4P4FA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor nc-2-40
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 262
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4fA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4fA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4fA02
4F8ZA 2EWBA 4TJXA 4NGQA 3K2KA 1VGYA 5DS0A 3BHXA 2AFOA 2OOTA 1Y7EA 5LYIA 3ISXA 4NGSA 3FVLA 4R7MA 1QMUA 4DJLA 1Y9ZA 2Q51A 4ZY2A 1XMBA 4NGNA 2QJ8A 3SJXA 3FH4A 3KGQA 2ZEMA 3KHZA 2AFUA 1Y0RA 4UF4A 2PJ9A 3PB4X 5K8OA 2PJAA 3N5FA 1FT7A 4ZI6A 2ZOFA 2POKA 4CDJA 3FX6A 1HEEA 2FVGA 4C8CA 3KR5A 5F09A 1ZG7A 4NGTA 4WWVA 5LRGA 3PBEA 1CPXA 3KQXA 3B3CA 4UEFA 1CX8A 2F8HA 1BAVA 4C8UA 2AFZA 4X8IA 5HVFA 3BI1A 4MXUA 3D7FA 4H2KA 1Z5RA 3HUVA 4F9UA 2ZEHA 1JQGA 1ZG9A 4YU9A 4BD9A 4CPAA 2IMOA 5LRJA 3TX8A 2NSMA 2PJ1A 1CBXA 5K8NA 3TC8A 2PJ3A 3WC7A 4R6TA 3IC1A 4R8FA 3RZAA 2PJ0A 2V8HA 5LRKA 4GM5A 2PJ5A 2XEGA 4C84A 1LCPA 3PB9X 2AFSA 3SI2A 4C9RA 3WC6A 4OC4A 3D68A 4YWYA 2ZELA 1YSJA 4LQGA 3WC5A 4ZYQA 4X2TA 2HC9A 1HDUA 4C85A 1ZG8A 1ARMA 2GLJA 3VATA 2PVVA 2HB6A 2PJ7A 2IJZA 4UEZA 1YLOA 2WYRA 3IFEA 4OP4A 1IGBA 3H8EA 3KHXA 3D7HA 4MHZA 2EK9A 3IIBA 1ZLHA 2GLFA 3SJFA 1EE3P 1F57A 1YW4A 3PFOA 5THWA 2VL1A 2ZEGA 1PYTB 3S9LA 4C9UA 2PJ2A 2CIJA 4EWTA 3VARA 2Q43A 3LMSA 2PJ4A 2C6GA 2ABZA 1PCAA 1CP6A 1Z8LA 3V7ZA 3FMCA 4ZY0A 2V8DA 4TJVA 4A94A 4ZY1A 3GLJA 1KWMA 3VTAA 1XFOA 3NA6A 4FUUA 3L2NA 4NGPA 3KZWA 4WJBA 3IWWA 2AFWA 4NGRA 5IB9A 3FJUA 4Z65A 4W9YA 2ZEDA 3ICUA 3H8GA 1ELMP 4IK2A 4DUKA 4Q7AA 4NFRA 4P45A 4CDKA 2ZOGA 1BLLE 4C8AA 3GUXA 4C9AA 4IHMA 1CG2A 4OIWA 1NSAA 4P4IA 3PB8X 4ZX9A 1XBUA 5CPAA 2JBJA 4O23A 1XJOA 3FF3A 3I74A 4C9VA 2ZEPA 2I3CA 3PB6X 1R43A 3B3TA 3KR4A 1AMPA 2V77A 1ELLP 3BI0A 2RB7A 3FEEA 4PXEA 2PE3A 4FBEA 4UIBA 2JBKA 1LAMA 3K9TA 1V6CA 4NGMA 4TWEA 5CBMA 5K8PA 1RTQA 1BPNA 4MMOA 4F9VA 2PJ8A 1TF8A 1LAPA 4MHNA 4C8FA 3RAMA 4ONWA 4K3NA 4EFDA 2BOAA 1DE4C 3FEDA 2C6PA 4RUHA 5J1QA 5LYFA 3IEHA 1AYEA 3PB7X 4P4BA 4MCQA 4R76A 7CPAA 1OBRA 3B35A 5D8NA 3IO1A 4G1PA 3IJ3A 2OR4A 1QQ9A 5K8MA 3SJEA 2J9AA 4ZX8A 2Q4ZA 4PXBA 2PJBA 2V8GA 2PJCA 1TKJA 2JEWA 3QNVA 2GREA 4A39A 5LYDA 4PXCA 5JH9A 4OC2A 3ISZA 3D4UA 5ELYA 4P10A 2ZENA 4OKOA 3HLPA 2ZEOA 2IQ6A 3PEIA 5I4MA 1YW6A 3WABA 1LFWA 4OMEA 1H8LA 3I6SA 2XEIA 4OC1A 5JGFA 1M4LA 1LANA 1ZLIA 3D67A 3B3VA 3KI9A 2CTCA 3KASA 3RBUA 1BPMA 1F2OA 3SJGA 4FWUA 4MHPA 1IY7A 2C6CA 1FNOA 2NYQA 2XEFA 1TXRA 4P4EA 4A37A 3B7IA 4EMEA 2ANPA 2G9DA 4C8PA 1UWYA 2CTBA 2F7VA 2PIZA 3KL9A 2O4HA 2DEAA 2PVWA 1TKFA 4AXVA 1VIXA 4MCPA 2PJ6A 3KQZA 1LOKA 4X3RA 1F2PA 3S9NA 3FECA 1YMEA 4DYOA 2O53A 3NH5A 1HDQA 5JM6A 4MCRA 1ARLA 6CPAA 4PQAA 4P4JA 4A38A 1WVMA 1XRYA 4OIDA 3B3WA 5HVHA 2AFXA 1Z2LA 1DTDA 4YN3A 3D7DA 4FAIA 2BCOA 2RFHA 1CP7A 1TKHA 2C1CA 5D29A 4C9EA 2EK8A 5LYLA 2AFMA 3H8FA 3JRUA 3PBBA 4B6ZA 3I1UA 4JZ0A 1TF9A 1XF1A 3T8WA 4JYWA 2ZEEA 3NH8A 1Y0YA 2WZNA 3WT4A 2BO9A 4P44A 3SI0A 3NH4A 3MRUA 1Q7LA 2QYVA 2PCUA 4OC0A 4PXDA 4UIAA 3CT9A 4PPZA 2GU2A 4TNUA 3CDXA 3D7GA 3B3SA 4OC5A 4P4FA 3PFEA 1VHEA 2PRQA 2CF4A 3CPXA 3GB0A 3CPAA 3BXMA 4NJRA 5HXDA 3DLJA 3D66A 4KNGE 1R3NA 3LWUA 4MHYA 4P4DA 2ZEFA 3MN8A 4OC3A 1VHOA 4MRIA 3EIFA 1CPSA 3S9MA 4KSIA 3B2YA 3PRTA 4UEEA 2QVPA 4P6YA 4C8TA 2V8VA 4NJQA 8CPAA 3VH9A 2PIYA 4C99A 4MCSA 4IAVA 5HVGA 4C86A 3SI1A 3NFZA 2XEJA 3V38A 1GYTA 3DGVA
chains in the Genus database with same CATH superfamily
3H5ZA 4F8ZA 2EZAA 2Z3NA 2EWBA 3T07A 2CNSA 4A30A 2AJ6A 4JVOA 4KOXA 3F8KA 1ON0A 3G3SA 3JVNA 4TJXA 4NGQA 3K2KA 5HKWA 1I1DA 1VGYA 2Z3MA 4JXQA 5DS0A 2CY2A 2VZZA 2Z3LA 3BHXA 3ZJ0A 2R8VA 1NE9A 4MI4A 2AFOA 3H4QA 2OOTA 1Y7EA 2P6GA 3ISXA 5LYIA 3U1BA 3TLAA 4NGSA 3FVLA 4B13A 4R7MA 1QMUA 1NBWA 4KSFA 4A31A 4DJLA 1Y9ZA 2Q51A 4ZY2A 1AUGA 3F0AA 1XMBA 1FBVA 1WWZA 4NGNA 2QJ8A 3SJXA 3FH4A 5HKZA 2OU2A 1Z4RA 3KGQA 4MY3A 5E96A 4E0AA 5J8FA 3PLFB 1ZYMA 2Q04A 2ZEMA 1M4DA 4A33A 3KHZA 2PRBA 2AFUA 3D2PA 1U6MA 3QAHA 1Y0RA 4UF4A 5IV0A 2PJ9A 3JTKA 1M44A 2OZGA 5G22A 4C68A 3PB4X 2B58A 4CRYB 2YJTA 2KCWA 5K8OA 2PJAA 3N5FA 1FT7A 2BUEA 4YRHA 4ZI6A 2REFA 2POKA 2ZOFA 3FX6A 1HEEA 4CDJA 2FVGA 2DIKA 4C8CA 3KR5A 5F09A 3D8PA 1ZG7A 4F0YA 1YVHA 3PFVA 1CM0A 1JDBC 5AG5A 3R1KA 1B87A 4NGTA 4RR2B 3EXNA 3P2HA 4WWVA 5LRGA 1GGOA 5FD8A 2QMLA 3PBEA 1CPXA 3KQXA 3B3CA 4UEFA 2JLMA 1CX8A 2F8HA 3G8WA 5ISVA 1Q5XA 4CYNA 2EZCA 1YQEA 1MJ9A 1BAVA 5G20A 3N7ZA 4C8UA 2EZBA 4R57A 2AFZA 4X8IA 5HVFA 1S7LA 1YK3A 1R61A 3BLNA 1BOBA 3PP9A 3BI1A 3D7FA 4H2KA 4MXUA 1Z5RA 4OAEA 5FVJA 5F48A 4UFVA 3HUVA 2VXKA 4B5PB 2ZEHA 2GE3A 4F9UA 1JQGA 1LRZA 1ZG9A 4YU9A 4BD9A 1NSLA 2IMOA 1XEBA 3F9KC 4CPAA 5LRJA 3TX8A 4E2AA 4PV6A 1Q2DA 2NSMA 1CBXA 2PJ1A 3TC8A 2G0BA 5K8NA 2D4PA 4PK2A 1VHSA 3E0KA 2PJ3A 3WC7A 4MFPA 2ZW7A 3IC1A 4R8FA 3F5BA 2PJ0A 4R6TA 3RZAA 1KEEB 2V8HA 4M6GA 3SXOA 2MP0A 1KUYA 5F9MA 5LRKA 4GM5A 2DPSA 2YNDA 3BUOB 2PJ5A 5GCNA 2XEGA 1FY7A 4NEXA 2XPNA 4KLVA 2ZPAA 4BPWB 4C84A 1LCPA 1XMTA 3PB9X 3TOBA 5KTDA 2AFSA 4M85A 1IYKA 3SI2A 1X10A 4C9RA 1IICA 3FBUA 2Q7SA 4AG7A 4JWPA 4OC4A 3WC6A 4COBA 2WSAA 4QUSA 3T9YA 2A4NA 3D68A 4YWYA 4MJXA 1YX0A 1RO5A 2PDOA 2ZELA 1KUXA 1YSJA 4UA3A 2Z0ZA 4KZTA 4LQGA 3DR6A 3UY5A 3WC5A 3TT2A 2R1IA 4UBRA 2GFQA 4ZYQA 4X2TA 1IB1E 4KSAA 2HI6A 2XPPA 2HC9A 3FRMA 1HDUA 4C7IA 4C85A 4BPXB 1ZG8A 3VWDA 2B5GB 3SHPA 2HROA 1DIKA 4F6AA 1ARMA 1OZPA 2DXQA 2GLJA 3T90A 3T0TA 3VATA 4B12A 4J3GA 4CAWA 2PR1A 3EZEA 2VEZA 2PVVA 2HB6A 1VI4A 4E94A 2Q0YA 2PJ7A 2IJZA 1Z8TA 4UEZA 1YLOA 2WYRA 3IFEA 3EFAA 4OP4A 1IGBA 3H8EA 4E8OA 3TYXA 3KHXA 3D7HA 4MHZA 4YGOA 2OZHA 5AXIA 2EK9A 4X5KA 3IIBA 1ZLHA 2GLFA 3SJFA 3U88C 1EE3P 1F57A 1YW4A 3PFOA 3EC4A 1VBGA 1L0CA 5THWA 4AVCA 2VL1A 2ZEGA 1PYTB 3S9LA 1J3LA 3IU1A 3R95A 2B4DB 4C9UA 2PJ2A 2CIJA 4EWTA 3VRPA 3VARA 2UV8G 2Q43A 3LMSA 4KOYA 2PJ4A 2C6GA 4CAEA 5F1YA 5BY0A 2DLAA 1KUVA 4CYOA 1V0CA 2ABZA 1S7KA 1PCAA 1KZFA 1CP6A 1Z8LA 3V7ZA 3FMCA 4KOVA 4ZY0A 2V8DA 2ARHA 1YGHA 3GYAA 5HMNA 4TJVA 1KBLA 4A94A 4ZY1A 3GLJA 1KWMA 3VTAA 1XFOA 5JYBA 3R96A 2Y1MA 1CJWA 4R9MA 3NA6A 4RI1A 4FUUA 4I49A 3L2NA 4CO9A 4NGPA 3V8IA 1EZAA 3KZWA 2Q4VA 4WJBA 3IWWA 3VGOA 1S3ZA 3LACA 5F47A 2AFWA 2E28A 4NGRA 2GIVA 3B8GA 5IB9A 3FJUA 4LX9A 3TLEA 4QC6A 4Z65A 4UCNA 4W9YA 2ZEDA 4L89A 3ICUA 3H8GA 5HKYA 1ELMP 2O28A 4IK2A 4Q38A 2FIAA 3VRQA 4QB9A 3ZNIA 4XPDB 4KOTA 4Q7AA 4DUKA 4NFRA 2K5TA 4XPDC 4P45A 3KKWA 1Z4EA 2ZOGA 4CDKA 2CNTA 3PGPA 4LQ6A 3TFYA 4GS4A 4B5OA 1BLLE 1VBHA 4C8AA 3GUXA 1X12A 4C9AA 1BO4A 4IHMA 4UWIA 1CG2A 1XOVA 1S7FA 3LD2A 1Z8XA 4OIWA 4U5YA 4YFJA 1NSAA 3BUMB 4P4IA 1WK4A 3HPGG 3OWCA 3PB8X 3HMJG 1YREA 4ZX9A 1XBUA 3EY5A 2CBLA 1YVKA 3ZZIA 1JDEA 5CPAA 3I3GA 2JBJA 1MJAA 4HPSA 4O23A 1T36B 4R3KA 1TIQA 1XJOA 4Q36A 2N3AB 5DWNA 3FF3A 4MFJA 3I74A 1IYLA 3CXSA 4C9VA 4XPKA 2P6EA 4CYQA 3W6XA 1KC7A 4IIXA 1J4JA 2C5QA 2ZEPA 2I3CA 3PB6X 4CGOA 1QSOA 1YLEA 1R43A 3B3TA 3KR4A 1AMPA 2QIRA 4HNWB 4MFLA 2V77A 1ELLP 4Y49C 3BI0A 2RB7A 3FEEA 4PXEA 3HPHE 2PE3A 4H89A 2PR8A 1GHEA 4UIBA 4Y49B 2JBKA 1LAMA 4FBEA 4EYSA 4BINA 2YNEA 3K9TA 2RC4A 4EVYA 1V6CA 4B10A 3FNCA 4NGMA 2FCKA 4U9ZA 1YR0A 1SQHA 4KUAA 4TWEA 3DDDA 2OB0A 1P0HA 2B3UA 5CBMA 5F13A 3QB8A 5K8PA 5IX3A 1RTQA 1BPNA 2B0AA 3T5MA 4MMOA 2G3AA 5H84A 4F9VA 2PJ8A 1QSRA 4A4BA 1LAPA 1TF8A 2FE7A 2Z3OA 2ZW4A 4MHNA 3R9FA 3RAMA 4IIYA 4C8FA 4ONWA 3K4IA 2P6FA 2EUIA 4K3NA 5F49A 4EFDA 3JUWA 3TLGA 4UCMA 2HQYA 2ZXVA 2BOAA 5AG6A 2PC1A 1DE4C 5I0CA 2GP4A 3FEDA 2BEIA 4ORFA 5HH1A 2C6PA 4RUHA 5J1QA 5LYFA 3IEHA 2XPLA 1AYEA 4MJ8A 1JWQA 4BBHA 5F46A 5KTCA 4M3SA 1B6BA 3PB7X 4MHDA 3IWGA 4P4BA 5BWAB 1BXRB 3TLCA 4AB7A 4MCQA 4R76A 7CPAA 3I9SA 1OBRA 3K9UA 3B35A 5D8NA 3IO1A 4MBUA 2I79A 4G1PA 3IJ3A 4KOSA 2X7BA 3RO0A 2OR4A 3TCVA 4B14A 4CAVA 1QQ9A 4CGPA 5K8MA 4J0NA 3SJEA 2J9AA 1XF8A 3CXPA 4MY0A 4ZX8A 2IL4A 2Q4ZA 4F0XA 2VZYA 4PXBA 3FXTA 2PJBA 2ODFA 3W91A 1QSNA 2R98A 2J8RA 4NCZA 2V8GA 4KORA 2X0SA 2BSWA 2PJCA 5AG7A 1TKJA 2JEWA 2OH1A 2WUUA 1ZL0A 3QNVA 4OADA 3PT1A 3NE7A 3VRRA 4K30A 2GANA 5A28A 2GREA 4A39A 5LYDA 1Z9EA 5IB0A 4PXCA 3S6FA 4BMHA 5JH9A 4BPUB 1Z9UA 4OC2A 2DF5A 4UFXA 4HNYB 2B5GA 2OZUA 5CNPA 5JQ4A 3W6SA 3ISZA 4COGA 4JJXA 4AVAA 1I12A 3D4UA 5ELYA 1PU9A 4P10A 3TLBA 2I00A 2Y1NA 1ZO0A 1YVOA 4FD6A 1CS0B 2ZENA 2Z3PA 4A32A 1M1DA 4OKOA 4CYPA 5G1ZA 3HLPA 2ZEOA 2FXFA 1Q2CA 2IQ6A 3PEIA 2R7HA 2R82A 5I4MA 1A9XB 4MFQA 1YW6A 2J8MA 2PQ8A 3TO7A 3WABA 5J8CA 1LFWA 4OMEA 2BL1A 1H8LA 3I6SA 2XEIA 4OC1A 1IIDA 5JGFA 4RN7A 1M4LA 1LANA 5J3XA 3TOAA 5A27A 2Z10A 1ZLIA 3D67A 3FIXA 4AVBA 3KRVA 3B3VA 5C82A 3KI9A 2CTCA 2Y0MA 2REEA 4CGNA 5KTAA 4CGLA 3KASA 3RBUA 1BPMA 2EVNA 4C2XA 1WJTA 1EO0A 1F2OA 2Z11A 3VWEA 3R9GA 3SJGA 2FS5A 3DNSA 4FWUA 4XNHB 4MHPA 1IY7A 2C6CA 4GXHA 1S60A 4R3LA 1FNOA 1QSTA 2NYQA 1S5KA 5C88A 4KUBA 4CS0B 1NMTA 2XEFA 1TXRA 2ZW6A 4P4EA 1M4GA 2YNCC 4FD5A 4A37A 1Y9KA 4KOUA 4R87A 1RXTA 4JXRA 3B7IA 2NMTA 4EMEA 2ANPA 2C27A 2G9DA 4C8PA 1UWYA 2CTBA 3DSBA 5EC4A 2F7VA 2PIZA 3KL9A 2O4HA 3BJ7A 4JLYA 2DEAA 3BUNB 3BUXB 1C30B 2PVWA 2F5IA 2FM4A 4A2ZA 1TKFA 2H5MA 2Q4YA 4AXVA 2DPTA 4MFKA 2JDDA 4PSXA 1VIXA 4MCPA 2PJ6A 3KQZA 4ZBGA 3TO9A 1LOKA 4BTFA 1QSMA 4X3RA 1N71A 1F2PA 3S9NA 4FD4A 3IU2A 3FECA 3SXNA 1YMEA 4KVOE 1NXJA 3EZBA 4NF1A 4DYOA 3BUWB 3CXQA 4L8AA 2O53A 4CRZB 2AUNA 3C26A 3NH5A 1HDQA 1PUAA 2PSWA 1B47A 4PK3A 5JM6A 2YJVA 1Y7RA 5JVLA 4MCRA 1ARLA 6CPAA 2J8NA 2CXAA 3S6KA 4QBJA 4KS9A 2AUMA 4PQAA 4P4JA 2VI7A 3VROA 3BJ8A 4A38A 2OLSA 4B5PA 1WVMA 1XRYA 3IGRA 3OB2B 2JDCA 3O8ZA 3B3WA 2WPXA 4NXYA 4OIDA 2AFXA 4UCPA 1Z2LA 2Q7BA 2XPOA 4CAFA 4ZGYB 1DTDA 4YN3A 3D7DA 3EZAA 4FAIA 4JD6A 3TLGB 2BCOA 2RFHA 4NSQA 3NOJA 1CP7A 2VKZG 3GJZA 1CE8B 1TKHA 2D0PA 2ATRA 2C1CA 4MI1A 4GPLB 2CNMA 3GY9A 5D29A 2Z3KA 3TTHA 4C9EA 4RS2A 2EK8A 4B11A 5LYLA 2AFMA 1A2ZA 2HUZA 3IWEA 3LODA 1M4IA 2D4OA 4A4CA 3H8FA 1Y9WA 5DWMA 2YNCA 4U9YA 3D2MA 3JRUA 1S7NA 3OB1B 1XE4A 3PBBA 4B6ZA 4M8DA 3I1UA 4FD7A 4KOWA 4JZ0A 2B4DA 4C7HA 1TF9A 1IOIA 3TE4A 1XF1A 1Q2YA 3CZXA 3T8WA 3TLZA 4JYWA 5K99A 3DR8A 2ZEEA 3NH8A 4LUAA 1Y0YA 4ONUA 1Z8WA 2WZNA 1M6VB 3WT4A 2BO9A 4P44A 2P0WA 4OLLA 4DNCA 2EBJA 4KVME 5JPHA 4KVXA 3SI0A 3NH4A 2HWGA 4H6UA 1IOFA 3MRUA 1Q7LA 4HNXB 1MJBA 4C2ZA 2PCNA 3NFQA 5AG4A 1UFHA 2B4BA 1ZRSA 2QYVA 3MGDA 2PCUA 4OC0A 1XIXA 3RNZA 5HVHA 1VKCA 4PXDA 4UIAA 3CT9A 4PPZA 1IU8A 2GU2A 3A9LA 3D3SA 4M6HA 3EO4A 3WR7A 4INJA 4E5SA 5G21A 2Q44A 4TNUA 3CDXA 4H1HA 3D7GA 3B3SA 4OC5A 4P4FA 2B3VA 2HV2A 3GIUA 3PFEA 4IF5A 3QAYA 3P2FA 3TLYA 5H86A 3OP0A 4KLWA 1MK4A 2EO8A 1VHEA 2PRQA 2CF4A 3CPXA 2QECA 4MFZA 3GB0A 5AGEA 3OAKA 3CPAA 4UFWA 3BXMA 4HKFA 4NJRA 3RYOA 3DLJA 3D66A 5HXDA 4KNGE 2D0OA 2FL4A 3FYNA 1I21A 1R3NA 3LWUA 1R57A 4CGMA 5EBVA 4MHYA 3SR3A 4P4DA 2JEVA 5F5XA 2ZEFA 3VRNA 3NE8A 1P4NA 4XNHC 3MN8A 4OC3A 2ZW5A 2G3TA 4UWJA 4IUSA 3S6HA 4AG9A 4CAXA 2FIWA 3R9EA 1EZBA 1VHOA 2FSRA 3S6GA 3FB3A 4MRIA 2VQYA 1CPSA 3S9MA 2AE6A 3EIFA 4KSIA 2FT0A 3B2YA 3T05A 2VBQA 3PRTA 4H6ZA 4PSWA 3TO6A 3GKRA 1K4JA 4II9A 4UEEA 3G23A 2QVPA 4P6YA 4C8TA 2V8VA 2WPWA 1C3OB 4NJQA 4CZ1A 3PZJA 8CPAA 3VH9A 4XPLA 4C2YA 2PIYA 5IR2A 4M6IA 4C99A 4MCSA 4IAVA 4QVTA 5HVGA 2YGWA 3SI1A 3NFZA 4C86A 2B4JC 2XEJA 3V38A 4A95A 5EMIA 1GYTA 3DGVA 3C8OA
chains in the Genus database with same CATH topology
4F8ZA 2EWBA 4TJXA 4NGQA 3K2KA 1VGYA 5DS0A 3BHXA 2AFOA 2OOTA 1Y7EA 5LYIA 3ISXA 4NGSA 3FVLA 4R7MA 1QMUA 4DJLA 1Y9ZA 2Q51A 4ZY2A 1XMBA 4NGNA 2QJ8A 3SJXA 3FH4A 3KGQA 2ZEMA 3KHZA 2AFUA 1Y0RA 4UF4A 2PJ9A 3PB4X 5K8OA 2PJAA 3N5FA 1FT7A 4ZI6A 2ZOFA 2POKA 4CDJA 3FX6A 1HEEA 2FVGA 4C8CA 3KR5A 5F09A 1ZG7A 4NGTA 4WWVA 5LRGA 3PBEA 1CPXA 3KQXA 3B3CA 4UEFA 1CX8A 2F8HA 1BAVA 4C8UA 2AFZA 4X8IA 5HVFA 3BI1A 4MXUA 3D7FA 4H2KA 1Z5RA 3HUVA 4F9UA 2ZEHA 1JQGA 1ZG9A 4YU9A 4BD9A 4CPAA 2IMOA 5LRJA 3TX8A 2NSMA 2PJ1A 1CBXA 5K8NA 3TC8A 2PJ3A 3WC7A 4R6TA 3IC1A 4R8FA 3RZAA 2PJ0A 2V8HA 5LRKA 4GM5A 2PJ5A 2XEGA 4C84A 1LCPA 3PB9X 2AFSA 3SI2A 4C9RA 3WC6A 4OC4A 3D68A 4YWYA 2ZELA 1YSJA 4LQGA 3WC5A 4ZYQA 4X2TA 2HC9A 1HDUA 4C85A 1ZG8A 1ARMA 2GLJA 3VATA 2PVVA 2HB6A 2PJ7A 2IJZA 4UEZA 1YLOA 2WYRA 3IFEA 4OP4A 1IGBA 3H8EA 3KHXA 3D7HA 4MHZA 2EK9A 3IIBA 1ZLHA 2GLFA 3SJFA 1EE3P 1F57A 1YW4A 3PFOA 5THWA 2VL1A 2ZEGA 1PYTB 3S9LA 4C9UA 2PJ2A 2CIJA 4EWTA 3VARA 2Q43A 3LMSA 2PJ4A 2C6GA 2ABZA 1PCAA 1CP6A 1Z8LA 3V7ZA 3FMCA 4ZY0A 2V8DA 4TJVA 4A94A 4ZY1A 3GLJA 1KWMA 3VTAA 1XFOA 3NA6A 4FUUA 3L2NA 4NGPA 3KZWA 4WJBA 3IWWA 2AFWA 4NGRA 5IB9A 3FJUA 4Z65A 4W9YA 2ZEDA 3ICUA 3H8GA 1ELMP 4IK2A 4DUKA 4Q7AA 4NFRA 4P45A 4CDKA 2ZOGA 1BLLE 4C8AA 3GUXA 4C9AA 4IHMA 1CG2A 4OIWA 1NSAA 4P4IA 3PB8X 4ZX9A 1XBUA 5CPAA 2JBJA 4O23A 1XJOA 3FF3A 3I74A 4C9VA 2C5QA 2ZEPA 2I3CA 3PB6X 1R43A 3B3TA 3KR4A 1AMPA 2V77A 1ELLP 3BI0A 2RB7A 3FEEA 4PXEA 2PE3A 4FBEA 4UIBA 2JBKA 1LAMA 3K9TA 1V6CA 4NGMA 4TWEA 5CBMA 5K8PA 1RTQA 1BPNA 4MMOA 4F9VA 2PJ8A 1TF8A 1LAPA 4MHNA 4C8FA 3RAMA 4ONWA 4K3NA 4EFDA 2BOAA 1DE4C 2GP4A 3FEDA 2C6PA 4RUHA 5J1QA 5LYFA 3IEHA 1AYEA 3PB7X 4P4BA 4MCQA 4R76A 7CPAA 1OBRA 3B35A 5D8NA 3IO1A 4G1PA 3IJ3A 2OR4A 1QQ9A 5K8MA 3SJEA 2J9AA 4ZX8A 2Q4ZA 4PXBA 2PJBA 2V8GA 2PJCA 1TKJA 2JEWA 3QNVA 2GREA 4A39A 5LYDA 4PXCA 5JH9A 4OC2A 3ISZA 3D4UA 5ELYA 4P10A 2ZENA 4OKOA 3HLPA 2ZEOA 2IQ6A 3PEIA 5I4MA 1YW6A 3WABA 1LFWA 4OMEA 1H8LA 3I6SA 2XEIA 4OC1A 5JGFA 1M4LA 1LANA 1ZLIA 3D67A 3B3VA 3KI9A 2CTCA 3KASA 3RBUA 1BPMA 1F2OA 3SJGA 4FWUA 4MHPA 1IY7A 2C6CA 1FNOA 2NYQA 2XEFA 1TXRA 4P4EA 4A37A 3B7IA 4EMEA 2ANPA 2G9DA 4C8PA 1UWYA 2CTBA 2F7VA 2PIZA 3KL9A 2O4HA 2DEAA 2PVWA 1TKFA 4AXVA 1VIXA 4MCPA 2PJ6A 3KQZA 1LOKA 4X3RA 1F2PA 3S9NA 3FECA 1YMEA 4DYOA 2O53A 3NH5A 1HDQA 5JM6A 4MCRA 1ARLA 6CPAA 4PQAA 4P4JA 4A38A 1WVMA 1XRYA 4OIDA 3B3WA 5HVHA 2AFXA 1Z2LA 1DTDA 4YN3A 3D7DA 4FAIA 2BCOA 2RFHA 1CP7A 1TKHA 2C1CA 5D29A 4C9EA 2EK8A 5LYLA 2AFMA 3H8FA 3JRUA 3PBBA 4B6ZA 3I1UA 4JZ0A 1TF9A 1XF1A 3T8WA 4JYWA 2ZEEA 3NH8A 1Y0YA 2WZNA 3WT4A 2BO9A 4P44A 3SI0A 3NH4A 3MRUA 1Q7LA 2QYVA 2PCUA 4OC0A 4PXDA 4UIAA 3CT9A 4PPZA 2GU2A 4TNUA 3CDXA 3D7GA 3B3SA 4OC5A 4P4FA 3PFEA 1VHEA 2PRQA 2CF4A 3CPXA 3GB0A 3CPAA 3BXMA 4NJRA 5HXDA 3DLJA 3D66A 4KNGE 1R3NA 3LWUA 4MHYA 4P4DA 2ZEFA 3MN8A 4OC3A 1VHOA 4MRIA 3EIFA 1CPSA 3S9MA 4KSIA 3B2YA 3PRTA 4UEEA 2QVPA 4P6YA 4C8TA 2V8VA 4NJQA 8CPAA 3VH9A 2PIYA 5IR2A 4C99A 4MCSA 4IAVA 5HVGA 4C86A 3SI1A 3NFZA 2XEJA 3V38A 1GYTA 3DGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F8Z A;  2EWB A;  4TJX A;  4NGQ A;  3K2K A;  1VGY A;  5DS0 A;  3BHX A;  2AFO A;  2OOT A;  1Y7E A;  5LYI A;  3ISX A;  4NGS A;  3FVL A;  4R7M A;  1QMU A;  4DJL A;  1Y9Z A;  2Q51 A;  4ZY2 A;  1XMB A;  4NGN A;  2QJ8 A;  3SJX A;  3FH4 A;  3KGQ A;  2ZEM A;  3KHZ A;  2AFU A;  1Y0R A;  4UF4 A;  2PJ9 A;  3PB4 X;  5K8O A;  2PJA A;  3N5F A;  1FT7 A;  4ZI6 A;  2ZOF A;  2POK A;  4CDJ A;  3FX6 A;  1HEE A;  2FVG A;  4C8C A;  3KR5 A;  5F09 A;  1ZG7 A;  4NGT A;  4WWV A;  5LRG A;  3PBE A;  1CPX A;  3KQX A;  3B3C A;  4UEF A;  1CX8 A;  2F8H A;  1BAV A;  4C8U A;  2AFZ A;  4X8I A;  5HVF A;  3BI1 A;  4MXU A;  3D7F A;  4H2K A;  1Z5R A;  3HUV A;  4F9U A;  2ZEH A;  1JQG A;  1ZG9 A;  4YU9 A;  4BD9 A;  4CPA A;  2IMO A;  5LRJ A;  3TX8 A;  2NSM A;  2PJ1 A;  1CBX A;  5K8N A;  3TC8 A;  2PJ3 A;  3WC7 A;  4R6T A;  3IC1 A;  4R8F A;  3RZA A;  2PJ0 A;  2V8H A;  5LRK A;  4GM5 A;  2PJ5 A;  2XEG A;  4C84 A;  1LCP A;  3PB9 X;  2AFS A;  3SI2 A;  4C9R A;  3WC6 A;  4OC4 A;  3D68 A;  4YWY A;  2ZEL A;  1YSJ A;  4LQG A;  3WC5 A;  4ZYQ A;  4X2T A;  2HC9 A;  1HDU A;  4C85 A;  1ZG8 A;  1ARM A;  2GLJ A;  3VAT A;  2PVV A;  2HB6 A;  2PJ7 A;  2IJZ A;  4UEZ A;  1YLO A;  2WYR A;  3IFE A;  4OP4 A;  1IGB A;  3H8E A;  3KHX A;  3D7H A;  4MHZ A;  2EK9 A;  3IIB A;  1ZLH A;  2GLF A;  3SJF A;  1EE3 P;  1F57 A;  1YW4 A;  3PFO A;  5THW A;  2VL1 A;  2ZEG A;  1PYT B;  3S9L A;  4C9U A;  2PJ2 A;  2CIJ A;  4EWT A;  3VAR A;  2Q43 A;  3LMS A;  2PJ4 A;  2C6G A;  2ABZ A;  1PCA A;  1CP6 A;  1Z8L A;  3V7Z A;  3FMC A;  4ZY0 A;  2V8D A;  4TJV A;  4A94 A;  4ZY1 A;  3GLJ A;  1KWM A;  3VTA A;  1XFO A;  3NA6 A;  4FUU A;  3L2N A;  4NGP A;  3KZW A;  4WJB A;  3IWW A;  2AFW A;  4NGR A;  5IB9 A;  3FJU A;  4Z65 A;  4W9Y A;  2ZED A;  3ICU A;  3H8G A;  1ELM P;  4IK2 A;  4DUK A;  4Q7A A;  4NFR A;  4P45 A;  4CDK A;  2ZOG A;  1BLL E;  4C8A A;  3GUX A;  4C9A A;  4IHM A;  1CG2 A;  4OIW A;  1NSA A;  4P4I A;  3PB8 X;  4ZX9 A;  1XBU A;  5CPA A;  2JBJ A;  4O23 A;  1XJO A;  3FF3 A;  3I74 A;  4C9V A;  2ZEP A;  2I3C A;  3PB6 X;  1R43 A;  3B3T A;  3KR4 A;  1AMP A;  2V77 A;  1ELL P;  3BI0 A;  2RB7 A;  3FEE A;  4PXE A;  2PE3 A;  4FBE A;  4UIB A;  2JBK A;  1LAM A;  3K9T A;  1V6C A;  4NGM A;  4TWE A;  5CBM A;  5K8P A;  1RTQ A;  1BPN A;  4MMO A;  4F9V A;  2PJ8 A;  1TF8 A;  1LAP A;  4MHN A;  4C8F A;  3RAM A;  4ONW A;  4K3N A;  4EFD A;  2BOA A;  1DE4 C;  3FED A;  2C6P A;  4RUH A;  5J1Q A;  5LYF A;  3IEH A;  1AYE A;  3PB7 X;  4P4B A;  4MCQ A;  4R76 A;  7CPA A;  1OBR A;  3B35 A;  5D8N A;  3IO1 A;  4G1P A;  3IJ3 A;  2OR4 A;  1QQ9 A;  5K8M A;  3SJE A;  2J9A A;  4ZX8 A;  2Q4Z A;  4PXB A;  2PJB A;  2V8G A;  2PJC A;  1TKJ A;  2JEW A;  3QNV A;  2GRE A;  4A39 A;  5LYD A;  4PXC A;  5JH9 A;  4OC2 A;  3ISZ A;  3D4U A;  5ELY A;  4P10 A;  2ZEN A;  4OKO A;  3HLP A;  2ZEO A;  2IQ6 A;  3PEI A;  5I4M A;  1YW6 A;  3WAB A;  1LFW A;  4OME A;  1H8L A;  3I6S A;  2XEI A;  4OC1 A;  5JGF A;  1M4L A;  1LAN A;  1ZLI A;  3D67 A;  3B3V A;  3KI9 A;  2CTC A;  3KAS A;  3RBU A;  1BPM A;  1F2O A;  3SJG A;  4FWU A;  4MHP A;  1IY7 A;  2C6C A;  1FNO A;  2NYQ A;  2XEF A;  1TXR A;  4P4E A;  4A37 A;  3B7I A;  4EME A;  2ANP A;  2G9D A;  4C8P A;  1UWY A;  2CTB A;  2F7V A;  2PIZ A;  3KL9 A;  2O4H A;  2DEA A;  2PVW A;  1TKF A;  4AXV A;  1VIX A;  4MCP A;  2PJ6 A;  3KQZ A;  1LOK A;  4X3R A;  1F2P A;  3S9N A;  3FEC A;  1YME A;  4DYO A;  2O53 A;  3NH5 A;  1HDQ A;  5JM6 A;  4MCR A;  1ARL A;  6CPA A;  4PQA A;  4P4J A;  4A38 A;  1WVM A;  1XRY A;  4OID A;  3B3W A;  5HVH A;  2AFX A;  1Z2L A;  1DTD A;  4YN3 A;  3D7D A;  4FAI A;  2BCO A;  2RFH A;  1CP7 A;  1TKH A;  2C1C A;  5D29 A;  4C9E A;  2EK8 A;  5LYL A;  2AFM A;  3H8F A;  3JRU A;  3PBB A;  4B6Z A;  3I1U A;  4JZ0 A;  1TF9 A;  1XF1 A;  3T8W A;  4JYW A;  2ZEE A;  3NH8 A;  1Y0Y A;  2WZN A;  3WT4 A;  2BO9 A;  4P44 A;  3SI0 A;  3NH4 A;  3MRU A;  1Q7L A;  2QYV A;  2PCU A;  4OC0 A;  4PXD A;  4UIA A;  3CT9 A;  4PPZ A;  2GU2 A;  4TNU A;  3CDX A;  3D7G A;  3B3S A;  4OC5 A;  4P4F A;  3PFE A;  1VHE A;  2PRQ A;  2CF4 A;  3CPX A;  3GB0 A;  3CPA A;  3BXM A;  4NJR A;  5HXD A;  3DLJ A;  3D66 A;  4KNG E;  1R3N A;  3LWU A;  4MHY A;  4P4D A;  2ZEF A;  3MN8 A;  4OC3 A;  1VHO A;  4MRI A;  3EIF A;  1CPS A;  3S9M A;  4KSI A;  3B2Y A;  3PRT A;  4UEE A;  2QVP A;  4P6Y A;  4C8T A;  2V8V A;  4NJQ A;  8CPA A;  3VH9 A;  2PIY A;  4C99 A;  4MCS A;  4IAV A;  5HVG A;  4C86 A;  3SI1 A;  3NFZ A;  2XEJ A;  3V38 A;  1GYT A;  3DGV A; 
#chains in the Genus database with same CATH topology
 3H5Z A;  4F8Z A;  2EZA A;  2Z3N A;  2EWB A;  3T07 A;  2CNS A;  4A30 A;  2AJ6 A;  4JVO A;  4KOX A;  3F8K A;  1ON0 A;  3G3S A;  3JVN A;  4TJX A;  4NGQ A;  3K2K A;  5HKW A;  1I1D A;  1VGY A;  2Z3M A;  4JXQ A;  5DS0 A;  2CY2 A;  2VZZ A;  2Z3L A;  3BHX A;  3ZJ0 A;  2R8V A;  1NE9 A;  4MI4 A;  2AFO A;  3H4Q A;  2OOT A;  1Y7E A;  2P6G A;  3ISX A;  5LYI A;  3U1B A;  3TLA A;  4NGS A;  3FVL A;  4B13 A;  4R7M A;  1QMU A;  1NBW A;  4KSF A;  4A31 A;  4DJL A;  1Y9Z A;  2Q51 A;  4ZY2 A;  1AUG A;  3F0A A;  1XMB A;  1FBV A;  1WWZ A;  4NGN A;  2QJ8 A;  3SJX A;  3FH4 A;  5HKZ A;  2OU2 A;  1Z4R A;  3KGQ A;  4MY3 A;  5E96 A;  4E0A A;  5J8F A;  3PLF B;  1ZYM A;  2Q04 A;  2ZEM A;  1M4D A;  4A33 A;  3KHZ A;  2PRB A;  2AFU A;  3D2P A;  1U6M A;  3QAH A;  1Y0R A;  4UF4 A;  5IV0 A;  2PJ9 A;  3JTK A;  1M44 A;  2OZG A;  5G22 A;  4C68 A;  3PB4 X;  2B58 A;  4CRY B;  2YJT A;  2KCW A;  5K8O A;  2PJA A;  3N5F A;  1FT7 A;  2BUE A;  4YRH A;  4ZI6 A;  2REF A;  2POK A;  2ZOF A;  3FX6 A;  1HEE A;  4CDJ A;  2FVG A;  2DIK A;  4C8C A;  3KR5 A;  5F09 A;  3D8P A;  1ZG7 A;  4F0Y A;  1YVH A;  3PFV A;  1CM0 A;  1JDB C;  5AG5 A;  3R1K A;  1B87 A;  4NGT A;  4RR2 B;  3EXN A;  3P2H A;  4WWV A;  5LRG A;  1GGO A;  5FD8 A;  2QML A;  3PBE A;  1CPX A;  3KQX A;  3B3C A;  4UEF A;  2JLM A;  1CX8 A;  2F8H A;  3G8W A;  5ISV A;  1Q5X A;  4CYN A;  2EZC A;  1YQE A;  1MJ9 A;  1BAV A;  5G20 A;  3N7Z A;  4C8U A;  2EZB A;  4R57 A;  2AFZ A;  4X8I A;  5HVF A;  1S7L A;  1YK3 A;  1R61 A;  3BLN A;  1BOB A;  3PP9 A;  3BI1 A;  3D7F A;  4H2K A;  4MXU A;  1Z5R A;  4OAE A;  5FVJ A;  5F48 A;  4UFV A;  3HUV A;  2VXK A;  4B5P B;  2ZEH A;  2GE3 A;  4F9U A;  1JQG A;  1LRZ A;  1ZG9 A;  4YU9 A;  4BD9 A;  1NSL A;  2IMO A;  1XEB A;  3F9K C;  4CPA A;  5LRJ A;  3TX8 A;  4E2A A;  4PV6 A;  1Q2D A;  2NSM A;  1CBX A;  2PJ1 A;  3TC8 A;  2G0B A;  5K8N A;  2D4P A;  4PK2 A;  1VHS A;  3E0K A;  2PJ3 A;  3WC7 A;  4MFP A;  2ZW7 A;  3IC1 A;  4R8F A;  3F5B A;  2PJ0 A;  4R6T A;  3RZA A;  1KEE B;  2V8H A;  4M6G A;  3SXO A;  2MP0 A;  1KUY A;  5F9M A;  5LRK A;  4GM5 A;  2DPS A;  2YND A;  3BUO B;  2PJ5 A;  5GCN A;  2XEG A;  1FY7 A;  4NEX A;  2XPN A;  4KLV A;  2ZPA A;  4BPW B;  4C84 A;  1LCP A;  1XMT A;  3PB9 X;  3TOB A;  5KTD A;  2AFS A;  4M85 A;  1IYK A;  3SI2 A;  1X10 A;  4C9R A;  1IIC A;  3FBU A;  2Q7S A;  4AG7 A;  4JWP A;  4OC4 A;  3WC6 A;  4COB A;  2WSA A;  4QUS A;  3T9Y A;  2A4N A;  3D68 A;  4YWY A;  4MJX A;  1YX0 A;  1RO5 A;  2PDO A;  2ZEL A;  1KUX A;  1YSJ A;  4UA3 A;  2Z0Z A;  4KZT A;  4LQG A;  3DR6 A;  3UY5 A;  3WC5 A;  3TT2 A;  2R1I A;  4UBR A;  2GFQ A;  4ZYQ A;  4X2T A;  1IB1 E;  4KSA A;  2HI6 A;  2XPP A;  2HC9 A;  3FRM A;  1HDU A;  4C7I A;  4C85 A;  4BPX B;  1ZG8 A;  3VWD A;  2B5G B;  3SHP A;  2HRO A;  1DIK A;  4F6A A;  1ARM A;  1OZP A;  2DXQ A;  2GLJ A;  3T90 A;  3T0T A;  3VAT A;  4B12 A;  4J3G A;  4CAW A;  2PR1 A;  3EZE A;  2VEZ A;  2PVV A;  2HB6 A;  1VI4 A;  4E94 A;  2Q0Y A;  2PJ7 A;  2IJZ A;  1Z8T A;  4UEZ A;  1YLO A;  2WYR A;  3IFE A;  3EFA A;  4OP4 A;  1IGB A;  3H8E A;  4E8O A;  3TYX A;  3KHX A;  3D7H A;  4MHZ A;  4YGO A;  2OZH A;  5AXI A;  2EK9 A;  4X5K A;  3IIB A;  1ZLH A;  2GLF A;  3SJF A;  3U88 C;  1EE3 P;  1F57 A;  1YW4 A;  3PFO A;  3EC4 A;  1VBG A;  1L0C A;  5THW A;  4AVC A;  2VL1 A;  2ZEG A;  1PYT B;  3S9L A;  1J3L A;  3IU1 A;  3R95 A;  2B4D B;  4C9U A;  2PJ2 A;  2CIJ A;  4EWT A;  3VRP A;  3VAR A;  2UV8 G;  2Q43 A;  3LMS A;  4KOY A;  2PJ4 A;  2C6G A;  4CAE A;  5F1Y A;  5BY0 A;  2DLA A;  1KUV A;  4CYO A;  1V0C A;  2ABZ A;  1S7K A;  1PCA A;  1KZF A;  1CP6 A;  1Z8L A;  3V7Z A;  3FMC A;  4KOV A;  4ZY0 A;  2V8D A;  2ARH A;  1YGH A;  3GYA A;  5HMN A;  4TJV A;  1KBL A;  4A94 A;  4ZY1 A;  3GLJ A;  1KWM A;  3VTA A;  1XFO A;  5JYB A;  3R96 A;  2Y1M A;  1CJW A;  4R9M A;  3NA6 A;  4RI1 A;  4FUU A;  4I49 A;  3L2N A;  4CO9 A;  4NGP A;  3V8I A;  1EZA A;  3KZW A;  2Q4V A;  4WJB A;  3IWW A;  3VGO A;  1S3Z A;  3LAC A;  5F47 A;  2AFW A;  2E28 A;  4NGR A;  2GIV A;  3B8G A;  5IB9 A;  3FJU A;  4LX9 A;  3TLE A;  4QC6 A;  4Z65 A;  4UCN A;  4W9Y A;  2ZED A;  4L89 A;  3ICU A;  3H8G A;  5HKY A;  1ELM P;  2O28 A;  4IK2 A;  4Q38 A;  2FIA A;  3VRQ A;  4QB9 A;  3ZNI A;  4XPD B;  4KOT A;  4Q7A A;  4DUK A;  4NFR A;  2K5T A;  4XPD C;  4P45 A;  3KKW A;  1Z4E A;  2ZOG A;  4CDK A;  2CNT A;  3PGP A;  4LQ6 A;  3TFY A;  4GS4 A;  4B5O A;  1BLL E;  1VBH A;  4C8A A;  3GUX A;  1X12 A;  4C9A A;  1BO4 A;  4IHM A;  4UWI A;  1CG2 A;  1XOV A;  1S7F A;  3LD2 A;  1Z8X A;  4OIW A;  4U5Y A;  4YFJ A;  1NSA A;  3BUM B;  4P4I A;  1WK4 A;  3HPG G;  3OWC A;  3PB8 X;  3HMJ G;  1YRE A;  4ZX9 A;  1XBU A;  3EY5 A;  2CBL A;  1YVK A;  3ZZI A;  1JDE A;  5CPA A;  3I3G A;  2JBJ A;  1MJA A;  4HPS A;  4O23 A;  1T36 B;  4R3K A;  1TIQ A;  1XJO A;  4Q36 A;  2N3A B;  5DWN A;  3FF3 A;  4MFJ A;  3I74 A;  1IYL A;  3CXS A;  4C9V A;  4XPK A;  2P6E A;  4CYQ A;  3W6X A;  1KC7 A;  4IIX A;  1J4J A;  2C5Q A;  2ZEP A;  2I3C A;  3PB6 X;  4CGO A;  1QSO A;  1YLE A;  1R43 A;  3B3T A;  3KR4 A;  1AMP A;  2QIR A;  4HNW B;  4MFL A;  2V77 A;  1ELL P;  4Y49 C;  3BI0 A;  2RB7 A;  3FEE A;  4PXE A;  3HPH E;  2PE3 A;  4H89 A;  2PR8 A;  1GHE A;  4UIB A;  4Y49 B;  2JBK A;  1LAM A;  4FBE A;  4EYS A;  4BIN A;  2YNE A;  3K9T A;  2RC4 A;  4EVY A;  1V6C A;  4B10 A;  3FNC A;  4NGM A;  2FCK A;  4U9Z A;  1YR0 A;  1SQH A;  4KUA A;  4TWE A;  3DDD A;  2OB0 A;  1P0H A;  2B3U A;  5CBM A;  5F13 A;  3QB8 A;  5K8P A;  5IX3 A;  1RTQ A;  1BPN A;  2B0A A;  3T5M A;  4MMO A;  2G3A A;  5H84 A;  4F9V A;  2PJ8 A;  1QSR A;  4A4B A;  1LAP A;  1TF8 A;  2FE7 A;  2Z3O A;  2ZW4 A;  4MHN A;  3R9F A;  3RAM A;  4IIY A;  4C8F A;  4ONW A;  3K4I A;  2P6F A;  2EUI A;  4K3N A;  5F49 A;  4EFD A;  3JUW A;  3TLG A;  4UCM A;  2HQY A;  2ZXV A;  2BOA A;  5AG6 A;  2PC1 A;  1DE4 C;  5I0C A;  2GP4 A;  3FED A;  2BEI A;  4ORF A;  5HH1 A;  2C6P A;  4RUH A;  5J1Q A;  5LYF A;  3IEH A;  2XPL A;  1AYE A;  4MJ8 A;  1JWQ A;  4BBH A;  5F46 A;  5KTC A;  4M3S A;  1B6B A;  3PB7 X;  4MHD A;  3IWG A;  4P4B A;  5BWA B;  1BXR B;  3TLC A;  4AB7 A;  4MCQ A;  4R76 A;  7CPA A;  3I9S A;  1OBR A;  3K9U A;  3B35 A;  5D8N A;  3IO1 A;  4MBU A;  2I79 A;  4G1P A;  3IJ3 A;  4KOS A;  2X7B A;  3RO0 A;  2OR4 A;  3TCV A;  4B14 A;  4CAV A;  1QQ9 A;  4CGP A;  5K8M A;  4J0N A;  3SJE A;  2J9A A;  1XF8 A;  3CXP A;  4MY0 A;  4ZX8 A;  2IL4 A;  2Q4Z A;  4F0X A;  2VZY A;  4PXB A;  3FXT A;  2PJB A;  2ODF A;  3W91 A;  1QSN A;  2R98 A;  2J8R A;  4NCZ A;  2V8G A;  4KOR A;  2X0S A;  2BSW A;  2PJC A;  5AG7 A;  1TKJ A;  2JEW A;  2OH1 A;  2WUU A;  1ZL0 A;  3QNV A;  4OAD A;  3PT1 A;  3NE7 A;  3VRR A;  4K30 A;  2GAN A;  5A28 A;  2GRE A;  4A39 A;  5LYD A;  1Z9E A;  5IB0 A;  4PXC A;  3S6F A;  4BMH A;  5JH9 A;  4BPU B;  1Z9U A;  4OC2 A;  2DF5 A;  4UFX A;  4HNY B;  2B5G A;  2OZU A;  5CNP A;  5JQ4 A;  3W6S A;  3ISZ A;  4COG A;  4JJX A;  4AVA A;  1I12 A;  3D4U A;  5ELY A;  1PU9 A;  4P10 A;  3TLB A;  2I00 A;  2Y1N A;  1ZO0 A;  1YVO A;  4FD6 A;  1CS0 B;  2ZEN A;  2Z3P A;  4A32 A;  1M1D A;  4OKO A;  4CYP A;  5G1Z A;  3HLP A;  2ZEO A;  2FXF A;  1Q2C A;  2IQ6 A;  3PEI A;  2R7H A;  2R82 A;  5I4M A;  1A9X B;  4MFQ A;  1YW6 A;  2J8M A;  2PQ8 A;  3TO7 A;  3WAB A;  5J8C A;  1LFW A;  4OME A;  2BL1 A;  1H8L A;  3I6S A;  2XEI A;  4OC1 A;  1IID A;  5JGF A;  4RN7 A;  1M4L A;  1LAN A;  5J3X A;  3TOA A;  5A27 A;  2Z10 A;  1ZLI A;  3D67 A;  3FIX A;  4AVB A;  3KRV A;  3B3V A;  5C82 A;  3KI9 A;  2CTC A;  2Y0M A;  2REE A;  4CGN A;  5KTA A;  4CGL A;  3KAS A;  3RBU A;  1BPM A;  2EVN A;  4C2X A;  1WJT A;  1EO0 A;  1F2O A;  2Z11 A;  3VWE A;  3R9G A;  3SJG A;  2FS5 A;  3DNS A;  4FWU A;  4XNH B;  4MHP A;  1IY7 A;  2C6C A;  4GXH A;  1S60 A;  4R3L A;  1FNO A;  1QST A;  2NYQ A;  1S5K A;  5C88 A;  4KUB A;  4CS0 B;  1NMT A;  2XEF A;  1TXR A;  2ZW6 A;  4P4E A;  1M4G A;  2YNC C;  4FD5 A;  4A37 A;  1Y9K A;  4KOU A;  4R87 A;  1RXT A;  4JXR A;  3B7I A;  2NMT A;  4EME A;  2ANP A;  2C27 A;  2G9D A;  4C8P A;  1UWY A;  2CTB A;  3DSB A;  5EC4 A;  2F7V A;  2PIZ A;  3KL9 A;  2O4H A;  3BJ7 A;  4JLY A;  2DEA A;  3BUN B;  3BUX B;  1C30 B;  2PVW A;  2F5I A;  2FM4 A;  4A2Z A;  1TKF A;  2H5M A;  2Q4Y A;  4AXV A;  2DPT A;  4MFK A;  2JDD A;  4PSX A;  1VIX A;  4MCP A;  2PJ6 A;  3KQZ A;  4ZBG A;  3TO9 A;  1LOK A;  4BTF A;  1QSM A;  4X3R A;  1N71 A;  1F2P A;  3S9N A;  4FD4 A;  3IU2 A;  3FEC A;  3SXN A;  1YME A;  4KVO E;  1NXJ A;  3EZB A;  4NF1 A;  4DYO A;  3BUW B;  3CXQ A;  4L8A A;  2O53 A;  4CRZ B;  2AUN A;  3C26 A;  3NH5 A;  1HDQ A;  1PUA A;  2PSW A;  1B47 A;  4PK3 A;  5JM6 A;  2YJV A;  1Y7R A;  5JVL A;  4MCR A;  1ARL A;  6CPA A;  2J8N A;  2CXA A;  3S6K A;  4QBJ A;  4KS9 A;  2AUM A;  4PQA A;  4P4J A;  2VI7 A;  3VRO A;  3BJ8 A;  4A38 A;  2OLS A;  4B5P A;  1WVM A;  1XRY A;  3IGR A;  3OB2 B;  2JDC A;  3O8Z A;  3B3W A;  2WPX A;  4NXY A;  4OID A;  2AFX A;  4UCP A;  1Z2L A;  2Q7B A;  2XPO A;  4CAF A;  4ZGY B;  1DTD A;  4YN3 A;  3D7D A;  3EZA A;  4FAI A;  4JD6 A;  3TLG B;  2BCO A;  2RFH A;  4NSQ A;  3NOJ A;  1CP7 A;  2VKZ G;  3GJZ A;  1CE8 B;  1TKH A;  2D0P A;  2ATR A;  2C1C A;  4MI1 A;  4GPL B;  2CNM A;  3GY9 A;  5D29 A;  2Z3K A;  3TTH A;  4C9E A;  4RS2 A;  2EK8 A;  4B11 A;  5LYL A;  2AFM A;  1A2Z A;  2HUZ A;  3IWE A;  3LOD A;  1M4I A;  2D4O A;  4A4C A;  3H8F A;  1Y9W A;  5DWM A;  2YNC A;  4U9Y A;  3D2M A;  3JRU A;  1S7N A;  3OB1 B;  1XE4 A;  3PBB A;  4B6Z A;  4M8D A;  3I1U A;  4FD7 A;  4KOW A;  4JZ0 A;  2B4D A;  4C7H A;  1TF9 A;  1IOI A;  3TE4 A;  1XF1 A;  1Q2Y A;  3CZX A;  3T8W A;  3TLZ A;  4JYW A;  5K99 A;  3DR8 A;  2ZEE A;  3NH8 A;  4LUA A;  1Y0Y A;  4ONU A;  1Z8W A;  2WZN A;  1M6V B;  3WT4 A;  2BO9 A;  4P44 A;  2P0W A;  4OLL A;  4DNC A;  2EBJ A;  4KVM E;  5JPH A;  4KVX A;  3SI0 A;  3NH4 A;  2HWG A;  4H6U A;  1IOF A;  3MRU A;  1Q7L A;  4HNX B;  1MJB A;  4C2Z A;  2PCN A;  3NFQ A;  5AG4 A;  1UFH A;  2B4B A;  1ZRS A;  2QYV A;  3MGD A;  2PCU A;  4OC0 A;  1XIX A;  3RNZ A;  5HVH A;  1VKC A;  4PXD A;  4UIA A;  3CT9 A;  4PPZ A;  1IU8 A;  2GU2 A;  3A9L A;  3D3S A;  4M6H A;  3EO4 A;  3WR7 A;  4INJ A;  4E5S A;  5G21 A;  2Q44 A;  4TNU A;  3CDX A;  4H1H A;  3D7G A;  3B3S A;  4OC5 A;  4P4F A;  2B3V A;  2HV2 A;  3GIU A;  3PFE A;  4IF5 A;  3QAY A;  3P2F A;  3TLY A;  5H86 A;  3OP0 A;  4KLW A;  1MK4 A;  2EO8 A;  1VHE A;  2PRQ A;  2CF4 A;  3CPX A;  2QEC A;  4MFZ A;  3GB0 A;  5AGE A;  3OAK A;  3CPA A;  4UFW A;  3BXM A;  4HKF A;  4NJR A;  3RYO A;  3DLJ A;  3D66 A;  5HXD A;  4KNG E;  2D0O A;  2FL4 A;  3FYN A;  1I21 A;  1R3N A;  3LWU A;  1R57 A;  4CGM A;  5EBV A;  4MHY A;  3SR3 A;  4P4D A;  2JEV A;  5F5X A;  2ZEF A;  3VRN A;  3NE8 A;  1P4N A;  4XNH C;  3MN8 A;  4OC3 A;  2ZW5 A;  2G3T A;  4UWJ A;  4IUS A;  3S6H A;  4AG9 A;  4CAX A;  2FIW A;  3R9E A;  1EZB A;  1VHO A;  2FSR A;  3S6G A;  3FB3 A;  4MRI A;  2VQY A;  1CPS A;  3S9M A;  2AE6 A;  3EIF A;  4KSI A;  2FT0 A;  3B2Y A;  3T05 A;  2VBQ A;  3PRT A;  4H6Z A;  4PSW A;  3TO6 A;  3GKR A;  1K4J A;  4II9 A;  4UEE A;  3G23 A;  2QVP A;  4P6Y A;  4C8T A;  2V8V A;  2WPW A;  1C3O B;  4NJQ A;  4CZ1 A;  3PZJ A;  8CPA A;  3VH9 A;  4XPL A;  4C2Y A;  2PIY A;  5IR2 A;  4M6I A;  4C99 A;  4MCS A;  4IAV A;  4QVT A;  5HVG A;  2YGW A;  3SI1 A;  3NFZ A;  4C86 A;  2B4J C;  2XEJ A;  3V38 A;  4A95 A;  5EMI A;  1GYT A;  3DGV A;  3C8O A; 
#chains in the Genus database with same CATH homology
 4F8Z A;  2EWB A;  4TJX A;  4NGQ A;  3K2K A;  1VGY A;  5DS0 A;  3BHX A;  2AFO A;  2OOT A;  1Y7E A;  5LYI A;  3ISX A;  4NGS A;  3FVL A;  4R7M A;  1QMU A;  4DJL A;  1Y9Z A;  2Q51 A;  4ZY2 A;  1XMB A;  4NGN A;  2QJ8 A;  3SJX A;  3FH4 A;  3KGQ A;  2ZEM A;  3KHZ A;  2AFU A;  1Y0R A;  4UF4 A;  2PJ9 A;  3PB4 X;  5K8O A;  2PJA A;  3N5F A;  1FT7 A;  4ZI6 A;  2ZOF A;  2POK A;  4CDJ A;  3FX6 A;  1HEE A;  2FVG A;  4C8C A;  3KR5 A;  5F09 A;  1ZG7 A;  4NGT A;  4WWV A;  5LRG A;  3PBE A;  1CPX A;  3KQX A;  3B3C A;  4UEF A;  1CX8 A;  2F8H A;  1BAV A;  4C8U A;  2AFZ A;  4X8I A;  5HVF A;  3BI1 A;  4MXU A;  3D7F A;  4H2K A;  1Z5R A;  3HUV A;  4F9U A;  2ZEH A;  1JQG A;  1ZG9 A;  4YU9 A;  4BD9 A;  4CPA A;  2IMO A;  5LRJ A;  3TX8 A;  2NSM A;  2PJ1 A;  1CBX A;  5K8N A;  3TC8 A;  2PJ3 A;  3WC7 A;  4R6T A;  3IC1 A;  4R8F A;  3RZA A;  2PJ0 A;  2V8H A;  5LRK A;  4GM5 A;  2PJ5 A;  2XEG A;  4C84 A;  1LCP A;  3PB9 X;  2AFS A;  3SI2 A;  4C9R A;  3WC6 A;  4OC4 A;  3D68 A;  4YWY A;  2ZEL A;  1YSJ A;  4LQG A;  3WC5 A;  4ZYQ A;  4X2T A;  2HC9 A;  1HDU A;  4C85 A;  1ZG8 A;  1ARM A;  2GLJ A;  3VAT A;  2PVV A;  2HB6 A;  2PJ7 A;  2IJZ A;  4UEZ A;  1YLO A;  2WYR A;  3IFE A;  4OP4 A;  1IGB A;  3H8E A;  3KHX A;  3D7H A;  4MHZ A;  2EK9 A;  3IIB A;  1ZLH A;  2GLF A;  3SJF A;  1EE3 P;  1F57 A;  1YW4 A;  3PFO A;  5THW A;  2VL1 A;  2ZEG A;  1PYT B;  3S9L A;  4C9U A;  2PJ2 A;  2CIJ A;  4EWT A;  3VAR A;  2Q43 A;  3LMS A;  2PJ4 A;  2C6G A;  2ABZ A;  1PCA A;  1CP6 A;  1Z8L A;  3V7Z A;  3FMC A;  4ZY0 A;  2V8D A;  4TJV A;  4A94 A;  4ZY1 A;  3GLJ A;  1KWM A;  3VTA A;  1XFO A;  3NA6 A;  4FUU A;  3L2N A;  4NGP A;  3KZW A;  4WJB A;  3IWW A;  2AFW A;  4NGR A;  5IB9 A;  3FJU A;  4Z65 A;  4W9Y A;  2ZED A;  3ICU A;  3H8G A;  1ELM P;  4IK2 A;  4DUK A;  4Q7A A;  4NFR A;  4P45 A;  4CDK A;  2ZOG A;  1BLL E;  4C8A A;  3GUX A;  4C9A A;  4IHM A;  1CG2 A;  4OIW A;  1NSA A;  4P4I A;  3PB8 X;  4ZX9 A;  1XBU A;  5CPA A;  2JBJ A;  4O23 A;  1XJO A;  3FF3 A;  3I74 A;  4C9V A;  2C5Q A;  2ZEP A;  2I3C A;  3PB6 X;  1R43 A;  3B3T A;  3KR4 A;  1AMP A;  2V77 A;  1ELL P;  3BI0 A;  2RB7 A;  3FEE A;  4PXE A;  2PE3 A;  4FBE A;  4UIB A;  2JBK A;  1LAM A;  3K9T A;  1V6C A;  4NGM A;  4TWE A;  5CBM A;  5K8P A;  1RTQ A;  1BPN A;  4MMO A;  4F9V A;  2PJ8 A;  1TF8 A;  1LAP A;  4MHN A;  4C8F A;  3RAM A;  4ONW A;  4K3N A;  4EFD A;  2BOA A;  1DE4 C;  2GP4 A;  3FED A;  2C6P A;  4RUH A;  5J1Q A;  5LYF A;  3IEH A;  1AYE A;  3PB7 X;  4P4B A;  4MCQ A;  4R76 A;  7CPA A;  1OBR A;  3B35 A;  5D8N A;  3IO1 A;  4G1P A;  3IJ3 A;  2OR4 A;  1QQ9 A;  5K8M A;  3SJE A;  2J9A A;  4ZX8 A;  2Q4Z A;  4PXB A;  2PJB A;  2V8G A;  2PJC A;  1TKJ A;  2JEW A;  3QNV A;  2GRE A;  4A39 A;  5LYD A;  4PXC A;  5JH9 A;  4OC2 A;  3ISZ A;  3D4U A;  5ELY A;  4P10 A;  2ZEN A;  4OKO A;  3HLP A;  2ZEO A;  2IQ6 A;  3PEI A;  5I4M A;  1YW6 A;  3WAB A;  1LFW A;  4OME A;  1H8L A;  3I6S A;  2XEI A;  4OC1 A;  5JGF A;  1M4L A;  1LAN A;  1ZLI A;  3D67 A;  3B3V A;  3KI9 A;  2CTC A;  3KAS A;  3RBU A;  1BPM A;  1F2O A;  3SJG A;  4FWU A;  4MHP A;  1IY7 A;  2C6C A;  1FNO A;  2NYQ A;  2XEF A;  1TXR A;  4P4E A;  4A37 A;  3B7I A;  4EME A;  2ANP A;  2G9D A;  4C8P A;  1UWY A;  2CTB A;  2F7V A;  2PIZ A;  3KL9 A;  2O4H A;  2DEA A;  2PVW A;  1TKF A;  4AXV A;  1VIX A;  4MCP A;  2PJ6 A;  3KQZ A;  1LOK A;  4X3R A;  1F2P A;  3S9N A;  3FEC A;  1YME A;  4DYO A;  2O53 A;  3NH5 A;  1HDQ A;  5JM6 A;  4MCR A;  1ARL A;  6CPA A;  4PQA A;  4P4J A;  4A38 A;  1WVM A;  1XRY A;  4OID A;  3B3W A;  5HVH A;  2AFX A;  1Z2L A;  1DTD A;  4YN3 A;  3D7D A;  4FAI A;  2BCO A;  2RFH A;  1CP7 A;  1TKH A;  2C1C A;  5D29 A;  4C9E A;  2EK8 A;  5LYL A;  2AFM A;  3H8F A;  3JRU A;  3PBB A;  4B6Z A;  3I1U A;  4JZ0 A;  1TF9 A;  1XF1 A;  3T8W A;  4JYW A;  2ZEE A;  3NH8 A;  1Y0Y A;  2WZN A;  3WT4 A;  2BO9 A;  4P44 A;  3SI0 A;  3NH4 A;  3MRU A;  1Q7L A;  2QYV A;  2PCU A;  4OC0 A;  4PXD A;  4UIA A;  3CT9 A;  4PPZ A;  2GU2 A;  4TNU A;  3CDX A;  3D7G A;  3B3S A;  4OC5 A;  4P4F A;  3PFE A;  1VHE A;  2PRQ A;  2CF4 A;  3CPX A;  3GB0 A;  3CPA A;  3BXM A;  4NJR A;  5HXD A;  3DLJ A;  3D66 A;  4KNG E;  1R3N A;  3LWU A;  4MHY A;  4P4D A;  2ZEF A;  3MN8 A;  4OC3 A;  1VHO A;  4MRI A;  3EIF A;  1CPS A;  3S9M A;  4KSI A;  3B2Y A;  3PRT A;  4UEE A;  2QVP A;  4P6Y A;  4C8T A;  2V8V A;  4NJQ A;  8CPA A;  3VH9 A;  2PIY A;  5IR2 A;  4C99 A;  4MCS A;  4IAV A;  5HVG A;  4C86 A;  3SI1 A;  3NFZ A;  2XEJ A;  3V38 A;  1GYT A;  3DGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...