4P4EA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor mp1d
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4eA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4eA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4eA02
4A37A 4OIWA 1HEEA 1BAVA 1UWYA 1DE4C 2PIYA 3CPXA 4NFRA 3PB4X 2WZNA 4R7MA 1QQ9A 1ARMA 3I74A 4JZ0A 3H8GA 5HVFA 4P6YA 1ARLA 3PFOA 2V8HA 4X2TA 4AXVA 2Q4ZA 2NYQA 4MCQA 3D4UA 2AFOA 1OBRA 1TF9A 3ISXA 3KASA 2Q43A 1H8LA 2PJ5A 4ZY1A 2ZEOA 3GLJA 4C9AA 2ANPA 2V77A 4OC0A 1M4LA 4C8FA 2V8GA 4A39A 2EWBA 4K3NA 2PJAA 1JQGA 2PJBA 3KHZA 1R3NA 2ZEGA 4UIBA 5F09A 3PBEA 4CPAA 4MHNA 4UIAA 1LAMA 1DTDA 4PXBA 4A94A 2G9DA 4ZY0A 3B3WA 2Q51A 3FJUA 3VH9A 3PB8X 2JBJA 3IC1A 4BD9A 1YW4A 3D68A 2PJ2A 4NGRA 3IEHA 2CIJA 4P4IA 3PFEA 5LYDA 3QNVA 4DUKA 4A38A 3FEDA 3KHXA 5K8MA 5D29A 3FF3A 5K8PA 2OOTA 3B35A 2GU2A 4FWUA 5JM6A 1CX8A 4JYWA 2AFMA 1LFWA 2BCOA 5D8NA 5JH9A 4C8AA 3SI0A 1YW6A 4P4FA 3B2YA 4KNGE 1VIXA 4NGTA 3NA6A 2C6PA 4YWYA 5IB9A 1IY7A 1XBUA 4OC4A 2HB6A 1ELLP 4Z65A 4NJQA 4UEEA 1XFOA 4ZY2A 3D7DA 1CPXA 1TKJA 4CDKA 4OIDA 2QYVA 3SJEA 2ZOFA 5LRJA 1ZG9A 2PVVA 5JGFA 2IQ6A 3VTAA 4R6TA 1XMBA 1Y0RA 3S9NA 1QMUA 5HXDA 3IIBA 1Q7LA 3NH5A 3IJ3A 3I1UA 2CF4A 1TKFA 1EE3P 5CPAA 1ELMP 4NJRA 3SJFA 2ZEPA 4P45A 2BOAA 3BXMA 2PJ7A 1LAPA 2ZELA 3TX8A 4MRIA 3B7IA 5J1QA 1CG2A 2BO9A 1CBXA 2J9AA 4IAVA 4C9EA 2ZEHA 2DEAA 3BI0A 3SI2A 2OR4A 4C85A 3NH8A 1KWMA 2PJCA 2PJ3A 3WC6A 2IJZA 4FBEA 4EWTA 4C9RA 3PEIA 2ZEDA 1TKHA 3RZAA 4WJBA 3TC8A 3WC7A 4OC1A 4MXUA 4TWEA 4NGMA 3RBUA 1F57A 2ZEEA 4WWVA 1IGBA 4C8TA 2NSMA 1ZG7A 3K2KA 4X8IA 1Z8LA 3WC5A 2XEGA 1BPMA 4O23A 4NGNA 3S9LA 1TF8A 4P10A 3KZWA 4PPZA 4YU9A 2PJ4A 2AFSA 4UF4A 4DJLA 2HC9A 2FVGA 1BPNA 1XF1A 2ABZA 5I4MA 4B6ZA 2C1CA 5HVHA 3PB7X 3EIFA 4OC2A 1R43A 2ZOGA 3KL9A 2GREA 4C86A 1FNOA 3IWWA 2PJ1A 3MN8A 3B3SA 4P44A 1FT7A 3BI1A 2WYRA 3VARA 3WT4A 4FUUA 3PBBA 3FX6A 4F8ZA 5LYLA 4CDJA 4C99A 4KSIA 3CPAA 1LOKA 4TJVA 4FAIA 1HDUA 2IMOA 3NH4A 2PJ0A 1LANA 3FECA 4G1PA 3NFZA 1LCPA 3KQZA 3V38A 2ZEFA 3DGVA 2RB7A 3CDXA 1CPSA 1YMEA 4C8CA 4EMEA 3SJGA 1ZLIA 4NGPA 2CTBA 1Y0YA 3GB0A 2V8VA 2POKA 4MHZA 4IHMA 4R76A 4GM5A 5DS0A 2C6CA 4UEFA 4MHPA 4C84A 3ICUA 2QVPA 4C8UA 3T8WA 3IFEA 3FEEA 3CT9A 2AFWA 4OC5A 7CPAA 2GLJA 3D7FA 2AFZA 3KGQA 4EFDA 4OC3A 3GUXA 8CPAA 3VATA 3IO1A 1RTQA 4P4BA 1AYEA 4MCPA 3V7ZA 2GLFA 3WABA 1PYTB 4UEZA 3PB9X 2PCUA 2O53A 2AFUA 4TNUA 4W9YA 1TXRA 3KI9A 4C9VA 4RUHA 3B3CA 2QJ8A 3D7GA 3SJXA 4X3RA 4ZX9A 3PB6X 2XEIA 3D66A 2PIZA 4NGSA 4OMEA 1XRYA 3LWUA 1YSJA 4R8FA 4IK2A 6CPAA 4TJXA 2AFXA 1YLOA 4C9UA 1AMPA 5HVGA 2ZENA 5LYFA 4MMOA 4F9UA 3RAMA 3KR4A 1VHOA 3L2NA 4MHYA 1VHEA 4ZX8A 1Z2LA 3I6SA 3DLJA 1XJOA 2EK8A 5LYIA 1F2PA 3ISZA 3KQXA 4MCRA 3PRTA 2ZEMA 3D7HA 4P4DA 3FMCA 1WVMA 5LRGA 2CTCA 3FH4A 1Y7EA 2C6GA 2O4HA 3S9MA 3SI1A 5ELYA 1CP7A 1CP6A 2XEJA 4ZI6A 1ZG8A 2I3CA 2PVWA 1F2OA 4ONWA 4PXEA 1Y9ZA 4H2KA 3BHXA 1Z5RA 2EK9A 4C8PA 4P4EA 3D67A 5LRKA 2XEFA 2JEWA 4ZYQA 3HLPA 1V6CA 4LQGA 3MRUA 3JRUA 2PRQA 3KR5A 1HDQA 3HUVA 4Q7AA 4PQAA 4P4JA 2F7VA 2VL1A 4PXCA 5THWA 1ZLHA 2PE3A 2V8DA 1PCAA 5CBMA 5K8OA 2PJ8A 3FVLA 4YN3A 3H8FA 1GYTA 3H8EA 4NGQA 1NSAA 4OP4A 2PJ9A 4F9VA 4OKOA 3B3VA 3N5FA 2JBKA 2RFHA 4MCSA 1BLLE 2F8HA 3K9TA 2PJ6A 5K8NA 4PXDA 4DYOA 3B3TA 3LMSA 1VGYA
chains in the Genus database with same CATH superfamily
2VEZA 4A37A 1XOVA 3LODA 4OIWA 2P0WA 1MJAA 4C68A 1HEEA 1BAVA 5EBVA 1UWYA 4NF1A 2Z3NA 2MP0A 1DE4C 2PIYA 3TLYA 3CPXA 4NFRA 1CJWA 3TFYA 3PB4X 4AG9A 3FXTA 4KLWA 2B4JC 3BJ8A 1NSLA 2WZNA 1IU8A 4R7MA 1EZBA 4RN7A 1QQ9A 1ARMA 3I74A 4JZ0A 2B3UA 2Q0YA 2CXAA 3H8GA 2H5MA 5G1ZA 5HVFA 4JJXA 2FSRA 3SR3A 3S6GA 3F5BA 4KOVA 3GYAA 5G21A 3W6SA 5A27A 2C5QA 4AVCA 4P6YA 1ARLA 3PFOA 2V8HA 4X2TA 4KOYA 4AXVA 2OU2A 2Q4ZA 4UA3A 2NYQA 4MCQA 4MFQA 3W91A 3F0AA 4JVOA 3D4UA 2AFOA 1OBRA 2YJTA 1TF9A 3ISXA 1LRZA 3KASA 2OZHA 4BTFA 2Q43A 2JEVA 4XPDB 1H8LA 4B13A 2VI7A 4ZGYB 1YK3A 2PJ5A 4ZY1A 3GJZA 2ZEOA 3GLJA 2Q4YA 3GKRA 4KORA 1XE4A 1IOIA 2B3VA 2F5IA 5GCNA 3TLEA 4C9AA 2CNTA 4H89A 1RO5A 2PR1A 2ANPA 1A2ZA 2V77A 1Q2YA 4OC0A 5BWAB 1M4LA 4C8FA 2V8GA 3DNSA 2J8NA 2OZGA 4R57A 4A39A 1CM0A 2EWBA 3ZZIA 2WSAA 4XPKA 4K3NA 5J8CA 2PJAA 3T0TA 1JQGA 1YX0A 2PJBA 5G20A 3KHZA 4CYQA 1R3NA 3TO6A 3C26A 2ZEGA 4J3GA 4UIBA 2JDDA 2BEIA 5F09A 3PBEA 3MGDA 4M85A 4QB9A 4CPAA 1KEEB 3TLGA 2ZW4A 3G8WA 1WWZA 4MHNA 4UIAA 1LAMA 2B5GA 1VBHA 1DTDA 3IU1A 4PXBA 3PZJA 3O8ZA 3T07A 3VRPA 2R1IA 4CYPA 3OAKA 4A94A 1YR0A 1NBWA 2Z3PA 2G9DA 1ON0A 4ZY0A 1QSTA 3B3WA 2Q51A 3FJUA 1B47A 4H6UA 5F47A 4ZBGA 3PB8X 3VH9A 2JBJA 3IC1A 5C82A 1V0CA 4PK3A 3TCVA 4BD9A 3CZXA 1YW4A 2DXQA 3BLNA 5JQ4A 4CDJA 2P6GA 3D68A 2PJ2A 3D3SA 4NGRA 1MJBA 3IEHA 2CIJA 4L8AA 3DSBA 1TIQA 4P4IA 1R57A 3I9SA 3HPHE 1ZO0A 1XEBA 2UV8G 4X5KA 3PFEA 4AVAA 5JYBA 1X12A 2ODFA 5LYDA 3JUWA 3QNVA 4DUKA 4QC6A 5EC4A 2Y1MA 4A38A 3P2HA 4CAXA 3FEDA 2PC1A 1JDBC 1M6VB 3KHXA 3R9EA 2WPWA 5K8MA 1MK4A 5D29A 3FF3A 2YNDA 1RXTA 4F6AA 4FD5A 5K8PA 4A4BA 4BPXB 2OOTA 3B35A 2R82A 2B4DB 2CNSA 2GU2A 4FWUA 5JM6A 1CX8A 4JYWA 1IOFA 2AFMA 1M1DA 1T36B 1LFWA 2BCOA 4I49A 4A2ZA 4M6HA 4Q38A 2FL4A 1B6BA 3QAYA 4MY0A 2WUUA 5D8NA 5JH9A 5IR2A 3R1KA 1Y9WA 4C8AA 4OADA 3EC4A 3SI0A 1YW6A 2GFQA 4P4FA 3B2YA 4KNGE 2ZXVA 2NMTA 4A33A 1VIXA 4NGTA 4UFXA 3NA6A 3NOJA 2C6PA 2FCKA 4M6GA 3TLAA 4YWYA 2PQ8A 5IB9A 4KVXA 2HROA 1IY7A 1Z4RA 4QVTA 5HKYA 4UFVA 4BBHA 1XBUA 4OC4A 2HB6A 1BO4A 4MI4A 4E2AA 5H84A 2JDCA 3TLGB 5ISVA 5DWMA 3G23A 4CRZB 4KSAA 1ELLP 5F46A 4Z65A 2B5GB 3RNZA 5AGEA 4NJQA 4UEEA 3EZEA 1K4JA 3K4IA 2EBJA 4C7HA 1XFOA 3TT2A 4ZY2A 4HKFA 3D7DA 4MJXA 1CPXA 1TKJA 3ZJ0A 4OIDA 2QYVA 4CDKA 1YVOA 3OB1B 3DR8A 4H6ZA 4JXQA 3SJEA 1Z9UA 2ZOFA 5LRJA 4J0NA 5KTAA 2Q04A 1ZG9A 1A9XB 3PGPA 3F8KA 4IUSA 2X0SA 5FD8A 2E28A 3VRRA 2PVVA 2Y1NA 2I00A 4GXHA 4M3SA 2IQ6A 4BINA 4R6TA 5JGFA 1XMBA 3EZAA 3VTAA 1EZAA 1Y0RA 3U1BA 3S9NA 1QMUA 5F48A 5HXDA 3IIBA 1Q7LA 2ZW7A 2G0BA 1B87A 3NH5A 4MHDA 3IJ3A 2PDOA 2Z0ZA 1Z8WA 1TKFA 1EE3P 1Z8TA 1ELMP 2CF4A 3D2PA 3I1UA 5CPAA 2DIKA 2D4PA 4NJRA 3SJFA 2ZEPA 1IB1E 4NXYA 1EO0A 4P45A 4KOUA 1GGOA 1FBVA 4MFKA 2BOAA 3BXMA 4NCZA 2PJ7A 4IF5A 5F49A 1LAPA 2REEA 3NE8A 2OB0A 3KKWA 3IWEA 3OWCA 2ZELA 4UCMA 4F0YA 3TX8A 1PU9A 4MRIA 2BL1A 1N71A 3B7IA 4JLYA 5J1QA 1CG2A 1WJTA 2B4DA 2BO9A 5EMIA 5F5XA 1CBXA 2OH1A 4DNCA 2J9AA 1QSNA 5AG7A 4IAVA 4CAEA 4KUBA 4F0XA 4C9EA 4HNXB 2ZEHA 3CXPA 2DEAA 3VGOA 2FS5A 3BI0A 1M4GA 5C88A 3SI2A 2OR4A 3FIXA 4C85A 2EUIA 3NH8A 1KWMA 2PJCA 2PJ3A 4C7IA 3WC6A 2ZW6A 2IJZA 1KUVA 4FBEA 4MFLA 4NEXA 4KOWA 4RS2A 2ARHA 4EWTA 3R9GA 4C9RA 2P6FA 3PEIA 2ZEDA 1TKHA 2VBQA 3RZAA 4WJBA 3TC8A 5E96A 3WC7A 4OC1A 4KVOE 4MXUA 4TWEA 4NGMA 3RBUA 1F57A 4U9YA 5AG4A 2G3TA 2ZEEA 3RYOA 4WWVA 3OP0A 1R61A 4CRYB 2DLAA 1IGBA 2BUEA 2CNMA 2CBLA 1J3LA 4B10A 4C8TA 3T9YA 2NSMA 1ZG7A 3K2KA 2ZPAA 3EO4A 4X8IA 1Z8LA 4M8DA 2N3AB 3OB2B 4UWJA 4JXRA 2Q7BA 2Z11A 4CGLA 4COBA 4EYSA 3WC5A 1S7KA 3TLBA 2XEGA 3R9FA 1BPMA 3S6HA 3DDDA 4XNHB 3QB8A 4NGNA 4O23A 1CS0B 3S9LA 3FBUA 1TF8A 4MFZA 4P10A 3KZWA 4CAWA 3BUXB 4COGA 4FD4A 1YLEA 3TTHA 2FM4A 1P4NA 1XIXA 4PPZA 4PSWA 4YU9A 2PJ4A 1M44A 5F1YA 2IL4A 2AFSA 4NSQA 4UF4A 2P6EA 3FYNA 4DJLA 1NXJA 2RC4A 2HC9A 2FVGA 1BPNA 4CYNA 4UBRA 2ABZA 5IX3A 5J8FA 5I4MA 1XF1A 5K99A 1QSRA 2X7BA 4KLVA 2C1CA 4B6ZA 3PB7X 5HVHA 2GP4A 3EIFA 2QIRA 4OAEA 4OC2A 4R3KA 1YQEA 1R43A 4QBJA 3S6FA 2ZOGA 3KL9A 2GREA 2HWGA 4C86A 3IU2A 2GANA 3S6KA 1FNOA 5DWNA 1I12A 3IWWA 4LX9A 1S5KA 4B5PA 4IIYA 2PJ1A 2HQYA 1JWQA 3MN8A 4CAFA 3B3SA 3P2FA 4KSFA 3TOBA 4P44A 1FT7A 1MJ9A 3BI1A 2WYRA 3TO9A 3VARA 4E5SA 3WT4A 2Z3MA 2QMLA 1OZPA 3PBBA 3FX6A 4FUUA 4KOTA 4F8ZA 1IYLA 1PUAA 1YVKA 2PRBA 4CS0B 4L89A 2J8MA 4MFPA 5LYLA 2HI6A 3TYXA 3CXQA 4C99A 2GIVA 4KSIA 3CPAA 1LOKA 4TJVA 4FAIA 2Z3OA 2PCNA 1HDUA 4YGOA 1I21A 2IMOA 2G3AA 1IYKA 1S3ZA 4RR2B 3TLCA 3NH4A 2PJ0A 1LANA 3FECA 3VROA 4G1PA 2EVNA 3NFZA 3LACA 3IGRA 2PSWA 1LCPA 3KQZA 1KUXA 4HNWB 2ZEFA 4KOSA 3V38A 3DGVA 2OLSA 2OZUA 2RB7A 3CDXA 3V8IA 1CPSA 1C30B 4C2YA 5IB0A 3PP9A 1YMEA 2HV2A 3BUNB 1L0CA 3QAHA 4R87A 4A30A 4OLLA 4AG7A 4C8CA 3CXSA 4EMEA 1QSMA 3SJGA 1S7FA 4XPDC 1Z9EA 3FRMA 1ZLIA 4XPLA 4NGPA 2YNCA 4FD6A 2ATRA 1Q2CA 2JLMA 2CTBA 1FY7A 4K30A 2K5TA 3R96A 1BXRB 3WR7A 1CE8B 1I1DA 1JDEA 5F9MA 4MI1A 3BUMB 1Y0YA 3GB0A 2R7HA 2POKA 2V8VA 1NE9A 4M6IA 1Q2DA 5BY0A 4MHZA 4UCNA 4CO9A 4IHMA 4R76A 4GM5A 5DS0A 3EY5A 2C6CA 2B0AA 1S7LA 4UEFA 3HPGG 4KZTA 4UFWA 4MHPA 4C84A 3ICUA 2AJ6A 4PSXA 2QVPA 4C8UA 2FIAA 3SHPA 5JVLA 4U5YA 3FB3A 2DPTA 3FEEA 3IFEA 3T8WA 4U9ZA 3CT9A 2AFWA 5AG6A 5FVJA 2AUNA 1XMTA 3BUWB 4OC5A 3NFQA 2AE6A 2D4OA 4YFJA 4B5PB 7CPAA 2GLJA 3D7FA 2C27A 2AFZA 3KGQA 3LD2A 4EFDA 4OC3A 3GUXA 4FD7A 4PK2A 1GHEA 4KOXA 8CPAA 2B4BA 2BSWA 3PFVA 1SQHA 3VATA 1U6MA 3IO1A 1NMTA 1RTQA 3VWDA 4CAVA 4P4BA 1AYEA 2Y0MA 4Y49C 1Z8XA 4MCPA 3NE7A 2GLFA 3V7ZA 3KRVA 4MFJA 3WABA 1PYTB 4UEZA 2XPLA 2DPSA 2KCWA 3EZBA 1KBLA 2FT0A 3E0KA 1Y9KA 3PB9X 1ZL0A 2PCUA 1YREA 2B58A 2O53A 2REFA 4BMHA 2AFUA 2Q4VA 4TNUA 4W9YA 3FNCA 1TXRA 4CGPA 1ZRSA 3IWGA 1DIKA 3KI9A 2FXFA 4C2ZA 4C9VA 2VKZG 4RUHA 2HUZA 3B3CA 1J4JA 4GPLB 3D7GA 1S7NA 1VKCA 2QJ8A 2EZCA 2D0OA 4INJA 5I0CA 4B11A 4A4CA 3SJXA 4X3RA 4RI1A 4ZX9A 4C2XA 5A28A 3PB6X 4A95A 3SXOA 2XEIA 3D66A 2PIZA 4NGSA 4KUAA 4OMEA 1XRYA 3D2MA 3I3GA 3LWUA 1YSJA 4R8FA 4IK2A 6CPAA 4TJXA 1IIDA 2AFXA 4B12A 4BPWB 1YLOA 2GE3A 2EZAA 4C9UA 1AMPA 1KUYA 2Z10A 1KZFA 1IICA 4B5OA 5HVGA 2FIWA 2CY2A 2ZENA 5LYFA 4MMOA 5IV0A 3BUOB 4HPSA 4F9UA 4PV6A 2O28A 3N7ZA 3RAMA 2PR8A 1YVHA 2R8VA 3KR4A 2A4NA 4B14A 3C8OA 1VHOA 3A9LA 1M4IA 3DR6A 3L2NA 4MHYA 1VHEA 3R95A 3UY5A 5HMNA 5HKWA 3BJ7A 1Z4EA 4ZX8A 1Z2LA 4AVBA 4CGMA 3DLJA 4LUAA 4EVYA 1XJOA 1WK4A 2EK8A 3I6SA 5LYIA 2XPOA 3VWEA 1F2PA 3ISZA 3KQXA 4MCRA 2VZZA 3PRTA 5J3XA 2R98A 2ZEMA 3D7HA 3PLFB 4JD6A 4JWPA 2YGWA 4UCPA 4P4DA 2VQYA 3H5ZA 3FMCA 1WVMA 5KTDA 5LRGA 1BOBA 4A31A 2CTCA 3FH4A 1QSOA 4HNYB 1Y7EA 2C6GA 2O4HA 5HH1A 2Q7SA 3GIUA 4KVME 4AB7A 1X10A 4UWIA 3S9MA 3SI1A 3ZNIA 2YNEA 4II9A 5ELYA 2J8RA 1ZYMA 4ONUA 2YNCC 2DF5A 1CP7A 2WPXA 4YRHA 3RO0A 1CP6A 4R3LA 2XEJA 3PT1A 1ZG8A 3K9UA 5HKZA 4ZI6A 3D8PA 2I3CA 2PVWA 1F2OA 4ONWA 4PXEA 1Y9ZA 4H2KA 1VBGA 3BHXA 1Z5RA 2EK9A 5JPHA 2VZYA 3W6XA 4C8PA 4P4EA 3SXNA 3D67A 5LRKA 2YJVA 4E94A 2XEFA 4CGOA 2XPNA 1KC7A 2JEWA 4ZYQA 4H1HA 5AXIA 3HLPA 4IIXA 2EO8A 1V6CA 3JVNA 4LQGA 3T05A 3MRUA 4GS4A 3EFAA 4A32A 3JRUA 1UFHA 2PRQA 3KR5A 4Y49B 4CZ1A 1HDQA 4MY3A 4CGNA 3HUVA 4Q7AA 1S60A 3EXNA 4PQAA 4P4JA 1M4DA 2F7VA 4MJ8A 2VL1A 4PXCA 5THWA 1ZLHA 2QECA 4E0AA 3TLZA 3HMJG 2PE3A 5KTCA 2V8DA 3GY9A 5AG5A 4R9MA 1PCAA 4KS9A 5CBMA 3TE4A 5K8OA 1C3OB 1Y7RA 2PJ8A 3G3SA 4Q36A 3TOAA 2AUMA 1AUGA 2Z3KA 5F13A 3H4QA 4LQ6A 4E8OA 3FVLA 1Q5XA 2EZBA 4YN3A 3H8FA 3T90A 1YGHA 1XF8A 4BPUB 1GYTA 1VHSA 3H8EA 4NGQA 1NSAA 3B8GA 4ORFA 2XPPA 2D0PA 3VRQA 2Q44A 4OP4A 5G22A 3F9KC 3JTKA 3TO7A 2PJ9A 4XNHC 2ZW5A 2I79A 4F9VA 3T5MA 4OKOA 3B3VA 5H86A 3N5FA 4QUSA 3VRNA 2JBKA 2RFHA 4MCSA 1BLLE 5CNPA 3U88C 2F8HA 4MBUA 2Z3LA 1VI4A 1P0HA 3K9TA 2PJ6A 2FE7A 4PXDA 2VXKA 4DYOA 5K8NA 3B3TA 4CYOA 3LMSA 1VGYA
chains in the Genus database with same CATH topology
4A37A 4OIWA 1HEEA 1BAVA 1UWYA 1DE4C 2PIYA 3CPXA 4NFRA 3PB4X 2WZNA 4R7MA 1QQ9A 1ARMA 3I74A 4JZ0A 3H8GA 5HVFA 2C5QA 4P6YA 1ARLA 3PFOA 2V8HA 4X2TA 4AXVA 2Q4ZA 2NYQA 4MCQA 3D4UA 2AFOA 1OBRA 1TF9A 3ISXA 3KASA 2Q43A 1H8LA 2PJ5A 4ZY1A 2ZEOA 3GLJA 4C9AA 2ANPA 2V77A 4OC0A 1M4LA 4C8FA 2V8GA 4A39A 2EWBA 4K3NA 2PJAA 1JQGA 2PJBA 3KHZA 1R3NA 2ZEGA 4UIBA 5F09A 3PBEA 4CPAA 4MHNA 4UIAA 1LAMA 1DTDA 4PXBA 4A94A 2G9DA 4ZY0A 3B3WA 2Q51A 3FJUA 3VH9A 3PB8X 2JBJA 3IC1A 4BD9A 1YW4A 3D68A 2PJ2A 4NGRA 3IEHA 2CIJA 4P4IA 3PFEA 5LYDA 3QNVA 4DUKA 4A38A 3FEDA 3KHXA 5K8MA 5D29A 3FF3A 5K8PA 2OOTA 3B35A 2GU2A 4FWUA 5JM6A 1CX8A 4JYWA 2AFMA 1LFWA 2BCOA 5D8NA 5JH9A 5IR2A 4C8AA 3SI0A 1YW6A 4P4FA 3B2YA 4KNGE 1VIXA 4NGTA 3NA6A 2C6PA 4YWYA 5IB9A 1IY7A 1XBUA 4OC4A 2HB6A 1ELLP 4Z65A 4NJQA 4UEEA 1XFOA 4ZY2A 3D7DA 1CPXA 1TKJA 4CDKA 4OIDA 2QYVA 3SJEA 2ZOFA 5LRJA 1ZG9A 2PVVA 5JGFA 2IQ6A 3VTAA 4R6TA 1XMBA 1Y0RA 3S9NA 1QMUA 5HXDA 3IIBA 1Q7LA 3NH5A 3IJ3A 3I1UA 2CF4A 1TKFA 1EE3P 5CPAA 1ELMP 4NJRA 3SJFA 2ZEPA 4P45A 2BOAA 3BXMA 2PJ7A 1LAPA 2ZELA 3TX8A 4MRIA 3B7IA 5J1QA 1CG2A 2BO9A 1CBXA 2J9AA 4IAVA 4C9EA 2ZEHA 2DEAA 3BI0A 3SI2A 2OR4A 4C85A 3NH8A 1KWMA 2PJCA 2PJ3A 3WC6A 2IJZA 4FBEA 4EWTA 4C9RA 3PEIA 2ZEDA 1TKHA 3RZAA 4WJBA 3TC8A 3WC7A 4OC1A 4MXUA 4TWEA 4NGMA 3RBUA 1F57A 2ZEEA 4WWVA 1IGBA 4C8TA 2NSMA 1ZG7A 3K2KA 4X8IA 1Z8LA 3WC5A 2XEGA 1BPMA 4O23A 4NGNA 3S9LA 1TF8A 4P10A 3KZWA 4PPZA 4YU9A 2PJ4A 2AFSA 4UF4A 4DJLA 2HC9A 2FVGA 1BPNA 1XF1A 2ABZA 5I4MA 4B6ZA 2C1CA 5HVHA 3PB7X 2GP4A 3EIFA 4OC2A 1R43A 2ZOGA 3KL9A 2GREA 4C86A 1FNOA 3IWWA 2PJ1A 3MN8A 3B3SA 4P44A 1FT7A 3BI1A 2WYRA 3VARA 3WT4A 4FUUA 3PBBA 3FX6A 4F8ZA 5LYLA 4CDJA 4C99A 4KSIA 3CPAA 1LOKA 4TJVA 4FAIA 1HDUA 2IMOA 3NH4A 2PJ0A 1LANA 3FECA 4G1PA 3NFZA 1LCPA 3KQZA 3V38A 2ZEFA 3DGVA 2RB7A 3CDXA 1CPSA 1YMEA 4C8CA 4EMEA 3SJGA 1ZLIA 4NGPA 2CTBA 1Y0YA 3GB0A 2V8VA 2POKA 4MHZA 4IHMA 4R76A 4GM5A 5DS0A 2C6CA 4UEFA 4MHPA 4C84A 3ICUA 2QVPA 4C8UA 3T8WA 3IFEA 3FEEA 3CT9A 2AFWA 4OC5A 7CPAA 2GLJA 3D7FA 2AFZA 3KGQA 4EFDA 4OC3A 3GUXA 8CPAA 3VATA 3IO1A 1RTQA 4P4BA 1AYEA 4MCPA 3V7ZA 2GLFA 3WABA 1PYTB 4UEZA 3PB9X 2PCUA 2O53A 2AFUA 4TNUA 4W9YA 1TXRA 3KI9A 4C9VA 4RUHA 3B3CA 2QJ8A 3D7GA 3SJXA 4X3RA 4ZX9A 3PB6X 2XEIA 3D66A 2PIZA 4NGSA 4OMEA 1XRYA 3LWUA 1YSJA 4R8FA 4IK2A 6CPAA 4TJXA 2AFXA 1YLOA 4C9UA 1AMPA 5HVGA 2ZENA 5LYFA 4MMOA 4F9UA 3RAMA 3KR4A 1VHOA 3L2NA 4MHYA 1VHEA 4ZX8A 1Z2LA 3I6SA 3DLJA 1XJOA 2EK8A 5LYIA 1F2PA 3ISZA 3KQXA 4MCRA 3PRTA 2ZEMA 3D7HA 4P4DA 3FMCA 1WVMA 5LRGA 2CTCA 3FH4A 1Y7EA 2C6GA 2O4HA 3S9MA 3SI1A 5ELYA 1CP7A 1CP6A 2XEJA 4ZI6A 1ZG8A 2I3CA 2PVWA 1F2OA 4ONWA 4PXEA 1Y9ZA 4H2KA 3BHXA 1Z5RA 2EK9A 4C8PA 4P4EA 3D67A 5LRKA 2XEFA 2JEWA 4ZYQA 3HLPA 1V6CA 4LQGA 3MRUA 3JRUA 2PRQA 3KR5A 1HDQA 3HUVA 4Q7AA 4PQAA 4P4JA 2F7VA 2VL1A 4PXCA 5THWA 1ZLHA 2PE3A 2V8DA 1PCAA 5CBMA 5K8OA 2PJ8A 3FVLA 4YN3A 3H8FA 1GYTA 3H8EA 4NGQA 1NSAA 4OP4A 2PJ9A 4F9VA 4OKOA 3B3VA 3N5FA 2JBKA 2RFHA 4MCSA 1BLLE 2F8HA 3K9TA 2PJ6A 5K8NA 4PXDA 4DYOA 3B3TA 3LMSA 1VGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A37 A;  4OIW A;  1HEE A;  1BAV A;  1UWY A;  1DE4 C;  2PIY A;  3CPX A;  4NFR A;  3PB4 X;  2WZN A;  4R7M A;  1QQ9 A;  1ARM A;  3I74 A;  4JZ0 A;  3H8G A;  5HVF A;  4P6Y A;  1ARL A;  3PFO A;  2V8H A;  4X2T A;  4AXV A;  2Q4Z A;  2NYQ A;  4MCQ A;  3D4U A;  2AFO A;  1OBR A;  1TF9 A;  3ISX A;  3KAS A;  2Q43 A;  1H8L A;  2PJ5 A;  4ZY1 A;  2ZEO A;  3GLJ A;  4C9A A;  2ANP A;  2V77 A;  4OC0 A;  1M4L A;  4C8F A;  2V8G A;  4A39 A;  2EWB A;  4K3N A;  2PJA A;  1JQG A;  2PJB A;  3KHZ A;  1R3N A;  2ZEG A;  4UIB A;  5F09 A;  3PBE A;  4CPA A;  4MHN A;  4UIA A;  1LAM A;  1DTD A;  4PXB A;  4A94 A;  2G9D A;  4ZY0 A;  3B3W A;  2Q51 A;  3FJU A;  3VH9 A;  3PB8 X;  2JBJ A;  3IC1 A;  4BD9 A;  1YW4 A;  3D68 A;  2PJ2 A;  4NGR A;  3IEH A;  2CIJ A;  4P4I A;  3PFE A;  5LYD A;  3QNV A;  4DUK A;  4A38 A;  3FED A;  3KHX A;  5K8M A;  5D29 A;  3FF3 A;  5K8P A;  2OOT A;  3B35 A;  2GU2 A;  4FWU A;  5JM6 A;  1CX8 A;  4JYW A;  2AFM A;  1LFW A;  2BCO A;  5D8N A;  5JH9 A;  4C8A A;  3SI0 A;  1YW6 A;  4P4F A;  3B2Y A;  4KNG E;  1VIX A;  4NGT A;  3NA6 A;  2C6P A;  4YWY A;  5IB9 A;  1IY7 A;  1XBU A;  4OC4 A;  2HB6 A;  1ELL P;  4Z65 A;  4NJQ A;  4UEE A;  1XFO A;  4ZY2 A;  3D7D A;  1CPX A;  1TKJ A;  4CDK A;  4OID A;  2QYV A;  3SJE A;  2ZOF A;  5LRJ A;  1ZG9 A;  2PVV A;  5JGF A;  2IQ6 A;  3VTA A;  4R6T A;  1XMB A;  1Y0R A;  3S9N A;  1QMU A;  5HXD A;  3IIB A;  1Q7L A;  3NH5 A;  3IJ3 A;  3I1U A;  2CF4 A;  1TKF A;  1EE3 P;  5CPA A;  1ELM P;  4NJR A;  3SJF A;  2ZEP A;  4P45 A;  2BOA A;  3BXM A;  2PJ7 A;  1LAP A;  2ZEL A;  3TX8 A;  4MRI A;  3B7I A;  5J1Q A;  1CG2 A;  2BO9 A;  1CBX A;  2J9A A;  4IAV A;  4C9E A;  2ZEH A;  2DEA A;  3BI0 A;  3SI2 A;  2OR4 A;  4C85 A;  3NH8 A;  1KWM A;  2PJC A;  2PJ3 A;  3WC6 A;  2IJZ A;  4FBE A;  4EWT A;  4C9R A;  3PEI A;  2ZED A;  1TKH A;  3RZA A;  4WJB A;  3TC8 A;  3WC7 A;  4OC1 A;  4MXU A;  4TWE A;  4NGM A;  3RBU A;  1F57 A;  2ZEE A;  4WWV A;  1IGB A;  4C8T A;  2NSM A;  1ZG7 A;  3K2K A;  4X8I A;  1Z8L A;  3WC5 A;  2XEG A;  1BPM A;  4O23 A;  4NGN A;  3S9L A;  1TF8 A;  4P10 A;  3KZW A;  4PPZ A;  4YU9 A;  2PJ4 A;  2AFS A;  4UF4 A;  4DJL A;  2HC9 A;  2FVG A;  1BPN A;  1XF1 A;  2ABZ A;  5I4M A;  4B6Z A;  2C1C A;  5HVH A;  3PB7 X;  3EIF A;  4OC2 A;  1R43 A;  2ZOG A;  3KL9 A;  2GRE A;  4C86 A;  1FNO A;  3IWW A;  2PJ1 A;  3MN8 A;  3B3S A;  4P44 A;  1FT7 A;  3BI1 A;  2WYR A;  3VAR A;  3WT4 A;  4FUU A;  3PBB A;  3FX6 A;  4F8Z A;  5LYL A;  4CDJ A;  4C99 A;  4KSI A;  3CPA A;  1LOK A;  4TJV A;  4FAI A;  1HDU A;  2IMO A;  3NH4 A;  2PJ0 A;  1LAN A;  3FEC A;  4G1P A;  3NFZ A;  1LCP A;  3KQZ A;  3V38 A;  2ZEF A;  3DGV A;  2RB7 A;  3CDX A;  1CPS A;  1YME A;  4C8C A;  4EME A;  3SJG A;  1ZLI A;  4NGP A;  2CTB A;  1Y0Y A;  3GB0 A;  2V8V A;  2POK A;  4MHZ A;  4IHM A;  4R76 A;  4GM5 A;  5DS0 A;  2C6C A;  4UEF A;  4MHP A;  4C84 A;  3ICU A;  2QVP A;  4C8U A;  3T8W A;  3IFE A;  3FEE A;  3CT9 A;  2AFW A;  4OC5 A;  7CPA A;  2GLJ A;  3D7F A;  2AFZ A;  3KGQ A;  4EFD A;  4OC3 A;  3GUX A;  8CPA A;  3VAT A;  3IO1 A;  1RTQ A;  4P4B A;  1AYE A;  4MCP A;  3V7Z A;  2GLF A;  3WAB A;  1PYT B;  4UEZ A;  3PB9 X;  2PCU A;  2O53 A;  2AFU A;  4TNU A;  4W9Y A;  1TXR A;  3KI9 A;  4C9V A;  4RUH A;  3B3C A;  2QJ8 A;  3D7G A;  3SJX A;  4X3R A;  4ZX9 A;  3PB6 X;  2XEI A;  3D66 A;  2PIZ A;  4NGS A;  4OME A;  1XRY A;  3LWU A;  1YSJ A;  4R8F A;  4IK2 A;  6CPA A;  4TJX A;  2AFX A;  1YLO A;  4C9U A;  1AMP A;  5HVG A;  2ZEN A;  5LYF A;  4MMO A;  4F9U A;  3RAM A;  3KR4 A;  1VHO A;  3L2N A;  4MHY A;  1VHE A;  4ZX8 A;  1Z2L A;  3I6S A;  3DLJ A;  1XJO A;  2EK8 A;  5LYI A;  1F2P A;  3ISZ A;  3KQX A;  4MCR A;  3PRT A;  2ZEM A;  3D7H A;  4P4D A;  3FMC A;  1WVM A;  5LRG A;  2CTC A;  3FH4 A;  1Y7E A;  2C6G A;  2O4H A;  3S9M A;  3SI1 A;  5ELY A;  1CP7 A;  1CP6 A;  2XEJ A;  4ZI6 A;  1ZG8 A;  2I3C A;  2PVW A;  1F2O A;  4ONW A;  4PXE A;  1Y9Z A;  4H2K A;  3BHX A;  1Z5R A;  2EK9 A;  4C8P A;  4P4E A;  3D67 A;  5LRK A;  2XEF A;  2JEW A;  4ZYQ A;  3HLP A;  1V6C A;  4LQG A;  3MRU A;  3JRU A;  2PRQ A;  3KR5 A;  1HDQ A;  3HUV A;  4Q7A A;  4PQA A;  4P4J A;  2F7V A;  2VL1 A;  4PXC A;  5THW A;  1ZLH A;  2PE3 A;  2V8D A;  1PCA A;  5CBM A;  5K8O A;  2PJ8 A;  3FVL A;  4YN3 A;  3H8F A;  1GYT A;  3H8E A;  4NGQ A;  1NSA A;  4OP4 A;  2PJ9 A;  4F9V A;  4OKO A;  3B3V A;  3N5F A;  2JBK A;  2RFH A;  4MCS A;  1BLL E;  2F8H A;  3K9T A;  2PJ6 A;  5K8N A;  4PXD A;  4DYO A;  3B3T A;  3LMS A;  1VGY A; 
#chains in the Genus database with same CATH topology
 2VEZ A;  4A37 A;  1XOV A;  3LOD A;  4OIW A;  2P0W A;  1MJA A;  4C68 A;  1HEE A;  1BAV A;  5EBV A;  1UWY A;  4NF1 A;  2Z3N A;  2MP0 A;  1DE4 C;  2PIY A;  3TLY A;  3CPX A;  4NFR A;  1CJW A;  3TFY A;  3PB4 X;  4AG9 A;  3FXT A;  4KLW A;  2B4J C;  3BJ8 A;  1NSL A;  2WZN A;  1IU8 A;  4R7M A;  1EZB A;  4RN7 A;  1QQ9 A;  1ARM A;  3I74 A;  4JZ0 A;  2B3U A;  2Q0Y A;  2CXA A;  3H8G A;  2H5M A;  5G1Z A;  5HVF A;  4JJX A;  2FSR A;  3SR3 A;  3S6G A;  3F5B A;  4KOV A;  3GYA A;  5G21 A;  3W6S A;  5A27 A;  2C5Q A;  4AVC A;  4P6Y A;  1ARL A;  3PFO A;  2V8H A;  4X2T A;  4KOY A;  4AXV A;  2OU2 A;  2Q4Z A;  4UA3 A;  2NYQ A;  4MCQ A;  4MFQ A;  3W91 A;  3F0A A;  4JVO A;  3D4U A;  2AFO A;  1OBR A;  2YJT A;  1TF9 A;  3ISX A;  1LRZ A;  3KAS A;  2OZH A;  4BTF A;  2Q43 A;  2JEV A;  4XPD B;  1H8L A;  4B13 A;  2VI7 A;  4ZGY B;  1YK3 A;  2PJ5 A;  4ZY1 A;  3GJZ A;  2ZEO A;  3GLJ A;  2Q4Y A;  3GKR A;  4KOR A;  1XE4 A;  1IOI A;  2B3V A;  2F5I A;  5GCN A;  3TLE A;  4C9A A;  2CNT A;  4H89 A;  1RO5 A;  2PR1 A;  2ANP A;  1A2Z A;  2V77 A;  1Q2Y A;  4OC0 A;  5BWA B;  1M4L A;  4C8F A;  2V8G A;  3DNS A;  2J8N A;  2OZG A;  4R57 A;  4A39 A;  1CM0 A;  2EWB A;  3ZZI A;  2WSA A;  4XPK A;  4K3N A;  5J8C A;  2PJA A;  3T0T A;  1JQG A;  1YX0 A;  2PJB A;  5G20 A;  3KHZ A;  4CYQ A;  1R3N A;  3TO6 A;  3C26 A;  2ZEG A;  4J3G A;  4UIB A;  2JDD A;  2BEI A;  5F09 A;  3PBE A;  3MGD A;  4M85 A;  4QB9 A;  4CPA A;  1KEE B;  3TLG A;  2ZW4 A;  3G8W A;  1WWZ A;  4MHN A;  4UIA A;  1LAM A;  2B5G A;  1VBH A;  1DTD A;  3IU1 A;  4PXB A;  3PZJ A;  3O8Z A;  3T07 A;  3VRP A;  2R1I A;  4CYP A;  3OAK A;  4A94 A;  1YR0 A;  1NBW A;  2Z3P A;  2G9D A;  1ON0 A;  4ZY0 A;  1QST A;  3B3W A;  2Q51 A;  3FJU A;  1B47 A;  4H6U A;  5F47 A;  4ZBG A;  3PB8 X;  3VH9 A;  2JBJ A;  3IC1 A;  5C82 A;  1V0C A;  4PK3 A;  3TCV A;  4BD9 A;  3CZX A;  1YW4 A;  2DXQ A;  3BLN A;  5JQ4 A;  4CDJ A;  2P6G A;  3D68 A;  2PJ2 A;  3D3S A;  4NGR A;  1MJB A;  3IEH A;  2CIJ A;  4L8A A;  3DSB A;  1TIQ A;  4P4I A;  1R57 A;  3I9S A;  3HPH E;  1ZO0 A;  1XEB A;  2UV8 G;  4X5K A;  3PFE A;  4AVA A;  5JYB A;  1X12 A;  2ODF A;  5LYD A;  3JUW A;  3QNV A;  4DUK A;  4QC6 A;  5EC4 A;  2Y1M A;  4A38 A;  3P2H A;  4CAX A;  3FED A;  2PC1 A;  1JDB C;  1M6V B;  3KHX A;  3R9E A;  2WPW A;  5K8M A;  1MK4 A;  5D29 A;  3FF3 A;  2YND A;  1RXT A;  4F6A A;  4FD5 A;  5K8P A;  4A4B A;  4BPX B;  2OOT A;  3B35 A;  2R82 A;  2B4D B;  2CNS A;  2GU2 A;  4FWU A;  5JM6 A;  1CX8 A;  4JYW A;  1IOF A;  2AFM A;  1M1D A;  1T36 B;  1LFW A;  2BCO A;  4I49 A;  4A2Z A;  4M6H A;  4Q38 A;  2FL4 A;  1B6B A;  3QAY A;  4MY0 A;  2WUU A;  5D8N A;  5JH9 A;  5IR2 A;  3R1K A;  1Y9W A;  4C8A A;  4OAD A;  3EC4 A;  3SI0 A;  1YW6 A;  2GFQ A;  4P4F A;  3B2Y A;  4KNG E;  2ZXV A;  2NMT A;  4A33 A;  1VIX A;  4NGT A;  4UFX A;  3NA6 A;  3NOJ A;  2C6P A;  2FCK A;  4M6G A;  3TLA A;  4YWY A;  2PQ8 A;  5IB9 A;  4KVX A;  2HRO A;  1IY7 A;  1Z4R A;  4QVT A;  5HKY A;  4UFV A;  4BBH A;  1XBU A;  4OC4 A;  2HB6 A;  1BO4 A;  4MI4 A;  4E2A A;  5H84 A;  2JDC A;  3TLG B;  5ISV A;  5DWM A;  3G23 A;  4CRZ B;  4KSA A;  1ELL P;  5F46 A;  4Z65 A;  2B5G B;  3RNZ A;  5AGE A;  4NJQ A;  4UEE A;  3EZE A;  1K4J A;  3K4I A;  2EBJ A;  4C7H A;  1XFO A;  3TT2 A;  4ZY2 A;  4HKF A;  3D7D A;  4MJX A;  1CPX A;  1TKJ A;  3ZJ0 A;  4OID A;  2QYV A;  4CDK A;  1YVO A;  3OB1 B;  3DR8 A;  4H6Z A;  4JXQ A;  3SJE A;  1Z9U A;  2ZOF A;  5LRJ A;  4J0N A;  5KTA A;  2Q04 A;  1ZG9 A;  1A9X B;  3PGP A;  3F8K A;  4IUS A;  2X0S A;  5FD8 A;  2E28 A;  3VRR A;  2PVV A;  2Y1N A;  2I00 A;  4GXH A;  4M3S A;  2IQ6 A;  4BIN A;  4R6T A;  5JGF A;  1XMB A;  3EZA A;  3VTA A;  1EZA A;  1Y0R A;  3U1B A;  3S9N A;  1QMU A;  5F48 A;  5HXD A;  3IIB A;  1Q7L A;  2ZW7 A;  2G0B A;  1B87 A;  3NH5 A;  4MHD A;  3IJ3 A;  2PDO A;  2Z0Z A;  1Z8W A;  1TKF A;  1EE3 P;  1Z8T A;  1ELM P;  2CF4 A;  3D2P A;  3I1U A;  5CPA A;  2DIK A;  2D4P A;  4NJR A;  3SJF A;  2ZEP A;  1IB1 E;  4NXY A;  1EO0 A;  4P45 A;  4KOU A;  1GGO A;  1FBV A;  4MFK A;  2BOA A;  3BXM A;  4NCZ A;  2PJ7 A;  4IF5 A;  5F49 A;  1LAP A;  2REE A;  3NE8 A;  2OB0 A;  3KKW A;  3IWE A;  3OWC A;  2ZEL A;  4UCM A;  4F0Y A;  3TX8 A;  1PU9 A;  4MRI A;  2BL1 A;  1N71 A;  3B7I A;  4JLY A;  5J1Q A;  1CG2 A;  1WJT A;  2B4D A;  2BO9 A;  5EMI A;  5F5X A;  1CBX A;  2OH1 A;  4DNC A;  2J9A A;  1QSN A;  5AG7 A;  4IAV A;  4CAE A;  4KUB A;  4F0X A;  4C9E A;  4HNX B;  2ZEH A;  3CXP A;  2DEA A;  3VGO A;  2FS5 A;  3BI0 A;  1M4G A;  5C88 A;  3SI2 A;  2OR4 A;  3FIX A;  4C85 A;  2EUI A;  3NH8 A;  1KWM A;  2PJC A;  2PJ3 A;  4C7I A;  3WC6 A;  2ZW6 A;  2IJZ A;  1KUV A;  4FBE A;  4MFL A;  4NEX A;  4KOW A;  4RS2 A;  2ARH A;  4EWT A;  3R9G A;  4C9R A;  2P6F A;  3PEI A;  2ZED A;  1TKH A;  2VBQ A;  3RZA A;  4WJB A;  3TC8 A;  5E96 A;  3WC7 A;  4OC1 A;  4KVO E;  4MXU A;  4TWE A;  4NGM A;  3RBU A;  1F57 A;  4U9Y A;  5AG4 A;  2G3T A;  2ZEE A;  3RYO A;  4WWV A;  3OP0 A;  1R61 A;  4CRY B;  2DLA A;  1IGB A;  2BUE A;  2CNM A;  2CBL A;  1J3L A;  4B10 A;  4C8T A;  3T9Y A;  2NSM A;  1ZG7 A;  3K2K A;  2ZPA A;  3EO4 A;  4X8I A;  1Z8L A;  4M8D A;  2N3A B;  3OB2 B;  4UWJ A;  4JXR A;  2Q7B A;  2Z11 A;  4CGL A;  4COB A;  4EYS A;  3WC5 A;  1S7K A;  3TLB A;  2XEG A;  3R9F A;  1BPM A;  3S6H A;  3DDD A;  4XNH B;  3QB8 A;  4NGN A;  4O23 A;  1CS0 B;  3S9L A;  3FBU A;  1TF8 A;  4MFZ A;  4P10 A;  3KZW A;  4CAW A;  3BUX B;  4COG A;  4FD4 A;  1YLE A;  3TTH A;  2FM4 A;  1P4N A;  1XIX A;  4PPZ A;  4PSW A;  4YU9 A;  2PJ4 A;  1M44 A;  5F1Y A;  2IL4 A;  2AFS A;  4NSQ A;  4UF4 A;  2P6E A;  3FYN A;  4DJL A;  1NXJ A;  2RC4 A;  2HC9 A;  2FVG A;  1BPN A;  4CYN A;  4UBR A;  2ABZ A;  5IX3 A;  5J8F A;  5I4M A;  1XF1 A;  5K99 A;  1QSR A;  2X7B A;  4KLV A;  2C1C A;  4B6Z A;  3PB7 X;  5HVH A;  2GP4 A;  3EIF A;  2QIR A;  4OAE A;  4OC2 A;  4R3K A;  1YQE A;  1R43 A;  4QBJ A;  3S6F A;  2ZOG A;  3KL9 A;  2GRE A;  2HWG A;  4C86 A;  3IU2 A;  2GAN A;  3S6K A;  1FNO A;  5DWN A;  1I12 A;  3IWW A;  4LX9 A;  1S5K A;  4B5P A;  4IIY A;  2PJ1 A;  2HQY A;  1JWQ A;  3MN8 A;  4CAF A;  3B3S A;  3P2F A;  4KSF A;  3TOB A;  4P44 A;  1FT7 A;  1MJ9 A;  3BI1 A;  2WYR A;  3TO9 A;  3VAR A;  4E5S A;  3WT4 A;  2Z3M A;  2QML A;  1OZP A;  3PBB A;  3FX6 A;  4FUU A;  4KOT A;  4F8Z A;  1IYL A;  1PUA A;  1YVK A;  2PRB A;  4CS0 B;  4L89 A;  2J8M A;  4MFP A;  5LYL A;  2HI6 A;  3TYX A;  3CXQ A;  4C99 A;  2GIV A;  4KSI A;  3CPA A;  1LOK A;  4TJV A;  4FAI A;  2Z3O A;  2PCN A;  1HDU A;  4YGO A;  1I21 A;  2IMO A;  2G3A A;  1IYK A;  1S3Z A;  4RR2 B;  3TLC A;  3NH4 A;  2PJ0 A;  1LAN A;  3FEC A;  3VRO A;  4G1P A;  2EVN A;  3NFZ A;  3LAC A;  3IGR A;  2PSW A;  1LCP A;  3KQZ A;  1KUX A;  4HNW B;  2ZEF A;  4KOS A;  3V38 A;  3DGV A;  2OLS A;  2OZU A;  2RB7 A;  3CDX A;  3V8I A;  1CPS A;  1C30 B;  4C2Y A;  5IB0 A;  3PP9 A;  1YME A;  2HV2 A;  3BUN B;  1L0C A;  3QAH A;  4R87 A;  4A30 A;  4OLL A;  4AG7 A;  4C8C A;  3CXS A;  4EME A;  1QSM A;  3SJG A;  1S7F A;  4XPD C;  1Z9E A;  3FRM A;  1ZLI A;  4XPL A;  4NGP A;  2YNC A;  4FD6 A;  2ATR A;  1Q2C A;  2JLM A;  2CTB A;  1FY7 A;  4K30 A;  2K5T A;  3R96 A;  1BXR B;  3WR7 A;  1CE8 B;  1I1D A;  1JDE A;  5F9M A;  4MI1 A;  3BUM B;  1Y0Y A;  3GB0 A;  2R7H A;  2POK A;  2V8V A;  1NE9 A;  4M6I A;  1Q2D A;  5BY0 A;  4MHZ A;  4UCN A;  4CO9 A;  4IHM A;  4R76 A;  4GM5 A;  5DS0 A;  3EY5 A;  2C6C A;  2B0A A;  1S7L A;  4UEF A;  3HPG G;  4KZT A;  4UFW A;  4MHP A;  4C84 A;  3ICU A;  2AJ6 A;  4PSX A;  2QVP A;  4C8U A;  2FIA A;  3SHP A;  5JVL A;  4U5Y A;  3FB3 A;  2DPT A;  3FEE A;  3IFE A;  3T8W A;  4U9Z A;  3CT9 A;  2AFW A;  5AG6 A;  5FVJ A;  2AUN A;  1XMT A;  3BUW B;  4OC5 A;  3NFQ A;  2AE6 A;  2D4O A;  4YFJ A;  4B5P B;  7CPA A;  2GLJ A;  3D7F A;  2C27 A;  2AFZ A;  3KGQ A;  3LD2 A;  4EFD A;  4OC3 A;  3GUX A;  4FD7 A;  4PK2 A;  1GHE A;  4KOX A;  8CPA A;  2B4B A;  2BSW A;  3PFV A;  1SQH A;  3VAT A;  1U6M A;  3IO1 A;  1NMT A;  1RTQ A;  3VWD A;  4CAV A;  4P4B A;  1AYE A;  2Y0M A;  4Y49 C;  1Z8X A;  4MCP A;  3NE7 A;  2GLF A;  3V7Z A;  3KRV A;  4MFJ A;  3WAB A;  1PYT B;  4UEZ A;  2XPL A;  2DPS A;  2KCW A;  3EZB A;  1KBL A;  2FT0 A;  3E0K A;  1Y9K A;  3PB9 X;  1ZL0 A;  2PCU A;  1YRE A;  2B58 A;  2O53 A;  2REF A;  4BMH A;  2AFU A;  2Q4V A;  4TNU A;  4W9Y A;  3FNC A;  1TXR A;  4CGP A;  1ZRS A;  3IWG A;  1DIK A;  3KI9 A;  2FXF A;  4C2Z A;  4C9V A;  2VKZ G;  4RUH A;  2HUZ A;  3B3C A;  1J4J A;  4GPL B;  3D7G A;  1S7N A;  1VKC A;  2QJ8 A;  2EZC A;  2D0O A;  4INJ A;  5I0C A;  4B11 A;  4A4C A;  3SJX A;  4X3R A;  4RI1 A;  4ZX9 A;  4C2X A;  5A28 A;  3PB6 X;  4A95 A;  3SXO A;  2XEI A;  3D66 A;  2PIZ A;  4NGS A;  4KUA A;  4OME A;  1XRY A;  3D2M A;  3I3G A;  3LWU A;  1YSJ A;  4R8F A;  4IK2 A;  6CPA A;  4TJX A;  1IID A;  2AFX A;  4B12 A;  4BPW B;  1YLO A;  2GE3 A;  2EZA A;  4C9U A;  1AMP A;  1KUY A;  2Z10 A;  1KZF A;  1IIC A;  4B5O A;  5HVG A;  2FIW A;  2CY2 A;  2ZEN A;  5LYF A;  4MMO A;  5IV0 A;  3BUO B;  4HPS A;  4F9U A;  4PV6 A;  2O28 A;  3N7Z A;  3RAM A;  2PR8 A;  1YVH A;  2R8V A;  3KR4 A;  2A4N A;  4B14 A;  3C8O A;  1VHO A;  3A9L A;  1M4I A;  3DR6 A;  3L2N A;  4MHY A;  1VHE A;  3R95 A;  3UY5 A;  5HMN A;  5HKW A;  3BJ7 A;  1Z4E A;  4ZX8 A;  1Z2L A;  4AVB A;  4CGM A;  3DLJ A;  4LUA A;  4EVY A;  1XJO A;  1WK4 A;  2EK8 A;  3I6S A;  5LYI A;  2XPO A;  3VWE A;  1F2P A;  3ISZ A;  3KQX A;  4MCR A;  2VZZ A;  3PRT A;  5J3X A;  2R98 A;  2ZEM A;  3D7H A;  3PLF B;  4JD6 A;  4JWP A;  2YGW A;  4UCP A;  4P4D A;  2VQY A;  3H5Z A;  3FMC A;  1WVM A;  5KTD A;  5LRG A;  1BOB A;  4A31 A;  2CTC A;  3FH4 A;  1QSO A;  4HNY B;  1Y7E A;  2C6G A;  2O4H A;  5HH1 A;  2Q7S A;  3GIU A;  4KVM E;  4AB7 A;  1X10 A;  4UWI A;  3S9M A;  3SI1 A;  3ZNI A;  2YNE A;  4II9 A;  5ELY A;  2J8R A;  1ZYM A;  4ONU A;  2YNC C;  2DF5 A;  1CP7 A;  2WPX A;  4YRH A;  3RO0 A;  1CP6 A;  4R3L A;  2XEJ A;  3PT1 A;  1ZG8 A;  3K9U A;  5HKZ A;  4ZI6 A;  3D8P A;  2I3C A;  2PVW A;  1F2O A;  4ONW A;  4PXE A;  1Y9Z A;  4H2K A;  1VBG A;  3BHX A;  1Z5R A;  2EK9 A;  5JPH A;  2VZY A;  3W6X A;  4C8P A;  4P4E A;  3SXN A;  3D67 A;  5LRK A;  2YJV A;  4E94 A;  2XEF A;  4CGO A;  2XPN A;  1KC7 A;  2JEW A;  4ZYQ A;  4H1H A;  5AXI A;  3HLP A;  4IIX A;  2EO8 A;  1V6C A;  3JVN A;  4LQG A;  3T05 A;  3MRU A;  4GS4 A;  3EFA A;  4A32 A;  3JRU A;  1UFH A;  2PRQ A;  3KR5 A;  4Y49 B;  4CZ1 A;  1HDQ A;  4MY3 A;  4CGN A;  3HUV A;  4Q7A A;  1S60 A;  3EXN A;  4PQA A;  4P4J A;  1M4D A;  2F7V A;  4MJ8 A;  2VL1 A;  4PXC A;  5THW A;  1ZLH A;  2QEC A;  4E0A A;  3TLZ A;  3HMJ G;  2PE3 A;  5KTC A;  2V8D A;  3GY9 A;  5AG5 A;  4R9M A;  1PCA A;  4KS9 A;  5CBM A;  3TE4 A;  5K8O A;  1C3O B;  1Y7R A;  2PJ8 A;  3G3S A;  4Q36 A;  3TOA A;  2AUM A;  1AUG A;  2Z3K A;  5F13 A;  3H4Q A;  4LQ6 A;  4E8O A;  3FVL A;  1Q5X A;  2EZB A;  4YN3 A;  3H8F A;  3T90 A;  1YGH A;  1XF8 A;  4BPU B;  1GYT A;  1VHS A;  3H8E A;  4NGQ A;  1NSA A;  3B8G A;  4ORF A;  2XPP A;  2D0P A;  3VRQ A;  2Q44 A;  4OP4 A;  5G22 A;  3F9K C;  3JTK A;  3TO7 A;  2PJ9 A;  4XNH C;  2ZW5 A;  2I79 A;  4F9V A;  3T5M A;  4OKO A;  3B3V A;  5H86 A;  3N5F A;  4QUS A;  3VRN A;  2JBK A;  2RFH A;  4MCS A;  1BLL E;  5CNP A;  3U88 C;  2F8H A;  4MBU A;  2Z3L A;  1VI4 A;  1P0H A;  3K9T A;  2PJ6 A;  2FE7 A;  4PXD A;  2VXK A;  4DYO A;  5K8N A;  3B3T A;  4CYO A;  3LMS A;  1VGY A; 
#chains in the Genus database with same CATH homology
 4A37 A;  4OIW A;  1HEE A;  1BAV A;  1UWY A;  1DE4 C;  2PIY A;  3CPX A;  4NFR A;  3PB4 X;  2WZN A;  4R7M A;  1QQ9 A;  1ARM A;  3I74 A;  4JZ0 A;  3H8G A;  5HVF A;  2C5Q A;  4P6Y A;  1ARL A;  3PFO A;  2V8H A;  4X2T A;  4AXV A;  2Q4Z A;  2NYQ A;  4MCQ A;  3D4U A;  2AFO A;  1OBR A;  1TF9 A;  3ISX A;  3KAS A;  2Q43 A;  1H8L A;  2PJ5 A;  4ZY1 A;  2ZEO A;  3GLJ A;  4C9A A;  2ANP A;  2V77 A;  4OC0 A;  1M4L A;  4C8F A;  2V8G A;  4A39 A;  2EWB A;  4K3N A;  2PJA A;  1JQG A;  2PJB A;  3KHZ A;  1R3N A;  2ZEG A;  4UIB A;  5F09 A;  3PBE A;  4CPA A;  4MHN A;  4UIA A;  1LAM A;  1DTD A;  4PXB A;  4A94 A;  2G9D A;  4ZY0 A;  3B3W A;  2Q51 A;  3FJU A;  3VH9 A;  3PB8 X;  2JBJ A;  3IC1 A;  4BD9 A;  1YW4 A;  3D68 A;  2PJ2 A;  4NGR A;  3IEH A;  2CIJ A;  4P4I A;  3PFE A;  5LYD A;  3QNV A;  4DUK A;  4A38 A;  3FED A;  3KHX A;  5K8M A;  5D29 A;  3FF3 A;  5K8P A;  2OOT A;  3B35 A;  2GU2 A;  4FWU A;  5JM6 A;  1CX8 A;  4JYW A;  2AFM A;  1LFW A;  2BCO A;  5D8N A;  5JH9 A;  5IR2 A;  4C8A A;  3SI0 A;  1YW6 A;  4P4F A;  3B2Y A;  4KNG E;  1VIX A;  4NGT A;  3NA6 A;  2C6P A;  4YWY A;  5IB9 A;  1IY7 A;  1XBU A;  4OC4 A;  2HB6 A;  1ELL P;  4Z65 A;  4NJQ A;  4UEE A;  1XFO A;  4ZY2 A;  3D7D A;  1CPX A;  1TKJ A;  4CDK A;  4OID A;  2QYV A;  3SJE A;  2ZOF A;  5LRJ A;  1ZG9 A;  2PVV A;  5JGF A;  2IQ6 A;  3VTA A;  4R6T A;  1XMB A;  1Y0R A;  3S9N A;  1QMU A;  5HXD A;  3IIB A;  1Q7L A;  3NH5 A;  3IJ3 A;  3I1U A;  2CF4 A;  1TKF A;  1EE3 P;  5CPA A;  1ELM P;  4NJR A;  3SJF A;  2ZEP A;  4P45 A;  2BOA A;  3BXM A;  2PJ7 A;  1LAP A;  2ZEL A;  3TX8 A;  4MRI A;  3B7I A;  5J1Q A;  1CG2 A;  2BO9 A;  1CBX A;  2J9A A;  4IAV A;  4C9E A;  2ZEH A;  2DEA A;  3BI0 A;  3SI2 A;  2OR4 A;  4C85 A;  3NH8 A;  1KWM A;  2PJC A;  2PJ3 A;  3WC6 A;  2IJZ A;  4FBE A;  4EWT A;  4C9R A;  3PEI A;  2ZED A;  1TKH A;  3RZA A;  4WJB A;  3TC8 A;  3WC7 A;  4OC1 A;  4MXU A;  4TWE A;  4NGM A;  3RBU A;  1F57 A;  2ZEE A;  4WWV A;  1IGB A;  4C8T A;  2NSM A;  1ZG7 A;  3K2K A;  4X8I A;  1Z8L A;  3WC5 A;  2XEG A;  1BPM A;  4O23 A;  4NGN A;  3S9L A;  1TF8 A;  4P10 A;  3KZW A;  4PPZ A;  4YU9 A;  2PJ4 A;  2AFS A;  4UF4 A;  4DJL A;  2HC9 A;  2FVG A;  1BPN A;  1XF1 A;  2ABZ A;  5I4M A;  4B6Z A;  2C1C A;  5HVH A;  3PB7 X;  2GP4 A;  3EIF A;  4OC2 A;  1R43 A;  2ZOG A;  3KL9 A;  2GRE A;  4C86 A;  1FNO A;  3IWW A;  2PJ1 A;  3MN8 A;  3B3S A;  4P44 A;  1FT7 A;  3BI1 A;  2WYR A;  3VAR A;  3WT4 A;  4FUU A;  3PBB A;  3FX6 A;  4F8Z A;  5LYL A;  4CDJ A;  4C99 A;  4KSI A;  3CPA A;  1LOK A;  4TJV A;  4FAI A;  1HDU A;  2IMO A;  3NH4 A;  2PJ0 A;  1LAN A;  3FEC A;  4G1P A;  3NFZ A;  1LCP A;  3KQZ A;  3V38 A;  2ZEF A;  3DGV A;  2RB7 A;  3CDX A;  1CPS A;  1YME A;  4C8C A;  4EME A;  3SJG A;  1ZLI A;  4NGP A;  2CTB A;  1Y0Y A;  3GB0 A;  2V8V A;  2POK A;  4MHZ A;  4IHM A;  4R76 A;  4GM5 A;  5DS0 A;  2C6C A;  4UEF A;  4MHP A;  4C84 A;  3ICU A;  2QVP A;  4C8U A;  3T8W A;  3IFE A;  3FEE A;  3CT9 A;  2AFW A;  4OC5 A;  7CPA A;  2GLJ A;  3D7F A;  2AFZ A;  3KGQ A;  4EFD A;  4OC3 A;  3GUX A;  8CPA A;  3VAT A;  3IO1 A;  1RTQ A;  4P4B A;  1AYE A;  4MCP A;  3V7Z A;  2GLF A;  3WAB A;  1PYT B;  4UEZ A;  3PB9 X;  2PCU A;  2O53 A;  2AFU A;  4TNU A;  4W9Y A;  1TXR A;  3KI9 A;  4C9V A;  4RUH A;  3B3C A;  2QJ8 A;  3D7G A;  3SJX A;  4X3R A;  4ZX9 A;  3PB6 X;  2XEI A;  3D66 A;  2PIZ A;  4NGS A;  4OME A;  1XRY A;  3LWU A;  1YSJ A;  4R8F A;  4IK2 A;  6CPA A;  4TJX A;  2AFX A;  1YLO A;  4C9U A;  1AMP A;  5HVG A;  2ZEN A;  5LYF A;  4MMO A;  4F9U A;  3RAM A;  3KR4 A;  1VHO A;  3L2N A;  4MHY A;  1VHE A;  4ZX8 A;  1Z2L A;  3I6S A;  3DLJ A;  1XJO A;  2EK8 A;  5LYI A;  1F2P A;  3ISZ A;  3KQX A;  4MCR A;  3PRT A;  2ZEM A;  3D7H A;  4P4D A;  3FMC A;  1WVM A;  5LRG A;  2CTC A;  3FH4 A;  1Y7E A;  2C6G A;  2O4H A;  3S9M A;  3SI1 A;  5ELY A;  1CP7 A;  1CP6 A;  2XEJ A;  4ZI6 A;  1ZG8 A;  2I3C A;  2PVW A;  1F2O A;  4ONW A;  4PXE A;  1Y9Z A;  4H2K A;  3BHX A;  1Z5R A;  2EK9 A;  4C8P A;  4P4E A;  3D67 A;  5LRK A;  2XEF A;  2JEW A;  4ZYQ A;  3HLP A;  1V6C A;  4LQG A;  3MRU A;  3JRU A;  2PRQ A;  3KR5 A;  1HDQ A;  3HUV A;  4Q7A A;  4PQA A;  4P4J A;  2F7V A;  2VL1 A;  4PXC A;  5THW A;  1ZLH A;  2PE3 A;  2V8D A;  1PCA A;  5CBM A;  5K8O A;  2PJ8 A;  3FVL A;  4YN3 A;  3H8F A;  1GYT A;  3H8E A;  4NGQ A;  1NSA A;  4OP4 A;  2PJ9 A;  4F9V A;  4OKO A;  3B3V A;  3N5F A;  2JBK A;  2RFH A;  4MCS A;  1BLL E;  2F8H A;  3K9T A;  2PJ6 A;  5K8N A;  4PXD A;  4DYO A;  3B3T A;  3LMS A;  1VGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...