4OC5A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with chibzl, a urea-based inhibitor n~2~-{[(s)-carboxy(4-hydroxyphenyl)methyl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 260
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
260
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 260
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc5A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc5A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc5A02
4ONWA 1Y0RA 2ZOGA 3RAMA 4EMEA 1RTQA 3L2NA 1LFWA 2XEGA 2PJ6A 3DGVA 2PJ0A 2C1CA 5HVFA 2ZEOA 4MCQA 4B6ZA 1ARLA 1TKFA 4NFRA 3CPAA 2C6CA 1Y9ZA 3BI0A 4NJRA 2IJZA 4DJLA 4P4EA 2AFZA 4C8CA 4TJXA 1IGBA 2BO9A 1ZG9A 3MRUA 2AFUA 4C9AA 2JBKA 4C85A 3S9LA 1YMEA 3PB9X 4R7MA 3FVLA 4YWYA 2ZEFA 2ZEEA 3SI1A 3BI1A 4UF4A 4F9UA 3RZAA 4NGMA 1VIXA 5K8MA 2PVWA 2V8GA 2EK8A 2PJ3A 3H8EA 1BLLE 5HVGA 3IWWA 4MCSA 1XRYA 1ZG7A 3CPXA 6CPAA 3QNVA 1Z5RA 3D66A 1JQGA 1PYTB 4JYWA 2NYQA 1TKHA 2ZEDA 1YW6A 3I74A 4X2TA 3IIBA 3SJGA 4MMOA 1LAMA 5LYDA 3SJXA 4PXBA 4ZY0A 4FBEA 4P4FA 4F8ZA 4A94A 3KR4A 2V8HA 1TF9A 2I3CA 4PXEA 4OC4A 3RBUA 1OBRA 3TX8A 1R43A 1YW4A 4NGSA 4C9EA 2QVPA 1Y7EA 2AFSA 2WZNA 1Q7LA 4DYOA 4FAIA 4KNGE 4C8FA 3LWUA 4PPZA 2RB7A 1ZLIA 4P10A 1LANA 1Z2LA 3I1UA 4EFDA 3H8FA 4GM5A 4MHYA 1IY7A 1CPSA 5HVHA 2ZEHA 2CF4A 3KGQA 1XMBA 1WVMA 4OP4A 4OC3A 5D29A 1TF8A 3BXMA 2FVGA 1ELMP 1LOKA 1DE4C 1VHEA 2PJ5A 2PJBA 1VHOA 4MXUA 4OIWA 2IQ6A 3ISXA 2ZEPA 2PJCA 4DUKA 4C9UA 1LCPA 2V8DA 4C8TA 3PB8X 3IJ3A 5LRKA 4R6TA 2Q4ZA 1FNOA 4TJVA 3I6SA 1TKJA 3PB7X 5LYIA 2PIZA 5IB9A 3FECA 4P4IA 4CDJA 4A38A 1F2PA 2OR4A 3VH9A 1AMPA 3KR5A 1ARMA 4UEZA 4MHNA 3PRTA 3PB4X 2IMOA 1CPXA 4ZY1A 5CPAA 2O53A 2AFXA 1XF1A 7CPAA 2EWBA 1UWYA 2PVVA 2PRQA 4C9RA 3NA6A 3PB6X 5CBMA 4FUUA 1F57A 4OC0A 4Q7AA 2XEIA 2PJ4A 3NH4A 2AFWA 3KZWA 1AYEA 4P4JA 1NSAA 4NGRA 4OIDA 2XEJA 1XBUA 4YU9A 4C99A 3K2KA 8CPAA 4JZ0A 2ZOFA 5ELYA 4IK2A 4AXVA 3TC8A 1HDQA 4EWTA 2NSMA 4O23A 4FWUA 4PXCA 3JRUA 1BAVA 3D7GA 2F8HA 3WABA 3T8WA 2QYVA 5LYFA 5J1QA 4NGQA 4ZY2A 3KASA 3D7HA 3FH4A 2AFOA 3KHZA 3CT9A 4R8FA 2EK9A 2ZENA 4PXDA 3KHXA 2J9AA 3N5FA 4OC2A 1PCAA 1XJOA 3HLPA 4OMEA 3SI2A 2F7VA 5JGFA 3WC7A 3KI9A 2GLJA 2RFHA 1V6CA 1H8LA 1GYTA 2Q43A 4IAVA 1DTDA 4OC5A 3B3WA 2WYRA 4BD9A 4F9VA 3GUXA 4OC1A 1ELLP 3PEIA 1YLOA 1ZG8A 3B3CA 5K8PA 1M4LA 2JEWA 2PJ9A 2CIJA 2C6GA 3FMCA 2BOAA 4P44A 3DLJA 2PJ1A 3FF3A 3V38A 4OKOA 4R76A 3ICUA 4NJQA 5JM6A 4C8UA 3B3TA 3NH8A 1QQ9A 4K3NA 5JH9A 3WC5A 2QJ8A 1QMUA 1BPNA 3B2YA 3LMSA 3MN8A 2GU2A 4ZYQA 4A39A 3EIFA 4MCPA 3D7DA 3SJFA 2DEAA 4KSIA 5HXDA 3VATA 2ANPA 1XFOA 1Z8LA 3GLJA 3IFEA 1LAPA 1BPMA 5THWA 3V7ZA 4C8PA 3KQXA 4C8AA 4C86A 3PBBA 4MCRA 2PJ8A 3GB0A 3NH5A 4PQAA 4CDKA 1Y0YA 4X3RA 2VL1A 3S9MA 5LRGA 3B35A 2V77A 4NGTA 2C6PA 1HDUA 4MHZA 4WJBA 3ISZA 2PJAA 2AFMA 4C9VA 3BHXA 3FJUA 4RUHA 4G1PA 2PCUA 4MHPA 3WC6A 5D8NA 4Z65A 1F2OA 3FX6A 4C84A 1VGYA 3D4UA 4UIAA 5I4MA 4MRIA 3B3SA 5DS0A 1R3NA 1HEEA 3SI0A 3FEDA 3CDXA 4TNUA 3IC1A 4UEFA 1CP7A 2GLFA 2PJ7A 2ZEGA 3K9TA 5F09A 3S9NA 3D67A 3PFOA 4W9YA 2V8VA 4LQGA 1CX8A 1TXRA 2ABZA 4UIBA 4P4DA 3HUVA 3NFZA 3WT4A 4NGNA 1ZLHA 2Q51A 2XEFA 2OOTA 1FT7A 2CTBA 4ZX9A 2ZELA 1EE3P 4X8IA 1CBXA 1KWMA 2BCOA 4P6YA 3KQZA 4A37A 4WWVA 1YSJA 4NGPA 5LRJA 3D7FA 3B3VA 4H2KA 1CG2A 3KL9A 2PE3A 2HB6A 2O4HA 4CPAA 3IO1A 3PBEA 3B7IA 2G9DA 4UEEA 2PIYA 4ZX8A 4ZI6A 2HC9A 5K8NA 5K8OA 5LYLA 2GREA 2JBJA 3IEHA 2PJ2A 3H8GA 3VTAA 3FEEA 2ZEMA 2CTCA 4IHMA 4P4BA 3D68A 4YN3A 3SJEA 2POKA 3PFEA 4P45A 4TWEA 1CP6A 3VARA
chains in the Genus database with same CATH superfamily
4ONWA 1Y0RA 5KTCA 2ZOGA 3RAMA 2B5GA 4BTFA 1VKCA 3N7ZA 4KVXA 2FCKA 1WK4A 3VRPA 2GE3A 2O28A 1RTQA 3CXPA 2Z11A 3L2NA 4LX9A 4KOVA 4CS0B 4EMEA 3U1BA 5JQ4A 1LFWA 2XEGA 2PJ6A 3DGVA 2C5QA 1MJ9A 3DNSA 2PJ0A 4KUBA 2C1CA 5HVFA 2ZEOA 4MCQA 3TO7A 4A4CA 4B6ZA 4COBA 1ARLA 3P2HA 1TKFA 2PR1A 1PU9A 1UFHA 2REEA 3NE8A 4JJXA 5F46A 1IU8A 2Q44A 1YVOA 2C6CA 2FSRA 3CPAA 4NFRA 1Y9ZA 2BSWA 4JVOA 1JDBC 3GKRA 3BI0A 1QSOA 5AGEA 5A27A 4MJXA 4NJRA 1NE9A 1QSMA 2IJZA 4RS2A 1Z9UA 2Q7SA 2R1IA 4A31A 4C2YA 4OAEA 4P4EA 2AFZA 1Q2YA 4DJLA 4TJXA 4C8CA 1IGBA 2BO9A 3VGOA 1ZG9A 3MRUA 1M4GA 2AFUA 2JBKA 4JD6A 4C9AA 4C85A 4CYOA 2DXQA 3S9LA 2X7BA 1YMEA 3PGPA 4UFWA 1LRZA 4H6UA 3PB9X 4R7MA 4KS9A 3W6SA 3FVLA 1V0CA 4YWYA 3TLAA 2ZEFA 3ZZIA 2Z3LA 3QAYA 4CYNA 2ZEEA 3SI1A 2Y0MA 3BI1A 3D2PA 1J3LA 4B14A 4UF4A 4F9UA 3RZAA 5J8CA 4NGMA 1VBHA 1VIXA 5K8MA 4A4BA 4Q38A 2PVWA 2F5IA 1FBVA 2V8GA 2FS5A 2EK8A 5DWNA 4CAFA 3TLBA 5AG5A 2PJ3A 3G3SA 3H8EA 5G1ZA 4B5OA 3TTHA 4U5YA 4ZBGA 4A2ZA 3FYNA 1BLLE 2Q04A 4F0YA 3IWWA 4MCSA 1XRYA 1ZG7A 4CGLA 3CPXA 5HVGA 1KBLA 4AVAA 2Z10A 5AG4A 3ZJ0A 6CPAA 3QNVA 1Z5RA 3D66A 1JQGA 1PYTB 4JYWA 5IV0A 1K4JA 4UBRA 2NYQA 1TKHA 1B47A 5H86A 2B58A 2HWGA 2ZEDA 1YW6A 2JLMA 1BXRB 4X2TA 3I74A 1AUGA 2P0WA 2EZCA 3IIBA 3SJGA 4CRYB 4MMOA 1LAMA 3G8WA 4HKFA 5LYDA 2VQYA 4CGOA 3K4IA 4CYQA 3SJXA 3SXOA 4AVBA 4PXBA 4ZY0A 4FBEA 2CBLA 3PT1A 4P4FA 4GS4A 5C88A 2PDOA 4F8ZA 1U6MA 4Y49C 4A94A 4COGA 3KR4A 4UFXA 2DIKA 2V8HA 1TF9A 4J0NA 2I3CA 4PXEA 3SR3A 4OC4A 1DIKA 1S7LA 3TE4A 2ZXVA 3RBUA 3BJ8A 2VXKA 1OBRA 2YNEA 1I12A 4DNCA 3VRQA 3TX8A 1R43A 1YW4A 4NGSA 1A9XB 1M44A 4C9EA 2QVPA 3PZJA 4UCPA 1Y7EA 2AFSA 2WZNA 1Q7LA 2P6EA 1BOBA 2WPWA 3D8PA 4IF5A 3P2FA 4CAEA 1I21A 4FAIA 3GY9A 4ORFA 4C8FA 4CAVA 3LWUA 1FY7A 2RB7A 4PPZA 4RR2B 1ZLIA 1YQEA 2C27A 2RC4A 1LANA 3FXTA 4P10A 4A95A 2B5GB 1Z2LA 2CY2A 3I1UA 1EZBA 1YLEA 2BEIA 4JXQA 3H8FA 4GM5A 4MHYA 4H6ZA 3S6KA 4EFDA 2D4OA 3BUXB 4U9YA 1IY7A 3BLNA 2QIRA 3TT2A 4CGPA 1CPSA 5HVHA 4MI1A 1IIDA 2VZZA 2ZEHA 4L89A 3E0KA 3JTKA 2D0OA 3FRMA 2CF4A 2GFQA 5EBVA 3KGQA 4KOWA 1XMBA 3T90A 2D0PA 1KZFA 1WVMA 5J8FA 4OP4A 4HNYB 5IB0A 4OC3A 2EUIA 5D29A 1TF8A 3BXMA 2FVGA 1ELMP 1LOKA 1PUAA 1DE4C 1VHEA 2PJ5A 4MFJA 2PJBA 4UA3A 4IIXA 2KCWA 1VHOA 4CYPA 4MXUA 4RN7A 1JDEA 4JXRA 2HI6A 4UWIA 5JPHA 4OIWA 2R98A 4XPLA 2DLAA 2IQ6A 2YJTA 3ISXA 4BBHA 3DR8A 3EY5A 2J8NA 4FD6A 4M6IA 2ZEPA 4EVYA 1B87A 4UCMA 2PJCA 5F48A 3T0TA 4FD5A 4DUKA 3TO6A 4C9UA 2OB0A 5F13A 2GANA 1LCPA 2V8DA 2B3UA 4YRHA 4KOXA 4C8TA 2NMTA 3PB8X 3IJ3A 3R9FA 1Y9KA 5LRKA 4R6TA 5EMIA 3OP0A 4MY0A 2Q4ZA 2CNSA 4MJ8A 3W91A 1FNOA 4NF1A 4E0AA 1J4JA 1M4IA 3I6SA 1S60A 4TJVA 2EVNA 4C2ZA 1VHSA 1YX0A 1TKJA 3PB7X 1T36B 2OU2A 3MGDA 5LYIA 2PIZA 3NFQA 1XEBA 5J3XA 5IB9A 5EC4A 3S6HA 2B4DB 3FECA 4P4IA 4A30A 5HH1A 4CDJA 4LQ6A 3NOJA 4A38A 5HKWA 1F2PA 2OR4A 5F47A 3VH9A 4BINA 1YGHA 1AMPA 2OH1A 2PC1A 3KR5A 1ARMA 2ZW7A 2VEZA 2R82A 3KKWA 4UEZA 4MHNA 3PRTA 3PB4X 4UCNA 4B5PB 3EZBA 1B6BA 5BWAB 4M85A 2IMOA 1CPXA 4ZY1A 4EYSA 1YR0A 3UY5A 5CPAA 3OB2B 2O53A 1A2ZA 3LODA 3S6FA 4C84A 2AFXA 1XF1A 5G21A 3PLFB 5C82A 2OZUA 7CPAA 2EWBA 2R7HA 1UWYA 2BL1A 2PVVA 3FB3A 3GJZA 2G0BA 3TO9A 2PRQA 1KC7A 5AG6A 4C9RA 3NA6A 4OLLA 4KLVA 5IX3A 1P4NA 3PB6X 4E8OA 1ZL0A 1IOFA 5CBMA 4FUUA 1F57A 4OC0A 2I00A 4Q7AA 2XEIA 4BPWB 2PJ4A 3C26A 4MFZA 3TLGA 3IU1A 3NH4A 2AFWA 4KUAA 4B13A 3TLEA 1EO0A 1AYEA 3KZWA 1JWQA 4P4JA 3F9KC 1IB1E 1NSAA 5HKYA 4NGRA 4OIDA 2XEJA 3GIUA 3FIXA 2D4PA 4B10A 1XBUA 2HUZA 4YU9A 1XF8A 3K2KA 8CPAA 1S7KA 4C99A 1XIXA 4JZ0A 2VI7A 4KOYA 1L0CA 2ZOFA 4GXHA 2EBJA 4CO9A 2ZW6A 3HPHE 1Y7RA 1CE8B 5ELYA 4XNHB 2AE6A 4IK2A 2XPLA 2Z0ZA 4C68A 5G22A 3R95A 2YNDA 3VROA 3TC8A 2PRBA 4AXVA 1HDQA 3G23A 4E94A 2OLSA 1YK3A 2HV2A 4EWTA 3EC4A 5F9MA 3OWCA 3O8ZA 2NSMA 4PK2A 2Q0YA 4O23A 4FWUA 4PXCA 3JRUA 1BAVA 3D7GA 2F8HA 4M6HA 4AB7A 3WABA 5H84A 3T8WA 2QYVA 2YJVA 5LYFA 5J1QA 4J3GA 5HXDA 4NGQA 4MI4A 4X5KA 1QSRA 3W6XA 3DSBA 4ZY2A 2YGWA 3KASA 3D7HA 1XMTA 3T9YA 2FE7A 5E96A 3FH4A 1QSTA 4MFLA 2I79A 4CZ1A 2FIAA 1VBGA 3ZNIA 2AFOA 2B4BA 1NXJA 3T05A 3TYXA 2EO8A 1GHEA 2R8VA 3KHZA 4ONUA 2Y1MA 2J8MA 4HPSA 3CT9A 3BJ7A 3OAKA 1X12A 3JUWA 4R8FA 2Q7BA 2AUMA 1KEEB 2EK9A 2JDCA 2ZENA 4PSWA 3QB8A 3D3SA 1BO4A 4PXDA 3KHXA 2J9AA 4RI1A 2YNCC 3N5FA 3TCVA 1Z4RA 2CNMA 3RYOA 3BUOB 4OC2A 1PCAA 1XJOA 3HLPA 5FD8A 4OMEA 3SI2A 4CAXA 3I3GA 2YNCA 3CXSA 2F7VA 3S6GA 1IICA 5JGFA 3WC7A 3IU2A 3KI9A 2GLJA 2RFHA 3VWEA 2Z3PA 5HKZA 5CNPA 1V6CA 1H8LA 4HNXB 2B3VA 2HROA 3TLCA 1GYTA 4AVCA 4KSAA 3F8KA 4XPDC 1Q2DA 3T07A 1X10A 2XPPA 2UV8G 1XOVA 2Q43A 3TFYA 3A9LA 3D2MA 1M1DA 4IAVA 1DTDA 2VZYA 4OC5A 3B3WA 3C8OA 2JEVA 4H89A 2WYRA 2QECA 4M3SA 4BD9A 2PCNA 4F9VA 3GUXA 4UWJA 4OC1A 2Q4YA 3KRVA 4R57A 3R9EA 2ARHA 1ELLP 3PEIA 3TOAA 2HQYA 1YLOA 1ZG8A 3B3CA 4QB9A 5K8PA 1M4LA 4NCZA 4DYOA 4QVTA 2JEWA 2PJ9A 2CIJA 2C6GA 3FMCA 4U9ZA 4H1HA 2IL4A 2EZBA 2BOAA 4P44A 3TLGB 2ATRA 2PR8A 3PFVA 3QAHA 3DLJA 4NEXA 2PJ1A 3FF3A 4KOSA 2PQ8A 3BUWB 3V38A 4PK3A 1Z9EA 4OKOA 4R76A 2REFA 4NJQA 4OADA 5JM6A 3B3TA 3ICUA 4C8UA 3NH8A 1QQ9A 1P0HA 1MK4A 1Z8WA 3HPGG 4K3NA 4C7HA 5JH9A 1S5KA 2GIVA 3WC5A 2QJ8A 4C2XA 3EZAA 1R57A 1QMUA 1BPNA 3B2YA 1IYLA 3LMSA 3MN8A 2GU2A 3IWGA 4MHDA 4ZYQA 5ISVA 5FVJA 3FNCA 1IOIA 4A39A 3EIFA 4MCPA 3EXNA 2P6FA 3IWEA 4FD7A 3D7DA 3SJFA 1C3OB 5JYBA 4Q36A 4IIYA 1NSLA 4Y49B 2DEAA 4BPUB 4KSIA 4MFQA 3VATA 2OZGA 3EFAA 2ANPA 1KUXA 2PSWA 2VBQA 3RNZA 4II9A 1XFOA 1Z8LA 3GLJA 3LD2A 4YFJA 1ZRSA 3OB1B 1WWZA 3IFEA 2QMLA 5F1YA 2K5TA 1LAPA 1BPMA 1I1DA 5THWA 4M6GA 3V7ZA 4QUSA 1YREA 4IUSA 1R61A 4C8PA 1N71A 1Y9WA 1M4DA 2XPNA 3KQXA 4PV6A 4F0XA 5AG7A 4C8AA 1KUYA 4C86A 3PBBA 2DPSA 4B11A 4INJA 4MCRA 2OZHA 3VRRA 2PJ8A 3GB0A 3NH5A 4BPXB 4PQAA 1EZAA 5F5XA 4CDKA 1Y0YA 1MJAA 4X3RA 3H5ZA 4LUAA 2VL1A 4MY3A 3S9MA 3F0AA 5LRGA 3TOBA 4AG9A 1OZPA 4E2AA 3TLZA 5F49A 1ZYMA 5JVLA 3B35A 2V77A 4NGTA 2C6PA 1HDUA 1RXTA 4HNWB 5A28A 3R9GA 5KTDA 2ZPAA 4MHZA 4WJBA 2Z3MA 3SXNA 2A4NA 4K30A 4KOTA 2CNTA 5DWMA 3ISZA 1CJWA 2PJAA 2AFMA 1YVHA 1MJBA 4C9VA 4CRZB 3NE7A 3BHXA 3FJUA 4RUHA 1NMTA 3DR6A 4AG7A 3FBUA 4G1PA 3R96A 4ZGYB 1SQHA 1YVKA 4R87A 2X0SA 3K9UA 4M8DA 2WSAA 2PCUA 4MHPA 3WC6A 5D8NA 4Z65A 4YGOA 4KVOE 2ZW5A 1F2OA 3FX6A 4JLYA 1C30B 4UFVA 2EZAA 4XPDB 2G3TA 1WJTA 3GYAA 5KTAA 1Z4EA 1VGYA 3R1KA 2B4DA 4KZTA 1QSNA 3D4UA 3VWDA 2WPXA 4KVME 4NXYA 4UIAA 5G20A 4BMHA 5I4MA 4MRIA 3B3SA 4L8AA 5DS0A 4I49A 3CZXA 1R3NA 2WUUA 4KOUA 2FM4A 4KLWA 2Z3NA 1HEEA 3SI0A 3VRNA 4F6AA 3FEDA 4KORA 3CDXA 5GCNA 2J8RA 1KUVA 4TNUA 3U88C 1CS0B 2XPOA 4R9MA 1Q5XA 3HMJG 1TIQA 3IC1A 1CP7A 2CXAA 2GLFA 2PJ7A 2ZEGA 3K9TA 4UEFA 4NSQA 5BY0A 5F09A 4B5PA 2Z3OA 2FT0A 5HMNA 3BUMB 3S9NA 3D67A 3DDDA 4XPKA 3PFOA 4W9YA 3H4QA 4C7IA 3I9SA 4JWPA 1Z8TA 2FXFA 4LQGA 2V8VA 4CGMA 1CX8A 2H5MA 1TXRA 2Q4VA 3BUNB 3IGRA 3JVNA 2ABZA 1S7FA 1RO5A 3V8IA 1IYKA 4MFPA 4UIBA 2ZW4A 2MP0A 3RO0A 4P4DA 2G3AA 3HUVA 3NFZA 2VKZG 1CM0A 3SHPA 3WR7A 3WT4A 4NGNA 2B0AA 1ZLHA 4B12A 4GPLB 2Q51A 4CAWA 2XEFA 2OOTA 1FT7A 2CTBA 4ZX9A 2ZELA 1EE3P 1XE4A 2ODFA 4QC6A 1CBXA 4X8IA 5I0CA 1Z8XA 1KWMA 2BCOA 3CXQA 4R3KA 4P6YA 2B4JC 3KQZA 4A37A 4WWVA 1YSJA 4NGPA 5LRJA 2DF5A 3D7FA 4KSFA 3PP9A 3B3VA 4H2KA 1CG2A 4A33A 3KL9A 1M6VB 4CGNA 1ZO0A 4XNHC 1NBWA 2PE3A 2N3AB 2HB6A 2O4HA 4KNGE 1Q2CA 4CPAA 3EZEA 4QBJA 2AUNA 4R3LA 3IO1A 3PBEA 4MFKA 3B7IA 2FL4A 2G9DA 4UEEA 2Y1NA 3EO4A 2BUEA 2PIYA 2Z3KA 2HC9A 3LACA 4ZX8A 4ZI6A 5K8OA 5K8NA 2GREA 5LYLA 1ON0A 2DPTA 2FIWA 2JBJA 3IEHA 2E28A 2PJ2A 2AJ6A 3H8GA 1S3ZA 3VTAA 3FEEA 2P6GA 5K99A 2GP4A 4FD4A 4A32A 2ZEMA 2CTCA 4IHMA 4P4BA 3TLYA 3D68A 5AXIA 3T5MA 3B8GA 4YN3A 3SJEA 2JDDA 1VI4A 2POKA 4MBUA 1S7NA 3PFEA 4PSXA 4P45A 3F5BA 4TWEA 1GGOA 1CP6A 3VARA 4E5SA 5IR2A
chains in the Genus database with same CATH topology
4ONWA 1Y0RA 2ZOGA 3RAMA 4EMEA 1RTQA 3L2NA 1LFWA 2XEGA 2PJ6A 3DGVA 2C5QA 2PJ0A 2C1CA 5HVFA 2ZEOA 4MCQA 4B6ZA 1ARLA 1TKFA 4NFRA 3CPAA 2C6CA 1Y9ZA 3BI0A 4NJRA 2IJZA 4DJLA 4P4EA 2AFZA 4C8CA 4TJXA 1IGBA 2BO9A 1ZG9A 3MRUA 2AFUA 4C9AA 2JBKA 4C85A 3S9LA 1YMEA 3PB9X 4R7MA 3FVLA 4YWYA 2ZEFA 2ZEEA 3SI1A 3BI1A 4UF4A 4F9UA 3RZAA 4NGMA 1VIXA 5K8MA 2PVWA 2V8GA 2EK8A 2PJ3A 3H8EA 1BLLE 5HVGA 3IWWA 4MCSA 1XRYA 1ZG7A 3CPXA 6CPAA 3QNVA 1Z5RA 3D66A 1JQGA 1PYTB 4JYWA 2NYQA 1TKHA 2ZEDA 1YW6A 3I74A 4X2TA 3IIBA 3SJGA 4MMOA 1LAMA 5LYDA 3SJXA 4PXBA 4ZY0A 4FBEA 4P4FA 4F8ZA 4A94A 3KR4A 2V8HA 1TF9A 2I3CA 4PXEA 4OC4A 3RBUA 1OBRA 3TX8A 1R43A 1YW4A 4NGSA 4C9EA 2QVPA 1Y7EA 2AFSA 2WZNA 1Q7LA 4DYOA 4FAIA 4KNGE 4C8FA 3LWUA 4PPZA 2RB7A 1ZLIA 4P10A 1LANA 1Z2LA 3I1UA 4EFDA 3H8FA 4GM5A 4MHYA 1IY7A 1CPSA 5HVHA 2ZEHA 2CF4A 3KGQA 1XMBA 1WVMA 4OP4A 4OC3A 5D29A 1TF8A 3BXMA 2FVGA 1ELMP 1LOKA 1DE4C 1VHEA 2PJ5A 2PJBA 1VHOA 4MXUA 4OIWA 2IQ6A 3ISXA 2ZEPA 2PJCA 4DUKA 4C9UA 1LCPA 2V8DA 4C8TA 3PB8X 3IJ3A 5LRKA 4R6TA 2Q4ZA 1FNOA 4TJVA 3I6SA 1TKJA 3PB7X 5LYIA 2PIZA 5IB9A 3FECA 4P4IA 4CDJA 4A38A 1F2PA 2OR4A 3VH9A 1AMPA 3KR5A 1ARMA 4UEZA 4MHNA 3PRTA 3PB4X 2IMOA 1CPXA 4ZY1A 5CPAA 2O53A 2AFXA 1XF1A 7CPAA 2EWBA 1UWYA 2PVVA 2PRQA 4C9RA 3NA6A 3PB6X 5CBMA 4FUUA 1F57A 4OC0A 4Q7AA 2XEIA 2PJ4A 3NH4A 2AFWA 3KZWA 1AYEA 4P4JA 1NSAA 4NGRA 4OIDA 2XEJA 1XBUA 4YU9A 4C99A 3K2KA 8CPAA 4JZ0A 2ZOFA 5ELYA 4IK2A 4AXVA 3TC8A 1HDQA 4EWTA 2NSMA 4O23A 4FWUA 4PXCA 3JRUA 1BAVA 3D7GA 2F8HA 3WABA 3T8WA 2QYVA 5LYFA 5J1QA 4NGQA 4ZY2A 3KASA 3D7HA 3FH4A 2AFOA 3KHZA 3CT9A 4R8FA 2EK9A 2ZENA 4PXDA 3KHXA 2J9AA 3N5FA 4OC2A 1PCAA 1XJOA 3HLPA 4OMEA 3SI2A 2F7VA 5JGFA 3WC7A 3KI9A 2GLJA 2RFHA 1V6CA 1H8LA 1GYTA 2Q43A 4IAVA 1DTDA 4OC5A 3B3WA 2WYRA 4BD9A 4F9VA 3GUXA 4OC1A 1ELLP 3PEIA 1YLOA 1ZG8A 3B3CA 5K8PA 1M4LA 2JEWA 2PJ9A 2CIJA 2C6GA 3FMCA 2BOAA 4P44A 3DLJA 2PJ1A 3FF3A 3V38A 4OKOA 4R76A 3ICUA 4NJQA 5JM6A 4C8UA 3B3TA 3NH8A 1QQ9A 4K3NA 5JH9A 3WC5A 2QJ8A 1QMUA 1BPNA 3B2YA 3LMSA 3MN8A 2GU2A 4ZYQA 4A39A 3EIFA 4MCPA 3D7DA 3SJFA 2DEAA 4KSIA 5HXDA 3VATA 2ANPA 1XFOA 1Z8LA 3GLJA 3IFEA 1LAPA 1BPMA 5THWA 3V7ZA 4C8PA 3KQXA 4C8AA 4C86A 3PBBA 4MCRA 2PJ8A 3GB0A 3NH5A 4PQAA 4CDKA 1Y0YA 4X3RA 2VL1A 3S9MA 5LRGA 3B35A 2V77A 4NGTA 2C6PA 1HDUA 4MHZA 4WJBA 3ISZA 2PJAA 2AFMA 4C9VA 3BHXA 3FJUA 4RUHA 4G1PA 2PCUA 4MHPA 3WC6A 5D8NA 4Z65A 1F2OA 3FX6A 4C84A 1VGYA 3D4UA 4UIAA 5I4MA 4MRIA 3B3SA 5DS0A 1R3NA 1HEEA 3SI0A 3FEDA 3CDXA 4TNUA 3IC1A 4UEFA 1CP7A 2GLFA 2PJ7A 2ZEGA 3K9TA 5F09A 3S9NA 3D67A 3PFOA 4W9YA 2V8VA 4LQGA 1CX8A 1TXRA 2ABZA 4UIBA 4P4DA 3HUVA 3NFZA 3WT4A 4NGNA 1ZLHA 2Q51A 2XEFA 2OOTA 1FT7A 2CTBA 4ZX9A 2ZELA 1EE3P 4X8IA 1CBXA 1KWMA 2BCOA 4P6YA 3KQZA 4A37A 4WWVA 1YSJA 4NGPA 5LRJA 3D7FA 3B3VA 4H2KA 1CG2A 3KL9A 2PE3A 2HB6A 2O4HA 4CPAA 3IO1A 3PBEA 3B7IA 2G9DA 4UEEA 2PIYA 4ZX8A 4ZI6A 2HC9A 5K8NA 5K8OA 5LYLA 2GREA 2JBJA 3IEHA 2PJ2A 3H8GA 3VTAA 3FEEA 2GP4A 2ZEMA 2CTCA 4IHMA 4P4BA 3D68A 4YN3A 3SJEA 2POKA 3PFEA 4P45A 4TWEA 1CP6A 3VARA 5IR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ONW A;  1Y0R A;  2ZOG A;  3RAM A;  4EME A;  1RTQ A;  3L2N A;  1LFW A;  2XEG A;  2PJ6 A;  3DGV A;  2PJ0 A;  2C1C A;  5HVF A;  2ZEO A;  4MCQ A;  4B6Z A;  1ARL A;  1TKF A;  4NFR A;  3CPA A;  2C6C A;  1Y9Z A;  3BI0 A;  4NJR A;  2IJZ A;  4DJL A;  4P4E A;  2AFZ A;  4C8C A;  4TJX A;  1IGB A;  2BO9 A;  1ZG9 A;  3MRU A;  2AFU A;  4C9A A;  2JBK A;  4C85 A;  3S9L A;  1YME A;  3PB9 X;  4R7M A;  3FVL A;  4YWY A;  2ZEF A;  2ZEE A;  3SI1 A;  3BI1 A;  4UF4 A;  4F9U A;  3RZA A;  4NGM A;  1VIX A;  5K8M A;  2PVW A;  2V8G A;  2EK8 A;  2PJ3 A;  3H8E A;  1BLL E;  5HVG A;  3IWW A;  4MCS A;  1XRY A;  1ZG7 A;  3CPX A;  6CPA A;  3QNV A;  1Z5R A;  3D66 A;  1JQG A;  1PYT B;  4JYW A;  2NYQ A;  1TKH A;  2ZED A;  1YW6 A;  3I74 A;  4X2T A;  3IIB A;  3SJG A;  4MMO A;  1LAM A;  5LYD A;  3SJX A;  4PXB A;  4ZY0 A;  4FBE A;  4P4F A;  4F8Z A;  4A94 A;  3KR4 A;  2V8H A;  1TF9 A;  2I3C A;  4PXE A;  4OC4 A;  3RBU A;  1OBR A;  3TX8 A;  1R43 A;  1YW4 A;  4NGS A;  4C9E A;  2QVP A;  1Y7E A;  2AFS A;  2WZN A;  1Q7L A;  4DYO A;  4FAI A;  4KNG E;  4C8F A;  3LWU A;  4PPZ A;  2RB7 A;  1ZLI A;  4P10 A;  1LAN A;  1Z2L A;  3I1U A;  4EFD A;  3H8F A;  4GM5 A;  4MHY A;  1IY7 A;  1CPS A;  5HVH A;  2ZEH A;  2CF4 A;  3KGQ A;  1XMB A;  1WVM A;  4OP4 A;  4OC3 A;  5D29 A;  1TF8 A;  3BXM A;  2FVG A;  1ELM P;  1LOK A;  1DE4 C;  1VHE A;  2PJ5 A;  2PJB A;  1VHO A;  4MXU A;  4OIW A;  2IQ6 A;  3ISX A;  2ZEP A;  2PJC A;  4DUK A;  4C9U A;  1LCP A;  2V8D A;  4C8T A;  3PB8 X;  3IJ3 A;  5LRK A;  4R6T A;  2Q4Z A;  1FNO A;  4TJV A;  3I6S A;  1TKJ A;  3PB7 X;  5LYI A;  2PIZ A;  5IB9 A;  3FEC A;  4P4I A;  4CDJ A;  4A38 A;  1F2P A;  2OR4 A;  3VH9 A;  1AMP A;  3KR5 A;  1ARM A;  4UEZ A;  4MHN A;  3PRT A;  3PB4 X;  2IMO A;  1CPX A;  4ZY1 A;  5CPA A;  2O53 A;  2AFX A;  1XF1 A;  7CPA A;  2EWB A;  1UWY A;  2PVV A;  2PRQ A;  4C9R A;  3NA6 A;  3PB6 X;  5CBM A;  4FUU A;  1F57 A;  4OC0 A;  4Q7A A;  2XEI A;  2PJ4 A;  3NH4 A;  2AFW A;  3KZW A;  1AYE A;  4P4J A;  1NSA A;  4NGR A;  4OID A;  2XEJ A;  1XBU A;  4YU9 A;  4C99 A;  3K2K A;  8CPA A;  4JZ0 A;  2ZOF A;  5ELY A;  4IK2 A;  4AXV A;  3TC8 A;  1HDQ A;  4EWT A;  2NSM A;  4O23 A;  4FWU A;  4PXC A;  3JRU A;  1BAV A;  3D7G A;  2F8H A;  3WAB A;  3T8W A;  2QYV A;  5LYF A;  5J1Q A;  4NGQ A;  4ZY2 A;  3KAS A;  3D7H A;  3FH4 A;  2AFO A;  3KHZ A;  3CT9 A;  4R8F A;  2EK9 A;  2ZEN A;  4PXD A;  3KHX A;  2J9A A;  3N5F A;  4OC2 A;  1PCA A;  1XJO A;  3HLP A;  4OME A;  3SI2 A;  2F7V A;  5JGF A;  3WC7 A;  3KI9 A;  2GLJ A;  2RFH A;  1V6C A;  1H8L A;  1GYT A;  2Q43 A;  4IAV A;  1DTD A;  4OC5 A;  3B3W A;  2WYR A;  4BD9 A;  4F9V A;  3GUX A;  4OC1 A;  1ELL P;  3PEI A;  1YLO A;  1ZG8 A;  3B3C A;  5K8P A;  1M4L A;  2JEW A;  2PJ9 A;  2CIJ A;  2C6G A;  3FMC A;  2BOA A;  4P44 A;  3DLJ A;  2PJ1 A;  3FF3 A;  3V38 A;  4OKO A;  4R76 A;  3ICU A;  4NJQ A;  5JM6 A;  4C8U A;  3B3T A;  3NH8 A;  1QQ9 A;  4K3N A;  5JH9 A;  3WC5 A;  2QJ8 A;  1QMU A;  1BPN A;  3B2Y A;  3LMS A;  3MN8 A;  2GU2 A;  4ZYQ A;  4A39 A;  3EIF A;  4MCP A;  3D7D A;  3SJF A;  2DEA A;  4KSI A;  5HXD A;  3VAT A;  2ANP A;  1XFO A;  1Z8L A;  3GLJ A;  3IFE A;  1LAP A;  1BPM A;  5THW A;  3V7Z A;  4C8P A;  3KQX A;  4C8A A;  4C86 A;  3PBB A;  4MCR A;  2PJ8 A;  3GB0 A;  3NH5 A;  4PQA A;  4CDK A;  1Y0Y A;  4X3R A;  2VL1 A;  3S9M A;  5LRG A;  3B35 A;  2V77 A;  4NGT A;  2C6P A;  1HDU A;  4MHZ A;  4WJB A;  3ISZ A;  2PJA A;  2AFM A;  4C9V A;  3BHX A;  3FJU A;  4RUH A;  4G1P A;  2PCU A;  4MHP A;  3WC6 A;  5D8N A;  4Z65 A;  1F2O A;  3FX6 A;  4C84 A;  1VGY A;  3D4U A;  4UIA A;  5I4M A;  4MRI A;  3B3S A;  5DS0 A;  1R3N A;  1HEE A;  3SI0 A;  3FED A;  3CDX A;  4TNU A;  3IC1 A;  4UEF A;  1CP7 A;  2GLF A;  2PJ7 A;  2ZEG A;  3K9T A;  5F09 A;  3S9N A;  3D67 A;  3PFO A;  4W9Y A;  2V8V A;  4LQG A;  1CX8 A;  1TXR A;  2ABZ A;  4UIB A;  4P4D A;  3HUV A;  3NFZ A;  3WT4 A;  4NGN A;  1ZLH A;  2Q51 A;  2XEF A;  2OOT A;  1FT7 A;  2CTB A;  4ZX9 A;  2ZEL A;  1EE3 P;  4X8I A;  1CBX A;  1KWM A;  2BCO A;  4P6Y A;  3KQZ A;  4A37 A;  4WWV A;  1YSJ A;  4NGP A;  5LRJ A;  3D7F A;  3B3V A;  4H2K A;  1CG2 A;  3KL9 A;  2PE3 A;  2HB6 A;  2O4H A;  4CPA A;  3IO1 A;  3PBE A;  3B7I A;  2G9D A;  4UEE A;  2PIY A;  4ZX8 A;  4ZI6 A;  2HC9 A;  5K8N A;  5K8O A;  5LYL A;  2GRE A;  2JBJ A;  3IEH A;  2PJ2 A;  3H8G A;  3VTA A;  3FEE A;  2ZEM A;  2CTC A;  4IHM A;  4P4B A;  3D68 A;  4YN3 A;  3SJE A;  2POK A;  3PFE A;  4P45 A;  4TWE A;  1CP6 A;  3VAR A; 
#chains in the Genus database with same CATH topology
 4ONW A;  1Y0R A;  5KTC A;  2ZOG A;  3RAM A;  2B5G A;  4BTF A;  1VKC A;  3N7Z A;  4KVX A;  2FCK A;  1WK4 A;  3VRP A;  2GE3 A;  2O28 A;  1RTQ A;  3CXP A;  2Z11 A;  3L2N A;  4LX9 A;  4KOV A;  4CS0 B;  4EME A;  3U1B A;  5JQ4 A;  1LFW A;  2XEG A;  2PJ6 A;  3DGV A;  2C5Q A;  1MJ9 A;  3DNS A;  2PJ0 A;  4KUB A;  2C1C A;  5HVF A;  2ZEO A;  4MCQ A;  3TO7 A;  4A4C A;  4B6Z A;  4COB A;  1ARL A;  3P2H A;  1TKF A;  2PR1 A;  1PU9 A;  1UFH A;  2REE A;  3NE8 A;  4JJX A;  5F46 A;  1IU8 A;  2Q44 A;  1YVO A;  2C6C A;  2FSR A;  3CPA A;  4NFR A;  1Y9Z A;  2BSW A;  4JVO A;  1JDB C;  3GKR A;  3BI0 A;  1QSO A;  5AGE A;  5A27 A;  4MJX A;  4NJR A;  1NE9 A;  1QSM A;  2IJZ A;  4RS2 A;  1Z9U A;  2Q7S A;  2R1I A;  4A31 A;  4C2Y A;  4OAE A;  4P4E A;  2AFZ A;  1Q2Y A;  4DJL A;  4TJX A;  4C8C A;  1IGB A;  2BO9 A;  3VGO A;  1ZG9 A;  3MRU A;  1M4G A;  2AFU A;  2JBK A;  4JD6 A;  4C9A A;  4C85 A;  4CYO A;  2DXQ A;  3S9L A;  2X7B A;  1YME A;  3PGP A;  4UFW A;  1LRZ A;  4H6U A;  3PB9 X;  4R7M A;  4KS9 A;  3W6S A;  3FVL A;  1V0C A;  4YWY A;  3TLA A;  2ZEF A;  3ZZI A;  2Z3L A;  3QAY A;  4CYN A;  2ZEE A;  3SI1 A;  2Y0M A;  3BI1 A;  3D2P A;  1J3L A;  4B14 A;  4UF4 A;  4F9U A;  3RZA A;  5J8C A;  4NGM A;  1VBH A;  1VIX A;  5K8M A;  4A4B A;  4Q38 A;  2PVW A;  2F5I A;  1FBV A;  2V8G A;  2FS5 A;  2EK8 A;  5DWN A;  4CAF A;  3TLB A;  5AG5 A;  2PJ3 A;  3G3S A;  3H8E A;  5G1Z A;  4B5O A;  3TTH A;  4U5Y A;  4ZBG A;  4A2Z A;  3FYN A;  1BLL E;  2Q04 A;  4F0Y A;  3IWW A;  4MCS A;  1XRY A;  1ZG7 A;  4CGL A;  3CPX A;  5HVG A;  1KBL A;  4AVA A;  2Z10 A;  5AG4 A;  3ZJ0 A;  6CPA A;  3QNV A;  1Z5R A;  3D66 A;  1JQG A;  1PYT B;  4JYW A;  5IV0 A;  1K4J A;  4UBR A;  2NYQ A;  1TKH A;  1B47 A;  5H86 A;  2B58 A;  2HWG A;  2ZED A;  1YW6 A;  2JLM A;  1BXR B;  4X2T A;  3I74 A;  1AUG A;  2P0W A;  2EZC A;  3IIB A;  3SJG A;  4CRY B;  4MMO A;  1LAM A;  3G8W A;  4HKF A;  5LYD A;  2VQY A;  4CGO A;  3K4I A;  4CYQ A;  3SJX A;  3SXO A;  4AVB A;  4PXB A;  4ZY0 A;  4FBE A;  2CBL A;  3PT1 A;  4P4F A;  4GS4 A;  5C88 A;  2PDO A;  4F8Z A;  1U6M A;  4Y49 C;  4A94 A;  4COG A;  3KR4 A;  4UFX A;  2DIK A;  2V8H A;  1TF9 A;  4J0N A;  2I3C A;  4PXE A;  3SR3 A;  4OC4 A;  1DIK A;  1S7L A;  3TE4 A;  2ZXV A;  3RBU A;  3BJ8 A;  2VXK A;  1OBR A;  2YNE A;  1I12 A;  4DNC A;  3VRQ A;  3TX8 A;  1R43 A;  1YW4 A;  4NGS A;  1A9X B;  1M44 A;  4C9E A;  2QVP A;  3PZJ A;  4UCP A;  1Y7E A;  2AFS A;  2WZN A;  1Q7L A;  2P6E A;  1BOB A;  2WPW A;  3D8P A;  4IF5 A;  3P2F A;  4CAE A;  1I21 A;  4FAI A;  3GY9 A;  4ORF A;  4C8F A;  4CAV A;  3LWU A;  1FY7 A;  2RB7 A;  4PPZ A;  4RR2 B;  1ZLI A;  1YQE A;  2C27 A;  2RC4 A;  1LAN A;  3FXT A;  4P10 A;  4A95 A;  2B5G B;  1Z2L A;  2CY2 A;  3I1U A;  1EZB A;  1YLE A;  2BEI A;  4JXQ A;  3H8F A;  4GM5 A;  4MHY A;  4H6Z A;  3S6K A;  4EFD A;  2D4O A;  3BUX B;  4U9Y A;  1IY7 A;  3BLN A;  2QIR A;  3TT2 A;  4CGP A;  1CPS A;  5HVH A;  4MI1 A;  1IID A;  2VZZ A;  2ZEH A;  4L89 A;  3E0K A;  3JTK A;  2D0O A;  3FRM A;  2CF4 A;  2GFQ A;  5EBV A;  3KGQ A;  4KOW A;  1XMB A;  3T90 A;  2D0P A;  1KZF A;  1WVM A;  5J8F A;  4OP4 A;  4HNY B;  5IB0 A;  4OC3 A;  2EUI A;  5D29 A;  1TF8 A;  3BXM A;  2FVG A;  1ELM P;  1LOK A;  1PUA A;  1DE4 C;  1VHE A;  2PJ5 A;  4MFJ A;  2PJB A;  4UA3 A;  4IIX A;  2KCW A;  1VHO A;  4CYP A;  4MXU A;  4RN7 A;  1JDE A;  4JXR A;  2HI6 A;  4UWI A;  5JPH A;  4OIW A;  2R98 A;  4XPL A;  2DLA A;  2IQ6 A;  2YJT A;  3ISX A;  4BBH A;  3DR8 A;  3EY5 A;  2J8N A;  4FD6 A;  4M6I A;  2ZEP A;  4EVY A;  1B87 A;  4UCM A;  2PJC A;  5F48 A;  3T0T A;  4FD5 A;  4DUK A;  3TO6 A;  4C9U A;  2OB0 A;  5F13 A;  2GAN A;  1LCP A;  2V8D A;  2B3U A;  4YRH A;  4KOX A;  4C8T A;  2NMT A;  3PB8 X;  3IJ3 A;  3R9F A;  1Y9K A;  5LRK A;  4R6T A;  5EMI A;  3OP0 A;  4MY0 A;  2Q4Z A;  2CNS A;  4MJ8 A;  3W91 A;  1FNO A;  4NF1 A;  4E0A A;  1J4J A;  1M4I A;  3I6S A;  1S60 A;  4TJV A;  2EVN A;  4C2Z A;  1VHS A;  1YX0 A;  1TKJ A;  3PB7 X;  1T36 B;  2OU2 A;  3MGD A;  5LYI A;  2PIZ A;  3NFQ A;  1XEB A;  5J3X A;  5IB9 A;  5EC4 A;  3S6H A;  2B4D B;  3FEC A;  4P4I A;  4A30 A;  5HH1 A;  4CDJ A;  4LQ6 A;  3NOJ A;  4A38 A;  5HKW A;  1F2P A;  2OR4 A;  5F47 A;  3VH9 A;  4BIN A;  1YGH A;  1AMP A;  2OH1 A;  2PC1 A;  3KR5 A;  1ARM A;  2ZW7 A;  2VEZ A;  2R82 A;  3KKW A;  4UEZ A;  4MHN A;  3PRT A;  3PB4 X;  4UCN A;  4B5P B;  3EZB A;  1B6B A;  5BWA B;  4M85 A;  2IMO A;  1CPX A;  4ZY1 A;  4EYS A;  1YR0 A;  3UY5 A;  5CPA A;  3OB2 B;  2O53 A;  1A2Z A;  3LOD A;  3S6F A;  4C84 A;  2AFX A;  1XF1 A;  5G21 A;  3PLF B;  5C82 A;  2OZU A;  7CPA A;  2EWB A;  2R7H A;  1UWY A;  2BL1 A;  2PVV A;  3FB3 A;  3GJZ A;  2G0B A;  3TO9 A;  2PRQ A;  1KC7 A;  5AG6 A;  4C9R A;  3NA6 A;  4OLL A;  4KLV A;  5IX3 A;  1P4N A;  3PB6 X;  4E8O A;  1ZL0 A;  1IOF A;  5CBM A;  4FUU A;  1F57 A;  4OC0 A;  2I00 A;  4Q7A A;  2XEI A;  4BPW B;  2PJ4 A;  3C26 A;  4MFZ A;  3TLG A;  3IU1 A;  3NH4 A;  2AFW A;  4KUA A;  4B13 A;  3TLE A;  1EO0 A;  1AYE A;  3KZW A;  1JWQ A;  4P4J A;  3F9K C;  1IB1 E;  1NSA A;  5HKY A;  4NGR A;  4OID A;  2XEJ A;  3GIU A;  3FIX A;  2D4P A;  4B10 A;  1XBU A;  2HUZ A;  4YU9 A;  1XF8 A;  3K2K A;  8CPA A;  1S7K A;  4C99 A;  1XIX A;  4JZ0 A;  2VI7 A;  4KOY A;  1L0C A;  2ZOF A;  4GXH A;  2EBJ A;  4CO9 A;  2ZW6 A;  3HPH E;  1Y7R A;  1CE8 B;  5ELY A;  4XNH B;  2AE6 A;  4IK2 A;  2XPL A;  2Z0Z A;  4C68 A;  5G22 A;  3R95 A;  2YND A;  3VRO A;  3TC8 A;  2PRB A;  4AXV A;  1HDQ A;  3G23 A;  4E94 A;  2OLS A;  1YK3 A;  2HV2 A;  4EWT A;  3EC4 A;  5F9M A;  3OWC A;  3O8Z A;  2NSM A;  4PK2 A;  2Q0Y A;  4O23 A;  4FWU A;  4PXC A;  3JRU A;  1BAV A;  3D7G A;  2F8H A;  4M6H A;  4AB7 A;  3WAB A;  5H84 A;  3T8W A;  2QYV A;  2YJV A;  5LYF A;  5J1Q A;  4J3G A;  5HXD A;  4NGQ A;  4MI4 A;  4X5K A;  1QSR A;  3W6X A;  3DSB A;  4ZY2 A;  2YGW A;  3KAS A;  3D7H A;  1XMT A;  3T9Y A;  2FE7 A;  5E96 A;  3FH4 A;  1QST A;  4MFL A;  2I79 A;  4CZ1 A;  2FIA A;  1VBG A;  3ZNI A;  2AFO A;  2B4B A;  1NXJ A;  3T05 A;  3TYX A;  2EO8 A;  1GHE A;  2R8V A;  3KHZ A;  4ONU A;  2Y1M A;  2J8M A;  4HPS A;  3CT9 A;  3BJ7 A;  3OAK A;  1X12 A;  3JUW A;  4R8F A;  2Q7B A;  2AUM A;  1KEE B;  2EK9 A;  2JDC A;  2ZEN A;  4PSW A;  3QB8 A;  3D3S A;  1BO4 A;  4PXD A;  3KHX A;  2J9A A;  4RI1 A;  2YNC C;  3N5F A;  3TCV A;  1Z4R A;  2CNM A;  3RYO A;  3BUO B;  4OC2 A;  1PCA A;  1XJO A;  3HLP A;  5FD8 A;  4OME A;  3SI2 A;  4CAX A;  3I3G A;  2YNC A;  3CXS A;  2F7V A;  3S6G A;  1IIC A;  5JGF A;  3WC7 A;  3IU2 A;  3KI9 A;  2GLJ A;  2RFH A;  3VWE A;  2Z3P A;  5HKZ A;  5CNP A;  1V6C A;  1H8L A;  4HNX B;  2B3V A;  2HRO A;  3TLC A;  1GYT A;  4AVC A;  4KSA A;  3F8K A;  4XPD C;  1Q2D A;  3T07 A;  1X10 A;  2XPP A;  2UV8 G;  1XOV A;  2Q43 A;  3TFY A;  3A9L A;  3D2M A;  1M1D A;  4IAV A;  1DTD A;  2VZY A;  4OC5 A;  3B3W A;  3C8O A;  2JEV A;  4H89 A;  2WYR A;  2QEC A;  4M3S A;  4BD9 A;  2PCN A;  4F9V A;  3GUX A;  4UWJ A;  4OC1 A;  2Q4Y A;  3KRV A;  4R57 A;  3R9E A;  2ARH A;  1ELL P;  3PEI A;  3TOA A;  2HQY A;  1YLO A;  1ZG8 A;  3B3C A;  4QB9 A;  5K8P A;  1M4L A;  4NCZ A;  4DYO A;  4QVT A;  2JEW A;  2PJ9 A;  2CIJ A;  2C6G A;  3FMC A;  4U9Z A;  4H1H A;  2IL4 A;  2EZB A;  2BOA A;  4P44 A;  3TLG B;  2ATR A;  2PR8 A;  3PFV A;  3QAH A;  3DLJ A;  4NEX A;  2PJ1 A;  3FF3 A;  4KOS A;  2PQ8 A;  3BUW B;  3V38 A;  4PK3 A;  1Z9E A;  4OKO A;  4R76 A;  2REF A;  4NJQ A;  4OAD A;  5JM6 A;  3B3T A;  3ICU A;  4C8U A;  3NH8 A;  1QQ9 A;  1P0H A;  1MK4 A;  1Z8W A;  3HPG G;  4K3N A;  4C7H A;  5JH9 A;  1S5K A;  2GIV A;  3WC5 A;  2QJ8 A;  4C2X A;  3EZA A;  1R57 A;  1QMU A;  1BPN A;  3B2Y A;  1IYL A;  3LMS A;  3MN8 A;  2GU2 A;  3IWG A;  4MHD A;  4ZYQ A;  5ISV A;  5FVJ A;  3FNC A;  1IOI A;  4A39 A;  3EIF A;  4MCP A;  3EXN A;  2P6F A;  3IWE A;  4FD7 A;  3D7D A;  3SJF A;  1C3O B;  5JYB A;  4Q36 A;  4IIY A;  1NSL A;  4Y49 B;  2DEA A;  4BPU B;  4KSI A;  4MFQ A;  3VAT A;  2OZG A;  3EFA A;  2ANP A;  1KUX A;  2PSW A;  2VBQ A;  3RNZ A;  4II9 A;  1XFO A;  1Z8L A;  3GLJ A;  3LD2 A;  4YFJ A;  1ZRS A;  3OB1 B;  1WWZ A;  3IFE A;  2QML A;  5F1Y A;  2K5T A;  1LAP A;  1BPM A;  1I1D A;  5THW A;  4M6G A;  3V7Z A;  4QUS A;  1YRE A;  4IUS A;  1R61 A;  4C8P A;  1N71 A;  1Y9W A;  1M4D A;  2XPN A;  3KQX A;  4PV6 A;  4F0X A;  5AG7 A;  4C8A A;  1KUY A;  4C86 A;  3PBB A;  2DPS A;  4B11 A;  4INJ A;  4MCR A;  2OZH A;  3VRR A;  2PJ8 A;  3GB0 A;  3NH5 A;  4BPX B;  4PQA A;  1EZA A;  5F5X A;  4CDK A;  1Y0Y A;  1MJA A;  4X3R A;  3H5Z A;  4LUA A;  2VL1 A;  4MY3 A;  3S9M A;  3F0A A;  5LRG A;  3TOB A;  4AG9 A;  1OZP A;  4E2A A;  3TLZ A;  5F49 A;  1ZYM A;  5JVL A;  3B35 A;  2V77 A;  4NGT A;  2C6P A;  1HDU A;  1RXT A;  4HNW B;  5A28 A;  3R9G A;  5KTD A;  2ZPA A;  4MHZ A;  4WJB A;  2Z3M A;  3SXN A;  2A4N A;  4K30 A;  4KOT A;  2CNT A;  5DWM A;  3ISZ A;  1CJW A;  2PJA A;  2AFM A;  1YVH A;  1MJB A;  4C9V A;  4CRZ B;  3NE7 A;  3BHX A;  3FJU A;  4RUH A;  1NMT A;  3DR6 A;  4AG7 A;  3FBU A;  4G1P A;  3R96 A;  4ZGY B;  1SQH A;  1YVK A;  4R87 A;  2X0S A;  3K9U A;  4M8D A;  2WSA A;  2PCU A;  4MHP A;  3WC6 A;  5D8N A;  4Z65 A;  4YGO A;  4KVO E;  2ZW5 A;  1F2O A;  3FX6 A;  4JLY A;  1C30 B;  4UFV A;  2EZA A;  4XPD B;  2G3T A;  1WJT A;  3GYA A;  5KTA A;  1Z4E A;  1VGY A;  3R1K A;  2B4D A;  4KZT A;  1QSN A;  3D4U A;  3VWD A;  2WPX A;  4KVM E;  4NXY A;  4UIA A;  5G20 A;  4BMH A;  5I4M A;  4MRI A;  3B3S A;  4L8A A;  5DS0 A;  4I49 A;  3CZX A;  1R3N A;  2WUU A;  4KOU A;  2FM4 A;  4KLW A;  2Z3N A;  1HEE A;  3SI0 A;  3VRN A;  4F6A A;  3FED A;  4KOR A;  3CDX A;  5GCN A;  2J8R A;  1KUV A;  4TNU A;  3U88 C;  1CS0 B;  2XPO A;  4R9M A;  1Q5X A;  3HMJ G;  1TIQ A;  3IC1 A;  1CP7 A;  2CXA A;  2GLF A;  2PJ7 A;  2ZEG A;  3K9T A;  4UEF A;  4NSQ A;  5BY0 A;  5F09 A;  4B5P A;  2Z3O A;  2FT0 A;  5HMN A;  3BUM B;  3S9N A;  3D67 A;  3DDD A;  4XPK A;  3PFO A;  4W9Y A;  3H4Q A;  4C7I A;  3I9S A;  4JWP A;  1Z8T A;  2FXF A;  4LQG A;  2V8V A;  4CGM A;  1CX8 A;  2H5M A;  1TXR A;  2Q4V A;  3BUN B;  3IGR A;  3JVN A;  2ABZ A;  1S7F A;  1RO5 A;  3V8I A;  1IYK A;  4MFP A;  4UIB A;  2ZW4 A;  2MP0 A;  3RO0 A;  4P4D A;  2G3A A;  3HUV A;  3NFZ A;  2VKZ G;  1CM0 A;  3SHP A;  3WR7 A;  3WT4 A;  4NGN A;  2B0A A;  1ZLH A;  4B12 A;  4GPL B;  2Q51 A;  4CAW A;  2XEF A;  2OOT A;  1FT7 A;  2CTB A;  4ZX9 A;  2ZEL A;  1EE3 P;  1XE4 A;  2ODF A;  4QC6 A;  1CBX A;  4X8I A;  5I0C A;  1Z8X A;  1KWM A;  2BCO A;  3CXQ A;  4R3K A;  4P6Y A;  2B4J C;  3KQZ A;  4A37 A;  4WWV A;  1YSJ A;  4NGP A;  5LRJ A;  2DF5 A;  3D7F A;  4KSF A;  3PP9 A;  3B3V A;  4H2K A;  1CG2 A;  4A33 A;  3KL9 A;  1M6V B;  4CGN A;  1ZO0 A;  4XNH C;  1NBW A;  2PE3 A;  2N3A B;  2HB6 A;  2O4H A;  4KNG E;  1Q2C A;  4CPA A;  3EZE A;  4QBJ A;  2AUN A;  4R3L A;  3IO1 A;  3PBE A;  4MFK A;  3B7I A;  2FL4 A;  2G9D A;  4UEE A;  2Y1N A;  3EO4 A;  2BUE A;  2PIY A;  2Z3K A;  2HC9 A;  3LAC A;  4ZX8 A;  4ZI6 A;  5K8O A;  5K8N A;  2GRE A;  5LYL A;  1ON0 A;  2DPT A;  2FIW A;  2JBJ A;  3IEH A;  2E28 A;  2PJ2 A;  2AJ6 A;  3H8G A;  1S3Z A;  3VTA A;  3FEE A;  2P6G A;  5K99 A;  2GP4 A;  4FD4 A;  4A32 A;  2ZEM A;  2CTC A;  4IHM A;  4P4B A;  3TLY A;  3D68 A;  5AXI A;  3T5M A;  3B8G A;  4YN3 A;  3SJE A;  2JDD A;  1VI4 A;  2POK A;  4MBU A;  1S7N A;  3PFE A;  4PSX A;  4P45 A;  3F5B A;  4TWE A;  1GGO A;  1CP6 A;  3VAR A;  4E5S A;  5IR2 A; 
#chains in the Genus database with same CATH homology
 4ONW A;  1Y0R A;  2ZOG A;  3RAM A;  4EME A;  1RTQ A;  3L2N A;  1LFW A;  2XEG A;  2PJ6 A;  3DGV A;  2C5Q A;  2PJ0 A;  2C1C A;  5HVF A;  2ZEO A;  4MCQ A;  4B6Z A;  1ARL A;  1TKF A;  4NFR A;  3CPA A;  2C6C A;  1Y9Z A;  3BI0 A;  4NJR A;  2IJZ A;  4DJL A;  4P4E A;  2AFZ A;  4C8C A;  4TJX A;  1IGB A;  2BO9 A;  1ZG9 A;  3MRU A;  2AFU A;  4C9A A;  2JBK A;  4C85 A;  3S9L A;  1YME A;  3PB9 X;  4R7M A;  3FVL A;  4YWY A;  2ZEF A;  2ZEE A;  3SI1 A;  3BI1 A;  4UF4 A;  4F9U A;  3RZA A;  4NGM A;  1VIX A;  5K8M A;  2PVW A;  2V8G A;  2EK8 A;  2PJ3 A;  3H8E A;  1BLL E;  5HVG A;  3IWW A;  4MCS A;  1XRY A;  1ZG7 A;  3CPX A;  6CPA A;  3QNV A;  1Z5R A;  3D66 A;  1JQG A;  1PYT B;  4JYW A;  2NYQ A;  1TKH A;  2ZED A;  1YW6 A;  3I74 A;  4X2T A;  3IIB A;  3SJG A;  4MMO A;  1LAM A;  5LYD A;  3SJX A;  4PXB A;  4ZY0 A;  4FBE A;  4P4F A;  4F8Z A;  4A94 A;  3KR4 A;  2V8H A;  1TF9 A;  2I3C A;  4PXE A;  4OC4 A;  3RBU A;  1OBR A;  3TX8 A;  1R43 A;  1YW4 A;  4NGS A;  4C9E A;  2QVP A;  1Y7E A;  2AFS A;  2WZN A;  1Q7L A;  4DYO A;  4FAI A;  4KNG E;  4C8F A;  3LWU A;  4PPZ A;  2RB7 A;  1ZLI A;  4P10 A;  1LAN A;  1Z2L A;  3I1U A;  4EFD A;  3H8F A;  4GM5 A;  4MHY A;  1IY7 A;  1CPS A;  5HVH A;  2ZEH A;  2CF4 A;  3KGQ A;  1XMB A;  1WVM A;  4OP4 A;  4OC3 A;  5D29 A;  1TF8 A;  3BXM A;  2FVG A;  1ELM P;  1LOK A;  1DE4 C;  1VHE A;  2PJ5 A;  2PJB A;  1VHO A;  4MXU A;  4OIW A;  2IQ6 A;  3ISX A;  2ZEP A;  2PJC A;  4DUK A;  4C9U A;  1LCP A;  2V8D A;  4C8T A;  3PB8 X;  3IJ3 A;  5LRK A;  4R6T A;  2Q4Z A;  1FNO A;  4TJV A;  3I6S A;  1TKJ A;  3PB7 X;  5LYI A;  2PIZ A;  5IB9 A;  3FEC A;  4P4I A;  4CDJ A;  4A38 A;  1F2P A;  2OR4 A;  3VH9 A;  1AMP A;  3KR5 A;  1ARM A;  4UEZ A;  4MHN A;  3PRT A;  3PB4 X;  2IMO A;  1CPX A;  4ZY1 A;  5CPA A;  2O53 A;  2AFX A;  1XF1 A;  7CPA A;  2EWB A;  1UWY A;  2PVV A;  2PRQ A;  4C9R A;  3NA6 A;  3PB6 X;  5CBM A;  4FUU A;  1F57 A;  4OC0 A;  4Q7A A;  2XEI A;  2PJ4 A;  3NH4 A;  2AFW A;  3KZW A;  1AYE A;  4P4J A;  1NSA A;  4NGR A;  4OID A;  2XEJ A;  1XBU A;  4YU9 A;  4C99 A;  3K2K A;  8CPA A;  4JZ0 A;  2ZOF A;  5ELY A;  4IK2 A;  4AXV A;  3TC8 A;  1HDQ A;  4EWT A;  2NSM A;  4O23 A;  4FWU A;  4PXC A;  3JRU A;  1BAV A;  3D7G A;  2F8H A;  3WAB A;  3T8W A;  2QYV A;  5LYF A;  5J1Q A;  4NGQ A;  4ZY2 A;  3KAS A;  3D7H A;  3FH4 A;  2AFO A;  3KHZ A;  3CT9 A;  4R8F A;  2EK9 A;  2ZEN A;  4PXD A;  3KHX A;  2J9A A;  3N5F A;  4OC2 A;  1PCA A;  1XJO A;  3HLP A;  4OME A;  3SI2 A;  2F7V A;  5JGF A;  3WC7 A;  3KI9 A;  2GLJ A;  2RFH A;  1V6C A;  1H8L A;  1GYT A;  2Q43 A;  4IAV A;  1DTD A;  4OC5 A;  3B3W A;  2WYR A;  4BD9 A;  4F9V A;  3GUX A;  4OC1 A;  1ELL P;  3PEI A;  1YLO A;  1ZG8 A;  3B3C A;  5K8P A;  1M4L A;  2JEW A;  2PJ9 A;  2CIJ A;  2C6G A;  3FMC A;  2BOA A;  4P44 A;  3DLJ A;  2PJ1 A;  3FF3 A;  3V38 A;  4OKO A;  4R76 A;  3ICU A;  4NJQ A;  5JM6 A;  4C8U A;  3B3T A;  3NH8 A;  1QQ9 A;  4K3N A;  5JH9 A;  3WC5 A;  2QJ8 A;  1QMU A;  1BPN A;  3B2Y A;  3LMS A;  3MN8 A;  2GU2 A;  4ZYQ A;  4A39 A;  3EIF A;  4MCP A;  3D7D A;  3SJF A;  2DEA A;  4KSI A;  5HXD A;  3VAT A;  2ANP A;  1XFO A;  1Z8L A;  3GLJ A;  3IFE A;  1LAP A;  1BPM A;  5THW A;  3V7Z A;  4C8P A;  3KQX A;  4C8A A;  4C86 A;  3PBB A;  4MCR A;  2PJ8 A;  3GB0 A;  3NH5 A;  4PQA A;  4CDK A;  1Y0Y A;  4X3R A;  2VL1 A;  3S9M A;  5LRG A;  3B35 A;  2V77 A;  4NGT A;  2C6P A;  1HDU A;  4MHZ A;  4WJB A;  3ISZ A;  2PJA A;  2AFM A;  4C9V A;  3BHX A;  3FJU A;  4RUH A;  4G1P A;  2PCU A;  4MHP A;  3WC6 A;  5D8N A;  4Z65 A;  1F2O A;  3FX6 A;  4C84 A;  1VGY A;  3D4U A;  4UIA A;  5I4M A;  4MRI A;  3B3S A;  5DS0 A;  1R3N A;  1HEE A;  3SI0 A;  3FED A;  3CDX A;  4TNU A;  3IC1 A;  4UEF A;  1CP7 A;  2GLF A;  2PJ7 A;  2ZEG A;  3K9T A;  5F09 A;  3S9N A;  3D67 A;  3PFO A;  4W9Y A;  2V8V A;  4LQG A;  1CX8 A;  1TXR A;  2ABZ A;  4UIB A;  4P4D A;  3HUV A;  3NFZ A;  3WT4 A;  4NGN A;  1ZLH A;  2Q51 A;  2XEF A;  2OOT A;  1FT7 A;  2CTB A;  4ZX9 A;  2ZEL A;  1EE3 P;  4X8I A;  1CBX A;  1KWM A;  2BCO A;  4P6Y A;  3KQZ A;  4A37 A;  4WWV A;  1YSJ A;  4NGP A;  5LRJ A;  3D7F A;  3B3V A;  4H2K A;  1CG2 A;  3KL9 A;  2PE3 A;  2HB6 A;  2O4H A;  4CPA A;  3IO1 A;  3PBE A;  3B7I A;  2G9D A;  4UEE A;  2PIY A;  4ZX8 A;  4ZI6 A;  2HC9 A;  5K8N A;  5K8O A;  5LYL A;  2GRE A;  2JBJ A;  3IEH A;  2PJ2 A;  3H8G A;  3VTA A;  3FEE A;  2GP4 A;  2ZEM A;  2CTC A;  4IHM A;  4P4B A;  3D68 A;  4YN3 A;  3SJE A;  2POK A;  3PFE A;  4P45 A;  4TWE A;  1CP6 A;  3VAR A;  5IR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...