4OC5A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with chibzl, a urea-based inhibitor n~2~-{[(s)-carboxy(4-hydroxyphenyl)methyl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 260
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
260
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 260
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc5A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc5A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc5A02
2AFWA 3TX8A 1NSAA 1R3NA 3CPXA 5HVGA 4R7MA 2V8HA 8CPAA 3KQXA 4NGPA 2Q4ZA 1AMPA 1HDUA 1GYTA 2EK8A 3KL9A 1XJOA 4P4IA 2ZEDA 3KGQA 2C1CA 4C84A 3LMSA 4P44A 2ANPA 5HXDA 3CPAA 4UEZA 4FBEA 2ZENA 4R8FA 5K8PA 4F8ZA 4OC2A 3DLJA 4CDJA 2PJ0A 2XEFA 3BHXA 2CTBA 4C9AA 2DEAA 3NA6A 4OIDA 2VL1A 2CIJA 2BCOA 4OC4A 2ZOGA 4MCSA 2C6GA 1TKHA 3B7IA 3D4UA 4WWVA 5CPAA 2OR4A 3K9TA 3B3VA 3I74A 5THWA 4NGNA 2PJ2A 2AFSA 2O4HA 1V6CA 1ELLP 4YN3A 3VATA 3L2NA 5K8OA 3KHZA 4IK2A 5LRKA 4ZY1A 2F8HA 4C8UA 5I4MA 2PJCA 1CP6A 2RB7A 1ZLHA 5LRJA 4FUUA 4C9UA 3VTAA 2IJZA 4NFRA 1ARLA 3IC1A 2PJ3A 3NH4A 3H8GA 3BXMA 3CT9A 1VIXA 1XMBA 4OC0A 2EK9A 1CX8A 3DGVA 3FEEA 3I1UA 1ZG8A 3JRUA 4OKOA 2PVWA 4PXCA 3NFZA 2C6CA 4A94A 2AFXA 4PPZA 1IGBA 4P4FA 1HEEA 2F7VA 3D67A 1XBUA 4K3NA 3HLPA 2QVPA 4C86A 3MN8A 4FWUA 2JBJA 1RTQA 4TJVA 5LRGA 2PE3A 3N5FA 5JGFA 2ZOFA 3IIBA 4ZY2A 5JH9A 2ZEHA 4LQGA 3V7ZA 1F2OA 2J9AA 4CPAA 4KNGE 3WABA 1Y7EA 1UWYA 2BO9A 2IQ6A 3FECA 1LCPA 2PJ5A 3QNVA 4NJRA 2Q51A 3NH5A 4O23A 4C9VA 4R76A 4CDKA 1YW4A 4WJBA 6CPAA 1XF1A 4MHPA 4YWYA 4C8AA 3KI9A 1QMUA 3MRUA 3SJEA 3WC5A 2QJ8A 3HUVA 2PJ6A 3D7DA 3B3TA 4P6YA 2G9DA 5HVHA 2ZEOA 4X2TA 5K8MA 1ZG9A 4C9EA 4NGQA 5K8NA 1OBRA 2JBKA 4PQAA 4IHMA 3IEHA 5D29A 5J1QA 4C8PA 4NGSA 1ZLIA 3FMCA 3S9NA 5LYFA 1AYEA 4TWEA 2ZEFA 4UIBA 5LYLA 2POKA 4A39A 4BD9A 4NGRA 1F57A 3FH4A 1BLLE 2V8VA 4ZX9A 3S9MA 1Q7LA 2JEWA 2WYRA 3SJFA 3GUXA 2AFMA 4UIAA 1EE3P 4PXBA 3SI2A 4DUKA 1TF9A 4UF4A 3SJGA 2PRQA 3KHXA 4OC3A 4OP4A 3D68A 3T8WA 2XEJA 1TKFA 1FNOA 3PB9X 4MCRA 4DYOA 1YSJA 3PB4X 4MXUA 3FEDA 2XEGA 4P45A 4OIWA 2PJ4A 1TKJA 1LANA 2QYVA 5LYDA 3KQZA 4GM5A 1IY7A 2PJ7A 4ZI6A 1ZG7A 5HVFA 1Z2LA 4W9YA 2HC9A 1XFOA 4NGMA 4C99A 4F9VA 3WC6A 2AFZA 4C8CA 3LWUA 4UEFA 3D7HA 1CP7A 1Y0YA 5F09A 4Q7AA 1BAVA 5JM6A 4NJQA 4C9RA 2IMOA 3PEIA 5ELYA 2CTCA 1CPSA 1YW6A 1BPNA 4JYWA 4ONWA 2ZELA 3H8EA 3RZAA 3SI1A 2PVVA 4C8FA 2C6PA 3FF3A 1YLOA 2PIZA 4P4EA 4R6TA 3WT4A 5IB9A 5D8NA 3CDXA 2HB6A 3B3SA 3PRTA 4FAIA 1ELMP 3B2YA 1HDQA 2I3CA 2ZEMA 1YMEA 3EIFA 4MMOA 1XRYA 2WZNA 2PJ1A 5DS0A 1ARMA 1VGYA 2ABZA 2V8GA 4PXEA 3ISXA 3KR5A 4MHNA 2OOTA 2GREA 3D7GA 4EMEA 4MCQA 1VHEA 3NH8A 4Z65A 2ZEGA 4A37A 3KASA 2PJ9A 2PCUA 2V77A 4PXDA 3H8FA 1JQGA 3IFEA 3IO1A 2GU2A 1VHOA 2XEIA 2PJ8A 1DE4C 4EWTA 3GLJA 1KWMA 1CPXA 4MCPA 2NYQA 4ZX8A 2FVGA 3BI1A 4F9UA 4C8TA 1Z8LA 1LAPA 1LAMA 3PBEA 3K2KA 4OC5A 2PIYA 1QQ9A 3PB6X 1Y9ZA 3FX6A 3B3CA 4KSIA 3RBUA 1F2PA 3VH9A 1R43A 3VARA 4C85A 4P4BA 3KZWA 1TXRA 4TNUA 5LYIA 4RUHA 3PB8X 2GLFA 4TJXA 3B3WA 4OMEA 4MRIA 1FT7A 4OC1A 1CG2A 3S9LA 1LOKA 4EFDA 3FVLA 4G1PA 3GB0A 1Z5RA 1DTDA 1M4LA 4DJLA 4P10A 2V8DA 1WVMA 2GLJA 4UEEA 3V38A 3D66A 4IAVA 4MHZA 3BI0A 4ZY0A 3FJUA 5CBMA 2NSMA 4ZYQA 3SJXA 3PBBA 2EWBA 3IWWA 2PJBA 4JZ0A 3ICUA 3B35A 3I6SA 2PJAA 4B6ZA 4X8IA 2AFUA 2O53A 2AFOA 2RFHA 3SI0A 3ISZA 2ZEPA 3TC8A 4A38A 4P4JA 1PCAA 1BPMA 3PFOA 4MHYA 4NGTA 1H8LA 1PYTB 3D7FA 3PB7X 2CF4A 4X3RA 3WC7A 3KR4A 1Y0RA 2ZEEA 4YU9A 4AXVA 3PFEA 4H2KA 7CPAA 1CBXA 1LFWA 3RAMA 2BOAA 2Q43A 4P4DA 3IJ3A 1TF8A
chains in the Genus database with same CATH superfamily
2ZPAA 3TLZA 3VRNA 2AFWA 2XPPA 1NSAA 1R3NA 3TX8A 4PSXA 2QIRA 3CPXA 2DPSA 3DNSA 5H86A 3O8ZA 1X10A 5HVGA 4R7MA 5JVLA 3DR6A 3BUWB 4KLWA 5I0CA 2V8HA 8CPAA 4J3GA 2Y1NA 3KQXA 4MI1A 4NGPA 2Q4ZA 4H6ZA 3TFYA 1EO0A 4E94A 2B4JC 1AMPA 1HDUA 2VBQA 1GYTA 3FBUA 4M6HA 2EK8A 3KL9A 2WPXA 3SR3A 1XJOA 3CXSA 4P4IA 4HKFA 3R95A 4Q38A 4KVME 3S6KA 4IIYA 4QBJA 2ZEDA 3KGQA 3VROA 4B12A 2AUNA 4A4BA 2C1CA 4MY3A 2AJ6A 4UCNA 5BWAB 3N7ZA 4C84A 3HMJG 3LMSA 4RI1A 4P44A 4Y49C 2ANPA 2YJVA 5HXDA 3CPAA 2C27A 4KLVA 2FM4A 3TTHA 2BL1A 1DIKA 2VZZA 4UEZA 1ZO0A 3DR8A 4FBEA 3U88C 2ZENA 4M85A 3OB2B 4R8FA 5K8PA 2P6FA 4F8ZA 1S7KA 5J3XA 1LRZA 4OC2A 4UWIA 5C88A 2ZW6A 1M1DA 3DLJA 1OZPA 4CDJA 1TIQA 5IV0A 4C2ZA 2PJ0A 2XEFA 3BHXA 3HPGG 2CTBA 3E0KA 2DEAA 3NA6A 4OIDA 2VL1A 1Q5XA 1BO4A 2CIJA 2BCOA 2VEZA 2WPWA 1ZRSA 1KUVA 4FD6A 4OC4A 5F9MA 2ZOGA 4ONUA 4MCSA 2C6GA 1N71A 4HNYB 2OLSA 1TKHA 4NF1A 1UFHA 3C26A 1J4JA 4KSFA 4QC6A 3B7IA 3D4UA 1Q2DA 4WWVA 1YVHA 1J3LA 3A9LA 4HNWB 5CPAA 2OR4A 3ZZIA 3K9TA 4JVOA 3B3VA 3I74A 5THWA 3F9KC 4NGNA 2FE7A 2OB0A 2PJ2A 2ARHA 2EZBA 1PUAA 2AFSA 4KSAA 2O4HA 1V6CA 4C7IA 1ELLP 1M4GA 2G0BA 3BJ7A 1X12A 4YN3A 3G23A 1IICA 3VATA 4M6IA 3L2NA 5K8OA 2Z3OA 3G8WA 3KHZA 1M44A 2B3UA 4IK2A 2G3TA 4OLLA 3T9YA 5AXIA 5LRKA 4II9A 3IU2A 4JXQA 2XPLA 4ZY1A 1IOFA 2F8HA 4C8UA 4FD7A 3F0AA 3FRMA 2H5MA 5G1ZA 5G21A 5I4MA 1A2ZA 4FD4A 1Y9KA 2PJCA 3ZNIA 1M4DA 2A4NA 3TO6A 1JWQA 1CP6A 2RB7A 5AG7A 1ZLHA 4A2ZA 4M3SA 1S60A 1YX0A 2JLMA 5LRJA 1IIDA 4YRHA 3LACA 4CGMA 1XE4A 3BUXB 1WK4A 4IUSA 4FUUA 4C9UA 2REEA 1B87A 4MFZA 3VTAA 2Q4YA 4BPWB 1BXRB 2IJZA 1IYLA 3GY9A 4HNXB 2XPNA 3NH4A 1ARLA 2JDCA 2PJ3A 4A4CA 3H8GA 3IC1A 3BXMA 4NFRA 4MY0A 4R3LA 3TO9A 3SXOA 4CGPA 2HROA 2IL4A 4U9YA 4NEXA 3OB1B 1YGHA 2VQYA 3CT9A 4KVOE 1VIXA 1GGOA 4KUBA 1YVOA 1XMBA 5IX3A 2PR1A 1I12A 4KOVA 4OC0A 4GPLB 3VRRA 2EK9A 1CX8A 5CNPA 3DGVA 3FEEA 4RS2A 4LQ6A 4CGNA 4MFKA 3I1UA 1ZG8A 1IYKA 3IWEA 5J8CA 3EZEA 3JRUA 4OKOA 2PVWA 2XPOA 3VRQA 3G3SA 4PXCA 2Q7BA 4MJ8A 5IR2A 3NFZA 2R1IA 3P2HA 5HH1A 2C6CA 4A94A 2AFXA 3SXNA 5HKZA 1SQHA 1IGBA 4PPZA 4P4FA 5JPHA 2GE3A 2EVNA 1A9XB 2R7HA 2EZAA 4UA3A 4UFWA 1HEEA 2P6GA 4XNHC 3VRPA 2F7VA 3D67A 1XBUA 4K3NA 5HMNA 2Q04A 3HLPA 2QVPA 5KTCA 4C86A 3MN8A 3FNCA 4CAVA 4FWUA 2JBJA 1XOVA 1RTQA 2PRBA 1VBGA 4TJVA 3P2FA 5LRGA 3TLYA 4E5SA 2B5GB 2PE3A 2Q4VA 3N5FA 4MFQA 5JGFA 5FD8A 2YGWA 3JTKA 2ZOFA 3IIBA 4ZY2A 5JH9A 2ZEHA 4XPLA 4LQGA 2DLAA 1M6VB 2D0PA 2CNMA 1F2OA 2J9AA 3SHPA 3V7ZA 1I21A 2B3VA 2VI7A 4CPAA 4KZTA 4BPUB 2HUZA 2B4BA 2B4DB 1Y7EA 3WABA 4KNGE 4NXYA 2DXQA 2ODFA 2ZW7A 3EZAA 1MJBA 1UWYA 4CO9A 2BO9A 4UCPA 4JJXA 2OZUA 4JLYA 2IQ6A 4GS4A 3D2PA 3FECA 1LCPA 2FCKA 3W6XA 2FT0A 2PJ5A 3DSBA 3QNVA 4NJRA 4XPDC 3PFVA 4L89A 2BUEA 2Q51A 3NH5A 4O23A 4C9AA 4C9VA 4R76A 2QMLA 3QB8A 4CDKA 1YW4A 2J8MA 1MK4A 4WJBA 1B6BA 1I1DA 2Z11A 4A31A 5F5XA 5K99A 6CPAA 3H4QA 1XF1A 2YNDA 4MHPA 4YWYA 2D4OA 4KS9A 3TLEA 4C8AA 3S6GA 3PT1A 3FYNA 1NMTA 3KI9A 4F0XA 1QMUA 3MRUA 3SJEA 2I00A 4AVCA 4ZGYB 3WC5A 2QJ8A 3HUVA 4MBUA 2PJ6A 4JXRA 3BUMB 3TLAA 4R87A 2B5GA 3D7DA 3B3TA 4P6YA 2G9DA 3BLNA 5HVHA 2ZEOA 4X2TA 3NFQA 5K8MA 1ZG9A 4L8AA 4C9EA 4NGQA 1JDBC 5K8NA 4IF5A 1OBRA 2JBKA 1KUXA 4IHMA 4PQAA 3IEHA 4DNCA 5D29A 4R57A 1EZBA 3IU1A 5J1QA 3HPHE 2Y1MA 4NGSA 4C8PA 1ZLIA 4MI4A 1Q2CA 4CGLA 3FMCA 3S9NA 3D2MA 1AYEA 4TWEA 2ZEFA 4QVTA 4UIBA 5LYFA 5LYLA 1WWZA 2HWGA 3TLGA 1RO5A 2POKA 3GYAA 3MGDA 4A39A 4BD9A 3EFAA 4LUAA 4NGRA 3PP9A 4MFLA 1F57A 3FH4A 1BLLE 2V8VA 2VZYA 5AG5A 1V0CA 3ZJ0A 3CXPA 4ZX9A 3S9MA 1Q7LA 2JEWA 2QECA 2WYRA 2Y0MA 4COBA 5ISVA 4E8OA 3SJFA 4EYSA 2NMTA 4XNHB 3GUXA 2AFMA 4UIAA 1EE3P 4PXBA 5IB0A 3BUNB 2OZHA 3SI2A 4DUKA 1Y9WA 1TF9A 4UF4A 3DDDA 4PV6A 3SJGA 4J0NA 2PRQA 2R98A 3KHXA 4OC3A 4R9MA 3TLBA 1FBVA 4OP4A 5EC4A 3D68A 3VWDA 3T8WA 4B5PB 2XEJA 4IIXA 1CJWA 1TKFA 1FNOA 5KTDA 1AUGA 3PB9X 4MCRA 4UFXA 4AG7A 4DYOA 5A28A 1YSJA 3PB4X 4MXUA 3FEDA 3V8IA 2XEGA 4P45A 1KUYA 1M4IA 2G3AA 3QAHA 4KOTA 3UY5A 4CYQA 3OWCA 4OIWA 2PJ4A 1TKJA 4CAEA 1LANA 2QYVA 5LYDA 3KQZA 1U6MA 4A30A 3RO0A 3S6FA 5C82A 1YLEA 4GM5A 1IY7A 2PJ7A 4ZI6A 1MJ9A 2Z3KA 1ZG7A 5HVFA 1Z2LA 3K4IA 4W9YA 1YREA 2GANA 2HC9A 2R82A 1XFOA 4NGMA 1Z4RA 4QUSA 5FVJA 4C99A 4PK3A 2F5IA 1Z8TA 5GCNA 3EC4A 4F9VA 2HI6A 4I49A 4CAFA 5EBVA 3WC6A 4CZ1A 2EBJA 1S7FA 3NE8A 2AFZA 1XIXA 4CYNA 4C8CA 5F13A 3LWUA 5HKWA 4E0AA 4COGA 4M8DA 4UEFA 2D0OA 5F46A 3D7HA 3JVNA 4RN7A 1CP7A 1T36B 1Y0YA 5F09A 2WSAA 1R57A 2ZXVA 4U5YA 4Q7AA 3TLCA 2Z3LA 4B5PA 3R9EA 1BAVA 3WR7A 2Z10A 5JM6A 4NJQA 4C68A 3LD2A 4C9RA 2IMOA 2REFA 4BBHA 1CS0B 1NXJA 4Y49B 5G20A 3PEIA 4E2AA 3EO4A 2CXAA 2FSRA 2Z3MA 1S7NA 3R1KA 5ELYA 2CTCA 1VI4A 1KC7A 1CPSA 1YW6A 1ZYMA 2VKZG 2B58A 4CYPA 2D4PA 1BPNA 1VHSA 4JYWA 4ONWA 1XEBA 1C30B 5HKYA 2ZELA 4R3KA 3KRVA 3T90A 3F5BA 5F47A 1P4NA 2HQYA 2J8RA 3H8EA 3RZAA 3SI1A 2PVVA 4JWPA 2C6PA 4C8FA 3FF3A 1YLOA 4EVYA 2ZW5A 2CNTA 5AG6A 2FXFA 4FD5A 2PIZA 4P4EA 4R6TA 3WT4A 5IB9A 3W6SA 3W91A 4H89A 2EO8A 2J8NA 5D8NA 3CDXA 2HB6A 3B3SA 3PRTA 3BJ8A 2O28A 4FAIA 5KTAA 3T5MA 2P0WA 2WUUA 1ELMP 4M6GA 4OAEA 5E96A 3GIUA 3B2YA 1HDQA 2ATRA 1S5KA 1QSTA 1YQEA 2I3CA 2ZEMA 1VKCA 3TO7A 1Y7RA 1YMEA 4MMOA 3EIFA 4UFVA 1XRYA 2WZNA 4GXHA 4B13A 3B8GA 3I9SA 2PJ1A 5DS0A 1ARMA 1VGYA 2ABZA 4LX9A 2V8GA 4PXEA 3ISXA 4NSQA 3VWEA 2X0SA 3KR5A 1KZFA 4MHNA 2Q44A 2OOTA 2ZW4A 3TYXA 4YFJA 2GREA 1C3OB 3D7GA 4EMEA 2BEIA 5F1YA 3LODA 5F48A 3PZJA 3OP0A 4CRYB 4MCQA 3FB3A 1GHEA 3TLGB 4CS0B 1VHEA 2FIWA 3NH8A 4Z65A 1QSOA 2ZEGA 2OU2A 3U1BA 5JQ4A 4A37A 3KASA 3NOJA 4RR2B 2PJ9A 3K9UA 3RYOA 4MHDA 1NBWA 2Z0ZA 4KOWA 1MJAA 2PCUA 2V77A 1FY7A 1Z9UA 4JD6A 3H8FA 1JQGA 4PXDA 3IFEA 3IO1A 4UCMA 3GKRA 1ZL0A 2GU2A 4PSWA 1VHOA 1YR0A 5BY0A 2X7BA 2CY2A 4AB7A 2B4DA 2XEIA 2PJ8A 1DE4C 4C7HA 4EWTA 3GLJA 1K4JA 1R61A 1KWMA 2PR8A 1CPXA 2FIAA 3H5ZA 4MCPA 2NYQA 3I3GA 4ZX8A 3R9FA 1Z8XA 2YNCC 2PQ8A 2FVGA 2N3AB 4A33A 2AUMA 4KORA 3TCVA 3BI1A 4F9UA 2CBLA 4C8TA 3CXQA 1CM0A 1Z8LA 3RNZA 3T0TA 1LAPA 1LAMA 3PBEA 3K2KA 4OC5A 2PIYA 3FIXA 2Q7SA 4AVBA 1XMTA 4BINA 1QQ9A 4CYOA 3T07A 2PCNA 3PB6X 1Z8WA 3T05A 1Y9ZA 3FX6A 1QSNA 1WJTA 3B3CA 4KSIA 2BSWA 3RBUA 3D8PA 1F2PA 3VH9A 2UV8G 2HV2A 1R43A 2Q0YA 1BOBA 2CNSA 4MFPA 3VARA 2RC4A 4B11A 3KKWA 3EXNA 4H1HA 4C85A 4P4BA 3KZWA 5AG4A 4B5OA 1TXRA 4TNUA 5LYIA 4RUHA 4BTFA 4INJA 3D3SA 3PLFB 3NE7A 3PB8X 1S3ZA 4U9ZA 1ON0A 2YNCA 2GLFA 4CRZB 2PC1A 4TJXA 1QSMA 3B3WA 4C2XA 1Z4EA 4B14A 4OMEA 4MRIA 1FT7A 3FXTA 4OC1A 1QSRA 4KOYA 4UBRA 4UWJA 2DIKA 1CG2A 2PDOA 3QAYA 3S9LA 1LOKA 5F49A 4AVAA 2FL4A 2YNEA 3FVLA 4EFDA 2GFQA 4G1PA 3GB0A 1Z5RA 4PK2A 4XPKA 1NE9A 1Z9EA 1DTDA 3TOBA 2YJTA 4YGOA 3C8OA 1IU8A 1M4LA 4KVXA 4DJLA 4P10A 4BMHA 5DWMA 2V8DA 3CZXA 1CE8B 3GJZA 3PGPA 3S6HA 1KBLA 1WVMA 5G22A 4MFJA 4Q36A 2GLJA 2Z3PA 4UEEA 3V38A 3D66A 4IAVA 4MHZA 2MP0A 3BI0A 3BUOB 2I79A 5AGEA 4ZY0A 3FJUA 4F0YA 5CBMA 2NSMA 1PU9A 4F6AA 1XF8A 4ZYQA 3SJXA 1VBHA 3PBBA 2EWBA 3IWWA 2PJBA 4H6UA 4ORFA 1IOIA 1P0HA 3F8KA 3TE4A 2R8VA 4JZ0A 5H84A 3B35A 3ICUA 1NSLA 3I6SA 2PJAA 4B6ZA 4X8IA 2PSWA 2AFUA 2O53A 2EUIA 4K30A 4KUAA 2E28A 4KOSA 5J8FA 2AFOA 2RFHA 1RXTA 2JEVA 3SI0A 4MJXA 3ISZA 1YVKA 4B10A 2ZEPA 1YK3A 4BPXB 3TT2A 2Z3NA 2DF5A 5EMIA 3TC8A 4A38A 4P4JA 1PCAA 4C2YA 1BPMA 2OH1A 1Q2YA 3PFOA 4MHYA 3VGOA 2VXKA 3IWGA 4X5KA 2OZGA 3R9GA 2B0AA 4NGTA 1H8LA 1EZAA 1PYTB 2GP4A 3R96A 3D7FA 2AE6A 3PB7X 2CF4A 2FS5A 4NCZA 4OADA 1B47A 4X3RA 2C5QA 4ZBGA 3OAKA 2EZCA 2K5TA 4QB9A 3JUWA 4KOUA 3WC7A 1KEEB 3KR4A 4CAXA 1IB1E 1JDEA 1Y0RA 2ZEEA 4YU9A 4AXVA 5A27A 3EZBA 4AG9A 2JDDA 2P6EA 2KCWA 3PFEA 4H2KA 7CPAA 4A32A 1CBXA 1LFWA 3RAMA 3TOAA 4CAWA 4XPDB 1L0CA 5JYBA 2BOAA 2DPTA 2Q43A 3IGRA 5DWNA 4A95A 2GIVA 4P4DA 4HPSA 1S7LA 3EY5A 4CGOA 4KOXA 3IJ3A 1TF8A
chains in the Genus database with same CATH topology
2AFWA 3TX8A 1NSAA 1R3NA 3CPXA 5HVGA 4R7MA 2V8HA 8CPAA 3KQXA 4NGPA 2Q4ZA 1AMPA 1HDUA 1GYTA 2EK8A 3KL9A 1XJOA 4P4IA 2ZEDA 3KGQA 2C1CA 4C84A 3LMSA 4P44A 2ANPA 5HXDA 3CPAA 4UEZA 4FBEA 2ZENA 4R8FA 5K8PA 4F8ZA 4OC2A 3DLJA 4CDJA 2PJ0A 2XEFA 3BHXA 2CTBA 4C9AA 2DEAA 3NA6A 4OIDA 2VL1A 2CIJA 2BCOA 4OC4A 2ZOGA 4MCSA 2C6GA 1TKHA 3B7IA 3D4UA 4WWVA 5CPAA 2OR4A 3K9TA 3B3VA 3I74A 5THWA 4NGNA 2PJ2A 2AFSA 2O4HA 1V6CA 1ELLP 4YN3A 3VATA 3L2NA 5K8OA 3KHZA 4IK2A 5LRKA 4ZY1A 2F8HA 4C8UA 5I4MA 2PJCA 1CP6A 2RB7A 1ZLHA 5LRJA 4FUUA 4C9UA 3VTAA 2IJZA 4NFRA 1ARLA 3IC1A 2PJ3A 3NH4A 3H8GA 3BXMA 3CT9A 1VIXA 1XMBA 4OC0A 2EK9A 1CX8A 3DGVA 3FEEA 3I1UA 1ZG8A 3JRUA 4OKOA 2PVWA 4PXCA 5IR2A 3NFZA 2C6CA 4A94A 2AFXA 4PPZA 1IGBA 4P4FA 1HEEA 2F7VA 3D67A 1XBUA 4K3NA 3HLPA 2QVPA 4C86A 3MN8A 4FWUA 2JBJA 1RTQA 4TJVA 5LRGA 2PE3A 3N5FA 5JGFA 2ZOFA 3IIBA 4ZY2A 5JH9A 2ZEHA 4LQGA 3V7ZA 1F2OA 2J9AA 4CPAA 4KNGE 3WABA 1Y7EA 1UWYA 2BO9A 2IQ6A 3FECA 1LCPA 2PJ5A 3QNVA 4NJRA 2Q51A 3NH5A 4O23A 4C9VA 4R76A 4CDKA 1YW4A 4WJBA 6CPAA 1XF1A 4MHPA 4YWYA 4C8AA 3KI9A 1QMUA 3MRUA 3SJEA 3WC5A 2QJ8A 3HUVA 2PJ6A 3D7DA 3B3TA 4P6YA 2G9DA 5HVHA 2ZEOA 4X2TA 5K8MA 1ZG9A 4C9EA 4NGQA 5K8NA 1OBRA 2JBKA 4PQAA 4IHMA 3IEHA 5D29A 5J1QA 4C8PA 4NGSA 1ZLIA 3FMCA 3S9NA 5LYFA 1AYEA 4TWEA 2ZEFA 4UIBA 5LYLA 2POKA 4A39A 4BD9A 4NGRA 1F57A 3FH4A 1BLLE 2V8VA 4ZX9A 3S9MA 1Q7LA 2JEWA 2WYRA 3SJFA 3GUXA 2AFMA 4UIAA 1EE3P 4PXBA 3SI2A 4DUKA 1TF9A 4UF4A 3SJGA 2PRQA 3KHXA 4OC3A 4OP4A 3D68A 3T8WA 2XEJA 1TKFA 1FNOA 3PB9X 4MCRA 4DYOA 1YSJA 3PB4X 4MXUA 3FEDA 2XEGA 4P45A 4OIWA 2PJ4A 1TKJA 1LANA 2QYVA 5LYDA 3KQZA 4GM5A 1IY7A 2PJ7A 4ZI6A 1ZG7A 5HVFA 1Z2LA 4W9YA 2HC9A 1XFOA 4NGMA 4C99A 4F9VA 3WC6A 2AFZA 4C8CA 3LWUA 4UEFA 3D7HA 1CP7A 1Y0YA 5F09A 4Q7AA 1BAVA 5JM6A 4NJQA 4C9RA 2IMOA 3PEIA 5ELYA 2CTCA 1CPSA 1YW6A 1BPNA 4JYWA 4ONWA 2ZELA 3H8EA 3RZAA 3SI1A 2PVVA 4C8FA 2C6PA 3FF3A 1YLOA 2PIZA 4P4EA 4R6TA 3WT4A 5IB9A 5D8NA 3CDXA 2HB6A 3B3SA 3PRTA 4FAIA 1ELMP 3B2YA 1HDQA 2I3CA 2ZEMA 1YMEA 3EIFA 4MMOA 1XRYA 2WZNA 2PJ1A 5DS0A 1ARMA 1VGYA 2ABZA 2V8GA 4PXEA 3ISXA 3KR5A 4MHNA 2OOTA 2GREA 3D7GA 4EMEA 4MCQA 1VHEA 3NH8A 4Z65A 2ZEGA 4A37A 3KASA 2PJ9A 2PCUA 2V77A 4PXDA 3H8FA 1JQGA 3IFEA 3IO1A 2GU2A 1VHOA 2XEIA 2PJ8A 1DE4C 4EWTA 3GLJA 1KWMA 1CPXA 4MCPA 2NYQA 4ZX8A 2FVGA 3BI1A 4F9UA 4C8TA 1Z8LA 1LAPA 1LAMA 3PBEA 3K2KA 4OC5A 2PIYA 1QQ9A 3PB6X 1Y9ZA 3FX6A 3B3CA 4KSIA 3RBUA 1F2PA 3VH9A 1R43A 3VARA 4C85A 4P4BA 3KZWA 1TXRA 4TNUA 5LYIA 4RUHA 3PB8X 2GLFA 4TJXA 3B3WA 4OMEA 4MRIA 1FT7A 4OC1A 1CG2A 3S9LA 1LOKA 4EFDA 3FVLA 4G1PA 3GB0A 1Z5RA 1DTDA 1M4LA 4DJLA 4P10A 2V8DA 1WVMA 2GLJA 4UEEA 3V38A 3D66A 4IAVA 4MHZA 3BI0A 4ZY0A 3FJUA 5CBMA 2NSMA 4ZYQA 3SJXA 3PBBA 2EWBA 3IWWA 2PJBA 4JZ0A 3ICUA 3B35A 3I6SA 2PJAA 4B6ZA 4X8IA 2AFUA 2O53A 2AFOA 2RFHA 3SI0A 3ISZA 2ZEPA 3TC8A 4A38A 4P4JA 1PCAA 1BPMA 3PFOA 4MHYA 4NGTA 1H8LA 2GP4A 1PYTB 3D7FA 3PB7X 2CF4A 4X3RA 2C5QA 3WC7A 3KR4A 1Y0RA 2ZEEA 4YU9A 4AXVA 3PFEA 4H2KA 7CPAA 1CBXA 1LFWA 3RAMA 2BOAA 2Q43A 4P4DA 3IJ3A 1TF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFW A;  3TX8 A;  1NSA A;  1R3N A;  3CPX A;  5HVG A;  4R7M A;  2V8H A;  8CPA A;  3KQX A;  4NGP A;  2Q4Z A;  1AMP A;  1HDU A;  1GYT A;  2EK8 A;  3KL9 A;  1XJO A;  4P4I A;  2ZED A;  3KGQ A;  2C1C A;  4C84 A;  3LMS A;  4P44 A;  2ANP A;  5HXD A;  3CPA A;  4UEZ A;  4FBE A;  2ZEN A;  4R8F A;  5K8P A;  4F8Z A;  4OC2 A;  3DLJ A;  4CDJ A;  2PJ0 A;  2XEF A;  3BHX A;  2CTB A;  4C9A A;  2DEA A;  3NA6 A;  4OID A;  2VL1 A;  2CIJ A;  2BCO A;  4OC4 A;  2ZOG A;  4MCS A;  2C6G A;  1TKH A;  3B7I A;  3D4U A;  4WWV A;  5CPA A;  2OR4 A;  3K9T A;  3B3V A;  3I74 A;  5THW A;  4NGN A;  2PJ2 A;  2AFS A;  2O4H A;  1V6C A;  1ELL P;  4YN3 A;  3VAT A;  3L2N A;  5K8O A;  3KHZ A;  4IK2 A;  5LRK A;  4ZY1 A;  2F8H A;  4C8U A;  5I4M A;  2PJC A;  1CP6 A;  2RB7 A;  1ZLH A;  5LRJ A;  4FUU A;  4C9U A;  3VTA A;  2IJZ A;  4NFR A;  1ARL A;  3IC1 A;  2PJ3 A;  3NH4 A;  3H8G A;  3BXM A;  3CT9 A;  1VIX A;  1XMB A;  4OC0 A;  2EK9 A;  1CX8 A;  3DGV A;  3FEE A;  3I1U A;  1ZG8 A;  3JRU A;  4OKO A;  2PVW A;  4PXC A;  3NFZ A;  2C6C A;  4A94 A;  2AFX A;  4PPZ A;  1IGB A;  4P4F A;  1HEE A;  2F7V A;  3D67 A;  1XBU A;  4K3N A;  3HLP A;  2QVP A;  4C86 A;  3MN8 A;  4FWU A;  2JBJ A;  1RTQ A;  4TJV A;  5LRG A;  2PE3 A;  3N5F A;  5JGF A;  2ZOF A;  3IIB A;  4ZY2 A;  5JH9 A;  2ZEH A;  4LQG A;  3V7Z A;  1F2O A;  2J9A A;  4CPA A;  4KNG E;  3WAB A;  1Y7E A;  1UWY A;  2BO9 A;  2IQ6 A;  3FEC A;  1LCP A;  2PJ5 A;  3QNV A;  4NJR A;  2Q51 A;  3NH5 A;  4O23 A;  4C9V A;  4R76 A;  4CDK A;  1YW4 A;  4WJB A;  6CPA A;  1XF1 A;  4MHP A;  4YWY A;  4C8A A;  3KI9 A;  1QMU A;  3MRU A;  3SJE A;  3WC5 A;  2QJ8 A;  3HUV A;  2PJ6 A;  3D7D A;  3B3T A;  4P6Y A;  2G9D A;  5HVH A;  2ZEO A;  4X2T A;  5K8M A;  1ZG9 A;  4C9E A;  4NGQ A;  5K8N A;  1OBR A;  2JBK A;  4PQA A;  4IHM A;  3IEH A;  5D29 A;  5J1Q A;  4C8P A;  4NGS A;  1ZLI A;  3FMC A;  3S9N A;  5LYF A;  1AYE A;  4TWE A;  2ZEF A;  4UIB A;  5LYL A;  2POK A;  4A39 A;  4BD9 A;  4NGR A;  1F57 A;  3FH4 A;  1BLL E;  2V8V A;  4ZX9 A;  3S9M A;  1Q7L A;  2JEW A;  2WYR A;  3SJF A;  3GUX A;  2AFM A;  4UIA A;  1EE3 P;  4PXB A;  3SI2 A;  4DUK A;  1TF9 A;  4UF4 A;  3SJG A;  2PRQ A;  3KHX A;  4OC3 A;  4OP4 A;  3D68 A;  3T8W A;  2XEJ A;  1TKF A;  1FNO A;  3PB9 X;  4MCR A;  4DYO A;  1YSJ A;  3PB4 X;  4MXU A;  3FED A;  2XEG A;  4P45 A;  4OIW A;  2PJ4 A;  1TKJ A;  1LAN A;  2QYV A;  5LYD A;  3KQZ A;  4GM5 A;  1IY7 A;  2PJ7 A;  4ZI6 A;  1ZG7 A;  5HVF A;  1Z2L A;  4W9Y A;  2HC9 A;  1XFO A;  4NGM A;  4C99 A;  4F9V A;  3WC6 A;  2AFZ A;  4C8C A;  3LWU A;  4UEF A;  3D7H A;  1CP7 A;  1Y0Y A;  5F09 A;  4Q7A A;  1BAV A;  5JM6 A;  4NJQ A;  4C9R A;  2IMO A;  3PEI A;  5ELY A;  2CTC A;  1CPS A;  1YW6 A;  1BPN A;  4JYW A;  4ONW A;  2ZEL A;  3H8E A;  3RZA A;  3SI1 A;  2PVV A;  4C8F A;  2C6P A;  3FF3 A;  1YLO A;  2PIZ A;  4P4E A;  4R6T A;  3WT4 A;  5IB9 A;  5D8N A;  3CDX A;  2HB6 A;  3B3S A;  3PRT A;  4FAI A;  1ELM P;  3B2Y A;  1HDQ A;  2I3C A;  2ZEM A;  1YME A;  3EIF A;  4MMO A;  1XRY A;  2WZN A;  2PJ1 A;  5DS0 A;  1ARM A;  1VGY A;  2ABZ A;  2V8G A;  4PXE A;  3ISX A;  3KR5 A;  4MHN A;  2OOT A;  2GRE A;  3D7G A;  4EME A;  4MCQ A;  1VHE A;  3NH8 A;  4Z65 A;  2ZEG A;  4A37 A;  3KAS A;  2PJ9 A;  2PCU A;  2V77 A;  4PXD A;  3H8F A;  1JQG A;  3IFE A;  3IO1 A;  2GU2 A;  1VHO A;  2XEI A;  2PJ8 A;  1DE4 C;  4EWT A;  3GLJ A;  1KWM A;  1CPX A;  4MCP A;  2NYQ A;  4ZX8 A;  2FVG A;  3BI1 A;  4F9U A;  4C8T A;  1Z8L A;  1LAP A;  1LAM A;  3PBE A;  3K2K A;  4OC5 A;  2PIY A;  1QQ9 A;  3PB6 X;  1Y9Z A;  3FX6 A;  3B3C A;  4KSI A;  3RBU A;  1F2P A;  3VH9 A;  1R43 A;  3VAR A;  4C85 A;  4P4B A;  3KZW A;  1TXR A;  4TNU A;  5LYI A;  4RUH A;  3PB8 X;  2GLF A;  4TJX A;  3B3W A;  4OME A;  4MRI A;  1FT7 A;  4OC1 A;  1CG2 A;  3S9L A;  1LOK A;  4EFD A;  3FVL A;  4G1P A;  3GB0 A;  1Z5R A;  1DTD A;  1M4L A;  4DJL A;  4P10 A;  2V8D A;  1WVM A;  2GLJ A;  4UEE A;  3V38 A;  3D66 A;  4IAV A;  4MHZ A;  3BI0 A;  4ZY0 A;  3FJU A;  5CBM A;  2NSM A;  4ZYQ A;  3SJX A;  3PBB A;  2EWB A;  3IWW A;  2PJB A;  4JZ0 A;  3ICU A;  3B35 A;  3I6S A;  2PJA A;  4B6Z A;  4X8I A;  2AFU A;  2O53 A;  2AFO A;  2RFH A;  3SI0 A;  3ISZ A;  2ZEP A;  3TC8 A;  4A38 A;  4P4J A;  1PCA A;  1BPM A;  3PFO A;  4MHY A;  4NGT A;  1H8L A;  1PYT B;  3D7F A;  3PB7 X;  2CF4 A;  4X3R A;  3WC7 A;  3KR4 A;  1Y0R A;  2ZEE A;  4YU9 A;  4AXV A;  3PFE A;  4H2K A;  7CPA A;  1CBX A;  1LFW A;  3RAM A;  2BOA A;  2Q43 A;  4P4D A;  3IJ3 A;  1TF8 A; 
#chains in the Genus database with same CATH topology
 2ZPA A;  3TLZ A;  3VRN A;  2AFW A;  2XPP A;  1NSA A;  1R3N A;  3TX8 A;  4PSX A;  2QIR A;  3CPX A;  2DPS A;  3DNS A;  5H86 A;  3O8Z A;  1X10 A;  5HVG A;  4R7M A;  5JVL A;  3DR6 A;  3BUW B;  4KLW A;  5I0C A;  2V8H A;  8CPA A;  4J3G A;  2Y1N A;  3KQX A;  4MI1 A;  4NGP A;  2Q4Z A;  4H6Z A;  3TFY A;  1EO0 A;  4E94 A;  2B4J C;  1AMP A;  1HDU A;  2VBQ A;  1GYT A;  3FBU A;  4M6H A;  2EK8 A;  3KL9 A;  2WPX A;  3SR3 A;  1XJO A;  3CXS A;  4P4I A;  4HKF A;  3R95 A;  4Q38 A;  4KVM E;  3S6K A;  4IIY A;  4QBJ A;  2ZED A;  3KGQ A;  3VRO A;  4B12 A;  2AUN A;  4A4B A;  2C1C A;  4MY3 A;  2AJ6 A;  4UCN A;  5BWA B;  3N7Z A;  4C84 A;  3HMJ G;  3LMS A;  4RI1 A;  4P44 A;  4Y49 C;  2ANP A;  2YJV A;  5HXD A;  3CPA A;  2C27 A;  4KLV A;  2FM4 A;  3TTH A;  2BL1 A;  1DIK A;  2VZZ A;  4UEZ A;  1ZO0 A;  3DR8 A;  4FBE A;  3U88 C;  2ZEN A;  4M85 A;  3OB2 B;  4R8F A;  5K8P A;  2P6F A;  4F8Z A;  1S7K A;  5J3X A;  1LRZ A;  4OC2 A;  4UWI A;  5C88 A;  2ZW6 A;  1M1D A;  3DLJ A;  1OZP A;  4CDJ A;  1TIQ A;  5IV0 A;  4C2Z A;  2PJ0 A;  2XEF A;  3BHX A;  3HPG G;  2CTB A;  3E0K A;  2DEA A;  3NA6 A;  4OID A;  2VL1 A;  1Q5X A;  1BO4 A;  2CIJ A;  2BCO A;  2VEZ A;  2WPW A;  1ZRS A;  1KUV A;  4FD6 A;  4OC4 A;  5F9M A;  2ZOG A;  4ONU A;  4MCS A;  2C6G A;  1N71 A;  4HNY B;  2OLS A;  1TKH A;  4NF1 A;  1UFH A;  3C26 A;  1J4J A;  4KSF A;  4QC6 A;  3B7I A;  3D4U A;  1Q2D A;  4WWV A;  1YVH A;  1J3L A;  3A9L A;  4HNW B;  5CPA A;  2OR4 A;  3ZZI A;  3K9T A;  4JVO A;  3B3V A;  3I74 A;  5THW A;  3F9K C;  4NGN A;  2FE7 A;  2OB0 A;  2PJ2 A;  2ARH A;  2EZB A;  1PUA A;  2AFS A;  4KSA A;  2O4H A;  1V6C A;  4C7I A;  1ELL P;  1M4G A;  2G0B A;  3BJ7 A;  1X12 A;  4YN3 A;  3G23 A;  1IIC A;  3VAT A;  4M6I A;  3L2N A;  5K8O A;  2Z3O A;  3G8W A;  3KHZ A;  1M44 A;  2B3U A;  4IK2 A;  2G3T A;  4OLL A;  3T9Y A;  5AXI A;  5LRK A;  4II9 A;  3IU2 A;  4JXQ A;  2XPL A;  4ZY1 A;  1IOF A;  2F8H A;  4C8U A;  4FD7 A;  3F0A A;  3FRM A;  2H5M A;  5G1Z A;  5G21 A;  5I4M A;  1A2Z A;  4FD4 A;  1Y9K A;  2PJC A;  3ZNI A;  1M4D A;  2A4N A;  3TO6 A;  1JWQ A;  1CP6 A;  2RB7 A;  5AG7 A;  1ZLH A;  4A2Z A;  4M3S A;  1S60 A;  1YX0 A;  2JLM A;  5LRJ A;  1IID A;  4YRH A;  3LAC A;  4CGM A;  1XE4 A;  3BUX B;  1WK4 A;  4IUS A;  4FUU A;  4C9U A;  2REE A;  1B87 A;  4MFZ A;  3VTA A;  2Q4Y A;  4BPW B;  1BXR B;  2IJZ A;  1IYL A;  3GY9 A;  4HNX B;  2XPN A;  3NH4 A;  1ARL A;  2JDC A;  2PJ3 A;  4A4C A;  3H8G A;  3IC1 A;  3BXM A;  4NFR A;  4MY0 A;  4R3L A;  3TO9 A;  3SXO A;  4CGP A;  2HRO A;  2IL4 A;  4U9Y A;  4NEX A;  3OB1 B;  1YGH A;  2VQY A;  3CT9 A;  4KVO E;  1VIX A;  1GGO A;  4KUB A;  1YVO A;  1XMB A;  5IX3 A;  2PR1 A;  1I12 A;  4KOV A;  4OC0 A;  4GPL B;  3VRR A;  2EK9 A;  1CX8 A;  5CNP A;  3DGV A;  3FEE A;  4RS2 A;  4LQ6 A;  4CGN A;  4MFK A;  3I1U A;  1ZG8 A;  1IYK A;  3IWE A;  5J8C A;  3EZE A;  3JRU A;  4OKO A;  2PVW A;  2XPO A;  3VRQ A;  3G3S A;  4PXC A;  2Q7B A;  4MJ8 A;  5IR2 A;  3NFZ A;  2R1I A;  3P2H A;  5HH1 A;  2C6C A;  4A94 A;  2AFX A;  3SXN A;  5HKZ A;  1SQH A;  1IGB A;  4PPZ A;  4P4F A;  5JPH A;  2GE3 A;  2EVN A;  1A9X B;  2R7H A;  2EZA A;  4UA3 A;  4UFW A;  1HEE A;  2P6G A;  4XNH C;  3VRP A;  2F7V A;  3D67 A;  1XBU A;  4K3N A;  5HMN A;  2Q04 A;  3HLP A;  2QVP A;  5KTC A;  4C86 A;  3MN8 A;  3FNC A;  4CAV A;  4FWU A;  2JBJ A;  1XOV A;  1RTQ A;  2PRB A;  1VBG A;  4TJV A;  3P2F A;  5LRG A;  3TLY A;  4E5S A;  2B5G B;  2PE3 A;  2Q4V A;  3N5F A;  4MFQ A;  5JGF A;  5FD8 A;  2YGW A;  3JTK A;  2ZOF A;  3IIB A;  4ZY2 A;  5JH9 A;  2ZEH A;  4XPL A;  4LQG A;  2DLA A;  1M6V B;  2D0P A;  2CNM A;  1F2O A;  2J9A A;  3SHP A;  3V7Z A;  1I21 A;  2B3V A;  2VI7 A;  4CPA A;  4KZT A;  4BPU B;  2HUZ A;  2B4B A;  2B4D B;  1Y7E A;  3WAB A;  4KNG E;  4NXY A;  2DXQ A;  2ODF A;  2ZW7 A;  3EZA A;  1MJB A;  1UWY A;  4CO9 A;  2BO9 A;  4UCP A;  4JJX A;  2OZU A;  4JLY A;  2IQ6 A;  4GS4 A;  3D2P A;  3FEC A;  1LCP A;  2FCK A;  3W6X A;  2FT0 A;  2PJ5 A;  3DSB A;  3QNV A;  4NJR A;  4XPD C;  3PFV A;  4L89 A;  2BUE A;  2Q51 A;  3NH5 A;  4O23 A;  4C9A A;  4C9V A;  4R76 A;  2QML A;  3QB8 A;  4CDK A;  1YW4 A;  2J8M A;  1MK4 A;  4WJB A;  1B6B A;  1I1D A;  2Z11 A;  4A31 A;  5F5X A;  5K99 A;  6CPA A;  3H4Q A;  1XF1 A;  2YND A;  4MHP A;  4YWY A;  2D4O A;  4KS9 A;  3TLE A;  4C8A A;  3S6G A;  3PT1 A;  3FYN A;  1NMT A;  3KI9 A;  4F0X A;  1QMU A;  3MRU A;  3SJE A;  2I00 A;  4AVC A;  4ZGY B;  3WC5 A;  2QJ8 A;  3HUV A;  4MBU A;  2PJ6 A;  4JXR A;  3BUM B;  3TLA A;  4R87 A;  2B5G A;  3D7D A;  3B3T A;  4P6Y A;  2G9D A;  3BLN A;  5HVH A;  2ZEO A;  4X2T A;  3NFQ A;  5K8M A;  1ZG9 A;  4L8A A;  4C9E A;  4NGQ A;  1JDB C;  5K8N A;  4IF5 A;  1OBR A;  2JBK A;  1KUX A;  4IHM A;  4PQA A;  3IEH A;  4DNC A;  5D29 A;  4R57 A;  1EZB A;  3IU1 A;  5J1Q A;  3HPH E;  2Y1M A;  4NGS A;  4C8P A;  1ZLI A;  4MI4 A;  1Q2C A;  4CGL A;  3FMC A;  3S9N A;  3D2M A;  1AYE A;  4TWE A;  2ZEF A;  4QVT A;  4UIB A;  5LYF A;  5LYL A;  1WWZ A;  2HWG A;  3TLG A;  1RO5 A;  2POK A;  3GYA A;  3MGD A;  4A39 A;  4BD9 A;  3EFA A;  4LUA A;  4NGR A;  3PP9 A;  4MFL A;  1F57 A;  3FH4 A;  1BLL E;  2V8V A;  2VZY A;  5AG5 A;  1V0C A;  3ZJ0 A;  3CXP A;  4ZX9 A;  3S9M A;  1Q7L A;  2JEW A;  2QEC A;  2WYR A;  2Y0M A;  4COB A;  5ISV A;  4E8O A;  3SJF A;  4EYS A;  2NMT A;  4XNH B;  3GUX A;  2AFM A;  4UIA A;  1EE3 P;  4PXB A;  5IB0 A;  3BUN B;  2OZH A;  3SI2 A;  4DUK A;  1Y9W A;  1TF9 A;  4UF4 A;  3DDD A;  4PV6 A;  3SJG A;  4J0N A;  2PRQ A;  2R98 A;  3KHX A;  4OC3 A;  4R9M A;  3TLB A;  1FBV A;  4OP4 A;  5EC4 A;  3D68 A;  3VWD A;  3T8W A;  4B5P B;  2XEJ A;  4IIX A;  1CJW A;  1TKF A;  1FNO A;  5KTD A;  1AUG A;  3PB9 X;  4MCR A;  4UFX A;  4AG7 A;  4DYO A;  5A28 A;  1YSJ A;  3PB4 X;  4MXU A;  3FED A;  3V8I A;  2XEG A;  4P45 A;  1KUY A;  1M4I A;  2G3A A;  3QAH A;  4KOT A;  3UY5 A;  4CYQ A;  3OWC A;  4OIW A;  2PJ4 A;  1TKJ A;  4CAE A;  1LAN A;  2QYV A;  5LYD A;  3KQZ A;  1U6M A;  4A30 A;  3RO0 A;  3S6F A;  5C82 A;  1YLE A;  4GM5 A;  1IY7 A;  2PJ7 A;  4ZI6 A;  1MJ9 A;  2Z3K A;  1ZG7 A;  5HVF A;  1Z2L A;  3K4I A;  4W9Y A;  1YRE A;  2GAN A;  2HC9 A;  2R82 A;  1XFO A;  4NGM A;  1Z4R A;  4QUS A;  5FVJ A;  4C99 A;  4PK3 A;  2F5I A;  1Z8T A;  5GCN A;  3EC4 A;  4F9V A;  2HI6 A;  4I49 A;  4CAF A;  5EBV A;  3WC6 A;  4CZ1 A;  2EBJ A;  1S7F A;  3NE8 A;  2AFZ A;  1XIX A;  4CYN A;  4C8C A;  5F13 A;  3LWU A;  5HKW A;  4E0A A;  4COG A;  4M8D A;  4UEF A;  2D0O A;  5F46 A;  3D7H A;  3JVN A;  4RN7 A;  1CP7 A;  1T36 B;  1Y0Y A;  5F09 A;  2WSA A;  1R57 A;  2ZXV A;  4U5Y A;  4Q7A A;  3TLC A;  2Z3L A;  4B5P A;  3R9E A;  1BAV A;  3WR7 A;  2Z10 A;  5JM6 A;  4NJQ A;  4C68 A;  3LD2 A;  4C9R A;  2IMO A;  2REF A;  4BBH A;  1CS0 B;  1NXJ A;  4Y49 B;  5G20 A;  3PEI A;  4E2A A;  3EO4 A;  2CXA A;  2FSR A;  2Z3M A;  1S7N A;  3R1K A;  5ELY A;  2CTC A;  1VI4 A;  1KC7 A;  1CPS A;  1YW6 A;  1ZYM A;  2VKZ G;  2B58 A;  4CYP A;  2D4P A;  1BPN A;  1VHS A;  4JYW A;  4ONW A;  1XEB A;  1C30 B;  5HKY A;  2ZEL A;  4R3K A;  3KRV A;  3T90 A;  3F5B A;  5F47 A;  1P4N A;  2HQY A;  2J8R A;  3H8E A;  3RZA A;  3SI1 A;  2PVV A;  4JWP A;  2C6P A;  4C8F A;  3FF3 A;  1YLO A;  4EVY A;  2ZW5 A;  2CNT A;  5AG6 A;  2FXF A;  4FD5 A;  2PIZ A;  4P4E A;  4R6T A;  3WT4 A;  5IB9 A;  3W6S A;  3W91 A;  4H89 A;  2EO8 A;  2J8N A;  5D8N A;  3CDX A;  2HB6 A;  3B3S A;  3PRT A;  3BJ8 A;  2O28 A;  4FAI A;  5KTA A;  3T5M A;  2P0W A;  2WUU A;  1ELM P;  4M6G A;  4OAE A;  5E96 A;  3GIU A;  3B2Y A;  1HDQ A;  2ATR A;  1S5K A;  1QST A;  1YQE A;  2I3C A;  2ZEM A;  1VKC A;  3TO7 A;  1Y7R A;  1YME A;  4MMO A;  3EIF A;  4UFV A;  1XRY A;  2WZN A;  4GXH A;  4B13 A;  3B8G A;  3I9S A;  2PJ1 A;  5DS0 A;  1ARM A;  1VGY A;  2ABZ A;  4LX9 A;  2V8G A;  4PXE A;  3ISX A;  4NSQ A;  3VWE A;  2X0S A;  3KR5 A;  1KZF A;  4MHN A;  2Q44 A;  2OOT A;  2ZW4 A;  3TYX A;  4YFJ A;  2GRE A;  1C3O B;  3D7G A;  4EME A;  2BEI A;  5F1Y A;  3LOD A;  5F48 A;  3PZJ A;  3OP0 A;  4CRY B;  4MCQ A;  3FB3 A;  1GHE A;  3TLG B;  4CS0 B;  1VHE A;  2FIW A;  3NH8 A;  4Z65 A;  1QSO A;  2ZEG A;  2OU2 A;  3U1B A;  5JQ4 A;  4A37 A;  3KAS A;  3NOJ A;  4RR2 B;  2PJ9 A;  3K9U A;  3RYO A;  4MHD A;  1NBW A;  2Z0Z A;  4KOW A;  1MJA A;  2PCU A;  2V77 A;  1FY7 A;  1Z9U A;  4JD6 A;  3H8F A;  1JQG A;  4PXD A;  3IFE A;  3IO1 A;  4UCM A;  3GKR A;  1ZL0 A;  2GU2 A;  4PSW A;  1VHO A;  1YR0 A;  5BY0 A;  2X7B A;  2CY2 A;  4AB7 A;  2B4D A;  2XEI A;  2PJ8 A;  1DE4 C;  4C7H A;  4EWT A;  3GLJ A;  1K4J A;  1R61 A;  1KWM A;  2PR8 A;  1CPX A;  2FIA A;  3H5Z A;  4MCP A;  2NYQ A;  3I3G A;  4ZX8 A;  3R9F A;  1Z8X A;  2YNC C;  2PQ8 A;  2FVG A;  2N3A B;  4A33 A;  2AUM A;  4KOR A;  3TCV A;  3BI1 A;  4F9U A;  2CBL A;  4C8T A;  3CXQ A;  1CM0 A;  1Z8L A;  3RNZ A;  3T0T A;  1LAP A;  1LAM A;  3PBE A;  3K2K A;  4OC5 A;  2PIY A;  3FIX A;  2Q7S A;  4AVB A;  1XMT A;  4BIN A;  1QQ9 A;  4CYO A;  3T07 A;  2PCN A;  3PB6 X;  1Z8W A;  3T05 A;  1Y9Z A;  3FX6 A;  1QSN A;  1WJT A;  3B3C A;  4KSI A;  2BSW A;  3RBU A;  3D8P A;  1F2P A;  3VH9 A;  2UV8 G;  2HV2 A;  1R43 A;  2Q0Y A;  1BOB A;  2CNS A;  4MFP A;  3VAR A;  2RC4 A;  4B11 A;  3KKW A;  3EXN A;  4H1H A;  4C85 A;  4P4B A;  3KZW A;  5AG4 A;  4B5O A;  1TXR A;  4TNU A;  5LYI A;  4RUH A;  4BTF A;  4INJ A;  3D3S A;  3PLF B;  3NE7 A;  3PB8 X;  1S3Z A;  4U9Z A;  1ON0 A;  2YNC A;  2GLF A;  4CRZ B;  2PC1 A;  4TJX A;  1QSM A;  3B3W A;  4C2X A;  1Z4E A;  4B14 A;  4OME A;  4MRI A;  1FT7 A;  3FXT A;  4OC1 A;  1QSR A;  4KOY A;  4UBR A;  4UWJ A;  2DIK A;  1CG2 A;  2PDO A;  3QAY A;  3S9L A;  1LOK A;  5F49 A;  4AVA A;  2FL4 A;  2YNE A;  3FVL A;  4EFD A;  2GFQ A;  4G1P A;  3GB0 A;  1Z5R A;  4PK2 A;  4XPK A;  1NE9 A;  1Z9E A;  1DTD A;  3TOB A;  2YJT A;  4YGO A;  3C8O A;  1IU8 A;  1M4L A;  4KVX A;  4DJL A;  4P10 A;  4BMH A;  5DWM A;  2V8D A;  3CZX A;  1CE8 B;  3GJZ A;  3PGP A;  3S6H A;  1KBL A;  1WVM A;  5G22 A;  4MFJ A;  4Q36 A;  2GLJ A;  2Z3P A;  4UEE A;  3V38 A;  3D66 A;  4IAV A;  4MHZ A;  2MP0 A;  3BI0 A;  3BUO B;  2I79 A;  5AGE A;  4ZY0 A;  3FJU A;  4F0Y A;  5CBM A;  2NSM A;  1PU9 A;  4F6A A;  1XF8 A;  4ZYQ A;  3SJX A;  1VBH A;  3PBB A;  2EWB A;  3IWW A;  2PJB A;  4H6U A;  4ORF A;  1IOI A;  1P0H A;  3F8K A;  3TE4 A;  2R8V A;  4JZ0 A;  5H84 A;  3B35 A;  3ICU A;  1NSL A;  3I6S A;  2PJA A;  4B6Z A;  4X8I A;  2PSW A;  2AFU A;  2O53 A;  2EUI A;  4K30 A;  4KUA A;  2E28 A;  4KOS A;  5J8F A;  2AFO A;  2RFH A;  1RXT A;  2JEV A;  3SI0 A;  4MJX A;  3ISZ A;  1YVK A;  4B10 A;  2ZEP A;  1YK3 A;  4BPX B;  3TT2 A;  2Z3N A;  2DF5 A;  5EMI A;  3TC8 A;  4A38 A;  4P4J A;  1PCA A;  4C2Y A;  1BPM A;  2OH1 A;  1Q2Y A;  3PFO A;  4MHY A;  3VGO A;  2VXK A;  3IWG A;  4X5K A;  2OZG A;  3R9G A;  2B0A A;  4NGT A;  1H8L A;  1EZA A;  1PYT B;  2GP4 A;  3R96 A;  3D7F A;  2AE6 A;  3PB7 X;  2CF4 A;  2FS5 A;  4NCZ A;  4OAD A;  1B47 A;  4X3R A;  2C5Q A;  4ZBG A;  3OAK A;  2EZC A;  2K5T A;  4QB9 A;  3JUW A;  4KOU A;  3WC7 A;  1KEE B;  3KR4 A;  4CAX A;  1IB1 E;  1JDE A;  1Y0R A;  2ZEE A;  4YU9 A;  4AXV A;  5A27 A;  3EZB A;  4AG9 A;  2JDD A;  2P6E A;  2KCW A;  3PFE A;  4H2K A;  7CPA A;  4A32 A;  1CBX A;  1LFW A;  3RAM A;  3TOA A;  4CAW A;  4XPD B;  1L0C A;  5JYB A;  2BOA A;  2DPT A;  2Q43 A;  3IGR A;  5DWN A;  4A95 A;  2GIV A;  4P4D A;  4HPS A;  1S7L A;  3EY5 A;  4CGO A;  4KOX A;  3IJ3 A;  1TF8 A; 
#chains in the Genus database with same CATH homology
 2AFW A;  3TX8 A;  1NSA A;  1R3N A;  3CPX A;  5HVG A;  4R7M A;  2V8H A;  8CPA A;  3KQX A;  4NGP A;  2Q4Z A;  1AMP A;  1HDU A;  1GYT A;  2EK8 A;  3KL9 A;  1XJO A;  4P4I A;  2ZED A;  3KGQ A;  2C1C A;  4C84 A;  3LMS A;  4P44 A;  2ANP A;  5HXD A;  3CPA A;  4UEZ A;  4FBE A;  2ZEN A;  4R8F A;  5K8P A;  4F8Z A;  4OC2 A;  3DLJ A;  4CDJ A;  2PJ0 A;  2XEF A;  3BHX A;  2CTB A;  4C9A A;  2DEA A;  3NA6 A;  4OID A;  2VL1 A;  2CIJ A;  2BCO A;  4OC4 A;  2ZOG A;  4MCS A;  2C6G A;  1TKH A;  3B7I A;  3D4U A;  4WWV A;  5CPA A;  2OR4 A;  3K9T A;  3B3V A;  3I74 A;  5THW A;  4NGN A;  2PJ2 A;  2AFS A;  2O4H A;  1V6C A;  1ELL P;  4YN3 A;  3VAT A;  3L2N A;  5K8O A;  3KHZ A;  4IK2 A;  5LRK A;  4ZY1 A;  2F8H A;  4C8U A;  5I4M A;  2PJC A;  1CP6 A;  2RB7 A;  1ZLH A;  5LRJ A;  4FUU A;  4C9U A;  3VTA A;  2IJZ A;  4NFR A;  1ARL A;  3IC1 A;  2PJ3 A;  3NH4 A;  3H8G A;  3BXM A;  3CT9 A;  1VIX A;  1XMB A;  4OC0 A;  2EK9 A;  1CX8 A;  3DGV A;  3FEE A;  3I1U A;  1ZG8 A;  3JRU A;  4OKO A;  2PVW A;  4PXC A;  5IR2 A;  3NFZ A;  2C6C A;  4A94 A;  2AFX A;  4PPZ A;  1IGB A;  4P4F A;  1HEE A;  2F7V A;  3D67 A;  1XBU A;  4K3N A;  3HLP A;  2QVP A;  4C86 A;  3MN8 A;  4FWU A;  2JBJ A;  1RTQ A;  4TJV A;  5LRG A;  2PE3 A;  3N5F A;  5JGF A;  2ZOF A;  3IIB A;  4ZY2 A;  5JH9 A;  2ZEH A;  4LQG A;  3V7Z A;  1F2O A;  2J9A A;  4CPA A;  4KNG E;  3WAB A;  1Y7E A;  1UWY A;  2BO9 A;  2IQ6 A;  3FEC A;  1LCP A;  2PJ5 A;  3QNV A;  4NJR A;  2Q51 A;  3NH5 A;  4O23 A;  4C9V A;  4R76 A;  4CDK A;  1YW4 A;  4WJB A;  6CPA A;  1XF1 A;  4MHP A;  4YWY A;  4C8A A;  3KI9 A;  1QMU A;  3MRU A;  3SJE A;  3WC5 A;  2QJ8 A;  3HUV A;  2PJ6 A;  3D7D A;  3B3T A;  4P6Y A;  2G9D A;  5HVH A;  2ZEO A;  4X2T A;  5K8M A;  1ZG9 A;  4C9E A;  4NGQ A;  5K8N A;  1OBR A;  2JBK A;  4PQA A;  4IHM A;  3IEH A;  5D29 A;  5J1Q A;  4C8P A;  4NGS A;  1ZLI A;  3FMC A;  3S9N A;  5LYF A;  1AYE A;  4TWE A;  2ZEF A;  4UIB A;  5LYL A;  2POK A;  4A39 A;  4BD9 A;  4NGR A;  1F57 A;  3FH4 A;  1BLL E;  2V8V A;  4ZX9 A;  3S9M A;  1Q7L A;  2JEW A;  2WYR A;  3SJF A;  3GUX A;  2AFM A;  4UIA A;  1EE3 P;  4PXB A;  3SI2 A;  4DUK A;  1TF9 A;  4UF4 A;  3SJG A;  2PRQ A;  3KHX A;  4OC3 A;  4OP4 A;  3D68 A;  3T8W A;  2XEJ A;  1TKF A;  1FNO A;  3PB9 X;  4MCR A;  4DYO A;  1YSJ A;  3PB4 X;  4MXU A;  3FED A;  2XEG A;  4P45 A;  4OIW A;  2PJ4 A;  1TKJ A;  1LAN A;  2QYV A;  5LYD A;  3KQZ A;  4GM5 A;  1IY7 A;  2PJ7 A;  4ZI6 A;  1ZG7 A;  5HVF A;  1Z2L A;  4W9Y A;  2HC9 A;  1XFO A;  4NGM A;  4C99 A;  4F9V A;  3WC6 A;  2AFZ A;  4C8C A;  3LWU A;  4UEF A;  3D7H A;  1CP7 A;  1Y0Y A;  5F09 A;  4Q7A A;  1BAV A;  5JM6 A;  4NJQ A;  4C9R A;  2IMO A;  3PEI A;  5ELY A;  2CTC A;  1CPS A;  1YW6 A;  1BPN A;  4JYW A;  4ONW A;  2ZEL A;  3H8E A;  3RZA A;  3SI1 A;  2PVV A;  4C8F A;  2C6P A;  3FF3 A;  1YLO A;  2PIZ A;  4P4E A;  4R6T A;  3WT4 A;  5IB9 A;  5D8N A;  3CDX A;  2HB6 A;  3B3S A;  3PRT A;  4FAI A;  1ELM P;  3B2Y A;  1HDQ A;  2I3C A;  2ZEM A;  1YME A;  3EIF A;  4MMO A;  1XRY A;  2WZN A;  2PJ1 A;  5DS0 A;  1ARM A;  1VGY A;  2ABZ A;  2V8G A;  4PXE A;  3ISX A;  3KR5 A;  4MHN A;  2OOT A;  2GRE A;  3D7G A;  4EME A;  4MCQ A;  1VHE A;  3NH8 A;  4Z65 A;  2ZEG A;  4A37 A;  3KAS A;  2PJ9 A;  2PCU A;  2V77 A;  4PXD A;  3H8F A;  1JQG A;  3IFE A;  3IO1 A;  2GU2 A;  1VHO A;  2XEI A;  2PJ8 A;  1DE4 C;  4EWT A;  3GLJ A;  1KWM A;  1CPX A;  4MCP A;  2NYQ A;  4ZX8 A;  2FVG A;  3BI1 A;  4F9U A;  4C8T A;  1Z8L A;  1LAP A;  1LAM A;  3PBE A;  3K2K A;  4OC5 A;  2PIY A;  1QQ9 A;  3PB6 X;  1Y9Z A;  3FX6 A;  3B3C A;  4KSI A;  3RBU A;  1F2P A;  3VH9 A;  1R43 A;  3VAR A;  4C85 A;  4P4B A;  3KZW A;  1TXR A;  4TNU A;  5LYI A;  4RUH A;  3PB8 X;  2GLF A;  4TJX A;  3B3W A;  4OME A;  4MRI A;  1FT7 A;  4OC1 A;  1CG2 A;  3S9L A;  1LOK A;  4EFD A;  3FVL A;  4G1P A;  3GB0 A;  1Z5R A;  1DTD A;  1M4L A;  4DJL A;  4P10 A;  2V8D A;  1WVM A;  2GLJ A;  4UEE A;  3V38 A;  3D66 A;  4IAV A;  4MHZ A;  3BI0 A;  4ZY0 A;  3FJU A;  5CBM A;  2NSM A;  4ZYQ A;  3SJX A;  3PBB A;  2EWB A;  3IWW A;  2PJB A;  4JZ0 A;  3ICU A;  3B35 A;  3I6S A;  2PJA A;  4B6Z A;  4X8I A;  2AFU A;  2O53 A;  2AFO A;  2RFH A;  3SI0 A;  3ISZ A;  2ZEP A;  3TC8 A;  4A38 A;  4P4J A;  1PCA A;  1BPM A;  3PFO A;  4MHY A;  4NGT A;  1H8L A;  2GP4 A;  1PYT B;  3D7F A;  3PB7 X;  2CF4 A;  4X3R A;  2C5Q A;  3WC7 A;  3KR4 A;  1Y0R A;  2ZEE A;  4YU9 A;  4AXV A;  3PFE A;  4H2K A;  7CPA A;  1CBX A;  1LFW A;  3RAM A;  2BOA A;  2Q43 A;  4P4D A;  3IJ3 A;  1TF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...