNTA 4BTFA 3EZAA 3TLEA 2PJ3A 3SJEA 1BAVA 4K30A 3TX8A 4CAVA 2GP4A 1TKFA 1F2PA 1V6CA 4MY3A 2C6GA 2EK8A 2JEWA 1M1DA 1TF8A 4BPWB 2J9AA 4NGRA 4KOVA 2AFUA 3BHXA 4UEEA 4WWVA 3B3CA 3IWEA 2X0SA 3TO7A 1KZFA 1L0CA 1MJBA 2PJ1A 3KZWA 4UF4A 4LX9A 4OMEA 3KHZA 4KUBA 4Q7AA 2UV8G 4L89A 4P4JA 3B8GA 2FT0A 3S6HA 2BCOA 2FIWA 2Y0MA 4GM5A 3I1UA 1BPMA 4X8IA 4MCQA 3BLNA 3T5MA 4R3LA 3TC8A 3BUXB 3VRPA 2O4HA 4NGTA 5F13A 2AJ6A 2H5MA 4OIWA 1GYTA 2BL1A 2Q43A 3ISZA 4FWUA 2YNCA 4P4DA 3MRUA 4LUAA 3DGVA 3IO1A 1VIXA 3NH8A 4R8FA 3D7DA 2VI7A 4J3GA 5AG5A 3P2HA 4MBUA 4RI1A 2J8NA 3PB8X 4PK2A 3V38A 2Z3MA 4MHPA 1R61A 3G23A 3TLCA 2QECA 2WSAA 1BPNA 4MHZA 4XPKA 4IIXA 1RTQA 3PB7X 2PJAA 4DUKA 1S7FA 1C3OB 2AFXA 1HEEA 5AGEA 4C2ZA 2Q0YA 4CGLA 3FJUA 1IY7A 3VRRA 3BUOB 2AFWA 1CP6A 4HPSA 1QSTA 1Z4EA 1ZG8A 4OAEA 1Z8LA 1VBGA 2G3TA 3P2FA 5DS0A 4ZX8A 4NJRA 5DWNA 1IOIA 3WC6A 4INJA 4M6GA 4C9EA 4DYOA 4BMHA 3FX6A 1Y9KA 4C8TA 4NXYA 4P4BA 1J4JA 4C85A 3R9GA 2ZW5A 4EVYA 4E8OA 1B47A 5HVFA 3PBEA 1Q5XA 1A2ZA 2AFMA 4M3SA 2AFOA 1ZRSA 2HQYA 2R7HA 4RUHA 3OP0A 5HVGA 4E94A 2CXAA 1ZL0A 2BSWA 2WZNA 3JRUA 4A4BA 1TF9A 1IIDA 4E0AA 2D0PA 3GYAA 4XNHC 1Q2CA 4KVOE 1PUAA 5J3XA 4KVME 3RNZA 2BO9A 3A9LA 5ISVA 3TTHA 1MJAA 4A37A 4KOTA 3PFOA 1CP7A 4B12A 2OH1A 4ZY0A 2I79A 5LRJA 3HPGG 1BO4A 3IU2A 4FD5A 4QC6A 4X5KA 1PU9A 3SI1A 4CAXA 4J0NA 4ZBGA 5F49A 1CX8A 2RB7A 3EC4A 3S9LA 2JLMA 3W91A 4CDJA 2NSMA 1FNOA 5K8NA 1J3LA 3SJFA 4ZI6A 4B5PB 1CBXA 5K8PA 3GKRA 4GS4A 4UCMA 2MP0A 2WYRA 3S6GA 1WVMA 5HVHA 4EYSA 2DF5A 3K9UA 4OIDA 2P6EA 4C2XA 5BWAB 1ON0A 3N7ZA 5KTAA 4MI4A 4UWJA 2JBJA 3K4IA 2EZAA 3IIBA 2OZHA 1P0HA 1YREA 1AYEA 2EZBA 3FECA 4H6ZA 1S7LA 3D3SA 4CRZB 3GIUA 1KEEB 2YNEA 4IF5A 4MFQA 2YGWA 3R1KA 4FD6A 3PFEA 1KUVA 2QIRA 4CPAA 5HKWA 1XF8A 2NYQA 3NH5A 2VBQA 4MCSA 4R57A 2CTBA 2RC4A 5JYBA 4A39A 3FMCA 1YX0A 4C8UA 2PJBA 3KKWA 4XPLA 2FCKA 4C8CA 3KL9A 2PJ7A 1XJOA 5FD8A 1ARMA 1CM0A 2WUUA 2DPTA 2VL1A 2B5GB 2FVGA 5J8CA 4M6HA 5AG7A 1UFHA 5G21A 1WK4A 4JD6A 1AUGA 1IU8A 3PBBA 2C6PA 5LYIA 4JLYA 2VKZG 4C9UA 4C7IA 2Z3PA 3JUWA 4FUUA 2ZELA 4AB7A 4FD7A 2JDDA 3K9TA 4Y49C 1TKHA 3IU1A 1EE3P 4AVCA 3C8OA 3FF3A 4P45A 1CPXA 4UFVA 1F57A 5ELYA 2DEAA 4ONWA 3FVLA 4RS2A 3WT4A 4B6ZA 1IYLA 2CNMA 2ZOGA 2VZZA 3SXOA 3W6SA 4UCPA 4CS0B 1WJTA 1N71A 2CY2A 3T07A 4JWPA 4MFKA 3KR5A 3D7FA 1KUXA 3TCVA 3WR7A 3TFYA 2B3UA 2Q51A 1OBRA 1XFOA 2EBJA 1Q2YA 4MFLA 2Z0ZA 3I3GA 5G22A 2PJ2A 2EVNA 3B7IA 1ZG9A 2AE6A 4OC1A 1M44A 1B6BA 1VKCA 1YSJA 2PR1A 3OB1B 1ARLA 2JDCA 3JVNA 4QBJA 3EZEA 3OWCA 4TJXA 2REFA 3DLJA 4HNYB 4M8DA 5A27A 1BXRB 3F9KC 2PJ0A 2FXFA 1JQGA 3D68A 3VATA 2PDOA 2ZPAA 3B3SA 1OZPA 1Z8WA 4CDKA 2C6CA 2C1CA 2WPXA 4A38A 3C26A 2Y1NA 2PC1A 2OR4A 4U9YA 3TLGA 1ELLP 1KBLA 1I12A 2R1IA 4B5PA 5K8MA 4ZGYB 3FNCA 1CJWA 4CYNA 4MI1A 2ANPA 4IAVA 4JYWA 3SXNA 2B4DA 2DLAA 3R9EA 3U1BA 2J8MA 2ZEOA 2ZOFA 5LYDA 3H5ZA 1S60A 3UY5A 4B5OA 4Z65A 2D0OA 2D4OA 2IMOA 2XEJA 2XPLA 4H1HA 1IGBA 1VHEA 2F5IA 3PLFB 2EK9A 5AG6A 4KLWA 5FVJA 1YVKA 1EZBA 4KOYA 4KOWA 3B3VA 3T8WA 3E0KA 3TO6A 1LAPA 5HXDA 3U88C 3I6SA 4CAWA 1YMEA 4FAIA 2B3VA 4KSIA 2VZYA 3D67A 3NA6A 3T0TA 5E96A 4AG9A 2V8VA 1JWQA 5JM6A 3F5BA 3T05A 4F9UA 5JQ4A 4OP4A 1NMTA 2CNSA 5G1ZA 5THWA 2REEA 5IB0A 1QQ9A 2GE3A 4W9YA 3TOAA 2Q7BA 1Z2LA 1LAMA 3KHXA 4PPZA 4R6TA 4I49A 4B13A 4YWYA 4KUAA 4K3NA 4F0YA 4P4FA 8CPAA 5EMIA 4P4EA 3QB8A 4PXDA 3FEEA 4MFJA 3MGDA 3PFVA 4ZYQA 2B58A 2G0BA 2PJ6A 2Z3NA 6CPAA 4C8AA 4O23A 3EY5A 1TIQA 3IEHA 3BJ7A 2DIKA 2PCNA 2OOTA 1BLLE 2K5TA 3NFZA 2C5QA 2QYVA 1CPSA 3EXNA 2B4JC 3NE7A 4MRIA 4NJQA 4BD9A 2OB0A 4C99A 3GB0A 3D7HA 2CIJA 1H8LA 2C27A 2HUZA 3R96A 5HKYA 3V7ZA 1NXJA 2FM4A 1EO0A 3CXSA 4C9RA 1Z8TA 3HLPA 2YNDA 1LANA 1M4LA 2ABZA 4NGQA 1S7KA 4B11A 2PJ8A
chains in the Genus database with same CATH topology
5LYFA 4C9VA 4TJVA 2PJ4A 4OC5A 1LFWA 4TWEA 3CT9A 4F8ZA 4EWTA 3SI2A 4UEFA 4NGMA 4FBEA 3RBUA 1HDUA 1KWMA 3WC5A 4P10A 5D29A 2QJ8A 3S9MA 4R76A 2ZEGA 1Y0YA 4NFRA 2V8HA 4EMEA 3EIFA 2PRQA 3H8GA 1Y7EA 3IC1A 3BI1A 2V8DA 5JH9A 1LCPA 3B3WA 4C86A 3D7GA 4EFDA 4H2KA 1XRYA 5IR2A 2XEIA 3CPAA 3CDXA 2JBKA 2GREA 4UIAA 4F9VA 4C8FA 1R43A 3PEIA 3I74A 4OC2A 5K8OA 2ZEHA 3ISXA 1TXRA 2PIZA 2PCUA 3KQZA 1Y9ZA 4R7MA 1LOKA 2IJZA 4YU9A 1PCAA 1QMUA 1YLOA 4UIBA 3BI0A 4JZ0A 2V8GA 3BXMA 2Q4ZA 1FT7A 2BOAA 2POKA 2ZEMA 4AXVA 1ELMP 3WABA 1PYTB 1VGYA 1ZLIA 3HUVA 7CPAA 1TKJA 4IHMA 4MXUA 5J1QA 1YW4A 3KR4A 2AFSA 2PJ5A 2CF4A 3LMSA 3B2YA 4ZY1A 3PB6X 2XEFA 3KASA 4MHNA 1CG2A 2GU2A 3KGQA 4P4IA 3VARA 4MCRA 3RZAA 4X3RA 4NGNA 1AMPA 3S9NA 3B35A 4A94A 4MHYA 5D8NA 2ZEPA 4C9AA 3SJXA 3GLJA 1HDQA 2PVWA 1ZG7A 3D4UA 4OKOA 2EWBA 3FH4A 3VTAA 4IK2A 4WJBA 1YW6A 3IFEA 1XBUA 1UWYA 1F2OA 3KQXA 4DJLA 4OC4A 4MMOA 5LYLA 3PB9X 2AFZA 1DTDA 2GLJA 4KNGE 2PJCA 5LRGA 2XEGA 5I4MA 3QNVA 3H8EA 3IJ3A 4ZX9A 4LQGA 5CPAA 4OC3A 4PQAA 3ICUA 4X2TA 4OC0A 3SI0A 1NSAA 4PXBA 2O53A 3KI9A 2ZEFA 2I3CA 5IB9A 1XMBA 4PXEA 4UEZA 4TNUA 2RFHA 1DE4C 3GUXA 3MN8A 4C84A 1XF1A 2G9DA 2PIYA 3H8FA 2ZEEA 2CTCA 1ZLHA 1R3NA 3SJGA 4PXCA 3D66A 2QVPA 3FEDA 3IWWA 4MCPA 3PRTA 1Y0RA 4NGPA 3CPXA 3PB4X 3RAMA 2PJ9A 2HB6A 2ZEDA 1Z5RA 3K2KA 4P6YA 4P44A 2IQ6A 5JGFA 4NGSA 3N5FA 1Q7LA 3NH4A 4G1PA 1VHOA 5LRKA 5CBMA 2PE3A 3L2NA 3B3TA 2HC9A 2F8HA 2F7VA 2V77A 3LWUA 3VH9A 4ZY2A 2ZENA 2PVVA 5F09A 2GLFA 4YN3A 3WC7A 2PJ3A 3SJEA 1BAVA 3TX8A 2GP4A 1TKFA 1F2PA 1V6CA 2C6GA 2EK8A 2JEWA 1TF8A 2J9AA 4WWVA 4NGRA 2AFUA 3BHXA 4UEEA 3B3CA 2PJ1A 3KZWA 4UF4A 4OMEA 3KHZA 4Q7AA 4P4JA 2BCOA 4GM5A 3I1UA 1BPMA 4X8IA 4MCQA 3TC8A 2O4HA 4NGTA 4OIWA 1GYTA 2Q43A 3ISZA 4FWUA 4P4DA 3MRUA 3DGVA 3IO1A 1VIXA 3NH8A 4R8FA 3D7DA 3PB8X 3V38A 4MHPA 1BPNA 4MHZA 1RTQA 3PB7X 2PJAA 4DUKA 2AFXA 1HEEA 3FJUA 1IY7A 2AFWA 1CP6A 1ZG8A 1Z8LA 5DS0A 4ZX8A 4C8PA 4NJRA 3WC6A 4C9EA 4DYOA 3FX6A 4C8TA 4P4BA 4C85A 5HVFA 3PBEA 2AFMA 2AFOA 4RUHA 5HVGA 2WZNA 3JRUA 1TF9A 2BO9A 4A37A 3PFOA 1CP7A 4ZY0A 5LRJA 3SI1A 1CX8A 2RB7A 3S9LA 4CDJA 2NSMA 1FNOA 5K8NA 3SJFA 4ZI6A 1CBXA 5K8PA 2WYRA 1WVMA 5HVHA 4OIDA 2JBJA 3IIBA 1AYEA 3FECA 4CPAA 3PFEA 3NH5A 2NYQA 4MCSA 2CTBA 4A39A 3FMCA 4C8UA 2PJBA 4C8CA 3KL9A 2PJ7A 1XJOA 1ARMA 2VL1A 2FVGA 3PBBA 2C6PA 5LYIA 4C9UA 4FUUA 2ZELA 3K9TA 1TKHA 1EE3P 4P45A 3FF3A 1CPXA 1F57A 5ELYA 2DEAA 4ONWA 3FVLA 3WT4A 4B6ZA 2ZOGA 3KR5A 3D7FA 2Q51A 1OBRA 1XFOA 2PJ2A 3B7IA 1ZG9A 4OC1A 1YSJA 1ARLA 4TJXA 3DLJA 2PJ0A 1JQGA 3D68A 3VATA 3B3SA 4CDKA 2C6CA 2C1CA 4A38A 2OR4A 1ELLP 5K8MA 2ANPA 4IAVA 4JYWA 2ZEOA 2ZOFA 5LYDA 4Z65A 2IMOA 2XEJA 1IGBA 1VHEA 2EK9A 3T8WA 5HXDA 3B3VA 3I6SA 1LAPA 1YMEA 4FAIA 4KSIA 3NA6A 3D67A 2V8VA 5JM6A 4F9UA 4OP4A 5THWA 1QQ9A 4W9YA 1Z2LA 1LAMA 3KHXA 4PPZA 4R6TA 4YWYA 4K3NA 4P4FA 8CPAA 4P4EA 4PXDA 3FEEA 4ZYQA 6CPAA 2PJ6A 4C8AA 4O23A 3IEHA 2OOTA 1BLLE 3NFZA 2C5QA 2QYVA 1CPSA 4MRIA 4NJQA 4BD9A 4C99A 3GB0A 3D7HA 2CIJA 1H8LA 3V7ZA 4C9RA 3HLPA 1LANA 1M4LA 2ABZA 4NGQA 2PJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LYF A;  4C9V A;  4TJV A;  2PJ4 A;  4OC5 A;  1LFW A;  4TWE A;  3CT9 A;  4F8Z A;  4EWT A;  3SI2 A;  4UEF A;  4NGM A;  4FBE A;  3RBU A;  1HDU A;  1KWM A;  3WC5 A;  4P10 A;  5D29 A;  2QJ8 A;  3S9M A;  4R76 A;  2ZEG A;  1Y0Y A;  4NFR A;  2V8H A;  4EME A;  3EIF A;  2PRQ A;  3H8G A;  1Y7E A;  3IC1 A;  3BI1 A;  2V8D A;  5JH9 A;  1LCP A;  3B3W A;  4C86 A;  3D7G A;  4EFD A;  4H2K A;  1XRY A;  2XEI A;  3CPA A;  3CDX A;  2JBK A;  2GRE A;  4UIA A;  4F9V A;  4C8F A;  1R43 A;  3PEI A;  3I74 A;  4OC2 A;  5K8O A;  2ZEH A;  3ISX A;  1TXR A;  2PIZ A;  2PCU A;  3KQZ A;  1Y9Z A;  4R7M A;  1LOK A;  2IJZ A;  4YU9 A;  1PCA A;  1QMU A;  1YLO A;  4UIB A;  3BI0 A;  4JZ0 A;  2V8G A;  3BXM A;  2Q4Z A;  1FT7 A;  2BOA A;  2POK A;  2ZEM A;  4AXV A;  1ELM P;  3WAB A;  1PYT B;  1VGY A;  1ZLI A;  3HUV A;  7CPA A;  1TKJ A;  4IHM A;  4MXU A;  5J1Q A;  1YW4 A;  3KR4 A;  2AFS A;  2PJ5 A;  2CF4 A;  3LMS A;  3B2Y A;  4ZY1 A;  3PB6 X;  2XEF A;  3KAS A;  4MHN A;  1CG2 A;  2GU2 A;  3KGQ A;  4P4I A;  3VAR A;  4MCR A;  3RZA A;  4X3R A;  4NGN A;  1AMP A;  3S9N A;  3B35 A;  4A94 A;  4MHY A;  5D8N A;  2ZEP A;  4C9A A;  3SJX A;  3GLJ A;  1HDQ A;  2PVW A;  1ZG7 A;  3D4U A;  4OKO A;  2EWB A;  3FH4 A;  3VTA A;  4IK2 A;  4WJB A;  1YW6 A;  3IFE A;  1XBU A;  1UWY A;  1F2O A;  3KQX A;  4DJL A;  4OC4 A;  4MMO A;  5LYL A;  3PB9 X;  2AFZ A;  1DTD A;  2GLJ A;  4KNG E;  2PJC A;  5LRG A;  2XEG A;  5I4M A;  3QNV A;  3H8E A;  3IJ3 A;  4ZX9 A;  4LQG A;  5CPA A;  4OC3 A;  4PQA A;  3ICU A;  4X2T A;  4OC0 A;  3SI0 A;  1NSA A;  4PXB A;  2O53 A;  3KI9 A;  2ZEF A;  2I3C A;  5IB9 A;  1XMB A;  4PXE A;  4UEZ A;  4TNU A;  2RFH A;  1DE4 C;  3GUX A;  3MN8 A;  4C84 A;  1XF1 A;  2G9D A;  2PIY A;  3H8F A;  2ZEE A;  2CTC A;  1ZLH A;  1R3N A;  3SJG A;  4PXC A;  3D66 A;  2QVP A;  3FED A;  3IWW A;  4MCP A;  3PRT A;  1Y0R A;  4NGP A;  3CPX A;  3PB4 X;  3RAM A;  2PJ9 A;  2HB6 A;  2ZED A;  1Z5R A;  3K2K A;  4P6Y A;  4P44 A;  2IQ6 A;  5JGF A;  4NGS A;  3N5F A;  1Q7L A;  3NH4 A;  4G1P A;  1VHO A;  5LRK A;  5CBM A;  2PE3 A;  3L2N A;  3B3T A;  2HC9 A;  2F8H A;  2F7V A;  2V77 A;  3LWU A;  3VH9 A;  4ZY2 A;  2ZEN A;  2PVV A;  5F09 A;  2GLF A;  4YN3 A;  3WC7 A;  2PJ3 A;  3SJE A;  1BAV A;  3TX8 A;  1TKF A;  1F2P A;  1V6C A;  2C6G A;  2EK8 A;  2JEW A;  1TF8 A;  2J9A A;  4WWV A;  4NGR A;  2AFU A;  3BHX A;  4UEE A;  3B3C A;  2PJ1 A;  3KZW A;  4UF4 A;  4OME A;  3KHZ A;  4Q7A A;  4P4J A;  2BCO A;  4GM5 A;  3I1U A;  1BPM A;  4X8I A;  4MCQ A;  3TC8 A;  2O4H A;  4NGT A;  4OIW A;  1GYT A;  2Q43 A;  3ISZ A;  4FWU A;  4P4D A;  3MRU A;  3DGV A;  3IO1 A;  1VIX A;  3NH8 A;  4R8F A;  3D7D A;  3PB8 X;  3V38 A;  4MHP A;  1BPN A;  4MHZ A;  1RTQ A;  3PB7 X;  2PJA A;  4DUK A;  2AFX A;  1HEE A;  3FJU A;  1IY7 A;  2AFW A;  1CP6 A;  1ZG8 A;  1Z8L A;  5DS0 A;  4ZX8 A;  4C8P A;  4NJR A;  3WC6 A;  4C9E A;  4DYO A;  3FX6 A;  4C8T A;  4P4B A;  4C85 A;  5HVF A;  3PBE A;  2AFM A;  2AFO A;  4RUH A;  5HVG A;  2WZN A;  3JRU A;  1TF9 A;  2BO9 A;  4A37 A;  3PFO A;  1CP7 A;  4ZY0 A;  5LRJ A;  3SI1 A;  1CX8 A;  2RB7 A;  3S9L A;  4CDJ A;  2NSM A;  1FNO A;  5K8N A;  3SJF A;  4ZI6 A;  1CBX A;  5K8P A;  2WYR A;  1WVM A;  5HVH A;  4OID A;  2JBJ A;  3IIB A;  1AYE A;  3FEC A;  4CPA A;  3PFE A;  3NH5 A;  2NYQ A;  4MCS A;  2CTB A;  4A39 A;  3FMC A;  4C8U A;  2PJB A;  4C8C A;  3KL9 A;  2PJ7 A;  1XJO A;  1ARM A;  2VL1 A;  2FVG A;  3PBB A;  2C6P A;  5LYI A;  4C9U A;  4FUU A;  2ZEL A;  3K9T A;  1TKH A;  1EE3 P;  4P45 A;  3FF3 A;  1CPX A;  1F57 A;  5ELY A;  2DEA A;  4ONW A;  3FVL A;  3WT4 A;  4B6Z A;  2ZOG A;  3KR5 A;  3D7F A;  2Q51 A;  1OBR A;  1XFO A;  2PJ2 A;  3B7I A;  1ZG9 A;  4OC1 A;  1YSJ A;  1ARL A;  4TJX A;  3DLJ A;  2PJ0 A;  1JQG A;  3D68 A;  3VAT A;  3B3S A;  4CDK A;  2C6C A;  2C1C A;  4A38 A;  2OR4 A;  1ELL P;  5K8M A;  2ANP A;  4IAV A;  4JYW A;  2ZEO A;  2ZOF A;  5LYD A;  4Z65 A;  2IMO A;  2XEJ A;  1IGB A;  1VHE A;  2EK9 A;  3T8W A;  5HXD A;  3B3V A;  3I6S A;  1LAP A;  1YME A;  4FAI A;  4KSI A;  3NA6 A;  3D67 A;  2V8V A;  5JM6 A;  4F9U A;  4OP4 A;  5THW A;  1QQ9 A;  4W9Y A;  1Z2L A;  1LAM A;  3KHX A;  4PPZ A;  4R6T A;  4YWY A;  4K3N A;  4P4F A;  8CPA A;  4P4E A;  4PXD A;  3FEE A;  4ZYQ A;  6CPA A;  2PJ6 A;  4C8A A;  4O23 A;  3IEH A;  2OOT A;  1BLL E;  3NFZ A;  2QYV A;  1CPS A;  4MRI A;  4NJQ A;  4BD9 A;  4C99 A;  3GB0 A;  3D7H A;  2CIJ A;  1H8L A;  3V7Z A;  4C9R A;  3HLP A;  1LAN A;  1M4L A;  2ABZ A;  4NGQ A;  2PJ8 A; 
#chains in the Genus database with same CATH topology
 5JVL A;  5LYF A;  2R82 A;  4C9V A;  4OAD A;  5JPH A;  2FE7 A;  5BY0 A;  4U9Z A;  4TJV A;  1M4D A;  4ORF A;  5A28 A;  2PJ4 A;  4OC5 A;  4C68 A;  5IV0 A;  1LFW A;  4TWE A;  1S7N A;  3CT9 A;  1Q2D A;  4XNH B;  1JDE A;  2HI6 A;  4NF1 A;  2OU2 A;  2FIA A;  4F8Z A;  1YQE A;  4EWT A;  1VHS A;  3SI2 A;  2DXQ A;  1QSO A;  4UEF A;  4COG A;  4NGM A;  4FBE A;  3HPH E;  2Z10 A;  4IUS A;  4XPD C;  3RBU A;  1HDU A;  1KWM A;  4H89 A;  3WC5 A;  1GGO A;  1VI4 A;  4YRH A;  4P10 A;  5D29 A;  2QJ8 A;  4A30 A;  2OZU A;  4YFJ A;  4AVB A;  2AUM A;  3S9M A;  4KZT A;  4R76 A;  3VWE A;  2HRO A;  2O28 A;  2ZEG A;  1YR0 A;  1Y0Y A;  1DIK A;  4NFR A;  2V8H A;  3NE8 A;  4CAE A;  1M6V B;  4H6U A;  4M85 A;  4R9M A;  2ZW7 A;  4E2A A;  4MJX A;  4EME A;  3TLB A;  1X12 A;  2XPP A;  3SHP A;  4DNC A;  3TLZ A;  3EIF A;  1RXT A;  5F5X A;  4QVT A;  1YVH A;  2PRQ A;  3BUW B;  1Y7R A;  1Y7E A;  3H8G A;  3IC1 A;  3BI1 A;  4UA3 A;  3TT2 A;  3TO9 A;  4JXR A;  4MJ8 A;  1BOB A;  2YNC C;  2R98 A;  2V8D A;  4HNX B;  2XPN A;  3VRO A;  5JH9 A;  3T9Y A;  2YJT A;  4KLV A;  2Q7S A;  4FD4 A;  1LCP A;  3B3W A;  2CBL A;  4C86 A;  3D7G A;  4EFD A;  4H2K A;  1XRY A;  5IR2 A;  3G8W A;  2XEI A;  3CPA A;  1QSM A;  2I00 A;  3PT1 A;  3CDX A;  5DWM A;  3T90 A;  2JBK A;  2GRE A;  4UIA A;  4F9V A;  3TYX A;  4PV6 A;  4MFP A;  2EZC A;  1YLE A;  4C8F A;  4NEX A;  3IGR A;  1R43 A;  3PEI A;  1CS0 B;  3I74 A;  1XEB A;  4OC2 A;  5K8O A;  2ATR A;  1XMT A;  2ZEH A;  3ISX A;  3BUM B;  3BUN B;  1NE9 A;  1TXR A;  3CXQ A;  2G3A A;  1Z8X A;  4CYQ A;  2N3A B;  2PIZ A;  2PCU A;  4KS9 A;  4JJX A;  1Z9E A;  3KQZ A;  2J8R A;  4KSA A;  1Y9Z A;  2EO8 A;  2HV2 A;  2Q4V A;  4R7M A;  1Z4R A;  3H4Q A;  4Q36 A;  3TOB A;  1LOK A;  2IJZ A;  5HKZ A;  2XPO A;  5CNP A;  4YU9 A;  1PCA A;  4PK3 A;  1QMU A;  3NOJ A;  1YLO A;  4UIB A;  3BI0 A;  4JZ0 A;  3FXT A;  2V8G A;  4KOS A;  2DPS A;  2KCW A;  4YGO A;  4L8A A;  4U5Y A;  3KRV A;  3BXM A;  3PP9 A;  2Q4Z A;  1GHE A;  3DR6 A;  1FT7 A;  4IIY A;  2BOA A;  1KUY A;  1S5K A;  5KTD A;  2POK A;  2ZEM A;  2PQ8 A;  4AXV A;  1ELM P;  3WAB A;  1PYT B;  1R57 A;  1VGY A;  1ZLI A;  3HUV A;  5EC4 A;  2PR8 A;  1QSN A;  3VRQ A;  4GPL B;  3O8Z A;  4E5S A;  5H84 A;  3R95 A;  1WWZ A;  2GIV A;  3D8P A;  2Q04 A;  3TLA A;  1CE8 B;  3JTK A;  3S6F A;  3LD2 A;  1IOF A;  2Z11 A;  1FY7 A;  1TKJ A;  4CZ1 A;  4AVA A;  4BPX B;  4IHM A;  2EUI A;  3DNS A;  4HKF A;  4MXU A;  5H86 A;  5IX3 A;  5J1Q A;  4QUS A;  4F0X A;  1NSL A;  4C2Y A;  1YW4 A;  4BPU B;  1JDB C;  2FSR A;  4BIN A;  3KR4 A;  4KOR A;  4LQ6 A;  2AFS A;  4BBH A;  2PJ5 A;  2CF4 A;  2OZG A;  3LMS A;  2Z3L A;  3B2Y A;  4ZY1 A;  3PB6 X;  3QAY A;  1Y9W A;  3G3S A;  2XEF A;  3KAS A;  4MHN A;  4KSF A;  1CG2 A;  2GU2 A;  3TE4 A;  2P6F A;  4C8P A;  1I21 A;  3KGQ A;  5AXI A;  4P4I A;  1LRZ A;  4KOU A;  4B14 A;  1Z9U A;  2B5G A;  1IYK A;  2ARH A;  5F47 A;  3VAR A;  2E28 A;  1XOV A;  4UCN A;  3RO0 A;  4MCR A;  1XE4 A;  3RZA A;  4X3R A;  2VXK A;  4NGN A;  2VEZ A;  3DSB A;  3CZX A;  4PSX A;  1AMP A;  4CGM A;  3S9N A;  3B35 A;  4AG7 A;  4CYO A;  4A94 A;  2PSW A;  1XIX A;  1NBW A;  1KC7 A;  4Q38 A;  1IIC A;  4MHY A;  4COB A;  3GJZ A;  3TLY A;  5D8N A;  3D2P A;  2ZEP A;  2NMT A;  1P4N A;  5EBV A;  4C9A A;  4OLL A;  3SJX A;  2Z3K A;  3GLJ A;  7CPA A;  1U6M A;  1HDQ A;  5F1Y A;  3BJ8 A;  2PVW A;  1ZG7 A;  3D4U A;  5HH1 A;  1I1D A;  3OAK A;  4OKO A;  2EWB A;  3FH4 A;  5C82 A;  1MJ9 A;  1V0C A;  1YVO A;  4IK2 A;  3VTA A;  4KOX A;  4WJB A;  4A31 A;  1YW6 A;  3I9S A;  4QB9 A;  3DR8 A;  3EFA A;  1T36 B;  3IFE A;  3IWG A;  1MK4 A;  1XBU A;  3PZJ A;  1UWY A;  2ZW6 A;  1F2O A;  3CXP A;  2GAN A;  4A95 A;  2B4B A;  3KQX A;  4DJL A;  4OC4 A;  1M4G A;  4MMO A;  5J8F A;  5LYL A;  3PB9 X;  2AFZ A;  2B0A A;  3LAC A;  1DTD A;  2GLJ A;  3OB2 B;  2PRB A;  2QML A;  4UFX A;  4KNG E;  2PJC A;  3D2M A;  4B10 A;  5LRG A;  2XEG A;  5I4M A;  3QNV A;  4XPD B;  3H8E A;  3IJ3 A;  4ZX9 A;  2YJV A;  2BEI A;  3FYN A;  1SQH A;  1M4I A;  4LQG A;  5CPA A;  2ZW4 A;  5F9M A;  4JVO A;  4OC3 A;  4PQA A;  4UBR A;  3ICU A;  2FS5 A;  4CGO A;  4CRY B;  4X2T A;  3EZB A;  4OC0 A;  2D4P A;  3SI0 A;  4C7H A;  4R3K A;  5HMN A;  4GXH A;  1NSA A;  4PXB A;  5G20 A;  3F0A A;  2O53 A;  3RYO A;  2OLS A;  3R9F A;  3TLG B;  3QAH A;  4KVX A;  3KI9 A;  2ZEF A;  2I3C A;  5IB9 A;  4MFZ A;  1XMB A;  4PXE A;  4UEZ A;  2B4D B;  4TNU A;  2RFH A;  3FIX A;  4HNW B;  4A32 A;  2FL4 A;  4MY0 A;  2BUE A;  1DE4 C;  3GUX A;  3MN8 A;  4M6I A;  4CYP A;  3HMJ G;  5I0C A;  4II9 A;  4C84 A;  1XF1 A;  4UWI A;  2A4N A;  2G9D A;  5F46 A;  2JEV A;  3SR3 A;  2PIY A;  1ZYM A;  4A2Z A;  4A33 A;  2Y1M A;  3H8F A;  2ZEE A;  3ZZI A;  1K4J A;  3FBU A;  4CGN A;  2CTC A;  1ZLH A;  1R3N A;  2GFQ A;  3F8K A;  5GCN A;  3SJG A;  4PXC A;  2VQY A;  3PGP A;  2Q44 A;  3D66 A;  1C30 B;  2QVP A;  4UFW A;  4Y49 B;  3FED A;  3IWW A;  4MCP A;  3PRT A;  1Y0R A;  5C88 A;  2IL4 A;  4NGP A;  3CPX A;  5F48 A;  3PB4 X;  3ZNI A;  5K99 A;  3RAM A;  3VWD A;  4F6A A;  2PJ9 A;  1S3Z A;  2HWG A;  4ONU A;  3GY9 A;  2HB6 A;  1VBH A;  4R87 A;  3VRN A;  2ZED A;  1Z5R A;  3K2K A;  4P6Y A;  4JXQ A;  3FRM A;  4CAF A;  4P44 A;  2IQ6 A;  2ODF A;  5JGF A;  4NGS A;  3DDD A;  3N5F A;  1Q7L A;  3NH4 A;  1IB1 E;  4MHD A;  4PSW A;  4G1P A;  4NCZ A;  1VHO A;  3W6X A;  5LRK A;  1ZO0 A;  1B87 A;  2R8V A;  5CBM A;  2PE3 A;  1A9X B;  3LOD A;  3L2N A;  4NSQ A;  3B3T A;  3FB3 A;  4RR2 B;  2P0W A;  2ZXV A;  1X10 A;  3NFQ A;  5AG4 A;  2HC9 A;  3VGO A;  2F8H A;  1EZA A;  2F7V A;  5KTC A;  1QSR A;  3V8I A;  2V77 A;  2AUN A;  3ZJ0 A;  1FBV A;  1YGH A;  2WPW A;  3LWU A;  4A4C A;  4ZY2 A;  3VH9 A;  1YK3 A;  2ZEN A;  4RN7 A;  2PVV A;  1RO5 A;  2X7B A;  3EO4 A;  5F09 A;  2GLF A;  2Z3O A;  3S6K A;  4CO9 A;  4CGP A;  2P6G A;  2Q4Y A;  4YN3 A;  3WC7 A;  2CNT A;  4BTF A;  3EZA A;  3TLE A;  2PJ3 A;  3SJE A;  1BAV A;  4K30 A;  3TX8 A;  4CAV A;  2GP4 A;  1TKF A;  1F2P A;  1V6C A;  4MY3 A;  2C6G A;  2EK8 A;  2JEW A;  1M1D A;  1TF8 A;  4BPW B;  2J9A A;  4NGR A;  4KOV A;  2AFU A;  3BHX A;  4UEE A;  4WWV A;  3B3C A;  3IWE A;  2X0S A;  3TO7 A;  1KZF A;  1L0C A;  1MJB A;  2PJ1 A;  3KZW A;  4UF4 A;  4LX9 A;  4OME A;  3KHZ A;  4KUB A;  4Q7A A;  2UV8 G;  4L89 A;  4P4J A;  3B8G A;  2FT0 A;  3S6H A;  2BCO A;  2FIW A;  2Y0M A;  4GM5 A;  3I1U A;  1BPM A;  4X8I A;  4MCQ A;  3BLN A;  3T5M A;  4R3L A;  3TC8 A;  3BUX B;  3VRP A;  2O4H A;  4NGT A;  5F13 A;  2AJ6 A;  2H5M A;  4OIW A;  1GYT A;  2BL1 A;  2Q43 A;  3ISZ A;  4FWU A;  2YNC A;  4P4D A;  3MRU A;  4LUA A;  3DGV A;  3IO1 A;  1VIX A;  3NH8 A;  4R8F A;  3D7D A;  2VI7 A;  4J3G A;  5AG5 A;  3P2H A;  4MBU A;  4RI1 A;  2J8N A;  3PB8 X;  4PK2 A;  3V38 A;  2Z3M A;  4MHP A;  1R61 A;  3G23 A;  3TLC A;  2QEC A;  2WSA A;  1BPN A;  4MHZ A;  4XPK A;  4IIX A;  1RTQ A;  3PB7 X;  2PJA A;  4DUK A;  1S7F A;  1C3O B;  2AFX A;  1HEE A;  5AGE A;  4C2Z A;  2Q0Y A;  4CGL A;  3FJU A;  1IY7 A;  3VRR A;  3BUO B;  2AFW A;  1CP6 A;  4HPS A;  1QST A;  1Z4E A;  1ZG8 A;  4OAE A;  1Z8L A;  1VBG A;  2G3T A;  3P2F A;  5DS0 A;  4ZX8 A;  4NJR A;  5DWN A;  1IOI A;  3WC6 A;  4INJ A;  4M6G A;  4C9E A;  4DYO A;  4BMH A;  3FX6 A;  1Y9K A;  4C8T A;  4NXY A;  4P4B A;  1J4J A;  4C85 A;  3R9G A;  2ZW5 A;  4EVY A;  4E8O A;  1B47 A;  5HVF A;  3PBE A;  1Q5X A;  1A2Z A;  2AFM A;  4M3S A;  2AFO A;  1ZRS A;  2HQY A;  2R7H A;  4RUH A;  3OP0 A;  5HVG A;  4E94 A;  2CXA A;  1ZL0 A;  2BSW A;  2WZN A;  3JRU A;  4A4B A;  1TF9 A;  1IID A;  4E0A A;  2D0P A;  3GYA A;  4XNH C;  1Q2C A;  4KVO E;  1PUA A;  5J3X A;  4KVM E;  3RNZ A;  2BO9 A;  3A9L A;  5ISV A;  3TTH A;  1MJA A;  4A37 A;  4KOT A;  3PFO A;  1CP7 A;  4B12 A;  2OH1 A;  4ZY0 A;  2I79 A;  5LRJ A;  3HPG G;  1BO4 A;  3IU2 A;  4FD5 A;  4QC6 A;  4X5K A;  1PU9 A;  3SI1 A;  4CAX A;  4J0N A;  4ZBG A;  5F49 A;  1CX8 A;  2RB7 A;  3EC4 A;  3S9L A;  2JLM A;  3W91 A;  4CDJ A;  2NSM A;  1FNO A;  5K8N A;  1J3L A;  3SJF A;  4ZI6 A;  4B5P B;  1CBX A;  5K8P A;  3GKR A;  4GS4 A;  4UCM A;  2MP0 A;  2WYR A;  3S6G A;  1WVM A;  5HVH A;  4EYS A;  2DF5 A;  3K9U A;  4OID A;  2P6E A;  4C2X A;  5BWA B;  1ON0 A;  3N7Z A;  5KTA A;  4MI4 A;  4UWJ A;  2JBJ A;  3K4I A;  2EZA A;  3IIB A;  2OZH A;  1P0H A;  1YRE A;  1AYE A;  2EZB A;  3FEC A;  4H6Z A;  1S7L A;  3D3S A;  4CRZ B;  3GIU A;  1KEE B;  2YNE A;  4IF5 A;  4MFQ A;  2YGW A;  3R1K A;  4FD6 A;  3PFE A;  1KUV A;  2QIR A;  4CPA A;  5HKW A;  1XF8 A;  2NYQ A;  3NH5 A;  2VBQ A;  4MCS A;  4R57 A;  2CTB A;  2RC4 A;  5JYB A;  4A39 A;  3FMC A;  1YX0 A;  4C8U A;  2PJB A;  3KKW A;  4XPL A;  2FCK A;  4C8C A;  3KL9 A;  2PJ7 A;  1XJO A;  5FD8 A;  1ARM A;  1CM0 A;  2WUU A;  2DPT A;  2VL1 A;  2B5G B;  2FVG A;  5J8C A;  4M6H A;  5AG7 A;  1UFH A;  5G21 A;  1WK4 A;  4JD6 A;  1AUG A;  1IU8 A;  3PBB A;  2C6P A;  5LYI A;  4JLY A;  2VKZ G;  4C9U A;  4C7I A;  2Z3P A;  3JUW A;  4FUU A;  2ZEL A;  4AB7 A;  4FD7 A;  2JDD A;  3K9T A;  4Y49 C;  1TKH A;  3IU1 A;  1EE3 P;  4AVC A;  3C8O A;  3FF3 A;  4P45 A;  1CPX A;  4UFV A;  1F57 A;  5ELY A;  2DEA A;  4ONW A;  3FVL A;  4RS2 A;  3WT4 A;  4B6Z A;  1IYL A;  2CNM A;  2ZOG A;  2VZZ A;  3SXO A;  3W6S A;  4UCP A;  4CS0 B;  1WJT A;  1N71 A;  2CY2 A;  3T07 A;  4JWP A;  4MFK A;  3KR5 A;  3D7F A;  1KUX A;  3TCV A;  3WR7 A;  3TFY A;  2B3U A;  2Q51 A;  1OBR A;  1XFO A;  2EBJ A;  1Q2Y A;  4MFL A;  2Z0Z A;  3I3G A;  5G22 A;  2PJ2 A;  2EVN A;  3B7I A;  1ZG9 A;  2AE6 A;  4OC1 A;  1M44 A;  1B6B A;  1VKC A;  1YSJ A;  2PR1 A;  3OB1 B;  1ARL A;  2JDC A;  3JVN A;  4QBJ A;  3EZE A;  3OWC A;  4TJX A;  2REF A;  3DLJ A;  4HNY B;  4M8D A;  5A27 A;  1BXR B;  3F9K C;  2PJ0 A;  2FXF A;  1JQG A;  3D68 A;  3VAT A;  2PDO A;  2ZPA A;  3B3S A;  1OZP A;  1Z8W A;  4CDK A;  2C6C A;  2C1C A;  2WPX A;  4A38 A;  3C26 A;  2Y1N A;  2PC1 A;  2OR4 A;  4U9Y A;  3TLG A;  1ELL P;  1KBL A;  1I12 A;  2R1I A;  4B5P A;  5K8M A;  4ZGY B;  3FNC A;  1CJW A;  4CYN A;  4MI1 A;  2ANP A;  4IAV A;  4JYW A;  3SXN A;  2B4D A;  2DLA A;  3R9E A;  3U1B A;  2J8M A;  2ZEO A;  2ZOF A;  5LYD A;  3H5Z A;  1S60 A;  3UY5 A;  4B5O A;  4Z65 A;  2D0O A;  2D4O A;  2IMO A;  2XEJ A;  2XPL A;  4H1H A;  1IGB A;  1VHE A;  2F5I A;  3PLF B;  2EK9 A;  5AG6 A;  4KLW A;  5FVJ A;  1YVK A;  1EZB A;  4KOY A;  4KOW A;  3B3V A;  3T8W A;  3E0K A;  3TO6 A;  1LAP A;  5HXD A;  3U88 C;  3I6S A;  4CAW A;  1YME A;  4FAI A;  2B3V A;  4KSI A;  2VZY A;  3D67 A;  3NA6 A;  3T0T A;  5E96 A;  4AG9 A;  2V8V A;  1JWQ A;  5JM6 A;  3F5B A;  3T05 A;  4F9U A;  5JQ4 A;  4OP4 A;  1NMT A;  2CNS A;  5G1Z A;  5THW A;  2REE A;  5IB0 A;  1QQ9 A;  2GE3 A;  4W9Y A;  3TOA A;  2Q7B A;  1Z2L A;  1LAM A;  3KHX A;  4PPZ A;  4R6T A;  4I49 A;  4B13 A;  4YWY A;  4KUA A;  4K3N A;  4F0Y A;  4P4F A;  8CPA A;  5EMI A;  4P4E A;  3QB8 A;  4PXD A;  3FEE A;  4MFJ A;  3MGD A;  3PFV A;  4ZYQ A;  2B58 A;  2G0B A;  2PJ6 A;  2Z3N A;  6CPA A;  4C8A A;  4O23 A;  3EY5 A;  1TIQ A;  3IEH A;  3BJ7 A;  2DIK A;  2PCN A;  2OOT A;  1BLL E;  2K5T A;  3NFZ A;  2C5Q A;  2QYV A;  1CPS A;  3EXN A;  2B4J C;  3NE7 A;  4MRI A;  4NJQ A;  4BD9 A;  2OB0 A;  4C99 A;  3GB0 A;  3D7H A;  2CIJ A;  1H8L A;  2C27 A;  2HUZ A;  3R96 A;  5HKY A;  3V7Z A;  1NXJ A;  2FM4 A;  1EO0 A;  3CXS A;  4C9R A;  1Z8T A;  3HLP A;  2YND A;  1LAN A;  1M4L A;  2ABZ A;  4NGQ A;  1S7K A;  4B11 A;  2PJ8 A; 
#chains in the Genus database with same CATH homology
 5LYF A;  4C9V A;  4TJV A;  2PJ4 A;  4OC5 A;  1LFW A;  4TWE A;  3CT9 A;  4F8Z A;  4EWT A;  3SI2 A;  4UEF A;  4NGM A;  4FBE A;  3RBU A;  1HDU A;  1KWM A;  3WC5 A;  4P10 A;  5D29 A;  2QJ8 A;  3S9M A;  4R76 A;  2ZEG A;  1Y0Y A;  4NFR A;  2V8H A;  4EME A;  3EIF A;  2PRQ A;  3H8G A;  1Y7E A;  3IC1 A;  3BI1 A;  2V8D A;  5JH9 A;  1LCP A;  3B3W A;  4C86 A;  3D7G A;  4EFD A;  4H2K A;  1XRY A;  5IR2 A;  2XEI A;  3CPA A;  3CDX A;  2JBK A;  2GRE A;  4UIA A;  4F9V A;  4C8F A;  1R43 A;  3PEI A;  3I74 A;  4OC2 A;  5K8O A;  2ZEH A;  3ISX A;  1TXR A;  2PIZ A;  2PCU A;  3KQZ A;  1Y9Z A;  4R7M A;  1LOK A;  2IJZ A;  4YU9 A;  1PCA A;  1QMU A;  1YLO A;  4UIB A;  3BI0 A;  4JZ0 A;  2V8G A;  3BXM A;  2Q4Z A;  1FT7 A;  2BOA A;  2POK A;  2ZEM A;  4AXV A;  1ELM P;  3WAB A;  1PYT B;  1VGY A;  1ZLI A;  3HUV A;  7CPA A;  1TKJ A;  4IHM A;  4MXU A;  5J1Q A;  1YW4 A;  3KR4 A;  2AFS A;  2PJ5 A;  2CF4 A;  3LMS A;  3B2Y A;  4ZY1 A;  3PB6 X;  2XEF A;  3KAS A;  4MHN A;  1CG2 A;  2GU2 A;  3KGQ A;  4P4I A;  3VAR A;  4MCR A;  3RZA A;  4X3R A;  4NGN A;  1AMP A;  3S9N A;  3B35 A;  4A94 A;  4MHY A;  5D8N A;  2ZEP A;  4C9A A;  3SJX A;  3GLJ A;  1HDQ A;  2PVW A;  1ZG7 A;  3D4U A;  4OKO A;  2EWB A;  3FH4 A;  3VTA A;  4IK2 A;  4WJB A;  1YW6 A;  3IFE A;  1XBU A;  1UWY A;  1F2O A;  3KQX A;  4DJL A;  4OC4 A;  4MMO A;  5LYL A;  3PB9 X;  2AFZ A;  1DTD A;  2GLJ A;  4KNG E;  2PJC A;  5LRG A;  2XEG A;  5I4M A;  3QNV A;  3H8E A;  3IJ3 A;  4ZX9 A;  4LQG A;  5CPA A;  4OC3 A;  4PQA A;  3ICU A;  4X2T A;  4OC0 A;  3SI0 A;  1NSA A;  4PXB A;  2O53 A;  3KI9 A;  2ZEF A;  2I3C A;  5IB9 A;  1XMB A;  4PXE A;  4UEZ A;  4TNU A;  2RFH A;  1DE4 C;  3GUX A;  3MN8 A;  4C84 A;  1XF1 A;  2G9D A;  2PIY A;  3H8F A;  2ZEE A;  2CTC A;  1ZLH A;  1R3N A;  3SJG A;  4PXC A;  3D66 A;  2QVP A;  3FED A;  3IWW A;  4MCP A;  3PRT A;  1Y0R A;  4NGP A;  3CPX A;  3PB4 X;  3RAM A;  2PJ9 A;  2HB6 A;  2ZED A;  1Z5R A;  3K2K A;  4P6Y A;  4P44 A;  2IQ6 A;  5JGF A;  4NGS A;  3N5F A;  1Q7L A;  3NH4 A;  4G1P A;  1VHO A;  5LRK A;  5CBM A;  2PE3 A;  3L2N A;  3B3T A;  2HC9 A;  2F8H A;  2F7V A;  2V77 A;  3LWU A;  3VH9 A;  4ZY2 A;  2ZEN A;  2PVV A;  5F09 A;  2GLF A;  4YN3 A;  3WC7 A;  2PJ3 A;  3SJE A;  1BAV A;  3TX8 A;  2GP4 A;  1TKF A;  1F2P A;  1V6C A;  2C6G A;  2EK8 A;  2JEW A;  1TF8 A;  2J9A A;  4WWV A;  4NGR A;  2AFU A;  3BHX A;  4UEE A;  3B3C A;  2PJ1 A;  3KZW A;  4UF4 A;  4OME A;  3KHZ A;  4Q7A A;  4P4J A;  2BCO A;  4GM5 A;  3I1U A;  1BPM A;  4X8I A;  4MCQ A;  3TC8 A;  2O4H A;  4NGT A;  4OIW A;  1GYT A;  2Q43 A;  3ISZ A;  4FWU A;  4P4D A;  3MRU A;  3DGV A;  3IO1 A;  1VIX A;  3NH8 A;  4R8F A;  3D7D A;  3PB8 X;  3V38 A;  4MHP A;  1BPN A;  4MHZ A;  1RTQ A;  3PB7 X;  2PJA A;  4DUK A;  2AFX A;  1HEE A;  3FJU A;  1IY7 A;  2AFW A;  1CP6 A;  1ZG8 A;  1Z8L A;  5DS0 A;  4ZX8 A;  4C8P A;  4NJR A;  3WC6 A;  4C9E A;  4DYO A;  3FX6 A;  4C8T A;  4P4B A;  4C85 A;  5HVF A;  3PBE A;  2AFM A;  2AFO A;  4RUH A;  5HVG A;  2WZN A;  3JRU A;  1TF9 A;  2BO9 A;  4A37 A;  3PFO A;  1CP7 A;  4ZY0 A;  5LRJ A;  3SI1 A;  1CX8 A;  2RB7 A;  3S9L A;  4CDJ A;  2NSM A;  1FNO A;  5K8N A;  3SJF A;  4ZI6 A;  1CBX A;  5K8P A;  2WYR A;  1WVM A;  5HVH A;  4OID A;  2JBJ A;  3IIB A;  1AYE A;  3FEC A;  4CPA A;  3PFE A;  3NH5 A;  2NYQ A;  4MCS A;  2CTB A;  4A39 A;  3FMC A;  4C8U A;  2PJB A;  4C8C A;  3KL9 A;  2PJ7 A;  1XJO A;  1ARM A;  2VL1 A;  2FVG A;  3PBB A;  2C6P A;  5LYI A;  4C9U A;  4FUU A;  2ZEL A;  3K9T A;  1TKH A;  1EE3 P;  4P45 A;  3FF3 A;  1CPX A;  1F57 A;  5ELY A;  2DEA A;  4ONW A;  3FVL A;  3WT4 A;  4B6Z A;  2ZOG A;  3KR5 A;  3D7F A;  2Q51 A;  1OBR A;  1XFO A;  2PJ2 A;  3B7I A;  1ZG9 A;  4OC1 A;  1YSJ A;  1ARL A;  4TJX A;  3DLJ A;  2PJ0 A;  1JQG A;  3D68 A;  3VAT A;  3B3S A;  4CDK A;  2C6C A;  2C1C A;  4A38 A;  2OR4 A;  1ELL P;  5K8M A;  2ANP A;  4IAV A;  4JYW A;  2ZEO A;  2ZOF A;  5LYD A;  4Z65 A;  2IMO A;  2XEJ A;  1IGB A;  1VHE A;  2EK9 A;  3T8W A;  5HXD A;  3B3V A;  3I6S A;  1LAP A;  1YME A;  4FAI A;  4KSI A;  3NA6 A;  3D67 A;  2V8V A;  5JM6 A;  4F9U A;  4OP4 A;  5THW A;  1QQ9 A;  4W9Y A;  1Z2L A;  1LAM A;  3KHX A;  4PPZ A;  4R6T A;  4YWY A;  4K3N A;  4P4F A;  8CPA A;  4P4E A;  4PXD A;  3FEE A;  4ZYQ A;  6CPA A;  2PJ6 A;  4C8A A;  4O23 A;  3IEH A;  2OOT A;  1BLL E;  3NFZ A;  2C5Q A;  2QYV A;  1CPS A;  4MRI A;  4NJQ A;  4BD9 A;  4C99 A;  3GB0 A;  3D7H A;  2CIJ A;  1H8L A;  3V7Z A;  4C9R A;  3HLP A;  1LAN A;  1M4L A;  2ABZ A;  4NGQ A;  2PJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...