4P4FA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor nc-2-40
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
total genus 262
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4fA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4fA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4fA02
1VHEA 3NFZA 4ONWA 4FWUA 1LCPA 4MCQA 3PFOA 3BI0A 2WZNA 3KQZA 4IK2A 2V77A 1XBUA 4PXBA 2AFSA 3FJUA 1YW6A 4A38A 4P4BA 3V7ZA 3KI9A 1XJOA 1XF1A 3B3TA 2NSMA 3D68A 4UEFA 2O4HA 3RBUA 3SI1A 5JM6A 4NJRA 4P6YA 4Q7AA 4C9VA 3KR4A 1Z2LA 3FF3A 2ZEDA 4ZX9A 4ZX8A 1M4LA 4AXVA 2PCUA 2HC9A 3ICUA 3KASA 4C9EA 1BAVA 4TJVA 4NGMA 1BPMA 4ZY1A 4OIWA 1RTQA 3IO1A 3S9NA 3SI0A 5D29A 1LAMA 2IQ6A 2RFHA 3I6SA 2C1CA 1CP6A 3BXMA 1AYEA 2PJ7A 3SI2A 5K8OA 3H8FA 2ZELA 4MCPA 2C6GA 2BOAA 1XMBA 4C9RA 2AFXA 3FMCA 2PJCA 2PIZA 2PJ9A 2DEAA 2IJZA 1Y9ZA 4NGRA 2AFOA 5LYLA 1CP7A 4OIDA 1R3NA 3SJGA 6CPAA 1TF8A 3D7GA 4X8IA 1V6CA 2EWBA 3BI1A 4O23A 2C6PA 1BLLE 4OC2A 2XEFA 3MN8A 4CPAA 2ZEGA 3KZWA 1ARLA 2F8HA 3IJ3A 2OOTA 4X2TA 2PJ5A 4MHNA 5HXDA 2FVGA 2CF4A 3PB8X 2HB6A 1HEEA 3D7FA 3VATA 2EK9A 2XEJA 3QNVA 3KL9A 2V8VA 4BD9A 3TC8A 4WWVA 4UF4A 5LYDA 4R6TA 5I4MA 2ZEMA 1CPSA 4ZI6A 2PJ0A 4NGQA 4A37A 4NGPA 4C99A 4IAVA 2PJAA 3D4UA 4C8UA 3SJXA 3PB9X 4K3NA 4P4EA 2Q51A 4PQAA 3VH9A 3IC1A 2AFWA 1TF9A 1GYTA 4UEZA 3SJFA 1BPNA 2V8GA 3WC6A 1ZG9A 1Q7LA 4C9UA 3PBEA 5THWA 3WABA 4PXDA 4F9VA 1CPXA 4MMOA 3TX8A 2XEGA 3KGQA 5JGFA 3K2KA 3RZAA 4NGSA 3VARA 3LMSA 2PIYA 4ZYQA 4G1PA 1H8LA 4TNUA 4KSIA 2AFMA 4P4JA 3ISXA 4UIAA 1QMUA 1IGBA 5HVGA 1ELMP 2GREA 2J9AA 5D8NA 2NYQA 3WC5A 4TWEA 1ELLP 3IEHA 5K8NA 2XEIA 4C85A 4F8ZA 3DGVA 1TKHA 1F2PA 4CDKA 3NH8A 3WT4A 3PB7X 1F57A 4R7MA 5K8PA 4H2KA 1PYTB 4OP4A 2V8HA 2RB7A 4R76A 3SJEA 1WVMA 2PJ3A 2GLFA 3CPXA 1IY7A 3DLJA 5LRGA 4MRIA 3FEEA 4EWTA 3RAMA 3ISZA 3D66A 4C8TA 2AFZA 1OBRA 5HVFA 2CTCA 3D7DA 3NA6A 1YW4A 2PJ8A 2QYVA 5ELYA 3B7IA 4YU9A 1JQGA 4NGNA 2PJ4A 3B2YA 2O53A 4NFRA 4A39A 1LOKA 4UEEA 3KHZA 4B6ZA 5J1QA 1YLOA 4PXEA 3T8WA 5LYFA 1YSJA 2CTBA 2WYRA 4GM5A 1HDQA 4MCSA 4R8FA 4C8AA 2ZEFA 3PRTA 2I3CA 1LFWA 4ZY2A 3NH5A 2ZEPA 4P4DA 4C8FA 5F09A 4OKOA 3BHXA 1ZLIA 1ZG8A 3B35A 4FAIA 1AMPA 1LAPA 2ZEHA 3L2NA 2C6CA 4PXCA 1VGYA 5JH9A 2Q43A 1Z8LA 1UWYA 1DTDA 3KQXA 4PPZA 1CG2A 3PB4X 1TXRA 1PCAA 1YMEA 1ARMA 4FUUA 1ZLHA 4F9UA 4DYOA 1FNOA 2PJ6A 4MHPA 1Z5RA 3FVLA 3B3WA 2OR4A 3GLJA 1XRYA 2PE3A 4IHMA 4ZY0A 1HDUA 3FX6A 3GUXA 1F2OA 2V8DA 4OC0A 1FT7A 2ZOGA 4MXUA 3EIFA 4C9AA 4C8PA 3IIBA 4EFDA 2F7VA 3FEDA 2JBJA 3D67A 4OC5A 5CBMA 1EE3P 2PJ1A 3V38A 2ZEEA 3HUVA 2IMOA 3KR5A 4JYWA 3PEIA 2ZENA 4W9YA 1TKJA 3B3CA 3JRUA 2ABZA 4DJLA 2JEWA 3D7HA 1Y0RA 1CBXA 4P45A 2VL1A 4OC1A 1KWMA 4YN3A 4A94A 2G9DA 2PVVA 3MRUA 2ZEOA 4MHYA 1NSAA 3I74A 3N5FA 1XFOA 3NH4A 4Z65A 3B3VA 4RUHA 4MCRA 2BCOA 3S9LA 1LANA 2BO9A 4P4FA 3S9MA 3FH4A 2JBKA 4OMEA 2POKA 2Q4ZA 3CT9A 3LWUA 4C84A 4LQGA 4C8CA 3GB0A 5LYIA 7CPAA 4C86A 1R43A 3I1UA 4JZ0A 4P44A 2EK8A 4OC4A 5CPAA 3PB6X 5HVHA 2AFUA 4NJQA 4TJXA 3HLPA 4MHZA 1QQ9A 4UIBA 3IWWA 3WC7A 5IB9A 2PJBA 5LRKA 2PRQA 3CPAA 3PBBA 4P10A 4X3RA 2QJ8A 4DUKA 3K9TA 3FECA 2ANPA 2PJ2A 3VTAA 4EMEA 2CIJA 4FBEA 3CDXA 5LRJA 1VHOA 3B3SA 2GLJA 4OC3A 2GU2A 4P4IA 4WJBA 1CX8A 1VIXA 5DS0A 1ZG7A 3PFEA 2QVPA 1Y0YA 8CPAA 1Y7EA 4KNGE 4YWYA 1DE4C 1TKFA 4NGTA 3IFEA 3H8GA 2ZOFA 2PVWA 3H8EA 3KHXA 5K8MA 4CDJA
chains in the Genus database with same CATH superfamily
1VHEA 4KOWA 3NFZA 4NCZA 1XIXA 2HV2A 4ONWA 4FWUA 4GS4A 1XOVA 1LCPA 4M3SA 2EZAA 4MCQA 3PFOA 3EO4A 4R87A 3EZBA 3BI0A 4JJXA 2WZNA 3NE7A 3KQZA 4IK2A 4B5PB 5F46A 1IU8A 3BLNA 3T07A 2V77A 1Q5XA 1XBUA 2K5TA 4PXBA 1JWQA 4M6IA 4NSQA 2AFSA 3FJUA 4KVXA 4KOSA 1YW6A 4QVTA 3C8OA 2XPNA 4P4BA 3BUNB 4A38A 4XNHC 4E2AA 4JVOA 2R82A 4H6ZA 1L0CA 4KSFA 4UFWA 3TO7A 4CYPA 1VKCA 3V7ZA 3KI9A 1Q2DA 1VBGA 2Z3LA 1XJOA 4CZ1A 1XF1A 3B3TA 2Z3KA 5JQ4A 2NSMA 3IU1A 3D68A 3DNSA 2AUNA 3GY9A 4UEFA 1ZL0A 2O4HA 4Y49B 3RBUA 3SI1A 5JM6A 3TYXA 4NJRA 1QSRA 4P6YA 1YREA 3QB8A 4Q7AA 4CAVA 2C5QA 4C9VA 2B3VA 3KR4A 1Z2LA 3FF3A 4C7HA 4KUAA 2ZEDA 4ZX9A 2PR1A 1M4LA 3DSBA 4ZX8A 3VWDA 2B0AA 3KRVA 4AXVA 2PCUA 2ZW7A 3S6FA 2HC9A 4R3KA 3R9GA 3ICUA 3KASA 1M44A 2HWGA 4IUSA 4C9EA 4BPXB 1BAVA 4TJVA 4NGMA 2JLMA 3GKRA 4KLWA 1BPMA 3RYOA 4ZY1A 2AE6A 4OIWA 1RTQA 3IO1A 2B4DB 2YJTA 3S9NA 3SI0A 5D29A 2EO8A 1LAMA 5A27A 3SHPA 2IQ6A 4K30A 2RFHA 4A4CA 3I6SA 2C1CA 3EXNA 3JUWA 4KOTA 1CP6A 3BXMA 3EC4A 1AYEA 3HPHE 1S60A 4BPWB 3GYAA 5GCNA 3T05A 4KOUA 4XPDB 5F13A 1P0HA 4MI1A 2CNTA 3ZNIA 2PJ7A 3SI2A 4MFKA 3B8GA 5K8OA 3H8FA 4YFJA 1NBWA 4E94A 2ZELA 4MCPA 2N3AB 1I12A 1Z9UA 4B5OA 2C6GA 2BOAA 4M8DA 1XMBA 3CZXA 4OADA 2X0SA 3SR3A 1Z8XA 4C9RA 2AFXA 1ZRSA 1IYKA 3OP0A 1GGOA 1Z4RA 5G1ZA 3FMCA 1YQEA 2PJCA 2J8NA 2PIZA 1UFHA 2PJ9A 2DEAA 3EZAA 2IJZA 4B5PA 4JLYA 3F9KC 1Y9ZA 1R57A 1J3LA 3U1BA 4NGRA 2D0OA 2YNDA 2BSWA 4F6AA 3BUWB 4AVBA 1P4NA 2AFOA 3CXQA 5LYLA 2HQYA 3TLGB 2MP0A 1CP7A 4UFVA 1KBLA 2Q7BA 4OIDA 1R3NA 3SJGA 6CPAA 5ISVA 3BUXB 1TF8A 4MFJA 3D7GA 3K9UA 4LQ6A 4M6HA 3OB2B 4X8IA 5CNPA 5DWMA 5EMIA 3R9FA 2ZW5A 2BUEA 2EWBA 1V6CA 5FD8A 1IYLA 1TIQA 3TO9A 3BI1A 4O23A 4QUSA 3W6XA 3O8ZA 1S3ZA 3PLFB 2C6PA 2Z3MA 2FE7A 1BLLE 4IF5A 4CAXA 2Z3OA 4KLVA 1YVKA 4OC2A 3IWEA 2XEFA 3MN8A 3FB3A 4CPAA 2HI6A 2CY2A 2ZEGA 3JTKA 2X7BA 3KZWA 4CGNA 1Y9WA 3TFYA 1ARLA 2F8HA 3IJ3A 5G22A 3TO6A 4CAEA 2XPPA 3E0KA 3TLZA 5HKYA 2OOTA 4X2TA 4CYNA 2Q0YA 3DR8A 1R61A 3G8WA 2PJ5A 4CAFA 1MK4A 1A2ZA 2QIRA 4HNYB 2FIWA 3TE4A 2Q4YA 4MHNA 5HXDA 2FVGA 4PSXA 3LACA 1K4JA 3BUOB 2CF4A 4INJA 3PB8X 2HB6A 3VRQA 1HEEA 3D7FA 3VATA 4MY3A 2EK9A 2XEJA 3QNVA 2OZUA 4BMHA 1YR0A 4CRZB 3KL9A 5J8FA 2V8VA 4BD9A 4CO9A 3TC8A 2GFQA 4WWVA 2P6GA 4AG7A 5HKZA 4RN7A 1M4GA 4UF4A 1Q2CA 2IL4A 4R6TA 2ZEMA 5LYDA 5I4MA 1BO4A 1CPSA 2PQ8A 4MHDA 4ZI6A 3OWCA 4KS9A 3T90A 2PJ0A 4NGQA 3TOBA 4NGPA 4A37A 4CGLA 1C30B 4C99A 4IAVA 2HUZA 2PJAA 2EVNA 3D4UA 2I79A 3SJXA 3PB9X 4MI4A 2PRBA 4K3NA 4C8UA 4P4EA 2Q51A 4JD6A 3TLYA 4PQAA 4PSWA 3D2PA 3VH9A 2R7HA 3UY5A 1KEEB 4ZBGA 1DIKA 5I0CA 3IC1A 2Z0ZA 2AFWA 2DIKA 1TF9A 2FT0A 4CAWA 1GYTA 4UEZA 2OB0A 2UV8G 4CRYB 3SJFA 1BPNA 2V8GA 4I49A 1ZG9A 1Q7LA 4MBUA 3WC6A 1KUXA 4AVAA 5C82A 3I3GA 4C9UA 2QMLA 3PBEA 1N71A 1XMTA 1VBHA 2DPSA 4A31A 5THWA 1B87A 1T36B 4R3LA 3P2FA 3WABA 5J8CA 4PXDA 3TLGA 2JDDA 4F9VA 3CXPA 2VKZG 2XPLA 1V0CA 3CXSA 4A95A 1M1DA 4KOYA 3D2MA 1S7KA 3VRPA 4KORA 2VZYA 3PFVA 1CPXA 4MMOA 2WPXA 3TX8A 2XEGA 4J3GA 2VEZA 3KGQA 3U88C 5JGFA 3K2KA 4A32A 4COBA 3RZAA 1NXJA 4NGSA 3VARA 3NFQA 4PK2A 3LMSA 2PIYA 5F49A 4G1PA 4ZYQA 1H8LA 1B47A 2DLAA 2I00A 4HKFA 4KSAA 2VBQA 5F47A 4TNUA 4KSIA 2EZBA 2AFMA 1IOFA 1EZAA 2GIVA 2XPOA 3R96A 4JWPA 4P4JA 3ISXA 1MJAA 2EUIA 4UIAA 1A9XB 1QMUA 1IGBA 4B13A 4J0NA 5J3XA 4KOVA 5HVGA 1ELMP 2B3UA 4H6UA 2GREA 2WSAA 4E5SA 4UA3A 2J9AA 5D8NA 4U9ZA 4AB7A 2NYQA 2RC4A 4TWEA 3WC5A 1ELLP 3IEHA 5K8NA 2XEIA 1CE8B 3OAKA 2BL1A 4C85A 4F8ZA 2REFA 3DGVA 3R1KA 2CBLA 1YVHA 4ORFA 2AJ6A 4MJXA 1ZO0A 1TKHA 3LD2A 1KC7A 2E28A 1F2PA 2B5GA 4M85A 3FNCA 4CDKA 3NH8A 3EFAA 3IU2A 3S6GA 5FVJA 3WT4A 3TOAA 1S7LA 1M6VB 4C68A 2ATRA 2D0PA 4BINA 3PB7X 4LX9A 1F57A 1BOBA 4FD7A 5EBVA 2H5MA 4R7MA 5K8PA 4QC6A 5H84A 4H2KA 3TLAA 1PYTB 1X12A 2YNEA 4L89A 2FCKA 4OP4A 3H4QA 2V8HA 3F8KA 4E8OA 2G0BA 2RB7A 4R76A 3SJEA 1WVMA 1CS0B 3EZEA 2PJ3A 2GLFA 3CPXA 1IY7A 3DLJA 4Q38A 5AG6A 5F1YA 5LRGA 4MRIA 3FEEA 2PC1A 4ONUA 5JVLA 3EY5A 2Q7SA 1WWZA 4EWTA 3RAMA 5F48A 3ISZA 3PP9A 3D66A 4C8TA 3SXOA 3DDDA 1Z9EA 5HKWA 2AFZA 4NEXA 3D8PA 4FD4A 4CYQA 1OBRA 5HVFA 2CTCA 4DNCA 3D7DA 4BTFA 2VXKA 3NA6A 1YW4A 2PJ8A 2QYVA 5ELYA 3B7IA 4L8AA 4YU9A 4LUAA 1OZPA 1Y7RA 1JQGA 1WJTA 4NGNA 2G3TA 1Z4EA 4B12A 2PJ4A 3B2YA 2O53A 4NFRA 1BXRB 4A39A 1VI4A 1LOKA 3RO0A 1S5KA 3PZJA 4Q36A 3KHZA 4UEEA 5G20A 4C2XA 4FD6A 2WUUA 4B6ZA 4UCMA 2YNCC 2Y1MA 4HPSA 1I1DA 1YLOA 4PXEA 3T8WA 1YSJA 5LYFA 1Z8WA 5J1QA 2B4BA 2CTBA 2WYRA 1I21A 4GM5A 1HDQA 1EO0A 2C27A 4IIXA 4MCSA 4R8FA 2Z3NA 2DF5A 1ZYMA 1NE9A 4YRHA 3FXTA 2FXFA 4C8AA 4KVME 5KTCA 3ZJ0A 2ZEFA 2F5IA 5BWAB 3PRTA 4C2YA 3BJ7A 2I3CA 1LFWA 2VZZA 1JDBC 4ZY2A 3K4IA 3RNZA 2R1IA 3NH5A 4A2ZA 4X5KA 2ZEPA 2CXAA 4B14A 1S7NA 3TLCA 4P4DA 5AGEA 4MFQA 4C7IA 3VRNA 1X10A 2B5GB 4C8FA 5F09A 2HROA 3N7ZA 3BHXA 5BY0A 4KZTA 3IWGA 4OKOA 4PV6A 1MJBA 2ARHA 1ZLIA 2YJVA 1ZG8A 3B35A 1SQHA 4FAIA 1AMPA 1YVOA 1LAPA 2ZEHA 1LRZA 2JEVA 3L2NA 2C6CA 4PXCA 1B6BA 1YX0A 1VGYA 5JH9A 2Q43A 4RR2B 1Z8LA 1UWYA 1DTDA 3KQXA 4PPZA 2OLSA 3HPGG 1CG2A 3PB4X 1TXRA 3FIXA 2FL4A 2Z3PA 1XE4A 1PCAA 1XF8A 1YMEA 2WPWA 3QAYA 3A9LA 1ARMA 4NF1A 4EVYA 2YNCA 2P0WA 4A33A 1PUAA 2Q04A 1ZLHA 4FUUA 1NMTA 4F9UA 4DYOA 5K99A 2J8MA 1FNOA 1YLEA 2PJ6A 4MHPA 3R9EA 4C2ZA 1Z5RA 2FSRA 3FVLA 1ON0A 2D4OA 2NMTA 3B3WA 5G21A 2OR4A 4GXHA 2Z11A 1C3OB 1PU9A 4M6GA 3GLJA 3TT2A 1XRYA 4IIYA 1YGHA 1IIDA 3VRRA 2PE3A 3C26A 1GHEA 5AXIA 2O28A 4MY0A 4IHMA 3TLBA 4A30A 4KOXA 4CS0B 4ZY0A 1HDUA 3FX6A 3GUXA 2G3AA 2QECA 3QAHA 1F2OA 2B4JC 3FBUA 4RS2A 1MJ9A 3W6SA 2V8DA 4OC0A 3FRMA 4B11A 3IGRA 1FT7A 4U9YA 2CNSA 2A4NA 2ZW6A 3GIUA 4QB9A 2ZOGA 4MXUA 3EIFA 3TCVA 4C9AA 2EZCA 3IIBA 4C8PA 2R98A 4EFDA 3DR6A 3VWEA 2F7VA 4HNXB 3FEDA 3W91A 2JBJA 4KUBA 4COGA 3G23A 1WK4A 2FIAA 1RO5A 3D67A 2P6EA 5HMNA 1JDEA 4R9MA 4OC5A 5CBMA 1EE3P 2ZW4A 3T0TA 2PJ1A 1M4DA 5JYBA 4PK3A 1NSLA 2PR8A 4U5YA 3V38A 2ZEEA 2JDCA 4JXQA 1CJWA 1M4IA 4CYOA 2Z10A 2FS5A 2IMOA 1FY7A 4JYWA 3HUVA 3KR5A 2ZENA 4W9YA 3PEIA 4UCNA 1TKJA 2J8RA 4H1HA 5KTAA 4R57A 3B3CA 3JRUA 3WR7A 3VROA 2D4PA 3PGPA 5JPHA 2ABZA 4DJLA 2JEWA 3D7HA 4ZGYB 2CNMA 1Y0RA 1CBXA 4GPLB 3NE8A 1IICA 2OH1A 3BJ8A 4P45A 2VL1A 5F5XA 4OC1A 1KWMA 4YN3A 1KUVA 4A94A 2G9DA 2PVVA 3MRUA 4II9A 3R95A 4MFLA 3JVNA 4Y49C 5IB0A 5AG4A 2ZEOA 4MHYA 1NSAA 2REEA 2Y1NA 4HNWB 5IV0A 1J4JA 2EBJA 4UFXA 2OZGA 3I74A 4BBHA 3TLEA 3N5FA 1FBVA 1XFOA 3NH4A 3S6KA 4Z65A 5EC4A 3B3VA 4RUHA 4UCPA 4MCRA 3NOJA 5IX3A 2PSWA 2BCOA 4AVCA 4F0XA 3SXNA 3S9LA 1LANA 2BO9A 2ZXVA 4P4FA 1Q2YA 3S9MA 3FH4A 2JBKA 4OMEA 2POKA 2Q4ZA 3CT9A 4FD5A 1IB1E 2P6FA 3MGDA 2ZPAA 3LWUA 4C84A 4LQGA 2R8VA 4C8CA 3GB0A 5LYIA 4B10A 7CPAA 4C86A 1R43A 3I1UA 4JZ0A 1CM0A 4MFZA 4P44A 2FM4A 1Y9KA 5A28A 1QSMA 2Q4VA 2EK8A 4OC4A 3F5BA 3PT1A 2Q44A 3F0AA 5CPAA 1KZFA 3PB6X 5HVHA 2AFUA 2YGWA 4XPKA 1Z8TA 4NJQA 4CGOA 5C88A 4RI1A 3TTHA 2KCWA 4TJXA 3HLPA 2Y0MA 3OB1B 1QSTA 4XPDC 4MHZA 1QQ9A 5DWNA 5AG5A 4UIBA 3IWWA 2OU2A 1RXTA 2VQYA 4OLLA 3GJZA 3WC7A 5IB9A 2PJBA 5LRKA 4F0YA 2PRQA 2BEIA 3CPAA 3PBBA 5IR2A 4A4BA 4P10A 4X3RA 1EZBA 2DXQA 2QJ8A 4DUKA 3H5ZA 4BPUB 1KUYA 2GANA 3D3SA 5AG7A 4YGOA 5KTDA 3K9TA 4XPLA 1IOIA 4UWIA 3FECA 2ANPA 2PJ2A 3VTAA 5H86A 4EMEA 3LODA 1QSOA 2VI7A 2CIJA 3HMJG 4CGMA 4FBEA 3CDXA 2OZHA 4QBJA 1AUGA 2GP4A 5LRJA 3G3SA 1VHOA 3B3SA 4MJ8A 1U6MA 3I9SA 1VHSA 2GLJA 4OC3A 3V8IA 2GU2A 3T9YA 4P4IA 1QSNA 4WJBA 4UWJA 1CX8A 3BUMB 5E96A 3KKWA 2ODFA 4NXYA 5F9MA 3P2HA 2PCNA 4EYSA 1VIXA 2DPTA 4UBRA 4AG9A 5DS0A 3S6HA 1ZG7A 3PFEA 4CGPA 4OAEA 1XEBA 2GE3A 4E0AA 4KVOE 3T5MA 3VGOA 3FYNA 1YK3A 2QVPA 4H89A 1Y0YA 5HH1A 1Y7EA 8CPAA 4KNGE 4YWYA 4XNHB 1DE4C 1S7FA 1TKFA 4NGTA 2B4DA 3IFEA 4MFPA 3ZZIA 3H8GA 2PDOA 2ZOFA 2PVWA 3H8EA 3KHXA 2B58A 5K8MA 4JXRA 4CDJA 2AUMA
chains in the Genus database with same CATH topology
1VHEA 3NFZA 4ONWA 4FWUA 1LCPA 4MCQA 3PFOA 3BI0A 2WZNA 3KQZA 4IK2A 2V77A 1XBUA 4PXBA 2AFSA 3FJUA 1YW6A 4A38A 4P4BA 3V7ZA 3KI9A 1XJOA 1XF1A 3B3TA 2NSMA 3D68A 4UEFA 2O4HA 3RBUA 3SI1A 5JM6A 4NJRA 4P6YA 4Q7AA 2C5QA 4C9VA 3KR4A 1Z2LA 3FF3A 2ZEDA 4ZX9A 4ZX8A 1M4LA 4AXVA 2PCUA 2HC9A 3ICUA 3KASA 4C9EA 1BAVA 4TJVA 4NGMA 1BPMA 4ZY1A 4OIWA 1RTQA 3IO1A 3S9NA 3SI0A 5D29A 1LAMA 2IQ6A 2RFHA 3I6SA 2C1CA 1CP6A 3BXMA 1AYEA 2PJ7A 3SI2A 5K8OA 3H8FA 2ZELA 4MCPA 2C6GA 2BOAA 1XMBA 4C9RA 2AFXA 3FMCA 2PJCA 2PIZA 2PJ9A 2DEAA 2IJZA 1Y9ZA 4NGRA 2AFOA 5LYLA 1CP7A 4OIDA 1R3NA 3SJGA 6CPAA 1TF8A 3D7GA 4X8IA 1V6CA 2EWBA 3BI1A 4O23A 2C6PA 1BLLE 4OC2A 2XEFA 3MN8A 4CPAA 2ZEGA 3KZWA 1ARLA 2F8HA 3IJ3A 2OOTA 4X2TA 2PJ5A 4MHNA 5HXDA 2FVGA 2CF4A 3PB8X 2HB6A 1HEEA 3D7FA 3VATA 2EK9A 2XEJA 3QNVA 3KL9A 2V8VA 4BD9A 3TC8A 4WWVA 4UF4A 5LYDA 4R6TA 5I4MA 2ZEMA 1CPSA 4ZI6A 2PJ0A 4NGQA 4A37A 4NGPA 4C99A 4IAVA 2PJAA 3D4UA 4C8UA 3SJXA 3PB9X 4K3NA 4P4EA 2Q51A 4PQAA 3VH9A 3IC1A 2AFWA 1TF9A 1GYTA 4UEZA 3SJFA 1BPNA 2V8GA 3WC6A 1ZG9A 1Q7LA 4C9UA 3PBEA 5THWA 3WABA 4PXDA 4F9VA 1CPXA 4MMOA 3TX8A 2XEGA 3KGQA 5JGFA 3K2KA 3RZAA 4NGSA 3VARA 3LMSA 2PIYA 4ZYQA 4G1PA 1H8LA 4TNUA 4KSIA 2AFMA 4P4JA 3ISXA 4UIAA 1QMUA 1IGBA 5HVGA 1ELMP 2GREA 2J9AA 5D8NA 2NYQA 3WC5A 4TWEA 1ELLP 3IEHA 5K8NA 2XEIA 4C85A 4F8ZA 3DGVA 1TKHA 1F2PA 4CDKA 3NH8A 3WT4A 3PB7X 1F57A 4R7MA 5K8PA 4H2KA 1PYTB 4OP4A 2V8HA 2RB7A 4R76A 3SJEA 1WVMA 2PJ3A 2GLFA 3CPXA 1IY7A 3DLJA 5LRGA 4MRIA 3FEEA 4EWTA 3RAMA 3ISZA 3D66A 4C8TA 2AFZA 1OBRA 5HVFA 2CTCA 3D7DA 3NA6A 1YW4A 2PJ8A 2QYVA 5ELYA 3B7IA 4YU9A 1JQGA 4NGNA 2PJ4A 3B2YA 2O53A 4NFRA 4A39A 1LOKA 4UEEA 3KHZA 4B6ZA 5J1QA 1YLOA 4PXEA 3T8WA 5LYFA 1YSJA 2CTBA 2WYRA 4GM5A 1HDQA 4MCSA 4R8FA 4C8AA 2ZEFA 3PRTA 2I3CA 1LFWA 4ZY2A 3NH5A 2ZEPA 4P4DA 4C8FA 5F09A 4OKOA 3BHXA 1ZLIA 1ZG8A 3B35A 4FAIA 1AMPA 1LAPA 2ZEHA 3L2NA 2C6CA 4PXCA 1VGYA 5JH9A 2Q43A 1Z8LA 1UWYA 1DTDA 3KQXA 4PPZA 1CG2A 3PB4X 1TXRA 1PCAA 1YMEA 1ARMA 4FUUA 1ZLHA 4F9UA 4DYOA 1FNOA 2PJ6A 4MHPA 1Z5RA 3FVLA 3B3WA 2OR4A 3GLJA 1XRYA 2PE3A 4IHMA 4ZY0A 1HDUA 3FX6A 3GUXA 1F2OA 2V8DA 4OC0A 1FT7A 2ZOGA 4MXUA 3EIFA 4C9AA 4C8PA 3IIBA 4EFDA 2F7VA 3FEDA 2JBJA 3D67A 4OC5A 5CBMA 1EE3P 2PJ1A 3V38A 2ZEEA 3HUVA 2IMOA 3KR5A 4JYWA 3PEIA 2ZENA 4W9YA 1TKJA 3B3CA 3JRUA 2ABZA 4DJLA 2JEWA 3D7HA 1Y0RA 1CBXA 4P45A 2VL1A 4OC1A 1KWMA 4YN3A 4A94A 2G9DA 2PVVA 3MRUA 2ZEOA 4MHYA 1NSAA 3I74A 3N5FA 1XFOA 3NH4A 4Z65A 3B3VA 4RUHA 4MCRA 2BCOA 3S9LA 1LANA 2BO9A 4P4FA 3S9MA 3FH4A 2JBKA 4OMEA 2POKA 2Q4ZA 3CT9A 3LWUA 4C84A 4LQGA 4C8CA 3GB0A 5LYIA 7CPAA 4C86A 1R43A 3I1UA 4JZ0A 4P44A 2EK8A 4OC4A 5CPAA 3PB6X 5HVHA 2AFUA 4NJQA 4TJXA 3HLPA 4MHZA 1QQ9A 4UIBA 3IWWA 3WC7A 5IB9A 2PJBA 5LRKA 2PRQA 3CPAA 3PBBA 5IR2A 4P10A 4X3RA 2QJ8A 4DUKA 3K9TA 3FECA 2ANPA 2PJ2A 3VTAA 4EMEA 2CIJA 4FBEA 3CDXA 2GP4A 5LRJA 1VHOA 3B3SA 2GLJA 4OC3A 2GU2A 4P4IA 4WJBA 1CX8A 1VIXA 5DS0A 1ZG7A 3PFEA 2QVPA 1Y0YA 8CPAA 1Y7EA 4KNGE 4YWYA 1DE4C 1TKFA 4NGTA 3IFEA 3H8GA 2ZOFA 2PVWA 3H8EA 3KHXA 5K8MA 4CDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHE A;  3NFZ A;  4ONW A;  4FWU A;  1LCP A;  4MCQ A;  3PFO A;  3BI0 A;  2WZN A;  3KQZ A;  4IK2 A;  2V77 A;  1XBU A;  4PXB A;  2AFS A;  3FJU A;  1YW6 A;  4A38 A;  4P4B A;  3V7Z A;  3KI9 A;  1XJO A;  1XF1 A;  3B3T A;  2NSM A;  3D68 A;  4UEF A;  2O4H A;  3RBU A;  3SI1 A;  5JM6 A;  4NJR A;  4P6Y A;  4Q7A A;  4C9V A;  3KR4 A;  1Z2L A;  3FF3 A;  2ZED A;  4ZX9 A;  4ZX8 A;  1M4L A;  4AXV A;  2PCU A;  2HC9 A;  3ICU A;  3KAS A;  4C9E A;  1BAV A;  4TJV A;  4NGM A;  1BPM A;  4ZY1 A;  4OIW A;  1RTQ A;  3IO1 A;  3S9N A;  3SI0 A;  5D29 A;  1LAM A;  2IQ6 A;  2RFH A;  3I6S A;  2C1C A;  1CP6 A;  3BXM A;  1AYE A;  2PJ7 A;  3SI2 A;  5K8O A;  3H8F A;  2ZEL A;  4MCP A;  2C6G A;  2BOA A;  1XMB A;  4C9R A;  2AFX A;  3FMC A;  2PJC A;  2PIZ A;  2PJ9 A;  2DEA A;  2IJZ A;  1Y9Z A;  4NGR A;  2AFO A;  5LYL A;  1CP7 A;  4OID A;  1R3N A;  3SJG A;  6CPA A;  1TF8 A;  3D7G A;  4X8I A;  1V6C A;  2EWB A;  3BI1 A;  4O23 A;  2C6P A;  1BLL E;  4OC2 A;  2XEF A;  3MN8 A;  4CPA A;  2ZEG A;  3KZW A;  1ARL A;  2F8H A;  3IJ3 A;  2OOT A;  4X2T A;  2PJ5 A;  4MHN A;  5HXD A;  2FVG A;  2CF4 A;  3PB8 X;  2HB6 A;  1HEE A;  3D7F A;  3VAT A;  2EK9 A;  2XEJ A;  3QNV A;  3KL9 A;  2V8V A;  4BD9 A;  3TC8 A;  4WWV A;  4UF4 A;  5LYD A;  4R6T A;  5I4M A;  2ZEM A;  1CPS A;  4ZI6 A;  2PJ0 A;  4NGQ A;  4A37 A;  4NGP A;  4C99 A;  4IAV A;  2PJA A;  3D4U A;  4C8U A;  3SJX A;  3PB9 X;  4K3N A;  4P4E A;  2Q51 A;  4PQA A;  3VH9 A;  3IC1 A;  2AFW A;  1TF9 A;  1GYT A;  4UEZ A;  3SJF A;  1BPN A;  2V8G A;  3WC6 A;  1ZG9 A;  1Q7L A;  4C9U A;  3PBE A;  5THW A;  3WAB A;  4PXD A;  4F9V A;  1CPX A;  4MMO A;  3TX8 A;  2XEG A;  3KGQ A;  5JGF A;  3K2K A;  3RZA A;  4NGS A;  3VAR A;  3LMS A;  2PIY A;  4ZYQ A;  4G1P A;  1H8L A;  4TNU A;  4KSI A;  2AFM A;  4P4J A;  3ISX A;  4UIA A;  1QMU A;  1IGB A;  5HVG A;  1ELM P;  2GRE A;  2J9A A;  5D8N A;  2NYQ A;  3WC5 A;  4TWE A;  1ELL P;  3IEH A;  5K8N A;  2XEI A;  4C85 A;  4F8Z A;  3DGV A;  1TKH A;  1F2P A;  4CDK A;  3NH8 A;  3WT4 A;  3PB7 X;  1F57 A;  4R7M A;  5K8P A;  4H2K A;  1PYT B;  4OP4 A;  2V8H A;  2RB7 A;  4R76 A;  3SJE A;  1WVM A;  2PJ3 A;  2GLF A;  3CPX A;  1IY7 A;  3DLJ A;  5LRG A;  4MRI A;  3FEE A;  4EWT A;  3RAM A;  3ISZ A;  3D66 A;  4C8T A;  2AFZ A;  1OBR A;  5HVF A;  2CTC A;  3D7D A;  3NA6 A;  1YW4 A;  2PJ8 A;  2QYV A;  5ELY A;  3B7I A;  4YU9 A;  1JQG A;  4NGN A;  2PJ4 A;  3B2Y A;  2O53 A;  4NFR A;  4A39 A;  1LOK A;  4UEE A;  3KHZ A;  4B6Z A;  5J1Q A;  1YLO A;  4PXE A;  3T8W A;  5LYF A;  1YSJ A;  2CTB A;  2WYR A;  4GM5 A;  1HDQ A;  4MCS A;  4R8F A;  4C8A A;  2ZEF A;  3PRT A;  2I3C A;  1LFW A;  4ZY2 A;  3NH5 A;  2ZEP A;  4P4D A;  4C8F A;  5F09 A;  4OKO A;  3BHX A;  1ZLI A;  1ZG8 A;  3B35 A;  4FAI A;  1AMP A;  1LAP A;  2ZEH A;  3L2N A;  2C6C A;  4PXC A;  1VGY A;  5JH9 A;  2Q43 A;  1Z8L A;  1UWY A;  1DTD A;  3KQX A;  4PPZ A;  1CG2 A;  3PB4 X;  1TXR A;  1PCA A;  1YME A;  1ARM A;  4FUU A;  1ZLH A;  4F9U A;  4DYO A;  1FNO A;  2PJ6 A;  4MHP A;  1Z5R A;  3FVL A;  3B3W A;  2OR4 A;  3GLJ A;  1XRY A;  2PE3 A;  4IHM A;  4ZY0 A;  1HDU A;  3FX6 A;  3GUX A;  1F2O A;  2V8D A;  4OC0 A;  1FT7 A;  2ZOG A;  4MXU A;  3EIF A;  4C9A A;  4C8P A;  3IIB A;  4EFD A;  2F7V A;  3FED A;  2JBJ A;  3D67 A;  4OC5 A;  5CBM A;  1EE3 P;  2PJ1 A;  3V38 A;  2ZEE A;  3HUV A;  2IMO A;  3KR5 A;  4JYW A;  3PEI A;  2ZEN A;  4W9Y A;  1TKJ A;  3B3C A;  3JRU A;  2ABZ A;  4DJL A;  2JEW A;  3D7H A;  1Y0R A;  1CBX A;  4P45 A;  2VL1 A;  4OC1 A;  1KWM A;  4YN3 A;  4A94 A;  2G9D A;  2PVV A;  3MRU A;  2ZEO A;  4MHY A;  1NSA A;  3I74 A;  3N5F A;  1XFO A;  3NH4 A;  4Z65 A;  3B3V A;  4RUH A;  4MCR A;  2BCO A;  3S9L A;  1LAN A;  2BO9 A;  4P4F A;  3S9M A;  3FH4 A;  2JBK A;  4OME A;  2POK A;  2Q4Z A;  3CT9 A;  3LWU A;  4C84 A;  4LQG A;  4C8C A;  3GB0 A;  5LYI A;  7CPA A;  4C86 A;  1R43 A;  3I1U A;  4JZ0 A;  4P44 A;  2EK8 A;  4OC4 A;  5CPA A;  3PB6 X;  5HVH A;  2AFU A;  4NJQ A;  4TJX A;  3HLP A;  4MHZ A;  1QQ9 A;  4UIB A;  3IWW A;  3WC7 A;  5IB9 A;  2PJB A;  5LRK A;  2PRQ A;  3CPA A;  3PBB A;  4P10 A;  4X3R A;  2QJ8 A;  4DUK A;  3K9T A;  3FEC A;  2ANP A;  2PJ2 A;  3VTA A;  4EME A;  2CIJ A;  4FBE A;  3CDX A;  5LRJ A;  1VHO A;  3B3S A;  2GLJ A;  4OC3 A;  2GU2 A;  4P4I A;  4WJB A;  1CX8 A;  1VIX A;  5DS0 A;  1ZG7 A;  3PFE A;  2QVP A;  1Y0Y A;  8CPA A;  1Y7E A;  4KNG E;  4YWY A;  1DE4 C;  1TKF A;  4NGT A;  3IFE A;  3H8G A;  2ZOF A;  2PVW A;  3H8E A;  3KHX A;  5K8M A;  4CDJ A; 
#chains in the Genus database with same CATH topology
 1VHE A;  4KOW A;  3NFZ A;  4NCZ A;  1XIX A;  2HV2 A;  4ONW A;  4FWU A;  4GS4 A;  1XOV A;  1LCP A;  4M3S A;  2EZA A;  4MCQ A;  3PFO A;  3EO4 A;  4R87 A;  3EZB A;  3BI0 A;  4JJX A;  2WZN A;  3NE7 A;  3KQZ A;  4IK2 A;  4B5P B;  5F46 A;  1IU8 A;  3BLN A;  3T07 A;  2V77 A;  1Q5X A;  1XBU A;  2K5T A;  4PXB A;  1JWQ A;  4M6I A;  4NSQ A;  2AFS A;  3FJU A;  4KVX A;  4KOS A;  1YW6 A;  4QVT A;  3C8O A;  2XPN A;  4P4B A;  3BUN B;  4A38 A;  4XNH C;  4E2A A;  4JVO A;  2R82 A;  4H6Z A;  1L0C A;  4KSF A;  4UFW A;  3TO7 A;  4CYP A;  1VKC A;  3V7Z A;  3KI9 A;  1Q2D A;  1VBG A;  2Z3L A;  1XJO A;  4CZ1 A;  1XF1 A;  3B3T A;  2Z3K A;  5JQ4 A;  2NSM A;  3IU1 A;  3D68 A;  3DNS A;  2AUN A;  3GY9 A;  4UEF A;  1ZL0 A;  2O4H A;  4Y49 B;  3RBU A;  3SI1 A;  5JM6 A;  3TYX A;  4NJR A;  1QSR A;  4P6Y A;  1YRE A;  3QB8 A;  4Q7A A;  4CAV A;  2C5Q A;  4C9V A;  2B3V A;  3KR4 A;  1Z2L A;  3FF3 A;  4C7H A;  4KUA A;  2ZED A;  4ZX9 A;  2PR1 A;  1M4L A;  3DSB A;  4ZX8 A;  3VWD A;  2B0A A;  3KRV A;  4AXV A;  2PCU A;  2ZW7 A;  3S6F A;  2HC9 A;  4R3K A;  3R9G A;  3ICU A;  3KAS A;  1M44 A;  2HWG A;  4IUS A;  4C9E A;  4BPX B;  1BAV A;  4TJV A;  4NGM A;  2JLM A;  3GKR A;  4KLW A;  1BPM A;  3RYO A;  4ZY1 A;  2AE6 A;  4OIW A;  1RTQ A;  3IO1 A;  2B4D B;  2YJT A;  3S9N A;  3SI0 A;  5D29 A;  2EO8 A;  1LAM A;  5A27 A;  3SHP A;  2IQ6 A;  4K30 A;  2RFH A;  4A4C A;  3I6S A;  2C1C A;  3EXN A;  3JUW A;  4KOT A;  1CP6 A;  3BXM A;  3EC4 A;  1AYE A;  3HPH E;  1S60 A;  4BPW B;  3GYA A;  5GCN A;  3T05 A;  4KOU A;  4XPD B;  5F13 A;  1P0H A;  4MI1 A;  2CNT A;  3ZNI A;  2PJ7 A;  3SI2 A;  4MFK A;  3B8G A;  5K8O A;  3H8F A;  4YFJ A;  1NBW A;  4E94 A;  2ZEL A;  4MCP A;  2N3A B;  1I12 A;  1Z9U A;  4B5O A;  2C6G A;  2BOA A;  4M8D A;  1XMB A;  3CZX A;  4OAD A;  2X0S A;  3SR3 A;  1Z8X A;  4C9R A;  2AFX A;  1ZRS A;  1IYK A;  3OP0 A;  1GGO A;  1Z4R A;  5G1Z A;  3FMC A;  1YQE A;  2PJC A;  2J8N A;  2PIZ A;  1UFH A;  2PJ9 A;  2DEA A;  3EZA A;  2IJZ A;  4B5P A;  4JLY A;  3F9K C;  1Y9Z A;  1R57 A;  1J3L A;  3U1B A;  4NGR A;  2D0O A;  2YND A;  2BSW A;  4F6A A;  3BUW B;  4AVB A;  1P4N A;  2AFO A;  3CXQ A;  5LYL A;  2HQY A;  3TLG B;  2MP0 A;  1CP7 A;  4UFV A;  1KBL A;  2Q7B A;  4OID A;  1R3N A;  3SJG A;  6CPA A;  5ISV A;  3BUX B;  1TF8 A;  4MFJ A;  3D7G A;  3K9U A;  4LQ6 A;  4M6H A;  3OB2 B;  4X8I A;  5CNP A;  5DWM A;  5EMI A;  3R9F A;  2ZW5 A;  2BUE A;  2EWB A;  1V6C A;  5FD8 A;  1IYL A;  1TIQ A;  3TO9 A;  3BI1 A;  4O23 A;  4QUS A;  3W6X A;  3O8Z A;  1S3Z A;  3PLF B;  2C6P A;  2Z3M A;  2FE7 A;  1BLL E;  4IF5 A;  4CAX A;  2Z3O A;  4KLV A;  1YVK A;  4OC2 A;  3IWE A;  2XEF A;  3MN8 A;  3FB3 A;  4CPA A;  2HI6 A;  2CY2 A;  2ZEG A;  3JTK A;  2X7B A;  3KZW A;  4CGN A;  1Y9W A;  3TFY A;  1ARL A;  2F8H A;  3IJ3 A;  5G22 A;  3TO6 A;  4CAE A;  2XPP A;  3E0K A;  3TLZ A;  5HKY A;  2OOT A;  4X2T A;  4CYN A;  2Q0Y A;  3DR8 A;  1R61 A;  3G8W A;  2PJ5 A;  4CAF A;  1MK4 A;  1A2Z A;  2QIR A;  4HNY B;  2FIW A;  3TE4 A;  2Q4Y A;  4MHN A;  5HXD A;  2FVG A;  4PSX A;  3LAC A;  1K4J A;  3BUO B;  2CF4 A;  4INJ A;  3PB8 X;  2HB6 A;  3VRQ A;  1HEE A;  3D7F A;  3VAT A;  4MY3 A;  2EK9 A;  2XEJ A;  3QNV A;  2OZU A;  4BMH A;  1YR0 A;  4CRZ B;  3KL9 A;  5J8F A;  2V8V A;  4BD9 A;  4CO9 A;  3TC8 A;  2GFQ A;  4WWV A;  2P6G A;  4AG7 A;  5HKZ A;  4RN7 A;  1M4G A;  4UF4 A;  1Q2C A;  2IL4 A;  4R6T A;  2ZEM A;  5LYD A;  5I4M A;  1BO4 A;  1CPS A;  2PQ8 A;  4MHD A;  4ZI6 A;  3OWC A;  4KS9 A;  3T90 A;  2PJ0 A;  4NGQ A;  3TOB A;  4NGP A;  4A37 A;  4CGL A;  1C30 B;  4C99 A;  4IAV A;  2HUZ A;  2PJA A;  2EVN A;  3D4U A;  2I79 A;  3SJX A;  3PB9 X;  4MI4 A;  2PRB A;  4K3N A;  4C8U A;  4P4E A;  2Q51 A;  4JD6 A;  3TLY A;  4PQA A;  4PSW A;  3D2P A;  3VH9 A;  2R7H A;  3UY5 A;  1KEE B;  4ZBG A;  1DIK A;  5I0C A;  3IC1 A;  2Z0Z A;  2AFW A;  2DIK A;  1TF9 A;  2FT0 A;  4CAW A;  1GYT A;  4UEZ A;  2OB0 A;  2UV8 G;  4CRY B;  3SJF A;  1BPN A;  2V8G A;  4I49 A;  1ZG9 A;  1Q7L A;  4MBU A;  3WC6 A;  1KUX A;  4AVA A;  5C82 A;  3I3G A;  4C9U A;  2QML A;  3PBE A;  1N71 A;  1XMT A;  1VBH A;  2DPS A;  4A31 A;  5THW A;  1B87 A;  1T36 B;  4R3L A;  3P2F A;  3WAB A;  5J8C A;  4PXD A;  3TLG A;  2JDD A;  4F9V A;  3CXP A;  2VKZ G;  2XPL A;  1V0C A;  3CXS A;  4A95 A;  1M1D A;  4KOY A;  3D2M A;  1S7K A;  3VRP A;  4KOR A;  2VZY A;  3PFV A;  1CPX A;  4MMO A;  2WPX A;  3TX8 A;  2XEG A;  4J3G A;  2VEZ A;  3KGQ A;  3U88 C;  5JGF A;  3K2K A;  4A32 A;  4COB A;  3RZA A;  1NXJ A;  4NGS A;  3VAR A;  3NFQ A;  4PK2 A;  3LMS A;  2PIY A;  5F49 A;  4G1P A;  4ZYQ A;  1H8L A;  1B47 A;  2DLA A;  2I00 A;  4HKF A;  4KSA A;  2VBQ A;  5F47 A;  4TNU A;  4KSI A;  2EZB A;  2AFM A;  1IOF A;  1EZA A;  2GIV A;  2XPO A;  3R96 A;  4JWP A;  4P4J A;  3ISX A;  1MJA A;  2EUI A;  4UIA A;  1A9X B;  1QMU A;  1IGB A;  4B13 A;  4J0N A;  5J3X A;  4KOV A;  5HVG A;  1ELM P;  2B3U A;  4H6U A;  2GRE A;  2WSA A;  4E5S A;  4UA3 A;  2J9A A;  5D8N A;  4U9Z A;  4AB7 A;  2NYQ A;  2RC4 A;  4TWE A;  3WC5 A;  1ELL P;  3IEH A;  5K8N A;  2XEI A;  1CE8 B;  3OAK A;  2BL1 A;  4C85 A;  4F8Z A;  2REF A;  3DGV A;  3R1K A;  2CBL A;  1YVH A;  4ORF A;  2AJ6 A;  4MJX A;  1ZO0 A;  1TKH A;  3LD2 A;  1KC7 A;  2E28 A;  1F2P A;  2B5G A;  4M85 A;  3FNC A;  4CDK A;  3NH8 A;  3EFA A;  3IU2 A;  3S6G A;  5FVJ A;  3WT4 A;  3TOA A;  1S7L A;  1M6V B;  4C68 A;  2ATR A;  2D0P A;  4BIN A;  3PB7 X;  4LX9 A;  1F57 A;  1BOB A;  4FD7 A;  5EBV A;  2H5M A;  4R7M A;  5K8P A;  4QC6 A;  5H84 A;  4H2K A;  3TLA A;  1PYT B;  1X12 A;  2YNE A;  4L89 A;  2FCK A;  4OP4 A;  3H4Q A;  2V8H A;  3F8K A;  4E8O A;  2G0B A;  2RB7 A;  4R76 A;  3SJE A;  1WVM A;  1CS0 B;  3EZE A;  2PJ3 A;  2GLF A;  3CPX A;  1IY7 A;  3DLJ A;  4Q38 A;  5AG6 A;  5F1Y A;  5LRG A;  4MRI A;  3FEE A;  2PC1 A;  4ONU A;  5JVL A;  3EY5 A;  2Q7S A;  1WWZ A;  4EWT A;  3RAM A;  5F48 A;  3ISZ A;  3PP9 A;  3D66 A;  4C8T A;  3SXO A;  3DDD A;  1Z9E A;  5HKW A;  2AFZ A;  4NEX A;  3D8P A;  4FD4 A;  4CYQ A;  1OBR A;  5HVF A;  2CTC A;  4DNC A;  3D7D A;  4BTF A;  2VXK A;  3NA6 A;  1YW4 A;  2PJ8 A;  2QYV A;  5ELY A;  3B7I A;  4L8A A;  4YU9 A;  4LUA A;  1OZP A;  1Y7R A;  1JQG A;  1WJT A;  4NGN A;  2G3T A;  1Z4E A;  4B12 A;  2PJ4 A;  3B2Y A;  2O53 A;  4NFR A;  1BXR B;  4A39 A;  1VI4 A;  1LOK A;  3RO0 A;  1S5K A;  3PZJ A;  4Q36 A;  3KHZ A;  4UEE A;  5G20 A;  4C2X A;  4FD6 A;  2WUU A;  4B6Z A;  4UCM A;  2YNC C;  2Y1M A;  4HPS A;  1I1D A;  1YLO A;  4PXE A;  3T8W A;  1YSJ A;  5LYF A;  1Z8W A;  5J1Q A;  2B4B A;  2CTB A;  2WYR A;  1I21 A;  4GM5 A;  1HDQ A;  1EO0 A;  2C27 A;  4IIX A;  4MCS A;  4R8F A;  2Z3N A;  2DF5 A;  1ZYM A;  1NE9 A;  4YRH A;  3FXT A;  2FXF A;  4C8A A;  4KVM E;  5KTC A;  3ZJ0 A;  2ZEF A;  2F5I A;  5BWA B;  3PRT A;  4C2Y A;  3BJ7 A;  2I3C A;  1LFW A;  2VZZ A;  1JDB C;  4ZY2 A;  3K4I A;  3RNZ A;  2R1I A;  3NH5 A;  4A2Z A;  4X5K A;  2ZEP A;  2CXA A;  4B14 A;  1S7N A;  3TLC A;  4P4D A;  5AGE A;  4MFQ A;  4C7I A;  3VRN A;  1X10 A;  2B5G B;  4C8F A;  5F09 A;  2HRO A;  3N7Z A;  3BHX A;  5BY0 A;  4KZT A;  3IWG A;  4OKO A;  4PV6 A;  1MJB A;  2ARH A;  1ZLI A;  2YJV A;  1ZG8 A;  3B35 A;  1SQH A;  4FAI A;  1AMP A;  1YVO A;  1LAP A;  2ZEH A;  1LRZ A;  2JEV A;  3L2N A;  2C6C A;  4PXC A;  1B6B A;  1YX0 A;  1VGY A;  5JH9 A;  2Q43 A;  4RR2 B;  1Z8L A;  1UWY A;  1DTD A;  3KQX A;  4PPZ A;  2OLS A;  3HPG G;  1CG2 A;  3PB4 X;  1TXR A;  3FIX A;  2FL4 A;  2Z3P A;  1XE4 A;  1PCA A;  1XF8 A;  1YME A;  2WPW A;  3QAY A;  3A9L A;  1ARM A;  4NF1 A;  4EVY A;  2YNC A;  2P0W A;  4A33 A;  1PUA A;  2Q04 A;  1ZLH A;  4FUU A;  1NMT A;  4F9U A;  4DYO A;  5K99 A;  2J8M A;  1FNO A;  1YLE A;  2PJ6 A;  4MHP A;  3R9E A;  4C2Z A;  1Z5R A;  2FSR A;  3FVL A;  1ON0 A;  2D4O A;  2NMT A;  3B3W A;  5G21 A;  2OR4 A;  4GXH A;  2Z11 A;  1C3O B;  1PU9 A;  4M6G A;  3GLJ A;  3TT2 A;  1XRY A;  4IIY A;  1YGH A;  1IID A;  3VRR A;  2PE3 A;  3C26 A;  1GHE A;  5AXI A;  2O28 A;  4MY0 A;  4IHM A;  3TLB A;  4A30 A;  4KOX A;  4CS0 B;  4ZY0 A;  1HDU A;  3FX6 A;  3GUX A;  2G3A A;  2QEC A;  3QAH A;  1F2O A;  2B4J C;  3FBU A;  4RS2 A;  1MJ9 A;  3W6S A;  2V8D A;  4OC0 A;  3FRM A;  4B11 A;  3IGR A;  1FT7 A;  4U9Y A;  2CNS A;  2A4N A;  2ZW6 A;  3GIU A;  4QB9 A;  2ZOG A;  4MXU A;  3EIF A;  3TCV A;  4C9A A;  2EZC A;  3IIB A;  4C8P A;  2R98 A;  4EFD A;  3DR6 A;  3VWE A;  2F7V A;  4HNX B;  3FED A;  3W91 A;  2JBJ A;  4KUB A;  4COG A;  3G23 A;  1WK4 A;  2FIA A;  1RO5 A;  3D67 A;  2P6E A;  5HMN A;  1JDE A;  4R9M A;  4OC5 A;  5CBM A;  1EE3 P;  2ZW4 A;  3T0T A;  2PJ1 A;  1M4D A;  5JYB A;  4PK3 A;  1NSL A;  2PR8 A;  4U5Y A;  3V38 A;  2ZEE A;  2JDC A;  4JXQ A;  1CJW A;  1M4I A;  4CYO A;  2Z10 A;  2FS5 A;  2IMO A;  1FY7 A;  4JYW A;  3HUV A;  3KR5 A;  2ZEN A;  4W9Y A;  3PEI A;  4UCN A;  1TKJ A;  2J8R A;  4H1H A;  5KTA A;  4R57 A;  3B3C A;  3JRU A;  3WR7 A;  3VRO A;  2D4P A;  3PGP A;  5JPH A;  2ABZ A;  4DJL A;  2JEW A;  3D7H A;  4ZGY B;  2CNM A;  1Y0R A;  1CBX A;  4GPL B;  3NE8 A;  1IIC A;  2OH1 A;  3BJ8 A;  4P45 A;  2VL1 A;  5F5X A;  4OC1 A;  1KWM A;  4YN3 A;  1KUV A;  4A94 A;  2G9D A;  2PVV A;  3MRU A;  4II9 A;  3R95 A;  4MFL A;  3JVN A;  4Y49 C;  5IB0 A;  5AG4 A;  2ZEO A;  4MHY A;  1NSA A;  2REE A;  2Y1N A;  4HNW B;  5IV0 A;  1J4J A;  2EBJ A;  4UFX A;  2OZG A;  3I74 A;  4BBH A;  3TLE A;  3N5F A;  1FBV A;  1XFO A;  3NH4 A;  3S6K A;  4Z65 A;  5EC4 A;  3B3V A;  4RUH A;  4UCP A;  4MCR A;  3NOJ A;  5IX3 A;  2PSW A;  2BCO A;  4AVC A;  4F0X A;  3SXN A;  3S9L A;  1LAN A;  2BO9 A;  2ZXV A;  4P4F A;  1Q2Y A;  3S9M A;  3FH4 A;  2JBK A;  4OME A;  2POK A;  2Q4Z A;  3CT9 A;  4FD5 A;  1IB1 E;  2P6F A;  3MGD A;  2ZPA A;  3LWU A;  4C84 A;  4LQG A;  2R8V A;  4C8C A;  3GB0 A;  5LYI A;  4B10 A;  7CPA A;  4C86 A;  1R43 A;  3I1U A;  4JZ0 A;  1CM0 A;  4MFZ A;  4P44 A;  2FM4 A;  1Y9K A;  5A28 A;  1QSM A;  2Q4V A;  2EK8 A;  4OC4 A;  3F5B A;  3PT1 A;  2Q44 A;  3F0A A;  5CPA A;  1KZF A;  3PB6 X;  5HVH A;  2AFU A;  2YGW A;  4XPK A;  1Z8T A;  4NJQ A;  4CGO A;  5C88 A;  4RI1 A;  3TTH A;  2KCW A;  4TJX A;  3HLP A;  2Y0M A;  3OB1 B;  1QST A;  4XPD C;  4MHZ A;  1QQ9 A;  5DWN A;  5AG5 A;  4UIB A;  3IWW A;  2OU2 A;  1RXT A;  2VQY A;  4OLL A;  3GJZ A;  3WC7 A;  5IB9 A;  2PJB A;  5LRK A;  4F0Y A;  2PRQ A;  2BEI A;  3CPA A;  3PBB A;  5IR2 A;  4A4B A;  4P10 A;  4X3R A;  1EZB A;  2DXQ A;  2QJ8 A;  4DUK A;  3H5Z A;  4BPU B;  1KUY A;  2GAN A;  3D3S A;  5AG7 A;  4YGO A;  5KTD A;  3K9T A;  4XPL A;  1IOI A;  4UWI A;  3FEC A;  2ANP A;  2PJ2 A;  3VTA A;  5H86 A;  4EME A;  3LOD A;  1QSO A;  2VI7 A;  2CIJ A;  3HMJ G;  4CGM A;  4FBE A;  3CDX A;  2OZH A;  4QBJ A;  1AUG A;  2GP4 A;  5LRJ A;  3G3S A;  1VHO A;  3B3S A;  4MJ8 A;  1U6M A;  3I9S A;  1VHS A;  2GLJ A;  4OC3 A;  3V8I A;  2GU2 A;  3T9Y A;  4P4I A;  1QSN A;  4WJB A;  4UWJ A;  1CX8 A;  3BUM B;  5E96 A;  3KKW A;  2ODF A;  4NXY A;  5F9M A;  3P2H A;  2PCN A;  4EYS A;  1VIX A;  2DPT A;  4UBR A;  4AG9 A;  5DS0 A;  3S6H A;  1ZG7 A;  3PFE A;  4CGP A;  4OAE A;  1XEB A;  2GE3 A;  4E0A A;  4KVO E;  3T5M A;  3VGO A;  3FYN A;  1YK3 A;  2QVP A;  4H89 A;  1Y0Y A;  5HH1 A;  1Y7E A;  8CPA A;  4KNG E;  4YWY A;  4XNH B;  1DE4 C;  1S7F A;  1TKF A;  4NGT A;  2B4D A;  3IFE A;  4MFP A;  3ZZI A;  3H8G A;  2PDO A;  2ZOF A;  2PVW A;  3H8E A;  3KHX A;  2B58 A;  5K8M A;  4JXR A;  4CDJ A;  2AUM A; 
#chains in the Genus database with same CATH homology
 1VHE A;  3NFZ A;  4ONW A;  4FWU A;  1LCP A;  4MCQ A;  3PFO A;  3BI0 A;  2WZN A;  3KQZ A;  4IK2 A;  2V77 A;  1XBU A;  4PXB A;  2AFS A;  3FJU A;  1YW6 A;  4A38 A;  4P4B A;  3V7Z A;  3KI9 A;  1XJO A;  1XF1 A;  3B3T A;  2NSM A;  3D68 A;  4UEF A;  2O4H A;  3RBU A;  3SI1 A;  5JM6 A;  4NJR A;  4P6Y A;  4Q7A A;  2C5Q A;  4C9V A;  3KR4 A;  1Z2L A;  3FF3 A;  2ZED A;  4ZX9 A;  4ZX8 A;  1M4L A;  4AXV A;  2PCU A;  2HC9 A;  3ICU A;  3KAS A;  4C9E A;  1BAV A;  4TJV A;  4NGM A;  1BPM A;  4ZY1 A;  4OIW A;  1RTQ A;  3IO1 A;  3S9N A;  3SI0 A;  5D29 A;  1LAM A;  2IQ6 A;  2RFH A;  3I6S A;  2C1C A;  1CP6 A;  3BXM A;  1AYE A;  2PJ7 A;  3SI2 A;  5K8O A;  3H8F A;  2ZEL A;  4MCP A;  2C6G A;  2BOA A;  1XMB A;  4C9R A;  2AFX A;  3FMC A;  2PJC A;  2PIZ A;  2PJ9 A;  2DEA A;  2IJZ A;  1Y9Z A;  4NGR A;  2AFO A;  5LYL A;  1CP7 A;  4OID A;  1R3N A;  3SJG A;  6CPA A;  1TF8 A;  3D7G A;  4X8I A;  1V6C A;  2EWB A;  3BI1 A;  4O23 A;  2C6P A;  1BLL E;  4OC2 A;  2XEF A;  3MN8 A;  4CPA A;  2ZEG A;  3KZW A;  1ARL A;  2F8H A;  3IJ3 A;  2OOT A;  4X2T A;  2PJ5 A;  4MHN A;  5HXD A;  2FVG A;  2CF4 A;  3PB8 X;  2HB6 A;  1HEE A;  3D7F A;  3VAT A;  2EK9 A;  2XEJ A;  3QNV A;  3KL9 A;  2V8V A;  4BD9 A;  3TC8 A;  4WWV A;  4UF4 A;  5LYD A;  4R6T A;  5I4M A;  2ZEM A;  1CPS A;  4ZI6 A;  2PJ0 A;  4NGQ A;  4A37 A;  4NGP A;  4C99 A;  4IAV A;  2PJA A;  3D4U A;  4C8U A;  3SJX A;  3PB9 X;  4K3N A;  4P4E A;  2Q51 A;  4PQA A;  3VH9 A;  3IC1 A;  2AFW A;  1TF9 A;  1GYT A;  4UEZ A;  3SJF A;  1BPN A;  2V8G A;  3WC6 A;  1ZG9 A;  1Q7L A;  4C9U A;  3PBE A;  5THW A;  3WAB A;  4PXD A;  4F9V A;  1CPX A;  4MMO A;  3TX8 A;  2XEG A;  3KGQ A;  5JGF A;  3K2K A;  3RZA A;  4NGS A;  3VAR A;  3LMS A;  2PIY A;  4ZYQ A;  4G1P A;  1H8L A;  4TNU A;  4KSI A;  2AFM A;  4P4J A;  3ISX A;  4UIA A;  1QMU A;  1IGB A;  5HVG A;  1ELM P;  2GRE A;  2J9A A;  5D8N A;  2NYQ A;  3WC5 A;  4TWE A;  1ELL P;  3IEH A;  5K8N A;  2XEI A;  4C85 A;  4F8Z A;  3DGV A;  1TKH A;  1F2P A;  4CDK A;  3NH8 A;  3WT4 A;  3PB7 X;  1F57 A;  4R7M A;  5K8P A;  4H2K A;  1PYT B;  4OP4 A;  2V8H A;  2RB7 A;  4R76 A;  3SJE A;  1WVM A;  2PJ3 A;  2GLF A;  3CPX A;  1IY7 A;  3DLJ A;  5LRG A;  4MRI A;  3FEE A;  4EWT A;  3RAM A;  3ISZ A;  3D66 A;  4C8T A;  2AFZ A;  1OBR A;  5HVF A;  2CTC A;  3D7D A;  3NA6 A;  1YW4 A;  2PJ8 A;  2QYV A;  5ELY A;  3B7I A;  4YU9 A;  1JQG A;  4NGN A;  2PJ4 A;  3B2Y A;  2O53 A;  4NFR A;  4A39 A;  1LOK A;  4UEE A;  3KHZ A;  4B6Z A;  5J1Q A;  1YLO A;  4PXE A;  3T8W A;  5LYF A;  1YSJ A;  2CTB A;  2WYR A;  4GM5 A;  1HDQ A;  4MCS A;  4R8F A;  4C8A A;  2ZEF A;  3PRT A;  2I3C A;  1LFW A;  4ZY2 A;  3NH5 A;  2ZEP A;  4P4D A;  4C8F A;  5F09 A;  4OKO A;  3BHX A;  1ZLI A;  1ZG8 A;  3B35 A;  4FAI A;  1AMP A;  1LAP A;  2ZEH A;  3L2N A;  2C6C A;  4PXC A;  1VGY A;  5JH9 A;  2Q43 A;  1Z8L A;  1UWY A;  1DTD A;  3KQX A;  4PPZ A;  1CG2 A;  3PB4 X;  1TXR A;  1PCA A;  1YME A;  1ARM A;  4FUU A;  1ZLH A;  4F9U A;  4DYO A;  1FNO A;  2PJ6 A;  4MHP A;  1Z5R A;  3FVL A;  3B3W A;  2OR4 A;  3GLJ A;  1XRY A;  2PE3 A;  4IHM A;  4ZY0 A;  1HDU A;  3FX6 A;  3GUX A;  1F2O A;  2V8D A;  4OC0 A;  1FT7 A;  2ZOG A;  4MXU A;  3EIF A;  4C9A A;  4C8P A;  3IIB A;  4EFD A;  2F7V A;  3FED A;  2JBJ A;  3D67 A;  4OC5 A;  5CBM A;  1EE3 P;  2PJ1 A;  3V38 A;  2ZEE A;  3HUV A;  2IMO A;  3KR5 A;  4JYW A;  3PEI A;  2ZEN A;  4W9Y A;  1TKJ A;  3B3C A;  3JRU A;  2ABZ A;  4DJL A;  2JEW A;  3D7H A;  1Y0R A;  1CBX A;  4P45 A;  2VL1 A;  4OC1 A;  1KWM A;  4YN3 A;  4A94 A;  2G9D A;  2PVV A;  3MRU A;  2ZEO A;  4MHY A;  1NSA A;  3I74 A;  3N5F A;  1XFO A;  3NH4 A;  4Z65 A;  3B3V A;  4RUH A;  4MCR A;  2BCO A;  3S9L A;  1LAN A;  2BO9 A;  4P4F A;  3S9M A;  3FH4 A;  2JBK A;  4OME A;  2POK A;  2Q4Z A;  3CT9 A;  3LWU A;  4C84 A;  4LQG A;  4C8C A;  3GB0 A;  5LYI A;  7CPA A;  4C86 A;  1R43 A;  3I1U A;  4JZ0 A;  4P44 A;  2EK8 A;  4OC4 A;  5CPA A;  3PB6 X;  5HVH A;  2AFU A;  4NJQ A;  4TJX A;  3HLP A;  4MHZ A;  1QQ9 A;  4UIB A;  3IWW A;  3WC7 A;  5IB9 A;  2PJB A;  5LRK A;  2PRQ A;  3CPA A;  3PBB A;  5IR2 A;  4P10 A;  4X3R A;  2QJ8 A;  4DUK A;  3K9T A;  3FEC A;  2ANP A;  2PJ2 A;  3VTA A;  4EME A;  2CIJ A;  4FBE A;  3CDX A;  2GP4 A;  5LRJ A;  1VHO A;  3B3S A;  2GLJ A;  4OC3 A;  2GU2 A;  4P4I A;  4WJB A;  1CX8 A;  1VIX A;  5DS0 A;  1ZG7 A;  3PFE A;  2QVP A;  1Y0Y A;  8CPA A;  1Y7E A;  4KNG E;  4YWY A;  1DE4 C;  1TKF A;  4NGT A;  3IFE A;  3H8G A;  2ZOF A;  2PVW A;  3H8E A;  3KHX A;  5K8M A;  4CDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...