4OC5A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with chibzl, a urea-based inhibitor n~2~-{[(s)-carboxy(4-hydroxyphenyl)methyl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 260
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
260
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 260
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc5A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc5A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc5A02
4EMEA 1M4LA 2PJ3A 5DS0A 3MN8A 4C9AA 3JRUA 1EE3P 4UEZA 3FVLA 1VIXA 2RFHA 3SJEA 1VHEA 1AMPA 4B6ZA 2ZENA 4C8FA 3K9TA 5K8MA 3KL9A 2HB6A 4MCPA 4NGRA 1ZG9A 3FJUA 1ZG7A 4TNUA 4R7MA 5LRJA 5D29A 3IFEA 3PFEA 4C8AA 4ZY2A 2PIZA 3RZAA 2AFWA 2JEWA 4OC4A 2G9DA 3ISXA 4AXVA 2C1CA 1UWYA 2FVGA 2V77A 3FECA 2EK9A 4R6TA 3KHZA 3PBBA 4NGPA 2ZELA 3I74A 4JYWA 3I1UA 1Y9ZA 5K8NA 2PJBA 3D4UA 3N5FA 3SJFA 3PBEA 5LYLA 1TF8A 2AFMA 1CPXA 4PXDA 2V8GA 3RAMA 4W9YA 1WVMA 2PIYA 1Y7EA 3B35A 2AFOA 2PJ2A 1TKHA 4R8FA 2JBKA 5LYFA 4X8IA 5JH9A 3D7GA 5LRKA 3T8WA 1ELMP 1PYTB 2EK8A 5D8NA 4UEEA 3D67A 2V8VA 5HVHA 3K2KA 1ZLHA 2ZEDA 3WABA 4NGNA 1BLLE 1OBRA 2C6CA 1VGYA 3BI1A 2PJ6A 1CP6A 4OMEA 4P44A 2ZEGA 1CBXA 1TXRA 2BOAA 3LMSA 4MHYA 4IHMA 2AFSA 3NH8A 3FH4A 2JBJA 2NSMA 4OP4A 3FF3A 2QYVA 4EFDA 4EWTA 1IGBA 1XFOA 3VH9A 2GLFA 4ONWA 4DUKA 2POKA 4C8TA 2XEIA 1YMEA 3BXMA 1XBUA 3B3CA 4OC2A 1KWMA 2IMOA 4P4IA 3KI9A 1TF9A 3NA6A 2AFZA 2HC9A 1Z5RA 2AFXA 3B3TA 3V38A 1Q7LA 4P45A 1YLOA 3D7FA 4YU9A 4LQGA 4C99A 4WWVA 5CPAA 2V8DA 2AFUA 1HDQA 3NFZA 5LRGA 3I6SA 4UEFA 4P4JA 1TKFA 4R76A 2PJ5A 2PJ0A 2C6GA 1HDUA 3HLPA 4PXCA 4MMOA 3KASA 2C6PA 4MRIA 4C86A 3IC1A 3PB7X 1Z2LA 5JGFA 4P6YA 3CDXA 2ZEEA 3WT4A 2OOTA 2F7VA 1YW6A 2WYRA 3PB4X 4NJRA 4A37A 1IY7A 1LAMA 3B3WA 2CTBA 1FNOA 1Y0YA 2I3CA 2ABZA 3CPXA 1XMBA 4OIWA 4P4DA 1BPMA 4MHPA 2PVWA 1F57A 4X2TA 2Q43A 3HUVA 1ELLP 3PRTA 2QVPA 4MCQA 1CG2A 1XJOA 3B3SA 3WC7A 3KR5A 2ZOGA 4CDKA 1H8LA 1CP7A 3CT9A 1DTDA 4P4FA 5ELYA 3PB6X 2PJCA 4P4BA 3KQZA 5LYIA 4CDJA 2NYQA 1CPSA 4DJLA 2BCOA 4OC0A 4IK2A 3IJ3A 4YN3A 1NSAA 2ZEMA 4FWUA 3NH4A 4P4EA 4PPZA 2PJ8A 2WZNA 2PJAA 4ZX9A 5HXDA 1LOKA 3IIBA 2RB7A 4NGTA 3PEIA 1GYTA 3LWUA 4MXUA 3D66A 1ZLIA 3V7ZA 2PRQA 1Z8LA 2XEFA 3GB0A 3KQXA 3KHXA 3FEEA 3SJGA 1BPNA 1ZG8A 3RBUA 4OC1A 4PQAA 2PJ1A 4Z65A 4GM5A 2ZEOA 2PE3A 3KR4A 2O4HA 4TJXA 3EIFA 3VTAA 4ZI6A 3S9NA 2BO9A 4ZY0A 1ARLA 3CPAA 3SI0A 2F8HA 3PFOA 3TX8A 4KSIA 4Q7AA 2VL1A 2ZOFA 3FEDA 3ICUA 4PXBA 4K3NA 4C9UA 2OR4A 2J9AA 8CPAA 1YSJA 3IO1A 4C8PA 3DGVA 2CF4A 3TC8A 1YW4A 4NJQA 3ISZA 3DLJA 1F2PA 5HVFA 3PB9X 2IJZA 3GLJA 1F2OA 1LAPA 4NGQA 4UIBA 4NGSA 5THWA 1XRYA 1FT7A 2V8HA 4O23A 5F09A 5J1QA 1HEEA 4IAVA 3BI0A 2CIJA 4WJBA 4CPAA 4UF4A 2XEGA 4MCRA 4MHNA 2PVVA 2GREA 4OC3A 3SI2A 3SI1A 1BAVA 1R3NA 1XF1A 4TWEA 3VARA 1RTQA 3H8GA 4C9EA 7CPAA 2PJ4A 4RUHA 3IEHA 1JQGA 2PJ7A 3S9LA 3WC6A 4C8UA 4P10A 4FAIA 1LCPA 4NGMA 2XEJA 2EWBA 3B7IA 5I4MA 4C85A 4C9VA 3VATA 1VHOA 3MRUA 3B2YA 4A39A 3BHXA 4C9RA 4YWYA 4FBEA 4F8ZA 1QMUA 4OC5A 1DE4C 6CPAA 3SJXA 3FMCA 3H8FA 5K8PA 1Y0RA 1LFWA 2QJ8A 4ZY1A 3B3VA 1V6CA 2ZEHA 4A38A 3WC5A 5JM6A 1AYEA 4F9UA 4MCSA 1CX8A 4X3RA 1R43A 2ZEFA 3PB8X 4KNGE 2ZEPA 4BD9A 4C8CA 2Q51A 4PXEA 2CTCA 4F9VA 4ZX8A 4C84A 2DEAA 2PCUA 5LYDA 5HVGA 2PJ9A 2GU2A 1LANA 3IWWA 5CBMA 3QNVA 4TJVA 4FUUA 3S9MA 3NH5A 3D7DA 2GLJA 3H8EA 4G1PA 4MHZA 3FX6A 2ANPA 4ZYQA 4JZ0A 5IB9A 2Q4ZA 4OKOA 3GUXA 4DYOA 4A94A 4H2KA 2O53A 4OIDA 3KZWA 4NFRA 3D7HA 3L2NA 1TKJA 2IQ6A 3D68A 5K8OA 4UIAA 1ARMA 1PCAA 3KGQA 1QQ9A
chains in the Genus database with same CATH superfamily
4KUAA 4UCMA 2FXFA 2R82A 5H84A 2YNCC 3NFQA 3EZEA 4EMEA 2GIVA 4UFVA 1M1DA 1M4LA 2PJ3A 5BWAB 1S3ZA 5DS0A 4A2ZA 1Z4EA 1IICA 5IB0A 1J4JA 2Q04A 3MN8A 4HPSA 5F47A 3JRUA 5J3XA 1C3OB 4C9AA 1EE3P 4KOVA 4U9ZA 2ZW7A 1J3LA 3TLCA 4UEZA 4BINA 3FVLA 1VIXA 1Z8WA 2RFHA 3SJEA 1VHEA 1AMPA 3PLFB 2ZENA 4B6ZA 4C8FA 3K9TA 2R98A 4E2AA 5K8MA 2EZBA 4C7IA 2PSWA 3KL9A 5HH1A 2HB6A 5A27A 4JVOA 4MCPA 4NGRA 2HROA 1ZG9A 2VZYA 3FJUA 5KTDA 3RYOA 1XMTA 3W6XA 1ZG7A 2H5MA 4OADA 4TNUA 4R7MA 3TOAA 4MFPA 3F8KA 5LRJA 3SXNA 1M6VB 4R3LA 4CYQA 4CGOA 3EZBA 5D29A 3GIUA 3R9FA 3IFEA 3PFEA 3VRQA 4C8AA 4LUAA 4ZY2A 2PIZA 2Z3KA 3RZAA 2YJTA 1CJWA 2I00A 3JUWA 2AFWA 2JEWA 5AG7A 4AG7A 4H1HA 3E0KA 4OC4A 2G9DA 3TTHA 3BJ7A 1QSTA 3ISXA 4AXVA 5F1YA 2XPLA 2C1CA 1UWYA 4CYPA 1YVKA 2YNEA 4QUSA 4C68A 4H6ZA 1PU9A 3TE4A 2FVGA 3JTKA 2V77A 3FECA 1XOVA 1Y7RA 1YVOA 1I12A 1EO0A 1R57A 2EK9A 4R6TA 2VKZG 3KHZA 3PBBA 4NGPA 2ZELA 4KOTA 4PK3A 4PPZA 4JLYA 4CAWA 3I74A 2ZPAA 4JYWA 3PZJA 1BO4A 4JXQA 3I1UA 5DWNA 1Y9ZA 4BTFA 5K8NA 1XIXA 2PJBA 3GY9A 2ODFA 3D4UA 5FD8A 2PRBA 2VEZA 1MJ9A 1TIQA 3VGOA 2DF5A 2VXKA 3U88C 4ONUA 2JDDA 1P4NA 3N5FA 3SJFA 2DIKA 5HMNA 3PBEA 5LYLA 2B5GA 1TF8A 4U5YA 2AFMA 1CPXA 1LRZA 4PXDA 2V8GA 3RAMA 1GGOA 3CXSA 2FCKA 3R96A 1ZL0A 5JYBA 4W9YA 2Y0MA 1WVMA 2PIYA 2Z10A 4H6UA 1A2ZA 1Y7EA 3B35A 2AFOA 2WUUA 2PJ2A 3H5ZA 1NE9A 3ZJ0A 4MJ8A 1TKHA 4R8FA 1I21A 4MFKA 3RNZA 2JBKA 5LYFA 2OZUA 4X8IA 4A30A 5IX3A 5JH9A 2JEVA 3VRRA 3D7GA 4RS2A 5LRKA 4R57A 3T8WA 2J8NA 1ELMP 4AVCA 1PYTB 2EK8A 5AGEA 5D8NA 2B5GB 1MJBA 2GE3A 3D67A 2V8VA 4UEEA 5HVHA 4JJXA 4UCNA 3K2KA 1KBLA 1FBVA 4KSAA 1ZLHA 4J0NA 2ZEDA 3C26A 3WABA 2HQYA 3NOJA 4NGNA 1BLLE 1XEBA 3BUOB 1SQHA 2C6CA 1OBRA 2D4PA 3EFAA 5F48A 4A4BA 1Q5XA 3KRVA 3T05A 2B4BA 3TLGB 3BUNB 2CY2A 1VGYA 4FD7A 2EZAA 1S7FA 2Z3LA 3BI1A 5AG6A 4E0AA 4KLWA 1S60A 3FXTA 4B13A 2PJ6A 2B0AA 4CO9A 5AXIA 1CP6A 4OMEA 2D0PA 2C27A 4P44A 2ATRA 3OP0A 2ZEGA 1CBXA 1K4JA 4UFWA 1TXRA 2BOAA 2WPWA 3LMSA 4KSFA 4MHYA 4IHMA 3TOBA 3K4IA 3S6FA 2A4NA 2AFSA 3NH8A 4UA3A 3FH4A 2VZZA 4IF5A 4MI1A 4XPDC 1DIKA 2JBJA 2NSMA 2FL4A 1S5KA 4OP4A 3FF3A 2C5QA 4NEXA 2QYVA 1I1DA 4EFDA 3O8ZA 4EWTA 1IGBA 1XFOA 3VH9A 5AG4A 2GLFA 1YX0A 2PR8A 2Y1NA 2GFQA 4ONWA 2BUEA 3D3SA 3TO6A 3VWDA 4DUKA 2POKA 4MI4A 4A4CA 2Y1MA 2EVNA 1WWZA 3FBUA 4C8TA 1MJAA 3CXQA 2XEIA 2GANA 2P6FA 1YMEA 3BXMA 1XBUA 3B3CA 2XPOA 4OC2A 4IUSA 1KWMA 1Z8XA 2UV8G 2IMOA 2P6GA 2Z3PA 4QB9A 3IWGA 4P4IA 3KI9A 2E28A 4KOSA 3BLNA 4AB7A 1TF9A 3NA6A 2AFZA 2HC9A 1JDBC 1Z5RA 2AFXA 3VWEA 3PGPA 4U9YA 3B3TA 3V38A 1Q7LA 4P45A 1YLOA 4J3GA 3D7FA 4YU9A 4LQGA 1CM0A 1Z9UA 2PQ8A 4HNXB 4C99A 4WWVA 5CPAA 2V8DA 3RO0A 5F46A 2XPPA 1S7KA 1HDQA 2CBLA 3BUMB 2AFUA 3NFZA 5LRGA 3I6SA 2FE7A 2J8MA 1AUGA 1V0CA 4UEFA 2JLMA 4P4JA 1TKFA 1VHSA 4Q36A 2PJ5A 4R76A 4UWIA 4AVAA 3HPHE 2PJ0A 1MK4A 3I9SA 3SHPA 2C6GA 1HDUA 1M4GA 3HLPA 4MMOA 4PXCA 5JQ4A 1IB1E 3OAKA 3IU2A 4XNHC 3KASA 2C6PA 5GCNA 4MRIA 4F0YA 4C86A 1YGHA 3IC1A 1CS0B 3SI2A 1B6BA 3PB7X 2FSRA 1Z2LA 3B8GA 1IIDA 1Y9KA 5JGFA 1B47A 4P6YA 3CDXA 1NBWA 2ZEEA 3WT4A 2HV2A 2OOTA 2QIRA 3EZAA 5CNPA 4MHDA 2F7VA 1YW6A 1OZPA 2WYRA 3PB4X 4NJRA 1IY7A 1Q2YA 4ORFA 4A37A 1LAMA 3VRPA 3B3WA 2OH1A 2CTBA 1FNOA 1Y0YA 2AUMA 3VRNA 2I3CA 2ABZA 4CGPA 5G21A 3CPXA 5IR2A 1XMBA 1YR0A 4OIWA 3U1BA 2HUZA 4P4DA 3T5MA 1BPMA 2DPSA 4MHPA 2PVWA 5IV0A 1IYKA 1F57A 2P0WA 4X2TA 2Q43A 2HWGA 4CZ1A 3HUVA 3DNSA 1ELLP 3PRTA 2QVPA 5C88A 4B14A 4KS9A 1KUXA 4MCQA 1CG2A 2JDCA 3KKWA 3UY5A 1N71A 1XJOA 3B3SA 4M6GA 3WC7A 3KR5A 2ZOGA 4R9MA 4CDKA 3IU1A 1H8LA 1CP7A 3R9GA 3CT9A 4B12A 1R61A 1DTDA 4P4FA 3WR7A 1QSRA 3NE7A 5ELYA 1P0HA 5BY0A 2OZGA 3S6KA 2AJ6A 4KOWA 2Z3NA 3PB6X 4CRYB 4E8OA 4E94A 4KOUA 4CRZB 2PJCA 1U6MA 4QBJA 4P4BA 3KQZA 4GS4A 1IU8A 5F49A 5LYIA 3TLGA 2FS5A 2YJVA 4CDJA 2NYQA 4BPWB 1M4IA 1CPSA 4B11A 4DJLA 2HI6A 2BCOA 4A31A 1ZRSA 2OLSA 1KUYA 1WK4A 4CS0B 4OC0A 4IK2A 4M6IA 1FY7A 3IJ3A 4KLVA 2PCNA 2OZHA 1NXJA 4YN3A 1NSAA 2ZEMA 3R1KA 1KUVA 2N3AB 4FWUA 1Z9EA 3F9KC 4P4EA 2FIWA 2KCWA 2CNSA 2O28A 2PJ8A 2WZNA 2PJAA 3PFVA 2RC4A 3EY5A 4ZX9A 5HXDA 4NCZA 1LOKA 3IIBA 1KC7A 2FT0A 2RB7A 4NGTA 3PEIA 1EZBA 2XPNA 4ZY1A 1YVHA 3SR3A 1GYTA 3LWUA 4XPLA 3R95A 3R9EA 4MXUA 2Q4YA 5C82A 1QSOA 3D66A 4KVOE 3TO9A 1ZLIA 3V7ZA 2PRQA 4C7HA 3PP9A 4C2YA 1L0CA 3G23A 1Z8LA 2F5IA 4OLLA 2XEFA 5HKYA 3GB0A 3BUXB 3KQXA 3KHXA 1VBGA 4UBRA 3FEEA 3W6SA 3SJGA 3VROA 1BPNA 1ZG8A 1VKCA 1S7LA 2Q7BA 3T9YA 3OB1B 4OC1A 3RBUA 2DPTA 2PJ1A 4PQAA 4B5PA 3IGRA 4Z65A 5KTAA 3EXNA 4JWPA 3PT1A 4GM5A 2ZEOA 2ZW6A 4F6AA 2B3UA 2PE3A 5I0CA 4M6HA 3KR4A 3G8WA 4DNCA 2O4HA 4HKFA 3TO7A 1Z4RA 1GHEA 4CGMA 4Y49B 3EIFA 5DWMA 4TJXA 4B5OA 4ZI6A 3VTAA 3S9NA 2BO9A 4ZY0A 3T90A 1ARLA 4CGNA 5F13A 1ZO0A 3CPAA 3SI0A 2F8HA 3PFOA 3TX8A 3S6HA 2P6EA 3D2MA 3T07A 1XE4A 4HNWB 1WJTA 4KSIA 4BBHA 3HPGG 1Q2DA 2EBJA 4Q7AA 3TYXA 4PSXA 2VL1A 3DR8A 2ZOFA 4B5PB 4CYNA 5F9MA 1QSMA 2PC1A 3G3SA 4M8DA 3FEDA 1UFHA 4FD4A 4PXBA 4K3NA 3ICUA 4BPUB 4C9UA 4II9A 2OR4A 1XF8A 2J9AA 3DSBA 3I3GA 1YSJA 3IO1A 8CPAA 5EMIA 1C30B 2Q7SA 4C8PA 3DGVA 2CF4A 2ZW4A 4JD6A 4NXYA 5FVJA 3TC8A 5K99A 4A32A 1YW4A 4NJQA 3ISZA 3DLJA 1F2PA 2BL1A 5HVFA 3EO4A 4KOXA 3PB9X 2IJZA 1F2OA 1LAPA 3GLJA 2BSWA 4NGQA 2ARHA 4UIBA 4RI1A 2GP4A 3FB3A 4NGSA 5THWA 1XRYA 1FT7A 2V8HA 2PR1A 3TFYA 1BOBA 3DDDA 4CAEA 4O23A 1BXRB 3CZXA 3GJZA 2ZXVA 5F09A 2BEIA 4CAFA 5J1QA 2YNCA 4PK2A 3TLEA 3NE8A 4YFJA 1HEEA 1RXTA 4IAVA 4F0XA 3BI0A 4IIXA 2CIJA 2B4DA 4WJBA 2R8VA 4KUBA 4CPAA 4MFJA 2VQYA 4UF4A 2XEGA 4MCRA 3P2FA 1VBHA 2FM4A 4MHNA 1Y9WA 2PVVA 1S7NA 2GREA 3D8PA 5G20A 4INJA 4OC3A 2REFA 2VI7A 2AE6A 4L89A 4XPDB 5H86A 3FRMA 3SI1A 3EC4A 1BAVA 1R3NA 2X7BA 2QECA 3BJ8A 4TWEA 3VARA 1XF1A 2CNTA 4GPLB 1X10A 2EO8A 1RTQA 3H8GA 2Q4VA 3TLYA 4MY3A 3QAYA 4MFZA 4C2ZA 3T0TA 4UWJA 2PJ4A 7CPAA 4C9EA 5ISVA 2B58A 2EUIA 4GXHA 3IEHA 3LODA 4FD5A 1JQGA 1PUAA 3N7ZA 4LQ6A 4RUHA 2PJ7A 2B3VA 3S9LA 3QAHA 3WC6A 1NSLA 4C8UA 2B4DB 1Z8TA 5HKZA 1IOIA 4P10A 2G3AA 3GKRA 4QVTA 3H4QA 4R87A 4FAIA 1JDEA 1IOFA 1LCPA 4RN7A 4NGMA 4PSWA 2XEJA 2EWBA 2Z3OA 3B7IA 4PV6A 5F5XA 4EYSA 5I4MA 4B10A 3IWEA 4BPXB 4C85A 4C9VA 3VATA 1VHOA 3ZNIA 4C2XA 4A33A 5JVLA 3MRUA 1M4DA 5HKWA 4KVME 3V8IA 1QSNA 3B2YA 4A39A 2X0SA 3BHXA 2K5TA 2WSAA 3ZZIA 4C9RA 4YWYA 1KZFA 4MFLA 2Q44A 4RR2B 2YGWA 1QMUA 3F5BA 4OC5A 2FIAA 2D4OA 1DE4C 2Z0ZA 4HNYB 4FBEA 1KEEB 3GYAA 6CPAA 1ZYMA 3SJXA 1RO5A 3FMCA 3H8FA 3JVNA 5K8PA 3LD2A 1Y0RA 2CNMA 5EBVA 5G1ZA 1JWQA 1LFWA 2QJ8A 3OWCA 2OU2A 3B3VA 4MFQA 4UFXA 4XNHB 2I79A 2ZEHA 3OB2B 2R7HA 3TCVA 4CGLA 4A38A 3P2HA 3WC5A 1M44A 4CYOA 1YK3A 4H89A 5JM6A 2YNDA 3TLBA 4F8ZA 4X5KA 3BUWB 4Y49C 2EZCA 1AYEA 5E96A 4IIYA 4F9UA 4MY0A 5A28A 1V6CA 4L8AA 4MCSA 4KZTA 4BMHA 1CX8A 4X3RA 1R43A 2REEA 2Z3MA 2B4JC 4OAEA 5G22A 2ZEFA 4CAXA 3PB8X 4AVBA 4KNGE 4EVYA 2NMTA 2ZEPA 1X12A 4BD9A 4E5SA 4C8CA 4NSQA 2Q51A 4JXRA 4PXEA 4ZGYB 2CTCA 4CAVA 4M85A 4F9VA 5KTCA 4ZX8A 3F0AA 2DEAA 2PDOA 3SXOA 2PCUA 3NH4A 4C84A 5LYDA 4XPKA 3FIXA 3W91A 3TLZA 5HVGA 2Q0YA 1ON0A 1CE8B 4COGA 2CXAA 2PJ9A 3K9UA 3S6GA 2GU2A 3MGDA 2AUNA 1LANA 2WPXA 3FYNA 4ZBGA 5EC4A 4AG9A 3IWWA 3TT2A 1A9XB 2MP0A 5CBMA 4R3KA 1YLEA 3QNVA 4TJVA 4KVXA 4FUUA 1VI4A 4MJXA 2Z11A 2ZW5A 3S9MA 1YREA 3NH5A 4FD6A 3QB8A 4K30A 2IL4A 5JPHA 3D7DA 2GLJA 3C8OA 3H8EA 2OB0A 4G1PA 4I49A 4MHZA 2DLAA 3FX6A 2VBQA 4LX9A 3CXPA 4KORA 4QC6A 2R1IA 4YRHA 2ANPA 4ZYQA 4JZ0A 5IB9A 4YGOA 2D0OA 2G3TA 4MBUA 2Q4ZA 2QMLA 2DXQA 4OKOA 5J8CA 3GUXA 3A9LA 4COBA 4DYOA 3DR6A 4A94A 3D2PA 4H2KA 1EZAA 3TLAA 2O53A 3HMJG 1YQEA 4OIDA 3KZWA 1NMTA 5AG5A 4NFRA 4UCPA 4M3SA 3D7HA 3L2NA 1TKJA 2IQ6A 3D68A 1Q2CA 4UIAA 5K8OA 1T36B 3FNCA 2J8RA 1IYLA 1ARMA 4KOYA 4NF1A 4Q38A 4A95A 5J8FA 1PCAA 3KGQA 1B87A 3LACA 2G0BA 1QQ9A
chains in the Genus database with same CATH topology
4EMEA 1M4LA 2PJ3A 5DS0A 3MN8A 4C9AA 3JRUA 1EE3P 4UEZA 3FVLA 1VIXA 2RFHA 3SJEA 1VHEA 1AMPA 4B6ZA 2ZENA 4C8FA 3K9TA 5K8MA 3KL9A 2HB6A 4MCPA 4NGRA 1ZG9A 3FJUA 1ZG7A 4TNUA 4R7MA 5LRJA 5D29A 3IFEA 3PFEA 4C8AA 4ZY2A 2PIZA 3RZAA 2AFWA 2JEWA 4OC4A 2G9DA 3ISXA 4AXVA 2C1CA 1UWYA 2FVGA 2V77A 3FECA 2EK9A 4R6TA 3KHZA 3PBBA 4NGPA 2ZELA 3I74A 4JYWA 3I1UA 1Y9ZA 5K8NA 2PJBA 3D4UA 3N5FA 3SJFA 3PBEA 5LYLA 1TF8A 2AFMA 1CPXA 4PXDA 2V8GA 3RAMA 4W9YA 1WVMA 2PIYA 1Y7EA 3B35A 2AFOA 2PJ2A 1TKHA 4R8FA 2JBKA 5LYFA 4X8IA 5JH9A 3D7GA 5LRKA 3T8WA 1ELMP 1PYTB 2EK8A 5D8NA 4UEEA 3D67A 2V8VA 5HVHA 3K2KA 1ZLHA 2ZEDA 3WABA 4NGNA 1BLLE 1OBRA 2C6CA 1VGYA 3BI1A 2PJ6A 1CP6A 4OMEA 4P44A 2ZEGA 1CBXA 1TXRA 2BOAA 3LMSA 4MHYA 4IHMA 2AFSA 3NH8A 3FH4A 2JBJA 2NSMA 4OP4A 2C5QA 3FF3A 2QYVA 4EFDA 4EWTA 1IGBA 1XFOA 3VH9A 2GLFA 4ONWA 4DUKA 2POKA 4C8TA 2XEIA 1YMEA 3BXMA 1XBUA 3B3CA 4OC2A 1KWMA 2IMOA 4P4IA 3KI9A 1TF9A 3NA6A 2AFZA 2HC9A 1Z5RA 2AFXA 3B3TA 3V38A 1Q7LA 4P45A 1YLOA 3D7FA 4YU9A 4LQGA 4C99A 4WWVA 5CPAA 2V8DA 2AFUA 1HDQA 3NFZA 5LRGA 3I6SA 4UEFA 4P4JA 1TKFA 4R76A 2PJ5A 2PJ0A 2C6GA 1HDUA 3HLPA 4PXCA 4MMOA 3KASA 2C6PA 4MRIA 4C86A 3IC1A 3PB7X 1Z2LA 5JGFA 4P6YA 3CDXA 2ZEEA 3WT4A 2OOTA 2F7VA 1YW6A 2WYRA 3PB4X 4NJRA 4A37A 1IY7A 1LAMA 3B3WA 2CTBA 1FNOA 1Y0YA 2I3CA 2ABZA 3CPXA 5IR2A 1XMBA 4OIWA 4P4DA 1BPMA 4MHPA 2PVWA 1F57A 4X2TA 2Q43A 3HUVA 1ELLP 3PRTA 2QVPA 4MCQA 1CG2A 1XJOA 3B3SA 3WC7A 3KR5A 2ZOGA 4CDKA 1H8LA 1CP7A 3CT9A 1DTDA 4P4FA 5ELYA 3PB6X 2PJCA 4P4BA 3KQZA 5LYIA 4CDJA 2NYQA 1CPSA 4DJLA 2BCOA 4OC0A 4IK2A 3IJ3A 4YN3A 1NSAA 2ZEMA 4FWUA 3NH4A 4P4EA 4PPZA 2GP4A 2PJ8A 2WZNA 2PJAA 4ZX9A 5HXDA 1LOKA 3IIBA 2RB7A 4NGTA 3PEIA 1GYTA 3LWUA 4MXUA 3D66A 1ZLIA 3V7ZA 2PRQA 1Z8LA 2XEFA 3GB0A 3KQXA 3KHXA 3FEEA 3SJGA 1BPNA 1ZG8A 3RBUA 4OC1A 4PQAA 2PJ1A 4Z65A 4GM5A 2ZEOA 2PE3A 3KR4A 2O4HA 4TJXA 3EIFA 3VTAA 4ZI6A 3S9NA 2BO9A 4ZY0A 1ARLA 3CPAA 3SI0A 2F8HA 3PFOA 3TX8A 4KSIA 4Q7AA 2VL1A 2ZOFA 3FEDA 3ICUA 4PXBA 4K3NA 4C9UA 2OR4A 2J9AA 8CPAA 1YSJA 3IO1A 4C8PA 3DGVA 2CF4A 3TC8A 1YW4A 4NJQA 3ISZA 3DLJA 1F2PA 5HVFA 3PB9X 2IJZA 3GLJA 1F2OA 1LAPA 4NGQA 4UIBA 4NGSA 5THWA 1XRYA 1FT7A 2V8HA 4O23A 5F09A 5J1QA 1HEEA 4IAVA 3BI0A 2CIJA 4WJBA 4CPAA 4UF4A 2XEGA 4MCRA 4MHNA 2PVVA 2GREA 4OC3A 3SI2A 3SI1A 1BAVA 1R3NA 1XF1A 4TWEA 3VARA 1RTQA 3H8GA 4C9EA 7CPAA 2PJ4A 4RUHA 3IEHA 1JQGA 2PJ7A 3S9LA 3WC6A 4C8UA 4P10A 4FAIA 1LCPA 4NGMA 2XEJA 2EWBA 3B7IA 5I4MA 4C85A 4C9VA 3VATA 1VHOA 3MRUA 3B2YA 4A39A 3BHXA 4C9RA 4YWYA 4FBEA 4F8ZA 1QMUA 4OC5A 1DE4C 6CPAA 3SJXA 3FMCA 3H8FA 5K8PA 1Y0RA 1LFWA 2QJ8A 4ZY1A 3B3VA 1V6CA 2ZEHA 4A38A 3WC5A 5JM6A 1AYEA 4F9UA 4MCSA 1CX8A 4X3RA 1R43A 2ZEFA 3PB8X 4KNGE 2ZEPA 4BD9A 4C8CA 2Q51A 4PXEA 2CTCA 4F9VA 4ZX8A 4C84A 2DEAA 2PCUA 5LYDA 5HVGA 2PJ9A 2GU2A 1LANA 3IWWA 5CBMA 3QNVA 4TJVA 4FUUA 3S9MA 3NH5A 3D7DA 2GLJA 3H8EA 4G1PA 4MHZA 3FX6A 2ANPA 4ZYQA 4JZ0A 5IB9A 2Q4ZA 4OKOA 3GUXA 4DYOA 4A94A 4H2KA 2O53A 4OIDA 3KZWA 4NFRA 3D7HA 3L2NA 1TKJA 2IQ6A 3D68A 5K8OA 4UIAA 1ARMA 1PCAA 3KGQA 1QQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EME A;  1M4L A;  2PJ3 A;  5DS0 A;  3MN8 A;  4C9A A;  3JRU A;  1EE3 P;  4UEZ A;  3FVL A;  1VIX A;  2RFH A;  3SJE A;  1VHE A;  1AMP A;  4B6Z A;  2ZEN A;  4C8F A;  3K9T A;  5K8M A;  3KL9 A;  2HB6 A;  4MCP A;  4NGR A;  1ZG9 A;  3FJU A;  1ZG7 A;  4TNU A;  4R7M A;  5LRJ A;  5D29 A;  3IFE A;  3PFE A;  4C8A A;  4ZY2 A;  2PIZ A;  3RZA A;  2AFW A;  2JEW A;  4OC4 A;  2G9D A;  3ISX A;  4AXV A;  2C1C A;  1UWY A;  2FVG A;  2V77 A;  3FEC A;  2EK9 A;  4R6T A;  3KHZ A;  3PBB A;  4NGP A;  2ZEL A;  3I74 A;  4JYW A;  3I1U A;  1Y9Z A;  5K8N A;  2PJB A;  3D4U A;  3N5F A;  3SJF A;  3PBE A;  5LYL A;  1TF8 A;  2AFM A;  1CPX A;  4PXD A;  2V8G A;  3RAM A;  4W9Y A;  1WVM A;  2PIY A;  1Y7E A;  3B35 A;  2AFO A;  2PJ2 A;  1TKH A;  4R8F A;  2JBK A;  5LYF A;  4X8I A;  5JH9 A;  3D7G A;  5LRK A;  3T8W A;  1ELM P;  1PYT B;  2EK8 A;  5D8N A;  4UEE A;  3D67 A;  2V8V A;  5HVH A;  3K2K A;  1ZLH A;  2ZED A;  3WAB A;  4NGN A;  1BLL E;  1OBR A;  2C6C A;  1VGY A;  3BI1 A;  2PJ6 A;  1CP6 A;  4OME A;  4P44 A;  2ZEG A;  1CBX A;  1TXR A;  2BOA A;  3LMS A;  4MHY A;  4IHM A;  2AFS A;  3NH8 A;  3FH4 A;  2JBJ A;  2NSM A;  4OP4 A;  3FF3 A;  2QYV A;  4EFD A;  4EWT A;  1IGB A;  1XFO A;  3VH9 A;  2GLF A;  4ONW A;  4DUK A;  2POK A;  4C8T A;  2XEI A;  1YME A;  3BXM A;  1XBU A;  3B3C A;  4OC2 A;  1KWM A;  2IMO A;  4P4I A;  3KI9 A;  1TF9 A;  3NA6 A;  2AFZ A;  2HC9 A;  1Z5R A;  2AFX A;  3B3T A;  3V38 A;  1Q7L A;  4P45 A;  1YLO A;  3D7F A;  4YU9 A;  4LQG A;  4C99 A;  4WWV A;  5CPA A;  2V8D A;  2AFU A;  1HDQ A;  3NFZ A;  5LRG A;  3I6S A;  4UEF A;  4P4J A;  1TKF A;  4R76 A;  2PJ5 A;  2PJ0 A;  2C6G A;  1HDU A;  3HLP A;  4PXC A;  4MMO A;  3KAS A;  2C6P A;  4MRI A;  4C86 A;  3IC1 A;  3PB7 X;  1Z2L A;  5JGF A;  4P6Y A;  3CDX A;  2ZEE A;  3WT4 A;  2OOT A;  2F7V A;  1YW6 A;  2WYR A;  3PB4 X;  4NJR A;  4A37 A;  1IY7 A;  1LAM A;  3B3W A;  2CTB A;  1FNO A;  1Y0Y A;  2I3C A;  2ABZ A;  3CPX A;  1XMB A;  4OIW A;  4P4D A;  1BPM A;  4MHP A;  2PVW A;  1F57 A;  4X2T A;  2Q43 A;  3HUV A;  1ELL P;  3PRT A;  2QVP A;  4MCQ A;  1CG2 A;  1XJO A;  3B3S A;  3WC7 A;  3KR5 A;  2ZOG A;  4CDK A;  1H8L A;  1CP7 A;  3CT9 A;  1DTD A;  4P4F A;  5ELY A;  3PB6 X;  2PJC A;  4P4B A;  3KQZ A;  5LYI A;  4CDJ A;  2NYQ A;  1CPS A;  4DJL A;  2BCO A;  4OC0 A;  4IK2 A;  3IJ3 A;  4YN3 A;  1NSA A;  2ZEM A;  4FWU A;  3NH4 A;  4P4E A;  4PPZ A;  2PJ8 A;  2WZN A;  2PJA A;  4ZX9 A;  5HXD A;  1LOK A;  3IIB A;  2RB7 A;  4NGT A;  3PEI A;  1GYT A;  3LWU A;  4MXU A;  3D66 A;  1ZLI A;  3V7Z A;  2PRQ A;  1Z8L A;  2XEF A;  3GB0 A;  3KQX A;  3KHX A;  3FEE A;  3SJG A;  1BPN A;  1ZG8 A;  3RBU A;  4OC1 A;  4PQA A;  2PJ1 A;  4Z65 A;  4GM5 A;  2ZEO A;  2PE3 A;  3KR4 A;  2O4H A;  4TJX A;  3EIF A;  3VTA A;  4ZI6 A;  3S9N A;  2BO9 A;  4ZY0 A;  1ARL A;  3CPA A;  3SI0 A;  2F8H A;  3PFO A;  3TX8 A;  4KSI A;  4Q7A A;  2VL1 A;  2ZOF A;  3FED A;  3ICU A;  4PXB A;  4K3N A;  4C9U A;  2OR4 A;  2J9A A;  8CPA A;  1YSJ A;  3IO1 A;  4C8P A;  3DGV A;  2CF4 A;  3TC8 A;  1YW4 A;  4NJQ A;  3ISZ A;  3DLJ A;  1F2P A;  5HVF A;  3PB9 X;  2IJZ A;  3GLJ A;  1F2O A;  1LAP A;  4NGQ A;  4UIB A;  4NGS A;  5THW A;  1XRY A;  1FT7 A;  2V8H A;  4O23 A;  5F09 A;  5J1Q A;  1HEE A;  4IAV A;  3BI0 A;  2CIJ A;  4WJB A;  4CPA A;  4UF4 A;  2XEG A;  4MCR A;  4MHN A;  2PVV A;  2GRE A;  4OC3 A;  3SI2 A;  3SI1 A;  1BAV A;  1R3N A;  1XF1 A;  4TWE A;  3VAR A;  1RTQ A;  3H8G A;  4C9E A;  7CPA A;  2PJ4 A;  4RUH A;  3IEH A;  1JQG A;  2PJ7 A;  3S9L A;  3WC6 A;  4C8U A;  4P10 A;  4FAI A;  1LCP A;  4NGM A;  2XEJ A;  2EWB A;  3B7I A;  5I4M A;  4C85 A;  4C9V A;  3VAT A;  1VHO A;  3MRU A;  3B2Y A;  4A39 A;  3BHX A;  4C9R A;  4YWY A;  4FBE A;  4F8Z A;  1QMU A;  4OC5 A;  1DE4 C;  6CPA A;  3SJX A;  3FMC A;  3H8F A;  5K8P A;  1Y0R A;  1LFW A;  2QJ8 A;  4ZY1 A;  3B3V A;  1V6C A;  2ZEH A;  4A38 A;  3WC5 A;  5JM6 A;  1AYE A;  4F9U A;  4MCS A;  1CX8 A;  4X3R A;  1R43 A;  2ZEF A;  3PB8 X;  4KNG E;  2ZEP A;  4BD9 A;  4C8C A;  2Q51 A;  4PXE A;  2CTC A;  4F9V A;  4ZX8 A;  4C84 A;  2DEA A;  2PCU A;  5LYD A;  5HVG A;  2PJ9 A;  2GU2 A;  1LAN A;  3IWW A;  5CBM A;  3QNV A;  4TJV A;  4FUU A;  3S9M A;  3NH5 A;  3D7D A;  2GLJ A;  3H8E A;  4G1P A;  4MHZ A;  3FX6 A;  2ANP A;  4ZYQ A;  4JZ0 A;  5IB9 A;  2Q4Z A;  4OKO A;  3GUX A;  4DYO A;  4A94 A;  4H2K A;  2O53 A;  4OID A;  3KZW A;  4NFR A;  3D7H A;  3L2N A;  1TKJ A;  2IQ6 A;  3D68 A;  5K8O A;  4UIA A;  1ARM A;  1PCA A;  3KGQ A;  1QQ9 A; 
#chains in the Genus database with same CATH topology
 4KUA A;  4UCM A;  2FXF A;  2R82 A;  5H84 A;  2YNC C;  3NFQ A;  3EZE A;  4EME A;  2GIV A;  4UFV A;  1M1D A;  1M4L A;  2PJ3 A;  5BWA B;  1S3Z A;  5DS0 A;  4A2Z A;  1Z4E A;  1IIC A;  5IB0 A;  1J4J A;  2Q04 A;  3MN8 A;  4HPS A;  5F47 A;  3JRU A;  5J3X A;  1C3O B;  4C9A A;  1EE3 P;  4KOV A;  4U9Z A;  2ZW7 A;  1J3L A;  3TLC A;  4UEZ A;  4BIN A;  3FVL A;  1VIX A;  1Z8W A;  2RFH A;  3SJE A;  1VHE A;  1AMP A;  3PLF B;  2ZEN A;  4B6Z A;  4C8F A;  3K9T A;  2R98 A;  4E2A A;  5K8M A;  2EZB A;  4C7I A;  2PSW A;  3KL9 A;  5HH1 A;  2HB6 A;  5A27 A;  4JVO A;  4MCP A;  4NGR A;  2HRO A;  1ZG9 A;  2VZY A;  3FJU A;  5KTD A;  3RYO A;  1XMT A;  3W6X A;  1ZG7 A;  2H5M A;  4OAD A;  4TNU A;  4R7M A;  3TOA A;  4MFP A;  3F8K A;  5LRJ A;  3SXN A;  1M6V B;  4R3L A;  4CYQ A;  4CGO A;  3EZB A;  5D29 A;  3GIU A;  3R9F A;  3IFE A;  3PFE A;  3VRQ A;  4C8A A;  4LUA A;  4ZY2 A;  2PIZ A;  2Z3K A;  3RZA A;  2YJT A;  1CJW A;  2I00 A;  3JUW A;  2AFW A;  2JEW A;  5AG7 A;  4AG7 A;  4H1H A;  3E0K A;  4OC4 A;  2G9D A;  3TTH A;  3BJ7 A;  1QST A;  3ISX A;  4AXV A;  5F1Y A;  2XPL A;  2C1C A;  1UWY A;  4CYP A;  1YVK A;  2YNE A;  4QUS A;  4C68 A;  4H6Z A;  1PU9 A;  3TE4 A;  2FVG A;  3JTK A;  2V77 A;  3FEC A;  1XOV A;  1Y7R A;  1YVO A;  1I12 A;  1EO0 A;  1R57 A;  2EK9 A;  4R6T A;  2VKZ G;  3KHZ A;  3PBB A;  4NGP A;  2ZEL A;  4KOT A;  4PK3 A;  4PPZ A;  4JLY A;  4CAW A;  3I74 A;  2ZPA A;  4JYW A;  3PZJ A;  1BO4 A;  4JXQ A;  3I1U A;  5DWN A;  1Y9Z A;  4BTF A;  5K8N A;  1XIX A;  2PJB A;  3GY9 A;  2ODF A;  3D4U A;  5FD8 A;  2PRB A;  2VEZ A;  1MJ9 A;  1TIQ A;  3VGO A;  2DF5 A;  2VXK A;  3U88 C;  4ONU A;  2JDD A;  1P4N A;  3N5F A;  3SJF A;  2DIK A;  5HMN A;  3PBE A;  5LYL A;  2B5G A;  1TF8 A;  4U5Y A;  2AFM A;  1CPX A;  1LRZ A;  4PXD A;  2V8G A;  3RAM A;  1GGO A;  3CXS A;  2FCK A;  3R96 A;  1ZL0 A;  5JYB A;  4W9Y A;  2Y0M A;  1WVM A;  2PIY A;  2Z10 A;  4H6U A;  1A2Z A;  1Y7E A;  3B35 A;  2AFO A;  2WUU A;  2PJ2 A;  3H5Z A;  1NE9 A;  3ZJ0 A;  4MJ8 A;  1TKH A;  4R8F A;  1I21 A;  4MFK A;  3RNZ A;  2JBK A;  5LYF A;  2OZU A;  4X8I A;  4A30 A;  5IX3 A;  5JH9 A;  2JEV A;  3VRR A;  3D7G A;  4RS2 A;  5LRK A;  4R57 A;  3T8W A;  2J8N A;  1ELM P;  4AVC A;  1PYT B;  2EK8 A;  5AGE A;  5D8N A;  2B5G B;  1MJB A;  2GE3 A;  3D67 A;  2V8V A;  4UEE A;  5HVH A;  4JJX A;  4UCN A;  3K2K A;  1KBL A;  1FBV A;  4KSA A;  1ZLH A;  4J0N A;  2ZED A;  3C26 A;  3WAB A;  2HQY A;  3NOJ A;  4NGN A;  1BLL E;  1XEB A;  3BUO B;  1SQH A;  2C6C A;  1OBR A;  2D4P A;  3EFA A;  5F48 A;  4A4B A;  1Q5X A;  3KRV A;  3T05 A;  2B4B A;  3TLG B;  3BUN B;  2CY2 A;  1VGY A;  4FD7 A;  2EZA A;  1S7F A;  2Z3L A;  3BI1 A;  5AG6 A;  4E0A A;  4KLW A;  1S60 A;  3FXT A;  4B13 A;  2PJ6 A;  2B0A A;  4CO9 A;  5AXI A;  1CP6 A;  4OME A;  2D0P A;  2C27 A;  4P44 A;  2ATR A;  3OP0 A;  2ZEG A;  1CBX A;  1K4J A;  4UFW A;  1TXR A;  2BOA A;  2WPW A;  3LMS A;  4KSF A;  4MHY A;  4IHM A;  3TOB A;  3K4I A;  3S6F A;  2A4N A;  2AFS A;  3NH8 A;  4UA3 A;  3FH4 A;  2VZZ A;  4IF5 A;  4MI1 A;  4XPD C;  1DIK A;  2JBJ A;  2NSM A;  2FL4 A;  1S5K A;  4OP4 A;  3FF3 A;  2C5Q A;  4NEX A;  2QYV A;  1I1D A;  4EFD A;  3O8Z A;  4EWT A;  1IGB A;  1XFO A;  3VH9 A;  5AG4 A;  2GLF A;  1YX0 A;  2PR8 A;  2Y1N A;  2GFQ A;  4ONW A;  2BUE A;  3D3S A;  3TO6 A;  3VWD A;  4DUK A;  2POK A;  4MI4 A;  4A4C A;  2Y1M A;  2EVN A;  1WWZ A;  3FBU A;  4C8T A;  1MJA A;  3CXQ A;  2XEI A;  2GAN A;  2P6F A;  1YME A;  3BXM A;  1XBU A;  3B3C A;  2XPO A;  4OC2 A;  4IUS A;  1KWM A;  1Z8X A;  2UV8 G;  2IMO A;  2P6G A;  2Z3P A;  4QB9 A;  3IWG A;  4P4I A;  3KI9 A;  2E28 A;  4KOS A;  3BLN A;  4AB7 A;  1TF9 A;  3NA6 A;  2AFZ A;  2HC9 A;  1JDB C;  1Z5R A;  2AFX A;  3VWE A;  3PGP A;  4U9Y A;  3B3T A;  3V38 A;  1Q7L A;  4P45 A;  1YLO A;  4J3G A;  3D7F A;  4YU9 A;  4LQG A;  1CM0 A;  1Z9U A;  2PQ8 A;  4HNX B;  4C99 A;  4WWV A;  5CPA A;  2V8D A;  3RO0 A;  5F46 A;  2XPP A;  1S7K A;  1HDQ A;  2CBL A;  3BUM B;  2AFU A;  3NFZ A;  5LRG A;  3I6S A;  2FE7 A;  2J8M A;  1AUG A;  1V0C A;  4UEF A;  2JLM A;  4P4J A;  1TKF A;  1VHS A;  4Q36 A;  2PJ5 A;  4R76 A;  4UWI A;  4AVA A;  3HPH E;  2PJ0 A;  1MK4 A;  3I9S A;  3SHP A;  2C6G A;  1HDU A;  1M4G A;  3HLP A;  4MMO A;  4PXC A;  5JQ4 A;  1IB1 E;  3OAK A;  3IU2 A;  4XNH C;  3KAS A;  2C6P A;  5GCN A;  4MRI A;  4F0Y A;  4C86 A;  1YGH A;  3IC1 A;  1CS0 B;  3SI2 A;  1B6B A;  3PB7 X;  2FSR A;  1Z2L A;  3B8G A;  1IID A;  1Y9K A;  5JGF A;  1B47 A;  4P6Y A;  3CDX A;  1NBW A;  2ZEE A;  3WT4 A;  2HV2 A;  2OOT A;  2QIR A;  3EZA A;  5CNP A;  4MHD A;  2F7V A;  1YW6 A;  1OZP A;  2WYR A;  3PB4 X;  4NJR A;  1IY7 A;  1Q2Y A;  4ORF A;  4A37 A;  1LAM A;  3VRP A;  3B3W A;  2OH1 A;  2CTB A;  1FNO A;  1Y0Y A;  2AUM A;  3VRN A;  2I3C A;  2ABZ A;  4CGP A;  5G21 A;  3CPX A;  5IR2 A;  1XMB A;  1YR0 A;  4OIW A;  3U1B A;  2HUZ A;  4P4D A;  3T5M A;  1BPM A;  2DPS A;  4MHP A;  2PVW A;  5IV0 A;  1IYK A;  1F57 A;  2P0W A;  4X2T A;  2Q43 A;  2HWG A;  4CZ1 A;  3HUV A;  3DNS A;  1ELL P;  3PRT A;  2QVP A;  5C88 A;  4B14 A;  4KS9 A;  1KUX A;  4MCQ A;  1CG2 A;  2JDC A;  3KKW A;  3UY5 A;  1N71 A;  1XJO A;  3B3S A;  4M6G A;  3WC7 A;  3KR5 A;  2ZOG A;  4R9M A;  4CDK A;  3IU1 A;  1H8L A;  1CP7 A;  3R9G A;  3CT9 A;  4B12 A;  1R61 A;  1DTD A;  4P4F A;  3WR7 A;  1QSR A;  3NE7 A;  5ELY A;  1P0H A;  5BY0 A;  2OZG A;  3S6K A;  2AJ6 A;  4KOW A;  2Z3N A;  3PB6 X;  4CRY B;  4E8O A;  4E94 A;  4KOU A;  4CRZ B;  2PJC A;  1U6M A;  4QBJ A;  4P4B A;  3KQZ A;  4GS4 A;  1IU8 A;  5F49 A;  5LYI A;  3TLG A;  2FS5 A;  2YJV A;  4CDJ A;  2NYQ A;  4BPW B;  1M4I A;  1CPS A;  4B11 A;  4DJL A;  2HI6 A;  2BCO A;  4A31 A;  1ZRS A;  2OLS A;  1KUY A;  1WK4 A;  4CS0 B;  4OC0 A;  4IK2 A;  4M6I A;  1FY7 A;  3IJ3 A;  4KLV A;  2PCN A;  2OZH A;  1NXJ A;  4YN3 A;  1NSA A;  2ZEM A;  3R1K A;  1KUV A;  2N3A B;  4FWU A;  1Z9E A;  3F9K C;  4P4E A;  2FIW A;  2KCW A;  2CNS A;  2O28 A;  2PJ8 A;  2WZN A;  2PJA A;  3PFV A;  2RC4 A;  3EY5 A;  4ZX9 A;  5HXD A;  4NCZ A;  1LOK A;  3IIB A;  1KC7 A;  2FT0 A;  2RB7 A;  4NGT A;  3PEI A;  1EZB A;  2XPN A;  4ZY1 A;  1YVH A;  3SR3 A;  1GYT A;  3LWU A;  4XPL A;  3R95 A;  3R9E A;  4MXU A;  2Q4Y A;  5C82 A;  1QSO A;  3D66 A;  4KVO E;  3TO9 A;  1ZLI A;  3V7Z A;  2PRQ A;  4C7H A;  3PP9 A;  4C2Y A;  1L0C A;  3G23 A;  1Z8L A;  2F5I A;  4OLL A;  2XEF A;  5HKY A;  3GB0 A;  3BUX B;  3KQX A;  3KHX A;  1VBG A;  4UBR A;  3FEE A;  3W6S A;  3SJG A;  3VRO A;  1BPN A;  1ZG8 A;  1VKC A;  1S7L A;  2Q7B A;  3T9Y A;  3OB1 B;  4OC1 A;  3RBU A;  2DPT A;  2PJ1 A;  4PQA A;  4B5P A;  3IGR A;  4Z65 A;  5KTA A;  3EXN A;  4JWP A;  3PT1 A;  4GM5 A;  2ZEO A;  2ZW6 A;  4F6A A;  2B3U A;  2PE3 A;  5I0C A;  4M6H A;  3KR4 A;  3G8W A;  4DNC A;  2O4H A;  4HKF A;  3TO7 A;  1Z4R A;  1GHE A;  4CGM A;  4Y49 B;  3EIF A;  5DWM A;  4TJX A;  4B5O A;  4ZI6 A;  3VTA A;  3S9N A;  2BO9 A;  4ZY0 A;  3T90 A;  1ARL A;  4CGN A;  5F13 A;  1ZO0 A;  3CPA A;  3SI0 A;  2F8H A;  3PFO A;  3TX8 A;  3S6H A;  2P6E A;  3D2M A;  3T07 A;  1XE4 A;  4HNW B;  1WJT A;  4KSI A;  4BBH A;  3HPG G;  1Q2D A;  2EBJ A;  4Q7A A;  3TYX A;  4PSX A;  2VL1 A;  3DR8 A;  2ZOF A;  4B5P B;  4CYN A;  5F9M A;  1QSM A;  2PC1 A;  3G3S A;  4M8D A;  3FED A;  1UFH A;  4FD4 A;  4PXB A;  4K3N A;  3ICU A;  4BPU B;  4C9U A;  4II9 A;  2OR4 A;  1XF8 A;  2J9A A;  3DSB A;  3I3G A;  1YSJ A;  3IO1 A;  8CPA A;  5EMI A;  1C30 B;  2Q7S A;  4C8P A;  3DGV A;  2CF4 A;  2ZW4 A;  4JD6 A;  4NXY A;  5FVJ A;  3TC8 A;  5K99 A;  4A32 A;  1YW4 A;  4NJQ A;  3ISZ A;  3DLJ A;  1F2P A;  2BL1 A;  5HVF A;  3EO4 A;  4KOX A;  3PB9 X;  2IJZ A;  1F2O A;  1LAP A;  3GLJ A;  2BSW A;  4NGQ A;  2ARH A;  4UIB A;  4RI1 A;  2GP4 A;  3FB3 A;  4NGS A;  5THW A;  1XRY A;  1FT7 A;  2V8H A;  2PR1 A;  3TFY A;  1BOB A;  3DDD A;  4CAE A;  4O23 A;  1BXR B;  3CZX A;  3GJZ A;  2ZXV A;  5F09 A;  2BEI A;  4CAF A;  5J1Q A;  2YNC A;  4PK2 A;  3TLE A;  3NE8 A;  4YFJ A;  1HEE A;  1RXT A;  4IAV A;  4F0X A;  3BI0 A;  4IIX A;  2CIJ A;  2B4D A;  4WJB A;  2R8V A;  4KUB A;  4CPA A;  4MFJ A;  2VQY A;  4UF4 A;  2XEG A;  4MCR A;  3P2F A;  1VBH A;  2FM4 A;  4MHN A;  1Y9W A;  2PVV A;  1S7N A;  2GRE A;  3D8P A;  5G20 A;  4INJ A;  4OC3 A;  2REF A;  2VI7 A;  2AE6 A;  4L89 A;  4XPD B;  5H86 A;  3FRM A;  3SI1 A;  3EC4 A;  1BAV A;  1R3N A;  2X7B A;  2QEC A;  3BJ8 A;  4TWE A;  3VAR A;  1XF1 A;  2CNT A;  4GPL B;  1X10 A;  2EO8 A;  1RTQ A;  3H8G A;  2Q4V A;  3TLY A;  4MY3 A;  3QAY A;  4MFZ A;  4C2Z A;  3T0T A;  4UWJ A;  2PJ4 A;  7CPA A;  4C9E A;  5ISV A;  2B58 A;  2EUI A;  4GXH A;  3IEH A;  3LOD A;  4FD5 A;  1JQG A;  1PUA A;  3N7Z A;  4LQ6 A;  4RUH A;  2PJ7 A;  2B3V A;  3S9L A;  3QAH A;  3WC6 A;  1NSL A;  4C8U A;  2B4D B;  1Z8T A;  5HKZ A;  1IOI A;  4P10 A;  2G3A A;  3GKR A;  4QVT A;  3H4Q A;  4R87 A;  4FAI A;  1JDE A;  1IOF A;  1LCP A;  4RN7 A;  4NGM A;  4PSW A;  2XEJ A;  2EWB A;  2Z3O A;  3B7I A;  4PV6 A;  5F5X A;  4EYS A;  5I4M A;  4B10 A;  3IWE A;  4BPX B;  4C85 A;  4C9V A;  3VAT A;  1VHO A;  3ZNI A;  4C2X A;  4A33 A;  5JVL A;  3MRU A;  1M4D A;  5HKW A;  4KVM E;  3V8I A;  1QSN A;  3B2Y A;  4A39 A;  2X0S A;  3BHX A;  2K5T A;  2WSA A;  3ZZI A;  4C9R A;  4YWY A;  1KZF A;  4MFL A;  2Q44 A;  4RR2 B;  2YGW A;  1QMU A;  3F5B A;  4OC5 A;  2FIA A;  2D4O A;  1DE4 C;  2Z0Z A;  4HNY B;  4FBE A;  1KEE B;  3GYA A;  6CPA A;  1ZYM A;  3SJX A;  1RO5 A;  3FMC A;  3H8F A;  3JVN A;  5K8P A;  3LD2 A;  1Y0R A;  2CNM A;  5EBV A;  5G1Z A;  1JWQ A;  1LFW A;  2QJ8 A;  3OWC A;  2OU2 A;  3B3V A;  4MFQ A;  4UFX A;  4XNH B;  2I79 A;  2ZEH A;  3OB2 B;  2R7H A;  3TCV A;  4CGL A;  4A38 A;  3P2H A;  3WC5 A;  1M44 A;  4CYO A;  1YK3 A;  4H89 A;  5JM6 A;  2YND A;  3TLB A;  4F8Z A;  4X5K A;  3BUW B;  4Y49 C;  2EZC A;  1AYE A;  5E96 A;  4IIY A;  4F9U A;  4MY0 A;  5A28 A;  1V6C A;  4L8A A;  4MCS A;  4KZT A;  4BMH A;  1CX8 A;  4X3R A;  1R43 A;  2REE A;  2Z3M A;  2B4J C;  4OAE A;  5G22 A;  2ZEF A;  4CAX A;  3PB8 X;  4AVB A;  4KNG E;  4EVY A;  2NMT A;  2ZEP A;  1X12 A;  4BD9 A;  4E5S A;  4C8C A;  4NSQ A;  2Q51 A;  4JXR A;  4PXE A;  4ZGY B;  2CTC A;  4CAV A;  4M85 A;  4F9V A;  5KTC A;  4ZX8 A;  3F0A A;  2DEA A;  2PDO A;  3SXO A;  2PCU A;  3NH4 A;  4C84 A;  5LYD A;  4XPK A;  3FIX A;  3W91 A;  3TLZ A;  5HVG A;  2Q0Y A;  1ON0 A;  1CE8 B;  4COG A;  2CXA A;  2PJ9 A;  3K9U A;  3S6G A;  2GU2 A;  3MGD A;  2AUN A;  1LAN A;  2WPX A;  3FYN A;  4ZBG A;  5EC4 A;  4AG9 A;  3IWW A;  3TT2 A;  1A9X B;  2MP0 A;  5CBM A;  4R3K A;  1YLE A;  3QNV A;  4TJV A;  4KVX A;  4FUU A;  1VI4 A;  4MJX A;  2Z11 A;  2ZW5 A;  3S9M A;  1YRE A;  3NH5 A;  4FD6 A;  3QB8 A;  4K30 A;  2IL4 A;  5JPH A;  3D7D A;  2GLJ A;  3C8O A;  3H8E A;  2OB0 A;  4G1P A;  4I49 A;  4MHZ A;  2DLA A;  3FX6 A;  2VBQ A;  4LX9 A;  3CXP A;  4KOR A;  4QC6 A;  2R1I A;  4YRH A;  2ANP A;  4ZYQ A;  4JZ0 A;  5IB9 A;  4YGO A;  2D0O A;  2G3T A;  4MBU A;  2Q4Z A;  2QML A;  2DXQ A;  4OKO A;  5J8C A;  3GUX A;  3A9L A;  4COB A;  4DYO A;  3DR6 A;  4A94 A;  3D2P A;  4H2K A;  1EZA A;  3TLA A;  2O53 A;  3HMJ G;  1YQE A;  4OID A;  3KZW A;  1NMT A;  5AG5 A;  4NFR A;  4UCP A;  4M3S A;  3D7H A;  3L2N A;  1TKJ A;  2IQ6 A;  3D68 A;  1Q2C A;  4UIA A;  5K8O A;  1T36 B;  3FNC A;  2J8R A;  1IYL A;  1ARM A;  4KOY A;  4NF1 A;  4Q38 A;  4A95 A;  5J8F A;  1PCA A;  3KGQ A;  1B87 A;  3LAC A;  2G0B A;  1QQ9 A; 
#chains in the Genus database with same CATH homology
 4EME A;  1M4L A;  2PJ3 A;  5DS0 A;  3MN8 A;  4C9A A;  3JRU A;  1EE3 P;  4UEZ A;  3FVL A;  1VIX A;  2RFH A;  3SJE A;  1VHE A;  1AMP A;  4B6Z A;  2ZEN A;  4C8F A;  3K9T A;  5K8M A;  3KL9 A;  2HB6 A;  4MCP A;  4NGR A;  1ZG9 A;  3FJU A;  1ZG7 A;  4TNU A;  4R7M A;  5LRJ A;  5D29 A;  3IFE A;  3PFE A;  4C8A A;  4ZY2 A;  2PIZ A;  3RZA A;  2AFW A;  2JEW A;  4OC4 A;  2G9D A;  3ISX A;  4AXV A;  2C1C A;  1UWY A;  2FVG A;  2V77 A;  3FEC A;  2EK9 A;  4R6T A;  3KHZ A;  3PBB A;  4NGP A;  2ZEL A;  3I74 A;  4JYW A;  3I1U A;  1Y9Z A;  5K8N A;  2PJB A;  3D4U A;  3N5F A;  3SJF A;  3PBE A;  5LYL A;  1TF8 A;  2AFM A;  1CPX A;  4PXD A;  2V8G A;  3RAM A;  4W9Y A;  1WVM A;  2PIY A;  1Y7E A;  3B35 A;  2AFO A;  2PJ2 A;  1TKH A;  4R8F A;  2JBK A;  5LYF A;  4X8I A;  5JH9 A;  3D7G A;  5LRK A;  3T8W A;  1ELM P;  1PYT B;  2EK8 A;  5D8N A;  4UEE A;  3D67 A;  2V8V A;  5HVH A;  3K2K A;  1ZLH A;  2ZED A;  3WAB A;  4NGN A;  1BLL E;  1OBR A;  2C6C A;  1VGY A;  3BI1 A;  2PJ6 A;  1CP6 A;  4OME A;  4P44 A;  2ZEG A;  1CBX A;  1TXR A;  2BOA A;  3LMS A;  4MHY A;  4IHM A;  2AFS A;  3NH8 A;  3FH4 A;  2JBJ A;  2NSM A;  4OP4 A;  2C5Q A;  3FF3 A;  2QYV A;  4EFD A;  4EWT A;  1IGB A;  1XFO A;  3VH9 A;  2GLF A;  4ONW A;  4DUK A;  2POK A;  4C8T A;  2XEI A;  1YME A;  3BXM A;  1XBU A;  3B3C A;  4OC2 A;  1KWM A;  2IMO A;  4P4I A;  3KI9 A;  1TF9 A;  3NA6 A;  2AFZ A;  2HC9 A;  1Z5R A;  2AFX A;  3B3T A;  3V38 A;  1Q7L A;  4P45 A;  1YLO A;  3D7F A;  4YU9 A;  4LQG A;  4C99 A;  4WWV A;  5CPA A;  2V8D A;  2AFU A;  1HDQ A;  3NFZ A;  5LRG A;  3I6S A;  4UEF A;  4P4J A;  1TKF A;  4R76 A;  2PJ5 A;  2PJ0 A;  2C6G A;  1HDU A;  3HLP A;  4PXC A;  4MMO A;  3KAS A;  2C6P A;  4MRI A;  4C86 A;  3IC1 A;  3PB7 X;  1Z2L A;  5JGF A;  4P6Y A;  3CDX A;  2ZEE A;  3WT4 A;  2OOT A;  2F7V A;  1YW6 A;  2WYR A;  3PB4 X;  4NJR A;  4A37 A;  1IY7 A;  1LAM A;  3B3W A;  2CTB A;  1FNO A;  1Y0Y A;  2I3C A;  2ABZ A;  3CPX A;  5IR2 A;  1XMB A;  4OIW A;  4P4D A;  1BPM A;  4MHP A;  2PVW A;  1F57 A;  4X2T A;  2Q43 A;  3HUV A;  1ELL P;  3PRT A;  2QVP A;  4MCQ A;  1CG2 A;  1XJO A;  3B3S A;  3WC7 A;  3KR5 A;  2ZOG A;  4CDK A;  1H8L A;  1CP7 A;  3CT9 A;  1DTD A;  4P4F A;  5ELY A;  3PB6 X;  2PJC A;  4P4B A;  3KQZ A;  5LYI A;  4CDJ A;  2NYQ A;  1CPS A;  4DJL A;  2BCO A;  4OC0 A;  4IK2 A;  3IJ3 A;  4YN3 A;  1NSA A;  2ZEM A;  4FWU A;  3NH4 A;  4P4E A;  4PPZ A;  2GP4 A;  2PJ8 A;  2WZN A;  2PJA A;  4ZX9 A;  5HXD A;  1LOK A;  3IIB A;  2RB7 A;  4NGT A;  3PEI A;  1GYT A;  3LWU A;  4MXU A;  3D66 A;  1ZLI A;  3V7Z A;  2PRQ A;  1Z8L A;  2XEF A;  3GB0 A;  3KQX A;  3KHX A;  3FEE A;  3SJG A;  1BPN A;  1ZG8 A;  3RBU A;  4OC1 A;  4PQA A;  2PJ1 A;  4Z65 A;  4GM5 A;  2ZEO A;  2PE3 A;  3KR4 A;  2O4H A;  4TJX A;  3EIF A;  3VTA A;  4ZI6 A;  3S9N A;  2BO9 A;  4ZY0 A;  1ARL A;  3CPA A;  3SI0 A;  2F8H A;  3PFO A;  3TX8 A;  4KSI A;  4Q7A A;  2VL1 A;  2ZOF A;  3FED A;  3ICU A;  4PXB A;  4K3N A;  4C9U A;  2OR4 A;  2J9A A;  8CPA A;  1YSJ A;  3IO1 A;  4C8P A;  3DGV A;  2CF4 A;  3TC8 A;  1YW4 A;  4NJQ A;  3ISZ A;  3DLJ A;  1F2P A;  5HVF A;  3PB9 X;  2IJZ A;  3GLJ A;  1F2O A;  1LAP A;  4NGQ A;  4UIB A;  4NGS A;  5THW A;  1XRY A;  1FT7 A;  2V8H A;  4O23 A;  5F09 A;  5J1Q A;  1HEE A;  4IAV A;  3BI0 A;  2CIJ A;  4WJB A;  4CPA A;  4UF4 A;  2XEG A;  4MCR A;  4MHN A;  2PVV A;  2GRE A;  4OC3 A;  3SI2 A;  3SI1 A;  1BAV A;  1R3N A;  1XF1 A;  4TWE A;  3VAR A;  1RTQ A;  3H8G A;  4C9E A;  7CPA A;  2PJ4 A;  4RUH A;  3IEH A;  1JQG A;  2PJ7 A;  3S9L A;  3WC6 A;  4C8U A;  4P10 A;  4FAI A;  1LCP A;  4NGM A;  2XEJ A;  2EWB A;  3B7I A;  5I4M A;  4C85 A;  4C9V A;  3VAT A;  1VHO A;  3MRU A;  3B2Y A;  4A39 A;  3BHX A;  4C9R A;  4YWY A;  4FBE A;  4F8Z A;  1QMU A;  4OC5 A;  1DE4 C;  6CPA A;  3SJX A;  3FMC A;  3H8F A;  5K8P A;  1Y0R A;  1LFW A;  2QJ8 A;  4ZY1 A;  3B3V A;  1V6C A;  2ZEH A;  4A38 A;  3WC5 A;  5JM6 A;  1AYE A;  4F9U A;  4MCS A;  1CX8 A;  4X3R A;  1R43 A;  2ZEF A;  3PB8 X;  4KNG E;  2ZEP A;  4BD9 A;  4C8C A;  2Q51 A;  4PXE A;  2CTC A;  4F9V A;  4ZX8 A;  4C84 A;  2DEA A;  2PCU A;  5LYD A;  5HVG A;  2PJ9 A;  2GU2 A;  1LAN A;  3IWW A;  5CBM A;  3QNV A;  4TJV A;  4FUU A;  3S9M A;  3NH5 A;  3D7D A;  2GLJ A;  3H8E A;  4G1P A;  4MHZ A;  3FX6 A;  2ANP A;  4ZYQ A;  4JZ0 A;  5IB9 A;  2Q4Z A;  4OKO A;  3GUX A;  4DYO A;  4A94 A;  4H2K A;  2O53 A;  4OID A;  3KZW A;  4NFR A;  3D7H A;  3L2N A;  1TKJ A;  2IQ6 A;  3D68 A;  5K8O A;  4UIA A;  1ARM A;  1PCA A;  3KGQ A;  1QQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...