4P4EA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor mp1d
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4eA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4eA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4eA02
3CPAA 1AMPA 3B2YA 2F7VA 5LRKA 1R3NA 3PRTA 1KWMA 4MHNA 2ZEOA 2AFXA 3DLJA 2PJAA 4NFRA 2V8VA 2BCOA 4C9VA 4IAVA 3PBBA 3HUVA 4MHYA 1QQ9A 2HB6A 4X3RA 2PRQA 3VH9A 3VARA 2J9AA 4C8CA 3ISZA 7CPAA 4MCSA 1AYEA 3BI0A 3FMCA 1EE3P 1ZG7A 3I1UA 4NJQA 4P4DA 1H8LA 4UEZA 2DEAA 3PB8X 2G9DA 1Y7EA 2PIYA 4FWUA 1XBUA 2PJ2A 3DGVA 3FX6A 1HEEA 1VIXA 3FJUA 3EIFA 4DUKA 3IWWA 4Q7AA 4K3NA 3KQXA 1YSJA 5K8PA 1DE4C 1R43A 4C8AA 3KR4A 4ZX8A 4ZYQA 4C99A 4JYWA 2AFZA 3GLJA 2C6PA 3SJFA 4ONWA 3D67A 3FEEA 4F9VA 4DYOA 2QYVA 2AFOA 1UWYA 2WYRA 3FECA 4B6ZA 5JM6A 3TC8A 1WVMA 4JZ0A 1ARMA 4WJBA 3B35A 4NGNA 2PJ7A 3D4UA 4NGRA 1ZG8A 2ANPA 2NYQA 4PQAA 5K8OA 3IEHA 1RTQA 4MXUA 1BPNA 4ZI6A 4C9AA 4MCRA 3B3SA 4EWTA 1F57A 3KHXA 2V8DA 2ZEFA 3HLPA 2CF4A 2QVPA 4OIDA 4H2KA 1HDQA 3WABA 1VHOA 3H8GA 3D7GA 1NSAA 3IJ3A 4C85A 1Z8LA 3B3WA 2EK9A 3S9LA 4P4FA 2Q51A 4PXDA 1YW6A 1TF9A 1Y9ZA 1CP6A 3B3CA 4TJVA 4OC5A 1LFWA 4X2TA 3VTAA 1XFOA 3BHXA 2PJ3A 3PB9X 1YW4A 1Y0YA 1Z2LA 1CPSA 1LANA 4P6YA 5LRGA 2PVVA 5LYLA 3I6SA 2XEGA 3FEDA 3NH5A 5F09A 4NGQA 4EFDA 3D7HA 4R76A 2BO9A 3T8WA 4P4EA 3H8EA 1ZLIA 3NH4A 1BAVA 3QNVA 3ISXA 1IGBA 2XEJA 4W9YA 4OIWA 2AFSA 2ZEEA 4C84A 3PB7X 2GLJA 3S9MA 2V8GA 1YLOA 1Y0RA 3D68A 3WC7A 1TKFA 5LYDA 4UF4A 3BI1A 4OP4A 3PBEA 3V7ZA 1VHEA 4PXCA 2PJ9A 3K2KA 2ABZA 2GU2A 3SI2A 5D29A 2BOAA 5I4MA 3CT9A 2AFUA 1CP7A 2PJ6A 3IIBA 4A94A 4NJRA 4NGSA 4P4JA 2IMOA 4KSIA 4R6TA 3WT4A 3NFZA 4NGPA 4OC1A 2CTCA 4PPZA 4X8IA 5HXDA 2PJ1A 3IO1A 3SJEA 3D7FA 4O23A 1FT7A 6CPAA 2HC9A 2ZOFA 3B3VA 2V77A 3JRUA 4ZY0A 2WZNA 2POKA 1LOKA 1PCAA 3SJGA 1CPXA 3LMSA 2V8HA 4KNGE 4C9RA 2CIJA 1BLLE 2PCUA 2AFMA 2ZEHA 1ELMP 2ZELA 3D7DA 2Q43A 3FH4A 1PYTB 1CBXA 2CTBA 1CX8A 3KL9A 1ZG9A 5K8NA 2ZOGA 1XJOA 5HVFA 3SJXA 1ELLP 3NH8A 5D8NA 4FUUA 4TNUA 2Q4ZA 3KZWA 4ZY1A 4C86A 4A38A 4YWYA 5THWA 2JBJA 2OOTA 1DTDA 4MCQA 4NGTA 4MRIA 2XEFA 1HDUA 3KASA 2I3CA 4R7MA 3KHZA 3IC1A 4FBEA 2EK8A 3NA6A 4MMOA 3PFEA 2PE3A 3PEIA 4CDJA 4UIAA 3V38A 4C8UA 4WWVA 3SI0A 2XEIA 3BXMA 3L2NA 3RBUA 4C9EA 2NSMA 4DJLA 3MN8A 4TJXA 4BD9A 3D66A 4TWEA 3K9TA 3GB0A 2ZEMA 1M4LA 4MHZA 2C1CA 3WC5A 2ZEPA 2AFWA 5K8MA 3B3TA 4PXEA 2ZEDA 1TXRA 2FVGA 1ZLHA 1LCPA 1TKJA 5LYIA 2PIZA 4IHMA 4ZX9A 2PJBA 2JBKA 1V6CA 1BPMA 2PVWA 4OC0A 4EMEA 2PJ5A 4P4BA 4Z65A 1QMUA 1XF1A 4MCPA 4C9UA 3PB6X 3CPXA 4C8FA 5HVGA 5JH9A 3IFEA 4IK2A 3KI9A 4P10A 3KGQA 1LAMA 2F8HA 2ZEGA 4FAIA 2IJZA 3MRUA 4RUHA 3B7IA 2PJ8A 4OMEA 2RB7A 2GLFA 1JQGA 2VL1A 3S9NA 4PXBA 5LYFA 3CDXA 4A39A 4OC2A 1OBRA 3H8FA 5CPAA 5DS0A 2C6GA 4NGMA 4G1PA 2PJ0A 2PJ4A 3N5FA 4P45A 4MHPA 1YMEA 4CDKA 1F2PA 3RAMA 4R8FA 5LRJA 3VATA 2GREA 4UEFA 1Z5RA 4CPAA 4P4IA 1Q7LA 5HVHA 1ARLA 5IB9A 3FF3A 3ICUA 4F9UA 4OC4A 3PB4X 4F8ZA 4C8PA 2RFHA 8CPAA 4YU9A 4YN3A 1IY7A 3GUXA 2C6CA 3LWUA 3RZAA 4OC3A 1XMBA 3KQZA 1TKHA 2EWBA 3KR5A 3I74A 4UIBA 1F2OA 3WC6A 3PFOA 5CBMA 4UEEA 2PJCA 2IQ6A 3SI1A 2O53A 5J1QA 4C8TA 2QJ8A 4ZY2A 1GYTA 3TX8A 2O4HA 4AXVA 2JEWA 1FNOA 4LQGA 1TF8A 2OR4A 5ELYA 1VGYA 1XRYA 3FVLA 1CG2A 4P44A 1LAPA 4A37A 5JGFA 2ZENA 4GM5A 4OKOA
chains in the Genus database with same CATH superfamily
3CPAA 4ZBGA 1AMPA 3B2YA 2VZZA 1EZAA 2F7VA 5LRKA 1R3NA 4II9A 1NSLA 3PRTA 2QIRA 1Z4EA 1KWMA 4MHNA 2ZEOA 3BUXB 4MHDA 4MFLA 2AFXA 1Q2YA 2GIVA 4JLYA 3T9YA 3T90A 1M6VB 2CY2A 4R57A 3DLJA 2PJAA 4NFRA 4PSXA 1KEEB 2V8VA 2BCOA 1Q2DA 4IAVA 1OZPA 1NXJA 4C9VA 1LRZA 2ATRA 3HUVA 3PBBA 3R1KA 4MHYA 1QQ9A 4NF1A 4Y49C 4B11A 2HB6A 3QAHA 3BUOB 3TLGA 4C68A 2PC1A 4X3RA 2PRQA 3NE7A 3VH9A 3TLGB 2ZPAA 3VARA 2D0PA 4UWIA 2J9AA 4C8CA 1QSOA 3BUNB 3D2PA 4EYSA 2BSWA 3CXPA 3C26A 3ISZA 4B5OA 4R3LA 4U9YA 7CPAA 2OLSA 4MCSA 1AYEA 4ZGYB 3H4QA 3SXOA 4COBA 3BI0A 2Q44A 1DIKA 3FMCA 5A28A 3VROA 1EE3P 1ZG7A 3I1UA 4NJQA 3W6XA 4CS0B 4C2YA 4P4DA 1KUYA 1H8LA 1QSMA 2Y0MA 4UEZA 3VGOA 2DEAA 2VXKA 2REFA 4FD4A 5HKYA 3PB8X 2G9DA 1CE8B 2XPLA 1Y7EA 2G0BA 3K4IA 2Y1NA 2PIYA 4OAEA 2DIKA 4FWUA 1XBUA 2PJ2A 3OB1B 1HEEA 1PUAA 1VIXA 3DGVA 3FJUA 3FX6A 3EIFA 2B58A 4DUKA 3IWWA 2D4PA 5AGEA 4KVOE 4E0AA 4Q7AA 4PK2A 4K3NA 4BBHA 1XE4A 3KQXA 2Q04A 1YSJA 3G3SA 3VWDA 4CGLA 5K8OA 5K8PA 1IIDA 2EO8A 1DE4C 1R43A 2FCKA 4UWJA 1Q2CA 2B4BA 3KR4A 4MBUA 4XNHB 4ZX8A 4ZYQA 2YJVA 4C99A 2PR1A 4JYWA 2AFZA 3GLJA 4KOVA 3FRMA 2C6PA 1S60A 4FD6A 3SJFA 2C27A 4ONWA 4AG7A 3RNZA 4AG9A 2JDCA 3D67A 2YNCC 1B47A 3FEEA 3S6FA 4XPDC 4F9VA 5J8CA 3I3GA 4DYOA 4YRHA 4KOXA 2X0SA 1XOVA 2QYVA 5H86A 5IX3A 2B4DA 3TO9A 2AFOA 1UWYA 2WYRA 3FECA 5FVJA 2B4DB 4B6ZA 1VBHA 5JM6A 1WK4A 3TC8A 4A31A 4MFJA 2Y1MA 1WVMA 2P0WA 4JZ0A 1ARMA 4A4BA 3SHPA 2Z11A 1YLEA 3IU1A 4H1HA 4WJBA 3B35A 4NGNA 1RO5A 2PJ7A 2ZW6A 2P6GA 4NGRA 1ZG8A 3HPGG 3D4UA 4M6GA 2ANPA 2NYQA 4Q38A 5F46A 3OAKA 3PP9A 1L0CA 2OZUA 4JXQA 2XPNA 2OZHA 4HNXB 3IEHA 1RTQA 1KUXA 4PQAA 4MXUA 1BPNA 1AUGA 4ZI6A 5J8FA 4MCRA 3B3SA 4C9AA 3FYNA 4EWTA 2DLAA 4CO9A 3R9GA 1F57A 2FL4A 2Z10A 3E0KA 3KHXA 2V8DA 2ZEFA 3HLPA 4YFJA 4F0XA 1EO0A 2CF4A 2QVPA 1WJTA 4M3SA 3TLZA 2WSAA 4KVXA 4Y49B 3DNSA 1YVKA 2Z3PA 3HPHE 4KOYA 1S3ZA 4OIDA 2R7HA 2GANA 1HDQA 4H2KA 5AG5A 3R95A 3WABA 5HH1A 5EC4A 3F9KC 1FY7A 1VHOA 3H8GA 1S7KA 1R57A 3D7GA 1NSAA 3IJ3A 4C85A 1Z8LA 3PFVA 2EUIA 4UCMA 3B3WA 2EK9A 3VRNA 3S9LA 4P4FA 3TOAA 2Q51A 4PXDA 1YW6A 2JDDA 1TF9A 1S7LA 2Z3NA 1CP6A 3B3CA 1Y9ZA 4TJVA 4CAVA 4OC5A 4B5PA 1LFWA 3S6KA 4XNHC 4ONUA 4B5PB 4CYNA 3EXNA 4X2TA 4E8OA 1JWQA 3VTAA 2PRBA 1XFOA 1QSRA 1U6MA 3BHXA 2PJ3A 3P2FA 3PB9X 3S6HA 3KRVA 3BJ7A 3BUWB 1YW4A 1Y0YA 2R8VA 1Z2LA 1CPSA 1LANA 4P6YA 5LRGA 5A27A 4KS9A 2Z0ZA 2PVVA 2PSWA 2Q4VA 4KLVA 3LACA 5LYLA 3I6SA 3TLCA 2XEGA 3FEDA 3NH5A 4R87A 4ORFA 5F47A 5EBVA 4KZTA 2CNTA 3NE8A 5F09A 4XPDB 2JLMA 1C30B 5G21A 4NGQA 4CGMA 4EFDA 3D7HA 5AG4A 1Q5XA 1T36B 4R76A 2BO9A 2CXAA 4P4EA 1WWZA 3NFQA 3T8WA 5DWNA 3T07A 2P6FA 4CZ1A 3O8ZA 3H8EA 1EZBA 1ZLIA 3NH4A 4AVBA 5JPHA 4R3KA 1BAVA 3EZAA 1M1DA 3QNVA 3ISXA 1M4IA 3TLEA 1IGBA 2XEJA 4W9YA 4M85A 1ZL0A 4OIWA 2AFSA 2ZEEA 4EVYA 4C84A 4UFWA 3PB7X 1SQHA 2G3AA 5AG7A 5G22A 2BL1A 2GLJA 3LD2A 4GPLB 5FD8A 3S9MA 3BUMB 2Q4YA 2V8GA 2JEVA 1YLOA 4UA3A 5HKZA 2BUEA 4QBJA 3U1BA 1Y0RA 3D68A 3WC7A 1QSTA 3V8IA 1TKFA 2XPPA 5LYDA 1R61A 1VKCA 4UF4A 3BI1A 4OP4A 4PSWA 1Y9KA 3W91A 3PBEA 1Y7RA 2VEZA 3PGPA 1VHEA 3V7ZA 1XMTA 4PXCA 4E94A 3EZEA 4QC6A 1JDEA 2PJ9A 3K2KA 2HI6A 2ABZA 2GU2A 4AVAA 2AE6A 2UV8G 4NEXA 3SI2A 3I9SA 4B12A 4XPKA 2CNMA 2WPWA 5D29A 3R96A 2BOAA 5I4MA 2J8RA 2MP0A 3CT9A 2AFUA 4QUSA 1KZFA 1CP7A 2N3AB 2PJ6A 3IIBA 2B4JC 2I00A 4A94A 4NJRA 5AXIA 4H6UA 1M4GA 3BJ8A 1RXTA 4CYOA 4COGA 4MJXA 5F1YA 3VWEA 2ZXVA 4NGSA 4P4JA 2IMOA 4L8AA 1A2ZA 3TCVA 4JVOA 4BPXB 4AB7A 4RN7A 2QECA 4KORA 4KSIA 4R9MA 4R6TA 3WT4A 1IOIA 4C2ZA 3NFZA 5IR2A 4NGPA 4OC1A 2WUUA 1P0HA 2CTCA 4PPZA 3PZJA 4RI1A 4X8IA 4M8DA 5HXDA 2PJ1A 3S6GA 2Z3OA 3IO1A 1MK4A 2OB0A 4LUAA 4CAXA 4JWPA 3SJEA 4IIXA 3D7FA 4A2ZA 3GJZA 4O23A 1FT7A 3WR7A 6CPAA 3W6SA 2HC9A 2ZOFA 4CGNA 3B3VA 4U9ZA 3ZJ0A 2FS5A 1VBGA 2V77A 3JRUA 4ZY0A 1M44A 2WZNA 3QAYA 2Q7BA 1IU8A 3FB3A 4KOUA 1YGHA 2POKA 4HNWB 5IV0A 1LOKA 1P4NA 1PCAA 2J8NA 3TYXA 3SJGA 1VHSA 1CPXA 3LMSA 2Z3MA 2V8HA 4M6HA 5E96A 2Z3LA 4KNGE 3NOJA 4C9RA 3TLBA 2CIJA 1BLLE 1Y9WA 2AFMA 2PCUA 3GY9A 1J3LA 2ZEHA 3G23A 4CGPA 1ELMP 2ZELA 2EZAA 3TLYA 3D7DA 2AJ6A 4JD6A 2Q43A 5I0CA 3R9EA 3FH4A 1GHEA 2A4NA 4KOSA 1PYTB 2EZBA 5EMIA 1CBXA 2CTBA 4KUAA 4C2XA 1CX8A 1Z4RA 2CNSA 3T5MA 3DR6A 2OH1A 1ZG9A 3JTKA 3KL9A 5K8NA 3DDDA 2ZOGA 3T0TA 1XJOA 3F5BA 5HVFA 3SJXA 4LQ6A 2ODFA 1YREA 3H5ZA 1ELLP 3NH8A 5D8NA 4FUUA 2O28A 1Z9EA 4H6ZA 3PT1A 5IB0A 4TNUA 4L89A 5F5XA 1Z8XA 2Q4ZA 3KZWA 4ZY1A 5ISVA 4CRZB 1MJAA 4GXHA 4C86A 3IU2A 4LX9A 4A38A 2KCWA 2FIAA 4YWYA 2JBJA 5THWA 2EZCA 2OOTA 1IOFA 1J4JA 1DTDA 2BEIA 4CAWA 2B5GA 4MCQA 4NGTA 2PDOA 2B5GB 4MRIA 4A32A 4CYQA 2XEFA 1HDUA 3KASA 2I3CA 3FXTA 2VZYA 3TO7A 2Z3KA 4R7MA 4PK3A 3KHZA 5KTDA 2Q7SA 3IC1A 5JVLA 4F6AA 4FBEA 2EK8A 4QVTA 2VBQA 2D0OA 3NA6A 2HROA 3DSBA 1JDBC 4MMOA 4MI1A 4UCNA 5F48A 3PFEA 2ARHA 3JVNA 1YR0A 1I21A 1YX0A 2PE3A 2ZW7A 3PEIA 4JXRA 1C3OB 4BTFA 1Z9UA 3SR3A 4UIAA 4CDJA 5JYBA 5C88A 1ZRSA 3OB2B 1NMTA 2FSRA 3V38A 5KTAA 3F0AA 4C8UA 4WWVA 5HMNA 4CGOA 3SI0A 2XEIA 2FIWA 3BXMA 1IYLA 1MJ9A 5AG6A 4INJA 4RR2B 3RYOA 2FXFA 3G8WA 3L2NA 3RBUA 4XPLA 1CM0A 4C9EA 2NSMA 3OP0A 3HMJG 1YK3A 3CZXA 3MN8A 4MFPA 4MY3A 4MY0A 4BD9A 4DJLA 2FE7A 4TJXA 3D66A 3DR8A 2E28A 3IGRA 1YQEA 3GB0A 3K9TA 4TWEA 1FBVA 2ZEMA 4A33A 4F0YA 3TFYA 1GGOA 4KSFA 4HNYB 2I79A 3PLFB 1N71A 1PU9A 2FM4A 1M4LA 2ZW4A 4MHZA 5G20A 2DF5A 3TE4A 1I1DA 2C1CA 4KOWA 2K5TA 3WC5A 2ZEPA 3VRPA 4C8AA 1ZO0A 4OADA 4MFZA 3D3SA 3TTHA 3EFAA 2YNEA 1S7NA 2CBLA 2AFWA 3B3TA 5K8MA 3GYAA 4PXEA 2X7BA 2ZEDA 4OLLA 4CAFA 1TXRA 2FVGA 3R9FA 1ZLHA 1LCPA 1TKJA 5LYIA 2PIZA 4FD7A 5F49A 2C5QA 4IHMA 1IICA 2Q0YA 2PJBA 4ZX9A 3GKRA 3IWGA 2JBKA 4KVME 2ZW5A 4KLWA 1V6CA 1MJBA 1BPMA 4AVCA 2PVWA 4OC0A 4H89A 2PJ5A 4EMEA 4P4BA 5G1ZA 4A30A 2J8MA 2VQYA 4X5KA 1QMUA 4NCZA 2H5MA 3TO6A 4Z65A 5DWMA 1IB1E 1K4JA 3OWCA 1XF1A 4MCPA 1VI4A 3PB6X 3CPXA 2YJTA 4MJ8A 4C9UA 4C8FA 1X10A 5HVGA 5JH9A 3IFEA 3KKWA 4IK2A 3KI9A 4P10A 4PV6A 3KGQA 3T05A 2VKZG 1LAMA 2F8HA 1YVHA 4A4CA 2ZEGA 3RO0A 4FAIA 3BLNA 2IJZA 3IWEA 4BINA 2G3TA 3SXNA 4B13A 4HPSA 2IL4A 4MI4A 2GFQA 3MRUA 4GS4A 2DPTA 2AUMA 2R98A 4RUHA 4CRYB 3B7IA 4BPUB 4BPWB 2PJ8A 2YGWA 4UBRA 3EO4A 3TT2A 4OMEA 3U88C 2RB7A 2WPXA 4FD5A 1V0CA 2GLFA 2YNDA 4NXYA 1JQGA 2QMLA 2VL1A 3S9NA 2NMTA 2B0AA 4PXBA 3CXQA 3VRQA 5LYFA 2DPSA 3CDXA 3EY5A 3A9LA 4OC2A 1OBRA 3GIUA 3LODA 3N7ZA 4A39A 3H8FA 2AUNA 3K9UA 5CPAA 5HKWA 5J3XA 4MFKA 1XEBA 4U5YA 1S5KA 5DS0A 2C6GA 1CJWA 2GE3A 4NGMA 1NE9A 3MGDA 2B3UA 4G1PA 2DXQA 2FT0A 3B8GA 4I49A 3QB8A 2PJ0A 4KOTA 4Q36A 3UY5A 2PJ4A 4B14A 2PCNA 3N5FA 5F9MA 4P45A 4MHPA 2B3VA 2D4OA 1YMEA 4CAEA 1F2PA 3RAMA 4CDKA 1UFHA 4K30A 3TLAA 4R8FA 3P2HA 5LRJA 3VATA 2GREA 4UEFA 1KUVA 1Z5RA 3D8PA 4CPAA 4P4IA 5BY0A 4CYPA 5BWAB 1Q7LA 5HVHA 1ARLA 5GCNA 1IYKA 5IB9A 1BXRB 3ZZIA 4A95A 5KTCA 3FF3A 2PR8A 3ICUA 2GP4A 4JJXA 5JQ4A 5K99A 4F9UA 1ON0A 4KUBA 1B6BA 2VI7A 4IIYA 4OC4A 5CNPA 4E5SA 5F13A 3PB4X 4KSAA 2R82A 3ZNIA 1B87A 3D2MA 4F8ZA 2OU2A 2P6EA 1XIXA 4BMHA 4C8PA 1NBWA 4E2AA 1KBLA 1KC7A 2RFHA 4C7IA 1I12A 4J3GA 2EBJA 3TOBA 8CPAA 4YU9A 4YN3A 3VRRA 1IY7A 3GUXA 2C6CA 3JUWA 1TIQA 3LWUA 4DNCA 3RZAA 4OC3A 1XMBA 3KQZA 4NSQA 4UFVA 4IF5A 1Z8WA 1TKHA 2EWBA 3FIXA 3KR5A 3I74A 4J0NA 4UIBA 1A9XB 1F2OA 3WC6A 3CXSA 1S7FA 3PFOA 1BOBA 5CBMA 4UEEA 2RC4A 1BO4A 2PJCA 4IUSA 2F5IA 2IQ6A 4QB9A 3SI1A 2O53A 5J1QA 4C8TA 2QJ8A 4ZY2A 3F8KA 2REEA 1GYTA 4M6IA 1Z8TA 3TX8A 2O4HA 4AXVA 3C8OA 2JEWA 2EVNA 3EC4A 1FNOA 4RS2A 2R1IA 4LQGA 1TF8A 2HQYA 2OR4A 4YGOA 3EZBA 5ELYA 4HKFA 1VGYA 1CS0B 2HWGA 5C82A 1M4DA 1XRYA 1YVOA 3FVLA 5H84A 4B10A 1CG2A 4P44A 1QSNA 4MFQA 1LAPA 4A37A 4UCPA 2HV2A 2OZGA 5JGFA 2ZENA 4UFXA 1ZYMA 2XPOA 3FBUA 4C7HA 2PQ8A 2HUZA 1XF8A 4GM5A 1X12A 3FNCA 2YNCA 4OKOA
chains in the Genus database with same CATH topology
3CPAA 1AMPA 3B2YA 2F7VA 5LRKA 1R3NA 3PRTA 1KWMA 4MHNA 2ZEOA 2AFXA 3DLJA 2PJAA 4NFRA 2V8VA 2BCOA 4C9VA 4IAVA 3PBBA 3HUVA 4MHYA 1QQ9A 2HB6A 4X3RA 2PRQA 3VH9A 3VARA 2J9AA 4C8CA 3ISZA 7CPAA 4MCSA 1AYEA 3BI0A 3FMCA 1EE3P 1ZG7A 3I1UA 4NJQA 4P4DA 1H8LA 4UEZA 2DEAA 3PB8X 2G9DA 1Y7EA 2PIYA 4FWUA 1XBUA 2PJ2A 3DGVA 3FX6A 1HEEA 1VIXA 3FJUA 3EIFA 4DUKA 3IWWA 4Q7AA 4K3NA 3KQXA 1YSJA 5K8PA 1DE4C 1R43A 4C8AA 3KR4A 4ZX8A 4ZYQA 4C99A 4JYWA 2AFZA 3GLJA 2C6PA 3SJFA 4ONWA 3D67A 3FEEA 4F9VA 4DYOA 2QYVA 2AFOA 1UWYA 2WYRA 3FECA 4B6ZA 5JM6A 3TC8A 1WVMA 4JZ0A 1ARMA 4WJBA 3B35A 4NGNA 2PJ7A 3D4UA 4NGRA 1ZG8A 2ANPA 2NYQA 4PQAA 5K8OA 3IEHA 1RTQA 4MXUA 1BPNA 4ZI6A 4C9AA 4MCRA 3B3SA 4EWTA 1F57A 3KHXA 2V8DA 2ZEFA 3HLPA 2CF4A 2QVPA 4OIDA 4H2KA 1HDQA 3WABA 1VHOA 3H8GA 3D7GA 1NSAA 3IJ3A 4C85A 1Z8LA 3B3WA 2EK9A 3S9LA 4P4FA 2Q51A 4PXDA 1YW6A 1TF9A 1Y9ZA 1CP6A 3B3CA 4TJVA 4OC5A 1LFWA 4X2TA 3VTAA 1XFOA 3BHXA 2PJ3A 3PB9X 1YW4A 1Y0YA 1Z2LA 1CPSA 1LANA 4P6YA 5LRGA 2PVVA 5LYLA 3I6SA 2XEGA 3FEDA 3NH5A 5F09A 4NGQA 4EFDA 3D7HA 4R76A 2BO9A 3T8WA 4P4EA 3H8EA 1ZLIA 3NH4A 1BAVA 3QNVA 3ISXA 1IGBA 2XEJA 4W9YA 4OIWA 2AFSA 2ZEEA 4C84A 3PB7X 2GLJA 3S9MA 2V8GA 1YLOA 1Y0RA 3D68A 3WC7A 1TKFA 5LYDA 4UF4A 3BI1A 4OP4A 3PBEA 3V7ZA 1VHEA 4PXCA 2PJ9A 3K2KA 2ABZA 2GU2A 3SI2A 5D29A 2BOAA 5I4MA 3CT9A 2AFUA 1CP7A 2PJ6A 3IIBA 4A94A 4NJRA 4NGSA 4P4JA 2IMOA 4KSIA 4R6TA 3WT4A 3NFZA 5IR2A 4NGPA 4OC1A 2CTCA 4PPZA 4X8IA 5HXDA 2PJ1A 3IO1A 3SJEA 3D7FA 4O23A 1FT7A 6CPAA 2HC9A 2ZOFA 3B3VA 2V77A 3JRUA 4ZY0A 2WZNA 2POKA 1LOKA 1PCAA 3SJGA 1CPXA 3LMSA 2V8HA 4KNGE 4C9RA 2CIJA 1BLLE 2PCUA 2AFMA 2ZEHA 1ELMP 2ZELA 3D7DA 2Q43A 3FH4A 1PYTB 1CBXA 2CTBA 1CX8A 3KL9A 1ZG9A 5K8NA 2ZOGA 1XJOA 5HVFA 3SJXA 1ELLP 3NH8A 5D8NA 4FUUA 4TNUA 2Q4ZA 3KZWA 4ZY1A 4C86A 4A38A 4YWYA 5THWA 2JBJA 2OOTA 1DTDA 4MCQA 4NGTA 4MRIA 2XEFA 1HDUA 3KASA 2I3CA 4R7MA 3KHZA 3IC1A 4FBEA 2EK8A 3NA6A 4MMOA 3PFEA 2PE3A 3PEIA 4CDJA 4UIAA 3V38A 4C8UA 4WWVA 3SI0A 2XEIA 3BXMA 3L2NA 3RBUA 4C9EA 2NSMA 4DJLA 3MN8A 4TJXA 4BD9A 3D66A 4TWEA 3K9TA 3GB0A 2ZEMA 1M4LA 4MHZA 2C1CA 3WC5A 2ZEPA 2AFWA 5K8MA 3B3TA 4PXEA 2ZEDA 1TXRA 2FVGA 1ZLHA 1LCPA 1TKJA 5LYIA 2PIZA 2C5QA 4IHMA 4ZX9A 2PJBA 2JBKA 1V6CA 1BPMA 2PVWA 4OC0A 4EMEA 2PJ5A 4P4BA 4Z65A 1QMUA 1XF1A 4MCPA 4C9UA 3PB6X 3CPXA 4C8FA 5HVGA 5JH9A 3IFEA 4IK2A 3KI9A 4P10A 3KGQA 1LAMA 2F8HA 2ZEGA 4FAIA 2IJZA 3MRUA 4RUHA 3B7IA 2PJ8A 4OMEA 2RB7A 2GLFA 1JQGA 2VL1A 3S9NA 4PXBA 5LYFA 3CDXA 4A39A 4OC2A 1OBRA 3H8FA 5CPAA 5DS0A 2C6GA 4NGMA 4G1PA 2PJ0A 2PJ4A 3N5FA 4P45A 4MHPA 1YMEA 4CDKA 1F2PA 3RAMA 4R8FA 5LRJA 3VATA 2GREA 4UEFA 1Z5RA 4CPAA 4P4IA 1Q7LA 5HVHA 1ARLA 5IB9A 3FF3A 3ICUA 2GP4A 4F9UA 4OC4A 3PB4X 4F8ZA 4C8PA 2RFHA 8CPAA 4YU9A 4YN3A 1IY7A 3GUXA 2C6CA 3LWUA 3RZAA 4OC3A 1XMBA 3KQZA 1TKHA 2EWBA 3KR5A 3I74A 4UIBA 1F2OA 3WC6A 3PFOA 5CBMA 4UEEA 2PJCA 2IQ6A 3SI1A 2O53A 5J1QA 4C8TA 2QJ8A 4ZY2A 1GYTA 3TX8A 2O4HA 4AXVA 2JEWA 1FNOA 4LQGA 1TF8A 2OR4A 5ELYA 1VGYA 1XRYA 3FVLA 1CG2A 4P44A 1LAPA 4A37A 5JGFA 2ZENA 4GM5A 4OKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPA A;  1AMP A;  3B2Y A;  2F7V A;  5LRK A;  1R3N A;  3PRT A;  1KWM A;  4MHN A;  2ZEO A;  2AFX A;  3DLJ A;  2PJA A;  4NFR A;  2V8V A;  2BCO A;  4C9V A;  4IAV A;  3PBB A;  3HUV A;  4MHY A;  1QQ9 A;  2HB6 A;  4X3R A;  2PRQ A;  3VH9 A;  3VAR A;  2J9A A;  4C8C A;  3ISZ A;  7CPA A;  4MCS A;  1AYE A;  3BI0 A;  3FMC A;  1EE3 P;  1ZG7 A;  3I1U A;  4NJQ A;  4P4D A;  1H8L A;  4UEZ A;  2DEA A;  3PB8 X;  2G9D A;  1Y7E A;  2PIY A;  4FWU A;  1XBU A;  2PJ2 A;  3DGV A;  3FX6 A;  1HEE A;  1VIX A;  3FJU A;  3EIF A;  4DUK A;  3IWW A;  4Q7A A;  4K3N A;  3KQX A;  1YSJ A;  5K8P A;  1DE4 C;  1R43 A;  4C8A A;  3KR4 A;  4ZX8 A;  4ZYQ A;  4C99 A;  4JYW A;  2AFZ A;  3GLJ A;  2C6P A;  3SJF A;  4ONW A;  3D67 A;  3FEE A;  4F9V A;  4DYO A;  2QYV A;  2AFO A;  1UWY A;  2WYR A;  3FEC A;  4B6Z A;  5JM6 A;  3TC8 A;  1WVM A;  4JZ0 A;  1ARM A;  4WJB A;  3B35 A;  4NGN A;  2PJ7 A;  3D4U A;  4NGR A;  1ZG8 A;  2ANP A;  2NYQ A;  4PQA A;  5K8O A;  3IEH A;  1RTQ A;  4MXU A;  1BPN A;  4ZI6 A;  4C9A A;  4MCR A;  3B3S A;  4EWT A;  1F57 A;  3KHX A;  2V8D A;  2ZEF A;  3HLP A;  2CF4 A;  2QVP A;  4OID A;  4H2K A;  1HDQ A;  3WAB A;  1VHO A;  3H8G A;  3D7G A;  1NSA A;  3IJ3 A;  4C85 A;  1Z8L A;  3B3W A;  2EK9 A;  3S9L A;  4P4F A;  2Q51 A;  4PXD A;  1YW6 A;  1TF9 A;  1Y9Z A;  1CP6 A;  3B3C A;  4TJV A;  4OC5 A;  1LFW A;  4X2T A;  3VTA A;  1XFO A;  3BHX A;  2PJ3 A;  3PB9 X;  1YW4 A;  1Y0Y A;  1Z2L A;  1CPS A;  1LAN A;  4P6Y A;  5LRG A;  2PVV A;  5LYL A;  3I6S A;  2XEG A;  3FED A;  3NH5 A;  5F09 A;  4NGQ A;  4EFD A;  3D7H A;  4R76 A;  2BO9 A;  3T8W A;  4P4E A;  3H8E A;  1ZLI A;  3NH4 A;  1BAV A;  3QNV A;  3ISX A;  1IGB A;  2XEJ A;  4W9Y A;  4OIW A;  2AFS A;  2ZEE A;  4C84 A;  3PB7 X;  2GLJ A;  3S9M A;  2V8G A;  1YLO A;  1Y0R A;  3D68 A;  3WC7 A;  1TKF A;  5LYD A;  4UF4 A;  3BI1 A;  4OP4 A;  3PBE A;  3V7Z A;  1VHE A;  4PXC A;  2PJ9 A;  3K2K A;  2ABZ A;  2GU2 A;  3SI2 A;  5D29 A;  2BOA A;  5I4M A;  3CT9 A;  2AFU A;  1CP7 A;  2PJ6 A;  3IIB A;  4A94 A;  4NJR A;  4NGS A;  4P4J A;  2IMO A;  4KSI A;  4R6T A;  3WT4 A;  3NFZ A;  4NGP A;  4OC1 A;  2CTC A;  4PPZ A;  4X8I A;  5HXD A;  2PJ1 A;  3IO1 A;  3SJE A;  3D7F A;  4O23 A;  1FT7 A;  6CPA A;  2HC9 A;  2ZOF A;  3B3V A;  2V77 A;  3JRU A;  4ZY0 A;  2WZN A;  2POK A;  1LOK A;  1PCA A;  3SJG A;  1CPX A;  3LMS A;  2V8H A;  4KNG E;  4C9R A;  2CIJ A;  1BLL E;  2PCU A;  2AFM A;  2ZEH A;  1ELM P;  2ZEL A;  3D7D A;  2Q43 A;  3FH4 A;  1PYT B;  1CBX A;  2CTB A;  1CX8 A;  3KL9 A;  1ZG9 A;  5K8N A;  2ZOG A;  1XJO A;  5HVF A;  3SJX A;  1ELL P;  3NH8 A;  5D8N A;  4FUU A;  4TNU A;  2Q4Z A;  3KZW A;  4ZY1 A;  4C86 A;  4A38 A;  4YWY A;  5THW A;  2JBJ A;  2OOT A;  1DTD A;  4MCQ A;  4NGT A;  4MRI A;  2XEF A;  1HDU A;  3KAS A;  2I3C A;  4R7M A;  3KHZ A;  3IC1 A;  4FBE A;  2EK8 A;  3NA6 A;  4MMO A;  3PFE A;  2PE3 A;  3PEI A;  4CDJ A;  4UIA A;  3V38 A;  4C8U A;  4WWV A;  3SI0 A;  2XEI A;  3BXM A;  3L2N A;  3RBU A;  4C9E A;  2NSM A;  4DJL A;  3MN8 A;  4TJX A;  4BD9 A;  3D66 A;  4TWE A;  3K9T A;  3GB0 A;  2ZEM A;  1M4L A;  4MHZ A;  2C1C A;  3WC5 A;  2ZEP A;  2AFW A;  5K8M A;  3B3T A;  4PXE A;  2ZED A;  1TXR A;  2FVG A;  1ZLH A;  1LCP A;  1TKJ A;  5LYI A;  2PIZ A;  4IHM A;  4ZX9 A;  2PJB A;  2JBK A;  1V6C A;  1BPM A;  2PVW A;  4OC0 A;  4EME A;  2PJ5 A;  4P4B A;  4Z65 A;  1QMU A;  1XF1 A;  4MCP A;  4C9U A;  3PB6 X;  3CPX A;  4C8F A;  5HVG A;  5JH9 A;  3IFE A;  4IK2 A;  3KI9 A;  4P10 A;  3KGQ A;  1LAM A;  2F8H A;  2ZEG A;  4FAI A;  2IJZ A;  3MRU A;  4RUH A;  3B7I A;  2PJ8 A;  4OME A;  2RB7 A;  2GLF A;  1JQG A;  2VL1 A;  3S9N A;  4PXB A;  5LYF A;  3CDX A;  4A39 A;  4OC2 A;  1OBR A;  3H8F A;  5CPA A;  5DS0 A;  2C6G A;  4NGM A;  4G1P A;  2PJ0 A;  2PJ4 A;  3N5F A;  4P45 A;  4MHP A;  1YME A;  4CDK A;  1F2P A;  3RAM A;  4R8F A;  5LRJ A;  3VAT A;  2GRE A;  4UEF A;  1Z5R A;  4CPA A;  4P4I A;  1Q7L A;  5HVH A;  1ARL A;  5IB9 A;  3FF3 A;  3ICU A;  4F9U A;  4OC4 A;  3PB4 X;  4F8Z A;  4C8P A;  2RFH A;  8CPA A;  4YU9 A;  4YN3 A;  1IY7 A;  3GUX A;  2C6C A;  3LWU A;  3RZA A;  4OC3 A;  1XMB A;  3KQZ A;  1TKH A;  2EWB A;  3KR5 A;  3I74 A;  4UIB A;  1F2O A;  3WC6 A;  3PFO A;  5CBM A;  4UEE A;  2PJC A;  2IQ6 A;  3SI1 A;  2O53 A;  5J1Q A;  4C8T A;  2QJ8 A;  4ZY2 A;  1GYT A;  3TX8 A;  2O4H A;  4AXV A;  2JEW A;  1FNO A;  4LQG A;  1TF8 A;  2OR4 A;  5ELY A;  1VGY A;  1XRY A;  3FVL A;  1CG2 A;  4P44 A;  1LAP A;  4A37 A;  5JGF A;  2ZEN A;  4GM5 A;  4OKO A; 
#chains in the Genus database with same CATH topology
 3CPA A;  4ZBG A;  1AMP A;  3B2Y A;  2VZZ A;  1EZA A;  2F7V A;  5LRK A;  1R3N A;  4II9 A;  1NSL A;  3PRT A;  2QIR A;  1Z4E A;  1KWM A;  4MHN A;  2ZEO A;  3BUX B;  4MHD A;  4MFL A;  2AFX A;  1Q2Y A;  2GIV A;  4JLY A;  3T9Y A;  3T90 A;  1M6V B;  2CY2 A;  4R57 A;  3DLJ A;  2PJA A;  4NFR A;  4PSX A;  1KEE B;  2V8V A;  2BCO A;  1Q2D A;  4IAV A;  1OZP A;  1NXJ A;  4C9V A;  1LRZ A;  2ATR A;  3HUV A;  3PBB A;  3R1K A;  4MHY A;  1QQ9 A;  4NF1 A;  4Y49 C;  4B11 A;  2HB6 A;  3QAH A;  3BUO B;  3TLG A;  4C68 A;  2PC1 A;  4X3R A;  2PRQ A;  3NE7 A;  3VH9 A;  3TLG B;  2ZPA A;  3VAR A;  2D0P A;  4UWI A;  2J9A A;  4C8C A;  1QSO A;  3BUN B;  3D2P A;  4EYS A;  2BSW A;  3CXP A;  3C26 A;  3ISZ A;  4B5O A;  4R3L A;  4U9Y A;  7CPA A;  2OLS A;  4MCS A;  1AYE A;  4ZGY B;  3H4Q A;  3SXO A;  4COB A;  3BI0 A;  2Q44 A;  1DIK A;  3FMC A;  5A28 A;  3VRO A;  1EE3 P;  1ZG7 A;  3I1U A;  4NJQ A;  3W6X A;  4CS0 B;  4C2Y A;  4P4D A;  1KUY A;  1H8L A;  1QSM A;  2Y0M A;  4UEZ A;  3VGO A;  2DEA A;  2VXK A;  2REF A;  4FD4 A;  5HKY A;  3PB8 X;  2G9D A;  1CE8 B;  2XPL A;  1Y7E A;  2G0B A;  3K4I A;  2Y1N A;  2PIY A;  4OAE A;  2DIK A;  4FWU A;  1XBU A;  2PJ2 A;  3OB1 B;  1HEE A;  1PUA A;  1VIX A;  3DGV A;  3FJU A;  3FX6 A;  3EIF A;  2B58 A;  4DUK A;  3IWW A;  2D4P A;  5AGE A;  4KVO E;  4E0A A;  4Q7A A;  4PK2 A;  4K3N A;  4BBH A;  1XE4 A;  3KQX A;  2Q04 A;  1YSJ A;  3G3S A;  3VWD A;  4CGL A;  5K8O A;  5K8P A;  1IID A;  2EO8 A;  1DE4 C;  1R43 A;  2FCK A;  4UWJ A;  1Q2C A;  2B4B A;  3KR4 A;  4MBU A;  4XNH B;  4ZX8 A;  4ZYQ A;  2YJV A;  4C99 A;  2PR1 A;  4JYW A;  2AFZ A;  3GLJ A;  4KOV A;  3FRM A;  2C6P A;  1S60 A;  4FD6 A;  3SJF A;  2C27 A;  4ONW A;  4AG7 A;  3RNZ A;  4AG9 A;  2JDC A;  3D67 A;  2YNC C;  1B47 A;  3FEE A;  3S6F A;  4XPD C;  4F9V A;  5J8C A;  3I3G A;  4DYO A;  4YRH A;  4KOX A;  2X0S A;  1XOV A;  2QYV A;  5H86 A;  5IX3 A;  2B4D A;  3TO9 A;  2AFO A;  1UWY A;  2WYR A;  3FEC A;  5FVJ A;  2B4D B;  4B6Z A;  1VBH A;  5JM6 A;  1WK4 A;  3TC8 A;  4A31 A;  4MFJ A;  2Y1M A;  1WVM A;  2P0W A;  4JZ0 A;  1ARM A;  4A4B A;  3SHP A;  2Z11 A;  1YLE A;  3IU1 A;  4H1H A;  4WJB A;  3B35 A;  4NGN A;  1RO5 A;  2PJ7 A;  2ZW6 A;  2P6G A;  4NGR A;  1ZG8 A;  3HPG G;  3D4U A;  4M6G A;  2ANP A;  2NYQ A;  4Q38 A;  5F46 A;  3OAK A;  3PP9 A;  1L0C A;  2OZU A;  4JXQ A;  2XPN A;  2OZH A;  4HNX B;  3IEH A;  1RTQ A;  1KUX A;  4PQA A;  4MXU A;  1BPN A;  1AUG A;  4ZI6 A;  5J8F A;  4MCR A;  3B3S A;  4C9A A;  3FYN A;  4EWT A;  2DLA A;  4CO9 A;  3R9G A;  1F57 A;  2FL4 A;  2Z10 A;  3E0K A;  3KHX A;  2V8D A;  2ZEF A;  3HLP A;  4YFJ A;  4F0X A;  1EO0 A;  2CF4 A;  2QVP A;  1WJT A;  4M3S A;  3TLZ A;  2WSA A;  4KVX A;  4Y49 B;  3DNS A;  1YVK A;  2Z3P A;  3HPH E;  4KOY A;  1S3Z A;  4OID A;  2R7H A;  2GAN A;  1HDQ A;  4H2K A;  5AG5 A;  3R95 A;  3WAB A;  5HH1 A;  5EC4 A;  3F9K C;  1FY7 A;  1VHO A;  3H8G A;  1S7K A;  1R57 A;  3D7G A;  1NSA A;  3IJ3 A;  4C85 A;  1Z8L A;  3PFV A;  2EUI A;  4UCM A;  3B3W A;  2EK9 A;  3VRN A;  3S9L A;  4P4F A;  3TOA A;  2Q51 A;  4PXD A;  1YW6 A;  2JDD A;  1TF9 A;  1S7L A;  2Z3N A;  1CP6 A;  3B3C A;  1Y9Z A;  4TJV A;  4CAV A;  4OC5 A;  4B5P A;  1LFW A;  3S6K A;  4XNH C;  4ONU A;  4B5P B;  4CYN A;  3EXN A;  4X2T A;  4E8O A;  1JWQ A;  3VTA A;  2PRB A;  1XFO A;  1QSR A;  1U6M A;  3BHX A;  2PJ3 A;  3P2F A;  3PB9 X;  3S6H A;  3KRV A;  3BJ7 A;  3BUW B;  1YW4 A;  1Y0Y A;  2R8V A;  1Z2L A;  1CPS A;  1LAN A;  4P6Y A;  5LRG A;  5A27 A;  4KS9 A;  2Z0Z A;  2PVV A;  2PSW A;  2Q4V A;  4KLV A;  3LAC A;  5LYL A;  3I6S A;  3TLC A;  2XEG A;  3FED A;  3NH5 A;  4R87 A;  4ORF A;  5F47 A;  5EBV A;  4KZT A;  2CNT A;  3NE8 A;  5F09 A;  4XPD B;  2JLM A;  1C30 B;  5G21 A;  4NGQ A;  4CGM A;  4EFD A;  3D7H A;  5AG4 A;  1Q5X A;  1T36 B;  4R76 A;  2BO9 A;  2CXA A;  4P4E A;  1WWZ A;  3NFQ A;  3T8W A;  5DWN A;  3T07 A;  2P6F A;  4CZ1 A;  3O8Z A;  3H8E A;  1EZB A;  1ZLI A;  3NH4 A;  4AVB A;  5JPH A;  4R3K A;  1BAV A;  3EZA A;  1M1D A;  3QNV A;  3ISX A;  1M4I A;  3TLE A;  1IGB A;  2XEJ A;  4W9Y A;  4M85 A;  1ZL0 A;  4OIW A;  2AFS A;  2ZEE A;  4EVY A;  4C84 A;  4UFW A;  3PB7 X;  1SQH A;  2G3A A;  5AG7 A;  5G22 A;  2BL1 A;  2GLJ A;  3LD2 A;  4GPL B;  5FD8 A;  3S9M A;  3BUM B;  2Q4Y A;  2V8G A;  2JEV A;  1YLO A;  4UA3 A;  5HKZ A;  2BUE A;  4QBJ A;  3U1B A;  1Y0R A;  3D68 A;  3WC7 A;  1QST A;  3V8I A;  1TKF A;  2XPP A;  5LYD A;  1R61 A;  1VKC A;  4UF4 A;  3BI1 A;  4OP4 A;  4PSW A;  1Y9K A;  3W91 A;  3PBE A;  1Y7R A;  2VEZ A;  3PGP A;  1VHE A;  3V7Z A;  1XMT A;  4PXC A;  4E94 A;  3EZE A;  4QC6 A;  1JDE A;  2PJ9 A;  3K2K A;  2HI6 A;  2ABZ A;  2GU2 A;  4AVA A;  2AE6 A;  2UV8 G;  4NEX A;  3SI2 A;  3I9S A;  4B12 A;  4XPK A;  2CNM A;  2WPW A;  5D29 A;  3R96 A;  2BOA A;  5I4M A;  2J8R A;  2MP0 A;  3CT9 A;  2AFU A;  4QUS A;  1KZF A;  1CP7 A;  2N3A B;  2PJ6 A;  3IIB A;  2B4J C;  2I00 A;  4A94 A;  4NJR A;  5AXI A;  4H6U A;  1M4G A;  3BJ8 A;  1RXT A;  4CYO A;  4COG A;  4MJX A;  5F1Y A;  3VWE A;  2ZXV A;  4NGS A;  4P4J A;  2IMO A;  4L8A A;  1A2Z A;  3TCV A;  4JVO A;  4BPX B;  4AB7 A;  4RN7 A;  2QEC A;  4KOR A;  4KSI A;  4R9M A;  4R6T A;  3WT4 A;  1IOI A;  4C2Z A;  3NFZ A;  5IR2 A;  4NGP A;  4OC1 A;  2WUU A;  1P0H A;  2CTC A;  4PPZ A;  3PZJ A;  4RI1 A;  4X8I A;  4M8D A;  5HXD A;  2PJ1 A;  3S6G A;  2Z3O A;  3IO1 A;  1MK4 A;  2OB0 A;  4LUA A;  4CAX A;  4JWP A;  3SJE A;  4IIX A;  3D7F A;  4A2Z A;  3GJZ A;  4O23 A;  1FT7 A;  3WR7 A;  6CPA A;  3W6S A;  2HC9 A;  2ZOF A;  4CGN A;  3B3V A;  4U9Z A;  3ZJ0 A;  2FS5 A;  1VBG A;  2V77 A;  3JRU A;  4ZY0 A;  1M44 A;  2WZN A;  3QAY A;  2Q7B A;  1IU8 A;  3FB3 A;  4KOU A;  1YGH A;  2POK A;  4HNW B;  5IV0 A;  1LOK A;  1P4N A;  1PCA A;  2J8N A;  3TYX A;  3SJG A;  1VHS A;  1CPX A;  3LMS A;  2Z3M A;  2V8H A;  4M6H A;  5E96 A;  2Z3L A;  4KNG E;  3NOJ A;  4C9R A;  3TLB A;  2CIJ A;  1BLL E;  1Y9W A;  2AFM A;  2PCU A;  3GY9 A;  1J3L A;  2ZEH A;  3G23 A;  4CGP A;  1ELM P;  2ZEL A;  2EZA A;  3TLY A;  3D7D A;  2AJ6 A;  4JD6 A;  2Q43 A;  5I0C A;  3R9E A;  3FH4 A;  1GHE A;  2A4N A;  4KOS A;  1PYT B;  2EZB A;  5EMI A;  1CBX A;  2CTB A;  4KUA A;  4C2X A;  1CX8 A;  1Z4R A;  2CNS A;  3T5M A;  3DR6 A;  2OH1 A;  1ZG9 A;  3JTK A;  3KL9 A;  5K8N A;  3DDD A;  2ZOG A;  3T0T A;  1XJO A;  3F5B A;  5HVF A;  3SJX A;  4LQ6 A;  2ODF A;  1YRE A;  3H5Z A;  1ELL P;  3NH8 A;  5D8N A;  4FUU A;  2O28 A;  1Z9E A;  4H6Z A;  3PT1 A;  5IB0 A;  4TNU A;  4L89 A;  5F5X A;  1Z8X A;  2Q4Z A;  3KZW A;  4ZY1 A;  5ISV A;  4CRZ B;  1MJA A;  4GXH A;  4C86 A;  3IU2 A;  4LX9 A;  4A38 A;  2KCW A;  2FIA A;  4YWY A;  2JBJ A;  5THW A;  2EZC A;  2OOT A;  1IOF A;  1J4J A;  1DTD A;  2BEI A;  4CAW A;  2B5G A;  4MCQ A;  4NGT A;  2PDO A;  2B5G B;  4MRI A;  4A32 A;  4CYQ A;  2XEF A;  1HDU A;  3KAS A;  2I3C A;  3FXT A;  2VZY A;  3TO7 A;  2Z3K A;  4R7M A;  4PK3 A;  3KHZ A;  5KTD A;  2Q7S A;  3IC1 A;  5JVL A;  4F6A A;  4FBE A;  2EK8 A;  4QVT A;  2VBQ A;  2D0O A;  3NA6 A;  2HRO A;  3DSB A;  1JDB C;  4MMO A;  4MI1 A;  4UCN A;  5F48 A;  3PFE A;  2ARH A;  3JVN A;  1YR0 A;  1I21 A;  1YX0 A;  2PE3 A;  2ZW7 A;  3PEI A;  4JXR A;  1C3O B;  4BTF A;  1Z9U A;  3SR3 A;  4UIA A;  4CDJ A;  5JYB A;  5C88 A;  1ZRS A;  3OB2 B;  1NMT A;  2FSR A;  3V38 A;  5KTA A;  3F0A A;  4C8U A;  4WWV A;  5HMN A;  4CGO A;  3SI0 A;  2XEI A;  2FIW A;  3BXM A;  1IYL A;  1MJ9 A;  5AG6 A;  4INJ A;  4RR2 B;  3RYO A;  2FXF A;  3G8W A;  3L2N A;  3RBU A;  4XPL A;  1CM0 A;  4C9E A;  2NSM A;  3OP0 A;  3HMJ G;  1YK3 A;  3CZX A;  3MN8 A;  4MFP A;  4MY3 A;  4MY0 A;  4BD9 A;  4DJL A;  2FE7 A;  4TJX A;  3D66 A;  3DR8 A;  2E28 A;  3IGR A;  1YQE A;  3GB0 A;  3K9T A;  4TWE A;  1FBV A;  2ZEM A;  4A33 A;  4F0Y A;  3TFY A;  1GGO A;  4KSF A;  4HNY B;  2I79 A;  3PLF B;  1N71 A;  1PU9 A;  2FM4 A;  1M4L A;  2ZW4 A;  4MHZ A;  5G20 A;  2DF5 A;  3TE4 A;  1I1D A;  2C1C A;  4KOW A;  2K5T A;  3WC5 A;  2ZEP A;  3VRP A;  4C8A A;  1ZO0 A;  4OAD A;  4MFZ A;  3D3S A;  3TTH A;  3EFA A;  2YNE A;  1S7N A;  2CBL A;  2AFW A;  3B3T A;  5K8M A;  3GYA A;  4PXE A;  2X7B A;  2ZED A;  4OLL A;  4CAF A;  1TXR A;  2FVG A;  3R9F A;  1ZLH A;  1LCP A;  1TKJ A;  5LYI A;  2PIZ A;  4FD7 A;  5F49 A;  2C5Q A;  4IHM A;  1IIC A;  2Q0Y A;  2PJB A;  4ZX9 A;  3GKR A;  3IWG A;  2JBK A;  4KVM E;  2ZW5 A;  4KLW A;  1V6C A;  1MJB A;  1BPM A;  4AVC A;  2PVW A;  4OC0 A;  4H89 A;  2PJ5 A;  4EME A;  4P4B A;  5G1Z A;  4A30 A;  2J8M A;  2VQY A;  4X5K A;  1QMU A;  4NCZ A;  2H5M A;  3TO6 A;  4Z65 A;  5DWM A;  1IB1 E;  1K4J A;  3OWC A;  1XF1 A;  4MCP A;  1VI4 A;  3PB6 X;  3CPX A;  2YJT A;  4MJ8 A;  4C9U A;  4C8F A;  1X10 A;  5HVG A;  5JH9 A;  3IFE A;  3KKW A;  4IK2 A;  3KI9 A;  4P10 A;  4PV6 A;  3KGQ A;  3T05 A;  2VKZ G;  1LAM A;  2F8H A;  1YVH A;  4A4C A;  2ZEG A;  3RO0 A;  4FAI A;  3BLN A;  2IJZ A;  3IWE A;  4BIN A;  2G3T A;  3SXN A;  4B13 A;  4HPS A;  2IL4 A;  4MI4 A;  2GFQ A;  3MRU A;  4GS4 A;  2DPT A;  2AUM A;  2R98 A;  4RUH A;  4CRY B;  3B7I A;  4BPU B;  4BPW B;  2PJ8 A;  2YGW A;  4UBR A;  3EO4 A;  3TT2 A;  4OME A;  3U88 C;  2RB7 A;  2WPX A;  4FD5 A;  1V0C A;  2GLF A;  2YND A;  4NXY A;  1JQG A;  2QML A;  2VL1 A;  3S9N A;  2NMT A;  2B0A A;  4PXB A;  3CXQ A;  3VRQ A;  5LYF A;  2DPS A;  3CDX A;  3EY5 A;  3A9L A;  4OC2 A;  1OBR A;  3GIU A;  3LOD A;  3N7Z A;  4A39 A;  3H8F A;  2AUN A;  3K9U A;  5CPA A;  5HKW A;  5J3X A;  4MFK A;  1XEB A;  4U5Y A;  1S5K A;  5DS0 A;  2C6G A;  1CJW A;  2GE3 A;  4NGM A;  1NE9 A;  3MGD A;  2B3U A;  4G1P A;  2DXQ A;  2FT0 A;  3B8G A;  4I49 A;  3QB8 A;  2PJ0 A;  4KOT A;  4Q36 A;  3UY5 A;  2PJ4 A;  4B14 A;  2PCN A;  3N5F A;  5F9M A;  4P45 A;  4MHP A;  2B3V A;  2D4O A;  1YME A;  4CAE A;  1F2P A;  3RAM A;  4CDK A;  1UFH A;  4K30 A;  3TLA A;  4R8F A;  3P2H A;  5LRJ A;  3VAT A;  2GRE A;  4UEF A;  1KUV A;  1Z5R A;  3D8P A;  4CPA A;  4P4I A;  5BY0 A;  4CYP A;  5BWA B;  1Q7L A;  5HVH A;  1ARL A;  5GCN A;  1IYK A;  5IB9 A;  1BXR B;  3ZZI A;  4A95 A;  5KTC A;  3FF3 A;  2PR8 A;  3ICU A;  2GP4 A;  4JJX A;  5JQ4 A;  5K99 A;  4F9U A;  1ON0 A;  4KUB A;  1B6B A;  2VI7 A;  4IIY A;  4OC4 A;  5CNP A;  4E5S A;  5F13 A;  3PB4 X;  4KSA A;  2R82 A;  3ZNI A;  1B87 A;  3D2M A;  4F8Z A;  2OU2 A;  2P6E A;  1XIX A;  4BMH A;  4C8P A;  1NBW A;  4E2A A;  1KBL A;  1KC7 A;  2RFH A;  4C7I A;  1I12 A;  4J3G A;  2EBJ A;  3TOB A;  8CPA A;  4YU9 A;  4YN3 A;  3VRR A;  1IY7 A;  3GUX A;  2C6C A;  3JUW A;  1TIQ A;  3LWU A;  4DNC A;  3RZA A;  4OC3 A;  1XMB A;  3KQZ A;  4NSQ A;  4UFV A;  4IF5 A;  1Z8W A;  1TKH A;  2EWB A;  3FIX A;  3KR5 A;  3I74 A;  4J0N A;  4UIB A;  1A9X B;  1F2O A;  3WC6 A;  3CXS A;  1S7F A;  3PFO A;  1BOB A;  5CBM A;  4UEE A;  2RC4 A;  1BO4 A;  2PJC A;  4IUS A;  2F5I A;  2IQ6 A;  4QB9 A;  3SI1 A;  2O53 A;  5J1Q A;  4C8T A;  2QJ8 A;  4ZY2 A;  3F8K A;  2REE A;  1GYT A;  4M6I A;  1Z8T A;  3TX8 A;  2O4H A;  4AXV A;  3C8O A;  2JEW A;  2EVN A;  3EC4 A;  1FNO A;  4RS2 A;  2R1I A;  4LQG A;  1TF8 A;  2HQY A;  2OR4 A;  4YGO A;  3EZB A;  5ELY A;  4HKF A;  1VGY A;  1CS0 B;  2HWG A;  5C82 A;  1M4D A;  1XRY A;  1YVO A;  3FVL A;  5H84 A;  4B10 A;  1CG2 A;  4P44 A;  1QSN A;  4MFQ A;  1LAP A;  4A37 A;  4UCP A;  2HV2 A;  2OZG A;  5JGF A;  2ZEN A;  4UFX A;  1ZYM A;  2XPO A;  3FBU A;  4C7H A;  2PQ8 A;  2HUZ A;  1XF8 A;  4GM5 A;  1X12 A;  3FNC A;  2YNC A;  4OKO A; 
#chains in the Genus database with same CATH homology
 3CPA A;  1AMP A;  3B2Y A;  2F7V A;  5LRK A;  1R3N A;  3PRT A;  1KWM A;  4MHN A;  2ZEO A;  2AFX A;  3DLJ A;  2PJA A;  4NFR A;  2V8V A;  2BCO A;  4C9V A;  4IAV A;  3PBB A;  3HUV A;  4MHY A;  1QQ9 A;  2HB6 A;  4X3R A;  2PRQ A;  3VH9 A;  3VAR A;  2J9A A;  4C8C A;  3ISZ A;  7CPA A;  4MCS A;  1AYE A;  3BI0 A;  3FMC A;  1EE3 P;  1ZG7 A;  3I1U A;  4NJQ A;  4P4D A;  1H8L A;  4UEZ A;  2DEA A;  3PB8 X;  2G9D A;  1Y7E A;  2PIY A;  4FWU A;  1XBU A;  2PJ2 A;  3DGV A;  3FX6 A;  1HEE A;  1VIX A;  3FJU A;  3EIF A;  4DUK A;  3IWW A;  4Q7A A;  4K3N A;  3KQX A;  1YSJ A;  5K8P A;  1DE4 C;  1R43 A;  4C8A A;  3KR4 A;  4ZX8 A;  4ZYQ A;  4C99 A;  4JYW A;  2AFZ A;  3GLJ A;  2C6P A;  3SJF A;  4ONW A;  3D67 A;  3FEE A;  4F9V A;  4DYO A;  2QYV A;  2AFO A;  1UWY A;  2WYR A;  3FEC A;  4B6Z A;  5JM6 A;  3TC8 A;  1WVM A;  4JZ0 A;  1ARM A;  4WJB A;  3B35 A;  4NGN A;  2PJ7 A;  3D4U A;  4NGR A;  1ZG8 A;  2ANP A;  2NYQ A;  4PQA A;  5K8O A;  3IEH A;  1RTQ A;  4MXU A;  1BPN A;  4ZI6 A;  4C9A A;  4MCR A;  3B3S A;  4EWT A;  1F57 A;  3KHX A;  2V8D A;  2ZEF A;  3HLP A;  2CF4 A;  2QVP A;  4OID A;  4H2K A;  1HDQ A;  3WAB A;  1VHO A;  3H8G A;  3D7G A;  1NSA A;  3IJ3 A;  4C85 A;  1Z8L A;  3B3W A;  2EK9 A;  3S9L A;  4P4F A;  2Q51 A;  4PXD A;  1YW6 A;  1TF9 A;  1Y9Z A;  1CP6 A;  3B3C A;  4TJV A;  4OC5 A;  1LFW A;  4X2T A;  3VTA A;  1XFO A;  3BHX A;  2PJ3 A;  3PB9 X;  1YW4 A;  1Y0Y A;  1Z2L A;  1CPS A;  1LAN A;  4P6Y A;  5LRG A;  2PVV A;  5LYL A;  3I6S A;  2XEG A;  3FED A;  3NH5 A;  5F09 A;  4NGQ A;  4EFD A;  3D7H A;  4R76 A;  2BO9 A;  3T8W A;  4P4E A;  3H8E A;  1ZLI A;  3NH4 A;  1BAV A;  3QNV A;  3ISX A;  1IGB A;  2XEJ A;  4W9Y A;  4OIW A;  2AFS A;  2ZEE A;  4C84 A;  3PB7 X;  2GLJ A;  3S9M A;  2V8G A;  1YLO A;  1Y0R A;  3D68 A;  3WC7 A;  1TKF A;  5LYD A;  4UF4 A;  3BI1 A;  4OP4 A;  3PBE A;  3V7Z A;  1VHE A;  4PXC A;  2PJ9 A;  3K2K A;  2ABZ A;  2GU2 A;  3SI2 A;  5D29 A;  2BOA A;  5I4M A;  3CT9 A;  2AFU A;  1CP7 A;  2PJ6 A;  3IIB A;  4A94 A;  4NJR A;  4NGS A;  4P4J A;  2IMO A;  4KSI A;  4R6T A;  3WT4 A;  3NFZ A;  5IR2 A;  4NGP A;  4OC1 A;  2CTC A;  4PPZ A;  4X8I A;  5HXD A;  2PJ1 A;  3IO1 A;  3SJE A;  3D7F A;  4O23 A;  1FT7 A;  6CPA A;  2HC9 A;  2ZOF A;  3B3V A;  2V77 A;  3JRU A;  4ZY0 A;  2WZN A;  2POK A;  1LOK A;  1PCA A;  3SJG A;  1CPX A;  3LMS A;  2V8H A;  4KNG E;  4C9R A;  2CIJ A;  1BLL E;  2PCU A;  2AFM A;  2ZEH A;  1ELM P;  2ZEL A;  3D7D A;  2Q43 A;  3FH4 A;  1PYT B;  1CBX A;  2CTB A;  1CX8 A;  3KL9 A;  1ZG9 A;  5K8N A;  2ZOG A;  1XJO A;  5HVF A;  3SJX A;  1ELL P;  3NH8 A;  5D8N A;  4FUU A;  4TNU A;  2Q4Z A;  3KZW A;  4ZY1 A;  4C86 A;  4A38 A;  4YWY A;  5THW A;  2JBJ A;  2OOT A;  1DTD A;  4MCQ A;  4NGT A;  4MRI A;  2XEF A;  1HDU A;  3KAS A;  2I3C A;  4R7M A;  3KHZ A;  3IC1 A;  4FBE A;  2EK8 A;  3NA6 A;  4MMO A;  3PFE A;  2PE3 A;  3PEI A;  4CDJ A;  4UIA A;  3V38 A;  4C8U A;  4WWV A;  3SI0 A;  2XEI A;  3BXM A;  3L2N A;  3RBU A;  4C9E A;  2NSM A;  4DJL A;  3MN8 A;  4TJX A;  4BD9 A;  3D66 A;  4TWE A;  3K9T A;  3GB0 A;  2ZEM A;  1M4L A;  4MHZ A;  2C1C A;  3WC5 A;  2ZEP A;  2AFW A;  5K8M A;  3B3T A;  4PXE A;  2ZED A;  1TXR A;  2FVG A;  1ZLH A;  1LCP A;  1TKJ A;  5LYI A;  2PIZ A;  2C5Q A;  4IHM A;  4ZX9 A;  2PJB A;  2JBK A;  1V6C A;  1BPM A;  2PVW A;  4OC0 A;  4EME A;  2PJ5 A;  4P4B A;  4Z65 A;  1QMU A;  1XF1 A;  4MCP A;  4C9U A;  3PB6 X;  3CPX A;  4C8F A;  5HVG A;  5JH9 A;  3IFE A;  4IK2 A;  3KI9 A;  4P10 A;  3KGQ A;  1LAM A;  2F8H A;  2ZEG A;  4FAI A;  2IJZ A;  3MRU A;  4RUH A;  3B7I A;  2PJ8 A;  4OME A;  2RB7 A;  2GLF A;  1JQG A;  2VL1 A;  3S9N A;  4PXB A;  5LYF A;  3CDX A;  4A39 A;  4OC2 A;  1OBR A;  3H8F A;  5CPA A;  5DS0 A;  2C6G A;  4NGM A;  4G1P A;  2PJ0 A;  2PJ4 A;  3N5F A;  4P45 A;  4MHP A;  1YME A;  4CDK A;  1F2P A;  3RAM A;  4R8F A;  5LRJ A;  3VAT A;  2GRE A;  4UEF A;  1Z5R A;  4CPA A;  4P4I A;  1Q7L A;  5HVH A;  1ARL A;  5IB9 A;  3FF3 A;  3ICU A;  2GP4 A;  4F9U A;  4OC4 A;  3PB4 X;  4F8Z A;  4C8P A;  2RFH A;  8CPA A;  4YU9 A;  4YN3 A;  1IY7 A;  3GUX A;  2C6C A;  3LWU A;  3RZA A;  4OC3 A;  1XMB A;  3KQZ A;  1TKH A;  2EWB A;  3KR5 A;  3I74 A;  4UIB A;  1F2O A;  3WC6 A;  3PFO A;  5CBM A;  4UEE A;  2PJC A;  2IQ6 A;  3SI1 A;  2O53 A;  5J1Q A;  4C8T A;  2QJ8 A;  4ZY2 A;  1GYT A;  3TX8 A;  2O4H A;  4AXV A;  2JEW A;  1FNO A;  4LQG A;  1TF8 A;  2OR4 A;  5ELY A;  1VGY A;  1XRY A;  3FVL A;  1CG2 A;  4P44 A;  1LAP A;  4A37 A;  5JGF A;  2ZEN A;  4GM5 A;  4OKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...