4P4FA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor nc-2-40
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 262
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4fA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4fA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4fA02
4OP4A 2ZEPA 4A94A 1XF1A 1JQGA 8CPAA 4C8TA 2I3CA 4NGPA 4YWYA 4UEFA 3D7GA 2PRQA 3B3CA 4JYWA 4OMEA 2EK9A 3DLJA 4NGTA 1CP6A 2WYRA 3KI9A 3IJ3A 1ARLA 3PEIA 3CPAA 4CDJA 4RUHA 3T8WA 1BAVA 1ELMP 3D4UA 1Z2LA 3SJXA 2QJ8A 3B7IA 3V7ZA 3D68A 1TKFA 3FF3A 5JH9A 4IHMA 1ZG9A 2GLFA 4A39A 4C86A 3BI0A 3PB4X 5HVGA 3PB6X 1TXRA 3SI0A 1PCAA 3PBEA 1YSJA 2PJ0A 2WZNA 1LFWA 2XEJA 3CPXA 3H8EA 1TF9A 2AFMA 3HLPA 2PJ2A 4MXUA 1V6CA 3IFEA 3WC5A 4C9EA 3I6SA 1LOKA 3D66A 4DJLA 2AFOA 4WWVA 4C9AA 3KGQA 3D67A 3PBBA 4MHYA 3S9NA 2V8HA 1R43A 4MMOA 4FBEA 4F9VA 4X2TA 1AMPA 1BLLE 3PRTA 3TC8A 1XRYA 5LYLA 5D29A 3SJEA 4CPAA 4MCPA 4IAVA 2PJ1A 4C8CA 2ZOGA 4P10A 3VTAA 3IC1A 4C85A 4P6YA 4C8AA 1HDUA 2CIJA 2ZOFA 2BO9A 3WT4A 4JZ0A 4KSIA 4IK2A 3GLJA 1WVMA 4UEEA 1VHEA 7CPAA 1Z8LA 1CP7A 3BI1A 4O23A 3B3WA 4UF4A 1PYTB 5LRKA 3N5FA 4B6ZA 1XFOA 2IMOA 3VATA 4EWTA 3SI1A 4F8ZA 4OC5A 2AFZA 4OIDA 3WABA 3RZAA 3IWWA 1ZLIA 2ZENA 2RFHA 3GB0A 1R3NA 1NSAA 2PJ8A 2EK8A 5ELYA 1XMBA 4UIAA 5JGFA 4X8IA 4TJXA 4PXEA 3KL9A 1IY7A 2QYVA 1Y7EA 3D7HA 4PXDA 3PB7X 1UWYA 4OC1A 1VGYA 4NJQA 1VIXA 2BCOA 3WC6A 3S9MA 3MRUA 5THWA 3LWUA 1CBXA 2CF4A 4LQGA 2XEIA 2OR4A 4ONWA 3CT9A 1DTDA 4P4FA 3S9LA 3SJFA 1KWMA 3DGVA 4NGSA 4P45A 4C8PA 2O53A 4ZX8A 4PXCA 4P4DA 4AXVA 2ZEDA 3BXMA 1CX8A 2DEAA 4KNGE 2PJ3A 3D7DA 2ZEGA 2GREA 3PFOA 2JEWA 1BPMA 2ZEMA 4NGQA 3B2YA 3ISZA 3NH4A 2BOAA 3FJUA 3PB8X 4A38A 4C9UA 1QMUA 1CG2A 5K8NA 4ZX9A 4P44A 4DUKA 4ZY0A 1TF8A 2AFWA 3K2KA 4WJBA 5LYIA 5DS0A 4PPZA 1YW6A 5D8NA 1ELLP 1HDQA 4OC0A 1XBUA 2V8DA 4R7MA 4OC4A 3SI2A 5HXDA 1LAPA 4ZI6A 2C1CA 2PJ7A 1HEEA 1H8LA 3KHXA 4TNUA 3TX8A 1BPNA 4Z65A 4C84A 1QQ9A 4G1PA 3L2NA 2PIZA 2ZEFA 1ZLHA 4MCRA 2O4HA 4ZYQA 2Q4ZA 2OOTA 1Y9ZA 5K8MA 4R6TA 4F9UA 3IO1A 2C6CA 2Q43A 2V8GA 4ZY1A 3B3TA 3LMSA 4EFDA 2NSMA 1YLOA 2JBKA 4FWUA 4K3NA 4ZY2A 3I74A 4NJRA 1OBRA 4Q7AA 2VL1A 4P4IA 2GU2A 3H8FA 4P4EA 2Q51A 2F7VA 4C8UA 3IEHA 3CDXA 3KR4A 4YN3A 4H2KA 2NYQA 4NGMA 3I1UA 1RTQA 1CPXA 3FEDA 1GYTA 3B35A 1XJOA 3SJGA 5CPAA 1EE3P 1F57A 3NFZA 3MN8A 4OKOA 4P4JA 3FEEA 5F09A 2PIYA 5I4MA 4C99A 4R8FA 5LYDA 3KZWA 1ZG7A 3V38A 2PVWA 3FX6A 3NA6A 3B3SA 2EWBA 3ISXA 4MRIA 4MCSA 4CDKA 1TKHA 1LAMA 3KASA 2ABZA 2G9DA 2PJAA 3QNVA 2V77A 3HUVA 4PQAA 2V8VA 3KHZA 2ZELA 3KQZA 4A37A 5JM6A 1DE4C 3NH5A 2PJBA 4W9YA 2C6GA 2J9AA 1F2OA 2PJ9A 1LCPA 4DYOA 1YMEA 4NFRA 3WC7A 4P4BA 2JBJA 2F8HA 4OC2A 2PJ6A 4X3RA 4MHZA 5J1QA 1TKJA 1Z5RA 3FH4A 3H8GA 3RAMA 3EIFA 3PFEA 3BHXA 2FVGA 2QVPA 4NGNA 3D7FA 4MCQA 3PB9X 2PJCA 6CPAA 2C6PA 2HB6A 3IIBA 3FMCA 1Q7LA 4MHPA 4FAIA 1AYEA 1Y0YA 2POKA 4MHNA 2IJZA 2PCUA 3KR5A 2GLJA 2PE3A 4C9RA 2ANPA 3B3VA 4TJVA 3VH9A 4C9VA 1Y0RA 4PXBA 2AFSA 4OC3A 1LANA 2IQ6A 4UIBA 5HVFA 2CTCA 4BD9A 4YU9A 3KQXA 3FECA 1CPSA 1VHOA 2PJ5A 5CBMA 2ZEEA 3K9TA 5IB9A 1FT7A 3JRUA 1FNOA 2ZEHA 2PVVA 2XEFA 1M4LA 2PJ4A 5LRJA 4UEZA 5HVHA 4TWEA 1YW4A 3FVLA 4GM5A 2RB7A 4NGRA 3ICUA 5K8PA 1ARMA 3GUXA 2ZEOA 4OIWA 2AFUA 5K8OA 4FUUA 3NH8A 2HC9A 2XEGA 4R76A 1F2PA 3VARA 1ZG8A 1IGBA 5LYFA 2AFXA 2CTBA 4C8FA 5LRGA 4EMEA 3RBUA
chains in the Genus database with same CATH superfamily
2CNMA 4OP4A 3RO0A 2ZEPA 5DWNA 4E8OA 2Z3NA 4HPSA 4A94A 3TLBA 3NE7A 1J3LA 4MFQA 1XF1A 1JQGA 1MK4A 4HNXB 8CPAA 2I3CA 4NGPA 2ODFA 4YWYA 4C8TA 4AG7A 1DIKA 4UEFA 2D0PA 3D7GA 2PRQA 3B3CA 3OB1B 4JYWA 2XPLA 3R95A 3VWEA 2Q04A 4OMEA 2EK9A 2FM4A 3DLJA 1ZO0A 4NGTA 1CP6A 2WYRA 3KRVA 3KI9A 5H86A 2OB0A 1IOIA 4QVTA 3IJ3A 3VWDA 4KOWA 2EUIA 5GCNA 4E0AA 1ARLA 3PEIA 2BL1A 4AVBA 4C68A 3CPAA 4CDJA 4RUHA 2VEZA 3T8WA 2J8RA 2PCNA 3PGPA 4FD5A 4C86A 2BEIA 5FVJA 1BAVA 3R9EA 1ELMP 2PQ8A 3DSBA 3JTKA 3IWGA 4M6HA 4XNHB 2EZCA 1XOVA 5ISVA 3D4UA 2ZW7A 3VRRA 5BWAB 1Z2LA 1Z8XA 2Q0YA 3SJXA 4UCMA 2QJ8A 3B7IA 5F48A 4IIXA 3DNSA 4ZY2A 3V7ZA 2YJVA 1S60A 3D68A 1TKFA 5F49A 3FF3A 4C2YA 5JH9A 4BPUB 4IHMA 3D3SA 1ZG9A 2GLFA 2Z11A 1XIXA 4UA3A 1YVOA 4A39A 3BI0A 4CS0B 3PB4X 4B6ZA 4L8AA 5HVGA 3PB6X 5CBMA 3EXNA 1IYKA 4NXYA 1TXRA 5BY0A 4JD6A 1PCAA 3PBEA 3SI0A 3EZEA 1YVKA 2WUUA 3V8IA 4KOVA 1YSJA 2FT0A 4I49A 2PJ0A 3FB3A 2WZNA 1LFWA 2XEJA 2JLMA 3TLGA 5AG6A 5KTDA 1AUGA 1M1DA 2Z3OA 3CPXA 3H8EA 4JXQA 1TF9A 2AFMA 4CYNA 1A9XB 3HLPA 4KOYA 2PJ2A 4MXUA 1V6CA 3IFEA 2DXQA 2NMTA 4R3LA 5EC4A 3I9SA 3WC5A 1KBLA 1U6MA 4U9ZA 4C9EA 3I6SA 3OP0A 1LOKA 4QB9A 3D66A 4CYOA 2CBLA 3F5BA 2GANA 4DJLA 2D0OA 1N71A 2AFOA 2B5GA 4WWVA 3F9KC 3KGQA 2JDCA 4HNWB 2WPXA 4M85A 4C9AA 4RN7A 1RO5A 3D67A 3PBBA 3VRNA 4MHDA 4MHYA 3W6SA 4NSQA 3S9NA 2V8HA 1R43A 4MMOA 4R57A 4FBEA 3BUXB 4F9VA 4X2TA 1AMPA 3H5ZA 1BLLE 3PRTA 5EMIA 2HROA 1LRZA 3TC8A 1XRYA 3GY9A 5D29A 4NF1A 3SJEA 2FS5A 5LYLA 2EVNA 1S3ZA 5HKZA 3R9FA 4CPAA 1JDBC 4MCPA 3EIFA 4MI1A 2C5QA 3A9LA 1XMTA 4IAVA 2HV2A 2BUEA 2PJ1A 2D4PA 4CAWA 4C8CA 4E94A 2AE6A 2DPTA 2R7HA 3FNCA 2G3TA 2ZOGA 4P10A 3VTAA 3IC1A 2ZW4A 4M6IA 1VBGA 4C85A 4P6YA 1Q2CA 1VI4A 1KZFA 2B5GB 1R57A 4C8AA 4MFZA 1HDUA 4GS4A 4QUSA 1S5KA 3SHPA 4Q38A 4CRZB 3LODA 2YNCC 5G22A 2CIJA 2ZOFA 2BO9A 3WT4A 4JZ0A 1JWQA 4IK2A 4KSIA 4KVME 3GLJA 1BOBA 1R61A 3GJZA 1WVMA 4UEEA 1VHEA 7CPAA 2Z3MA 3T05A 4M3SA 1Z8LA 3BJ7A 1CP7A 3BI1A 4O23A 4BBHA 3B3WA 4UF4A 4BTFA 4OAEA 1PYTB 5LRKA 4J0NA 4UFVA 4KS9A 3N5FA 1Z8TA 4K30A 1MJ9A 1XFOA 3OB2B 2IMOA 1ON0A 3SI1A 4OC5A 3VATA 2AFZA 1Z9EA 4B13A 4XPLA 4EWTA 5A27A 1EZAA 4OIDA 1KUYA 3VROA 1KC7A 3CXPA 3WABA 4E5SA 4B5PA 1CE8B 4MFKA 3RZAA 3IWWA 2O28A 1ZLIA 2IL4A 1ZL0A 2ZENA 2RFHA 2VZYA 1I1DA 3CZXA 3GB0A 1R3NA 4KSAA 1NSAA 2PJ8A 5EBVA 2EK8A 5ELYA 1I21A 1S7KA 1XMBA 2ATRA 2VZZA 4UIAA 4DNCA 4UWIA 5JGFA 4Y49B 3TLYA 4KVXA 2Q4VA 4X8IA 4MJXA 3IGRA 4TJXA 4PXEA 3C8OA 1P4NA 2P0WA 2R1IA 3KL9A 2N3AB 2B0AA 1IY7A 2QYVA 4CGLA 4COGA 2HUZA 2QECA 1Y9WA 2EZBA 1Y7EA 1BO4A 3D7HA 2B3VA 3K9UA 2GIVA 1YVHA 4A4CA 2J8MA 3PB7X 4PXDA 1UWYA 2PSWA 4KUBA 4OC1A 1VGYA 1NSLA 4NJQA 4A2ZA 1KEEB 4GPLB 1VIXA 4B5PB 4CGNA 2BCOA 1MJBA 3WC6A 3S9MA 5IV0A 4BPXB 3MRUA 5THWA 4UBRA 1WK4A 1Q5XA 3BUOB 3LWUA 4UCPA 4Y49C 2X0SA 1CBXA 4NEXA 1CS0B 1IB1E 3IWEA 3BLNA 4U9YA 2CF4A 4R3KA 4LQGA 1MJAA 2OR4A 2XEIA 3FIXA 4KVOE 4ONWA 4HKFA 4C2ZA 3CT9A 3TOBA 4II9A 1DTDA 5E96A 4P4FA 1Z9UA 2BSWA 2XPOA 3SJFA 3S9LA 1KWMA 4NGSA 4P45A 1VHSA 5F13A 3DGVA 4IF5A 4KSFA 4XPKA 4B11A 4C8PA 3TO7A 2O53A 2OH1A 3QAYA 4U5YA 2B4BA 3SXOA 1S7NA 4ZX8A 4MY3A 4P4DA 4PXCA 3GKRA 4AXVA 4C2XA 4CAEA 3E0KA 2ZEDA 3BXMA 3K4IA 3D2MA 4OLLA 3LD2A 1CX8A 2DEAA 1Z4EA 1M4GA 1M4DA 2DLAA 1NE9A 4XNHC 3ZNIA 3EZBA 3NOJA 2PJ3A 4KNGE 3D7DA 4F8ZA 2ZEGA 2AJ6A 2GREA 2Z10A 3PFOA 2JEWA 1BPMA 2ZEMA 4NGQA 4UWJA 3R9GA 3SR3A 3HMJG 4BINA 3B2YA 1XF8A 3ISZA 4B10A 3NH4A 3U1BA 2BOAA 3NE8A 3FJUA 3PB8X 4A38A 4CAXA 4CGOA 3HPHE 4C9UA 2XPNA 3W6XA 1QMUA 3T9YA 3JUWA 1CG2A 3UY5A 4A32A 2F5IA 2GE3A 5K8NA 4FD4A 4ZX9A 1Z4RA 3F8KA 1FBVA 1QSOA 4AVCA 5AG7A 4P44A 4M6GA 4DUKA 4ZY0A 1TF8A 2AFWA 3K2KA 4WJBA 5LYIA 5DS0A 3ZJ0A 5IX3A 1ZYMA 3TO6A 4PPZA 2YNEA 1YW6A 4AB7A 4H89A 2Y1MA 2H5MA 5D8NA 1ELLP 1HDQA 2DIKA 4OC0A 1XBUA 2FCKA 2V8DA 4KOTA 1X10A 4R7MA 4MFJA 4AG9A 2PDOA 3CXSA 4H6ZA 2C27A 4OC4A 2UV8G 3IU1A 3SI2A 5HXDA 2ZW5A 1B87A 5G21A 4A4BA 1LAPA 4ZI6A 5AG4A 2EZAA 2C1CA 2PJ7A 4GXHA 1HEEA 4PSXA 1QSTA 1H8LA 2DPSA 1YK3A 3EY5A 2EBJA 2CXAA 3KHXA 4TNUA 3TX8A 2REFA 4QC6A 5AG5A 5I0CA 2GFQA 3KKWA 1YLEA 4R87A 2Z3KA 3TCVA 3RYOA 4EVYA 1BPNA 4Z65A 4C84A 1QQ9A 1TIQA 2FSRA 4G1PA 3C26A 3L2NA 4YFJA 2PC1A 3RNZA 1CJWA 2PIZA 2Q7BA 2ZEFA 3EZAA 2Q7SA 1KUVA 3JVNA 3T90A 1ZLHA 3ZZIA 1NBWA 3G23A 4MCRA 2O4HA 2REEA 2Q4ZA 4ZYQA 2OOTA 4EYSA 1Y9ZA 5K8MA 3FYNA 5KTAA 4CGPA 4R6TA 2CNSA 4F9UA 3IO1A 2C6CA 3PP9A 1IYLA 2Q43A 1OZPA 2G3AA 4ZGYB 4MY0A 4PK2A 2QIRA 2V8GA 4ZY1A 3B3TA 3WR7A 3D8PA 3LMSA 4F0XA 4EFDA 2NSMA 4LQ6A 1V0CA 1YLOA 4B14A 4CRYB 2JBKA 5J3XA 4FWUA 3N7ZA 4K3NA 4OADA 4NJRA 1GHEA 1OBRA 4Q7AA 1GGOA 2R82A 3I74A 4AVAA 5C82A 2VL1A 4MFPA 4P4IA 2Q4YA 5F1YA 5IR2A 5DWMA 2GU2A 3H8FA 2CNTA 4P4EA 2Q51A 3TLGB 2F7VA 1JDEA 4BMHA 3IU2A 1BXRB 4CAFA 4CO9A 4C8UA 2FIAA 3VRQA 2OU2A 4RI1A 3IEHA 4IIYA 2CY2A 1IIDA 1M44A 3CDXA 3KR4A 1A2ZA 4UFXA 4CYPA 2PR1A 4YN3A 4H2KA 3U88C 2NYQA 4NGMA 2FIWA 3PLFB 2ARHA 2ZPAA 3BJ8A 1RTQA 1CPXA 3DR8A 3GYAA 3I1UA 4HNYB 4JJXA 4E2AA 2ZW6A 3FEDA 2MP0A 1GYTA 3B35A 4UCNA 1XJOA 3SJGA 5AXIA 3TLAA 2D4OA 1X12A 5CPAA 3R96A 3TO9A 3TOAA 1EE3P 1F57A 1Y7RA 3MN8A 3NFZA 4P4JA 2WSAA 4OKOA 3FEEA 5F09A 2PIYA 2KCWA 2B4JC 5I4MA 1T36B 4R8FA 2AUMA 4C99A 5LYDA 3KZWA 5G20A 5J8FA 3T0TA 1FY7A 3D2PA 3O8ZA 1ZG7A 5KTCA 3V38A 1P0HA 5C88A 2PVWA 3G3SA 1YGHA 4C7IA 3FX6A 3NA6A 4YRHA 1IICA 3S6KA 3BUWB 2EWBA 3B3SA 3W91A 1ZRSA 1RXTA 3ISXA 4KOUA 5FD8A 1XEBA 2OLSA 2Y1NA 2RC4A 1WWZA 2R98A 2Y0MA 4MRIA 4MCSA 1L0CA 3EC4A 5IB0A 5F5XA 4CDKA 1NXJA 3P2HA 1TKHA 2GP4A 4NCZA 1LAMA 3R1KA 5JVLA 3KASA 4CAVA 1Z8WA 2ABZA 2G9DA 2PJAA 2VXKA 2B58A 2FL4A 2V77A 3GIUA 3HUVA 3QNVA 4KZTA 4MJ8A 4PQAA 4KUAA 2V8VA 3LACA 2X7BA 3KHZA 5F47A 2ZELA 3KQZA 4F0YA 4M8DA 3RBUA 4A37A 4UFWA 1DE4C 3HPGG 4A33A 5A28A 3DDDA 5JM6A 5HKYA 2P6FA 2DF5A 3T07A 5K99A 3NH5A 4JVOA 2PJBA 3VGOA 1PU9A 4W9YA 2C6GA 2E28A 1J4JA 4KOXA 2J9AA 4A30A 2PR8A 3OWCA 1F2OA 3H4QA 4CYQA 1VBHA 2VKZG 1LCPA 2PJ9A 4MBUA 4DYOA 1YMEA 4H1HA 3TTHA 4JWPA 4NFRA 1EO0A 4CGMA 1K4JA 4KORA 3WC7A 4P4BA 2JBJA 2F8HA 4YGOA 2HWGA 3EFAA 5AGEA 2QMLA 3TYXA 3S6FA 3QB8A 4OC2A 2FXFA 2OZGA 2PJ6A 4JXRA 1Q2YA 2WPWA 5G1ZA 4X3RA 4RS2A 4MHZA 5JPHA 5J1QA 4CZ1A 1TKJA 1QSRA 1Z5RA 2J8NA 3FH4A 3H8GA 4L89A 5H84A 3RAMA 4PV6A 1PUAA 5F9MA 1SQHA 3TLEA 3PFEA 4QBJA 3BHXA 1IOFA 1C3OB 4INJA 3TE4A 2FVGA 3TLZA 2OZUA 2QVPA 2Z3PA 4NGNA 3D7FA 1NMTA 3TFYA 5HH1A 3FBUA 4MCQA 3PB9X 3T5MA 2PJCA 2K5TA 4PK3A 4R9MA 2HI6A 5J8CA 2YNCA 6CPAA 3OAKA 4ONUA 4F6AA 3TLCA 2C6PA 2HB6A 3IIBA 3FMCA 1Q7LA 2YGWA 4MHPA 4FAIA 3DR6A 2JDDA 1AYEA 4MI4A 1Y0YA 2POKA 4MHNA 4ZBGA 2IJZA 3MGDA 4PSWA 2PCUA 2PRBA 2GLJA 3KR5A 2PE3A 4C9RA 2ANPA 3B3VA 4IUSA 3P2FA 3VH9A 1QSNA 1XE4A 3FXTA 2AUNA 4TJVA 4C9VA 2HQYA 3S6GA 1Y0RA 3PT1A 4PXBA 2AFSA 3PFVA 1IU8A 4OC3A 3G8WA 2I00A 2I79A 4JLYA 2R8VA 1LANA 2IQ6A 1B6BA 2B3UA 4UIBA 5HVFA 3BUNB 2CTCA 2XPPA 4BD9A 1M6VB 2Z0ZA 5JYBA 2VQYA 4XPDB 4YU9A 3SXNA 1I12A 2P6EA 4FD7A 3KQXA 3FECA 1CPSA 4B5OA 4COBA 1VHOA 2JEVA 2P6GA 2PJ5A 3FRMA 5HKWA 2ZEEA 4J3GA 1VKCA 2A4NA 3K9TA 4ORFA 4LUAA 1YR0A 3NFQA 5IB9A 1YX0A 2OZHA 5F46A 1C30B 1FT7A 2B4DA 3JRUA 1FNOA 2YJTA 2ZEHA 4KLVA 1S7LA 2PVVA 2XEFA 5CNPA 2FE7A 3QAHA 1B47A 3VRPA 1M4LA 2EO8A 2PJ4A 5LRJA 1Y9KA 4UEZA 5HVHA 4TWEA 1EZBA 4MFLA 1KUXA 4FD6A 1YW4A 4XPDC 4B12A 4KOSA 4C7HA 2VI7A 1YREA 1WJTA 1YQEA 2ZXVA 3FVLA 4GM5A 3I3GA 2RB7A 4NGRA 3F0AA 3S6HA 3ICUA 4BPWB 5K8PA 3CXQA 1ARMA 3GUXA 2ZEOA 4OIWA 4RR2B 4A31A 2AFUA 3PZJA 4X5KA 2B4DB 1UFHA 4FUUA 4A95A 3NH8A 5K8OA 1QSMA 2HC9A 2XEGA 4KLWA 1F2PA 4R76A 3VARA 2VBQA 5JQ4A 1S7FA 1ZG8A 2YNDA 4H6UA 2Z3LA 1IGBA 3TT2A 5LYFA 5HMNA 2AFXA 2CTBA 1M4IA 2G0BA 3B8GA 5LRGA 4C8FA 4Q36A 4EMEA 3BUMB 1CM0A 2Q44A 1Q2DA 3EO4A 4LX9A
chains in the Genus database with same CATH topology
4OP4A 2ZEPA 4A94A 1XF1A 1JQGA 8CPAA 4C8TA 2I3CA 4NGPA 4YWYA 4UEFA 3D7GA 2PRQA 3B3CA 4JYWA 4OMEA 2EK9A 3DLJA 4NGTA 1CP6A 2WYRA 3KI9A 3IJ3A 1ARLA 3PEIA 3CPAA 4CDJA 4RUHA 3T8WA 1BAVA 1ELMP 3D4UA 1Z2LA 3SJXA 2QJ8A 3B7IA 3V7ZA 3D68A 1TKFA 3FF3A 5JH9A 4IHMA 1ZG9A 2GLFA 4A39A 4C86A 3BI0A 3PB4X 5HVGA 3PB6X 1TXRA 3SI0A 1PCAA 3PBEA 1YSJA 2PJ0A 2WZNA 1LFWA 2XEJA 3CPXA 3H8EA 1TF9A 2AFMA 3HLPA 2PJ2A 4MXUA 1V6CA 3IFEA 3WC5A 4C9EA 3I6SA 1LOKA 3D66A 4DJLA 2AFOA 4WWVA 4C9AA 3KGQA 3D67A 3PBBA 4MHYA 3S9NA 2V8HA 1R43A 4MMOA 4FBEA 4F9VA 4X2TA 1AMPA 1BLLE 3PRTA 3TC8A 1XRYA 5LYLA 5D29A 3SJEA 4CPAA 4MCPA 2C5QA 4IAVA 2PJ1A 4C8CA 2ZOGA 4P10A 3VTAA 3IC1A 4C85A 4P6YA 4C8AA 1HDUA 2CIJA 2ZOFA 2BO9A 3WT4A 4JZ0A 4KSIA 4IK2A 3GLJA 1WVMA 4UEEA 1VHEA 7CPAA 1Z8LA 1CP7A 3BI1A 4O23A 3B3WA 4UF4A 1PYTB 5LRKA 3N5FA 4B6ZA 1XFOA 2IMOA 3VATA 4EWTA 3SI1A 4F8ZA 4OC5A 2AFZA 4OIDA 3WABA 3RZAA 3IWWA 1ZLIA 2ZENA 2RFHA 3GB0A 1R3NA 1NSAA 2PJ8A 2EK8A 5ELYA 1XMBA 4UIAA 5JGFA 4X8IA 4TJXA 4PXEA 3KL9A 1IY7A 2QYVA 1Y7EA 3D7HA 4PXDA 3PB7X 1UWYA 4OC1A 1VGYA 4NJQA 1VIXA 2BCOA 3WC6A 3S9MA 3MRUA 5THWA 3LWUA 1CBXA 2CF4A 4LQGA 2XEIA 2OR4A 4ONWA 3CT9A 1DTDA 4P4FA 3S9LA 3SJFA 1KWMA 3DGVA 4NGSA 4P45A 4C8PA 2O53A 4ZX8A 4PXCA 4P4DA 4AXVA 2ZEDA 3BXMA 1CX8A 2DEAA 4KNGE 2PJ3A 3D7DA 2ZEGA 2GREA 3PFOA 2JEWA 1BPMA 2ZEMA 4NGQA 3B2YA 3ISZA 3NH4A 2BOAA 3FJUA 3PB8X 4A38A 4C9UA 1QMUA 1CG2A 5K8NA 4ZX9A 4P44A 4DUKA 4ZY0A 1TF8A 2AFWA 3K2KA 4WJBA 5LYIA 5DS0A 4PPZA 1YW6A 5D8NA 1ELLP 1HDQA 4OC0A 1XBUA 2V8DA 4R7MA 4OC4A 3SI2A 5HXDA 1LAPA 4ZI6A 2C1CA 2PJ7A 1HEEA 1H8LA 3KHXA 4TNUA 3TX8A 1BPNA 4Z65A 4C84A 1QQ9A 4G1PA 3L2NA 2PIZA 2ZEFA 1ZLHA 4MCRA 2O4HA 4ZYQA 2Q4ZA 2OOTA 1Y9ZA 5K8MA 4R6TA 4F9UA 3IO1A 2C6CA 2Q43A 2V8GA 4ZY1A 3B3TA 3LMSA 4EFDA 2NSMA 1YLOA 2JBKA 4FWUA 4K3NA 4ZY2A 3I74A 4NJRA 1OBRA 4Q7AA 2VL1A 4P4IA 5IR2A 2GU2A 3H8FA 4P4EA 2Q51A 2F7VA 4C8UA 3IEHA 3CDXA 3KR4A 4YN3A 4H2KA 2NYQA 4NGMA 3I1UA 1RTQA 1CPXA 3FEDA 1GYTA 3B35A 1XJOA 3SJGA 5CPAA 1EE3P 1F57A 3NFZA 3MN8A 4OKOA 4P4JA 3FEEA 5F09A 2PIYA 5I4MA 4C99A 4R8FA 5LYDA 3KZWA 1ZG7A 3V38A 2PVWA 3FX6A 3NA6A 3B3SA 2EWBA 3ISXA 4MRIA 4MCSA 4CDKA 1TKHA 2GP4A 1LAMA 3KASA 2ABZA 2G9DA 2PJAA 3QNVA 2V77A 3HUVA 4PQAA 2V8VA 3KHZA 2ZELA 3KQZA 4A37A 5JM6A 1DE4C 3NH5A 2PJBA 4W9YA 2C6GA 2J9AA 1F2OA 2PJ9A 1LCPA 4DYOA 1YMEA 4NFRA 3WC7A 4P4BA 2JBJA 2F8HA 4OC2A 2PJ6A 4X3RA 4MHZA 5J1QA 1TKJA 1Z5RA 3FH4A 3H8GA 3RAMA 3EIFA 3PFEA 3BHXA 2FVGA 2QVPA 4NGNA 3D7FA 4MCQA 3PB9X 2PJCA 6CPAA 2C6PA 2HB6A 3IIBA 3FMCA 1Q7LA 4MHPA 4FAIA 1AYEA 1Y0YA 2POKA 4MHNA 2IJZA 2PCUA 3KR5A 2GLJA 2PE3A 4C9RA 2ANPA 3B3VA 4TJVA 3VH9A 4C9VA 1Y0RA 4PXBA 2AFSA 4OC3A 1LANA 2IQ6A 4UIBA 5HVFA 2CTCA 4BD9A 4YU9A 3KQXA 3FECA 1CPSA 1VHOA 2PJ5A 5CBMA 2ZEEA 3K9TA 5IB9A 1FT7A 3JRUA 1FNOA 2ZEHA 2PVVA 2XEFA 1M4LA 2PJ4A 5LRJA 4UEZA 5HVHA 4TWEA 1YW4A 3FVLA 4GM5A 2RB7A 4NGRA 3ICUA 5K8PA 1ARMA 3GUXA 2ZEOA 4OIWA 2AFUA 5K8OA 4FUUA 3NH8A 2HC9A 2XEGA 4R76A 1F2PA 3VARA 1ZG8A 1IGBA 5LYFA 2AFXA 2CTBA 4C8FA 5LRGA 4EMEA 3RBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OP4 A;  2ZEP A;  4A94 A;  1XF1 A;  1JQG A;  8CPA A;  4C8T A;  2I3C A;  4NGP A;  4YWY A;  4UEF A;  3D7G A;  2PRQ A;  3B3C A;  4JYW A;  4OME A;  2EK9 A;  3DLJ A;  4NGT A;  1CP6 A;  2WYR A;  3KI9 A;  3IJ3 A;  1ARL A;  3PEI A;  3CPA A;  4CDJ A;  4RUH A;  3T8W A;  1BAV A;  1ELM P;  3D4U A;  1Z2L A;  3SJX A;  2QJ8 A;  3B7I A;  3V7Z A;  3D68 A;  1TKF A;  3FF3 A;  5JH9 A;  4IHM A;  1ZG9 A;  2GLF A;  4A39 A;  4C86 A;  3BI0 A;  3PB4 X;  5HVG A;  3PB6 X;  1TXR A;  3SI0 A;  1PCA A;  3PBE A;  1YSJ A;  2PJ0 A;  2WZN A;  1LFW A;  2XEJ A;  3CPX A;  3H8E A;  1TF9 A;  2AFM A;  3HLP A;  2PJ2 A;  4MXU A;  1V6C A;  3IFE A;  3WC5 A;  4C9E A;  3I6S A;  1LOK A;  3D66 A;  4DJL A;  2AFO A;  4WWV A;  4C9A A;  3KGQ A;  3D67 A;  3PBB A;  4MHY A;  3S9N A;  2V8H A;  1R43 A;  4MMO A;  4FBE A;  4F9V A;  4X2T A;  1AMP A;  1BLL E;  3PRT A;  3TC8 A;  1XRY A;  5LYL A;  5D29 A;  3SJE A;  4CPA A;  4MCP A;  4IAV A;  2PJ1 A;  4C8C A;  2ZOG A;  4P10 A;  3VTA A;  3IC1 A;  4C85 A;  4P6Y A;  4C8A A;  1HDU A;  2CIJ A;  2ZOF A;  2BO9 A;  3WT4 A;  4JZ0 A;  4KSI A;  4IK2 A;  3GLJ A;  1WVM A;  4UEE A;  1VHE A;  7CPA A;  1Z8L A;  1CP7 A;  3BI1 A;  4O23 A;  3B3W A;  4UF4 A;  1PYT B;  5LRK A;  3N5F A;  4B6Z A;  1XFO A;  2IMO A;  3VAT A;  4EWT A;  3SI1 A;  4F8Z A;  4OC5 A;  2AFZ A;  4OID A;  3WAB A;  3RZA A;  3IWW A;  1ZLI A;  2ZEN A;  2RFH A;  3GB0 A;  1R3N A;  1NSA A;  2PJ8 A;  2EK8 A;  5ELY A;  1XMB A;  4UIA A;  5JGF A;  4X8I A;  4TJX A;  4PXE A;  3KL9 A;  1IY7 A;  2QYV A;  1Y7E A;  3D7H A;  4PXD A;  3PB7 X;  1UWY A;  4OC1 A;  1VGY A;  4NJQ A;  1VIX A;  2BCO A;  3WC6 A;  3S9M A;  3MRU A;  5THW A;  3LWU A;  1CBX A;  2CF4 A;  4LQG A;  2XEI A;  2OR4 A;  4ONW A;  3CT9 A;  1DTD A;  4P4F A;  3S9L A;  3SJF A;  1KWM A;  3DGV A;  4NGS A;  4P45 A;  4C8P A;  2O53 A;  4ZX8 A;  4PXC A;  4P4D A;  4AXV A;  2ZED A;  3BXM A;  1CX8 A;  2DEA A;  4KNG E;  2PJ3 A;  3D7D A;  2ZEG A;  2GRE A;  3PFO A;  2JEW A;  1BPM A;  2ZEM A;  4NGQ A;  3B2Y A;  3ISZ A;  3NH4 A;  2BOA A;  3FJU A;  3PB8 X;  4A38 A;  4C9U A;  1QMU A;  1CG2 A;  5K8N A;  4ZX9 A;  4P44 A;  4DUK A;  4ZY0 A;  1TF8 A;  2AFW A;  3K2K A;  4WJB A;  5LYI A;  5DS0 A;  4PPZ A;  1YW6 A;  5D8N A;  1ELL P;  1HDQ A;  4OC0 A;  1XBU A;  2V8D A;  4R7M A;  4OC4 A;  3SI2 A;  5HXD A;  1LAP A;  4ZI6 A;  2C1C A;  2PJ7 A;  1HEE A;  1H8L A;  3KHX A;  4TNU A;  3TX8 A;  1BPN A;  4Z65 A;  4C84 A;  1QQ9 A;  4G1P A;  3L2N A;  2PIZ A;  2ZEF A;  1ZLH A;  4MCR A;  2O4H A;  4ZYQ A;  2Q4Z A;  2OOT A;  1Y9Z A;  5K8M A;  4R6T A;  4F9U A;  3IO1 A;  2C6C A;  2Q43 A;  2V8G A;  4ZY1 A;  3B3T A;  3LMS A;  4EFD A;  2NSM A;  1YLO A;  2JBK A;  4FWU A;  4K3N A;  4ZY2 A;  3I74 A;  4NJR A;  1OBR A;  4Q7A A;  2VL1 A;  4P4I A;  2GU2 A;  3H8F A;  4P4E A;  2Q51 A;  2F7V A;  4C8U A;  3IEH A;  3CDX A;  3KR4 A;  4YN3 A;  4H2K A;  2NYQ A;  4NGM A;  3I1U A;  1RTQ A;  1CPX A;  3FED A;  1GYT A;  3B35 A;  1XJO A;  3SJG A;  5CPA A;  1EE3 P;  1F57 A;  3NFZ A;  3MN8 A;  4OKO A;  4P4J A;  3FEE A;  5F09 A;  2PIY A;  5I4M A;  4C99 A;  4R8F A;  5LYD A;  3KZW A;  1ZG7 A;  3V38 A;  2PVW A;  3FX6 A;  3NA6 A;  3B3S A;  2EWB A;  3ISX A;  4MRI A;  4MCS A;  4CDK A;  1TKH A;  1LAM A;  3KAS A;  2ABZ A;  2G9D A;  2PJA A;  3QNV A;  2V77 A;  3HUV A;  4PQA A;  2V8V A;  3KHZ A;  2ZEL A;  3KQZ A;  4A37 A;  5JM6 A;  1DE4 C;  3NH5 A;  2PJB A;  4W9Y A;  2C6G A;  2J9A A;  1F2O A;  2PJ9 A;  1LCP A;  4DYO A;  1YME A;  4NFR A;  3WC7 A;  4P4B A;  2JBJ A;  2F8H A;  4OC2 A;  2PJ6 A;  4X3R A;  4MHZ A;  5J1Q A;  1TKJ A;  1Z5R A;  3FH4 A;  3H8G A;  3RAM A;  3EIF A;  3PFE A;  3BHX A;  2FVG A;  2QVP A;  4NGN A;  3D7F A;  4MCQ A;  3PB9 X;  2PJC A;  6CPA A;  2C6P A;  2HB6 A;  3IIB A;  3FMC A;  1Q7L A;  4MHP A;  4FAI A;  1AYE A;  1Y0Y A;  2POK A;  4MHN A;  2IJZ A;  2PCU A;  3KR5 A;  2GLJ A;  2PE3 A;  4C9R A;  2ANP A;  3B3V A;  4TJV A;  3VH9 A;  4C9V A;  1Y0R A;  4PXB A;  2AFS A;  4OC3 A;  1LAN A;  2IQ6 A;  4UIB A;  5HVF A;  2CTC A;  4BD9 A;  4YU9 A;  3KQX A;  3FEC A;  1CPS A;  1VHO A;  2PJ5 A;  5CBM A;  2ZEE A;  3K9T A;  5IB9 A;  1FT7 A;  3JRU A;  1FNO A;  2ZEH A;  2PVV A;  2XEF A;  1M4L A;  2PJ4 A;  5LRJ A;  4UEZ A;  5HVH A;  4TWE A;  1YW4 A;  3FVL A;  4GM5 A;  2RB7 A;  4NGR A;  3ICU A;  5K8P A;  1ARM A;  3GUX A;  2ZEO A;  4OIW A;  2AFU A;  5K8O A;  4FUU A;  3NH8 A;  2HC9 A;  2XEG A;  4R76 A;  1F2P A;  3VAR A;  1ZG8 A;  1IGB A;  5LYF A;  2AFX A;  2CTB A;  4C8F A;  5LRG A;  4EME A;  3RBU A; 
#chains in the Genus database with same CATH topology
 2CNM A;  4OP4 A;  3RO0 A;  2ZEP A;  5DWN A;  4E8O A;  2Z3N A;  4HPS A;  4A94 A;  3TLB A;  3NE7 A;  1J3L A;  4MFQ A;  1XF1 A;  1JQG A;  1MK4 A;  4HNX B;  8CPA A;  2I3C A;  4NGP A;  2ODF A;  4YWY A;  4C8T A;  4AG7 A;  1DIK A;  4UEF A;  2D0P A;  3D7G A;  2PRQ A;  3B3C A;  3OB1 B;  4JYW A;  2XPL A;  3R95 A;  3VWE A;  2Q04 A;  4OME A;  2EK9 A;  2FM4 A;  3DLJ A;  1ZO0 A;  4NGT A;  1CP6 A;  2WYR A;  3KRV A;  3KI9 A;  5H86 A;  2OB0 A;  1IOI A;  4QVT A;  3IJ3 A;  3VWD A;  4KOW A;  2EUI A;  5GCN A;  4E0A A;  1ARL A;  3PEI A;  2BL1 A;  4AVB A;  4C68 A;  3CPA A;  4CDJ A;  4RUH A;  2VEZ A;  3T8W A;  2J8R A;  2PCN A;  3PGP A;  4FD5 A;  4C86 A;  2BEI A;  5FVJ A;  1BAV A;  3R9E A;  1ELM P;  2PQ8 A;  3DSB A;  3JTK A;  3IWG A;  4M6H A;  4XNH B;  2EZC A;  1XOV A;  5ISV A;  3D4U A;  2ZW7 A;  3VRR A;  5BWA B;  1Z2L A;  1Z8X A;  2Q0Y A;  3SJX A;  4UCM A;  2QJ8 A;  3B7I A;  5F48 A;  4IIX A;  3DNS A;  4ZY2 A;  3V7Z A;  2YJV A;  1S60 A;  3D68 A;  1TKF A;  5F49 A;  3FF3 A;  4C2Y A;  5JH9 A;  4BPU B;  4IHM A;  3D3S A;  1ZG9 A;  2GLF A;  2Z11 A;  1XIX A;  4UA3 A;  1YVO A;  4A39 A;  3BI0 A;  4CS0 B;  3PB4 X;  4B6Z A;  4L8A A;  5HVG A;  3PB6 X;  5CBM A;  3EXN A;  1IYK A;  4NXY A;  1TXR A;  5BY0 A;  4JD6 A;  1PCA A;  3PBE A;  3SI0 A;  3EZE A;  1YVK A;  2WUU A;  3V8I A;  4KOV A;  1YSJ A;  2FT0 A;  4I49 A;  2PJ0 A;  3FB3 A;  2WZN A;  1LFW A;  2XEJ A;  2JLM A;  3TLG A;  5AG6 A;  5KTD A;  1AUG A;  1M1D A;  2Z3O A;  3CPX A;  3H8E A;  4JXQ A;  1TF9 A;  2AFM A;  4CYN A;  1A9X B;  3HLP A;  4KOY A;  2PJ2 A;  4MXU A;  1V6C A;  3IFE A;  2DXQ A;  2NMT A;  4R3L A;  5EC4 A;  3I9S A;  3WC5 A;  1KBL A;  1U6M A;  4U9Z A;  4C9E A;  3I6S A;  3OP0 A;  1LOK A;  4QB9 A;  3D66 A;  4CYO A;  2CBL A;  3F5B A;  2GAN A;  4DJL A;  2D0O A;  1N71 A;  2AFO A;  2B5G A;  4WWV A;  3F9K C;  3KGQ A;  2JDC A;  4HNW B;  2WPX A;  4M85 A;  4C9A A;  4RN7 A;  1RO5 A;  3D67 A;  3PBB A;  3VRN A;  4MHD A;  4MHY A;  3W6S A;  4NSQ A;  3S9N A;  2V8H A;  1R43 A;  4MMO A;  4R57 A;  4FBE A;  3BUX B;  4F9V A;  4X2T A;  1AMP A;  3H5Z A;  1BLL E;  3PRT A;  5EMI A;  2HRO A;  1LRZ A;  3TC8 A;  1XRY A;  3GY9 A;  5D29 A;  4NF1 A;  3SJE A;  2FS5 A;  5LYL A;  2EVN A;  1S3Z A;  5HKZ A;  3R9F A;  4CPA A;  1JDB C;  4MCP A;  3EIF A;  4MI1 A;  2C5Q A;  3A9L A;  1XMT A;  4IAV A;  2HV2 A;  2BUE A;  2PJ1 A;  2D4P A;  4CAW A;  4C8C A;  4E94 A;  2AE6 A;  2DPT A;  2R7H A;  3FNC A;  2G3T A;  2ZOG A;  4P10 A;  3VTA A;  3IC1 A;  2ZW4 A;  4M6I A;  1VBG A;  4C85 A;  4P6Y A;  1Q2C A;  1VI4 A;  1KZF A;  2B5G B;  1R57 A;  4C8A A;  4MFZ A;  1HDU A;  4GS4 A;  4QUS A;  1S5K A;  3SHP A;  4Q38 A;  4CRZ B;  3LOD A;  2YNC C;  5G22 A;  2CIJ A;  2ZOF A;  2BO9 A;  3WT4 A;  4JZ0 A;  1JWQ A;  4IK2 A;  4KSI A;  4KVM E;  3GLJ A;  1BOB A;  1R61 A;  3GJZ A;  1WVM A;  4UEE A;  1VHE A;  7CPA A;  2Z3M A;  3T05 A;  4M3S A;  1Z8L A;  3BJ7 A;  1CP7 A;  3BI1 A;  4O23 A;  4BBH A;  3B3W A;  4UF4 A;  4BTF A;  4OAE A;  1PYT B;  5LRK A;  4J0N A;  4UFV A;  4KS9 A;  3N5F A;  1Z8T A;  4K30 A;  1MJ9 A;  1XFO A;  3OB2 B;  2IMO A;  1ON0 A;  3SI1 A;  4OC5 A;  3VAT A;  2AFZ A;  1Z9E A;  4B13 A;  4XPL A;  4EWT A;  5A27 A;  1EZA A;  4OID A;  1KUY A;  3VRO A;  1KC7 A;  3CXP A;  3WAB A;  4E5S A;  4B5P A;  1CE8 B;  4MFK A;  3RZA A;  3IWW A;  2O28 A;  1ZLI A;  2IL4 A;  1ZL0 A;  2ZEN A;  2RFH A;  2VZY A;  1I1D A;  3CZX A;  3GB0 A;  1R3N A;  4KSA A;  1NSA A;  2PJ8 A;  5EBV A;  2EK8 A;  5ELY A;  1I21 A;  1S7K A;  1XMB A;  2ATR A;  2VZZ A;  4UIA A;  4DNC A;  4UWI A;  5JGF A;  4Y49 B;  3TLY A;  4KVX A;  2Q4V A;  4X8I A;  4MJX A;  3IGR A;  4TJX A;  4PXE A;  3C8O A;  1P4N A;  2P0W A;  2R1I A;  3KL9 A;  2N3A B;  2B0A A;  1IY7 A;  2QYV A;  4CGL A;  4COG A;  2HUZ A;  2QEC A;  1Y9W A;  2EZB A;  1Y7E A;  1BO4 A;  3D7H A;  2B3V A;  3K9U A;  2GIV A;  1YVH A;  4A4C A;  2J8M A;  3PB7 X;  4PXD A;  1UWY A;  2PSW A;  4KUB A;  4OC1 A;  1VGY A;  1NSL A;  4NJQ A;  4A2Z A;  1KEE B;  4GPL B;  1VIX A;  4B5P B;  4CGN A;  2BCO A;  1MJB A;  3WC6 A;  3S9M A;  5IV0 A;  4BPX B;  3MRU A;  5THW A;  4UBR A;  1WK4 A;  1Q5X A;  3BUO B;  3LWU A;  4UCP A;  4Y49 C;  2X0S A;  1CBX A;  4NEX A;  1CS0 B;  1IB1 E;  3IWE A;  3BLN A;  4U9Y A;  2CF4 A;  4R3K A;  4LQG A;  1MJA A;  2OR4 A;  2XEI A;  3FIX A;  4KVO E;  4ONW A;  4HKF A;  4C2Z A;  3CT9 A;  3TOB A;  4II9 A;  1DTD A;  5E96 A;  4P4F A;  1Z9U A;  2BSW A;  2XPO A;  3SJF A;  3S9L A;  1KWM A;  4NGS A;  4P45 A;  1VHS A;  5F13 A;  3DGV A;  4IF5 A;  4KSF A;  4XPK A;  4B11 A;  4C8P A;  3TO7 A;  2O53 A;  2OH1 A;  3QAY A;  4U5Y A;  2B4B A;  3SXO A;  1S7N A;  4ZX8 A;  4MY3 A;  4P4D A;  4PXC A;  3GKR A;  4AXV A;  4C2X A;  4CAE A;  3E0K A;  2ZED A;  3BXM A;  3K4I A;  3D2M A;  4OLL A;  3LD2 A;  1CX8 A;  2DEA A;  1Z4E A;  1M4G A;  1M4D A;  2DLA A;  1NE9 A;  4XNH C;  3ZNI A;  3EZB A;  3NOJ A;  2PJ3 A;  4KNG E;  3D7D A;  4F8Z A;  2ZEG A;  2AJ6 A;  2GRE A;  2Z10 A;  3PFO A;  2JEW A;  1BPM A;  2ZEM A;  4NGQ A;  4UWJ A;  3R9G A;  3SR3 A;  3HMJ G;  4BIN A;  3B2Y A;  1XF8 A;  3ISZ A;  4B10 A;  3NH4 A;  3U1B A;  2BOA A;  3NE8 A;  3FJU A;  3PB8 X;  4A38 A;  4CAX A;  4CGO A;  3HPH E;  4C9U A;  2XPN A;  3W6X A;  1QMU A;  3T9Y A;  3JUW A;  1CG2 A;  3UY5 A;  4A32 A;  2F5I A;  2GE3 A;  5K8N A;  4FD4 A;  4ZX9 A;  1Z4R A;  3F8K A;  1FBV A;  1QSO A;  4AVC A;  5AG7 A;  4P44 A;  4M6G A;  4DUK A;  4ZY0 A;  1TF8 A;  2AFW A;  3K2K A;  4WJB A;  5LYI A;  5DS0 A;  3ZJ0 A;  5IX3 A;  1ZYM A;  3TO6 A;  4PPZ A;  2YNE A;  1YW6 A;  4AB7 A;  4H89 A;  2Y1M A;  2H5M A;  5D8N A;  1ELL P;  1HDQ A;  2DIK A;  4OC0 A;  1XBU A;  2FCK A;  2V8D A;  4KOT A;  1X10 A;  4R7M A;  4MFJ A;  4AG9 A;  2PDO A;  3CXS A;  4H6Z A;  2C27 A;  4OC4 A;  2UV8 G;  3IU1 A;  3SI2 A;  5HXD A;  2ZW5 A;  1B87 A;  5G21 A;  4A4B A;  1LAP A;  4ZI6 A;  5AG4 A;  2EZA A;  2C1C A;  2PJ7 A;  4GXH A;  1HEE A;  4PSX A;  1QST A;  1H8L A;  2DPS A;  1YK3 A;  3EY5 A;  2EBJ A;  2CXA A;  3KHX A;  4TNU A;  3TX8 A;  2REF A;  4QC6 A;  5AG5 A;  5I0C A;  2GFQ A;  3KKW A;  1YLE A;  4R87 A;  2Z3K A;  3TCV A;  3RYO A;  4EVY A;  1BPN A;  4Z65 A;  4C84 A;  1QQ9 A;  1TIQ A;  2FSR A;  4G1P A;  3C26 A;  3L2N A;  4YFJ A;  2PC1 A;  3RNZ A;  1CJW A;  2PIZ A;  2Q7B A;  2ZEF A;  3EZA A;  2Q7S A;  1KUV A;  3JVN A;  3T90 A;  1ZLH A;  3ZZI A;  1NBW A;  3G23 A;  4MCR A;  2O4H A;  2REE A;  2Q4Z A;  4ZYQ A;  2OOT A;  4EYS A;  1Y9Z A;  5K8M A;  3FYN A;  5KTA A;  4CGP A;  4R6T A;  2CNS A;  4F9U A;  3IO1 A;  2C6C A;  3PP9 A;  1IYL A;  2Q43 A;  1OZP A;  2G3A A;  4ZGY B;  4MY0 A;  4PK2 A;  2QIR A;  2V8G A;  4ZY1 A;  3B3T A;  3WR7 A;  3D8P A;  3LMS A;  4F0X A;  4EFD A;  2NSM A;  4LQ6 A;  1V0C A;  1YLO A;  4B14 A;  4CRY B;  2JBK A;  5J3X A;  4FWU A;  3N7Z A;  4K3N A;  4OAD A;  4NJR A;  1GHE A;  1OBR A;  4Q7A A;  1GGO A;  2R82 A;  3I74 A;  4AVA A;  5C82 A;  2VL1 A;  4MFP A;  4P4I A;  2Q4Y A;  5F1Y A;  5IR2 A;  5DWM A;  2GU2 A;  3H8F A;  2CNT A;  4P4E A;  2Q51 A;  3TLG B;  2F7V A;  1JDE A;  4BMH A;  3IU2 A;  1BXR B;  4CAF A;  4CO9 A;  4C8U A;  2FIA A;  3VRQ A;  2OU2 A;  4RI1 A;  3IEH A;  4IIY A;  2CY2 A;  1IID A;  1M44 A;  3CDX A;  3KR4 A;  1A2Z A;  4UFX A;  4CYP A;  2PR1 A;  4YN3 A;  4H2K A;  3U88 C;  2NYQ A;  4NGM A;  2FIW A;  3PLF B;  2ARH A;  2ZPA A;  3BJ8 A;  1RTQ A;  1CPX A;  3DR8 A;  3GYA A;  3I1U A;  4HNY B;  4JJX A;  4E2A A;  2ZW6 A;  3FED A;  2MP0 A;  1GYT A;  3B35 A;  4UCN A;  1XJO A;  3SJG A;  5AXI A;  3TLA A;  2D4O A;  1X12 A;  5CPA A;  3R96 A;  3TO9 A;  3TOA A;  1EE3 P;  1F57 A;  1Y7R A;  3MN8 A;  3NFZ A;  4P4J A;  2WSA A;  4OKO A;  3FEE A;  5F09 A;  2PIY A;  2KCW A;  2B4J C;  5I4M A;  1T36 B;  4R8F A;  2AUM A;  4C99 A;  5LYD A;  3KZW A;  5G20 A;  5J8F A;  3T0T A;  1FY7 A;  3D2P A;  3O8Z A;  1ZG7 A;  5KTC A;  3V38 A;  1P0H A;  5C88 A;  2PVW A;  3G3S A;  1YGH A;  4C7I A;  3FX6 A;  3NA6 A;  4YRH A;  1IIC A;  3S6K A;  3BUW B;  2EWB A;  3B3S A;  3W91 A;  1ZRS A;  1RXT A;  3ISX A;  4KOU A;  5FD8 A;  1XEB A;  2OLS A;  2Y1N A;  2RC4 A;  1WWZ A;  2R98 A;  2Y0M A;  4MRI A;  4MCS A;  1L0C A;  3EC4 A;  5IB0 A;  5F5X A;  4CDK A;  1NXJ A;  3P2H A;  1TKH A;  2GP4 A;  4NCZ A;  1LAM A;  3R1K A;  5JVL A;  3KAS A;  4CAV A;  1Z8W A;  2ABZ A;  2G9D A;  2PJA A;  2VXK A;  2B58 A;  2FL4 A;  2V77 A;  3GIU A;  3HUV A;  3QNV A;  4KZT A;  4MJ8 A;  4PQA A;  4KUA A;  2V8V A;  3LAC A;  2X7B A;  3KHZ A;  5F47 A;  2ZEL A;  3KQZ A;  4F0Y A;  4M8D A;  3RBU A;  4A37 A;  4UFW A;  1DE4 C;  3HPG G;  4A33 A;  5A28 A;  3DDD A;  5JM6 A;  5HKY A;  2P6F A;  2DF5 A;  3T07 A;  5K99 A;  3NH5 A;  4JVO A;  2PJB A;  3VGO A;  1PU9 A;  4W9Y A;  2C6G A;  2E28 A;  1J4J A;  4KOX A;  2J9A A;  4A30 A;  2PR8 A;  3OWC A;  1F2O A;  3H4Q A;  4CYQ A;  1VBH A;  2VKZ G;  1LCP A;  2PJ9 A;  4MBU A;  4DYO A;  1YME A;  4H1H A;  3TTH A;  4JWP A;  4NFR A;  1EO0 A;  4CGM A;  1K4J A;  4KOR A;  3WC7 A;  4P4B A;  2JBJ A;  2F8H A;  4YGO A;  2HWG A;  3EFA A;  5AGE A;  2QML A;  3TYX A;  3S6F A;  3QB8 A;  4OC2 A;  2FXF A;  2OZG A;  2PJ6 A;  4JXR A;  1Q2Y A;  2WPW A;  5G1Z A;  4X3R A;  4RS2 A;  4MHZ A;  5JPH A;  5J1Q A;  4CZ1 A;  1TKJ A;  1QSR A;  1Z5R A;  2J8N A;  3FH4 A;  3H8G A;  4L89 A;  5H84 A;  3RAM A;  4PV6 A;  1PUA A;  5F9M A;  1SQH A;  3TLE A;  3PFE A;  4QBJ A;  3BHX A;  1IOF A;  1C3O B;  4INJ A;  3TE4 A;  2FVG A;  3TLZ A;  2OZU A;  2QVP A;  2Z3P A;  4NGN A;  3D7F A;  1NMT A;  3TFY A;  5HH1 A;  3FBU A;  4MCQ A;  3PB9 X;  3T5M A;  2PJC A;  2K5T A;  4PK3 A;  4R9M A;  2HI6 A;  5J8C A;  2YNC A;  6CPA A;  3OAK A;  4ONU A;  4F6A A;  3TLC A;  2C6P A;  2HB6 A;  3IIB A;  3FMC A;  1Q7L A;  2YGW A;  4MHP A;  4FAI A;  3DR6 A;  2JDD A;  1AYE A;  4MI4 A;  1Y0Y A;  2POK A;  4MHN A;  4ZBG A;  2IJZ A;  3MGD A;  4PSW A;  2PCU A;  2PRB A;  2GLJ A;  3KR5 A;  2PE3 A;  4C9R A;  2ANP A;  3B3V A;  4IUS A;  3P2F A;  3VH9 A;  1QSN A;  1XE4 A;  3FXT A;  2AUN A;  4TJV A;  4C9V A;  2HQY A;  3S6G A;  1Y0R A;  3PT1 A;  4PXB A;  2AFS A;  3PFV A;  1IU8 A;  4OC3 A;  3G8W A;  2I00 A;  2I79 A;  4JLY A;  2R8V A;  1LAN A;  2IQ6 A;  1B6B A;  2B3U A;  4UIB A;  5HVF A;  3BUN B;  2CTC A;  2XPP A;  4BD9 A;  1M6V B;  2Z0Z A;  5JYB A;  2VQY A;  4XPD B;  4YU9 A;  3SXN A;  1I12 A;  2P6E A;  4FD7 A;  3KQX A;  3FEC A;  1CPS A;  4B5O A;  4COB A;  1VHO A;  2JEV A;  2P6G A;  2PJ5 A;  3FRM A;  5HKW A;  2ZEE A;  4J3G A;  1VKC A;  2A4N A;  3K9T A;  4ORF A;  4LUA A;  1YR0 A;  3NFQ A;  5IB9 A;  1YX0 A;  2OZH A;  5F46 A;  1C30 B;  1FT7 A;  2B4D A;  3JRU A;  1FNO A;  2YJT A;  2ZEH A;  4KLV A;  1S7L A;  2PVV A;  2XEF A;  5CNP A;  2FE7 A;  3QAH A;  1B47 A;  3VRP A;  1M4L A;  2EO8 A;  2PJ4 A;  5LRJ A;  1Y9K A;  4UEZ A;  5HVH A;  4TWE A;  1EZB A;  4MFL A;  1KUX A;  4FD6 A;  1YW4 A;  4XPD C;  4B12 A;  4KOS A;  4C7H A;  2VI7 A;  1YRE A;  1WJT A;  1YQE A;  2ZXV A;  3FVL A;  4GM5 A;  3I3G A;  2RB7 A;  4NGR A;  3F0A A;  3S6H A;  3ICU A;  4BPW B;  5K8P A;  3CXQ A;  1ARM A;  3GUX A;  2ZEO A;  4OIW A;  4RR2 B;  4A31 A;  2AFU A;  3PZJ A;  4X5K A;  2B4D B;  1UFH A;  4FUU A;  4A95 A;  3NH8 A;  5K8O A;  1QSM A;  2HC9 A;  2XEG A;  4KLW A;  1F2P A;  4R76 A;  3VAR A;  2VBQ A;  5JQ4 A;  1S7F A;  1ZG8 A;  2YND A;  4H6U A;  2Z3L A;  1IGB A;  3TT2 A;  5LYF A;  5HMN A;  2AFX A;  2CTB A;  1M4I A;  2G0B A;  3B8G A;  5LRG A;  4C8F A;  4Q36 A;  4EME A;  3BUM B;  1CM0 A;  2Q44 A;  1Q2D A;  3EO4 A;  4LX9 A; 
#chains in the Genus database with same CATH homology
 4OP4 A;  2ZEP A;  4A94 A;  1XF1 A;  1JQG A;  8CPA A;  4C8T A;  2I3C A;  4NGP A;  4YWY A;  4UEF A;  3D7G A;  2PRQ A;  3B3C A;  4JYW A;  4OME A;  2EK9 A;  3DLJ A;  4NGT A;  1CP6 A;  2WYR A;  3KI9 A;  3IJ3 A;  1ARL A;  3PEI A;  3CPA A;  4CDJ A;  4RUH A;  3T8W A;  1BAV A;  1ELM P;  3D4U A;  1Z2L A;  3SJX A;  2QJ8 A;  3B7I A;  3V7Z A;  3D68 A;  1TKF A;  3FF3 A;  5JH9 A;  4IHM A;  1ZG9 A;  2GLF A;  4A39 A;  4C86 A;  3BI0 A;  3PB4 X;  5HVG A;  3PB6 X;  1TXR A;  3SI0 A;  1PCA A;  3PBE A;  1YSJ A;  2PJ0 A;  2WZN A;  1LFW A;  2XEJ A;  3CPX A;  3H8E A;  1TF9 A;  2AFM A;  3HLP A;  2PJ2 A;  4MXU A;  1V6C A;  3IFE A;  3WC5 A;  4C9E A;  3I6S A;  1LOK A;  3D66 A;  4DJL A;  2AFO A;  4WWV A;  4C9A A;  3KGQ A;  3D67 A;  3PBB A;  4MHY A;  3S9N A;  2V8H A;  1R43 A;  4MMO A;  4FBE A;  4F9V A;  4X2T A;  1AMP A;  1BLL E;  3PRT A;  3TC8 A;  1XRY A;  5LYL A;  5D29 A;  3SJE A;  4CPA A;  4MCP A;  2C5Q A;  4IAV A;  2PJ1 A;  4C8C A;  2ZOG A;  4P10 A;  3VTA A;  3IC1 A;  4C85 A;  4P6Y A;  4C8A A;  1HDU A;  2CIJ A;  2ZOF A;  2BO9 A;  3WT4 A;  4JZ0 A;  4KSI A;  4IK2 A;  3GLJ A;  1WVM A;  4UEE A;  1VHE A;  7CPA A;  1Z8L A;  1CP7 A;  3BI1 A;  4O23 A;  3B3W A;  4UF4 A;  1PYT B;  5LRK A;  3N5F A;  4B6Z A;  1XFO A;  2IMO A;  3VAT A;  4EWT A;  3SI1 A;  4F8Z A;  4OC5 A;  2AFZ A;  4OID A;  3WAB A;  3RZA A;  3IWW A;  1ZLI A;  2ZEN A;  2RFH A;  3GB0 A;  1R3N A;  1NSA A;  2PJ8 A;  2EK8 A;  5ELY A;  1XMB A;  4UIA A;  5JGF A;  4X8I A;  4TJX A;  4PXE A;  3KL9 A;  1IY7 A;  2QYV A;  1Y7E A;  3D7H A;  4PXD A;  3PB7 X;  1UWY A;  4OC1 A;  1VGY A;  4NJQ A;  1VIX A;  2BCO A;  3WC6 A;  3S9M A;  3MRU A;  5THW A;  3LWU A;  1CBX A;  2CF4 A;  4LQG A;  2XEI A;  2OR4 A;  4ONW A;  3CT9 A;  1DTD A;  4P4F A;  3S9L A;  3SJF A;  1KWM A;  3DGV A;  4NGS A;  4P45 A;  4C8P A;  2O53 A;  4ZX8 A;  4PXC A;  4P4D A;  4AXV A;  2ZED A;  3BXM A;  1CX8 A;  2DEA A;  4KNG E;  2PJ3 A;  3D7D A;  2ZEG A;  2GRE A;  3PFO A;  2JEW A;  1BPM A;  2ZEM A;  4NGQ A;  3B2Y A;  3ISZ A;  3NH4 A;  2BOA A;  3FJU A;  3PB8 X;  4A38 A;  4C9U A;  1QMU A;  1CG2 A;  5K8N A;  4ZX9 A;  4P44 A;  4DUK A;  4ZY0 A;  1TF8 A;  2AFW A;  3K2K A;  4WJB A;  5LYI A;  5DS0 A;  4PPZ A;  1YW6 A;  5D8N A;  1ELL P;  1HDQ A;  4OC0 A;  1XBU A;  2V8D A;  4R7M A;  4OC4 A;  3SI2 A;  5HXD A;  1LAP A;  4ZI6 A;  2C1C A;  2PJ7 A;  1HEE A;  1H8L A;  3KHX A;  4TNU A;  3TX8 A;  1BPN A;  4Z65 A;  4C84 A;  1QQ9 A;  4G1P A;  3L2N A;  2PIZ A;  2ZEF A;  1ZLH A;  4MCR A;  2O4H A;  4ZYQ A;  2Q4Z A;  2OOT A;  1Y9Z A;  5K8M A;  4R6T A;  4F9U A;  3IO1 A;  2C6C A;  2Q43 A;  2V8G A;  4ZY1 A;  3B3T A;  3LMS A;  4EFD A;  2NSM A;  1YLO A;  2JBK A;  4FWU A;  4K3N A;  4ZY2 A;  3I74 A;  4NJR A;  1OBR A;  4Q7A A;  2VL1 A;  4P4I A;  5IR2 A;  2GU2 A;  3H8F A;  4P4E A;  2Q51 A;  2F7V A;  4C8U A;  3IEH A;  3CDX A;  3KR4 A;  4YN3 A;  4H2K A;  2NYQ A;  4NGM A;  3I1U A;  1RTQ A;  1CPX A;  3FED A;  1GYT A;  3B35 A;  1XJO A;  3SJG A;  5CPA A;  1EE3 P;  1F57 A;  3NFZ A;  3MN8 A;  4OKO A;  4P4J A;  3FEE A;  5F09 A;  2PIY A;  5I4M A;  4C99 A;  4R8F A;  5LYD A;  3KZW A;  1ZG7 A;  3V38 A;  2PVW A;  3FX6 A;  3NA6 A;  3B3S A;  2EWB A;  3ISX A;  4MRI A;  4MCS A;  4CDK A;  1TKH A;  2GP4 A;  1LAM A;  3KAS A;  2ABZ A;  2G9D A;  2PJA A;  3QNV A;  2V77 A;  3HUV A;  4PQA A;  2V8V A;  3KHZ A;  2ZEL A;  3KQZ A;  4A37 A;  5JM6 A;  1DE4 C;  3NH5 A;  2PJB A;  4W9Y A;  2C6G A;  2J9A A;  1F2O A;  2PJ9 A;  1LCP A;  4DYO A;  1YME A;  4NFR A;  3WC7 A;  4P4B A;  2JBJ A;  2F8H A;  4OC2 A;  2PJ6 A;  4X3R A;  4MHZ A;  5J1Q A;  1TKJ A;  1Z5R A;  3FH4 A;  3H8G A;  3RAM A;  3EIF A;  3PFE A;  3BHX A;  2FVG A;  2QVP A;  4NGN A;  3D7F A;  4MCQ A;  3PB9 X;  2PJC A;  6CPA A;  2C6P A;  2HB6 A;  3IIB A;  3FMC A;  1Q7L A;  4MHP A;  4FAI A;  1AYE A;  1Y0Y A;  2POK A;  4MHN A;  2IJZ A;  2PCU A;  3KR5 A;  2GLJ A;  2PE3 A;  4C9R A;  2ANP A;  3B3V A;  4TJV A;  3VH9 A;  4C9V A;  1Y0R A;  4PXB A;  2AFS A;  4OC3 A;  1LAN A;  2IQ6 A;  4UIB A;  5HVF A;  2CTC A;  4BD9 A;  4YU9 A;  3KQX A;  3FEC A;  1CPS A;  1VHO A;  2PJ5 A;  5CBM A;  2ZEE A;  3K9T A;  5IB9 A;  1FT7 A;  3JRU A;  1FNO A;  2ZEH A;  2PVV A;  2XEF A;  1M4L A;  2PJ4 A;  5LRJ A;  4UEZ A;  5HVH A;  4TWE A;  1YW4 A;  3FVL A;  4GM5 A;  2RB7 A;  4NGR A;  3ICU A;  5K8P A;  1ARM A;  3GUX A;  2ZEO A;  4OIW A;  2AFU A;  5K8O A;  4FUU A;  3NH8 A;  2HC9 A;  2XEG A;  4R76 A;  1F2P A;  3VAR A;  1ZG8 A;  1IGB A;  5LYF A;  2AFX A;  2CTB A;  4C8F A;  5LRG A;  4EME A;  3RBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...