4P4FA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor nc-2-40
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 262
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4fA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4fA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4fA02
4OKOA 4ZYQA 2QVPA 1XFOA 3PRTA 2GLJA 2PJ3A 4TWEA 5LRJA 4PXEA 1EE3P 3FF3A 1ZLHA 4MCRA 3KQXA 3KL9A 4P4DA 3HUVA 5F09A 2POKA 4EFDA 1CPXA 2XEJA 4X2TA 1ELMP 4EMEA 2ZEHA 1VHEA 3B3CA 3SJXA 3S9NA 2QJ8A 2AFOA 1PCAA 2GU2A 2ZELA 1TKJA 4MCSA 4DYOA 2PJ2A 4CPAA 1R3NA 4UIAA 4C9RA 1LAMA 2F7VA 3I74A 4MHPA 1KWMA 3NA6A 3B3SA 3IO1A 2PVVA 2XEGA 2IMOA 3PEIA 1PYTB 6CPAA 5HXDA 3VARA 4YU9A 4NGRA 2F8HA 3FEDA 2HC9A 2IJZA 4FBEA 4NGSA 3IJ3A 3FEEA 3BHXA 4MCQA 4NGPA 2BCOA 1AMPA 3PB6X 2V8VA 2AFSA 1FNOA 2CF4A 2CIJA 3D4UA 4P45A 3KASA 3PB7X 1ELLP 3ISZA 2PJ4A 4C8AA 3ISXA 2NSMA 2RB7A 2OR4A 1Y9ZA 1CPSA 1TF8A 2GLFA 4X8IA 4R7MA 4C86A 4R6TA 4FUUA 2Q51A 5K8PA 3PFOA 2ABZA 3D7DA 4R76A 1CBXA 3LMSA 4ZY0A 3I1UA 4NGNA 1LAPA 1DTDA 4Z65A 5HVHA 3MN8A 2Q43A 3SI0A 2AFZA 2PJ9A 5K8NA 1CG2A 4UEFA 2V8HA 5K8OA 4BD9A 4OMEA 1ARLA 4A94A 3FMCA 2ZENA 2AFMA 4UIBA 3RZAA 5IB9A 4UF4A 3EIFA 1YMEA 2AFWA 5D29A 2ZEPA 3BI1A 4MHZA 1QQ9A 2ANPA 3L2NA 3CT9A 1FT7A 1XJOA 1F57A 3WT4A 1BLLE 2PE3A 4DUKA 3V38A 3H8FA 1Q7LA 4KNGE 3HLPA 4IK2A 2C6CA 5D8NA 1QMUA 3B3VA 1DE4C 3S9MA 4ONWA 4OIDA 3GUXA 4OC0A 2JBKA 1TKFA 2QYVA 1CX8A 2NYQA 4IAVA 4MCPA 4O23A 3FVLA 1VHOA 1HDQA 2PJ5A 4G1PA 2PJAA 4B6ZA 1BAVA 1YW4A 2PIYA 4PPZA 4C8TA 3BI0A 4P4JA 4JYWA 2WYRA 3PBEA 4C9EA 4OC2A 3WABA 4C9AA 3DGVA 3S9LA 4P4EA 3KR5A 5ELYA 3SJEA 1XRYA 4NJRA 1ZG8A 4MHNA 4LQGA 1IGBA 1ARMA 4P4BA 4C85A 2ZEOA 3D7GA 2PIZA 1TKHA 2AFUA 5LYFA 1CP6A 1WVMA 3SI2A 1AYEA 2PJBA 2OOTA 3NH4A 3PB8X 3DLJA 2CTCA 4P44A 1LOKA 3I6SA 4OC3A 2ZEMA 3WC7A 3TC8A 1Z2LA 3V7ZA 1Y0YA 3D67A 2ZEFA 1BPNA 2O4HA 4F9UA 1TF9A 1Z8LA 3B3WA 2I3CA 3QNVA 4OP4A 7CPAA 2ZEDA 1IY7A 3B3TA 2FVGA 4AXVA 3NFZA 3KR4A 4WJBA 1H8LA 1Y7EA 4YWYA 4YN3A 1YSJA 1TXRA 3T8WA 3VTAA 4OC1A 4NGTA 5JM6A 3K9TA 2V77A 2XEFA 1CP7A 3JRUA 4NJQA 3VH9A 2ZEEA 5J1QA 3TX8A 1LCPA 3RAMA 1F2OA 1RTQA 3KQZA 1ZG9A 2C1CA 3SJGA 3VATA 3B2YA 4C8FA 1HEEA 4C9UA 4UEZA 4UEEA 1R43A 4PXBA 2JEWA 3B7IA 4DJLA 2C6GA 4A38A 2PJCA 5I4MA 4NGMA 5THWA 3PB4X 3GB0A 4MRIA 3D7HA 4OC4A 3RBUA 3FH4A 3KGQA 4P4IA 5LRGA 4PQAA 5LYIA 3IIBA 2V8DA 2PJ1A 4C8PA 2O53A 2PJ6A 4MXUA 1VIXA 4GM5A 1XBUA 4NGQA 3K2KA 2HB6A 4CDJA 3SI1A 3MRUA 4OIWA 1Y0RA 2JBJA 1XF1A 3D7FA 3IWWA 1GYTA 4C8CA 4TNUA 4X3RA 2PJ8A 1YW6A 2BO9A 4C9VA 1XMBA 4PXCA 1VGYA 1Z5RA 1LANA 3B35A 1JQGA 4P10A 5K8MA 2PRQA 2PJ7A 3N5FA 3ICUA 4P4FA 4C8UA 4MMOA 4CDKA 4A39A 3PFEA 4IHMA 3FECA 4TJVA 2CTBA 1V6CA 2AFXA 4ZY2A 3IEHA 5DS0A 2J9AA 3H8EA 3LWUA 4Q7AA 1LFWA 8CPAA 5JGFA 4F8ZA 3NH5A 3CPAA 2EK9A 2RFHA 3KI9A 3D68A 4ZX8A 4K3NA 3FX6A 5HVFA 3SJFA 3IFEA 4TJXA 4A37A 2WZNA 3FJUA 4F9VA 4W9YA 3PB9X 5CBMA 1UWYA 4C99A 4MHYA 4RUHA 3WC6A 4OC5A 1HDUA 1ZLIA 1ZG7A 5CPAA 4NFRA 5LYLA 4C84A 4H2KA 1NSAA 3GLJA 4JZ0A 3NH8A 1YLOA 2ZOGA 2PVWA 3IC1A 4R8FA 5HVGA 1M4LA 2ZOFA 2EWBA 4KSIA 3CDXA 2VL1A 3CPXA 2G9DA 4ZX9A 4ZI6A 5JH9A 2C6PA 4FWUA 1BPMA 2BOAA 3WC5A 1OBRA 3KZWA 2PJ0A 3BXMA 2XEIA 4PXDA 2IQ6A 2V8GA 3PBBA 4ZY1A 2PCUA 4WWVA 4EWTA 2EK8A 3D66A 2Q4ZA 3KHZA 2DEAA 2GREA 5LRKA 2ZEGA 4FAIA 4P6YA 3KHXA 5LYDA 1F2PA 3H8GA
chains in the Genus database with same CATH superfamily
2B0AA 4OKOA 1M6VB 4ZYQA 2QVPA 5HKYA 1XFOA 4XPLA 3OP0A 2GLJA 3PRTA 2PJ3A 4HKFA 4UCPA 3FNCA 4TWEA 3VWDA 4Y49C 5A27A 3LODA 2FIWA 5LRJA 4PXEA 4ZBGA 1EE3P 2CNTA 2X0SA 2YNEA 4R9MA 4COGA 4B10A 3TT2A 3FF3A 1J3LA 1ZLHA 4MCRA 3S6GA 4KSAA 5F48A 3BUWB 3KL9A 3KQXA 4P4DA 3W6XA 3HUVA 2HROA 1Q2CA 1XMTA 3TLAA 1XOVA 5F09A 2OZGA 2POKA 3SXNA 1CPXA 4EFDA 2XEJA 1MJBA 2WPWA 3P2FA 1ELMP 4UWJA 4X2TA 4MHDA 1Z8XA 2ZEHA 2FSRA 4EMEA 1Z4EA 2XPNA 3W91A 3KRVA 1VHEA 3B3CA 3SJXA 3S9NA 2QJ8A 2AFOA 4A4CA 3BUMB 1PCAA 2FXFA 4GS4A 4BMHA 1IOIA 1C3OB 4H6ZA 4KS9A 2N3AB 4MFZA 2GU2A 5C82A 1K4JA 2XPOA 1YVOA 2ZELA 3G8WA 5AG4A 1TKJA 4MCSA 1QSMA 2PJ2A 4KLVA 4CPAA 3DR8A 4DYOA 2OB0A 2VZZA 1R3NA 2WUUA 4UIAA 1JDEA 4M6IA 4C9RA 4FD5A 4C7IA 2ZW6A 1LAMA 2F7VA 4LX9A 4MFLA 2JLMA 4MHPA 1KWMA 4YRHA 3NA6A 4EVYA 2GP4A 4OAEA 3B3SA 3IO1A 3RO0A 4JWPA 5A28A 2PVVA 5KTAA 2XEGA 1JWQA 2IMOA 3PEIA 3TLGA 4COBA 3O8ZA 1PYTB 1S3ZA 2BEIA 1VKCA 1M4IA 3F0AA 3VARA 4YU9A 6CPAA 5HXDA 4NGRA 2F8HA 2FCKA 3FEDA 4KVME 2HC9A 5J8FA 1C30B 3EXNA 5DWMA 5J3XA 3NFQA 2G0BA 2Q0YA 2RC4A 2IJZA 3CXPA 4FBEA 1IICA 2B5GB 4NGSA 3IJ3A 3FEEA 3BHXA 4MCQA 3T90A 4CGPA 4NGPA 3VRPA 2BCOA 1R61A 3DNSA 2OU2A 1I21A 1AMPA 3PB6X 4XPDB 2V8VA 4X5KA 1T36B 2HI6A 2AFSA 2R1IA 4PSXA 5JPHA 3K4IA 3GYAA 3TOAA 1FNOA 1RO5A 2CF4A 4A2ZA 4AVCA 1YGHA 2CIJA 1KUVA 3D4UA 4IUSA 1ON0A 4P45A 1IIDA 4JLYA 3KASA 3A9LA 3PB7X 1ELLP 3ISZA 4F0XA 2Q7BA 2PJ4A 1R57A 1JDBC 3EZBA 1XIXA 2DF5A 3OB2B 1X10A 4C8AA 2VQYA 3FBUA 3ISXA 3S6FA 4MFJA 4AG7A 2NSMA 2RB7A 2OR4A 1Y9ZA 1LRZA 3TLYA 1CPSA 1TF8A 3PGPA 5I0CA 2GLFA 2YNDA 4FD7A 4R7MA 4X8IA 5G22A 3TO6A 2AUNA 4UFVA 2D0OA 3FYNA 4E94A 5E96A 4B11A 4C86A 4R6TA 4JXRA 4FUUA 4FD4A 3SXOA 3KKWA 5H84A 1B47A 1GHEA 4XNHB 2Q51A 1J4JA 3PP9A 5K8PA 1U6MA 4BPUB 3VRRA 1KUXA 3PFOA 4JD6A 1Z9EA 3D7DA 2ABZA 4M6GA 1NSLA 4R76A 1CBXA 5HKWA 3LMSA 2YJTA 5F47A 1P4NA 2B3UA 3D8PA 4RN7A 4ZY0A 3I1UA 5BWAB 4NGNA 1LAPA 1DTDA 4CRYB 1DIKA 4C2YA 1KEEB 4H89A 2FE7A 4Z65A 5HVHA 3MN8A 4B12A 2D0PA 4H1HA 1PU9A 2Q43A 3SI0A 5AXIA 4L89A 4RS2A 2AFZA 2PJ9A 3EZEA 3BJ7A 3HMJG 2EO8A 2AJ6A 4RR2B 3R95A 5K8NA 4UFXA 1IOFA 2EZAA 1CG2A 4B13A 3N7ZA 3H5ZA 3NOJA 4UEFA 2V8HA 5K8OA 4A33A 4BD9A 2REEA 4OMEA 1ARLA 2H5MA 4A94A 3FMCA 2Y0MA 2ZENA 2AFMA 4UIBA 3RZAA 5IB9A 4R3LA 4UF4A 3EZAA 4JJXA 2G3TA 3EIFA 1Q2DA 1YMEA 5F49A 4E2AA 2AFWA 5D29A 2B4BA 2ZEPA 1UFHA 3BI1A 2B5GA 3QAYA 1QQ9A 2ANPA 4MHZA 4GPLB 4B5PA 5AGEA 3L2NA 3CT9A 2PDOA 4A31A 4XPDC 1FT7A 1Q5XA 1MJAA 1XJOA 1F57A 4A30A 4E8OA 3I3GA 3WT4A 1KUYA 1BLLE 2PE3A 2Z3KA 3JVNA 5HH1A 3V38A 4DUKA 2XPLA 3H8FA 4MJ8A 1Q7LA 3TO9A 4KNGE 3HLPA 5F5XA 5G21A 4IK2A 2C6CA 4KORA 4OADA 5D8NA 3TOBA 1QMUA 3B3VA 4M6HA 1DE4C 3S9MA 4ONWA 4OIDA 1GGOA 1WK4A 3GUXA 4AVBA 4E5SA 1NE9A 2Z3LA 4OC0A 2JBKA 3QAHA 3HPHE 2J8RA 1VHSA 1TKFA 2A4NA 4MI4A 2VI7A 3EC4A 4AG9A 2QYVA 1CX8A 3I9SA 2CBLA 1BOBA 2NYQA 4MCPA 3ZNIA 3FVLA 4IAVA 4O23A 1VHOA 5AG6A 3RNZA 5HKZA 4XNHC 1HDQA 1QSOA 3MGDA 2PJ5A 1FBVA 5KTDA 3TLEA 4PSWA 1A9XB 4G1PA 1M1DA 2R7HA 2PJAA 4C68A 1ZL0A 4IIYA 4B6ZA 1Z8WA 2D4PA 4UCMA 1BAVA 1YW4A 2PIYA 3PZJA 4PPZA 3SHPA 5ISVA 4C8TA 3IGRA 5DWNA 3BI0A 2REFA 4P4JA 3IU2A 1S60A 1CE8B 3BUOB 4JYWA 2OZHA 3GJZA 2WYRA 2ZXVA 1YVHA 3PBEA 4C9EA 4OC2A 4L8AA 3WABA 2PQ8A 1QSRA 4C9AA 3S9LA 3DGVA 4P4EA 2BSWA 3KR5A 2YNCC 5FD8A 5ELYA 2VEZA 1KBLA 5H86A 4LUAA 4CYNA 3SJEA 2YNCA 5GCNA 1XRYA 4NJRA 2F5IA 2Q4VA 4R57A 3G23A 1ZG8A 4MHNA 2Q4YA 4LQGA 1IGBA 2Q44A 4PV6A 2ZW5A 1ARMA 4M3SA 5AG5A 4BINA 3TO7A 4P4BA 3T5MA 4R87A 2X7BA 1KC7A 1YX0A 3G3SA 2J8MA 4C85A 2ZEOA 5F13A 2CNSA 4UCNA 3D7GA 1IYKA 3S6HA 4YFJA 5JYBA 4ORFA 2PIZA 2D4OA 2R8VA 4NF1A 3LACA 4RI1A 4C2XA 2BL1A 3TFYA 4CO9A 4BPXB 1TKHA 2AFUA 2EVNA 4HNWB 1CJWA 1CP6A 5LYFA 1WVMA 3SI2A 1AYEA 1CM0A 2PJBA 2OOTA 3K9UA 3NH4A 1S7KA 3DLJA 3PB8X 4NCZA 2CTCA 4P44A 1LOKA 1PUAA 4YGOA 5F46A 1S5KA 2KCWA 1FY7A 2OZUA 4OC3A 2ZEMA 2FT0A 3I6SA 3WC7A 1B6BA 4CGOA 2FS5A 3SR3A 3T0TA 3TC8A 1Z2LA 1Y9KA 3V7ZA 1Y0YA 3D67A 2ZEFA 1BPNA 2O4HA 3OWCA 3R1KA 4F9UA 1TF9A 2WSAA 3ZZIA 1IYLA 1NBWA 1Z8LA 3H4QA 3B3WA 5AG7A 2I3CA 4R3KA 3QNVA 4OP4A 3B8GA 5CNPA 4F0YA 4F6AA 7CPAA 3DDDA 2ZEDA 1M44A 3BUNB 1IY7A 4MY3A 1L0CA 4ONUA 4UBRA 4MI1A 3VRNA 3B3TA 2FVGA 2P6EA 4AB7A 4AXVA 3NFZA 3KR4A 4KOSA 4UWIA 4WJBA 1H8LA 1Y7EA 4YWYA 1AUGA 4A95A 3I74A 2P0WA 4YN3A 3D3SA 3F5BA 1YSJA 4HPSA 4JXQA 2B58A 1TXRA 3T8WA 3S6KA 4M8DA 2Z11A 2AE6A 2VZYA 2Z10A 3VTAA 2CXAA 3TE4A 4OC1A 3R9EA 4NGTA 3C8OA 5JM6A 1EZAA 5F9MA 3CXSA 2R98A 2V77A 3OB1B 2XEFA 2WPXA 3K9TA 1CP7A 3VWEA 3OAKA 2P6GA 3JRUA 1VBHA 1I1DA 4NJQA 3JUWA 4MFQA 4Q38A 3VH9A 4C7HA 3U1BA 4MBUA 2ZEEA 4KOTA 4U9YA 5J1QA 4MY0A 4JVOA 2B4DB 1S7FA 2CNMA 3TX8A 3R96A 3GY9A 1MK4A 4J0NA 4PK2A 1LCPA 3RAMA 5KTCA 1F2OA 1RTQA 3KQZA 1NXJA 1ZG9A 2DPTA 4KSFA 4U9ZA 4IIXA 5IV0A 2C1CA 3SJGA 1M4GA 3CZXA 4KZTA 3VATA 2I79A 1MJ9A 3B2YA 3IU1A 4C8FA 3P2HA 4KOWA 2EUIA 1HEEA 1ZO0A 4NXYA 2PCNA 1OZPA 4C9UA 1EO0A 2P6FA 4UEZA 4UEEA 1R43A 4PXBA 2JEWA 3F8KA 4AVAA 3B7IA 4DJLA 2C6GA 1NMTA 4A38A 2PJCA 2QMLA 3FB3A 4CAVA 5I4MA 2VKZG 4NGMA 5THWA 2ZPAA 3PB4X 3GB0A 4PK3A 4MRIA 2PR8A 3D7HA 4OC4A 2K5TA 3RBUA 3FH4A 3KGQA 2Q04A 1Z4RA 4XPKA 4P4IA 4QC6A 4PQAA 5LRGA 3VRQA 3IIBA 5LYIA 2V8DA 2PJ1A 2QIRA 3JTKA 3TLCA 4C8PA 2O53A 2HV2A 2FIAA 2PJ6A 4MXUA 1VIXA 4GM5A 1P0HA 2BUEA 4B5OA 4MFPA 3EO4A 5HMNA 1CS0B 1XBUA 4NGQA 1QSNA 3K2KA 2XPPA 2HB6A 4CDJA 4HNXB 3MRUA 4OIWA 3SI1A 2E28A 1Y0RA 2IL4A 1S7LA 1YR0A 2JBJA 2JEVA 4MFKA 1XF1A 3C26A 3D7FA 1Y7RA 3IWWA 2FL4A 2DXQA 1GYTA 3WR7A 2YJVA 2Z3NA 4OLLA 4X3RA 2PJ8A 1YLEA 4TNUA 4C8CA 5IB0A 2HQYA 2GE3A 1YW6A 5J8CA 4INJA 2BO9A 2Z0ZA 4KOXA 4DNCA 4C9VA 3W6SA 1XMBA 4PXCA 1VGYA 2UV8G 1Z5RA 3RYOA 1A2ZA 2ZW4A 4KUBA 1LANA 1JQGA 2G3AA 3B35A 4P10A 3VGOA 5K8MA 1VI4A 2DPSA 2PRQA 2PJ7A 2FM4A 4CYOA 3N5FA 1XEBA 2C5QA 3PLFB 3R9FA 3ICUA 4P4FA 3GIUA 1BO4A 2EBJA 4C8UA 4MMOA 2B4JC 3TCVA 2HWGA 4BBHA 4CDKA 2ATRA 4A39A 2OLSA 1YQEA 4KLWA 3PFEA 3EY5A 4IHMA 2O28A 2B4DA 3FECA 3DR6A 2CTBA 4TJVA 4QBJA 1V6CA 2AFXA 4B14A 3T05A 4QB9A 4ZY2A 4KVOE 3IEHA 1I12A 1V0CA 5DS0A 2J9AA 4C2ZA 4IF5A 1YK3A 4CYPA 3H8EA 3LWUA 3E0KA 2CY2A 1QSTA 4Q7AA 3TYXA 1LFWA 2Q7SA 8CPAA 5C88A 1SQHA 2DIKA 5JGFA 3NE8A 5IR2A 4K30A 1Z9UA 4F8ZA 3NH5A 4I49A 4LQ6A 4BTFA 3CPAA 2EK9A 3TTHA 2RFHA 3KI9A 4B5PB 3D68A 4CS0B 4ZX8A 4K3NA 3BUXB 1YVKA 4CAXA 5JVLA 4H6UA 1S7NA 3FX6A 5HVFA 2JDCA 3SJFA 3QB8A 2JDDA 3IFEA 2R82A 2GIVA 3LD2A 5EC4A 2WZNA 2ZW7A 4A37A 3CXQA 3FJUA 4QVTA 4F9VA 4W9YA 4KOVA 3PB9X 5CBMA 4Y49B 5G1ZA 1KZFA 2ODFA 4KOUA 4CAEA 4UFWA 1UWYA 3T07A 4C99A 4MHYA 4RUHA 1Z8TA 4KUAA 3IWGA 3WC6A 4OC5A 1HDUA 3HPGG 2PC1A 2EZBA 5BY0A 1ZLIA 2EZCA 1TIQA 1WWZA 2B3VA 2DLAA 1IU8A 1ZG7A 2Z3PA 5CPAA 5FVJA 3NE7A 2ARHA 1VBGA 4CZ1A 4GXHA 4CAFA 4NFRA 3TLZA 3VROA 4CAWA 4CGMA 3BLNA 2PRBA 4UA3A 4BPWB 5EMIA 3FRMA 3EFAA 4CYQA 5LYLA 4H2KA 1NSAA 3FIXA 4C84A 3PT1A 3GLJA 5IX3A 2OH1A 4JZ0A 3NH8A 1YLOA 1XE4A 2ZOGA 4CGLA 3DSBA 2PVWA 3IC1A 3V8IA 3F9KC 1X12A 4R8FA 3T9YA 1RXTA 5HVGA 3PFVA 4M85A 4CGNA 2AUMA 3IWEA 1M4LA 2ZOFA 2EWBA 4KSIA 4HNYB 3CDXA 2NMTA 2VL1A 2Z3OA 2PR1A 4KVXA 3CPXA 3BJ8A 1BXRB 5F1YA 1XF8A 2G9DA 4ZX9A 5G20A 2VBQA 3D2MA 2C6PA 1YREA 2C27A 4ZI6A 5JH9A 4FWUA 4EYSA 4U5YA 5EBVA 1BPMA 2BOAA 4E0AA 2Y1MA 2QECA 3WC5A 3TLGB 1OBRA 3KZWA 2I00A 4MJXA 1M4DA 2PJ0A 3BXMA 3U88C 2XEIA 2PSWA 2IQ6A 2V8GA 3D2PA 4PXDA 3PBBA 4QUSA 3ZJ0A 4II9A 3GKRA 4FD6A 3FXTA 4Q36A 1Q2YA 2Y1NA 2GANA 2PCUA 1IB1E 4ZY1A 5JQ4A 4WWVA 2HUZA 2J8NA 3UY5A 4TJXA 2Z3MA 1N71A 3TLBA 4EWTA 4ZGYB 4CRZB 4NSQA 4NEXA 2EK8A 3D66A 2Q4ZA 4KOYA 2VXKA 1ZRSA 1Y9WA 1WJTA 2DEAA 4A4BA 2GREA 3KHZA 4A32A 1B87A 2GFQA 1EZBA 1ZYMA 5LRKA 2ZEGA 4J3GA 5K99A 4FAIA 2YGWA 2MP0A 4P6YA 3KHXA 3R9GA 5LYDA 1F2PA 3H8GA
chains in the Genus database with same CATH topology
4OKOA 4ZYQA 2QVPA 1XFOA 3PRTA 2GLJA 2PJ3A 4TWEA 5LRJA 4PXEA 1EE3P 3FF3A 1ZLHA 4MCRA 3KQXA 3KL9A 4P4DA 3HUVA 5F09A 2POKA 4EFDA 1CPXA 2XEJA 4X2TA 1ELMP 4EMEA 2ZEHA 1VHEA 3B3CA 3SJXA 3S9NA 2QJ8A 2AFOA 1PCAA 2GU2A 2ZELA 1TKJA 4MCSA 4DYOA 2PJ2A 4CPAA 1R3NA 4UIAA 4C9RA 1LAMA 2F7VA 2GP4A 3I74A 4MHPA 1KWMA 3NA6A 3B3SA 3IO1A 2PVVA 2XEGA 2IMOA 3PEIA 1PYTB 6CPAA 5HXDA 3VARA 4YU9A 4NGRA 2F8HA 3FEDA 2HC9A 2IJZA 4FBEA 4NGSA 3IJ3A 3FEEA 3BHXA 4MCQA 4NGPA 2BCOA 1AMPA 3PB6X 2V8VA 2AFSA 1FNOA 2CF4A 2CIJA 3D4UA 4P45A 3KASA 3PB7X 1ELLP 3ISZA 2PJ4A 4C8AA 3ISXA 2NSMA 2RB7A 2OR4A 1Y9ZA 1CPSA 1TF8A 2GLFA 4X8IA 4R7MA 4C86A 4R6TA 4FUUA 2Q51A 5K8PA 3PFOA 2ABZA 3D7DA 4R76A 1CBXA 3LMSA 4ZY0A 3I1UA 4NGNA 1LAPA 1DTDA 4Z65A 5HVHA 3MN8A 2Q43A 3SI0A 2AFZA 2PJ9A 5K8NA 1CG2A 4UEFA 2V8HA 5K8OA 4BD9A 4OMEA 1ARLA 4A94A 3FMCA 2ZENA 2AFMA 4UIBA 3RZAA 5IB9A 4UF4A 3EIFA 1YMEA 2AFWA 5D29A 2ZEPA 3BI1A 4MHZA 1QQ9A 2ANPA 3L2NA 3CT9A 1FT7A 1XJOA 1F57A 3WT4A 1BLLE 2PE3A 4DUKA 3V38A 3H8FA 1Q7LA 4KNGE 3HLPA 4IK2A 2C6CA 5D8NA 1QMUA 3B3VA 1DE4C 3S9MA 4ONWA 4OIDA 3GUXA 4OC0A 2JBKA 1TKFA 2QYVA 1CX8A 2NYQA 4IAVA 4MCPA 4O23A 3FVLA 1VHOA 1HDQA 2PJ5A 4G1PA 2PJAA 4B6ZA 1BAVA 1YW4A 2PIYA 4PPZA 4C8TA 3BI0A 4P4JA 4JYWA 2WYRA 3PBEA 4C9EA 4OC2A 3WABA 4C9AA 3DGVA 3S9LA 4P4EA 3KR5A 5ELYA 3SJEA 1XRYA 4NJRA 1ZG8A 4MHNA 4LQGA 1IGBA 1ARMA 4P4BA 4C85A 2ZEOA 3D7GA 2PIZA 1TKHA 2AFUA 5LYFA 1CP6A 1WVMA 3SI2A 1AYEA 2PJBA 2OOTA 3NH4A 3PB8X 3DLJA 2CTCA 4P44A 1LOKA 3I6SA 4OC3A 2ZEMA 3WC7A 3TC8A 1Z2LA 3V7ZA 1Y0YA 3D67A 2ZEFA 1BPNA 2O4HA 4F9UA 1TF9A 1Z8LA 3B3WA 2I3CA 3QNVA 4OP4A 7CPAA 2ZEDA 1IY7A 3B3TA 2FVGA 4AXVA 3NFZA 3KR4A 4WJBA 1H8LA 1Y7EA 4YWYA 4YN3A 1YSJA 1TXRA 3T8WA 3VTAA 4OC1A 4NGTA 5JM6A 3K9TA 2V77A 2XEFA 1CP7A 3JRUA 4NJQA 3VH9A 2ZEEA 5J1QA 3TX8A 1LCPA 3RAMA 1F2OA 1RTQA 3KQZA 1ZG9A 2C1CA 3SJGA 3VATA 3B2YA 4C8FA 1HEEA 4C9UA 4UEZA 4UEEA 1R43A 4PXBA 2JEWA 3B7IA 4DJLA 2C6GA 4A38A 2PJCA 5I4MA 4NGMA 5THWA 3PB4X 3GB0A 4MRIA 3D7HA 4OC4A 3RBUA 3FH4A 3KGQA 4P4IA 5LRGA 4PQAA 5LYIA 3IIBA 2V8DA 2PJ1A 4C8PA 2O53A 2PJ6A 4MXUA 1VIXA 4GM5A 1XBUA 4NGQA 3K2KA 2HB6A 4CDJA 3SI1A 3MRUA 4OIWA 1Y0RA 2JBJA 1XF1A 3D7FA 3IWWA 1GYTA 4C8CA 4TNUA 4X3RA 2PJ8A 1YW6A 2BO9A 4C9VA 1XMBA 4PXCA 1VGYA 1Z5RA 1LANA 3B35A 1JQGA 4P10A 5K8MA 2PRQA 2PJ7A 3N5FA 2C5QA 3ICUA 4P4FA 4C8UA 4MMOA 4CDKA 4A39A 3PFEA 4IHMA 3FECA 4TJVA 2CTBA 1V6CA 2AFXA 4ZY2A 3IEHA 5DS0A 2J9AA 3H8EA 3LWUA 4Q7AA 1LFWA 8CPAA 5JGFA 5IR2A 4F8ZA 3NH5A 3CPAA 2EK9A 2RFHA 3KI9A 3D68A 4ZX8A 4K3NA 3FX6A 5HVFA 3SJFA 3IFEA 4TJXA 4A37A 2WZNA 3FJUA 4F9VA 4W9YA 3PB9X 5CBMA 1UWYA 4C99A 4MHYA 4RUHA 3WC6A 4OC5A 1HDUA 1ZLIA 1ZG7A 5CPAA 4NFRA 5LYLA 4C84A 4H2KA 1NSAA 3GLJA 4JZ0A 3NH8A 1YLOA 2ZOGA 2PVWA 3IC1A 4R8FA 5HVGA 1M4LA 2ZOFA 2EWBA 4KSIA 3CDXA 2VL1A 3CPXA 2G9DA 4ZX9A 4ZI6A 5JH9A 2C6PA 4FWUA 1BPMA 2BOAA 3WC5A 1OBRA 3KZWA 2PJ0A 3BXMA 2XEIA 4PXDA 2IQ6A 2V8GA 3PBBA 4ZY1A 2PCUA 4WWVA 4EWTA 2EK8A 3D66A 2Q4ZA 3KHZA 2DEAA 2GREA 5LRKA 2ZEGA 4FAIA 4P6YA 3KHXA 5LYDA 1F2PA 3H8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OKO A;  4ZYQ A;  2QVP A;  1XFO A;  3PRT A;  2GLJ A;  2PJ3 A;  4TWE A;  5LRJ A;  4PXE A;  1EE3 P;  3FF3 A;  1ZLH A;  4MCR A;  3KQX A;  3KL9 A;  4P4D A;  3HUV A;  5F09 A;  2POK A;  4EFD A;  1CPX A;  2XEJ A;  4X2T A;  1ELM P;  4EME A;  2ZEH A;  1VHE A;  3B3C A;  3SJX A;  3S9N A;  2QJ8 A;  2AFO A;  1PCA A;  2GU2 A;  2ZEL A;  1TKJ A;  4MCS A;  4DYO A;  2PJ2 A;  4CPA A;  1R3N A;  4UIA A;  4C9R A;  1LAM A;  2F7V A;  3I74 A;  4MHP A;  1KWM A;  3NA6 A;  3B3S A;  3IO1 A;  2PVV A;  2XEG A;  2IMO A;  3PEI A;  1PYT B;  6CPA A;  5HXD A;  3VAR A;  4YU9 A;  4NGR A;  2F8H A;  3FED A;  2HC9 A;  2IJZ A;  4FBE A;  4NGS A;  3IJ3 A;  3FEE A;  3BHX A;  4MCQ A;  4NGP A;  2BCO A;  1AMP A;  3PB6 X;  2V8V A;  2AFS A;  1FNO A;  2CF4 A;  2CIJ A;  3D4U A;  4P45 A;  3KAS A;  3PB7 X;  1ELL P;  3ISZ A;  2PJ4 A;  4C8A A;  3ISX A;  2NSM A;  2RB7 A;  2OR4 A;  1Y9Z A;  1CPS A;  1TF8 A;  2GLF A;  4X8I A;  4R7M A;  4C86 A;  4R6T A;  4FUU A;  2Q51 A;  5K8P A;  3PFO A;  2ABZ A;  3D7D A;  4R76 A;  1CBX A;  3LMS A;  4ZY0 A;  3I1U A;  4NGN A;  1LAP A;  1DTD A;  4Z65 A;  5HVH A;  3MN8 A;  2Q43 A;  3SI0 A;  2AFZ A;  2PJ9 A;  5K8N A;  1CG2 A;  4UEF A;  2V8H A;  5K8O A;  4BD9 A;  4OME A;  1ARL A;  4A94 A;  3FMC A;  2ZEN A;  2AFM A;  4UIB A;  3RZA A;  5IB9 A;  4UF4 A;  3EIF A;  1YME A;  2AFW A;  5D29 A;  2ZEP A;  3BI1 A;  4MHZ A;  1QQ9 A;  2ANP A;  3L2N A;  3CT9 A;  1FT7 A;  1XJO A;  1F57 A;  3WT4 A;  1BLL E;  2PE3 A;  4DUK A;  3V38 A;  3H8F A;  1Q7L A;  4KNG E;  3HLP A;  4IK2 A;  2C6C A;  5D8N A;  1QMU A;  3B3V A;  1DE4 C;  3S9M A;  4ONW A;  4OID A;  3GUX A;  4OC0 A;  2JBK A;  1TKF A;  2QYV A;  1CX8 A;  2NYQ A;  4IAV A;  4MCP A;  4O23 A;  3FVL A;  1VHO A;  1HDQ A;  2PJ5 A;  4G1P A;  2PJA A;  4B6Z A;  1BAV A;  1YW4 A;  2PIY A;  4PPZ A;  4C8T A;  3BI0 A;  4P4J A;  4JYW A;  2WYR A;  3PBE A;  4C9E A;  4OC2 A;  3WAB A;  4C9A A;  3DGV A;  3S9L A;  4P4E A;  3KR5 A;  5ELY A;  3SJE A;  1XRY A;  4NJR A;  1ZG8 A;  4MHN A;  4LQG A;  1IGB A;  1ARM A;  4P4B A;  4C85 A;  2ZEO A;  3D7G A;  2PIZ A;  1TKH A;  2AFU A;  5LYF A;  1CP6 A;  1WVM A;  3SI2 A;  1AYE A;  2PJB A;  2OOT A;  3NH4 A;  3PB8 X;  3DLJ A;  2CTC A;  4P44 A;  1LOK A;  3I6S A;  4OC3 A;  2ZEM A;  3WC7 A;  3TC8 A;  1Z2L A;  3V7Z A;  1Y0Y A;  3D67 A;  2ZEF A;  1BPN A;  2O4H A;  4F9U A;  1TF9 A;  1Z8L A;  3B3W A;  2I3C A;  3QNV A;  4OP4 A;  7CPA A;  2ZED A;  1IY7 A;  3B3T A;  2FVG A;  4AXV A;  3NFZ A;  3KR4 A;  4WJB A;  1H8L A;  1Y7E A;  4YWY A;  4YN3 A;  1YSJ A;  1TXR A;  3T8W A;  3VTA A;  4OC1 A;  4NGT A;  5JM6 A;  3K9T A;  2V77 A;  2XEF A;  1CP7 A;  3JRU A;  4NJQ A;  3VH9 A;  2ZEE A;  5J1Q A;  3TX8 A;  1LCP A;  3RAM A;  1F2O A;  1RTQ A;  3KQZ A;  1ZG9 A;  2C1C A;  3SJG A;  3VAT A;  3B2Y A;  4C8F A;  1HEE A;  4C9U A;  4UEZ A;  4UEE A;  1R43 A;  4PXB A;  2JEW A;  3B7I A;  4DJL A;  2C6G A;  4A38 A;  2PJC A;  5I4M A;  4NGM A;  5THW A;  3PB4 X;  3GB0 A;  4MRI A;  3D7H A;  4OC4 A;  3RBU A;  3FH4 A;  3KGQ A;  4P4I A;  5LRG A;  4PQA A;  5LYI A;  3IIB A;  2V8D A;  2PJ1 A;  4C8P A;  2O53 A;  2PJ6 A;  4MXU A;  1VIX A;  4GM5 A;  1XBU A;  4NGQ A;  3K2K A;  2HB6 A;  4CDJ A;  3SI1 A;  3MRU A;  4OIW A;  1Y0R A;  2JBJ A;  1XF1 A;  3D7F A;  3IWW A;  1GYT A;  4C8C A;  4TNU A;  4X3R A;  2PJ8 A;  1YW6 A;  2BO9 A;  4C9V A;  1XMB A;  4PXC A;  1VGY A;  1Z5R A;  1LAN A;  3B35 A;  1JQG A;  4P10 A;  5K8M A;  2PRQ A;  2PJ7 A;  3N5F A;  3ICU A;  4P4F A;  4C8U A;  4MMO A;  4CDK A;  4A39 A;  3PFE A;  4IHM A;  3FEC A;  4TJV A;  2CTB A;  1V6C A;  2AFX A;  4ZY2 A;  3IEH A;  5DS0 A;  2J9A A;  3H8E A;  3LWU A;  4Q7A A;  1LFW A;  8CPA A;  5JGF A;  4F8Z A;  3NH5 A;  3CPA A;  2EK9 A;  2RFH A;  3KI9 A;  3D68 A;  4ZX8 A;  4K3N A;  3FX6 A;  5HVF A;  3SJF A;  3IFE A;  4TJX A;  4A37 A;  2WZN A;  3FJU A;  4F9V A;  4W9Y A;  3PB9 X;  5CBM A;  1UWY A;  4C99 A;  4MHY A;  4RUH A;  3WC6 A;  4OC5 A;  1HDU A;  1ZLI A;  1ZG7 A;  5CPA A;  4NFR A;  5LYL A;  4C84 A;  4H2K A;  1NSA A;  3GLJ A;  4JZ0 A;  3NH8 A;  1YLO A;  2ZOG A;  2PVW A;  3IC1 A;  4R8F A;  5HVG A;  1M4L A;  2ZOF A;  2EWB A;  4KSI A;  3CDX A;  2VL1 A;  3CPX A;  2G9D A;  4ZX9 A;  4ZI6 A;  5JH9 A;  2C6P A;  4FWU A;  1BPM A;  2BOA A;  3WC5 A;  1OBR A;  3KZW A;  2PJ0 A;  3BXM A;  2XEI A;  4PXD A;  2IQ6 A;  2V8G A;  3PBB A;  4ZY1 A;  2PCU A;  4WWV A;  4EWT A;  2EK8 A;  3D66 A;  2Q4Z A;  3KHZ A;  2DEA A;  2GRE A;  5LRK A;  2ZEG A;  4FAI A;  4P6Y A;  3KHX A;  5LYD A;  1F2P A;  3H8G A; 
#chains in the Genus database with same CATH topology
 2B0A A;  4OKO A;  1M6V B;  4ZYQ A;  2QVP A;  5HKY A;  1XFO A;  4XPL A;  3OP0 A;  2GLJ A;  3PRT A;  2PJ3 A;  4HKF A;  4UCP A;  3FNC A;  4TWE A;  3VWD A;  4Y49 C;  5A27 A;  3LOD A;  2FIW A;  5LRJ A;  4PXE A;  4ZBG A;  1EE3 P;  2CNT A;  2X0S A;  2YNE A;  4R9M A;  4COG A;  4B10 A;  3TT2 A;  3FF3 A;  1J3L A;  1ZLH A;  4MCR A;  3S6G A;  4KSA A;  5F48 A;  3BUW B;  3KL9 A;  3KQX A;  4P4D A;  3W6X A;  3HUV A;  2HRO A;  1Q2C A;  1XMT A;  3TLA A;  1XOV A;  5F09 A;  2OZG A;  2POK A;  3SXN A;  1CPX A;  4EFD A;  2XEJ A;  1MJB A;  2WPW A;  3P2F A;  1ELM P;  4UWJ A;  4X2T A;  4MHD A;  1Z8X A;  2ZEH A;  2FSR A;  4EME A;  1Z4E A;  2XPN A;  3W91 A;  3KRV A;  1VHE A;  3B3C A;  3SJX A;  3S9N A;  2QJ8 A;  2AFO A;  4A4C A;  3BUM B;  1PCA A;  2FXF A;  4GS4 A;  4BMH A;  1IOI A;  1C3O B;  4H6Z A;  4KS9 A;  2N3A B;  4MFZ A;  2GU2 A;  5C82 A;  1K4J A;  2XPO A;  1YVO A;  2ZEL A;  3G8W A;  5AG4 A;  1TKJ A;  4MCS A;  1QSM A;  2PJ2 A;  4KLV A;  4CPA A;  3DR8 A;  4DYO A;  2OB0 A;  2VZZ A;  1R3N A;  2WUU A;  4UIA A;  1JDE A;  4M6I A;  4C9R A;  4FD5 A;  4C7I A;  2ZW6 A;  1LAM A;  2F7V A;  4LX9 A;  4MFL A;  2JLM A;  4MHP A;  1KWM A;  4YRH A;  3NA6 A;  4EVY A;  2GP4 A;  4OAE A;  3B3S A;  3IO1 A;  3RO0 A;  4JWP A;  5A28 A;  2PVV A;  5KTA A;  2XEG A;  1JWQ A;  2IMO A;  3PEI A;  3TLG A;  4COB A;  3O8Z A;  1PYT B;  1S3Z A;  2BEI A;  1VKC A;  1M4I A;  3F0A A;  3VAR A;  4YU9 A;  6CPA A;  5HXD A;  4NGR A;  2F8H A;  2FCK A;  3FED A;  4KVM E;  2HC9 A;  5J8F A;  1C30 B;  3EXN A;  5DWM A;  5J3X A;  3NFQ A;  2G0B A;  2Q0Y A;  2RC4 A;  2IJZ A;  3CXP A;  4FBE A;  1IIC A;  2B5G B;  4NGS A;  3IJ3 A;  3FEE A;  3BHX A;  4MCQ A;  3T90 A;  4CGP A;  4NGP A;  3VRP A;  2BCO A;  1R61 A;  3DNS A;  2OU2 A;  1I21 A;  1AMP A;  3PB6 X;  4XPD B;  2V8V A;  4X5K A;  1T36 B;  2HI6 A;  2AFS A;  2R1I A;  4PSX A;  5JPH A;  3K4I A;  3GYA A;  3TOA A;  1FNO A;  1RO5 A;  2CF4 A;  4A2Z A;  4AVC A;  1YGH A;  2CIJ A;  1KUV A;  3D4U A;  4IUS A;  1ON0 A;  4P45 A;  1IID A;  4JLY A;  3KAS A;  3A9L A;  3PB7 X;  1ELL P;  3ISZ A;  4F0X A;  2Q7B A;  2PJ4 A;  1R57 A;  1JDB C;  3EZB A;  1XIX A;  2DF5 A;  3OB2 B;  1X10 A;  4C8A A;  2VQY A;  3FBU A;  3ISX A;  3S6F A;  4MFJ A;  4AG7 A;  2NSM A;  2RB7 A;  2OR4 A;  1Y9Z A;  1LRZ A;  3TLY A;  1CPS A;  1TF8 A;  3PGP A;  5I0C A;  2GLF A;  2YND A;  4FD7 A;  4R7M A;  4X8I A;  5G22 A;  3TO6 A;  2AUN A;  4UFV A;  2D0O A;  3FYN A;  4E94 A;  5E96 A;  4B11 A;  4C86 A;  4R6T A;  4JXR A;  4FUU A;  4FD4 A;  3SXO A;  3KKW A;  5H84 A;  1B47 A;  1GHE A;  4XNH B;  2Q51 A;  1J4J A;  3PP9 A;  5K8P A;  1U6M A;  4BPU B;  3VRR A;  1KUX A;  3PFO A;  4JD6 A;  1Z9E A;  3D7D A;  2ABZ A;  4M6G A;  1NSL A;  4R76 A;  1CBX A;  5HKW A;  3LMS A;  2YJT A;  5F47 A;  1P4N A;  2B3U A;  3D8P A;  4RN7 A;  4ZY0 A;  3I1U A;  5BWA B;  4NGN A;  1LAP A;  1DTD A;  4CRY B;  1DIK A;  4C2Y A;  1KEE B;  4H89 A;  2FE7 A;  4Z65 A;  5HVH A;  3MN8 A;  4B12 A;  2D0P A;  4H1H A;  1PU9 A;  2Q43 A;  3SI0 A;  5AXI A;  4L89 A;  4RS2 A;  2AFZ A;  2PJ9 A;  3EZE A;  3BJ7 A;  3HMJ G;  2EO8 A;  2AJ6 A;  4RR2 B;  3R95 A;  5K8N A;  4UFX A;  1IOF A;  2EZA A;  1CG2 A;  4B13 A;  3N7Z A;  3H5Z A;  3NOJ A;  4UEF A;  2V8H A;  5K8O A;  4A33 A;  4BD9 A;  2REE A;  4OME A;  1ARL A;  2H5M A;  4A94 A;  3FMC A;  2Y0M A;  2ZEN A;  2AFM A;  4UIB A;  3RZA A;  5IB9 A;  4R3L A;  4UF4 A;  3EZA A;  4JJX A;  2G3T A;  3EIF A;  1Q2D A;  1YME A;  5F49 A;  4E2A A;  2AFW A;  5D29 A;  2B4B A;  2ZEP A;  1UFH A;  3BI1 A;  2B5G A;  3QAY A;  1QQ9 A;  2ANP A;  4MHZ A;  4GPL B;  4B5P A;  5AGE A;  3L2N A;  3CT9 A;  2PDO A;  4A31 A;  4XPD C;  1FT7 A;  1Q5X A;  1MJA A;  1XJO A;  1F57 A;  4A30 A;  4E8O A;  3I3G A;  3WT4 A;  1KUY A;  1BLL E;  2PE3 A;  2Z3K A;  3JVN A;  5HH1 A;  3V38 A;  4DUK A;  2XPL A;  3H8F A;  4MJ8 A;  1Q7L A;  3TO9 A;  4KNG E;  3HLP A;  5F5X A;  5G21 A;  4IK2 A;  2C6C A;  4KOR A;  4OAD A;  5D8N A;  3TOB A;  1QMU A;  3B3V A;  4M6H A;  1DE4 C;  3S9M A;  4ONW A;  4OID A;  1GGO A;  1WK4 A;  3GUX A;  4AVB A;  4E5S A;  1NE9 A;  2Z3L A;  4OC0 A;  2JBK A;  3QAH A;  3HPH E;  2J8R A;  1VHS A;  1TKF A;  2A4N A;  4MI4 A;  2VI7 A;  3EC4 A;  4AG9 A;  2QYV A;  1CX8 A;  3I9S A;  2CBL A;  1BOB A;  2NYQ A;  4MCP A;  3ZNI A;  3FVL A;  4IAV A;  4O23 A;  1VHO A;  5AG6 A;  3RNZ A;  5HKZ A;  4XNH C;  1HDQ A;  1QSO A;  3MGD A;  2PJ5 A;  1FBV A;  5KTD A;  3TLE A;  4PSW A;  1A9X B;  4G1P A;  1M1D A;  2R7H A;  2PJA A;  4C68 A;  1ZL0 A;  4IIY A;  4B6Z A;  1Z8W A;  2D4P A;  4UCM A;  1BAV A;  1YW4 A;  2PIY A;  3PZJ A;  4PPZ A;  3SHP A;  5ISV A;  4C8T A;  3IGR A;  5DWN A;  3BI0 A;  2REF A;  4P4J A;  3IU2 A;  1S60 A;  1CE8 B;  3BUO B;  4JYW A;  2OZH A;  3GJZ A;  2WYR A;  2ZXV A;  1YVH A;  3PBE A;  4C9E A;  4OC2 A;  4L8A A;  3WAB A;  2PQ8 A;  1QSR A;  4C9A A;  3S9L A;  3DGV A;  4P4E A;  2BSW A;  3KR5 A;  2YNC C;  5FD8 A;  5ELY A;  2VEZ A;  1KBL A;  5H86 A;  4LUA A;  4CYN A;  3SJE A;  2YNC A;  5GCN A;  1XRY A;  4NJR A;  2F5I A;  2Q4V A;  4R57 A;  3G23 A;  1ZG8 A;  4MHN A;  2Q4Y A;  4LQG A;  1IGB A;  2Q44 A;  4PV6 A;  2ZW5 A;  1ARM A;  4M3S A;  5AG5 A;  4BIN A;  3TO7 A;  4P4B A;  3T5M A;  4R87 A;  2X7B A;  1KC7 A;  1YX0 A;  3G3S A;  2J8M A;  4C85 A;  2ZEO A;  5F13 A;  2CNS A;  4UCN A;  3D7G A;  1IYK A;  3S6H A;  4YFJ A;  5JYB A;  4ORF A;  2PIZ A;  2D4O A;  2R8V A;  4NF1 A;  3LAC A;  4RI1 A;  4C2X A;  2BL1 A;  3TFY A;  4CO9 A;  4BPX B;  1TKH A;  2AFU A;  2EVN A;  4HNW B;  1CJW A;  1CP6 A;  5LYF A;  1WVM A;  3SI2 A;  1AYE A;  1CM0 A;  2PJB A;  2OOT A;  3K9U A;  3NH4 A;  1S7K A;  3DLJ A;  3PB8 X;  4NCZ A;  2CTC A;  4P44 A;  1LOK A;  1PUA A;  4YGO A;  5F46 A;  1S5K A;  2KCW A;  1FY7 A;  2OZU A;  4OC3 A;  2ZEM A;  2FT0 A;  3I6S A;  3WC7 A;  1B6B A;  4CGO A;  2FS5 A;  3SR3 A;  3T0T A;  3TC8 A;  1Z2L A;  1Y9K A;  3V7Z A;  1Y0Y A;  3D67 A;  2ZEF A;  1BPN A;  2O4H A;  3OWC A;  3R1K A;  4F9U A;  1TF9 A;  2WSA A;  3ZZI A;  1IYL A;  1NBW A;  1Z8L A;  3H4Q A;  3B3W A;  5AG7 A;  2I3C A;  4R3K A;  3QNV A;  4OP4 A;  3B8G A;  5CNP A;  4F0Y A;  4F6A A;  7CPA A;  3DDD A;  2ZED A;  1M44 A;  3BUN B;  1IY7 A;  4MY3 A;  1L0C A;  4ONU A;  4UBR A;  4MI1 A;  3VRN A;  3B3T A;  2FVG A;  2P6E A;  4AB7 A;  4AXV A;  3NFZ A;  3KR4 A;  4KOS A;  4UWI A;  4WJB A;  1H8L A;  1Y7E A;  4YWY A;  1AUG A;  4A95 A;  3I74 A;  2P0W A;  4YN3 A;  3D3S A;  3F5B A;  1YSJ A;  4HPS A;  4JXQ A;  2B58 A;  1TXR A;  3T8W A;  3S6K A;  4M8D A;  2Z11 A;  2AE6 A;  2VZY A;  2Z10 A;  3VTA A;  2CXA A;  3TE4 A;  4OC1 A;  3R9E A;  4NGT A;  3C8O A;  5JM6 A;  1EZA A;  5F9M A;  3CXS A;  2R98 A;  2V77 A;  3OB1 B;  2XEF A;  2WPX A;  3K9T A;  1CP7 A;  3VWE A;  3OAK A;  2P6G A;  3JRU A;  1VBH A;  1I1D A;  4NJQ A;  3JUW A;  4MFQ A;  4Q38 A;  3VH9 A;  4C7H A;  3U1B A;  4MBU A;  2ZEE A;  4KOT A;  4U9Y A;  5J1Q A;  4MY0 A;  4JVO A;  2B4D B;  1S7F A;  2CNM A;  3TX8 A;  3R96 A;  3GY9 A;  1MK4 A;  4J0N A;  4PK2 A;  1LCP A;  3RAM A;  5KTC A;  1F2O A;  1RTQ A;  3KQZ A;  1NXJ A;  1ZG9 A;  2DPT A;  4KSF A;  4U9Z A;  4IIX A;  5IV0 A;  2C1C A;  3SJG A;  1M4G A;  3CZX A;  4KZT A;  3VAT A;  2I79 A;  1MJ9 A;  3B2Y A;  3IU1 A;  4C8F A;  3P2H A;  4KOW A;  2EUI A;  1HEE A;  1ZO0 A;  4NXY A;  2PCN A;  1OZP A;  4C9U A;  1EO0 A;  2P6F A;  4UEZ A;  4UEE A;  1R43 A;  4PXB A;  2JEW A;  3F8K A;  4AVA A;  3B7I A;  4DJL A;  2C6G A;  1NMT A;  4A38 A;  2PJC A;  2QML A;  3FB3 A;  4CAV A;  5I4M A;  2VKZ G;  4NGM A;  5THW A;  2ZPA A;  3PB4 X;  3GB0 A;  4PK3 A;  4MRI A;  2PR8 A;  3D7H A;  4OC4 A;  2K5T A;  3RBU A;  3FH4 A;  3KGQ A;  2Q04 A;  1Z4R A;  4XPK A;  4P4I A;  4QC6 A;  4PQA A;  5LRG A;  3VRQ A;  3IIB A;  5LYI A;  2V8D A;  2PJ1 A;  2QIR A;  3JTK A;  3TLC A;  4C8P A;  2O53 A;  2HV2 A;  2FIA A;  2PJ6 A;  4MXU A;  1VIX A;  4GM5 A;  1P0H A;  2BUE A;  4B5O A;  4MFP A;  3EO4 A;  5HMN A;  1CS0 B;  1XBU A;  4NGQ A;  1QSN A;  3K2K A;  2XPP A;  2HB6 A;  4CDJ A;  4HNX B;  3MRU A;  4OIW A;  3SI1 A;  2E28 A;  1Y0R A;  2IL4 A;  1S7L A;  1YR0 A;  2JBJ A;  2JEV A;  4MFK A;  1XF1 A;  3C26 A;  3D7F A;  1Y7R A;  3IWW A;  2FL4 A;  2DXQ A;  1GYT A;  3WR7 A;  2YJV A;  2Z3N A;  4OLL A;  4X3R A;  2PJ8 A;  1YLE A;  4TNU A;  4C8C A;  5IB0 A;  2HQY A;  2GE3 A;  1YW6 A;  5J8C A;  4INJ A;  2BO9 A;  2Z0Z A;  4KOX A;  4DNC A;  4C9V A;  3W6S A;  1XMB A;  4PXC A;  1VGY A;  2UV8 G;  1Z5R A;  3RYO A;  1A2Z A;  2ZW4 A;  4KUB A;  1LAN A;  1JQG A;  2G3A A;  3B35 A;  4P10 A;  3VGO A;  5K8M A;  1VI4 A;  2DPS A;  2PRQ A;  2PJ7 A;  2FM4 A;  4CYO A;  3N5F A;  1XEB A;  2C5Q A;  3PLF B;  3R9F A;  3ICU A;  4P4F A;  3GIU A;  1BO4 A;  2EBJ A;  4C8U A;  4MMO A;  2B4J C;  3TCV A;  2HWG A;  4BBH A;  4CDK A;  2ATR A;  4A39 A;  2OLS A;  1YQE A;  4KLW A;  3PFE A;  3EY5 A;  4IHM A;  2O28 A;  2B4D A;  3FEC A;  3DR6 A;  2CTB A;  4TJV A;  4QBJ A;  1V6C A;  2AFX A;  4B14 A;  3T05 A;  4QB9 A;  4ZY2 A;  4KVO E;  3IEH A;  1I12 A;  1V0C A;  5DS0 A;  2J9A A;  4C2Z A;  4IF5 A;  1YK3 A;  4CYP A;  3H8E A;  3LWU A;  3E0K A;  2CY2 A;  1QST A;  4Q7A A;  3TYX A;  1LFW A;  2Q7S A;  8CPA A;  5C88 A;  1SQH A;  2DIK A;  5JGF A;  3NE8 A;  5IR2 A;  4K30 A;  1Z9U A;  4F8Z A;  3NH5 A;  4I49 A;  4LQ6 A;  4BTF A;  3CPA A;  2EK9 A;  3TTH A;  2RFH A;  3KI9 A;  4B5P B;  3D68 A;  4CS0 B;  4ZX8 A;  4K3N A;  3BUX B;  1YVK A;  4CAX A;  5JVL A;  4H6U A;  1S7N A;  3FX6 A;  5HVF A;  2JDC A;  3SJF A;  3QB8 A;  2JDD A;  3IFE A;  2R82 A;  2GIV A;  3LD2 A;  5EC4 A;  2WZN A;  2ZW7 A;  4A37 A;  3CXQ A;  3FJU A;  4QVT A;  4F9V A;  4W9Y A;  4KOV A;  3PB9 X;  5CBM A;  4Y49 B;  5G1Z A;  1KZF A;  2ODF A;  4KOU A;  4CAE A;  4UFW A;  1UWY A;  3T07 A;  4C99 A;  4MHY A;  4RUH A;  1Z8T A;  4KUA A;  3IWG A;  3WC6 A;  4OC5 A;  1HDU A;  3HPG G;  2PC1 A;  2EZB A;  5BY0 A;  1ZLI A;  2EZC A;  1TIQ A;  1WWZ A;  2B3V A;  2DLA A;  1IU8 A;  1ZG7 A;  2Z3P A;  5CPA A;  5FVJ A;  3NE7 A;  2ARH A;  1VBG A;  4CZ1 A;  4GXH A;  4CAF A;  4NFR A;  3TLZ A;  3VRO A;  4CAW A;  4CGM A;  3BLN A;  2PRB A;  4UA3 A;  4BPW B;  5EMI A;  3FRM A;  3EFA A;  4CYQ A;  5LYL A;  4H2K A;  1NSA A;  3FIX A;  4C84 A;  3PT1 A;  3GLJ A;  5IX3 A;  2OH1 A;  4JZ0 A;  3NH8 A;  1YLO A;  1XE4 A;  2ZOG A;  4CGL A;  3DSB A;  2PVW A;  3IC1 A;  3V8I A;  3F9K C;  1X12 A;  4R8F A;  3T9Y A;  1RXT A;  5HVG A;  3PFV A;  4M85 A;  4CGN A;  2AUM A;  3IWE A;  1M4L A;  2ZOF A;  2EWB A;  4KSI A;  4HNY B;  3CDX A;  2NMT A;  2VL1 A;  2Z3O A;  2PR1 A;  4KVX A;  3CPX A;  3BJ8 A;  1BXR B;  5F1Y A;  1XF8 A;  2G9D A;  4ZX9 A;  5G20 A;  2VBQ A;  3D2M A;  2C6P A;  1YRE A;  2C27 A;  4ZI6 A;  5JH9 A;  4FWU A;  4EYS A;  4U5Y A;  5EBV A;  1BPM A;  2BOA A;  4E0A A;  2Y1M A;  2QEC A;  3WC5 A;  3TLG B;  1OBR A;  3KZW A;  2I00 A;  4MJX A;  1M4D A;  2PJ0 A;  3BXM A;  3U88 C;  2XEI A;  2PSW A;  2IQ6 A;  2V8G A;  3D2P A;  4PXD A;  3PBB A;  4QUS A;  3ZJ0 A;  4II9 A;  3GKR A;  4FD6 A;  3FXT A;  4Q36 A;  1Q2Y A;  2Y1N A;  2GAN A;  2PCU A;  1IB1 E;  4ZY1 A;  5JQ4 A;  4WWV A;  2HUZ A;  2J8N A;  3UY5 A;  4TJX A;  2Z3M A;  1N71 A;  3TLB A;  4EWT A;  4ZGY B;  4CRZ B;  4NSQ A;  4NEX A;  2EK8 A;  3D66 A;  2Q4Z A;  4KOY A;  2VXK A;  1ZRS A;  1Y9W A;  1WJT A;  2DEA A;  4A4B A;  2GRE A;  3KHZ A;  4A32 A;  1B87 A;  2GFQ A;  1EZB A;  1ZYM A;  5LRK A;  2ZEG A;  4J3G A;  5K99 A;  4FAI A;  2YGW A;  2MP0 A;  4P6Y A;  3KHX A;  3R9G A;  5LYD A;  1F2P A;  3H8G A; 
#chains in the Genus database with same CATH homology
 4OKO A;  4ZYQ A;  2QVP A;  1XFO A;  3PRT A;  2GLJ A;  2PJ3 A;  4TWE A;  5LRJ A;  4PXE A;  1EE3 P;  3FF3 A;  1ZLH A;  4MCR A;  3KQX A;  3KL9 A;  4P4D A;  3HUV A;  5F09 A;  2POK A;  4EFD A;  1CPX A;  2XEJ A;  4X2T A;  1ELM P;  4EME A;  2ZEH A;  1VHE A;  3B3C A;  3SJX A;  3S9N A;  2QJ8 A;  2AFO A;  1PCA A;  2GU2 A;  2ZEL A;  1TKJ A;  4MCS A;  4DYO A;  2PJ2 A;  4CPA A;  1R3N A;  4UIA A;  4C9R A;  1LAM A;  2F7V A;  2GP4 A;  3I74 A;  4MHP A;  1KWM A;  3NA6 A;  3B3S A;  3IO1 A;  2PVV A;  2XEG A;  2IMO A;  3PEI A;  1PYT B;  6CPA A;  5HXD A;  3VAR A;  4YU9 A;  4NGR A;  2F8H A;  3FED A;  2HC9 A;  2IJZ A;  4FBE A;  4NGS A;  3IJ3 A;  3FEE A;  3BHX A;  4MCQ A;  4NGP A;  2BCO A;  1AMP A;  3PB6 X;  2V8V A;  2AFS A;  1FNO A;  2CF4 A;  2CIJ A;  3D4U A;  4P45 A;  3KAS A;  3PB7 X;  1ELL P;  3ISZ A;  2PJ4 A;  4C8A A;  3ISX A;  2NSM A;  2RB7 A;  2OR4 A;  1Y9Z A;  1CPS A;  1TF8 A;  2GLF A;  4X8I A;  4R7M A;  4C86 A;  4R6T A;  4FUU A;  2Q51 A;  5K8P A;  3PFO A;  2ABZ A;  3D7D A;  4R76 A;  1CBX A;  3LMS A;  4ZY0 A;  3I1U A;  4NGN A;  1LAP A;  1DTD A;  4Z65 A;  5HVH A;  3MN8 A;  2Q43 A;  3SI0 A;  2AFZ A;  2PJ9 A;  5K8N A;  1CG2 A;  4UEF A;  2V8H A;  5K8O A;  4BD9 A;  4OME A;  1ARL A;  4A94 A;  3FMC A;  2ZEN A;  2AFM A;  4UIB A;  3RZA A;  5IB9 A;  4UF4 A;  3EIF A;  1YME A;  2AFW A;  5D29 A;  2ZEP A;  3BI1 A;  4MHZ A;  1QQ9 A;  2ANP A;  3L2N A;  3CT9 A;  1FT7 A;  1XJO A;  1F57 A;  3WT4 A;  1BLL E;  2PE3 A;  4DUK A;  3V38 A;  3H8F A;  1Q7L A;  4KNG E;  3HLP A;  4IK2 A;  2C6C A;  5D8N A;  1QMU A;  3B3V A;  1DE4 C;  3S9M A;  4ONW A;  4OID A;  3GUX A;  4OC0 A;  2JBK A;  1TKF A;  2QYV A;  1CX8 A;  2NYQ A;  4IAV A;  4MCP A;  4O23 A;  3FVL A;  1VHO A;  1HDQ A;  2PJ5 A;  4G1P A;  2PJA A;  4B6Z A;  1BAV A;  1YW4 A;  2PIY A;  4PPZ A;  4C8T A;  3BI0 A;  4P4J A;  4JYW A;  2WYR A;  3PBE A;  4C9E A;  4OC2 A;  3WAB A;  4C9A A;  3DGV A;  3S9L A;  4P4E A;  3KR5 A;  5ELY A;  3SJE A;  1XRY A;  4NJR A;  1ZG8 A;  4MHN A;  4LQG A;  1IGB A;  1ARM A;  4P4B A;  4C85 A;  2ZEO A;  3D7G A;  2PIZ A;  1TKH A;  2AFU A;  5LYF A;  1CP6 A;  1WVM A;  3SI2 A;  1AYE A;  2PJB A;  2OOT A;  3NH4 A;  3PB8 X;  3DLJ A;  2CTC A;  4P44 A;  1LOK A;  3I6S A;  4OC3 A;  2ZEM A;  3WC7 A;  3TC8 A;  1Z2L A;  3V7Z A;  1Y0Y A;  3D67 A;  2ZEF A;  1BPN A;  2O4H A;  4F9U A;  1TF9 A;  1Z8L A;  3B3W A;  2I3C A;  3QNV A;  4OP4 A;  7CPA A;  2ZED A;  1IY7 A;  3B3T A;  2FVG A;  4AXV A;  3NFZ A;  3KR4 A;  4WJB A;  1H8L A;  1Y7E A;  4YWY A;  4YN3 A;  1YSJ A;  1TXR A;  3T8W A;  3VTA A;  4OC1 A;  4NGT A;  5JM6 A;  3K9T A;  2V77 A;  2XEF A;  1CP7 A;  3JRU A;  4NJQ A;  3VH9 A;  2ZEE A;  5J1Q A;  3TX8 A;  1LCP A;  3RAM A;  1F2O A;  1RTQ A;  3KQZ A;  1ZG9 A;  2C1C A;  3SJG A;  3VAT A;  3B2Y A;  4C8F A;  1HEE A;  4C9U A;  4UEZ A;  4UEE A;  1R43 A;  4PXB A;  2JEW A;  3B7I A;  4DJL A;  2C6G A;  4A38 A;  2PJC A;  5I4M A;  4NGM A;  5THW A;  3PB4 X;  3GB0 A;  4MRI A;  3D7H A;  4OC4 A;  3RBU A;  3FH4 A;  3KGQ A;  4P4I A;  5LRG A;  4PQA A;  5LYI A;  3IIB A;  2V8D A;  2PJ1 A;  4C8P A;  2O53 A;  2PJ6 A;  4MXU A;  1VIX A;  4GM5 A;  1XBU A;  4NGQ A;  3K2K A;  2HB6 A;  4CDJ A;  3SI1 A;  3MRU A;  4OIW A;  1Y0R A;  2JBJ A;  1XF1 A;  3D7F A;  3IWW A;  1GYT A;  4C8C A;  4TNU A;  4X3R A;  2PJ8 A;  1YW6 A;  2BO9 A;  4C9V A;  1XMB A;  4PXC A;  1VGY A;  1Z5R A;  1LAN A;  3B35 A;  1JQG A;  4P10 A;  5K8M A;  2PRQ A;  2PJ7 A;  3N5F A;  2C5Q A;  3ICU A;  4P4F A;  4C8U A;  4MMO A;  4CDK A;  4A39 A;  3PFE A;  4IHM A;  3FEC A;  4TJV A;  2CTB A;  1V6C A;  2AFX A;  4ZY2 A;  3IEH A;  5DS0 A;  2J9A A;  3H8E A;  3LWU A;  4Q7A A;  1LFW A;  8CPA A;  5JGF A;  5IR2 A;  4F8Z A;  3NH5 A;  3CPA A;  2EK9 A;  2RFH A;  3KI9 A;  3D68 A;  4ZX8 A;  4K3N A;  3FX6 A;  5HVF A;  3SJF A;  3IFE A;  4TJX A;  4A37 A;  2WZN A;  3FJU A;  4F9V A;  4W9Y A;  3PB9 X;  5CBM A;  1UWY A;  4C99 A;  4MHY A;  4RUH A;  3WC6 A;  4OC5 A;  1HDU A;  1ZLI A;  1ZG7 A;  5CPA A;  4NFR A;  5LYL A;  4C84 A;  4H2K A;  1NSA A;  3GLJ A;  4JZ0 A;  3NH8 A;  1YLO A;  2ZOG A;  2PVW A;  3IC1 A;  4R8F A;  5HVG A;  1M4L A;  2ZOF A;  2EWB A;  4KSI A;  3CDX A;  2VL1 A;  3CPX A;  2G9D A;  4ZX9 A;  4ZI6 A;  5JH9 A;  2C6P A;  4FWU A;  1BPM A;  2BOA A;  3WC5 A;  1OBR A;  3KZW A;  2PJ0 A;  3BXM A;  2XEI A;  4PXD A;  2IQ6 A;  2V8G A;  3PBB A;  4ZY1 A;  2PCU A;  4WWV A;  4EWT A;  2EK8 A;  3D66 A;  2Q4Z A;  3KHZ A;  2DEA A;  2GRE A;  5LRK A;  2ZEG A;  4FAI A;  4P6Y A;  3KHX A;  5LYD A;  1F2P A;  3H8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...