4P4EA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor mp1d
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4eA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4eA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4eA02
2AFMA 1ELMP 1LAMA 4OKOA 4OMEA 1HEEA 3SJFA 3D4UA 2PJ5A 2ZEGA 3FMCA 1IY7A 3PB4X 3D68A 2OOTA 1R3NA 1QQ9A 3PFEA 3D67A 3ISZA 3D7FA 1WVMA 4ZY1A 5K8OA 4OC4A 4P45A 4OC0A 1VHEA 3S9MA 4FUUA 4MHNA 1Y0RA 2AFWA 2J9AA 4P4FA 3B2YA 3IO1A 1CX8A 5LRKA 1BPMA 5HXDA 2JEWA 2IJZA 3PRTA 1LAPA 4YWYA 4KSIA 4A38A 4X8IA 1PCAA 4MCQA 3LWUA 3SJXA 3SJEA 2IQ6A 2PJ0A 1Z8LA 3D66A 2GLFA 5HVFA 4OC1A 1ZLHA 2PE3A 3TX8A 3IFEA 5I4MA 3GLJA 1XFOA 3WC5A 4NJRA 4YN3A 4C8TA 2I3CA 4BD9A 4F8ZA 2PJAA 4R6TA 4PPZA 4R8FA 1ELLP 2BOAA 2ZEOA 1F2OA 3WC7A 2ZEDA 1GYTA 2NYQA 4ONWA 1XBUA 4MHPA 3RZAA 5K8PA 3EIFA 4F9VA 2ANPA 1LOKA 1ZG7A 4C8UA 4R7MA 4CDJA 2GU2A 2PJ2A 3KQZA 1F2PA 4ZYQA 5LYIA 2WYRA 1ZG8A 2O4HA 4MRIA 3PEIA 1TKJA 1VGYA 5THWA 1BPNA 4FWUA 3B3SA 3KGQA 4Z65A 1QMUA 3L2NA 1CPXA 4OP4A 2ZEHA 1Y7EA 1VHOA 3B3CA 2AFZA 3PB6X 4EFDA 3VATA 4C8FA 4O23A 1DTDA 3D7DA 3KL9A 3PBBA 4C8AA 5DS0A 4ZX9A 3TC8A 1H8LA 3PBEA 4Q7AA 4OC5A 3H8EA 4C9VA 4P4JA 2ABZA 4P4DA 2XEGA 2RB7A 2V8VA 1TKHA 4EWTA 2BCOA 3KHZA 4EMEA 5JM6A 4UEZA 2G9DA 2O53A 5HVGA 4MCRA 2CF4A 4CPAA 3KR5A 4MCPA 2Q43A 4UEFA 4NGPA 5ELYA 2V8GA 2C6GA 3V38A 2RFHA 2AFOA 1YSJA 3VTAA 2PVWA 4FBEA 3N5FA 4A94A 2IMOA 4DUKA 1Z5RA 1EE3P 1XRYA 3H8FA 2PJBA 4P4BA 3KQXA 1CP6A 1YLOA 5CPAA 1LANA 3ISXA 2PJ7A 3SI2A 2FVGA 5JH9A 4TJVA 2PJ9A 1TKFA 1ZLIA 2HB6A 4P10A 4X2TA 3I1UA 5LYFA 2QVPA 2POKA 8CPAA 2PJCA 3DGVA 2ZENA 4AXVA 3IEHA 3CDXA 3GUXA 1V6CA 2ZELA 5LYDA 1LFWA 1JQGA 4P6YA 5F09A 2JBJA 3SI1A 1CP7A 2NSMA 2GLJA 4ZX8A 4TJXA 4NGRA 3ICUA 3NFZA 4IAVA 2EK8A 4OC3A 3CT9A 1TF8A 1Z2LA 3IIBA 2WZNA 3FJUA 4PQAA 3BHXA 3BI1A 4ZI6A 3B7IA 3IC1A 2AFSA 4KNGE 4ZY2A 4C9EA 3IWWA 2PJ3A 4CDKA 3RAMA 3HUVA 2ZEMA 3FX6A 3K2KA 4YU9A 4OC2A 2PIYA 2OR4A 4C86A 3B3WA 4MXUA 3SI0A 4C9AA 3NH5A 4WWVA 2V8DA 2PCUA 1OBRA 2XEJA 1F57A 4MMOA 2GREA 4UEEA 2ZEPA 1FT7A 3I6SA 4P4EA 1DE4C 1XJOA 1ARMA 4FAIA 4ZY0A 4X3RA 4PXEA 3B3TA 1XF1A 3FECA 1TXRA 2V8HA 2V77A 2PVVA 1AYEA 1PYTB 3WC6A 5D29A 4TNUA 4B6ZA 1KWMA 2PJ8A 3NA6A 1YW6A 4NGQA 3KASA 5IB9A 3KR4A 2EWBA 3LMSA 1YW4A 5K8MA 2PRQA 1XMBA 2F7VA 4PXBA 1ARLA 2HC9A 4TWEA 3VARA 4R76A 7CPAA 1UWYA 4C8PA 4GM5A 4C9UA 2ZOGA 4JYWA 1Y0YA 4A39A 2Q51A 4W9YA 5HVHA 5JGFA 2VL1A 2ZEFA 3T8WA 5J1QA 4MHZA 2QYVA 4K3NA 2QJ8A 5LRGA 3DLJA 4H2KA 4F9UA 1CPSA 3QNVA 3NH4A 4DJLA 1FNOA 3GB0A 2PIZA 3IJ3A 3MRUA 4UF4A 4C84A 4C99A 4P44A 3CPXA 1NSAA 4NGTA 4NFRA 2DEAA 4A37A 3V7ZA 3FF3A 1CG2A 4PXDA 3FH4A 3MN8A 2BO9A 4P4IA 4OIWA 2C6CA 1IGBA 4OIDA 2XEIA 5K8NA 1CBXA 2AFXA 3WT4A 2CTCA 1TF9A 4LQGA 2ZOFA 4IHMA 3D7HA 4C9RA 4NJQA 1Q7LA 1LCPA 2CIJA 2XEFA 4NGNA 3I74A 5LYLA 5CBMA 2F8HA 4NGSA 3JRUA 4G1PA 3FVLA 1BLLE 3KI9A 3CPAA 3KZWA 2PJ6A 4WJBA 3SJGA 3S9LA 4IK2A 2JBKA 2EK9A 1YMEA 3KHXA 1BAVA 3PB8X 4MHYA 5LRJA 3RBUA 2AFUA 6CPAA 3HLPA 1HDQA 3PFOA 3FEEA 3NH8A 3S9NA 3VH9A 1HDUA 4RUHA 4MCSA 1M4LA 1Y9ZA 3K9TA 3B3VA 2C6PA 1VIXA 2C1CA 3PB9X 1RTQA 4UIBA 3PB7X 1R43A 2PJ1A 5D8NA 2ZEEA 3B35A 1ZG9A 4C85A 3FEDA 3H8GA 3D7GA 3BXMA 4PXCA 1AMPA 2CTBA 4C8CA 4NGMA 4UIAA 2PJ4A 2Q4ZA 4DYOA 3WABA 4JZ0A 3BI0A
chains in the Genus database with same CATH superfamily
4MFPA 2HUZA 2AFMA 1ELMP 1LAMA 4OKOA 4OMEA 5H86A 1HEEA 5FVJA 2VZYA 3SJFA 1NBWA 3D4UA 3G8WA 1Q2DA 2PJ5A 2ZEGA 3BLNA 1IY7A 3ZNIA 3FMCA 3TTHA 4IIXA 1IICA 3D68A 3PB4X 2OOTA 2R98A 2O28A 1R3NA 1QQ9A 1QSNA 3D67A 1S7FA 1BO4A 3D7FA 1VKCA 3ISZA 2G0BA 3PFEA 4HPSA 4KOXA 2JDDA 2EUIA 3RYOA 3SXOA 1WVMA 4ORFA 4E8OA 4ZY1A 4NF1A 3NFQA 5AG7A 2X7BA 2XPPA 5K8OA 4CAXA 1KC7A 4OC4A 4OLLA 1VBGA 1XOVA 3ZZIA 4P45A 2PSWA 4OC0A 1VHEA 1YLEA 3PZJA 3V8IA 3BUMB 3D2PA 3S9MA 1U6MA 4FUUA 4MHNA 1Y0RA 2AFWA 2J9AA 4P4FA 2IL4A 3B2YA 3IO1A 1CX8A 3IWEA 4XPDC 5LRKA 4R9MA 4YGOA 1BPMA 2DPTA 5HXDA 1S7NA 4A33A 2FIWA 3TLEA 2JEWA 2IJZA 3PRTA 1LAPA 1XIXA 1JDEA 4BPXB 2CNMA 4YWYA 3TCVA 2FSRA 4KSIA 3TO7A 4U5YA 4A38A 2D4OA 1Y7RA 1PCAA 2R1IA 4KSAA 4X8IA 1J3LA 5F46A 4AVAA 4NXYA 1IOFA 4PSXA 2ZXVA 3S6FA 5I0CA 4MCQA 2GE3A 5HKZA 3LWUA 3SJXA 3SJEA 2IQ6A 2JEVA 3T07A 4MFJA 4XPDB 3TLGA 2PJ0A 4B11A 1CM0A 1Z8LA 4MI4A 2YNCC 3D66A 2GLFA 1R57A 5DWMA 3TLCA 1WWZA 3HMJG 4RN7A 2HQYA 5HVFA 3GY9A 4OC1A 1ZLHA 2PE3A 3TX8A 3IFEA 4OAEA 1B6BA 5I4MA 3GLJA 3R9FA 1XFOA 3E0KA 3WC5A 2FS5A 1YVKA 2GFQA 4NJRA 4YN3A 1IOIA 3IWGA 4JXRA 2I3CA 4BD9A 4F8ZA 4C8TA 2OU2A 2PJAA 4R6TA 1MJ9A 4PPZA 4R8FA 2Y1MA 1ELLP 3B8GA 2YGWA 1JDBC 3BUXB 2BOAA 2ZEOA 1F2OA 3WC7A 2C27A 1ZO0A 2ZEDA 1GYTA 3LD2A 2NYQA 1TIQA 4ONWA 1Z8WA 1IB1E 1XBUA 4MHPA 5DWNA 3RZAA 2Z3KA 5K8PA 4KOYA 1M4DA 3EIFA 1BXRB 4F9VA 4KLWA 2ANPA 1LOKA 4J3GA 4RI1A 1KEEB 2D0OA 3SR3A 1KUXA 3CXSA 1JWQA 3CXQA 1ZG7A 3LODA 2N3AB 1UFHA 3BJ7A 4UCMA 4R7MA 3OWCA 4C8UA 2J8NA 4HNXB 1S60A 2GU2A 2PJ2A 3GKRA 4CDJA 3FBUA 3KQZA 1F2PA 4C99A 4ZYQA 2XPNA 2CY2A 1FY7A 1XMTA 4JWPA 4AG7A 5LYIA 2WYRA 1ZG8A 3R1KA 5HMNA 2HROA 1N71A 2O4HA 3F5BA 2CNSA 4KLVA 1MK4A 2WUUA 4GS4A 4MRIA 4ZBGA 2PRBA 3PEIA 1A2ZA 1TKJA 1VGYA 5THWA 3EC4A 4KVME 1BPNA 1VI4A 4HKFA 2AE6A 2Z3PA 3DR6A 3EZBA 2G3AA 3P2FA 2B5GB 3EZAA 4JVOA 4FWUA 2A4NA 3F9KC 4JD6A 4NCZA 3B3SA 2HI6A 5AXIA 4A95A 1WK4A 3HPGG 3KGQA 1S7LA 3U1BA 1ZL0A 4Z65A 1B47A 1QMUA 3F8KA 3PGPA 4B5OA 3QAYA 1YVHA 5H84A 4B12A 1CJWA 3L2NA 1CPXA 4OP4A 4MBUA 1Q2YA 2Z10A 4AVCA 2D0PA 1YVOA 5EBVA 3U88C 2VEZA 1LRZA 2ZEHA 1Y7EA 1VHOA 2QMLA 2VQYA 3F0AA 4RR2B 3B3CA 2AFZA 3PB6X 4EFDA 4UFWA 3VATA 4C8FA 4M6IA 2Q7BA 4O23A 1DTDA 1KZFA 4H6UA 3D7DA 3PT1A 3KL9A 3PBBA 5DS0A 4ZX9A 4C8AA 1BOBA 3TC8A 1EZAA 1H8LA 4R3KA 3EFAA 2XPOA 3PBEA 3G3SA 4Q7AA 3TO9A 4OC5A 3H8EA 4CRYB 4P4JA 2ABZA 4P4DA 2XEGA 2ZW5A 2RB7A 4C2YA 4C9VA 5C88A 2AUMA 2V8VA 1TKHA 4XPLA 4EWTA 2BCOA 2P6FA 3FB3A 5HKYA 3KHZA 4EMEA 5JM6A 4UEZA 2G9DA 2O53A 3JTKA 2B58A 4PV6A 4COGA 5JVLA 4B5PA 5HVGA 4QB9A 4MCRA 2CF4A 4CPAA 3T05A 4H89A 4Q36A 1NMTA 3KR5A 4MCPA 2Q43A 1IYKA 5A28A 4E94A 4M6HA 4UEFA 4NGPA 5ELYA 2V8GA 3TOAA 2C6GA 5F13A 4KOWA 3V38A 2B3VA 2AFOA 2RFHA 1YSJA 2ZW7A 2PVWA 5KTAA 3VTAA 4FBEA 3TOBA 3N5FA 4A94A 2IMOA 4U9YA 1Z5RA 3BUNB 1EE3P 1P4NA 1XRYA 2EO8A 3H8FA 2PJBA 3P2HA 4P4BA 3KQXA 1CP6A 1YLOA 4H6ZA 4MFLA 5CPAA 3S6KA 3T90A 3DR8A 4M85A 1LANA 2K5TA 1MJAA 3ISXA 2PJ7A 3SI2A 3TLYA 5F49A 3VWDA 3OB2B 2FVGA 4LQ6A 5JH9A 1CE8B 4J0NA 2FM4A 2PJ9A 1TKFA 1ZLIA 2HB6A 2VZZA 4LX9A 4CAEA 1CS0B 4TJVA 1S3ZA 4YFJA 3C8OA 1I1DA 3W91A 2FE7A 4P10A 4X2TA 4CYPA 1QSOA 3I1UA 3IU2A 1Z4RA 5K99A 5LYFA 1YX0A 2WPWA 2QVPA 1PUAA 2POKA 2PQ8A 4AVBA 2OZUA 8CPAA 5JQ4A 1Z9UA 2VXKA 4QVTA 2F5IA 1XE4A 2PJCA 4KOVA 2RC4A 1M6VB 3DGVA 2ZENA 3GIUA 5IB0A 5J8FA 4AXVA 1Y9KA 2OZHA 2ZW4A 3IEHA 3CDXA 3GUXA 4MFKA 3C26A 4E2AA 2JDCA 4NEXA 1V6CA 2ZELA 2EVNA 5LYDA 2EZAA 2R7HA 4R87A 1LFWA 1JQGA 4P6YA 1A9XB 1RO5A 5F09A 1NE9A 3FIXA 1OZPA 2JBJA 2B4DA 2FT0A 2NMTA 3SI1A 3W6SA 4C2XA 4CGOA 1Q2CA 2AJ6A 1CP7A 4CAWA 4CYNA 1KBLA 2NSMA 2Y1NA 5FD8A 2GLJA 4ZX8A 2H5MA 3MGDA 2EBJA 4TJXA 3R96A 2PCNA 4NGRA 5KTCA 4FD5A 3ICUA 3NFZA 4IAVA 2B0AA 4CS0B 4L89A 4F6AA 1B87A 2R8VA 2EK8A 2Q4VA 1EZBA 4OC3A 4M6GA 3W6XA 3CT9A 1TF8A 1Z2LA 3IIBA 2WZNA 3IU1A 3FJUA 2ATRA 4FD7A 4PQAA 3D2MA 3BHXA 3BI1A 2I79A 5AG4A 2EZBA 4BPWB 4ZI6A 2BL1A 5J8CA 3B7IA 3IC1A 4A30A 2AFSA 2PC1A 3KKWA 3VRQA 3GJZA 4PSWA 4QUSA 4KNGE 4Q38A 4ZY2A 1YQEA 2Q04A 4UFVA 4BINA 3IWWA 2PJ3A 4F0YA 4C9EA 4CDKA 1S7KA 3RAMA 2HV2A 4KOSA 4EVYA 3VRNA 1M4GA 3HUVA 1WJTA 3EO4A 4K30A 2ZEMA 3FX6A 3K2KA 4UCPA 2G3TA 5AGEA 4YU9A 4B13A 3TFYA 4OC2A 2P0WA 2PIYA 1I12A 2Z3MA 3TLGB 1XF8A 3D8PA 5HH1A 2OR4A 2OLSA 4ONUA 3R95A 2CNTA 3HPHE 4FD6A 4CGPA 4C7HA 2J8RA 3T0TA 4C86A 3B3WA 4MXUA 4JXQA 3SI0A 1C3OB 4C9AA 3G23A 3OP0A 3TT2A 3VROA 3NH5A 4WWVA 2GIVA 3N7ZA 2V8DA 3KRVA 5F5XA 2PCUA 1OBRA 2XEJA 1F57A 2B4BA 2Z0ZA 2QIRA 3DDDA 4MMOA 2GREA 1M44A 1VHSA 3D3SA 3H5ZA 4UEEA 4KOTA 2ZEPA 2HWGA 1FT7A 3I6SA 4P4EA 1DE4C 3UY5A 1XJOA 1ARMA 2Q4YA 4FAIA 4ZY0A 4X3RA 4A32A 3ZJ0A 4PXEA 4UBRA 2BSWA 2Q7SA 3B3TA 4U9ZA 5F47A 1M1DA 1Z8TA 1XF1A 3FECA 2DXQA 1TXRA 1KUYA 3BUWB 2V8HA 2V77A 2PVVA 2GANA 1AYEA 1PYTB 5EMIA 3R9GA 3WC6A 4MI1A 4MJXA 2FXFA 5D29A 2WPXA 4A4BA 4TNUA 4B6ZA 4KZTA 1KWMA 1NSLA 2PJ8A 4MFQA 3NE7A 3NA6A 1YW6A 2YJTA 4PK2A 4NGQA 4UWJA 3KASA 3FNCA 5IB9A 2X0SA 3KR4A 5F9MA 2EWBA 4C7IA 4KSFA 3LMSA 1GGOA 1YW4A 4CYQA 2BEIA 5K8MA 2PRQA 1XMBA 2F7VA 1VBHA 4PXBA 1RXTA 4CAFA 2JLMA 1ZRSA 2DPSA 1ARLA 5BWAB 1QSRA 3TLAA 4BTFA 1IIDA 2PDOA 2REFA 3CZXA 2P6EA 1S5KA 1X12A 4MFZA 2XPLA 2HC9A 2I00A 4TWEA 2Z3LA 3GYAA 3IGRA 3VARA 4II9A 3PFVA 2PR8A 4CGLA 2GP4A 2WSAA 3VRPA 4B10A 2VBQA 4R76A 2DF5A 4AG9A 3S6GA 7CPAA 3TYXA 1UWYA 4F0XA 4GM5A 4C8PA 4CO9A 4C9UA 2ZOGA 4M8DA 4PK3A 5KTDA 4QBJA 3EY5A 4X5KA 1Z9EA 4JYWA 4BPUB 1IU8A 2FL4A 3K9UA 5E96A 3NE8A 3NOJA 1Y0YA 2Z3NA 1J4JA 2CBLA 4A39A 2Q51A 4COBA 4W9YA 5HVHA 5JGFA 2VL1A 2ZEFA 3FYNA 3T8WA 3TLBA 3VGOA 2D4PA 4Y49B 3SHPA 4MHZA 2QYVA 4K3NA 4BMHA 5J1QA 4DUKA 2QJ8A 3CXPA 5LRGA 3DLJA 1NXJA 4H2KA 4F9UA 4E5SA 1CPSA 5J3XA 3FRMA 4B5PB 1M4IA 2FIAA 3NH4A 3QNVA 4CRZB 2YNEA 4DJLA 4H1HA 1FNOA 2OZGA 3PP9A 4KUAA 3GB0A 4YRHA 2PIZA 5AG6A 3IJ3A 3OB1B 3MRUA 4IF5A 4KUBA 4UF4A 1DIKA 3EXNA 2DIKA 2YNCA 2VKZG 4P44A 2AUNA 4NSQA 4IIYA 3CPXA 5ISVA 1NSAA 4CGNA 4NGTA 3FXTA 4ZGYB 2C5QA 2Z11A 4KORA 4M3SA 2MP0A 3OAKA 1X10A 1YREA 4CYOA 2KCWA 3T5MA 4NFRA 2DEAA 5G22A 2J8MA 3WR7A 4R3LA 1Z4EA 3RO0A 4A37A 3V7ZA 3FF3A 1EO0A 1MJBA 3PLFB 4B14A 1CG2A 1YGHA 1SQHA 3TLZA 2QECA 4PXDA 3FH4A 3MN8A 2BO9A 2ZW6A 2CXAA 4P4IA 4EYSA 4OIWA 4R57A 2C6CA 1IGBA 3JVNA 4A4CA 4OIDA 2XEIA 2ZPAA 4UA3A 5K8NA 5IR2A 1CBXA 5JYBA 2AFXA 2Z3OA 3WT4A 5IX3A 2B3UA 4HNYB 3TE4A 5F48A 1R61A 1QSMA 4UCNA 2CTCA 2E28A 2ARHA 2UV8G 1TF9A 5G21A 4QC6A 4LQGA 2ZOFA 2REEA 2B5GA 4IHMA 5JPHA 4KVOE 5AG5A 3D7HA 1T36B 3EZEA 3K4IA 2PR1A 3QB8A 4C9RA 4NJQA 1Q7LA 4C68A 2P6GA 3DSBA 4CAVA 3H4QA 1LCPA 2CIJA 2XEFA 4NGNA 4KOUA 3R9EA 3I74A 4MHDA 5CBMA 2F8HA 4GPLB 1L0CA 5LYLA 5CNPA 4NGSA 2EZCA 4INJA 4CGMA 2B4DB 3JRUA 3A9LA 1P0HA 4G1PA 5IV0A 1PU9A 3FVLA 1BLLE 3KI9A 1Y9WA 1YR0A 2B4JC 2Q0YA 3CPAA 3KZWA 4AB7A 2R82A 2PJ6A 4WJBA 3SJGA 3S9LA 3TO6A 4IK2A 2JBKA 2EK9A 1YMEA 3KHXA 4RS2A 3JUWA 1XEBA 1AUGA 4KVXA 1BAVA 3PB8X 4JJXA 4MHYA 5LRJA 1FBVA 4MJ8A 3RBUA 2AFUA 2YNDA 4XNHC 6CPAA 4DNCA 1ON0A 4UWIA 3HLPA 1QSTA 4MY0A 2DLAA 1HDQA 4GXHA 3VWEA 3PFOA 1ZYMA 3FEEA 3NH8A 5G20A 4OADA 3S9NA 2BUEA 4L8AA 3VH9A 3VRRA 1HDUA 2OB0A 4KS9A 3O8ZA 4RUHA 4MCSA 1Z8XA 3BUOB 1M4LA 1Y9ZA 2Q44A 3K9TA 5C82A 2VI7A 5HKWA 2FCKA 3B3VA 2C6PA 3LACA 1Q5XA 1KUVA 4CZ1A 5G1ZA 5F1YA 2ODFA 1VIXA 2C1CA 3PB9X 4XPKA 2YJVA 1RTQA 4UIBA 1YK3A 1C30B 2OH1A 4XNHB 4FD4A 3SXNA 5BY0A 4MY3A 4JLYA 3PB7X 1K4JA 3RNZA 3I9SA 4E0AA 4I49A 5A27A 4C84A 1R43A 2Y0MA 1IYLA 2PJ1A 3BJ8A 4HNWB 2ZEEA 3B35A 5D8NA 1ZG9A 3I3GA 3FEDA 5EC4A 4C85A 3H8GA 4A31A 3D7GA 1V0CA 3BXMA 1GHEA 3DNSA 1AMPA 2CTBA 4PXCA 3S6HA 5GCNA 4BBHA 3T9YA 4C8CA 4NGMA 4A2ZA 4IUSA 4UFXA 4C2ZA 4LUAA 1I21A 4UIAA 2PJ4A 2Q4ZA 3QAHA 4Y49C 4JZ0A 3WABA 4DYOA 3BI0A
chains in the Genus database with same CATH topology
2AFMA 1ELMP 1LAMA 4OKOA 4OMEA 1HEEA 3SJFA 3D4UA 2PJ5A 2ZEGA 3FMCA 1IY7A 3PB4X 3D68A 2OOTA 1R3NA 1QQ9A 3PFEA 3D67A 3ISZA 3D7FA 1WVMA 4ZY1A 5K8OA 4OC4A 4P45A 4OC0A 1VHEA 3S9MA 4FUUA 4MHNA 1Y0RA 2AFWA 2J9AA 4P4FA 3B2YA 3IO1A 1CX8A 5LRKA 1BPMA 5HXDA 2JEWA 2IJZA 3PRTA 1LAPA 4YWYA 4KSIA 4A38A 4X8IA 1PCAA 4MCQA 3LWUA 3SJXA 3SJEA 2IQ6A 2PJ0A 1Z8LA 3D66A 2GLFA 5HVFA 4OC1A 1ZLHA 2PE3A 3TX8A 3IFEA 5I4MA 3GLJA 1XFOA 3WC5A 4NJRA 4YN3A 4C8TA 2I3CA 4BD9A 4F8ZA 2PJAA 4R6TA 4PPZA 4R8FA 1ELLP 2BOAA 2ZEOA 1F2OA 3WC7A 2ZEDA 1GYTA 2NYQA 4ONWA 1XBUA 4MHPA 3RZAA 5K8PA 3EIFA 4F9VA 2ANPA 1LOKA 1ZG7A 4C8UA 4R7MA 4CDJA 2GU2A 2PJ2A 3KQZA 1F2PA 4ZYQA 5LYIA 2WYRA 1ZG8A 2O4HA 4MRIA 3PEIA 1TKJA 1VGYA 5THWA 1BPNA 4FWUA 3B3SA 3KGQA 4Z65A 1QMUA 3L2NA 1CPXA 4OP4A 2ZEHA 1Y7EA 1VHOA 3B3CA 2AFZA 3PB6X 4EFDA 3VATA 4C8FA 4O23A 1DTDA 3D7DA 3KL9A 3PBBA 4C8AA 5DS0A 4ZX9A 3TC8A 1H8LA 3PBEA 4Q7AA 4OC5A 3H8EA 4C9VA 4P4JA 2ABZA 4P4DA 2XEGA 2RB7A 2V8VA 1TKHA 4EWTA 2BCOA 3KHZA 4EMEA 5JM6A 4UEZA 2G9DA 2O53A 5HVGA 4MCRA 2CF4A 4CPAA 3KR5A 4MCPA 2Q43A 4UEFA 4NGPA 5ELYA 2V8GA 2C6GA 3V38A 2RFHA 2AFOA 1YSJA 3VTAA 2PVWA 4FBEA 3N5FA 4A94A 2IMOA 4DUKA 1Z5RA 1EE3P 1XRYA 3H8FA 2PJBA 4P4BA 3KQXA 1CP6A 1YLOA 5CPAA 1LANA 3ISXA 2PJ7A 3SI2A 2FVGA 5JH9A 4TJVA 2PJ9A 1TKFA 1ZLIA 2HB6A 4P10A 4X2TA 3I1UA 5LYFA 2QVPA 2POKA 8CPAA 2PJCA 3DGVA 2ZENA 4AXVA 3IEHA 3CDXA 3GUXA 1V6CA 2ZELA 5LYDA 1LFWA 1JQGA 4P6YA 5F09A 2JBJA 3SI1A 1CP7A 2NSMA 2GLJA 4ZX8A 4TJXA 4NGRA 3ICUA 3NFZA 4IAVA 2EK8A 4OC3A 3CT9A 1TF8A 1Z2LA 3IIBA 2WZNA 3FJUA 4PQAA 3BHXA 3BI1A 4ZI6A 3B7IA 3IC1A 2AFSA 4KNGE 4ZY2A 4C9EA 3IWWA 2PJ3A 4CDKA 3RAMA 3HUVA 2ZEMA 3FX6A 3K2KA 4YU9A 4OC2A 2PIYA 2OR4A 4C86A 3B3WA 4MXUA 3SI0A 4C9AA 3NH5A 4WWVA 2V8DA 2PCUA 1OBRA 2XEJA 1F57A 4MMOA 2GREA 4UEEA 2ZEPA 1FT7A 3I6SA 4P4EA 1DE4C 1XJOA 1ARMA 4FAIA 4ZY0A 4X3RA 4PXEA 3B3TA 1XF1A 3FECA 1TXRA 2V8HA 2V77A 2PVVA 1AYEA 1PYTB 3WC6A 5D29A 4TNUA 4B6ZA 1KWMA 2PJ8A 3NA6A 1YW6A 4NGQA 3KASA 5IB9A 3KR4A 2EWBA 3LMSA 1YW4A 5K8MA 2PRQA 1XMBA 2F7VA 4PXBA 1ARLA 2HC9A 4TWEA 3VARA 2GP4A 4R76A 7CPAA 1UWYA 4C8PA 4GM5A 4C9UA 2ZOGA 4JYWA 1Y0YA 4A39A 2Q51A 4W9YA 5HVHA 5JGFA 2VL1A 2ZEFA 3T8WA 5J1QA 4MHZA 2QYVA 4K3NA 2QJ8A 5LRGA 3DLJA 4H2KA 4F9UA 1CPSA 3QNVA 3NH4A 4DJLA 1FNOA 3GB0A 2PIZA 3IJ3A 3MRUA 4UF4A 4C84A 4C99A 4P44A 3CPXA 1NSAA 4NGTA 2C5QA 4NFRA 2DEAA 4A37A 3V7ZA 3FF3A 1CG2A 4PXDA 3FH4A 3MN8A 2BO9A 4P4IA 4OIWA 2C6CA 1IGBA 4OIDA 2XEIA 5K8NA 5IR2A 1CBXA 2AFXA 3WT4A 2CTCA 1TF9A 4LQGA 2ZOFA 4IHMA 3D7HA 4C9RA 4NJQA 1Q7LA 1LCPA 2CIJA 2XEFA 4NGNA 3I74A 5LYLA 5CBMA 2F8HA 4NGSA 3JRUA 4G1PA 3FVLA 1BLLE 3KI9A 3CPAA 3KZWA 2PJ6A 4WJBA 3SJGA 3S9LA 4IK2A 2JBKA 2EK9A 1YMEA 3KHXA 1BAVA 3PB8X 4MHYA 5LRJA 3RBUA 2AFUA 6CPAA 3HLPA 1HDQA 3PFOA 3FEEA 3NH8A 3S9NA 3VH9A 1HDUA 4RUHA 4MCSA 1M4LA 1Y9ZA 3K9TA 3B3VA 2C6PA 1VIXA 2C1CA 3PB9X 1RTQA 4UIBA 3PB7X 1R43A 2PJ1A 5D8NA 2ZEEA 3B35A 1ZG9A 4C85A 3FEDA 3H8GA 3D7GA 3BXMA 4PXCA 1AMPA 2CTBA 4C8CA 4NGMA 4UIAA 2PJ4A 2Q4ZA 4DYOA 3WABA 4JZ0A 3BI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFM A;  1ELM P;  1LAM A;  4OKO A;  4OME A;  1HEE A;  3SJF A;  3D4U A;  2PJ5 A;  2ZEG A;  3FMC A;  1IY7 A;  3PB4 X;  3D68 A;  2OOT A;  1R3N A;  1QQ9 A;  3PFE A;  3D67 A;  3ISZ A;  3D7F A;  1WVM A;  4ZY1 A;  5K8O A;  4OC4 A;  4P45 A;  4OC0 A;  1VHE A;  3S9M A;  4FUU A;  4MHN A;  1Y0R A;  2AFW A;  2J9A A;  4P4F A;  3B2Y A;  3IO1 A;  1CX8 A;  5LRK A;  1BPM A;  5HXD A;  2JEW A;  2IJZ A;  3PRT A;  1LAP A;  4YWY A;  4KSI A;  4A38 A;  4X8I A;  1PCA A;  4MCQ A;  3LWU A;  3SJX A;  3SJE A;  2IQ6 A;  2PJ0 A;  1Z8L A;  3D66 A;  2GLF A;  5HVF A;  4OC1 A;  1ZLH A;  2PE3 A;  3TX8 A;  3IFE A;  5I4M A;  3GLJ A;  1XFO A;  3WC5 A;  4NJR A;  4YN3 A;  4C8T A;  2I3C A;  4BD9 A;  4F8Z A;  2PJA A;  4R6T A;  4PPZ A;  4R8F A;  1ELL P;  2BOA A;  2ZEO A;  1F2O A;  3WC7 A;  2ZED A;  1GYT A;  2NYQ A;  4ONW A;  1XBU A;  4MHP A;  3RZA A;  5K8P A;  3EIF A;  4F9V A;  2ANP A;  1LOK A;  1ZG7 A;  4C8U A;  4R7M A;  4CDJ A;  2GU2 A;  2PJ2 A;  3KQZ A;  1F2P A;  4ZYQ A;  5LYI A;  2WYR A;  1ZG8 A;  2O4H A;  4MRI A;  3PEI A;  1TKJ A;  1VGY A;  5THW A;  1BPN A;  4FWU A;  3B3S A;  3KGQ A;  4Z65 A;  1QMU A;  3L2N A;  1CPX A;  4OP4 A;  2ZEH A;  1Y7E A;  1VHO A;  3B3C A;  2AFZ A;  3PB6 X;  4EFD A;  3VAT A;  4C8F A;  4O23 A;  1DTD A;  3D7D A;  3KL9 A;  3PBB A;  4C8A A;  5DS0 A;  4ZX9 A;  3TC8 A;  1H8L A;  3PBE A;  4Q7A A;  4OC5 A;  3H8E A;  4C9V A;  4P4J A;  2ABZ A;  4P4D A;  2XEG A;  2RB7 A;  2V8V A;  1TKH A;  4EWT A;  2BCO A;  3KHZ A;  4EME A;  5JM6 A;  4UEZ A;  2G9D A;  2O53 A;  5HVG A;  4MCR A;  2CF4 A;  4CPA A;  3KR5 A;  4MCP A;  2Q43 A;  4UEF A;  4NGP A;  5ELY A;  2V8G A;  2C6G A;  3V38 A;  2RFH A;  2AFO A;  1YSJ A;  3VTA A;  2PVW A;  4FBE A;  3N5F A;  4A94 A;  2IMO A;  4DUK A;  1Z5R A;  1EE3 P;  1XRY A;  3H8F A;  2PJB A;  4P4B A;  3KQX A;  1CP6 A;  1YLO A;  5CPA A;  1LAN A;  3ISX A;  2PJ7 A;  3SI2 A;  2FVG A;  5JH9 A;  4TJV A;  2PJ9 A;  1TKF A;  1ZLI A;  2HB6 A;  4P10 A;  4X2T A;  3I1U A;  5LYF A;  2QVP A;  2POK A;  8CPA A;  2PJC A;  3DGV A;  2ZEN A;  4AXV A;  3IEH A;  3CDX A;  3GUX A;  1V6C A;  2ZEL A;  5LYD A;  1LFW A;  1JQG A;  4P6Y A;  5F09 A;  2JBJ A;  3SI1 A;  1CP7 A;  2NSM A;  2GLJ A;  4ZX8 A;  4TJX A;  4NGR A;  3ICU A;  3NFZ A;  4IAV A;  2EK8 A;  4OC3 A;  3CT9 A;  1TF8 A;  1Z2L A;  3IIB A;  2WZN A;  3FJU A;  4PQA A;  3BHX A;  3BI1 A;  4ZI6 A;  3B7I A;  3IC1 A;  2AFS A;  4KNG E;  4ZY2 A;  4C9E A;  3IWW A;  2PJ3 A;  4CDK A;  3RAM A;  3HUV A;  2ZEM A;  3FX6 A;  3K2K A;  4YU9 A;  4OC2 A;  2PIY A;  2OR4 A;  4C86 A;  3B3W A;  4MXU A;  3SI0 A;  4C9A A;  3NH5 A;  4WWV A;  2V8D A;  2PCU A;  1OBR A;  2XEJ A;  1F57 A;  4MMO A;  2GRE A;  4UEE A;  2ZEP A;  1FT7 A;  3I6S A;  4P4E A;  1DE4 C;  1XJO A;  1ARM A;  4FAI A;  4ZY0 A;  4X3R A;  4PXE A;  3B3T A;  1XF1 A;  3FEC A;  1TXR A;  2V8H A;  2V77 A;  2PVV A;  1AYE A;  1PYT B;  3WC6 A;  5D29 A;  4TNU A;  4B6Z A;  1KWM A;  2PJ8 A;  3NA6 A;  1YW6 A;  4NGQ A;  3KAS A;  5IB9 A;  3KR4 A;  2EWB A;  3LMS A;  1YW4 A;  5K8M A;  2PRQ A;  1XMB A;  2F7V A;  4PXB A;  1ARL A;  2HC9 A;  4TWE A;  3VAR A;  4R76 A;  7CPA A;  1UWY A;  4C8P A;  4GM5 A;  4C9U A;  2ZOG A;  4JYW A;  1Y0Y A;  4A39 A;  2Q51 A;  4W9Y A;  5HVH A;  5JGF A;  2VL1 A;  2ZEF A;  3T8W A;  5J1Q A;  4MHZ A;  2QYV A;  4K3N A;  2QJ8 A;  5LRG A;  3DLJ A;  4H2K A;  4F9U A;  1CPS A;  3QNV A;  3NH4 A;  4DJL A;  1FNO A;  3GB0 A;  2PIZ A;  3IJ3 A;  3MRU A;  4UF4 A;  4C84 A;  4C99 A;  4P44 A;  3CPX A;  1NSA A;  4NGT A;  4NFR A;  2DEA A;  4A37 A;  3V7Z A;  3FF3 A;  1CG2 A;  4PXD A;  3FH4 A;  3MN8 A;  2BO9 A;  4P4I A;  4OIW A;  2C6C A;  1IGB A;  4OID A;  2XEI A;  5K8N A;  1CBX A;  2AFX A;  3WT4 A;  2CTC A;  1TF9 A;  4LQG A;  2ZOF A;  4IHM A;  3D7H A;  4C9R A;  4NJQ A;  1Q7L A;  1LCP A;  2CIJ A;  2XEF A;  4NGN A;  3I74 A;  5LYL A;  5CBM A;  2F8H A;  4NGS A;  3JRU A;  4G1P A;  3FVL A;  1BLL E;  3KI9 A;  3CPA A;  3KZW A;  2PJ6 A;  4WJB A;  3SJG A;  3S9L A;  4IK2 A;  2JBK A;  2EK9 A;  1YME A;  3KHX A;  1BAV A;  3PB8 X;  4MHY A;  5LRJ A;  3RBU A;  2AFU A;  6CPA A;  3HLP A;  1HDQ A;  3PFO A;  3FEE A;  3NH8 A;  3S9N A;  3VH9 A;  1HDU A;  4RUH A;  4MCS A;  1M4L A;  1Y9Z A;  3K9T A;  3B3V A;  2C6P A;  1VIX A;  2C1C A;  3PB9 X;  1RTQ A;  4UIB A;  3PB7 X;  1R43 A;  2PJ1 A;  5D8N A;  2ZEE A;  3B35 A;  1ZG9 A;  4C85 A;  3FED A;  3H8G A;  3D7G A;  3BXM A;  4PXC A;  1AMP A;  2CTB A;  4C8C A;  4NGM A;  4UIA A;  2PJ4 A;  2Q4Z A;  4DYO A;  3WAB A;  4JZ0 A;  3BI0 A; 
#chains in the Genus database with same CATH topology
 4MFP A;  2HUZ A;  2AFM A;  1ELM P;  1LAM A;  4OKO A;  4OME A;  5H86 A;  1HEE A;  5FVJ A;  2VZY A;  3SJF A;  1NBW A;  3D4U A;  3G8W A;  1Q2D A;  2PJ5 A;  2ZEG A;  3BLN A;  1IY7 A;  3ZNI A;  3FMC A;  3TTH A;  4IIX A;  1IIC A;  3D68 A;  3PB4 X;  2OOT A;  2R98 A;  2O28 A;  1R3N A;  1QQ9 A;  1QSN A;  3D67 A;  1S7F A;  1BO4 A;  3D7F A;  1VKC A;  3ISZ A;  2G0B A;  3PFE A;  4HPS A;  4KOX A;  2JDD A;  2EUI A;  3RYO A;  3SXO A;  1WVM A;  4ORF A;  4E8O A;  4ZY1 A;  4NF1 A;  3NFQ A;  5AG7 A;  2X7B A;  2XPP A;  5K8O A;  4CAX A;  1KC7 A;  4OC4 A;  4OLL A;  1VBG A;  1XOV A;  3ZZI A;  4P45 A;  2PSW A;  4OC0 A;  1VHE A;  1YLE A;  3PZJ A;  3V8I A;  3BUM B;  3D2P A;  3S9M A;  1U6M A;  4FUU A;  4MHN A;  1Y0R A;  2AFW A;  2J9A A;  4P4F A;  2IL4 A;  3B2Y A;  3IO1 A;  1CX8 A;  3IWE A;  4XPD C;  5LRK A;  4R9M A;  4YGO A;  1BPM A;  2DPT A;  5HXD A;  1S7N A;  4A33 A;  2FIW A;  3TLE A;  2JEW A;  2IJZ A;  3PRT A;  1LAP A;  1XIX A;  1JDE A;  4BPX B;  2CNM A;  4YWY A;  3TCV A;  2FSR A;  4KSI A;  3TO7 A;  4U5Y A;  4A38 A;  2D4O A;  1Y7R A;  1PCA A;  2R1I A;  4KSA A;  4X8I A;  1J3L A;  5F46 A;  4AVA A;  4NXY A;  1IOF A;  4PSX A;  2ZXV A;  3S6F A;  5I0C A;  4MCQ A;  2GE3 A;  5HKZ A;  3LWU A;  3SJX A;  3SJE A;  2IQ6 A;  2JEV A;  3T07 A;  4MFJ A;  4XPD B;  3TLG A;  2PJ0 A;  4B11 A;  1CM0 A;  1Z8L A;  4MI4 A;  2YNC C;  3D66 A;  2GLF A;  1R57 A;  5DWM A;  3TLC A;  1WWZ A;  3HMJ G;  4RN7 A;  2HQY A;  5HVF A;  3GY9 A;  4OC1 A;  1ZLH A;  2PE3 A;  3TX8 A;  3IFE A;  4OAE A;  1B6B A;  5I4M A;  3GLJ A;  3R9F A;  1XFO A;  3E0K A;  3WC5 A;  2FS5 A;  1YVK A;  2GFQ A;  4NJR A;  4YN3 A;  1IOI A;  3IWG A;  4JXR A;  2I3C A;  4BD9 A;  4F8Z A;  4C8T A;  2OU2 A;  2PJA A;  4R6T A;  1MJ9 A;  4PPZ A;  4R8F A;  2Y1M A;  1ELL P;  3B8G A;  2YGW A;  1JDB C;  3BUX B;  2BOA A;  2ZEO A;  1F2O A;  3WC7 A;  2C27 A;  1ZO0 A;  2ZED A;  1GYT A;  3LD2 A;  2NYQ A;  1TIQ A;  4ONW A;  1Z8W A;  1IB1 E;  1XBU A;  4MHP A;  5DWN A;  3RZA A;  2Z3K A;  5K8P A;  4KOY A;  1M4D A;  3EIF A;  1BXR B;  4F9V A;  4KLW A;  2ANP A;  1LOK A;  4J3G A;  4RI1 A;  1KEE B;  2D0O A;  3SR3 A;  1KUX A;  3CXS A;  1JWQ A;  3CXQ A;  1ZG7 A;  3LOD A;  2N3A B;  1UFH A;  3BJ7 A;  4UCM A;  4R7M A;  3OWC A;  4C8U A;  2J8N A;  4HNX B;  1S60 A;  2GU2 A;  2PJ2 A;  3GKR A;  4CDJ A;  3FBU A;  3KQZ A;  1F2P A;  4C99 A;  4ZYQ A;  2XPN A;  2CY2 A;  1FY7 A;  1XMT A;  4JWP A;  4AG7 A;  5LYI A;  2WYR A;  1ZG8 A;  3R1K A;  5HMN A;  2HRO A;  1N71 A;  2O4H A;  3F5B A;  2CNS A;  4KLV A;  1MK4 A;  2WUU A;  4GS4 A;  4MRI A;  4ZBG A;  2PRB A;  3PEI A;  1A2Z A;  1TKJ A;  1VGY A;  5THW A;  3EC4 A;  4KVM E;  1BPN A;  1VI4 A;  4HKF A;  2AE6 A;  2Z3P A;  3DR6 A;  3EZB A;  2G3A A;  3P2F A;  2B5G B;  3EZA A;  4JVO A;  4FWU A;  2A4N A;  3F9K C;  4JD6 A;  4NCZ A;  3B3S A;  2HI6 A;  5AXI A;  4A95 A;  1WK4 A;  3HPG G;  3KGQ A;  1S7L A;  3U1B A;  1ZL0 A;  4Z65 A;  1B47 A;  1QMU A;  3F8K A;  3PGP A;  4B5O A;  3QAY A;  1YVH A;  5H84 A;  4B12 A;  1CJW A;  3L2N A;  1CPX A;  4OP4 A;  4MBU A;  1Q2Y A;  2Z10 A;  4AVC A;  2D0P A;  1YVO A;  5EBV A;  3U88 C;  2VEZ A;  1LRZ A;  2ZEH A;  1Y7E A;  1VHO A;  2QML A;  2VQY A;  3F0A A;  4RR2 B;  3B3C A;  2AFZ A;  3PB6 X;  4EFD A;  4UFW A;  3VAT A;  4C8F A;  4M6I A;  2Q7B A;  4O23 A;  1DTD A;  1KZF A;  4H6U A;  3D7D A;  3PT1 A;  3KL9 A;  3PBB A;  5DS0 A;  4ZX9 A;  4C8A A;  1BOB A;  3TC8 A;  1EZA A;  1H8L A;  4R3K A;  3EFA A;  2XPO A;  3PBE A;  3G3S A;  4Q7A A;  3TO9 A;  4OC5 A;  3H8E A;  4CRY B;  4P4J A;  2ABZ A;  4P4D A;  2XEG A;  2ZW5 A;  2RB7 A;  4C2Y A;  4C9V A;  5C88 A;  2AUM A;  2V8V A;  1TKH A;  4XPL A;  4EWT A;  2BCO A;  2P6F A;  3FB3 A;  5HKY A;  3KHZ A;  4EME A;  5JM6 A;  4UEZ A;  2G9D A;  2O53 A;  3JTK A;  2B58 A;  4PV6 A;  4COG A;  5JVL A;  4B5P A;  5HVG A;  4QB9 A;  4MCR A;  2CF4 A;  4CPA A;  3T05 A;  4H89 A;  4Q36 A;  1NMT A;  3KR5 A;  4MCP A;  2Q43 A;  1IYK A;  5A28 A;  4E94 A;  4M6H A;  4UEF A;  4NGP A;  5ELY A;  2V8G A;  3TOA A;  2C6G A;  5F13 A;  4KOW A;  3V38 A;  2B3V A;  2AFO A;  2RFH A;  1YSJ A;  2ZW7 A;  2PVW A;  5KTA A;  3VTA A;  4FBE A;  3TOB A;  3N5F A;  4A94 A;  2IMO A;  4U9Y A;  1Z5R A;  3BUN B;  1EE3 P;  1P4N A;  1XRY A;  2EO8 A;  3H8F A;  2PJB A;  3P2H A;  4P4B A;  3KQX A;  1CP6 A;  1YLO A;  4H6Z A;  4MFL A;  5CPA A;  3S6K A;  3T90 A;  3DR8 A;  4M85 A;  1LAN A;  2K5T A;  1MJA A;  3ISX A;  2PJ7 A;  3SI2 A;  3TLY A;  5F49 A;  3VWD A;  3OB2 B;  2FVG A;  4LQ6 A;  5JH9 A;  1CE8 B;  4J0N A;  2FM4 A;  2PJ9 A;  1TKF A;  1ZLI A;  2HB6 A;  2VZZ A;  4LX9 A;  4CAE A;  1CS0 B;  4TJV A;  1S3Z A;  4YFJ A;  3C8O A;  1I1D A;  3W91 A;  2FE7 A;  4P10 A;  4X2T A;  4CYP A;  1QSO A;  3I1U A;  3IU2 A;  1Z4R A;  5K99 A;  5LYF A;  1YX0 A;  2WPW A;  2QVP A;  1PUA A;  2POK A;  2PQ8 A;  4AVB A;  2OZU A;  8CPA A;  5JQ4 A;  1Z9U A;  2VXK A;  4QVT A;  2F5I A;  1XE4 A;  2PJC A;  4KOV A;  2RC4 A;  1M6V B;  3DGV A;  2ZEN A;  3GIU A;  5IB0 A;  5J8F A;  4AXV A;  1Y9K A;  2OZH A;  2ZW4 A;  3IEH A;  3CDX A;  3GUX A;  4MFK A;  3C26 A;  4E2A A;  2JDC A;  4NEX A;  1V6C A;  2ZEL A;  2EVN A;  5LYD A;  2EZA A;  2R7H A;  4R87 A;  1LFW A;  1JQG A;  4P6Y A;  1A9X B;  1RO5 A;  5F09 A;  1NE9 A;  3FIX A;  1OZP A;  2JBJ A;  2B4D A;  2FT0 A;  2NMT A;  3SI1 A;  3W6S A;  4C2X A;  4CGO A;  1Q2C A;  2AJ6 A;  1CP7 A;  4CAW A;  4CYN A;  1KBL A;  2NSM A;  2Y1N A;  5FD8 A;  2GLJ A;  4ZX8 A;  2H5M A;  3MGD A;  2EBJ A;  4TJX A;  3R96 A;  2PCN A;  4NGR A;  5KTC A;  4FD5 A;  3ICU A;  3NFZ A;  4IAV A;  2B0A A;  4CS0 B;  4L89 A;  4F6A A;  1B87 A;  2R8V A;  2EK8 A;  2Q4V A;  1EZB A;  4OC3 A;  4M6G A;  3W6X A;  3CT9 A;  1TF8 A;  1Z2L A;  3IIB A;  2WZN A;  3IU1 A;  3FJU A;  2ATR A;  4FD7 A;  4PQA A;  3D2M A;  3BHX A;  3BI1 A;  2I79 A;  5AG4 A;  2EZB A;  4BPW B;  4ZI6 A;  2BL1 A;  5J8C A;  3B7I A;  3IC1 A;  4A30 A;  2AFS A;  2PC1 A;  3KKW A;  3VRQ A;  3GJZ A;  4PSW A;  4QUS A;  4KNG E;  4Q38 A;  4ZY2 A;  1YQE A;  2Q04 A;  4UFV A;  4BIN A;  3IWW A;  2PJ3 A;  4F0Y A;  4C9E A;  4CDK A;  1S7K A;  3RAM A;  2HV2 A;  4KOS A;  4EVY A;  3VRN A;  1M4G A;  3HUV A;  1WJT A;  3EO4 A;  4K30 A;  2ZEM A;  3FX6 A;  3K2K A;  4UCP A;  2G3T A;  5AGE A;  4YU9 A;  4B13 A;  3TFY A;  4OC2 A;  2P0W A;  2PIY A;  1I12 A;  2Z3M A;  3TLG B;  1XF8 A;  3D8P A;  5HH1 A;  2OR4 A;  2OLS A;  4ONU A;  3R95 A;  2CNT A;  3HPH E;  4FD6 A;  4CGP A;  4C7H A;  2J8R A;  3T0T A;  4C86 A;  3B3W A;  4MXU A;  4JXQ A;  3SI0 A;  1C3O B;  4C9A A;  3G23 A;  3OP0 A;  3TT2 A;  3VRO A;  3NH5 A;  4WWV A;  2GIV A;  3N7Z A;  2V8D A;  3KRV A;  5F5X A;  2PCU A;  1OBR A;  2XEJ A;  1F57 A;  2B4B A;  2Z0Z A;  2QIR A;  3DDD A;  4MMO A;  2GRE A;  1M44 A;  1VHS A;  3D3S A;  3H5Z A;  4UEE A;  4KOT A;  2ZEP A;  2HWG A;  1FT7 A;  3I6S A;  4P4E A;  1DE4 C;  3UY5 A;  1XJO A;  1ARM A;  2Q4Y A;  4FAI A;  4ZY0 A;  4X3R A;  4A32 A;  3ZJ0 A;  4PXE A;  4UBR A;  2BSW A;  2Q7S A;  3B3T A;  4U9Z A;  5F47 A;  1M1D A;  1Z8T A;  1XF1 A;  3FEC A;  2DXQ A;  1TXR A;  1KUY A;  3BUW B;  2V8H A;  2V77 A;  2PVV A;  2GAN A;  1AYE A;  1PYT B;  5EMI A;  3R9G A;  3WC6 A;  4MI1 A;  4MJX A;  2FXF A;  5D29 A;  2WPX A;  4A4B A;  4TNU A;  4B6Z A;  4KZT A;  1KWM A;  1NSL A;  2PJ8 A;  4MFQ A;  3NE7 A;  3NA6 A;  1YW6 A;  2YJT A;  4PK2 A;  4NGQ A;  4UWJ A;  3KAS A;  3FNC A;  5IB9 A;  2X0S A;  3KR4 A;  5F9M A;  2EWB A;  4C7I A;  4KSF A;  3LMS A;  1GGO A;  1YW4 A;  4CYQ A;  2BEI A;  5K8M A;  2PRQ A;  1XMB A;  2F7V A;  1VBH A;  4PXB A;  1RXT A;  4CAF A;  2JLM A;  1ZRS A;  2DPS A;  1ARL A;  5BWA B;  1QSR A;  3TLA A;  4BTF A;  1IID A;  2PDO A;  2REF A;  3CZX A;  2P6E A;  1S5K A;  1X12 A;  4MFZ A;  2XPL A;  2HC9 A;  2I00 A;  4TWE A;  2Z3L A;  3GYA A;  3IGR A;  3VAR A;  4II9 A;  3PFV A;  2PR8 A;  4CGL A;  2GP4 A;  2WSA A;  3VRP A;  4B10 A;  2VBQ A;  4R76 A;  2DF5 A;  4AG9 A;  3S6G A;  7CPA A;  3TYX A;  1UWY A;  4F0X A;  4GM5 A;  4C8P A;  4CO9 A;  4C9U A;  2ZOG A;  4M8D A;  4PK3 A;  5KTD A;  4QBJ A;  3EY5 A;  4X5K A;  1Z9E A;  4JYW A;  4BPU B;  1IU8 A;  2FL4 A;  3K9U A;  5E96 A;  3NE8 A;  3NOJ A;  1Y0Y A;  2Z3N A;  1J4J A;  2CBL A;  4A39 A;  2Q51 A;  4COB A;  4W9Y A;  5HVH A;  5JGF A;  2VL1 A;  2ZEF A;  3FYN A;  3T8W A;  3TLB A;  3VGO A;  2D4P A;  4Y49 B;  3SHP A;  4MHZ A;  2QYV A;  4K3N A;  4BMH A;  5J1Q A;  4DUK A;  2QJ8 A;  3CXP A;  5LRG A;  3DLJ A;  1NXJ A;  4H2K A;  4F9U A;  4E5S A;  1CPS A;  5J3X A;  3FRM A;  4B5P B;  1M4I A;  2FIA A;  3NH4 A;  3QNV A;  4CRZ B;  2YNE A;  4DJL A;  4H1H A;  1FNO A;  2OZG A;  3PP9 A;  4KUA A;  3GB0 A;  4YRH A;  2PIZ A;  5AG6 A;  3IJ3 A;  3OB1 B;  3MRU A;  4IF5 A;  4KUB A;  4UF4 A;  1DIK A;  3EXN A;  2DIK A;  2YNC A;  2VKZ G;  4P44 A;  2AUN A;  4NSQ A;  4IIY A;  3CPX A;  5ISV A;  1NSA A;  4CGN A;  4NGT A;  3FXT A;  4ZGY B;  2C5Q A;  2Z11 A;  4KOR A;  4M3S A;  2MP0 A;  3OAK A;  1X10 A;  1YRE A;  4CYO A;  2KCW A;  3T5M A;  4NFR A;  2DEA A;  5G22 A;  2J8M A;  3WR7 A;  4R3L A;  1Z4E A;  3RO0 A;  4A37 A;  3V7Z A;  3FF3 A;  1EO0 A;  1MJB A;  3PLF B;  4B14 A;  1CG2 A;  1YGH A;  1SQH A;  3TLZ A;  2QEC A;  4PXD A;  3FH4 A;  3MN8 A;  2BO9 A;  2ZW6 A;  2CXA A;  4P4I A;  4EYS A;  4OIW A;  4R57 A;  2C6C A;  1IGB A;  3JVN A;  4A4C A;  4OID A;  2XEI A;  2ZPA A;  4UA3 A;  5K8N A;  5IR2 A;  1CBX A;  5JYB A;  2AFX A;  2Z3O A;  3WT4 A;  5IX3 A;  2B3U A;  4HNY B;  3TE4 A;  5F48 A;  1R61 A;  1QSM A;  4UCN A;  2CTC A;  2E28 A;  2ARH A;  2UV8 G;  1TF9 A;  5G21 A;  4QC6 A;  4LQG A;  2ZOF A;  2REE A;  2B5G A;  4IHM A;  5JPH A;  4KVO E;  5AG5 A;  3D7H A;  1T36 B;  3EZE A;  3K4I A;  2PR1 A;  3QB8 A;  4C9R A;  4NJQ A;  1Q7L A;  4C68 A;  2P6G A;  3DSB A;  4CAV A;  3H4Q A;  1LCP A;  2CIJ A;  2XEF A;  4NGN A;  4KOU A;  3R9E A;  3I74 A;  4MHD A;  5CBM A;  2F8H A;  4GPL B;  1L0C A;  5LYL A;  5CNP A;  4NGS A;  2EZC A;  4INJ A;  4CGM A;  2B4D B;  3JRU A;  3A9L A;  1P0H A;  4G1P A;  5IV0 A;  1PU9 A;  3FVL A;  1BLL E;  3KI9 A;  1Y9W A;  1YR0 A;  2B4J C;  2Q0Y A;  3CPA A;  3KZW A;  4AB7 A;  2R82 A;  2PJ6 A;  4WJB A;  3SJG A;  3S9L A;  3TO6 A;  4IK2 A;  2JBK A;  2EK9 A;  1YME A;  3KHX A;  4RS2 A;  3JUW A;  1XEB A;  1AUG A;  4KVX A;  1BAV A;  3PB8 X;  4JJX A;  4MHY A;  5LRJ A;  1FBV A;  4MJ8 A;  3RBU A;  2AFU A;  2YND A;  4XNH C;  6CPA A;  4DNC A;  1ON0 A;  4UWI A;  3HLP A;  1QST A;  4MY0 A;  2DLA A;  1HDQ A;  4GXH A;  3VWE A;  3PFO A;  1ZYM A;  3FEE A;  3NH8 A;  5G20 A;  4OAD A;  3S9N A;  2BUE A;  4L8A A;  3VH9 A;  3VRR A;  1HDU A;  2OB0 A;  4KS9 A;  3O8Z A;  4RUH A;  4MCS A;  1Z8X A;  3BUO B;  1M4L A;  1Y9Z A;  2Q44 A;  3K9T A;  5C82 A;  2VI7 A;  5HKW A;  2FCK A;  3B3V A;  2C6P A;  3LAC A;  1Q5X A;  1KUV A;  4CZ1 A;  5G1Z A;  5F1Y A;  2ODF A;  1VIX A;  2C1C A;  3PB9 X;  4XPK A;  2YJV A;  1RTQ A;  4UIB A;  1YK3 A;  1C30 B;  2OH1 A;  4XNH B;  4FD4 A;  3SXN A;  5BY0 A;  4MY3 A;  4JLY A;  3PB7 X;  1K4J A;  3RNZ A;  3I9S A;  4E0A A;  4I49 A;  5A27 A;  4C84 A;  1R43 A;  2Y0M A;  1IYL A;  2PJ1 A;  3BJ8 A;  4HNW B;  2ZEE A;  3B35 A;  5D8N A;  1ZG9 A;  3I3G A;  3FED A;  5EC4 A;  4C85 A;  3H8G A;  4A31 A;  3D7G A;  1V0C A;  3BXM A;  1GHE A;  3DNS A;  1AMP A;  2CTB A;  4PXC A;  3S6H A;  5GCN A;  4BBH A;  3T9Y A;  4C8C A;  4NGM A;  4A2Z A;  4IUS A;  4UFX A;  4C2Z A;  4LUA A;  1I21 A;  4UIA A;  2PJ4 A;  2Q4Z A;  3QAH A;  4Y49 C;  4JZ0 A;  3WAB A;  4DYO A;  3BI0 A; 
#chains in the Genus database with same CATH homology
 2AFM A;  1ELM P;  1LAM A;  4OKO A;  4OME A;  1HEE A;  3SJF A;  3D4U A;  2PJ5 A;  2ZEG A;  3FMC A;  1IY7 A;  3PB4 X;  3D68 A;  2OOT A;  1R3N A;  1QQ9 A;  3PFE A;  3D67 A;  3ISZ A;  3D7F A;  1WVM A;  4ZY1 A;  5K8O A;  4OC4 A;  4P45 A;  4OC0 A;  1VHE A;  3S9M A;  4FUU A;  4MHN A;  1Y0R A;  2AFW A;  2J9A A;  4P4F A;  3B2Y A;  3IO1 A;  1CX8 A;  5LRK A;  1BPM A;  5HXD A;  2JEW A;  2IJZ A;  3PRT A;  1LAP A;  4YWY A;  4KSI A;  4A38 A;  4X8I A;  1PCA A;  4MCQ A;  3LWU A;  3SJX A;  3SJE A;  2IQ6 A;  2PJ0 A;  1Z8L A;  3D66 A;  2GLF A;  5HVF A;  4OC1 A;  1ZLH A;  2PE3 A;  3TX8 A;  3IFE A;  5I4M A;  3GLJ A;  1XFO A;  3WC5 A;  4NJR A;  4YN3 A;  4C8T A;  2I3C A;  4BD9 A;  4F8Z A;  2PJA A;  4R6T A;  4PPZ A;  4R8F A;  1ELL P;  2BOA A;  2ZEO A;  1F2O A;  3WC7 A;  2ZED A;  1GYT A;  2NYQ A;  4ONW A;  1XBU A;  4MHP A;  3RZA A;  5K8P A;  3EIF A;  4F9V A;  2ANP A;  1LOK A;  1ZG7 A;  4C8U A;  4R7M A;  4CDJ A;  2GU2 A;  2PJ2 A;  3KQZ A;  1F2P A;  4ZYQ A;  5LYI A;  2WYR A;  1ZG8 A;  2O4H A;  4MRI A;  3PEI A;  1TKJ A;  1VGY A;  5THW A;  1BPN A;  4FWU A;  3B3S A;  3KGQ A;  4Z65 A;  1QMU A;  3L2N A;  1CPX A;  4OP4 A;  2ZEH A;  1Y7E A;  1VHO A;  3B3C A;  2AFZ A;  3PB6 X;  4EFD A;  3VAT A;  4C8F A;  4O23 A;  1DTD A;  3D7D A;  3KL9 A;  3PBB A;  4C8A A;  5DS0 A;  4ZX9 A;  3TC8 A;  1H8L A;  3PBE A;  4Q7A A;  4OC5 A;  3H8E A;  4C9V A;  4P4J A;  2ABZ A;  4P4D A;  2XEG A;  2RB7 A;  2V8V A;  1TKH A;  4EWT A;  2BCO A;  3KHZ A;  4EME A;  5JM6 A;  4UEZ A;  2G9D A;  2O53 A;  5HVG A;  4MCR A;  2CF4 A;  4CPA A;  3KR5 A;  4MCP A;  2Q43 A;  4UEF A;  4NGP A;  5ELY A;  2V8G A;  2C6G A;  3V38 A;  2RFH A;  2AFO A;  1YSJ A;  3VTA A;  2PVW A;  4FBE A;  3N5F A;  4A94 A;  2IMO A;  4DUK A;  1Z5R A;  1EE3 P;  1XRY A;  3H8F A;  2PJB A;  4P4B A;  3KQX A;  1CP6 A;  1YLO A;  5CPA A;  1LAN A;  3ISX A;  2PJ7 A;  3SI2 A;  2FVG A;  5JH9 A;  4TJV A;  2PJ9 A;  1TKF A;  1ZLI A;  2HB6 A;  4P10 A;  4X2T A;  3I1U A;  5LYF A;  2QVP A;  2POK A;  8CPA A;  2PJC A;  3DGV A;  2ZEN A;  4AXV A;  3IEH A;  3CDX A;  3GUX A;  1V6C A;  2ZEL A;  5LYD A;  1LFW A;  1JQG A;  4P6Y A;  5F09 A;  2JBJ A;  3SI1 A;  1CP7 A;  2NSM A;  2GLJ A;  4ZX8 A;  4TJX A;  4NGR A;  3ICU A;  3NFZ A;  4IAV A;  2EK8 A;  4OC3 A;  3CT9 A;  1TF8 A;  1Z2L A;  3IIB A;  2WZN A;  3FJU A;  4PQA A;  3BHX A;  3BI1 A;  4ZI6 A;  3B7I A;  3IC1 A;  2AFS A;  4KNG E;  4ZY2 A;  4C9E A;  3IWW A;  2PJ3 A;  4CDK A;  3RAM A;  3HUV A;  2ZEM A;  3FX6 A;  3K2K A;  4YU9 A;  4OC2 A;  2PIY A;  2OR4 A;  4C86 A;  3B3W A;  4MXU A;  3SI0 A;  4C9A A;  3NH5 A;  4WWV A;  2V8D A;  2PCU A;  1OBR A;  2XEJ A;  1F57 A;  4MMO A;  2GRE A;  4UEE A;  2ZEP A;  1FT7 A;  3I6S A;  4P4E A;  1DE4 C;  1XJO A;  1ARM A;  4FAI A;  4ZY0 A;  4X3R A;  4PXE A;  3B3T A;  1XF1 A;  3FEC A;  1TXR A;  2V8H A;  2V77 A;  2PVV A;  1AYE A;  1PYT B;  3WC6 A;  5D29 A;  4TNU A;  4B6Z A;  1KWM A;  2PJ8 A;  3NA6 A;  1YW6 A;  4NGQ A;  3KAS A;  5IB9 A;  3KR4 A;  2EWB A;  3LMS A;  1YW4 A;  5K8M A;  2PRQ A;  1XMB A;  2F7V A;  4PXB A;  1ARL A;  2HC9 A;  4TWE A;  3VAR A;  2GP4 A;  4R76 A;  7CPA A;  1UWY A;  4C8P A;  4GM5 A;  4C9U A;  2ZOG A;  4JYW A;  1Y0Y A;  4A39 A;  2Q51 A;  4W9Y A;  5HVH A;  5JGF A;  2VL1 A;  2ZEF A;  3T8W A;  5J1Q A;  4MHZ A;  2QYV A;  4K3N A;  2QJ8 A;  5LRG A;  3DLJ A;  4H2K A;  4F9U A;  1CPS A;  3QNV A;  3NH4 A;  4DJL A;  1FNO A;  3GB0 A;  2PIZ A;  3IJ3 A;  3MRU A;  4UF4 A;  4C84 A;  4C99 A;  4P44 A;  3CPX A;  1NSA A;  4NGT A;  2C5Q A;  4NFR A;  2DEA A;  4A37 A;  3V7Z A;  3FF3 A;  1CG2 A;  4PXD A;  3FH4 A;  3MN8 A;  2BO9 A;  4P4I A;  4OIW A;  2C6C A;  1IGB A;  4OID A;  2XEI A;  5K8N A;  5IR2 A;  1CBX A;  2AFX A;  3WT4 A;  2CTC A;  1TF9 A;  4LQG A;  2ZOF A;  4IHM A;  3D7H A;  4C9R A;  4NJQ A;  1Q7L A;  1LCP A;  2CIJ A;  2XEF A;  4NGN A;  3I74 A;  5LYL A;  5CBM A;  2F8H A;  4NGS A;  3JRU A;  4G1P A;  3FVL A;  1BLL E;  3KI9 A;  3CPA A;  3KZW A;  2PJ6 A;  4WJB A;  3SJG A;  3S9L A;  4IK2 A;  2JBK A;  2EK9 A;  1YME A;  3KHX A;  1BAV A;  3PB8 X;  4MHY A;  5LRJ A;  3RBU A;  2AFU A;  6CPA A;  3HLP A;  1HDQ A;  3PFO A;  3FEE A;  3NH8 A;  3S9N A;  3VH9 A;  1HDU A;  4RUH A;  4MCS A;  1M4L A;  1Y9Z A;  3K9T A;  3B3V A;  2C6P A;  1VIX A;  2C1C A;  3PB9 X;  1RTQ A;  4UIB A;  3PB7 X;  1R43 A;  2PJ1 A;  5D8N A;  2ZEE A;  3B35 A;  1ZG9 A;  4C85 A;  3FED A;  3H8G A;  3D7G A;  3BXM A;  4PXC A;  1AMP A;  2CTB A;  4C8C A;  4NGM A;  4UIA A;  2PJ4 A;  2Q4Z A;  4DYO A;  3WAB A;  4JZ0 A;  3BI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...