4P4FA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor nc-2-40
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 262
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4fA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4fA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4fA02
1HEEA 4P4DA 1XMBA 1TF9A 2ZEDA 3TC8A 7CPAA 4UEZA 3KR5A 4OC1A 3GB0A 4IK2A 4ZY2A 4R76A 2PVWA 2BOAA 4MCRA 2PCUA 2PJ9A 5K8NA 2O53A 3PFEA 4C9EA 1LCPA 3SI2A 2ZOFA 1LAMA 4A38A 3PB4X 4UEEA 4P6YA 3S9NA 4CDJA 5JM6A 3WC5A 3B3CA 1LFWA 5IB9A 1TKFA 2CTCA 3D7GA 1UWYA 4ONWA 4NGPA 4F8ZA 1CG2A 3K9TA 2C6PA 2GU2A 3D68A 1CP7A 5K8OA 3V7ZA 4JZ0A 3SJGA 4OIDA 2ZEEA 1ARMA 2QYVA 2ZEPA 1IY7A 3D66A 3DLJA 5DS0A 3DGVA 5ELYA 2PJ5A 3CPXA 2C6GA 2DEAA 1BAVA 1FNOA 3WC7A 3I6SA 4OKOA 3PFOA 3K2KA 3FEEA 4C8AA 3S9LA 3KZWA 2PJAA 3B3VA 1F57A 1M4LA 3FEDA 5LYLA 2AFUA 1TXRA 3V38A 5J1QA 3BHXA 4C85A 1YW4A 2PVVA 3CPAA 3WABA 4A94A 4DYOA 4PPZA 1XBUA 3CT9A 4X8IA 5HVFA 3IFEA 1QMUA 3D7DA 4B6ZA 4F9UA 3NA6A 5HXDA 3ISXA 4C99A 1R3NA 4OC0A 5LRJA 1XFOA 4P4EA 4YWYA 3H8GA 1ZG7A 4W9YA 1Q7LA 1CPXA 3B3WA 1Y7EA 4Q7AA 1ARLA 3SJFA 4A37A 3D7HA 3EIFA 2BO9A 4NJQA 2AFMA 3IJ3A 1TKJA 3SI1A 3IIBA 4MHNA 2CIJA 3PRTA 1Y0RA 2FVGA 3NFZA 2EK9A 2XEGA 2XEJA 2PJ2A 2POKA 4K3NA 2QVPA 4NGNA 3SI0A 3KGQA 4FAIA 2EWBA 5D29A 3NH5A 3IO1A 3BXMA 4IAVA 4MRIA 1F2OA 4KSIA 3TX8A 4IHMA 3KQZA 4FWUA 3HLPA 4MHPA 2AFOA 2PJBA 4MHZA 1WVMA 2XEFA 2GLJA 1YLOA 1CP6A 2PJ7A 1ZG9A 3JRUA 3PB6X 4PXCA 4ZX8A 4PQAA 3VARA 1AMPA 4NGSA 3PBEA 1VIXA 2CF4A 2F7VA 2PIYA 2JEWA 2ZEFA 4C9VA 2AFZA 2HC9A 1CBXA 3NH4A 4PXBA 2PJ6A 4OC4A 3PEIA 2RFHA 4EMEA 1VHOA 4P45A 2PJ8A 4C8TA 3PBBA 4TWEA 4FBEA 4EFDA 4MCSA 2ZEOA 3CDXA 1LOKA 4KNGE 3GUXA 4ZX9A 3FX6A 4WWVA 3H8EA 3H8FA 3KI9A 3B35A 4C86A 3LWUA 3B3SA 2QJ8A 2GREA 3I74A 3B2YA 2GLFA 2C6CA 1DTDA 4UF4A 1BPMA 2NSMA 3WT4A 1BPNA 2PJ3A 5THWA 3RBUA 3N5FA 1TF8A 3T8WA 1JQGA 2PJ1A 3WC6A 4Z65A 4C9RA 5CBMA 1F2PA 3FJUA 2PRQA 4R8FA 3FVLA 4YU9A 4DJLA 2Q51A 3SJEA 4RUHA 4C84A 5LRGA 1Z5RA 1NSAA 2AFSA 2XEIA 1V6CA 1PYTB 4OMEA 1YSJA 3S9MA 1XF1A 2IQ6A 4G1PA 5LRKA 2BCOA 4C8CA 4FUUA 3ICUA 1LANA 4UEFA 1HDQA 4NGQA 1HDUA 4GM5A 1EE3P 2EK8A 3SJXA 1OBRA 2WYRA 4LQGA 2IJZA 4BD9A 1R43A 4EWTA 1H8LA 4MMOA 4OC3A 1CPSA 1XRYA 5HVHA 3D7FA 4JYWA 1CX8A 3FF3A 5JGFA 3NH8A 4MXUA 2HB6A 1ZLIA 3HUVA 2I3CA 3B7IA 3IWWA 1RTQA 3VH9A 3IEHA 3FH4A 5LYFA 4R7MA 2ANPA 2PE3A 2AFXA 3PB8X 4MCPA 1IGBA 2CTBA 4NFRA 4CPAA 3KHXA 1YMEA 4F9VA 4YN3A 1QQ9A 3KQXA 4ZY1A 4MHYA 2G9DA 4C8FA 3ISZA 2V77A 3KHZA 4P10A 1FT7A 4MCQA 2PJCA 1VHEA 2V8GA 2ZEHA 4OC5A 2OR4A 4WJBA 2JBJA 3GLJA 3KL9A 3VTAA 1XJOA 1PCAA 3FECA 4C8UA 4X2TA 4TNUA 1ZG8A 3D4UA 2RB7A 3PB7X 2PJ0A 2VL1A 3KR4A 1DE4C 2C1CA 1KWMA 3D67A 1Y9ZA 4R6TA 1Z2LA 2PIZA 2ZELA 3IC1A 5CPAA 4P4FA 4OIWA 2ZEMA 4PXEA 3RZAA 3FMCA 2OOTA 4DUKA 2NYQA 5K8PA 4TJVA 1BLLE 5HVGA 5LYIA 2O4HA 3I1UA 2Q4ZA 1VGYA 5K8MA 4ZY0A 2WZNA 4UIAA 2V8VA 3KASA 1AYEA 3PB9X 2ZOGA 4TJXA 4NJRA 1LAPA 2ZENA 6CPAA 2V8DA 3L2NA 1ZLHA 2PJ4A 4ZYQA 1Z8LA 4NGMA 4UIBA 4P4IA 4O23A 4ZI6A 2Q43A 3RAMA 3B3TA 5F09A 3VATA 8CPAA 4P4JA 5LYDA 3BI0A 4P44A 1YW6A 3QNVA 1ELMP 1ELLP 1GYTA 2F8HA 1Y0YA 2IMOA 4PXDA 4C8PA 3MN8A 4OC2A 4H2KA 4NGTA 4P4BA 2J9AA 4C9UA 2ABZA 4AXVA 3MRUA 4X3RA 3LMSA 5D8NA 5JH9A 2JBKA 2ZEGA 4NGRA 4C9AA 4CDKA 3BI1A 4OP4A 4A39A 2V8HA 1TKHA 5I4MA 2AFWA
chains in the Genus database with same CATH superfamily
4K30A 3R9GA 4AG7A 1HEEA 4YFJA 4R9MA 3QB8A 2HI6A 3G8WA 3TLZA 3FNCA 4MI4A 5JVLA 4P4DA 2CNTA 4AVBA 3H4QA 1J4JA 1QSMA 1XMBA 1TF9A 2ZEDA 3TC8A 7CPAA 1J3LA 3EY5A 4UEZA 3IWGA 3KR5A 5GCNA 4OC1A 4C2ZA 3R95A 1Z9EA 3GB0A 4IK2A 4ZY2A 4CAVA 3F0AA 4R76A 2EZBA 2YJTA 2Z3MA 2D0OA 2PVWA 5JQ4A 1CM0A 2BOAA 2FXFA 4MCRA 2PCUA 1EO0A 1MJ9A 3OB1B 2O53A 2PJ9A 4R3KA 4A2ZA 1MK4A 2PSWA 3CXPA 3GJZA 1M4IA 3PFEA 4C9EA 3PZJA 4PSXA 2P6GA 1LCPA 4KOUA 2GFQA 3SI2A 2ZOFA 1LAMA 2ZW5A 3A9LA 3PB4X 4P6YA 4UEEA 4XPKA 3S9NA 4A38A 1JDEA 4CDJA 5JM6A 3TLGA 3FBUA 3TTHA 3B3CA 3WC5A 3PFVA 3S6KA 2VEZA 1LFWA 2J8RA 2VXKA 5IB9A 1VI4A 1TKFA 2CTCA 4COBA 3D7GA 1XF8A 3TOAA 5E96A 1UWYA 4IUSA 2EZAA 3PP9A 2GE3A 2Q04A 1IIDA 4ONWA 4NGPA 3U1BA 4F8ZA 5G21A 5G1ZA 1CG2A 2PCNA 3K9TA 2JDCA 2F5IA 2C6PA 2GU2A 3D68A 2XPPA 1CP7A 4H6ZA 5F46A 3C8OA 5K8OA 5AXIA 2ZW7A 3V7ZA 1QSOA 4JZ0A 4JVOA 3SJGA 4OIDA 4BINA 2ZEEA 4XPDC 2G0BA 3O8ZA 1ARMA 2QYVA 2ZEPA 3DR6A 1IY7A 3D66A 3DLJA 5DS0A 3DGVA 5ELYA 3HMJG 4MI1A 2PJ5A 3CPXA 2C6GA 2Z10A 4FD7A 2DEAA 4A30A 4CYOA 1BAVA 1FNOA 4UFWA 3WC7A 1C30B 4IIXA 2J8MA 4H89A 3I6SA 5F49A 3HPGG 1VKCA 2BSWA 4OKOA 1YK3A 3PFOA 3K2KA 3RNZA 3FEEA 4KVXA 5AG5A 4C8AA 3S9LA 2FL4A 1WWZA 3KZWA 1M4DA 4UCNA 5JYBA 1PUAA 2PJAA 3OAKA 3B3VA 3FB3A 4MFJA 4CGLA 4E0AA 4II9A 1F57A 1M4LA 3FEDA 2JEVA 1Q5XA 3EZEA 4AG9A 4KORA 4RN7A 2Z3PA 4U9YA 5LYLA 2AFUA 3R96A 1P4NA 1TXRA 3KKWA 4GS4A 1OZPA 5F13A 5J3XA 1MJBA 4KOWA 3GYAA 3V38A 5J1QA 3BHXA 1S7LA 1A2ZA 2AUNA 2C5QA 4C85A 1YGHA 1YW4A 4KS9A 2PVVA 4HNWB 4MFLA 5K8NA 1Q2DA 3CPAA 3WABA 2AUMA 4A94A 5FVJA 4DYOA 4PPZA 1XBUA 5I0CA 1Z9UA 3CT9A 4X8IA 5HVFA 1XE4A 4HKFA 3VROA 3IFEA 1QMUA 4L8AA 3D7DA 4NEXA 4B6ZA 3NA6A 4F9UA 3ISXA 5HXDA 1NXJA 4C99A 1IYKA 2B4BA 3EZAA 3V8IA 1R3NA 1BOBA 4CAWA 4OAEA 1KUXA 2REEA 4BBHA 3CXQA 4KUAA 1M1DA 1Z8XA 3JTKA 4OC0A 3T05A 3IWEA 3CZXA 5LRJA 1XFOA 2ARHA 4P4EA 3W6SA 1YLEA 4YWYA 4KOVA 2DXQA 3H8GA 3WR7A 1I12A 1I1DA 4W9YA 1ZG7A 1Q7LA 1CPXA 4MJ8A 2Q0YA 5DWMA 1EZAA 3B3WA 1Y7EA 5IR2A 5F48A 4Q7AA 1ARLA 2C27A 2HWGA 3SJFA 2CNMA 3T9YA 4KLVA 4A37A 3D7HA 4BTFA 2WPXA 4AVCA 4JD6A 2BO9A 3EIFA 4NJQA 3SR3A 2REFA 2AFMA 3IJ3A 2QMLA 4BPXB 1TKJA 4GXHA 3SI1A 3SXOA 3IIBA 1Z8WA 1ON0A 4MHNA 4PSWA 2B0AA 4XNHC 4CS0B 2CIJA 2R7HA 1Y0RA 3DDDA 3PRTA 4KOXA 2FVGA 4JLYA 3NFZA 1Y9KA 2EK9A 2XEGA 3TO6A 2PR1A 2XEJA 2PJ2A 3I9SA 2POKA 3P2FA 4K3NA 2XPOA 5F5XA 2VQYA 2QVPA 4MFPA 2AJ6A 4NGNA 2GANA 4C7HA 1M44A 1Q2CA 1U6MA 3SI0A 2WSAA 1WK4A 3KGQA 4FAIA 1UFHA 2EWBA 2FT0A 4PK2A 3NFQA 5D29A 3IO1A 3NH5A 4EVYA 3BXMA 4IAVA 4CAXA 4MRIA 1F2OA 3VWDA 5EBVA 3D3SA 1S7FA 2ZXVA 4KSIA 1V0CA 4M6GA 3R1KA 3TX8A 4C2XA 4IHMA 3VRQA 1N71A 2YNCA 3KQZA 4FWUA 3HLPA 4M85A 3NE7A 4MHPA 2AFOA 2PJBA 4HNYB 1M6VB 2R8VA 4MHZA 1WVMA 2XEFA 3S6FA 3TFYA 1P0HA 2R1IA 2GLJA 1YLOA 4GPLB 1CP6A 5DWNA 4B14A 2BEIA 2PJ7A 2EBJA 1ZG9A 3JRUA 2P6FA 3PB6X 1NE9A 2B4DA 3S6HA 4RI1A 2GIVA 4PXCA 4X5KA 4ZX8A 4PQAA 3VARA 5ISVA 1AMPA 5KTAA 1Z8TA 4NGSA 2CNSA 1ZL0A 4FD5A 3PBEA 1B6BA 1VIXA 3R9EA 3W91A 2CF4A 2F7VA 2XPNA 4M8DA 4F0XA 4U5YA 5F9MA 2PIYA 2Z3KA 5A28A 1CJWA 1RXTA 2ODFA 4B5PA 2JEWA 2ZEFA 1NSLA 5EC4A 1QSRA 2YGWA 3S6GA 2MP0A 2ZPAA 5H84A 4QVTA 2AFZA 4C9VA 3B8GA 1Z4EA 1XEBA 2CBLA 4KZTA 1CE8B 4H1HA 2HC9A 4R87A 1S7KA 1CBXA 1KUYA 2RC4A 3NH4A 1X12A 4PXBA 4A32A 2PJ6A 3TYXA 4OC4A 1IB1E 2QIRA 2RFHA 3FIXA 3PEIA 4JWPA 1VHOA 5AGEA 4EMEA 5J8CA 4P45A 3EO4A 3ZZIA 2PJ8A 4UWJA 4C8TA 1KZFA 4CAEA 3PBBA 4M3SA 3K4IA 3NOJA 4Y49B 1B47A 4AB7A 4CGMA 4TWEA 4FBEA 4EFDA 3G23A 2Y1NA 1QSTA 4MCSA 2ZEOA 3CDXA 1LOKA 3MGDA 4KNGE 3GUXA 5IX3A 4J3GA 3C26A 4ZX9A 1C3OB 3FX6A 4B11A 4WWVA 3E0KA 3DR8A 2O28A 2B58A 4YRHA 3H8EA 1YVKA 4CYNA 1QSNA 3H8FA 3KI9A 3B35A 2YJVA 4C86A 3LWUA 3B3SA 2QJ8A 3TT2A 2I00A 2GREA 2PR8A 3I74A 2Z3LA 5J8FA 2D4PA 2Z11A 3B2YA 2GLFA 2C6CA 1DTDA 2IL4A 2WPWA 1IOIA 4KSAA 4MFKA 4QBJA 3BUMB 1BPMA 2NSMA 3F5BA 4UF4A 1VHSA 5G20A 2X0SA 2Y0MA 3WT4A 4I49A 1BPNA 2PJ3A 5THWA 3RBUA 1IYLA 1S7NA 3RYOA 3N5FA 1TF8A 3T8WA 1JQGA 2EO8A 2J8NA 2PJ1A 4KOYA 3WC6A 4BMHA 2HROA 2B4DB 2B4JC 2A4NA 4LX9A 4OADA 4Z65A 4C9RA 1NMTA 4BPWB 3F8KA 5CBMA 4HPSA 1F2PA 3EZBA 4A33A 3FJUA 2VBQA 3UY5A 2PRQA 1X10A 2OZUA 4J0NA 4H6UA 2Q4YA 4R8FA 3T07A 3FVLA 4YU9A 2OH1A 4E8OA 4DJLA 4CAFA 2Q51A 3SJEA 4RUHA 1KC7A 4C84A 4B5PB 5LRGA 4HNXB 5HKYA 1Z5RA 4UBRA 4UFVA 1NSAA 2AFSA 1SQHA 2XEIA 1CS0B 3LODA 3VWEA 1V6CA 1PYTB 4NSQA 5AG4A 2YNCC 4OMEA 1YSJA 3IU1A 5HKZA 3S9MA 3LACA 2IQ6A 1XF1A 4G1PA 5LRKA 4COGA 1AUGA 2ATRA 2FIAA 3OWCA 1VBGA 2BCOA 2X7BA 4C8CA 5KTCA 4FUUA 4UA3A 3ICUA 1LANA 4UEFA 1HDQA 1R57A 4FD6A 2JDDA 2DPTA 4KOTA 4NGQA 1HDUA 4GM5A 3RO0A 1EE3P 2H5MA 3TO7A 4E5SA 3BUWB 2EK8A 3QAHA 3SJXA 1M4GA 1OBRA 2WYRA 3CXSA 4LQGA 4KUBA 2IJZA 4BD9A 3EFAA 1A9XB 1R43A 2VZYA 3EC4A 4L89A 4EWTA 3BUXB 5K99A 1H8LA 3LD2A 4F0YA 5HKWA 4MMOA 3ZNIA 4OC3A 1CPSA 4KOSA 1XRYA 2NMTA 3N7ZA 4UWIA 5A27A 5HVHA 3D7FA 4JYWA 1CX8A 3FF3A 3VGOA 5JGFA 3FRMA 3GY9A 3NH8A 4MXUA 2BUEA 4R57A 4PV6A 4NCZA 1ZYMA 2HB6A 3TOBA 2AE6A 3PT1A 1ZLIA 2G3AA 3G3SA 3HUVA 4CRYB 2OZGA 3D8PA 1FY7A 2I3CA 2Q44A 3FYNA 3OP0A 1YQEA 3B7IA 4UCMA 3IWWA 2XPLA 4M6HA 4A31A 4CYPA 2N3AB 3VRRA 1RTQA 3IEHA 3GIUA 3VH9A 4B10A 1I21A 3FH4A 5LYFA 3PLFB 1GGOA 1JWQA 2Q7SA 2WUUA 4NF1A 4IIYA 4KLWA 3TCVA 2R98A 4R7MA 1ZO0A 4ZGYB 2DIKA 3BLNA 4QUSA 2ANPA 2HQYA 3TO9A 2UV8G 2PE3A 4UFXA 1EZBA 2AFXA 3PB8X 3DSBA 4CGPA 5IV0A 4MCPA 4LUAA 1IGBA 1KEEB 2CTBA 1XIXA 4ZBGA 3T90A 2DLAA 4NFRA 4CPAA 3KHXA 4Q38A 3TE4A 1YMEA 1BO4A 4F9VA 4YN3A 4A95A 3KRVA 4PK3A 4A4BA 1QQ9A 2FE7A 3KQXA 4MBUA 4ZY1A 3T0TA 3QAYA 4MFZA 4CYQA 3JUWA 4MHYA 4QB9A 2G9DA 4UCPA 4C8FA 3ISZA 2V77A 3KHZA 4P10A 1FT7A 4MCQA 2PJCA 3T5MA 4XPDB 1VHEA 2V8GA 4JXRA 5AG7A 3VRPA 2DPSA 2ZEHA 4OC5A 4JXQA 4R3LA 2OR4A 3D2PA 4WJBA 2FIWA 2JBJA 3GLJA 3KL9A 5HMNA 1YREA 3VTAA 1XJOA 1PCAA 1KUVA 3FECA 3IGRA 2GP4A 1R61A 5BWAB 4KSFA 4C8UA 3HPHE 1Y9WA 4X2TA 4TNUA 3EXNA 1ZG8A 1T36B 4MY0A 2ZW6A 4YGOA 3SHPA 3D4UA 3H5ZA 4U9ZA 4CGNA 5JPHA 2RB7A 4EYSA 1MJAA 3PB7X 3BJ8A 2PJ0A 2VL1A 2VZZA 3KR4A 4ORFA 1DE4C 2P6EA 5F1YA 4B5OA 3FXTA 2C1CA 4JJXA 3TLAA 2I79A 3TLCA 1KWMA 1TIQA 2P0WA 4IF5A 3D67A 2Q7BA 1Y9ZA 2EVNA 4R6TA 1Z2LA 2Y1MA 2PIZA 2ZELA 3IC1A 5CPAA 4CRZB 2FCKA 2D4OA 2Z0ZA 1Z4RA 2YNDA 4P4FA 3BJ7A 4CO9A 4BPUB 1IOFA 2CXAA 4OIWA 2ZEMA 1IICA 4B13A 2OB0A 3U88C 1B87A 4PXEA 3RZAA 2B5GB 2OOTA 3FMCA 1LRZA 2NYQA 4QC6A 3SXNA 4DUKA 5K8PA 4TJVA 1BLLE 1XMTA 4DNCA 4CGOA 5HVGA 5LYIA 4C7IA 4F6AA 1VBHA 2O4HA 3I1UA 1JDBC 4MFQA 1KBLA 2Q4ZA 4M6IA 4MY3A 4LQ6A 4E2AA 1YVOA 1VGYA 4NXYA 4Y49C 4RR2B 2B3VA 4MHDA 1L0CA 3JVNA 3BUOB 2Z3OA 4ZY0A 5K8MA 2WZNA 4UIAA 4MJXA 2V8VA 1Q2YA 4KVOE 2HV2A 3GKRA 1BXRB 3TLYA 2QECA 4ONUA 5AG6A 2EZCA 3KASA 1AYEA 4XPLA 3PB9X 3R9FA 2ZOGA 1RO5A 2B3UA 2BL1A 4NJRA 4TJXA 5G22A 2YNEA 1LAPA 1S3ZA 2ZENA 4A4CA 6CPAA 2V8DA 1XOVA 2ZW4A 3L2NA 1ZLHA 4OLLA 3W6XA 2K5TA 2D0PA 5EMIA 1S60A 2PJ4A 4ZYQA 1ZRSA 1Z8LA 5FD8A 4NGMA 4UIBA 5CNPA 1YVHA 2OU2A 2FM4A 4P4IA 4O23A 4ZI6A 2Q43A 4C2YA 3RAMA 5H86A 3B3TA 4INJA 5F09A 3VATA 4XNHB 2PC1A 1FBVA 3TLGB 8CPAA 2JLMA 2CY2A 4P4JA 2PRBA 2KCWA 4RS2A 5HH1A 5IB0A 5LYDA 3NE8A 1S5KA 1PU9A 3BI0A 4P44A 1YW6A 2FS5A 5C88A 3BUNB 3QNVA 1ELMP 1ELLP 1GYTA 3IU2A 3TLBA 2F8HA 1Y0YA 2IMOA 4PXDA 1Y7RA 4C8PA 3K9UA 2EUIA 3MN8A 4B12A 2Q4VA 4OC2A 4H2KA 2E28A 4NGTA 2VI7A 1WJTA 1K4JA 4P4BA 2PQ8A 1GHEA 4AVAA 3PGPA 3TLEA 2J9AA 2VKZG 4FD4A 1YR0A 1YX0A 3ZJ0A 5KTDA 2HUZA 4CZ1A 4C9UA 2ABZA 4AXVA 3MRUA 1NBWA 3OB2B 4C68A 2R82A 1DIKA 3P2HA 4X3RA 3LMSA 5D8NA 5BY0A 2JBKA 2G3TA 5JH9A 4E94A 2ZEGA 3F9KC 4NGRA 4KVME 3I3GA 2OZHA 3VRNA 4C9AA 2DF5A 2OLSA 3DNSA 2FSRA 1IU8A 5C82A 4CDKA 2B5GA 3BI1A 4OP4A 4Q36A 3D2MA 2Z3NA 4A39A 2PDOA 2V8HA 1TKHA 5I4MA 2AFWA 5F47A
chains in the Genus database with same CATH topology
1HEEA 4P4DA 1XMBA 1TF9A 2ZEDA 3TC8A 7CPAA 4UEZA 3KR5A 4OC1A 3GB0A 4IK2A 4ZY2A 4R76A 2PVWA 2BOAA 4MCRA 2PCUA 2PJ9A 5K8NA 2O53A 3PFEA 4C9EA 1LCPA 3SI2A 2ZOFA 1LAMA 4A38A 3PB4X 4UEEA 4P6YA 3S9NA 4CDJA 5JM6A 3WC5A 3B3CA 1LFWA 5IB9A 1TKFA 2CTCA 3D7GA 1UWYA 4ONWA 4NGPA 4F8ZA 1CG2A 3K9TA 2C6PA 2GU2A 3D68A 1CP7A 5K8OA 3V7ZA 4JZ0A 3SJGA 4OIDA 2ZEEA 1ARMA 2QYVA 2ZEPA 1IY7A 3D66A 3DLJA 5DS0A 3DGVA 5ELYA 2PJ5A 3CPXA 2C6GA 2DEAA 1BAVA 1FNOA 3WC7A 3I6SA 4OKOA 3PFOA 3K2KA 3FEEA 4C8AA 3S9LA 3KZWA 2PJAA 3B3VA 1F57A 1M4LA 3FEDA 5LYLA 2AFUA 1TXRA 2C5QA 3V38A 5J1QA 3BHXA 4C85A 1YW4A 2PVVA 3CPAA 3WABA 4A94A 4DYOA 4PPZA 1XBUA 3CT9A 4X8IA 5HVFA 3IFEA 1QMUA 3D7DA 4B6ZA 4F9UA 3NA6A 5HXDA 3ISXA 4C99A 1R3NA 4OC0A 5LRJA 1XFOA 4P4EA 4YWYA 3H8GA 1ZG7A 4W9YA 1Q7LA 1CPXA 3B3WA 1Y7EA 5IR2A 4Q7AA 1ARLA 3SJFA 4A37A 3D7HA 3EIFA 2BO9A 4NJQA 2AFMA 3IJ3A 1TKJA 3SI1A 3IIBA 4MHNA 2CIJA 3PRTA 1Y0RA 2FVGA 3NFZA 2EK9A 2XEGA 2XEJA 2PJ2A 2POKA 4K3NA 2QVPA 4NGNA 3SI0A 3KGQA 4FAIA 2EWBA 5D29A 3NH5A 3IO1A 3BXMA 4IAVA 4MRIA 1F2OA 4KSIA 3TX8A 4IHMA 3KQZA 4FWUA 3HLPA 4MHPA 2AFOA 2PJBA 4MHZA 1WVMA 2XEFA 2GLJA 1YLOA 1CP6A 2PJ7A 1ZG9A 3JRUA 3PB6X 4PXCA 4ZX8A 4PQAA 3VARA 1AMPA 4NGSA 3PBEA 1VIXA 2CF4A 2F7VA 2PIYA 2JEWA 2ZEFA 4C9VA 2AFZA 2HC9A 1CBXA 3NH4A 4PXBA 2PJ6A 4OC4A 3PEIA 2RFHA 4EMEA 1VHOA 4P45A 2PJ8A 4C8TA 3PBBA 4TWEA 4FBEA 4EFDA 4MCSA 2ZEOA 3CDXA 1LOKA 4KNGE 3GUXA 4ZX9A 3FX6A 4WWVA 3H8EA 3H8FA 3KI9A 3B35A 4C86A 3LWUA 3B3SA 2QJ8A 2GREA 3I74A 3B2YA 2GLFA 2C6CA 1DTDA 4UF4A 1BPMA 2NSMA 3WT4A 1BPNA 2PJ3A 5THWA 3RBUA 3N5FA 1TF8A 3T8WA 1JQGA 2PJ1A 3WC6A 4Z65A 4C9RA 5CBMA 1F2PA 3FJUA 2PRQA 4R8FA 3FVLA 4YU9A 4DJLA 2Q51A 3SJEA 4RUHA 4C84A 5LRGA 1Z5RA 1NSAA 2AFSA 2XEIA 1V6CA 1PYTB 4OMEA 1YSJA 3S9MA 1XF1A 2IQ6A 4G1PA 5LRKA 2BCOA 4C8CA 4FUUA 3ICUA 1LANA 4UEFA 1HDQA 4NGQA 1HDUA 4GM5A 1EE3P 2EK8A 3SJXA 1OBRA 2WYRA 4LQGA 2IJZA 4BD9A 1R43A 4EWTA 1H8LA 4MMOA 4OC3A 1CPSA 1XRYA 5HVHA 3D7FA 4JYWA 1CX8A 3FF3A 5JGFA 3NH8A 4MXUA 2HB6A 1ZLIA 3HUVA 2I3CA 3B7IA 3IWWA 1RTQA 3VH9A 3IEHA 3FH4A 5LYFA 4R7MA 2ANPA 2PE3A 2AFXA 3PB8X 4MCPA 1IGBA 2CTBA 4NFRA 4CPAA 3KHXA 1YMEA 4F9VA 4YN3A 1QQ9A 3KQXA 4ZY1A 4MHYA 2G9DA 4C8FA 3ISZA 2V77A 3KHZA 4P10A 1FT7A 4MCQA 2PJCA 1VHEA 2V8GA 2ZEHA 4OC5A 2OR4A 4WJBA 2JBJA 3GLJA 3KL9A 3VTAA 1XJOA 1PCAA 3FECA 2GP4A 4C8UA 4X2TA 4TNUA 1ZG8A 3D4UA 2RB7A 3PB7X 2PJ0A 2VL1A 3KR4A 1DE4C 2C1CA 1KWMA 3D67A 1Y9ZA 4R6TA 1Z2LA 2PIZA 2ZELA 3IC1A 5CPAA 4P4FA 4OIWA 2ZEMA 4PXEA 3RZAA 3FMCA 2OOTA 4DUKA 2NYQA 5K8PA 4TJVA 1BLLE 5HVGA 5LYIA 2O4HA 3I1UA 2Q4ZA 1VGYA 5K8MA 4ZY0A 2WZNA 4UIAA 2V8VA 3KASA 1AYEA 3PB9X 2ZOGA 4TJXA 4NJRA 1LAPA 2ZENA 6CPAA 2V8DA 3L2NA 1ZLHA 2PJ4A 4ZYQA 1Z8LA 4NGMA 4UIBA 4P4IA 4O23A 4ZI6A 2Q43A 3RAMA 3B3TA 5F09A 3VATA 8CPAA 4P4JA 5LYDA 3BI0A 4P44A 1YW6A 3QNVA 1ELMP 1ELLP 1GYTA 2F8HA 1Y0YA 2IMOA 4PXDA 4C8PA 3MN8A 4OC2A 4H2KA 4NGTA 4P4BA 2J9AA 4C9UA 2ABZA 4AXVA 3MRUA 4X3RA 3LMSA 5D8NA 5JH9A 2JBKA 2ZEGA 4NGRA 4C9AA 4CDKA 3BI1A 4OP4A 4A39A 2V8HA 1TKHA 5I4MA 2AFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HEE A;  4P4D A;  1XMB A;  1TF9 A;  2ZED A;  3TC8 A;  7CPA A;  4UEZ A;  3KR5 A;  4OC1 A;  3GB0 A;  4IK2 A;  4ZY2 A;  4R76 A;  2PVW A;  2BOA A;  4MCR A;  2PCU A;  2PJ9 A;  5K8N A;  2O53 A;  3PFE A;  4C9E A;  1LCP A;  3SI2 A;  2ZOF A;  1LAM A;  4A38 A;  3PB4 X;  4UEE A;  4P6Y A;  3S9N A;  4CDJ A;  5JM6 A;  3WC5 A;  3B3C A;  1LFW A;  5IB9 A;  1TKF A;  2CTC A;  3D7G A;  1UWY A;  4ONW A;  4NGP A;  4F8Z A;  1CG2 A;  3K9T A;  2C6P A;  2GU2 A;  3D68 A;  1CP7 A;  5K8O A;  3V7Z A;  4JZ0 A;  3SJG A;  4OID A;  2ZEE A;  1ARM A;  2QYV A;  2ZEP A;  1IY7 A;  3D66 A;  3DLJ A;  5DS0 A;  3DGV A;  5ELY A;  2PJ5 A;  3CPX A;  2C6G A;  2DEA A;  1BAV A;  1FNO A;  3WC7 A;  3I6S A;  4OKO A;  3PFO A;  3K2K A;  3FEE A;  4C8A A;  3S9L A;  3KZW A;  2PJA A;  3B3V A;  1F57 A;  1M4L A;  3FED A;  5LYL A;  2AFU A;  1TXR A;  3V38 A;  5J1Q A;  3BHX A;  4C85 A;  1YW4 A;  2PVV A;  3CPA A;  3WAB A;  4A94 A;  4DYO A;  4PPZ A;  1XBU A;  3CT9 A;  4X8I A;  5HVF A;  3IFE A;  1QMU A;  3D7D A;  4B6Z A;  4F9U A;  3NA6 A;  5HXD A;  3ISX A;  4C99 A;  1R3N A;  4OC0 A;  5LRJ A;  1XFO A;  4P4E A;  4YWY A;  3H8G A;  1ZG7 A;  4W9Y A;  1Q7L A;  1CPX A;  3B3W A;  1Y7E A;  4Q7A A;  1ARL A;  3SJF A;  4A37 A;  3D7H A;  3EIF A;  2BO9 A;  4NJQ A;  2AFM A;  3IJ3 A;  1TKJ A;  3SI1 A;  3IIB A;  4MHN A;  2CIJ A;  3PRT A;  1Y0R A;  2FVG A;  3NFZ A;  2EK9 A;  2XEG A;  2XEJ A;  2PJ2 A;  2POK A;  4K3N A;  2QVP A;  4NGN A;  3SI0 A;  3KGQ A;  4FAI A;  2EWB A;  5D29 A;  3NH5 A;  3IO1 A;  3BXM A;  4IAV A;  4MRI A;  1F2O A;  4KSI A;  3TX8 A;  4IHM A;  3KQZ A;  4FWU A;  3HLP A;  4MHP A;  2AFO A;  2PJB A;  4MHZ A;  1WVM A;  2XEF A;  2GLJ A;  1YLO A;  1CP6 A;  2PJ7 A;  1ZG9 A;  3JRU A;  3PB6 X;  4PXC A;  4ZX8 A;  4PQA A;  3VAR A;  1AMP A;  4NGS A;  3PBE A;  1VIX A;  2CF4 A;  2F7V A;  2PIY A;  2JEW A;  2ZEF A;  4C9V A;  2AFZ A;  2HC9 A;  1CBX A;  3NH4 A;  4PXB A;  2PJ6 A;  4OC4 A;  3PEI A;  2RFH A;  4EME A;  1VHO A;  4P45 A;  2PJ8 A;  4C8T A;  3PBB A;  4TWE A;  4FBE A;  4EFD A;  4MCS A;  2ZEO A;  3CDX A;  1LOK A;  4KNG E;  3GUX A;  4ZX9 A;  3FX6 A;  4WWV A;  3H8E A;  3H8F A;  3KI9 A;  3B35 A;  4C86 A;  3LWU A;  3B3S A;  2QJ8 A;  2GRE A;  3I74 A;  3B2Y A;  2GLF A;  2C6C A;  1DTD A;  4UF4 A;  1BPM A;  2NSM A;  3WT4 A;  1BPN A;  2PJ3 A;  5THW A;  3RBU A;  3N5F A;  1TF8 A;  3T8W A;  1JQG A;  2PJ1 A;  3WC6 A;  4Z65 A;  4C9R A;  5CBM A;  1F2P A;  3FJU A;  2PRQ A;  4R8F A;  3FVL A;  4YU9 A;  4DJL A;  2Q51 A;  3SJE A;  4RUH A;  4C84 A;  5LRG A;  1Z5R A;  1NSA A;  2AFS A;  2XEI A;  1V6C A;  1PYT B;  4OME A;  1YSJ A;  3S9M A;  1XF1 A;  2IQ6 A;  4G1P A;  5LRK A;  2BCO A;  4C8C A;  4FUU A;  3ICU A;  1LAN A;  4UEF A;  1HDQ A;  4NGQ A;  1HDU A;  4GM5 A;  1EE3 P;  2EK8 A;  3SJX A;  1OBR A;  2WYR A;  4LQG A;  2IJZ A;  4BD9 A;  1R43 A;  4EWT A;  1H8L A;  4MMO A;  4OC3 A;  1CPS A;  1XRY A;  5HVH A;  3D7F A;  4JYW A;  1CX8 A;  3FF3 A;  5JGF A;  3NH8 A;  4MXU A;  2HB6 A;  1ZLI A;  3HUV A;  2I3C A;  3B7I A;  3IWW A;  1RTQ A;  3VH9 A;  3IEH A;  3FH4 A;  5LYF A;  4R7M A;  2ANP A;  2PE3 A;  2AFX A;  3PB8 X;  4MCP A;  1IGB A;  2CTB A;  4NFR A;  4CPA A;  3KHX A;  1YME A;  4F9V A;  4YN3 A;  1QQ9 A;  3KQX A;  4ZY1 A;  4MHY A;  2G9D A;  4C8F A;  3ISZ A;  2V77 A;  3KHZ A;  4P10 A;  1FT7 A;  4MCQ A;  2PJC A;  1VHE A;  2V8G A;  2ZEH A;  4OC5 A;  2OR4 A;  4WJB A;  2JBJ A;  3GLJ A;  3KL9 A;  3VTA A;  1XJO A;  1PCA A;  3FEC A;  4C8U A;  4X2T A;  4TNU A;  1ZG8 A;  3D4U A;  2RB7 A;  3PB7 X;  2PJ0 A;  2VL1 A;  3KR4 A;  1DE4 C;  2C1C A;  1KWM A;  3D67 A;  1Y9Z A;  4R6T A;  1Z2L A;  2PIZ A;  2ZEL A;  3IC1 A;  5CPA A;  4P4F A;  4OIW A;  2ZEM A;  4PXE A;  3RZA A;  3FMC A;  2OOT A;  4DUK A;  2NYQ A;  5K8P A;  4TJV A;  1BLL E;  5HVG A;  5LYI A;  2O4H A;  3I1U A;  2Q4Z A;  1VGY A;  5K8M A;  4ZY0 A;  2WZN A;  4UIA A;  2V8V A;  3KAS A;  1AYE A;  3PB9 X;  2ZOG A;  4TJX A;  4NJR A;  1LAP A;  2ZEN A;  6CPA A;  2V8D A;  3L2N A;  1ZLH A;  2PJ4 A;  4ZYQ A;  1Z8L A;  4NGM A;  4UIB A;  4P4I A;  4O23 A;  4ZI6 A;  2Q43 A;  3RAM A;  3B3T A;  5F09 A;  3VAT A;  8CPA A;  4P4J A;  5LYD A;  3BI0 A;  4P44 A;  1YW6 A;  3QNV A;  1ELM P;  1ELL P;  1GYT A;  2F8H A;  1Y0Y A;  2IMO A;  4PXD A;  4C8P A;  3MN8 A;  4OC2 A;  4H2K A;  4NGT A;  4P4B A;  2J9A A;  4C9U A;  2ABZ A;  4AXV A;  3MRU A;  4X3R A;  3LMS A;  5D8N A;  5JH9 A;  2JBK A;  2ZEG A;  4NGR A;  4C9A A;  4CDK A;  3BI1 A;  4OP4 A;  4A39 A;  2V8H A;  1TKH A;  5I4M A;  2AFW A; 
#chains in the Genus database with same CATH topology
 4K30 A;  3R9G A;  4AG7 A;  1HEE A;  4YFJ A;  4R9M A;  3QB8 A;  2HI6 A;  3G8W A;  3TLZ A;  3FNC A;  4MI4 A;  5JVL A;  4P4D A;  2CNT A;  4AVB A;  3H4Q A;  1J4J A;  1QSM A;  1XMB A;  1TF9 A;  2ZED A;  3TC8 A;  7CPA A;  1J3L A;  3EY5 A;  4UEZ A;  3IWG A;  3KR5 A;  5GCN A;  4OC1 A;  4C2Z A;  3R95 A;  1Z9E A;  3GB0 A;  4IK2 A;  4ZY2 A;  4CAV A;  3F0A A;  4R76 A;  2EZB A;  2YJT A;  2Z3M A;  2D0O A;  2PVW A;  5JQ4 A;  1CM0 A;  2BOA A;  2FXF A;  4MCR A;  2PCU A;  1EO0 A;  1MJ9 A;  3OB1 B;  2O53 A;  2PJ9 A;  4R3K A;  4A2Z A;  1MK4 A;  2PSW A;  3CXP A;  3GJZ A;  1M4I A;  3PFE A;  4C9E A;  3PZJ A;  4PSX A;  2P6G A;  1LCP A;  4KOU A;  2GFQ A;  3SI2 A;  2ZOF A;  1LAM A;  2ZW5 A;  3A9L A;  3PB4 X;  4P6Y A;  4UEE A;  4XPK A;  3S9N A;  4A38 A;  1JDE A;  4CDJ A;  5JM6 A;  3TLG A;  3FBU A;  3TTH A;  3B3C A;  3WC5 A;  3PFV A;  3S6K A;  2VEZ A;  1LFW A;  2J8R A;  2VXK A;  5IB9 A;  1VI4 A;  1TKF A;  2CTC A;  4COB A;  3D7G A;  1XF8 A;  3TOA A;  5E96 A;  1UWY A;  4IUS A;  2EZA A;  3PP9 A;  2GE3 A;  2Q04 A;  1IID A;  4ONW A;  4NGP A;  3U1B A;  4F8Z A;  5G21 A;  5G1Z A;  1CG2 A;  2PCN A;  3K9T A;  2JDC A;  2F5I A;  2C6P A;  2GU2 A;  3D68 A;  2XPP A;  1CP7 A;  4H6Z A;  5F46 A;  3C8O A;  5K8O A;  5AXI A;  2ZW7 A;  3V7Z A;  1QSO A;  4JZ0 A;  4JVO A;  3SJG A;  4OID A;  4BIN A;  2ZEE A;  4XPD C;  2G0B A;  3O8Z A;  1ARM A;  2QYV A;  2ZEP A;  3DR6 A;  1IY7 A;  3D66 A;  3DLJ A;  5DS0 A;  3DGV A;  5ELY A;  3HMJ G;  4MI1 A;  2PJ5 A;  3CPX A;  2C6G A;  2Z10 A;  4FD7 A;  2DEA A;  4A30 A;  4CYO A;  1BAV A;  1FNO A;  4UFW A;  3WC7 A;  1C30 B;  4IIX A;  2J8M A;  4H89 A;  3I6S A;  5F49 A;  3HPG G;  1VKC A;  2BSW A;  4OKO A;  1YK3 A;  3PFO A;  3K2K A;  3RNZ A;  3FEE A;  4KVX A;  5AG5 A;  4C8A A;  3S9L A;  2FL4 A;  1WWZ A;  3KZW A;  1M4D A;  4UCN A;  5JYB A;  1PUA A;  2PJA A;  3OAK A;  3B3V A;  3FB3 A;  4MFJ A;  4CGL A;  4E0A A;  4II9 A;  1F57 A;  1M4L A;  3FED A;  2JEV A;  1Q5X A;  3EZE A;  4AG9 A;  4KOR A;  4RN7 A;  2Z3P A;  4U9Y A;  5LYL A;  2AFU A;  3R96 A;  1P4N A;  1TXR A;  3KKW A;  4GS4 A;  1OZP A;  5F13 A;  5J3X A;  1MJB A;  4KOW A;  3GYA A;  3V38 A;  5J1Q A;  3BHX A;  1S7L A;  1A2Z A;  2AUN A;  2C5Q A;  4C85 A;  1YGH A;  1YW4 A;  4KS9 A;  2PVV A;  4HNW B;  4MFL A;  5K8N A;  1Q2D A;  3CPA A;  3WAB A;  2AUM A;  4A94 A;  5FVJ A;  4DYO A;  4PPZ A;  1XBU A;  5I0C A;  1Z9U A;  3CT9 A;  4X8I A;  5HVF A;  1XE4 A;  4HKF A;  3VRO A;  3IFE A;  1QMU A;  4L8A A;  3D7D A;  4NEX A;  4B6Z A;  3NA6 A;  4F9U A;  3ISX A;  5HXD A;  1NXJ A;  4C99 A;  1IYK A;  2B4B A;  3EZA A;  3V8I A;  1R3N A;  1BOB A;  4CAW A;  4OAE A;  1KUX A;  2REE A;  4BBH A;  3CXQ A;  4KUA A;  1M1D A;  1Z8X A;  3JTK A;  4OC0 A;  3T05 A;  3IWE A;  3CZX A;  5LRJ A;  1XFO A;  2ARH A;  4P4E A;  3W6S A;  1YLE A;  4YWY A;  4KOV A;  2DXQ A;  3H8G A;  3WR7 A;  1I12 A;  1I1D A;  4W9Y A;  1ZG7 A;  1Q7L A;  1CPX A;  4MJ8 A;  2Q0Y A;  5DWM A;  1EZA A;  3B3W A;  1Y7E A;  5IR2 A;  5F48 A;  4Q7A A;  1ARL A;  2C27 A;  2HWG A;  3SJF A;  2CNM A;  3T9Y A;  4KLV A;  4A37 A;  3D7H A;  4BTF A;  2WPX A;  4AVC A;  4JD6 A;  2BO9 A;  3EIF A;  4NJQ A;  3SR3 A;  2REF A;  2AFM A;  3IJ3 A;  2QML A;  4BPX B;  1TKJ A;  4GXH A;  3SI1 A;  3SXO A;  3IIB A;  1Z8W A;  1ON0 A;  4MHN A;  4PSW A;  2B0A A;  4XNH C;  4CS0 B;  2CIJ A;  2R7H A;  1Y0R A;  3DDD A;  3PRT A;  4KOX A;  2FVG A;  4JLY A;  3NFZ A;  1Y9K A;  2EK9 A;  2XEG A;  3TO6 A;  2PR1 A;  2XEJ A;  2PJ2 A;  3I9S A;  2POK A;  3P2F A;  4K3N A;  2XPO A;  5F5X A;  2VQY A;  2QVP A;  4MFP A;  2AJ6 A;  4NGN A;  2GAN A;  4C7H A;  1M44 A;  1Q2C A;  1U6M A;  3SI0 A;  2WSA A;  1WK4 A;  3KGQ A;  4FAI A;  1UFH A;  2EWB A;  2FT0 A;  4PK2 A;  3NFQ A;  5D29 A;  3IO1 A;  3NH5 A;  4EVY A;  3BXM A;  4IAV A;  4CAX A;  4MRI A;  1F2O A;  3VWD A;  5EBV A;  3D3S A;  1S7F A;  2ZXV A;  4KSI A;  1V0C A;  4M6G A;  3R1K A;  3TX8 A;  4C2X A;  4IHM A;  3VRQ A;  1N71 A;  2YNC A;  3KQZ A;  4FWU A;  3HLP A;  4M85 A;  3NE7 A;  4MHP A;  2AFO A;  2PJB A;  4HNY B;  1M6V B;  2R8V A;  4MHZ A;  1WVM A;  2XEF A;  3S6F A;  3TFY A;  1P0H A;  2R1I A;  2GLJ A;  1YLO A;  4GPL B;  1CP6 A;  5DWN A;  4B14 A;  2BEI A;  2PJ7 A;  2EBJ A;  1ZG9 A;  3JRU A;  2P6F A;  3PB6 X;  1NE9 A;  2B4D A;  3S6H A;  4RI1 A;  2GIV A;  4PXC A;  4X5K A;  4ZX8 A;  4PQA A;  3VAR A;  5ISV A;  1AMP A;  5KTA A;  1Z8T A;  4NGS A;  2CNS A;  1ZL0 A;  4FD5 A;  3PBE A;  1B6B A;  1VIX A;  3R9E A;  3W91 A;  2CF4 A;  2F7V A;  2XPN A;  4M8D A;  4F0X A;  4U5Y A;  5F9M A;  2PIY A;  2Z3K A;  5A28 A;  1CJW A;  1RXT A;  2ODF A;  4B5P A;  2JEW A;  2ZEF A;  1NSL A;  5EC4 A;  1QSR A;  2YGW A;  3S6G A;  2MP0 A;  2ZPA A;  5H84 A;  4QVT A;  2AFZ A;  4C9V A;  3B8G A;  1Z4E A;  1XEB A;  2CBL A;  4KZT A;  1CE8 B;  4H1H A;  2HC9 A;  4R87 A;  1S7K A;  1CBX A;  1KUY A;  2RC4 A;  3NH4 A;  1X12 A;  4PXB A;  4A32 A;  2PJ6 A;  3TYX A;  4OC4 A;  1IB1 E;  2QIR A;  2RFH A;  3FIX A;  3PEI A;  4JWP A;  1VHO A;  5AGE A;  4EME A;  5J8C A;  4P45 A;  3EO4 A;  3ZZI A;  2PJ8 A;  4UWJ A;  4C8T A;  1KZF A;  4CAE A;  3PBB A;  4M3S A;  3K4I A;  3NOJ A;  4Y49 B;  1B47 A;  4AB7 A;  4CGM A;  4TWE A;  4FBE A;  4EFD A;  3G23 A;  2Y1N A;  1QST A;  4MCS A;  2ZEO A;  3CDX A;  1LOK A;  3MGD A;  4KNG E;  3GUX A;  5IX3 A;  4J3G A;  3C26 A;  4ZX9 A;  1C3O B;  3FX6 A;  4B11 A;  4WWV A;  3E0K A;  3DR8 A;  2O28 A;  2B58 A;  4YRH A;  3H8E A;  1YVK A;  4CYN A;  1QSN A;  3H8F A;  3KI9 A;  3B35 A;  2YJV A;  4C86 A;  3LWU A;  3B3S A;  2QJ8 A;  3TT2 A;  2I00 A;  2GRE A;  2PR8 A;  3I74 A;  2Z3L A;  5J8F A;  2D4P A;  2Z11 A;  3B2Y A;  2GLF A;  2C6C A;  1DTD A;  2IL4 A;  2WPW A;  1IOI A;  4KSA A;  4MFK A;  4QBJ A;  3BUM B;  1BPM A;  2NSM A;  3F5B A;  4UF4 A;  1VHS A;  5G20 A;  2X0S A;  2Y0M A;  3WT4 A;  4I49 A;  1BPN A;  2PJ3 A;  5THW A;  3RBU A;  1IYL A;  1S7N A;  3RYO A;  3N5F A;  1TF8 A;  3T8W A;  1JQG A;  2EO8 A;  2J8N A;  2PJ1 A;  4KOY A;  3WC6 A;  4BMH A;  2HRO A;  2B4D B;  2B4J C;  2A4N A;  4LX9 A;  4OAD A;  4Z65 A;  4C9R A;  1NMT A;  4BPW B;  3F8K A;  5CBM A;  4HPS A;  1F2P A;  3EZB A;  4A33 A;  3FJU A;  2VBQ A;  3UY5 A;  2PRQ A;  1X10 A;  2OZU A;  4J0N A;  4H6U A;  2Q4Y A;  4R8F A;  3T07 A;  3FVL A;  4YU9 A;  2OH1 A;  4E8O A;  4DJL A;  4CAF A;  2Q51 A;  3SJE A;  4RUH A;  1KC7 A;  4C84 A;  4B5P B;  5LRG A;  4HNX B;  5HKY A;  1Z5R A;  4UBR A;  4UFV A;  1NSA A;  2AFS A;  1SQH A;  2XEI A;  1CS0 B;  3LOD A;  3VWE A;  1V6C A;  1PYT B;  4NSQ A;  5AG4 A;  2YNC C;  4OME A;  1YSJ A;  3IU1 A;  5HKZ A;  3S9M A;  3LAC A;  2IQ6 A;  1XF1 A;  4G1P A;  5LRK A;  4COG A;  1AUG A;  2ATR A;  2FIA A;  3OWC A;  1VBG A;  2BCO A;  2X7B A;  4C8C A;  5KTC A;  4FUU A;  4UA3 A;  3ICU A;  1LAN A;  4UEF A;  1HDQ A;  1R57 A;  4FD6 A;  2JDD A;  2DPT A;  4KOT A;  4NGQ A;  1HDU A;  4GM5 A;  3RO0 A;  1EE3 P;  2H5M A;  3TO7 A;  4E5S A;  3BUW B;  2EK8 A;  3QAH A;  3SJX A;  1M4G A;  1OBR A;  2WYR A;  3CXS A;  4LQG A;  4KUB A;  2IJZ A;  4BD9 A;  3EFA A;  1A9X B;  1R43 A;  2VZY A;  3EC4 A;  4L89 A;  4EWT A;  3BUX B;  5K99 A;  1H8L A;  3LD2 A;  4F0Y A;  5HKW A;  4MMO A;  3ZNI A;  4OC3 A;  1CPS A;  4KOS A;  1XRY A;  2NMT A;  3N7Z A;  4UWI A;  5A27 A;  5HVH A;  3D7F A;  4JYW A;  1CX8 A;  3FF3 A;  3VGO A;  5JGF A;  3FRM A;  3GY9 A;  3NH8 A;  4MXU A;  2BUE A;  4R57 A;  4PV6 A;  4NCZ A;  1ZYM A;  2HB6 A;  3TOB A;  2AE6 A;  3PT1 A;  1ZLI A;  2G3A A;  3G3S A;  3HUV A;  4CRY B;  2OZG A;  3D8P A;  1FY7 A;  2I3C A;  2Q44 A;  3FYN A;  3OP0 A;  1YQE A;  3B7I A;  4UCM A;  3IWW A;  2XPL A;  4M6H A;  4A31 A;  4CYP A;  2N3A B;  3VRR A;  1RTQ A;  3IEH A;  3GIU A;  3VH9 A;  4B10 A;  1I21 A;  3FH4 A;  5LYF A;  3PLF B;  1GGO A;  1JWQ A;  2Q7S A;  2WUU A;  4NF1 A;  4IIY A;  4KLW A;  3TCV A;  2R98 A;  4R7M A;  1ZO0 A;  4ZGY B;  2DIK A;  3BLN A;  4QUS A;  2ANP A;  2HQY A;  3TO9 A;  2UV8 G;  2PE3 A;  4UFX A;  1EZB A;  2AFX A;  3PB8 X;  3DSB A;  4CGP A;  5IV0 A;  4MCP A;  4LUA A;  1IGB A;  1KEE B;  2CTB A;  1XIX A;  4ZBG A;  3T90 A;  2DLA A;  4NFR A;  4CPA A;  3KHX A;  4Q38 A;  3TE4 A;  1YME A;  1BO4 A;  4F9V A;  4YN3 A;  4A95 A;  3KRV A;  4PK3 A;  4A4B A;  1QQ9 A;  2FE7 A;  3KQX A;  4MBU A;  4ZY1 A;  3T0T A;  3QAY A;  4MFZ A;  4CYQ A;  3JUW A;  4MHY A;  4QB9 A;  2G9D A;  4UCP A;  4C8F A;  3ISZ A;  2V77 A;  3KHZ A;  4P10 A;  1FT7 A;  4MCQ A;  2PJC A;  3T5M A;  4XPD B;  1VHE A;  2V8G A;  4JXR A;  5AG7 A;  3VRP A;  2DPS A;  2ZEH A;  4OC5 A;  4JXQ A;  4R3L A;  2OR4 A;  3D2P A;  4WJB A;  2FIW A;  2JBJ A;  3GLJ A;  3KL9 A;  5HMN A;  1YRE A;  3VTA A;  1XJO A;  1PCA A;  1KUV A;  3FEC A;  3IGR A;  2GP4 A;  1R61 A;  5BWA B;  4KSF A;  4C8U A;  3HPH E;  1Y9W A;  4X2T A;  4TNU A;  3EXN A;  1ZG8 A;  1T36 B;  4MY0 A;  2ZW6 A;  4YGO A;  3SHP A;  3D4U A;  3H5Z A;  4U9Z A;  4CGN A;  5JPH A;  2RB7 A;  4EYS A;  1MJA A;  3PB7 X;  3BJ8 A;  2PJ0 A;  2VL1 A;  2VZZ A;  3KR4 A;  4ORF A;  1DE4 C;  2P6E A;  5F1Y A;  4B5O A;  3FXT A;  2C1C A;  4JJX A;  3TLA A;  2I79 A;  3TLC A;  1KWM A;  1TIQ A;  2P0W A;  4IF5 A;  3D67 A;  2Q7B A;  1Y9Z A;  2EVN A;  4R6T A;  1Z2L A;  2Y1M A;  2PIZ A;  2ZEL A;  3IC1 A;  5CPA A;  4CRZ B;  2FCK A;  2D4O A;  2Z0Z A;  1Z4R A;  2YND A;  4P4F A;  3BJ7 A;  4CO9 A;  4BPU B;  1IOF A;  2CXA A;  4OIW A;  2ZEM A;  1IIC A;  4B13 A;  2OB0 A;  3U88 C;  1B87 A;  4PXE A;  3RZA A;  2B5G B;  2OOT A;  3FMC A;  1LRZ A;  2NYQ A;  4QC6 A;  3SXN A;  4DUK A;  5K8P A;  4TJV A;  1BLL E;  1XMT A;  4DNC A;  4CGO A;  5HVG A;  5LYI A;  4C7I A;  4F6A A;  1VBH A;  2O4H A;  3I1U A;  1JDB C;  4MFQ A;  1KBL A;  2Q4Z A;  4M6I A;  4MY3 A;  4LQ6 A;  4E2A A;  1YVO A;  1VGY A;  4NXY A;  4Y49 C;  4RR2 B;  2B3V A;  4MHD A;  1L0C A;  3JVN A;  3BUO B;  2Z3O A;  4ZY0 A;  5K8M A;  2WZN A;  4UIA A;  4MJX A;  2V8V A;  1Q2Y A;  4KVO E;  2HV2 A;  3GKR A;  1BXR B;  3TLY A;  2QEC A;  4ONU A;  5AG6 A;  2EZC A;  3KAS A;  1AYE A;  4XPL A;  3PB9 X;  3R9F A;  2ZOG A;  1RO5 A;  2B3U A;  2BL1 A;  4NJR A;  4TJX A;  5G22 A;  2YNE A;  1LAP A;  1S3Z A;  2ZEN A;  4A4C A;  6CPA A;  2V8D A;  1XOV A;  2ZW4 A;  3L2N A;  1ZLH A;  4OLL A;  3W6X A;  2K5T A;  2D0P A;  5EMI A;  1S60 A;  2PJ4 A;  4ZYQ A;  1ZRS A;  1Z8L A;  5FD8 A;  4NGM A;  4UIB A;  5CNP A;  1YVH A;  2OU2 A;  2FM4 A;  4P4I A;  4O23 A;  4ZI6 A;  2Q43 A;  4C2Y A;  3RAM A;  5H86 A;  3B3T A;  4INJ A;  5F09 A;  3VAT A;  4XNH B;  2PC1 A;  1FBV A;  3TLG B;  8CPA A;  2JLM A;  2CY2 A;  4P4J A;  2PRB A;  2KCW A;  4RS2 A;  5HH1 A;  5IB0 A;  5LYD A;  3NE8 A;  1S5K A;  1PU9 A;  3BI0 A;  4P44 A;  1YW6 A;  2FS5 A;  5C88 A;  3BUN B;  3QNV A;  1ELM P;  1ELL P;  1GYT A;  3IU2 A;  3TLB A;  2F8H A;  1Y0Y A;  2IMO A;  4PXD A;  1Y7R A;  4C8P A;  3K9U A;  2EUI A;  3MN8 A;  4B12 A;  2Q4V A;  4OC2 A;  4H2K A;  2E28 A;  4NGT A;  2VI7 A;  1WJT A;  1K4J A;  4P4B A;  2PQ8 A;  1GHE A;  4AVA A;  3PGP A;  3TLE A;  2J9A A;  2VKZ G;  4FD4 A;  1YR0 A;  1YX0 A;  3ZJ0 A;  5KTD A;  2HUZ A;  4CZ1 A;  4C9U A;  2ABZ A;  4AXV A;  3MRU A;  1NBW A;  3OB2 B;  4C68 A;  2R82 A;  1DIK A;  3P2H A;  4X3R A;  3LMS A;  5D8N A;  5BY0 A;  2JBK A;  2G3T A;  5JH9 A;  4E94 A;  2ZEG A;  3F9K C;  4NGR A;  4KVM E;  3I3G A;  2OZH A;  3VRN A;  4C9A A;  2DF5 A;  2OLS A;  3DNS A;  2FSR A;  1IU8 A;  5C82 A;  4CDK A;  2B5G A;  3BI1 A;  4OP4 A;  4Q36 A;  3D2M A;  2Z3N A;  4A39 A;  2PDO A;  2V8H A;  1TKH A;  5I4M A;  2AFW A;  5F47 A; 
#chains in the Genus database with same CATH homology
 1HEE A;  4P4D A;  1XMB A;  1TF9 A;  2ZED A;  3TC8 A;  7CPA A;  4UEZ A;  3KR5 A;  4OC1 A;  3GB0 A;  4IK2 A;  4ZY2 A;  4R76 A;  2PVW A;  2BOA A;  4MCR A;  2PCU A;  2PJ9 A;  5K8N A;  2O53 A;  3PFE A;  4C9E A;  1LCP A;  3SI2 A;  2ZOF A;  1LAM A;  4A38 A;  3PB4 X;  4UEE A;  4P6Y A;  3S9N A;  4CDJ A;  5JM6 A;  3WC5 A;  3B3C A;  1LFW A;  5IB9 A;  1TKF A;  2CTC A;  3D7G A;  1UWY A;  4ONW A;  4NGP A;  4F8Z A;  1CG2 A;  3K9T A;  2C6P A;  2GU2 A;  3D68 A;  1CP7 A;  5K8O A;  3V7Z A;  4JZ0 A;  3SJG A;  4OID A;  2ZEE A;  1ARM A;  2QYV A;  2ZEP A;  1IY7 A;  3D66 A;  3DLJ A;  5DS0 A;  3DGV A;  5ELY A;  2PJ5 A;  3CPX A;  2C6G A;  2DEA A;  1BAV A;  1FNO A;  3WC7 A;  3I6S A;  4OKO A;  3PFO A;  3K2K A;  3FEE A;  4C8A A;  3S9L A;  3KZW A;  2PJA A;  3B3V A;  1F57 A;  1M4L A;  3FED A;  5LYL A;  2AFU A;  1TXR A;  2C5Q A;  3V38 A;  5J1Q A;  3BHX A;  4C85 A;  1YW4 A;  2PVV A;  3CPA A;  3WAB A;  4A94 A;  4DYO A;  4PPZ A;  1XBU A;  3CT9 A;  4X8I A;  5HVF A;  3IFE A;  1QMU A;  3D7D A;  4B6Z A;  4F9U A;  3NA6 A;  5HXD A;  3ISX A;  4C99 A;  1R3N A;  4OC0 A;  5LRJ A;  1XFO A;  4P4E A;  4YWY A;  3H8G A;  1ZG7 A;  4W9Y A;  1Q7L A;  1CPX A;  3B3W A;  1Y7E A;  5IR2 A;  4Q7A A;  1ARL A;  3SJF A;  4A37 A;  3D7H A;  3EIF A;  2BO9 A;  4NJQ A;  2AFM A;  3IJ3 A;  1TKJ A;  3SI1 A;  3IIB A;  4MHN A;  2CIJ A;  3PRT A;  1Y0R A;  2FVG A;  3NFZ A;  2EK9 A;  2XEG A;  2XEJ A;  2PJ2 A;  2POK A;  4K3N A;  2QVP A;  4NGN A;  3SI0 A;  3KGQ A;  4FAI A;  2EWB A;  5D29 A;  3NH5 A;  3IO1 A;  3BXM A;  4IAV A;  4MRI A;  1F2O A;  4KSI A;  3TX8 A;  4IHM A;  3KQZ A;  4FWU A;  3HLP A;  4MHP A;  2AFO A;  2PJB A;  4MHZ A;  1WVM A;  2XEF A;  2GLJ A;  1YLO A;  1CP6 A;  2PJ7 A;  1ZG9 A;  3JRU A;  3PB6 X;  4PXC A;  4ZX8 A;  4PQA A;  3VAR A;  1AMP A;  4NGS A;  3PBE A;  1VIX A;  2CF4 A;  2F7V A;  2PIY A;  2JEW A;  2ZEF A;  4C9V A;  2AFZ A;  2HC9 A;  1CBX A;  3NH4 A;  4PXB A;  2PJ6 A;  4OC4 A;  3PEI A;  2RFH A;  4EME A;  1VHO A;  4P45 A;  2PJ8 A;  4C8T A;  3PBB A;  4TWE A;  4FBE A;  4EFD A;  4MCS A;  2ZEO A;  3CDX A;  1LOK A;  4KNG E;  3GUX A;  4ZX9 A;  3FX6 A;  4WWV A;  3H8E A;  3H8F A;  3KI9 A;  3B35 A;  4C86 A;  3LWU A;  3B3S A;  2QJ8 A;  2GRE A;  3I74 A;  3B2Y A;  2GLF A;  2C6C A;  1DTD A;  4UF4 A;  1BPM A;  2NSM A;  3WT4 A;  1BPN A;  2PJ3 A;  5THW A;  3RBU A;  3N5F A;  1TF8 A;  3T8W A;  1JQG A;  2PJ1 A;  3WC6 A;  4Z65 A;  4C9R A;  5CBM A;  1F2P A;  3FJU A;  2PRQ A;  4R8F A;  3FVL A;  4YU9 A;  4DJL A;  2Q51 A;  3SJE A;  4RUH A;  4C84 A;  5LRG A;  1Z5R A;  1NSA A;  2AFS A;  2XEI A;  1V6C A;  1PYT B;  4OME A;  1YSJ A;  3S9M A;  1XF1 A;  2IQ6 A;  4G1P A;  5LRK A;  2BCO A;  4C8C A;  4FUU A;  3ICU A;  1LAN A;  4UEF A;  1HDQ A;  4NGQ A;  1HDU A;  4GM5 A;  1EE3 P;  2EK8 A;  3SJX A;  1OBR A;  2WYR A;  4LQG A;  2IJZ A;  4BD9 A;  1R43 A;  4EWT A;  1H8L A;  4MMO A;  4OC3 A;  1CPS A;  1XRY A;  5HVH A;  3D7F A;  4JYW A;  1CX8 A;  3FF3 A;  5JGF A;  3NH8 A;  4MXU A;  2HB6 A;  1ZLI A;  3HUV A;  2I3C A;  3B7I A;  3IWW A;  1RTQ A;  3VH9 A;  3IEH A;  3FH4 A;  5LYF A;  4R7M A;  2ANP A;  2PE3 A;  2AFX A;  3PB8 X;  4MCP A;  1IGB A;  2CTB A;  4NFR A;  4CPA A;  3KHX A;  1YME A;  4F9V A;  4YN3 A;  1QQ9 A;  3KQX A;  4ZY1 A;  4MHY A;  2G9D A;  4C8F A;  3ISZ A;  2V77 A;  3KHZ A;  4P10 A;  1FT7 A;  4MCQ A;  2PJC A;  1VHE A;  2V8G A;  2ZEH A;  4OC5 A;  2OR4 A;  4WJB A;  2JBJ A;  3GLJ A;  3KL9 A;  3VTA A;  1XJO A;  1PCA A;  3FEC A;  2GP4 A;  4C8U A;  4X2T A;  4TNU A;  1ZG8 A;  3D4U A;  2RB7 A;  3PB7 X;  2PJ0 A;  2VL1 A;  3KR4 A;  1DE4 C;  2C1C A;  1KWM A;  3D67 A;  1Y9Z A;  4R6T A;  1Z2L A;  2PIZ A;  2ZEL A;  3IC1 A;  5CPA A;  4P4F A;  4OIW A;  2ZEM A;  4PXE A;  3RZA A;  3FMC A;  2OOT A;  4DUK A;  2NYQ A;  5K8P A;  4TJV A;  1BLL E;  5HVG A;  5LYI A;  2O4H A;  3I1U A;  2Q4Z A;  1VGY A;  5K8M A;  4ZY0 A;  2WZN A;  4UIA A;  2V8V A;  3KAS A;  1AYE A;  3PB9 X;  2ZOG A;  4TJX A;  4NJR A;  1LAP A;  2ZEN A;  6CPA A;  2V8D A;  3L2N A;  1ZLH A;  2PJ4 A;  4ZYQ A;  1Z8L A;  4NGM A;  4UIB A;  4P4I A;  4O23 A;  4ZI6 A;  2Q43 A;  3RAM A;  3B3T A;  5F09 A;  3VAT A;  8CPA A;  4P4J A;  5LYD A;  3BI0 A;  4P44 A;  1YW6 A;  3QNV A;  1ELM P;  1ELL P;  1GYT A;  2F8H A;  1Y0Y A;  2IMO A;  4PXD A;  4C8P A;  3MN8 A;  4OC2 A;  4H2K A;  4NGT A;  4P4B A;  2J9A A;  4C9U A;  2ABZ A;  4AXV A;  3MRU A;  4X3R A;  3LMS A;  5D8N A;  5JH9 A;  2JBK A;  2ZEG A;  4NGR A;  4C9A A;  4CDK A;  3BI1 A;  4OP4 A;  4A39 A;  2V8H A;  1TKH A;  5I4M A;  2AFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...