4P4EA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor mp1d
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
total genus 266
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4eA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4eA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4eA02
5LYDA 1DE4C 3CT9A 4FAIA 2PJ4A 2BOAA 3B35A 4UEFA 3NA6A 5HVFA 3NH8A 3H8FA 2JBKA 5HVGA 5LRJA 4JYWA 3L2NA 2V8VA 1V6CA 1VHEA 4YWYA 2PJ1A 1R3NA 2EK8A 4B6ZA 1TF9A 4P44A 3S9LA 1ELLP 4NGMA 4MCRA 1FT7A 4OC0A 3B7IA 2AFZA 2PJ3A 2HB6A 2VL1A 4UIAA 3FMCA 1PYTB 2BCOA 2PIZA 1LAMA 1YSJA 2C1CA 3VTAA 4W9YA 2CTBA 3D7DA 2C6CA 4EMEA 5HVHA 1YW4A 2XEFA 3KR4A 5LYIA 2PCUA 2I3CA 3B3TA 3D7FA 1ZG8A 2O4HA 1CPSA 2NSMA 3KGQA 3KHZA 3FEEA 4P4DA 4WWVA 5K8MA 4C8PA 2GREA 2C6GA 2WZNA 2V8DA 3RBUA 4OC1A 5HXDA 4C99A 3V7ZA 4UIBA 4TWEA 3BI1A 4NJRA 4NGQA 4OMEA 3PRTA 4R7MA 3WC5A 1ZG7A 2HC9A 3IFEA 4JZ0A 1AYEA 3SJGA 5LYFA 3FEDA 2GLFA 3KQXA 2V8GA 2PJCA 3GUXA 4C8CA 4C8UA 4WJBA 4R6TA 3RAMA 3BI0A 4P4JA 4R76A 3K9TA 1LAPA 2F7VA 3IC1A 5K8NA 4P6YA 2GU2A 3PFEA 5D29A 3LWUA 1Z8LA 4OC5A 3GLJA 2AFMA 3NH5A 2Q43A 3SJFA 3FF3A 4PPZA 2GLJA 3D68A 7CPAA 2POKA 8CPAA 4R8FA 2XEJA 4RUHA 3IEHA 6CPAA 4AXVA 1ZLIA 4TJXA 4C84A 2EK9A 3T8WA 3PB8X 4K3NA 4MCPA 2O53A 3IJ3A 3SJXA 4NGPA 5K8PA 5J1QA 4MXUA 1XF1A 4P4IA 2ZEMA 3KL9A 1Q7LA 4NFRA 3D7GA 1JQGA 3WT4A 3K2KA 4NGTA 1QQ9A 3D66A 3MRUA 1BPMA 3D4UA 3WC6A 4P45A 4P4FA 3B3WA 4FUUA 3TC8A 3B3CA 1HDUA 1Y0RA 2PIYA 3SI1A 4DYOA 2IQ6A 3WC7A 1LANA 4MMOA 3KI9A 4ZY2A 4C9EA 3IWWA 4NJQA 3LMSA 3I1UA 4ZY1A 4ZYQA 1F2OA 4PXCA 5CBMA 1VIXA 2V77A 4OIDA 2ZEGA 4MHZA 1IY7A 1Z2LA 2PRQA 5F09A 2ZEOA 3ISXA 1CP7A 2PJ8A 5K8OA 3WABA 1XBUA 4C9AA 4ZX8A 5JGFA 2F8HA 4P4EA 3H8EA 3B3VA 2ZEPA 2PJ5A 4X3RA 3B2YA 1KWMA 4TNUA 4TJVA 3S9NA 1Z5RA 3H8GA 4NGSA 2IJZA 2ZEFA 5THWA 2G9DA 2ANPA 4C85A 2ZEDA 4P10A 4A38A 2PJ9A 4ZI6A 2XEIA 1QMUA 3DGVA 1H8LA 4KNGE 4OC3A 4PXBA 4OIWA 3BXMA 3NFZA 2FVGA 1RTQA 5D8NA 1BPNA 3ICUA 1UWYA 3GB0A 4A39A 3TX8A 2AFXA 2RB7A 2WYRA 4PXDA 3V38A 2QYVA 4C9UA 4A37A 4ZY0A 3HLPA 5I4MA 4EFDA 3SI0A 3VATA 1F2PA 4F8ZA 2J9AA 1XFOA 1CG2A 3PEIA 5DS0A 4PQAA 4DUKA 3D7HA 1XJOA 3D67A 3KR5A 1XMBA 4DJLA 3KQZA 1FNOA 2BO9A 4F9VA 2C6PA 1AMPA 1ARLA 2CIJA 4Q7AA 5LRKA 2ZELA 4YN3A 1NSAA 2PJ6A 1M4LA 4G1PA 4C9VA 2ABZA 4CDJA 1Y0YA 2OOTA 3PBEA 1WVMA 2Q51A 1ELMP 2PVWA 3KHXA 1EE3P 4EWTA 1TKJA 3NH4A 4OC4A 2PJ2A 4X2TA 2JBJA 4FWUA 3PBBA 2ZENA 2JEWA 4P4BA 1VGYA 5JM6A 4MHNA 3S9MA 1YLOA 2PJAA 2ZEEA 4UEEA 1DTDA 2ZOGA 3FH4A 3BHXA 4ONWA 4BD9A 1HDQA 2V8HA 4IHMA 1TKFA 2PVVA 1BAVA 3I74A 4F9UA 1IGBA 5IB9A 4UF4A 5ELYA 1Y7EA 3CPAA 1CPXA 3QNVA 4MRIA 4KSIA 3MN8A 2QVPA 4CDKA 3RZAA 1BLLE 1GYTA 4A94A 4NGNA 1Y9ZA 3FX6A 2CF4A 4C8TA 2NYQA 1TF8A 1ZLHA 3FJUA 4UEZA 4FBEA 4H2KA 3PB6X 2EWBA 4PXEA 2OR4A 2CTCA 3B3SA 2AFOA 3HUVA 4C8FA 3I6SA 1XRYA 2QJ8A 3SJEA 3N5FA 4MCSA 1F57A 2PJ7A 4MCQA 3IIBA 3CDXA 2DEAA 1ZG9A 2AFWA 2IMOA 1YMEA 2PE3A 1ARMA 1LFWA 3FECA 4OKOA 4GM5A 1LCPA 4IAVA 3KASA 1PCAA 4IK2A 2XEGA 2AFUA 2ZEHA 4LQGA 3DLJA 1R43A 5JH9A 2AFSA 1CP6A 5LRGA 4C8AA 4C86A 1VHOA 3PB4X 3PB9X 4YU9A 4C9RA 3PFOA 3IO1A 3KZWA 4OP4A 4ZX9A 3VARA 3CPXA 4MHPA 1CBXA 5CPAA 3PB7X 2RFHA 5LYLA 4Z65A 3SI2A 3JRUA 1CX8A 1OBRA 4X8IA 3ISZA 4MHYA 1TXRA 2PJBA 3EIFA 1LOKA 1HEEA 2ZOFA 1TKHA 4NGRA 4OC2A 2Q4ZA 3VH9A 3FVLA 4O23A 2PJ0A 1YW6A 4CPAA
chains in the Genus database with same CATH superfamily
1XIXA 1S7KA 3D2MA 1WJTA 5BY0A 5LYDA 1EZAA 1DE4C 3CT9A 1VBGA 4FAIA 1AUGA 2PCNA 4GPLB 2PSWA 1PU9A 5KTDA 4KSFA 2FCKA 3I3GA 4MFKA 2BEIA 4CRZB 5AG6A 2PJ4A 1B87A 2BOAA 3WR7A 3ZZIA 4MBUA 3B35A 4UEFA 3NA6A 5HVFA 3NH8A 3H8FA 4QB9A 3TLYA 2XPNA 2ZW7A 1CE8B 2JBKA 5HVGA 4FD7A 4L89A 3TE4A 5K99A 5LRJA 4JYWA 4CAVA 5F46A 2YNEA 2R1IA 2EBJA 2Z3LA 3W6SA 3L2NA 5A28A 2V8VA 2J8RA 5FVJA 1V6CA 1VHEA 4YWYA 2OZGA 4AVBA 3TLZA 5CNPA 4ORFA 2PJ1A 1I12A 4CS0B 3S6HA 1R3NA 2EK8A 4MFQA 4B6ZA 1TF9A 4P44A 2D0OA 1DIKA 3TLCA 3S9LA 1ELLP 3P2HA 3RNZA 2REFA 2R82A 4NGMA 4COBA 2ZW4A 4UA3A 4MCRA 1FT7A 4OC0A 3B7IA 4EVYA 2AFZA 2PJ3A 3BUWB 2FM4A 5AGEA 2OZUA 2DF5A 1V0CA 2HB6A 1ZRSA 1YQEA 2VL1A 4UIAA 1S7LA 1S7FA 4HNXB 3I9SA 3FMCA 1PYTB 4KLVA 4M6IA 3FYNA 2BCOA 3QAHA 5J8CA 2K5TA 4UFVA 2PIZA 4QVTA 1C3OB 1MJBA 1LAMA 1YSJA 2C1CA 2P6FA 2Q4VA 1FBVA 2JDCA 2ODFA 4GXHA 4L8AA 4ONUA 4UBRA 1YVHA 4W9YA 2CTBA 3BJ8A 3R95A 3D7DA 2C6CA 4B5PB 1LRZA 2CY2A 4EMEA 1RXTA 5HVHA 1YW4A 2VBQA 5F5XA 2XEFA 2CBLA 3ZNIA 3KR4A 3D2PA 1IB1E 1QSRA 5LYIA 2PCUA 1S60A 2I3CA 3B3TA 3JVNA 5AG4A 3PZJA 3D7FA 5F47A 2WSAA 3U88C 4MJ8A 5AG7A 5C88A 2FIWA 4A4BA 1ZG8A 2CNMA 4C68A 4B5PA 2O4HA 1CPSA 2Z3MA 1XF8A 2NSMA 4MI1A 3KGQA 1M4DA 3KHZA 3TO7A 3FEEA 4ZI6A 4P4DA 1MJAA 1GHEA 4WWVA 5K8MA 3SXOA 2GREA 2GIVA 2C6GA 1CS0B 1ZO0A 2WZNA 3A9LA 5IR2A 4C8PA 3QAYA 1KBLA 2V8DA 4OC1A 3RBUA 3FBUA 3TLAA 4CYNA 5HXDA 4C99A 4PSWA 3V7ZA 3E0KA 1M4GA 3EXNA 4PK3A 4UIBA 5F9MA 4TWEA 3TLGA 3BI1A 1M6VB 2FSRA 4NJRA 4NGQA 4XPDC 3HPHE 4OMEA 3PRTA 4R7MA 3WC5A 1ZG7A 2HC9A 3IFEA 2EZAA 4JZ0A 1AYEA 2Z10A 4UFWA 3SJGA 5LYFA 3T05A 4XNHC 3FEDA 3TOAA 2EZBA 2GLFA 3KQXA 4NCZA 3RO0A 2WPXA 1MK4A 2GE3A 2V8GA 4B5OA 3BUXB 2PJCA 3FRMA 3GUXA 4KOUA 4C8CA 4WJBA 4C8UA 2Z3PA 4R6TA 3RAMA 3IU2A 1YLEA 3G23A 3HPGG 4R9MA 1I1DA 1Q2DA 4KUAA 2R98A 2VZYA 4MFPA 3CZXA 3BI0A 4P4JA 4R76A 3K9TA 5ISVA 2GFQA 1I21A 2VKZG 3PFVA 4H89A 3R9FA 1LAPA 2G3AA 2Z11A 4CRYB 4C8TA 2F7VA 3IC1A 5K8NA 4P6YA 2GU2A 1S5KA 3PFEA 4UWIA 5D29A 1Z9UA 2UV8G 1NE9A 2DPSA 3JUWA 3LWUA 5H84A 1Z8LA 3LD2A 4OC5A 3GLJA 4C2XA 2AFMA 3TO6A 2KCWA 3OP0A 4A33A 1M44A 3NH5A 2Q43A 3SJFA 3T9YA 3DSBA 2WPWA 4KORA 4KOTA 1JDBC 3FF3A 4PPZA 2GLJA 3D68A 7CPAA 1L0CA 3C8OA 2POKA 1IYKA 1IICA 8CPAA 2D0PA 4OLLA 3U1BA 1Z8TA 4Q38A 3QB8A 4B10A 4CAEA 1XOVA 2MP0A 2QMLA 4R8FA 1KEEB 2XEJA 4RUHA 3IEHA 1Y7RA 6CPAA 3IGRA 3H4QA 4AXVA 1KUXA 1ZLIA 2HUZA 2ZW6A 3IWEA 4H6UA 4TJXA 3LACA 4PSXA 4C84A 1EZBA 2EK9A 3IU1A 3T8WA 4CAFA 3PB8X 4K3NA 1JDEA 3NFQA 4MCPA 2FL4A 2O53A 5AXIA 3IJ3A 3SJXA 5IX3A 4NGPA 5K8PA 3TLBA 2P6EA 2X7BA 3PGPA 5J1QA 4MXUA 4RS2A 4IIXA 1U6MA 1XF1A 1M4IA 2YGWA 4CO9A 2DXQA 4P4IA 2YJTA 3NE8A 2ZEMA 3KL9A 1Q7LA 2EO8A 4NFRA 4RI1A 3D7GA 1JQGA 3OB2B 2ZPAA 4A32A 3WT4A 3D3SA 3K2KA 1VBHA 2AUNA 2HV2A 1VKCA 4NGTA 4II9A 5HMNA 4BTFA 1QQ9A 3D66A 2OB0A 4KVME 3MRUA 1BPMA 3D4UA 3WC6A 3IWGA 1JWQA 4P45A 4P4FA 3VGOA 3B3WA 4FUUA 2BUEA 2FS5A 2NMTA 3TC8A 4A30A 3PT1A 3B3CA 1HDUA 1Y0RA 2PIYA 3SI1A 4C7HA 4RR2B 4DYOA 2FXFA 2IQ6A 3WC7A 1LANA 4CGMA 3EO4A 4MMOA 4YFJA 4JVOA 3CXPA 3KI9A 2Y1NA 3IWWA 3R1KA 1IIDA 2Z3OA 4M85A 5DWNA 4ZY2A 2I79A 5IB0A 4A95A 4NJQA 1P0HA 3LMSA 4JJXA 2Q4YA 3I1UA 4CAWA 4E94A 4ZY1A 3EC4A 3OB1B 4KOVA 1F2OA 3F5BA 2IL4A 4LQ6A 4PXCA 4B14A 4ZYQA 4I49A 2EZCA 5CBMA 1VIXA 1VI4A 2V77A 4OIDA 2ZEGA 1IOIA 5A27A 4M6GA 4MHZA 1IY7A 1Z2LA 2PRQA 3DNSA 5F09A 4KZTA 4BPWB 3VRNA 2YNCA 3VRPA 2ZEOA 4KS9A 3ISXA 2G0BA 1YVOA 1VHSA 4MFLA 3W91A 5C82A 3NOJA 3G3SA 1CP7A 3TLGB 2P6GA 2R7HA 2PJ8A 4KVOE 2JDDA 2N3AB 4R87A 5E96A 3SR3A 2Z0ZA 5K8OA 3BUNB 1Z9EA 3WABA 1XBUA 2GANA 3CXQA 2EVNA 5EMIA 4ZX8A 4CYPA 5JGFA 4RN7A 4C9AA 2F8HA 4P4EA 4Y49C 2ZEPA 3B3VA 1YR0A 2BSWA 3BLNA 3C26A 4BPUB 2PJ5A 4X3RA 3H8EA 4MY0A 4XPKA 3EZBA 3G8WA 1KZFA 3B2YA 3T90A 4JWPA 1KWMA 3ZJ0A 3TLEA 4TNUA 4TJVA 3S9NA 1Z5RA 4H1HA 1J4JA 1ON0A 1YK3A 3H8GA 2JEVA 4NGSA 4KLWA 1SQHA 2IJZA 2ZEFA 2B58A 5THWA 4B11A 4Y49B 1Z4RA 2G9DA 2ANPA 3TTHA 4C85A 2ZEDA 4P10A 2I00A 4A38A 1KUVA 2PJ9A 4FD5A 2XEIA 1QMUA 2CNTA 1H8LA 2G3TA 3DGVA 4KUBA 4B12A 4BINA 1Z8XA 4E2AA 4KNGE 2B5GA 3TCVA 4OC3A 1X12A 4F0XA 4PXBA 3N7ZA 1BOBA 5KTAA 4IUSA 4MFZA 4Q36A 1BO4A 2VI7A 3BXMA 2QIRA 4KSAA 4OIWA 3NFZA 3OWCA 2FVGA 2REEA 1RTQA 4KOXA 4XPDB 5D8NA 1BPNA 3SXNA 1XEBA 2BL1A 3TOBA 2Q7SA 1UWYA 3GB0A 2HROA 4A39A 3TX8A 3ICUA 2AFXA 4XNHB 3K4IA 2RB7A 3T5MA 2XPLA 2HI6A 3KRVA 2WYRA 4PXDA 3V38A 4E5SA 2ZXVA 1Q2CA 5I0CA 4E8OA 1J3LA 2QYVA 4NXYA 1WVMA 4M8DA 1CJWA 3GYAA 3LODA 4AG9A 2ZW5A 1RO5A 4C9UA 4A37A 3F0AA 4ZY0A 4NSQA 2Q0YA 2VZZA 3HLPA 1S7NA 2DIKA 3T07A 5I4MA 4EFDA 3SI0A 4K30A 2Q44A 3VRQA 5G20A 1ZL0A 3VATA 3GKRA 1F2PA 4F8ZA 1R57A 4OAEA 2J9AA 4M6HA 2JLMA 2PQ8A 1S3ZA 5G22A 4E0AA 4CGPA 1R61A 2E28A 1XFOA 1CG2A 3PEIA 4CYQA 3R9EA 3O8ZA 3P2FA 5F13A 4LUAA 1IOFA 1NSLA 3FIXA 1KC7A 3MGDA 5DS0A 4PQAA 5KTCA 2XPOA 4DNCA 1Q2YA 4DUKA 3D7HA 4IIYA 1XJOA 3D67A 1QSTA 1XE4A 1YX0A 3KR5A 2F5IA 1XMBA 4DJLA 4JLYA 2B0AA 3KQZA 1FNOA 2BO9A 4PK2A 2FT0A 4F9VA 2C6PA 1AMPA 1ARLA 2FIAA 1QSNA 3FNCA 2CIJA 2X0SA 4Q7AA 3VWDA 4YRHA 2CNSA 5LRKA 2ZELA 4YN3A 1NSAA 3RYOA 2DPTA 2PJ6A 1M4LA 4G1PA 4C9VA 2ABZA 4IF5A 3KKWA 4CDJA 1Y0YA 4NF1A 4QC6A 2OOTA 1B6BA 2J8NA 3FXTA 2Q51A 3GY9A 3PBEA 1A9XB 4A4CA 1ELMP 4AB7A 2PVWA 3PLFB 1IU8A 3KHXA 4KOYA 2EUIA 2YNDA 3K9UA 4MY3A 1EE3P 4EWTA 3TYXA 4ZGYB 3UY5A 4AVCA 4C9EA 2Y1MA 4F0YA 1TKJA 3NH4A 3S6FA 4OC4A 2ATRA 2PJ2A 5F48A 5JYBA 4X2TA 2JBJA 4FWUA 3PBBA 4A31A 2PDOA 3GJZA 2B4DA 2ZENA 2JEWA 4P4BA 1VGYA 5JM6A 4HKFA 1YVKA 4MHNA 4AVAA 4QBJA 3S9MA 2YNCC 4UWJA 1YLOA 1WK4A 2PJAA 4QUSA 2ZEEA 1WWZA 4UEEA 1DTDA 2ZOGA 3FH4A 2DLAA 3BHXA 4KOWA 5EC4A 3VTAA 2AE6A 4ONWA 2C5QA 4BD9A 1HDQA 2V8HA 4IHMA 1UFHA 1QSOA 1TKFA 4R3KA 2PVVA 1BAVA 4INJA 3I74A 5HKWA 4F9UA 1IGBA 5IB9A 4UFXA 4UF4A 4X5KA 5ELYA 2B3UA 4M3SA 4HNWB 4LX9A 1Y7EA 5JVLA 3W6XA 1Y9KA 2PRBA 4KVXA 4H6ZA 2B4JC 1FY7A 4BMHA 2PR8A 3FB3A 4BBHA 4C7IA 5DWMA 3VWEA 3CPAA 1M1DA 1CPXA 3QNVA 1PUAA 4JXQA 4KSIA 4MRIA 4C2YA 3MN8A 4F6AA 5JPHA 3EZAA 2QVPA 2Z3NA 4EYSA 1P4NA 4CDKA 3RZAA 2AUMA 1YGHA 1K4JA 3TO9A 3F9KC 1BLLE 3HMJG 2CXAA 3BUMB 1GYTA 4CGNA 4MJXA 3NE7A 2B3VA 4MFJA 2OZHA 5H86A 3BUOB 4NGNA 4A94A 1KUYA 1QSMA 1Y9ZA 4CYOA 4C2ZA 3FX6A 1OZPA 2CF4A 4CGOA 3TFYA 3EY5A 2NYQA 4HPSA 4BPXB 2HQYA 5JQ4A 2HWGA 3PP9A 3DDDA 2B5GB 3R9GA 1TF8A 1ZLHA 2B4BA 2VEZA 4FD4A 4GS4A 3B8GA 4ZBGA 3FJUA 2H5MA 4OADA 4UEZA 5G1ZA 4FBEA 4H2KA 3PB6X 2EWBA 4PXEA 2OR4A 2CTCA 3B3SA 2AFOA 3HUVA 4C8FA 3I6SA 3EZEA 1XRYA 1Z4EA 1B47A 2QJ8A 2OLSA 3SJEA 3N5FA 1EO0A 3JTKA 5AG5A 4JD6A 4MCSA 1F57A 1TIQA 5HKZA 2P0WA 2PJ7A 3T0TA 4MCQA 3IIBA 5IV0A 2D4OA 3CDXA 2DEAA 2Q7BA 4R3LA 3OAKA 1Y9WA 1XMTA 1ZG9A 2AFWA 2RC4A 4J3GA 4UCNA 2IMOA 2XPPA 3V8IA 1YMEA 2PE3A 4YGOA 4UCPA 3DR8A 1ARMA 1X10A 3TT2A 4COGA 3GIUA 2PC1A 1GGOA 5EBVA 2AJ6A 5J8FA 5F1YA 1LFWA 3FECA 4OKOA 1BXRB 4GM5A 1N71A 3D8PA 1LCPA 2YJVA 1MJ9A 2PR1A 3CXSA 4U5YA 4IAVA 3KASA 1PCAA 4IK2A 2XEGA 1C30B 2AFUA 4PV6A 2ZEHA 4FD6A 4LQGA 1NMTA 3DLJA 2VQYA 1R43A 5JH9A 2AFSA 2QECA 4R57A 1NXJA 4MI4A 2OU2A 1CP6A 1Z8WA 5FD8A 3H5ZA 1IYLA 5LRGA 4C8AA 3VROA 1VHOA 2VXKA 3BJ7A 3PB4X 4HNYB 4MHDA 1ZYMA 5HKYA 4C86A 3PB9X 4KOSA 4XPLA 4YU9A 2C27A 4NEXA 4AG7A 4C9RA 2D4PA 3PFOA 2FE7A 2A4NA 3IO1A 1Q5XA 3KZWA 4OP4A 5BWAB 4U9ZA 4ZX9A 3VARA 3CPXA 4MHPA 2Z3KA 1CBXA 5F49A 5CPAA 2WUUA 2J8MA 5J3XA 4CAXA 3PB7X 5G21A 5GCNA 2RFHA 5LYLA 2O28A 2R8VA 4Z65A 2Y0MA 3SI2A 1CM0A 3JRUA 1CX8A 1OBRA 4U9YA 1YREA 4X8IA 3R96A 2B4DB 3DR6A 4A2ZA 3VRRA 3ISZA 3S6GA 2OH1A 1A2ZA 2Q04A 4MHYA 4CGLA 4JXRA 3S6KA 4B13A 1NBWA 4J0NA 1TXRA 2PJBA 3EIFA 1LOKA 4CZ1A 1HEEA 2ZOFA 5HH1A 1TKHA 2ARHA 1T36B 3EFAA 4NGRA 4OC2A 2Q4ZA 3VH9A 3FVLA 3F8KA 4UCMA 4O23A 2PJ0A 2GP4A 1YW6A 3SHPA 4CPAA
chains in the Genus database with same CATH topology
5LYDA 1DE4C 3CT9A 4FAIA 2PJ4A 2BOAA 3B35A 4UEFA 3NA6A 5HVFA 3NH8A 3H8FA 2JBKA 5HVGA 5LRJA 4JYWA 3L2NA 2V8VA 1V6CA 1VHEA 4YWYA 2PJ1A 1R3NA 2EK8A 4B6ZA 1TF9A 4P44A 3S9LA 1ELLP 4NGMA 4MCRA 1FT7A 4OC0A 3B7IA 2AFZA 2PJ3A 2HB6A 2VL1A 4UIAA 3FMCA 1PYTB 2BCOA 2PIZA 1LAMA 1YSJA 2C1CA 3VTAA 4W9YA 2CTBA 3D7DA 2C6CA 4EMEA 5HVHA 1YW4A 2XEFA 3KR4A 5LYIA 2PCUA 2I3CA 3B3TA 3D7FA 1ZG8A 2O4HA 1CPSA 2NSMA 3KGQA 3KHZA 3FEEA 4P4DA 4WWVA 5K8MA 4C8PA 2GREA 5IR2A 2C6GA 2WZNA 2V8DA 3RBUA 4OC1A 5HXDA 4C99A 3V7ZA 4UIBA 4TWEA 3BI1A 4NJRA 4NGQA 4OMEA 3PRTA 4R7MA 3WC5A 1ZG7A 2HC9A 3IFEA 4JZ0A 1AYEA 3SJGA 5LYFA 3FEDA 2GLFA 3KQXA 2V8GA 2PJCA 3GUXA 4C8CA 4C8UA 4WJBA 4R6TA 3RAMA 3BI0A 4P4JA 4R76A 3K9TA 1LAPA 2F7VA 3IC1A 5K8NA 4P6YA 2GU2A 3PFEA 5D29A 3LWUA 1Z8LA 4OC5A 3GLJA 2AFMA 3NH5A 2Q43A 3SJFA 3FF3A 4PPZA 2GLJA 3D68A 7CPAA 2POKA 8CPAA 4R8FA 2XEJA 4RUHA 3IEHA 6CPAA 4AXVA 1ZLIA 4TJXA 4C84A 2EK9A 3T8WA 3PB8X 4K3NA 4MCPA 2O53A 3IJ3A 3SJXA 4NGPA 5K8PA 5J1QA 4MXUA 1XF1A 4P4IA 2ZEMA 3KL9A 1Q7LA 4NFRA 3D7GA 1JQGA 3WT4A 3K2KA 4NGTA 1QQ9A 3D66A 3MRUA 1BPMA 3D4UA 3WC6A 4P45A 4P4FA 3B3WA 4FUUA 3TC8A 3B3CA 1HDUA 1Y0RA 2PIYA 3SI1A 4DYOA 2IQ6A 3WC7A 1LANA 4MMOA 3KI9A 4ZY2A 4C9EA 3IWWA 4NJQA 3LMSA 3I1UA 4ZY1A 4ZYQA 1F2OA 4PXCA 5CBMA 1VIXA 2V77A 4OIDA 2ZEGA 4MHZA 1IY7A 1Z2LA 2PRQA 5F09A 2ZEOA 3ISXA 1CP7A 2PJ8A 5K8OA 3WABA 1XBUA 4C9AA 4ZX8A 5JGFA 2F8HA 4P4EA 3H8EA 3B3VA 2ZEPA 2PJ5A 4X3RA 3B2YA 1KWMA 4TNUA 4TJVA 3S9NA 1Z5RA 3H8GA 4NGSA 2IJZA 2ZEFA 5THWA 2G9DA 2ANPA 4C85A 2ZEDA 4P10A 4A38A 2PJ9A 4ZI6A 2XEIA 1QMUA 3DGVA 1H8LA 4KNGE 4OC3A 4PXBA 4OIWA 3BXMA 3NFZA 2FVGA 1RTQA 5D8NA 1BPNA 3ICUA 1UWYA 3GB0A 4A39A 3TX8A 2AFXA 2RB7A 2WYRA 4PXDA 3V38A 2QYVA 4C9UA 4A37A 4ZY0A 3HLPA 5I4MA 4EFDA 3SI0A 3VATA 1F2PA 4F8ZA 2J9AA 1XFOA 1CG2A 3PEIA 5DS0A 4PQAA 4DUKA 3D7HA 1XJOA 3D67A 3KR5A 1XMBA 4DJLA 3KQZA 1FNOA 2BO9A 4F9VA 2C6PA 1AMPA 1ARLA 2CIJA 4Q7AA 5LRKA 2ZELA 4YN3A 1NSAA 2PJ6A 1M4LA 4G1PA 4C9VA 2ABZA 4CDJA 1Y0YA 2OOTA 3PBEA 1WVMA 2Q51A 1ELMP 2PVWA 3KHXA 1EE3P 4EWTA 1TKJA 3NH4A 4OC4A 2PJ2A 4X2TA 2JBJA 4FWUA 3PBBA 2ZENA 2JEWA 4P4BA 1VGYA 5JM6A 4MHNA 3S9MA 1YLOA 2PJAA 2ZEEA 4UEEA 1DTDA 2ZOGA 3FH4A 3BHXA 4ONWA 2C5QA 4BD9A 1HDQA 2V8HA 4IHMA 1TKFA 2PVVA 1BAVA 3I74A 4F9UA 1IGBA 5IB9A 4UF4A 5ELYA 1Y7EA 3CPAA 1CPXA 3QNVA 4MRIA 4KSIA 3MN8A 2QVPA 4CDKA 3RZAA 1BLLE 1GYTA 4A94A 4NGNA 1Y9ZA 3FX6A 2CF4A 4C8TA 2NYQA 1TF8A 1ZLHA 3FJUA 4UEZA 4FBEA 4H2KA 3PB6X 2EWBA 4PXEA 2OR4A 2CTCA 3B3SA 2AFOA 3HUVA 4C8FA 3I6SA 1XRYA 2QJ8A 3SJEA 3N5FA 4MCSA 1F57A 2PJ7A 4MCQA 3IIBA 3CDXA 2DEAA 1ZG9A 2AFWA 2IMOA 1YMEA 2PE3A 1ARMA 1LFWA 3FECA 4OKOA 4GM5A 1LCPA 4IAVA 3KASA 1PCAA 4IK2A 2XEGA 2AFUA 2ZEHA 4LQGA 3DLJA 1R43A 5JH9A 2AFSA 1CP6A 5LRGA 4C8AA 4C86A 1VHOA 3PB4X 3PB9X 4YU9A 4C9RA 3PFOA 3IO1A 3KZWA 4OP4A 4ZX9A 3VARA 3CPXA 4MHPA 1CBXA 5CPAA 3PB7X 2RFHA 5LYLA 4Z65A 3SI2A 3JRUA 1CX8A 1OBRA 4X8IA 3ISZA 4MHYA 1TXRA 2PJBA 3EIFA 1LOKA 1HEEA 2ZOFA 1TKHA 4NGRA 4OC2A 2Q4ZA 3VH9A 3FVLA 4O23A 2PJ0A 2GP4A 1YW6A 4CPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LYD A;  1DE4 C;  3CT9 A;  4FAI A;  2PJ4 A;  2BOA A;  3B35 A;  4UEF A;  3NA6 A;  5HVF A;  3NH8 A;  3H8F A;  2JBK A;  5HVG A;  5LRJ A;  4JYW A;  3L2N A;  2V8V A;  1V6C A;  1VHE A;  4YWY A;  2PJ1 A;  1R3N A;  2EK8 A;  4B6Z A;  1TF9 A;  4P44 A;  3S9L A;  1ELL P;  4NGM A;  4MCR A;  1FT7 A;  4OC0 A;  3B7I A;  2AFZ A;  2PJ3 A;  2HB6 A;  2VL1 A;  4UIA A;  3FMC A;  1PYT B;  2BCO A;  2PIZ A;  1LAM A;  1YSJ A;  2C1C A;  3VTA A;  4W9Y A;  2CTB A;  3D7D A;  2C6C A;  4EME A;  5HVH A;  1YW4 A;  2XEF A;  3KR4 A;  5LYI A;  2PCU A;  2I3C A;  3B3T A;  3D7F A;  1ZG8 A;  2O4H A;  1CPS A;  2NSM A;  3KGQ A;  3KHZ A;  3FEE A;  4P4D A;  4WWV A;  5K8M A;  4C8P A;  2GRE A;  2C6G A;  2WZN A;  2V8D A;  3RBU A;  4OC1 A;  5HXD A;  4C99 A;  3V7Z A;  4UIB A;  4TWE A;  3BI1 A;  4NJR A;  4NGQ A;  4OME A;  3PRT A;  4R7M A;  3WC5 A;  1ZG7 A;  2HC9 A;  3IFE A;  4JZ0 A;  1AYE A;  3SJG A;  5LYF A;  3FED A;  2GLF A;  3KQX A;  2V8G A;  2PJC A;  3GUX A;  4C8C A;  4C8U A;  4WJB A;  4R6T A;  3RAM A;  3BI0 A;  4P4J A;  4R76 A;  3K9T A;  1LAP A;  2F7V A;  3IC1 A;  5K8N A;  4P6Y A;  2GU2 A;  3PFE A;  5D29 A;  3LWU A;  1Z8L A;  4OC5 A;  3GLJ A;  2AFM A;  3NH5 A;  2Q43 A;  3SJF A;  3FF3 A;  4PPZ A;  2GLJ A;  3D68 A;  7CPA A;  2POK A;  8CPA A;  4R8F A;  2XEJ A;  4RUH A;  3IEH A;  6CPA A;  4AXV A;  1ZLI A;  4TJX A;  4C84 A;  2EK9 A;  3T8W A;  3PB8 X;  4K3N A;  4MCP A;  2O53 A;  3IJ3 A;  3SJX A;  4NGP A;  5K8P A;  5J1Q A;  4MXU A;  1XF1 A;  4P4I A;  2ZEM A;  3KL9 A;  1Q7L A;  4NFR A;  3D7G A;  1JQG A;  3WT4 A;  3K2K A;  4NGT A;  1QQ9 A;  3D66 A;  3MRU A;  1BPM A;  3D4U A;  3WC6 A;  4P45 A;  4P4F A;  3B3W A;  4FUU A;  3TC8 A;  3B3C A;  1HDU A;  1Y0R A;  2PIY A;  3SI1 A;  4DYO A;  2IQ6 A;  3WC7 A;  1LAN A;  4MMO A;  3KI9 A;  4ZY2 A;  4C9E A;  3IWW A;  4NJQ A;  3LMS A;  3I1U A;  4ZY1 A;  4ZYQ A;  1F2O A;  4PXC A;  5CBM A;  1VIX A;  2V77 A;  4OID A;  2ZEG A;  4MHZ A;  1IY7 A;  1Z2L A;  2PRQ A;  5F09 A;  2ZEO A;  3ISX A;  1CP7 A;  2PJ8 A;  5K8O A;  3WAB A;  1XBU A;  4C9A A;  4ZX8 A;  5JGF A;  2F8H A;  4P4E A;  3H8E A;  3B3V A;  2ZEP A;  2PJ5 A;  4X3R A;  3B2Y A;  1KWM A;  4TNU A;  4TJV A;  3S9N A;  1Z5R A;  3H8G A;  4NGS A;  2IJZ A;  2ZEF A;  5THW A;  2G9D A;  2ANP A;  4C85 A;  2ZED A;  4P10 A;  4A38 A;  2PJ9 A;  4ZI6 A;  2XEI A;  1QMU A;  3DGV A;  1H8L A;  4KNG E;  4OC3 A;  4PXB A;  4OIW A;  3BXM A;  3NFZ A;  2FVG A;  1RTQ A;  5D8N A;  1BPN A;  3ICU A;  1UWY A;  3GB0 A;  4A39 A;  3TX8 A;  2AFX A;  2RB7 A;  2WYR A;  4PXD A;  3V38 A;  2QYV A;  4C9U A;  4A37 A;  4ZY0 A;  3HLP A;  5I4M A;  4EFD A;  3SI0 A;  3VAT A;  1F2P A;  4F8Z A;  2J9A A;  1XFO A;  1CG2 A;  3PEI A;  5DS0 A;  4PQA A;  4DUK A;  3D7H A;  1XJO A;  3D67 A;  3KR5 A;  1XMB A;  4DJL A;  3KQZ A;  1FNO A;  2BO9 A;  4F9V A;  2C6P A;  1AMP A;  1ARL A;  2CIJ A;  4Q7A A;  5LRK A;  2ZEL A;  4YN3 A;  1NSA A;  2PJ6 A;  1M4L A;  4G1P A;  4C9V A;  2ABZ A;  4CDJ A;  1Y0Y A;  2OOT A;  3PBE A;  1WVM A;  2Q51 A;  1ELM P;  2PVW A;  3KHX A;  1EE3 P;  4EWT A;  1TKJ A;  3NH4 A;  4OC4 A;  2PJ2 A;  4X2T A;  2JBJ A;  4FWU A;  3PBB A;  2ZEN A;  2JEW A;  4P4B A;  1VGY A;  5JM6 A;  4MHN A;  3S9M A;  1YLO A;  2PJA A;  2ZEE A;  4UEE A;  1DTD A;  2ZOG A;  3FH4 A;  3BHX A;  4ONW A;  4BD9 A;  1HDQ A;  2V8H A;  4IHM A;  1TKF A;  2PVV A;  1BAV A;  3I74 A;  4F9U A;  1IGB A;  5IB9 A;  4UF4 A;  5ELY A;  1Y7E A;  3CPA A;  1CPX A;  3QNV A;  4MRI A;  4KSI A;  3MN8 A;  2QVP A;  4CDK A;  3RZA A;  1BLL E;  1GYT A;  4A94 A;  4NGN A;  1Y9Z A;  3FX6 A;  2CF4 A;  4C8T A;  2NYQ A;  1TF8 A;  1ZLH A;  3FJU A;  4UEZ A;  4FBE A;  4H2K A;  3PB6 X;  2EWB A;  4PXE A;  2OR4 A;  2CTC A;  3B3S A;  2AFO A;  3HUV A;  4C8F A;  3I6S A;  1XRY A;  2QJ8 A;  3SJE A;  3N5F A;  4MCS A;  1F57 A;  2PJ7 A;  4MCQ A;  3IIB A;  3CDX A;  2DEA A;  1ZG9 A;  2AFW A;  2IMO A;  1YME A;  2PE3 A;  1ARM A;  1LFW A;  3FEC A;  4OKO A;  4GM5 A;  1LCP A;  4IAV A;  3KAS A;  1PCA A;  4IK2 A;  2XEG A;  2AFU A;  2ZEH A;  4LQG A;  3DLJ A;  1R43 A;  5JH9 A;  2AFS A;  1CP6 A;  5LRG A;  4C8A A;  4C86 A;  1VHO A;  3PB4 X;  3PB9 X;  4YU9 A;  4C9R A;  3PFO A;  3IO1 A;  3KZW A;  4OP4 A;  4ZX9 A;  3VAR A;  3CPX A;  4MHP A;  1CBX A;  5CPA A;  3PB7 X;  2RFH A;  5LYL A;  4Z65 A;  3SI2 A;  3JRU A;  1CX8 A;  1OBR A;  4X8I A;  3ISZ A;  4MHY A;  1TXR A;  2PJB A;  3EIF A;  1LOK A;  1HEE A;  2ZOF A;  1TKH A;  4NGR A;  4OC2 A;  2Q4Z A;  3VH9 A;  3FVL A;  4O23 A;  2PJ0 A;  1YW6 A;  4CPA A; 
#chains in the Genus database with same CATH topology
 1XIX A;  1S7K A;  3D2M A;  1WJT A;  5BY0 A;  5LYD A;  1EZA A;  1DE4 C;  3CT9 A;  1VBG A;  4FAI A;  1AUG A;  2PCN A;  4GPL B;  2PSW A;  1PU9 A;  5KTD A;  4KSF A;  2FCK A;  3I3G A;  4MFK A;  2BEI A;  4CRZ B;  5AG6 A;  2PJ4 A;  1B87 A;  2BOA A;  3WR7 A;  3ZZI A;  4MBU A;  3B35 A;  4UEF A;  3NA6 A;  5HVF A;  3NH8 A;  3H8F A;  4QB9 A;  3TLY A;  2XPN A;  2ZW7 A;  1CE8 B;  2JBK A;  5HVG A;  4FD7 A;  4L89 A;  3TE4 A;  5K99 A;  5LRJ A;  4JYW A;  4CAV A;  5F46 A;  2YNE A;  2R1I A;  2EBJ A;  2Z3L A;  3W6S A;  3L2N A;  5A28 A;  2V8V A;  2J8R A;  5FVJ A;  1V6C A;  1VHE A;  4YWY A;  2OZG A;  4AVB A;  3TLZ A;  5CNP A;  4ORF A;  2PJ1 A;  1I12 A;  4CS0 B;  3S6H A;  1R3N A;  2EK8 A;  4MFQ A;  4B6Z A;  1TF9 A;  4P44 A;  2D0O A;  1DIK A;  3TLC A;  3S9L A;  1ELL P;  3P2H A;  3RNZ A;  2REF A;  2R82 A;  4NGM A;  4COB A;  2ZW4 A;  4UA3 A;  4MCR A;  1FT7 A;  4OC0 A;  3B7I A;  4EVY A;  2AFZ A;  2PJ3 A;  3BUW B;  2FM4 A;  5AGE A;  2OZU A;  2DF5 A;  1V0C A;  2HB6 A;  1ZRS A;  1YQE A;  2VL1 A;  4UIA A;  1S7L A;  1S7F A;  4HNX B;  3I9S A;  3FMC A;  1PYT B;  4KLV A;  4M6I A;  3FYN A;  2BCO A;  3QAH A;  5J8C A;  2K5T A;  4UFV A;  2PIZ A;  4QVT A;  1C3O B;  1MJB A;  1LAM A;  1YSJ A;  2C1C A;  2P6F A;  2Q4V A;  1FBV A;  2JDC A;  2ODF A;  4GXH A;  4L8A A;  4ONU A;  4UBR A;  1YVH A;  4W9Y A;  2CTB A;  3BJ8 A;  3R95 A;  3D7D A;  2C6C A;  4B5P B;  1LRZ A;  2CY2 A;  4EME A;  1RXT A;  5HVH A;  1YW4 A;  2VBQ A;  5F5X A;  2XEF A;  2CBL A;  3ZNI A;  3KR4 A;  3D2P A;  1IB1 E;  1QSR A;  5LYI A;  2PCU A;  1S60 A;  2I3C A;  3B3T A;  3JVN A;  5AG4 A;  3PZJ A;  3D7F A;  5F47 A;  2WSA A;  3U88 C;  4MJ8 A;  5AG7 A;  5C88 A;  2FIW A;  4A4B A;  1ZG8 A;  2CNM A;  4C68 A;  4B5P A;  2O4H A;  1CPS A;  2Z3M A;  1XF8 A;  2NSM A;  4MI1 A;  3KGQ A;  1M4D A;  3KHZ A;  3TO7 A;  3FEE A;  4ZI6 A;  4P4D A;  1MJA A;  1GHE A;  4WWV A;  5K8M A;  3SXO A;  2GRE A;  2GIV A;  2C6G A;  1CS0 B;  1ZO0 A;  2WZN A;  3A9L A;  5IR2 A;  4C8P A;  3QAY A;  1KBL A;  2V8D A;  4OC1 A;  3RBU A;  3FBU A;  3TLA A;  4CYN A;  5HXD A;  4C99 A;  4PSW A;  3V7Z A;  3E0K A;  1M4G A;  3EXN A;  4PK3 A;  4UIB A;  5F9M A;  4TWE A;  3TLG A;  3BI1 A;  1M6V B;  2FSR A;  4NJR A;  4NGQ A;  4XPD C;  3HPH E;  4OME A;  3PRT A;  4R7M A;  3WC5 A;  1ZG7 A;  2HC9 A;  3IFE A;  2EZA A;  4JZ0 A;  1AYE A;  2Z10 A;  4UFW A;  3SJG A;  5LYF A;  3T05 A;  4XNH C;  3FED A;  3TOA A;  2EZB A;  2GLF A;  3KQX A;  4NCZ A;  3RO0 A;  2WPX A;  1MK4 A;  2GE3 A;  2V8G A;  4B5O A;  3BUX B;  2PJC A;  3FRM A;  3GUX A;  4KOU A;  4C8C A;  4WJB A;  4C8U A;  2Z3P A;  4R6T A;  3RAM A;  3IU2 A;  1YLE A;  3G23 A;  3HPG G;  4R9M A;  1I1D A;  1Q2D A;  4KUA A;  2R98 A;  2VZY A;  4MFP A;  3CZX A;  3BI0 A;  4P4J A;  4R76 A;  3K9T A;  5ISV A;  2GFQ A;  1I21 A;  2VKZ G;  3PFV A;  4H89 A;  3R9F A;  1LAP A;  2G3A A;  2Z11 A;  4CRY B;  4C8T A;  2F7V A;  3IC1 A;  5K8N A;  4P6Y A;  2GU2 A;  1S5K A;  3PFE A;  4UWI A;  5D29 A;  1Z9U A;  2UV8 G;  1NE9 A;  2DPS A;  3JUW A;  3LWU A;  5H84 A;  1Z8L A;  3LD2 A;  4OC5 A;  3GLJ A;  4C2X A;  2AFM A;  3TO6 A;  2KCW A;  3OP0 A;  4A33 A;  1M44 A;  3NH5 A;  2Q43 A;  3SJF A;  3T9Y A;  3DSB A;  2WPW A;  4KOR A;  4KOT A;  1JDB C;  3FF3 A;  4PPZ A;  2GLJ A;  3D68 A;  7CPA A;  1L0C A;  3C8O A;  2POK A;  1IYK A;  1IIC A;  8CPA A;  2D0P A;  4OLL A;  3U1B A;  1Z8T A;  4Q38 A;  3QB8 A;  4B10 A;  4CAE A;  1XOV A;  2MP0 A;  2QML A;  4R8F A;  1KEE B;  2XEJ A;  4RUH A;  3IEH A;  1Y7R A;  6CPA A;  3IGR A;  3H4Q A;  4AXV A;  1KUX A;  1ZLI A;  2HUZ A;  2ZW6 A;  3IWE A;  4H6U A;  4TJX A;  3LAC A;  4PSX A;  4C84 A;  1EZB A;  2EK9 A;  3IU1 A;  3T8W A;  4CAF A;  3PB8 X;  4K3N A;  1JDE A;  3NFQ A;  4MCP A;  2FL4 A;  2O53 A;  5AXI A;  3IJ3 A;  3SJX A;  5IX3 A;  4NGP A;  5K8P A;  3TLB A;  2P6E A;  2X7B A;  3PGP A;  5J1Q A;  4MXU A;  4RS2 A;  4IIX A;  1U6M A;  1XF1 A;  1M4I A;  2YGW A;  4CO9 A;  2DXQ A;  4P4I A;  2YJT A;  3NE8 A;  2ZEM A;  3KL9 A;  1Q7L A;  2EO8 A;  4NFR A;  4RI1 A;  3D7G A;  1JQG A;  3OB2 B;  2ZPA A;  4A32 A;  3WT4 A;  3D3S A;  3K2K A;  1VBH A;  2AUN A;  2HV2 A;  1VKC A;  4NGT A;  4II9 A;  5HMN A;  4BTF A;  1QQ9 A;  3D66 A;  2OB0 A;  4KVM E;  3MRU A;  1BPM A;  3D4U A;  3WC6 A;  3IWG A;  1JWQ A;  4P45 A;  4P4F A;  3VGO A;  3B3W A;  4FUU A;  2BUE A;  2FS5 A;  2NMT A;  3TC8 A;  4A30 A;  3PT1 A;  3B3C A;  1HDU A;  1Y0R A;  2PIY A;  3SI1 A;  4C7H A;  4RR2 B;  4DYO A;  2FXF A;  2IQ6 A;  3WC7 A;  1LAN A;  4CGM A;  3EO4 A;  4MMO A;  4YFJ A;  4JVO A;  3CXP A;  3KI9 A;  2Y1N A;  3IWW A;  3R1K A;  1IID A;  2Z3O A;  4M85 A;  5DWN A;  4ZY2 A;  2I79 A;  5IB0 A;  4A95 A;  4NJQ A;  1P0H A;  3LMS A;  4JJX A;  2Q4Y A;  3I1U A;  4CAW A;  4E94 A;  4ZY1 A;  3EC4 A;  3OB1 B;  4KOV A;  1F2O A;  3F5B A;  2IL4 A;  4LQ6 A;  4PXC A;  4B14 A;  4ZYQ A;  4I49 A;  2EZC A;  5CBM A;  1VIX A;  1VI4 A;  2V77 A;  4OID A;  2ZEG A;  1IOI A;  5A27 A;  4M6G A;  4MHZ A;  1IY7 A;  1Z2L A;  2PRQ A;  3DNS A;  5F09 A;  4KZT A;  4BPW B;  3VRN A;  2YNC A;  3VRP A;  2ZEO A;  4KS9 A;  3ISX A;  2G0B A;  1YVO A;  1VHS A;  4MFL A;  3W91 A;  5C82 A;  3NOJ A;  3G3S A;  1CP7 A;  3TLG B;  2P6G A;  2R7H A;  2PJ8 A;  4KVO E;  2JDD A;  2N3A B;  4R87 A;  5E96 A;  3SR3 A;  2Z0Z A;  5K8O A;  3BUN B;  1Z9E A;  3WAB A;  1XBU A;  2GAN A;  3CXQ A;  2EVN A;  5EMI A;  4ZX8 A;  4CYP A;  5JGF A;  4RN7 A;  4C9A A;  2F8H A;  4P4E A;  4Y49 C;  2ZEP A;  3B3V A;  1YR0 A;  2BSW A;  3BLN A;  3C26 A;  4BPU B;  2PJ5 A;  4X3R A;  3H8E A;  4MY0 A;  4XPK A;  3EZB A;  3G8W A;  1KZF A;  3B2Y A;  3T90 A;  4JWP A;  1KWM A;  3ZJ0 A;  3TLE A;  4TNU A;  4TJV A;  3S9N A;  1Z5R A;  4H1H A;  1J4J A;  1ON0 A;  1YK3 A;  3H8G A;  2JEV A;  4NGS A;  4KLW A;  1SQH A;  2IJZ A;  2ZEF A;  2B58 A;  5THW A;  4B11 A;  4Y49 B;  1Z4R A;  2G9D A;  2ANP A;  3TTH A;  4C85 A;  2ZED A;  4P10 A;  2I00 A;  4A38 A;  1KUV A;  2PJ9 A;  4FD5 A;  2XEI A;  1QMU A;  2CNT A;  1H8L A;  2G3T A;  3DGV A;  4KUB A;  4B12 A;  4BIN A;  1Z8X A;  4E2A A;  4KNG E;  2B5G A;  3TCV A;  4OC3 A;  1X12 A;  4F0X A;  4PXB A;  3N7Z A;  1BOB A;  5KTA A;  4IUS A;  4MFZ A;  4Q36 A;  1BO4 A;  2VI7 A;  3BXM A;  2QIR A;  4KSA A;  4OIW A;  3NFZ A;  3OWC A;  2FVG A;  2REE A;  1RTQ A;  4KOX A;  4XPD B;  5D8N A;  1BPN A;  3SXN A;  1XEB A;  2BL1 A;  3TOB A;  2Q7S A;  1UWY A;  3GB0 A;  2HRO A;  4A39 A;  3TX8 A;  3ICU A;  2AFX A;  4XNH B;  3K4I A;  2RB7 A;  3T5M A;  2XPL A;  2HI6 A;  3KRV A;  2WYR A;  4PXD A;  3V38 A;  4E5S A;  2ZXV A;  1Q2C A;  5I0C A;  4E8O A;  1J3L A;  2QYV A;  4NXY A;  1WVM A;  4M8D A;  1CJW A;  3GYA A;  3LOD A;  4AG9 A;  2ZW5 A;  1RO5 A;  4C9U A;  4A37 A;  3F0A A;  4ZY0 A;  4NSQ A;  2Q0Y A;  2VZZ A;  3HLP A;  1S7N A;  2DIK A;  3T07 A;  5I4M A;  4EFD A;  3SI0 A;  4K30 A;  2Q44 A;  3VRQ A;  5G20 A;  1ZL0 A;  3VAT A;  3GKR A;  1F2P A;  4F8Z A;  1R57 A;  4OAE A;  2J9A A;  4M6H A;  2JLM A;  2PQ8 A;  1S3Z A;  5G22 A;  4E0A A;  4CGP A;  1R61 A;  2E28 A;  1XFO A;  1CG2 A;  3PEI A;  4CYQ A;  3R9E A;  3O8Z A;  3P2F A;  5F13 A;  4LUA A;  1IOF A;  1NSL A;  3FIX A;  1KC7 A;  3MGD A;  5DS0 A;  4PQA A;  5KTC A;  2XPO A;  4DNC A;  1Q2Y A;  4DUK A;  3D7H A;  4IIY A;  1XJO A;  3D67 A;  1QST A;  1XE4 A;  1YX0 A;  3KR5 A;  2F5I A;  1XMB A;  4DJL A;  4JLY A;  2B0A A;  3KQZ A;  1FNO A;  2BO9 A;  4PK2 A;  2FT0 A;  4F9V A;  2C6P A;  1AMP A;  1ARL A;  2FIA A;  1QSN A;  3FNC A;  2CIJ A;  2X0S A;  4Q7A A;  3VWD A;  4YRH A;  2CNS A;  5LRK A;  2ZEL A;  4YN3 A;  1NSA A;  3RYO A;  2DPT A;  2PJ6 A;  1M4L A;  4G1P A;  4C9V A;  2ABZ A;  4IF5 A;  3KKW A;  4CDJ A;  1Y0Y A;  4NF1 A;  4QC6 A;  2OOT A;  1B6B A;  2J8N A;  3FXT A;  2Q51 A;  3GY9 A;  3PBE A;  1A9X B;  4A4C A;  1ELM P;  4AB7 A;  2PVW A;  3PLF B;  1IU8 A;  3KHX A;  4KOY A;  2EUI A;  2YND A;  3K9U A;  4MY3 A;  1EE3 P;  4EWT A;  3TYX A;  4ZGY B;  3UY5 A;  4AVC A;  4C9E A;  2Y1M A;  4F0Y A;  1TKJ A;  3NH4 A;  3S6F A;  4OC4 A;  2ATR A;  2PJ2 A;  5F48 A;  5JYB A;  4X2T A;  2JBJ A;  4FWU A;  3PBB A;  4A31 A;  2PDO A;  3GJZ A;  2B4D A;  2ZEN A;  2JEW A;  4P4B A;  1VGY A;  5JM6 A;  4HKF A;  1YVK A;  4MHN A;  4AVA A;  4QBJ A;  3S9M A;  2YNC C;  4UWJ A;  1YLO A;  1WK4 A;  2PJA A;  4QUS A;  2ZEE A;  1WWZ A;  4UEE A;  1DTD A;  2ZOG A;  3FH4 A;  2DLA A;  3BHX A;  4KOW A;  5EC4 A;  3VTA A;  2AE6 A;  4ONW A;  2C5Q A;  4BD9 A;  1HDQ A;  2V8H A;  4IHM A;  1UFH A;  1QSO A;  1TKF A;  4R3K A;  2PVV A;  1BAV A;  4INJ A;  3I74 A;  5HKW A;  4F9U A;  1IGB A;  5IB9 A;  4UFX A;  4UF4 A;  4X5K A;  5ELY A;  2B3U A;  4M3S A;  4HNW B;  4LX9 A;  1Y7E A;  5JVL A;  3W6X A;  1Y9K A;  2PRB A;  4KVX A;  4H6Z A;  2B4J C;  1FY7 A;  4BMH A;  2PR8 A;  3FB3 A;  4BBH A;  4C7I A;  5DWM A;  3VWE A;  3CPA A;  1M1D A;  1CPX A;  3QNV A;  1PUA A;  4JXQ A;  4KSI A;  4MRI A;  4C2Y A;  3MN8 A;  4F6A A;  5JPH A;  3EZA A;  2QVP A;  2Z3N A;  4EYS A;  1P4N A;  4CDK A;  3RZA A;  2AUM A;  1YGH A;  1K4J A;  3TO9 A;  3F9K C;  1BLL E;  3HMJ G;  2CXA A;  3BUM B;  1GYT A;  4CGN A;  4MJX A;  3NE7 A;  2B3V A;  4MFJ A;  2OZH A;  5H86 A;  3BUO B;  4NGN A;  4A94 A;  1KUY A;  1QSM A;  1Y9Z A;  4CYO A;  4C2Z A;  3FX6 A;  1OZP A;  2CF4 A;  4CGO A;  3TFY A;  3EY5 A;  2NYQ A;  4HPS A;  4BPX B;  2HQY A;  5JQ4 A;  2HWG A;  3PP9 A;  3DDD A;  2B5G B;  3R9G A;  1TF8 A;  1ZLH A;  2B4B A;  2VEZ A;  4FD4 A;  4GS4 A;  3B8G A;  4ZBG A;  3FJU A;  2H5M A;  4OAD A;  4UEZ A;  5G1Z A;  4FBE A;  4H2K A;  3PB6 X;  2EWB A;  4PXE A;  2OR4 A;  2CTC A;  3B3S A;  2AFO A;  3HUV A;  4C8F A;  3I6S A;  3EZE A;  1XRY A;  1Z4E A;  1B47 A;  2QJ8 A;  2OLS A;  3SJE A;  3N5F A;  1EO0 A;  3JTK A;  5AG5 A;  4JD6 A;  4MCS A;  1F57 A;  1TIQ A;  5HKZ A;  2P0W A;  2PJ7 A;  3T0T A;  4MCQ A;  3IIB A;  5IV0 A;  2D4O A;  3CDX A;  2DEA A;  2Q7B A;  4R3L A;  3OAK A;  1Y9W A;  1XMT A;  1ZG9 A;  2AFW A;  2RC4 A;  4J3G A;  4UCN A;  2IMO A;  2XPP A;  3V8I A;  1YME A;  2PE3 A;  4YGO A;  4UCP A;  3DR8 A;  1ARM A;  1X10 A;  3TT2 A;  4COG A;  3GIU A;  2PC1 A;  1GGO A;  5EBV A;  2AJ6 A;  5J8F A;  5F1Y A;  1LFW A;  3FEC A;  4OKO A;  1BXR B;  4GM5 A;  1N71 A;  3D8P A;  1LCP A;  2YJV A;  1MJ9 A;  2PR1 A;  3CXS A;  4U5Y A;  4IAV A;  3KAS A;  1PCA A;  4IK2 A;  2XEG A;  1C30 B;  2AFU A;  4PV6 A;  2ZEH A;  4FD6 A;  4LQG A;  1NMT A;  3DLJ A;  2VQY A;  1R43 A;  5JH9 A;  2AFS A;  2QEC A;  4R57 A;  1NXJ A;  4MI4 A;  2OU2 A;  1CP6 A;  1Z8W A;  5FD8 A;  3H5Z A;  1IYL A;  5LRG A;  4C8A A;  3VRO A;  1VHO A;  2VXK A;  3BJ7 A;  3PB4 X;  4HNY B;  4MHD A;  1ZYM A;  5HKY A;  4C86 A;  3PB9 X;  4KOS A;  4XPL A;  4YU9 A;  2C27 A;  4NEX A;  4AG7 A;  4C9R A;  2D4P A;  3PFO A;  2FE7 A;  2A4N A;  3IO1 A;  1Q5X A;  3KZW A;  4OP4 A;  5BWA B;  4U9Z A;  4ZX9 A;  3VAR A;  3CPX A;  4MHP A;  2Z3K A;  1CBX A;  5F49 A;  5CPA A;  2WUU A;  2J8M A;  5J3X A;  4CAX A;  3PB7 X;  5G21 A;  5GCN A;  2RFH A;  5LYL A;  2O28 A;  2R8V A;  4Z65 A;  2Y0M A;  3SI2 A;  1CM0 A;  3JRU A;  1CX8 A;  1OBR A;  4U9Y A;  1YRE A;  4X8I A;  3R96 A;  2B4D B;  3DR6 A;  4A2Z A;  3VRR A;  3ISZ A;  3S6G A;  2OH1 A;  1A2Z A;  2Q04 A;  4MHY A;  4CGL A;  4JXR A;  3S6K A;  4B13 A;  1NBW A;  4J0N A;  1TXR A;  2PJB A;  3EIF A;  1LOK A;  4CZ1 A;  1HEE A;  2ZOF A;  5HH1 A;  1TKH A;  2ARH A;  1T36 B;  3EFA A;  4NGR A;  4OC2 A;  2Q4Z A;  3VH9 A;  3FVL A;  3F8K A;  4UCM A;  4O23 A;  2PJ0 A;  2GP4 A;  1YW6 A;  3SHP A;  4CPA A; 
#chains in the Genus database with same CATH homology
 5LYD A;  1DE4 C;  3CT9 A;  4FAI A;  2PJ4 A;  2BOA A;  3B35 A;  4UEF A;  3NA6 A;  5HVF A;  3NH8 A;  3H8F A;  2JBK A;  5HVG A;  5LRJ A;  4JYW A;  3L2N A;  2V8V A;  1V6C A;  1VHE A;  4YWY A;  2PJ1 A;  1R3N A;  2EK8 A;  4B6Z A;  1TF9 A;  4P44 A;  3S9L A;  1ELL P;  4NGM A;  4MCR A;  1FT7 A;  4OC0 A;  3B7I A;  2AFZ A;  2PJ3 A;  2HB6 A;  2VL1 A;  4UIA A;  3FMC A;  1PYT B;  2BCO A;  2PIZ A;  1LAM A;  1YSJ A;  2C1C A;  3VTA A;  4W9Y A;  2CTB A;  3D7D A;  2C6C A;  4EME A;  5HVH A;  1YW4 A;  2XEF A;  3KR4 A;  5LYI A;  2PCU A;  2I3C A;  3B3T A;  3D7F A;  1ZG8 A;  2O4H A;  1CPS A;  2NSM A;  3KGQ A;  3KHZ A;  3FEE A;  4P4D A;  4WWV A;  5K8M A;  4C8P A;  2GRE A;  5IR2 A;  2C6G A;  2WZN A;  2V8D A;  3RBU A;  4OC1 A;  5HXD A;  4C99 A;  3V7Z A;  4UIB A;  4TWE A;  3BI1 A;  4NJR A;  4NGQ A;  4OME A;  3PRT A;  4R7M A;  3WC5 A;  1ZG7 A;  2HC9 A;  3IFE A;  4JZ0 A;  1AYE A;  3SJG A;  5LYF A;  3FED A;  2GLF A;  3KQX A;  2V8G A;  2PJC A;  3GUX A;  4C8C A;  4C8U A;  4WJB A;  4R6T A;  3RAM A;  3BI0 A;  4P4J A;  4R76 A;  3K9T A;  1LAP A;  2F7V A;  3IC1 A;  5K8N A;  4P6Y A;  2GU2 A;  3PFE A;  5D29 A;  3LWU A;  1Z8L A;  4OC5 A;  3GLJ A;  2AFM A;  3NH5 A;  2Q43 A;  3SJF A;  3FF3 A;  4PPZ A;  2GLJ A;  3D68 A;  7CPA A;  2POK A;  8CPA A;  4R8F A;  2XEJ A;  4RUH A;  3IEH A;  6CPA A;  4AXV A;  1ZLI A;  4TJX A;  4C84 A;  2EK9 A;  3T8W A;  3PB8 X;  4K3N A;  4MCP A;  2O53 A;  3IJ3 A;  3SJX A;  4NGP A;  5K8P A;  5J1Q A;  4MXU A;  1XF1 A;  4P4I A;  2ZEM A;  3KL9 A;  1Q7L A;  4NFR A;  3D7G A;  1JQG A;  3WT4 A;  3K2K A;  4NGT A;  1QQ9 A;  3D66 A;  3MRU A;  1BPM A;  3D4U A;  3WC6 A;  4P45 A;  4P4F A;  3B3W A;  4FUU A;  3TC8 A;  3B3C A;  1HDU A;  1Y0R A;  2PIY A;  3SI1 A;  4DYO A;  2IQ6 A;  3WC7 A;  1LAN A;  4MMO A;  3KI9 A;  4ZY2 A;  4C9E A;  3IWW A;  4NJQ A;  3LMS A;  3I1U A;  4ZY1 A;  4ZYQ A;  1F2O A;  4PXC A;  5CBM A;  1VIX A;  2V77 A;  4OID A;  2ZEG A;  4MHZ A;  1IY7 A;  1Z2L A;  2PRQ A;  5F09 A;  2ZEO A;  3ISX A;  1CP7 A;  2PJ8 A;  5K8O A;  3WAB A;  1XBU A;  4C9A A;  4ZX8 A;  5JGF A;  2F8H A;  4P4E A;  3H8E A;  3B3V A;  2ZEP A;  2PJ5 A;  4X3R A;  3B2Y A;  1KWM A;  4TNU A;  4TJV A;  3S9N A;  1Z5R A;  3H8G A;  4NGS A;  2IJZ A;  2ZEF A;  5THW A;  2G9D A;  2ANP A;  4C85 A;  2ZED A;  4P10 A;  4A38 A;  2PJ9 A;  4ZI6 A;  2XEI A;  1QMU A;  3DGV A;  1H8L A;  4KNG E;  4OC3 A;  4PXB A;  4OIW A;  3BXM A;  3NFZ A;  2FVG A;  1RTQ A;  5D8N A;  1BPN A;  3ICU A;  1UWY A;  3GB0 A;  4A39 A;  3TX8 A;  2AFX A;  2RB7 A;  2WYR A;  4PXD A;  3V38 A;  2QYV A;  4C9U A;  4A37 A;  4ZY0 A;  3HLP A;  5I4M A;  4EFD A;  3SI0 A;  3VAT A;  1F2P A;  4F8Z A;  2J9A A;  1XFO A;  1CG2 A;  3PEI A;  5DS0 A;  4PQA A;  4DUK A;  3D7H A;  1XJO A;  3D67 A;  3KR5 A;  1XMB A;  4DJL A;  3KQZ A;  1FNO A;  2BO9 A;  4F9V A;  2C6P A;  1AMP A;  1ARL A;  2CIJ A;  4Q7A A;  5LRK A;  2ZEL A;  4YN3 A;  1NSA A;  2PJ6 A;  1M4L A;  4G1P A;  4C9V A;  2ABZ A;  4CDJ A;  1Y0Y A;  2OOT A;  3PBE A;  1WVM A;  2Q51 A;  1ELM P;  2PVW A;  3KHX A;  1EE3 P;  4EWT A;  1TKJ A;  3NH4 A;  4OC4 A;  2PJ2 A;  4X2T A;  2JBJ A;  4FWU A;  3PBB A;  2ZEN A;  2JEW A;  4P4B A;  1VGY A;  5JM6 A;  4MHN A;  3S9M A;  1YLO A;  2PJA A;  2ZEE A;  4UEE A;  1DTD A;  2ZOG A;  3FH4 A;  3BHX A;  4ONW A;  2C5Q A;  4BD9 A;  1HDQ A;  2V8H A;  4IHM A;  1TKF A;  2PVV A;  1BAV A;  3I74 A;  4F9U A;  1IGB A;  5IB9 A;  4UF4 A;  5ELY A;  1Y7E A;  3CPA A;  1CPX A;  3QNV A;  4MRI A;  4KSI A;  3MN8 A;  2QVP A;  4CDK A;  3RZA A;  1BLL E;  1GYT A;  4A94 A;  4NGN A;  1Y9Z A;  3FX6 A;  2CF4 A;  4C8T A;  2NYQ A;  1TF8 A;  1ZLH A;  3FJU A;  4UEZ A;  4FBE A;  4H2K A;  3PB6 X;  2EWB A;  4PXE A;  2OR4 A;  2CTC A;  3B3S A;  2AFO A;  3HUV A;  4C8F A;  3I6S A;  1XRY A;  2QJ8 A;  3SJE A;  3N5F A;  4MCS A;  1F57 A;  2PJ7 A;  4MCQ A;  3IIB A;  3CDX A;  2DEA A;  1ZG9 A;  2AFW A;  2IMO A;  1YME A;  2PE3 A;  1ARM A;  1LFW A;  3FEC A;  4OKO A;  4GM5 A;  1LCP A;  4IAV A;  3KAS A;  1PCA A;  4IK2 A;  2XEG A;  2AFU A;  2ZEH A;  4LQG A;  3DLJ A;  1R43 A;  5JH9 A;  2AFS A;  1CP6 A;  5LRG A;  4C8A A;  4C86 A;  1VHO A;  3PB4 X;  3PB9 X;  4YU9 A;  4C9R A;  3PFO A;  3IO1 A;  3KZW A;  4OP4 A;  4ZX9 A;  3VAR A;  3CPX A;  4MHP A;  1CBX A;  5CPA A;  3PB7 X;  2RFH A;  5LYL A;  4Z65 A;  3SI2 A;  3JRU A;  1CX8 A;  1OBR A;  4X8I A;  3ISZ A;  4MHY A;  1TXR A;  2PJB A;  3EIF A;  1LOK A;  1HEE A;  2ZOF A;  1TKH A;  4NGR A;  4OC2 A;  2Q4Z A;  3VH9 A;  3FVL A;  4O23 A;  2PJ0 A;  2GP4 A;  1YW6 A;  4CPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...