4OC5A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with chibzl, a urea-based inhibitor n~2~-{[(s)-carboxy(4-hydroxyphenyl)methyl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 260
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
260
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 260
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc5A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc5A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc5A02
1HDUA 2AFWA 5CPAA 2C1CA 4OC1A 3H8FA 3B2YA 4MCPA 1FT7A 2GLJA 4ONWA 4C9AA 5JGFA 4NJQA 4C8FA 1TKHA 2PJBA 4NGTA 5I4MA 1JQGA 2IJZA 3B3CA 4G1PA 1ZG7A 3DGVA 1ARLA 1VHOA 3HUVA 3PB6X 4EFDA 4C8AA 2PVVA 4OP4A 3S9MA 1Z8LA 2HC9A 5F09A 4F9VA 3PBBA 3SI1A 4ZY0A 4CDJA 3PBEA 3QNVA 2IQ6A 4NGMA 1UWYA 4F8ZA 4MCQA 1ZG9A 2V8HA 5LRKA 3KZWA 2QYVA 4H2KA 4TJVA 4KNGE 2O4HA 4P45A 1Y0RA 3KGQA 4ZI6A 2BOAA 5HVFA 4CDKA 4X8IA 1BAVA 1FNOA 5J1QA 1DTDA 3KASA 3RAMA 3D67A 4AXVA 5HXDA 2Q51A 1Q7LA 4C85A 3GB0A 3PRTA 4A38A 1IGBA 4TNUA 2QVPA 4OC5A 8CPAA 2PJ3A 3D7DA 3FEEA 3WC6A 3L2NA 3K2KA 3VH9A 2CF4A 3D7GA 2C6GA 4PPZA 4ZX8A 1PYTB 3CDXA 4C9EA 4OC2A 4WJBA 3GLJA 2PJ9A 2ANPA 2V8DA 5D8NA 4W9YA 3N5FA 2Q43A 1VHEA 2ZENA 4IHMA 1AMPA 3DLJA 4UIAA 1OBRA 2PJ5A 1CX8A 2BO9A 1ELLP 5K8MA 2ZEOA 3B35A 3IEHA 3SJXA 3B3TA 2HB6A 4PXDA 5LYIA 1F2OA 5THWA 7CPAA 4X3RA 4ZX9A 3KQXA 2F7VA 1ZG8A 4ZYQA 3LMSA 4MCRA 2WZNA 4PXBA 4OC3A 1H8LA 4NGRA 4RUHA 3NFZA 1DE4C 2XEJA 3B3SA 4MHZA 4P6YA 5D29A 5K8PA 3CT9A 2V77A 4PXEA 5JH9A 3D4UA 3PB7X 2CIJA 2PCUA 3FJUA 4R6TA 4OIWA 2RFHA 2GREA 3EIFA 2AFUA 2ABZA 3K9TA 3KL9A 4KSIA 4TJXA 2C6CA 3VTAA 3B7IA 4C86A 2JBKA 2ZEFA 3IO1A 5LRJA 2ZOFA 1LFWA 1Y9ZA 2PJ8A 4O23A 3KHZA 1ZLHA 3GUXA 4P10A 2ZEGA 5LYLA 3PFOA 3KQZA 3SI2A 2I3CA 3FMCA 2PJ6A 4FBEA 2ZEEA 4PXCA 1F2PA 1Y0YA 2EK9A 4R8FA 3S9LA 1VGYA 3ISZA 1BLLE 1EE3P 1ZLIA 1HEEA 3IFEA 4OC4A 3PFEA 3ICUA 4C9RA 4OMEA 3BXMA 1Z2LA 3WABA 3IIBA 3NH4A 1PCAA 4P4FA 3VATA 3TX8A 3RBUA 2NYQA 2PJAA 3MN8A 4FAIA 3D7HA 1WVMA 5JM6A 2GLFA 5LYFA 4C99A 4Q7AA 2JBJA 2CTCA 3D68A 3ISXA 3LWUA 4UEFA 2ZELA 4P4DA 1LAPA 1CP6A 4FUUA 5IB9A 3SJEA 2F8HA 1YW4A 3BI1A 1LANA 3VARA 4MMOA 2J9AA 3B3WA 4NGQA 2C6PA 2PJ7A 1CP7A 4TWEA 4NJRA 2PJCA 5K8NA 4F9UA 4P4JA 2JEWA 3PB8X 2BCOA 3MRUA 1YLOA 2AFMA 4ZY1A 2GU2A 4B6ZA 4EWTA 4PQAA 4K3NA 1IY7A 4NGNA 3PB9X 4JYWA 1CG2A 4P4EA 1QQ9A 3NA6A 2IMOA 1TF8A 3KR5A 1XMBA 3BI0A 2Q4ZA 4Z65A 2XEFA 1AYEA 4YU9A 5CBMA 4A39A 4C9VA 3FF3A 3IWWA 3S9NA 1BPNA 3WT4A 4YN3A 1XJOA 2WYRA 3H8GA 1LOKA 1M4LA 3D7FA 4A37A 4DUKA 3NH5A 2ZEDA 4YWYA 4WWVA 4MHNA 4FWUA 2AFOA 1CPXA 2AFXA 3KI9A 4A94A 3FECA 2VL1A 3T8WA 2PE3A 4GM5A 2ZEMA 1GYTA 2EWBA 3I74A 4MHYA 1R43A 4OC0A 1LCPA 3D66A 1XFOA 1TXRA 3KR4A 4X2TA 5LRGA 2PVWA 4R7MA 2XEIA 4P44A 5HVHA 3FEDA 4NGPA 4MRIA 1V6CA 1HDQA 3V7ZA 3CPAA 1RTQA 5DS0A 4NFRA 3I6SA 2OOTA 2ZEHA 3KHXA 4C84A 1TKFA 3PEIA 3IC1A 4EMEA 1YSJA 1TKJA 2DEAA 2PJ1A 2AFZA 4MHPA 3FH4A 4MXUA 5HVGA 1Y7EA 2G9DA 3HLPA 4C8CA 3H8EA 3FVLA 1TF9A 3JRUA 4ZY2A 1LAMA 3WC5A 4C8TA 4DJLA 2PJ0A 3FX6A 3I1UA 4P4BA 1CBXA 1Z5RA 4DYOA 4IAVA 2EK8A 3WC7A 5ELYA 4UF4A 3PB4X 3SJGA 2ZEPA 2PJ2A 4C8UA 3SI0A 2PIZA 4IK2A 3TC8A 1XF1A 1BPMA 2PJ4A 5LYDA 3NH8A 2NSMA 4R76A 4CPAA 2CTBA 1CPSA 1KWMA 2PIYA 4NGSA 1R3NA 4BD9A 4C8PA 1NSAA 1F57A 2ZOGA 4UEZA 4UEEA 4OIDA 3IJ3A 2FVGA 1VIXA 2XEGA 1ELMP 5K8OA 3RZAA 2POKA 2V8GA 2PRQA 2OR4A 3V38A 3SJFA 4JZ0A 4MCSA 2RB7A 3B3VA 2QJ8A 4OKOA 4LQGA 6CPAA 3BHXA 2O53A 1YW6A 1YMEA 2AFSA 4C9UA 4P4IA 2V8VA 1XBUA 3CPXA 4UIBA 1XRYA 1QMUA 1ARMA
chains in the Genus database with same CATH superfamily
1HDUA 2PC1A 1VBHA 2B5GA 2AFWA 2ZW4A 5CPAA 2C1CA 1FBVA 4J3GA 1Z8WA 1B6BA 3VRQA 2OZHA 2Z3KA 4HPSA 4OC1A 4NXYA 1CJWA 3H5ZA 3RYOA 3H8FA 1TIQA 1QSNA 1BXRB 2JDCA 3B2YA 4MCPA 4BINA 1FT7A 4UFXA 3VRPA 2A4NA 1JWQA 2GLJA 4ONWA 4C9AA 4GXHA 4HNYB 3VWEA 2AUNA 5JGFA 3JVNA 4NJQA 4XPDB 3U88C 4C8FA 1TKHA 2NMTA 2VKZG 2PJBA 4NGTA 3IU2A 1LRZA 5I4MA 1Y7RA 3TLCA 5HKYA 1Y9WA 4CAEA 2Q4VA 2REEA 3BLNA 1JQGA 2DPTA 2IJZA 3B3CA 4G1PA 4ONUA 3EXNA 4Q38A 5F46A 3P2FA 1ZG7A 3DGVA 1IICA 2P6FA 4KSAA 1ARLA 1V0CA 1VHOA 3HUVA 3PB6X 4EFDA 3IWGA 2Z3MA 2PVVA 1UFHA 4OP4A 2R98A 4RS2A 2XPNA 4A33A 3S9MA 1YK3A 4BBHA 5K99A 1Z8LA 4MFZA 1OZPA 2HC9A 4HKFA 5F09A 3PZJA 4F9VA 5AXIA 4NCZA 3PBBA 3SI1A 4ZY0A 5F9MA 4CDJA 5J8FA 4PSWA 2RC4A 1MJ9A 5AG7A 3PBEA 3QNVA 5JPHA 2IQ6A 3IU1A 4NGMA 1UWYA 3R9EA 4F8ZA 2Z3LA 4MCQA 1KEEB 2EZCA 1ZG9A 4EVYA 5HMNA 3TLBA 2V8HA 5LRKA 5HH1A 3T90A 2YNCC 1NMTA 2WPXA 3KZWA 2QYVA 4A30A 4H2KA 3W6SA 4KNGE 4TJVA 4UWIA 2XPPA 2EZAA 4AVBA 2O4HA 2OU2A 2BUEA 4JD6A 4P45A 1Y0RA 5H84A 3KGQA 1Q2DA 1VKCA 5G21A 4FD4A 4M6IA 2C27A 5G22A 3TLGB 4ZI6A 2BOAA 5HVFA 3SXOA 3R1KA 3DR8A 4CDKA 4DNCA 4CS0B 3I3GA 4X8IA 1BAVA 1FNOA 4KOXA 2JEVA 5J1QA 1DTDA 5IV0A 3EZEA 3QAHA 3KASA 3RAMA 4EYSA 3D67A 4AXVA 5HXDA 2Q51A 1Q7LA 3JTKA 4M8DA 3VROA 2VQYA 4UBRA 5HKZA 4C85A 3GB0A 3PRTA 4A38A 1IGBA 3OB1B 2GE3A 2Y0MA 2ZXVA 2QVPA 4L8AA 4TNUA 4OC5A 2P6GA 8CPAA 1M6VB 2PJ3A 3D7DA 1I1DA 2VEZA 3GYAA 2Q7BA 3TO9A 4C8AA 3I9SA 1NSLA 2YNCA 5KTAA 3ZJ0A 3FEEA 2B3UA 3WC6A 3L2NA 3K2KA 3VH9A 2PQ8A 3UY5A 4M3SA 2CF4A 3D2PA 3D7GA 3FIXA 1B87A 5F13A 2Z3OA 5F49A 3TO7A 2C6GA 2FXFA 4JXRA 4NSQA 4PPZA 4ZX8A 5IB0A 1YVKA 5EC4A 4CYQA 3TLEA 1PYTB 4GPLB 2Q44A 2VBQA 3OB2B 3CDXA 5EMIA 4OC2A 4WJBA 3RNZA 4C9EA 3GLJA 5J3XA 3TTHA 2PJ9A 2ANPA 2V8DA 3G23A 5D8NA 4L89A 4W9YA 3OAKA 3DNSA 3N5FA 2Q43A 1VHEA 2ZENA 5A28A 4IHMA 1AMPA 3IWEA 3DLJA 2PSWA 1M1DA 2X7BA 4UIAA 2YJTA 4B5PA 4JXQA 1OBRA 2PJ5A 1CX8A 2BO9A 1ELLP 5KTDA 5K8MA 2ZEOA 2CXAA 2JDDA 1YREA 3B35A 3IEHA 3FYNA 4MY3A 3SJXA 3LACA 1GGOA 2OLSA 3B3TA 1ZYMA 1VHSA 4YN3A 2D0OA 2G3TA 3VGOA 2HB6A 5IX3A 1MK4A 3ZNIA 4PXDA 5LYIA 1F2OA 1Z9UA 4KVOE 2FS5A 5A27A 4R3LA 4KUBA 2CY2A 4MFKA 4C2XA 2CNMA 5THWA 7CPAA 4X3RA 1NE9A 4ZX9A 3DDDA 3KQXA 1Z8XA 2F7VA 1ZG8A 1I12A 1S7LA 4ZYQA 3LMSA 1XOVA 4AVAA 4MCRA 2ZPAA 2WZNA 4PXBA 1ON0A 4OC3A 1H8LA 4NGRA 4RUHA 4HNXB 5J8CA 3NFZA 3WR7A 4C2ZA 1DE4C 4BPWB 4CGPA 2C5QA 4E2AA 2XEJA 4YGOA 3B3SA 3K9UA 4MHZA 4P6YA 5FD8A 4E94A 5D29A 2PR8A 3BJ8A 4XPDC 5K8PA 3CT9A 5AG4A 2V77A 3O8ZA 4CGLA 1S7FA 4KZTA 4PXEA 2YNDA 5JH9A 2BEIA 3BUWB 2K5TA 4BTFA 2D0PA 4H1HA 1YVOA 4IF5A 4B12A 2VI7A 3D4UA 3PB7X 4RR2B 4H6UA 2CIJA 3BUOB 2PCUA 4C7IA 5DWMA 1XMTA 3FJUA 4R6TA 1I21A 1KUYA 1U6MA 2RFHA 1QSOA 2GREA 3E0KA 4OIWA 3C8OA 2G0BA 3T9YA 3EIFA 2AFUA 2ABZA 2QIRA 3K9TA 3KL9A 4KSIA 3NE8A 4TJXA 1M44A 3FBUA 2C6CA 3P2HA 1IB1E 1IIDA 2D4PA 4FD7A 2E28A 3B7IA 3VTAA 3VRRA 4C86A 2JBKA 1IU8A 1P0HA 2ZEFA 3IO1A 3F0AA 3IGRA 1Y9KA 4A2ZA 5LRJA 2ZOFA 1MJBA 1LFWA 3B8GA 1IOFA 4I49A 5EBVA 4C7HA 2MP0A 1Y9ZA 2PJ8A 4O23A 3KHZA 4YFJA 5IR2A 1ZLHA 3GUXA 4OADA 4P10A 3R9GA 2ZEGA 3T07A 3G3SA 3K4IA 5LYLA 1WK4A 3PFOA 1C3OB 3TYXA 1L0CA 2FT0A 3H4QA 3KQZA 3SI2A 1ZRSA 3EZBA 1JDBC 2AUMA 4A4BA 1QSTA 2I3CA 3FMCA 1C30B 2PJ6A 4CRZB 2Z10A 4FBEA 2ZEEA 4C68A 3OWCA 4PXCA 5BWAB 4MY0A 1MJAA 1F2PA 2EZBA 1Y0YA 3EFAA 3PGPA 3R9FA 1KBLA 4JWPA 2Y1MA 2EK9A 2ODFA 4R8FA 4F0YA 2YNEA 1VI4A 3S9LA 1VGYA 2I00A 3ISZA 1QSMA 1BLLE 1M4GA 4X5KA 4AB7A 4QB9A 1EE3P 2JLMA 1ZLIA 2FIWA 3FNCA 3GY9A 1DIKA 4MI1A 1HEEA 3IFEA 4R3KA 4OC4A 3PFEA 3ICUA 2FCKA 4C9RA 2DXQA 1K4JA 2HROA 3OP0A 4OMEA 3TLZA 4UCPA 3BXMA 5F5XA 2P0WA 1Z2LA 3BJ7A 4JJXA 3WABA 3S6GA 2J8NA 1A9XB 1Z4EA 3IIBA 3NH4A 1A2ZA 1PCAA 4P4FA 3VATA 1PUAA 4IUSA 4KVME 3TX8A 3RBUA 1KUVA 4Y49B 2NYQA 1Q5XA 4OLLA 2PJAA 1Z8TA 4R9MA 3ZZIA 3MN8A 4FAIA 3TLGA 3D7HA 4MJ8A 1WVMA 4COBA 2CNSA 5JM6A 2R7HA 2GLFA 5LYFA 2EVNA 4BPUB 4Q7AA 4CGOA 4C99A 4COGA 2OB0A 3R96A 3NOJA 2JBJA 2CTCA 3D68A 3D8PA 3ISXA 3LWUA 3JUWA 4QUSA 2I79A 3KKWA 4JLYA 4UEFA 4FD5A 2ZELA 4P4DA 1LAPA 4KS9A 1CP6A 4MBUA 4FUUA 2ZW5A 2FIAA 3SJEA 5IB9A 2F8HA 1CE8B 1IYLA 4QBJA 1YR0A 1YW4A 5JVLA 3TO6A 4E8OA 4LX9A 3BI1A 3N7ZA 4M6HA 3S6HA 3TE4A 2N3AB 1BO4A 3D3SA 2ZW7A 1XF8A 4CYPA 1LANA 2FM4A 4J0NA 3VARA 1CM0A 4MMOA 2J9AA 4KOYA 3B3WA 4NGQA 4CAWA 4INJA 1ZO0A 2O28A 2C6PA 1RO5A 4XNHC 5FVJA 2PJ7A 1R57A 1CP7A 4TWEA 3TCVA 4NJRA 2F5IA 1S7NA 2PJCA 5K8NA 2EUIA 4F9UA 2Z11A 4P4JA 5C88A 2JEWA 3R95A 3PB8X 2BCOA 3MRUA 1YLOA 4M85A 4F0XA 2AFMA 4ZY1A 2GU2A 5I0CA 4B6ZA 3EY5A 4EWTA 2ATRA 4PQAA 3F8KA 4FD6A 4K3NA 1IY7A 4CRYB 2J8RA 4NGNA 3PB9X 4JYWA 1CG2A 4CGNA 3PLFB 4CO9A 4P4EA 1QQ9A 3NA6A 2Z3NA 2IMOA 4KLVA 2R1IA 1TF8A 3KR5A 1XMBA 3BI0A 3HPGG 2Q4ZA 4ZBGA 1Q2YA 1BOBA 2OH1A 4Z65A 4KOVA 4BPXB 2XEFA 1AYEA 3F5BA 4YU9A 2GANA 2GFQA 1R61A 2VXKA 5CBMA 4A39A 1YVHA 3BUNB 3TLYA 3PFVA 5H86A 4C9VA 2UV8G 5JYBA 1S5KA 3FF3A 1X10A 3IWWA 3S9NA 1BPNA 2XPOA 2FE7A 3NE7A 4PSXA 4KSFA 3WT4A 2B0AA 4MI4A 2HI6A 5BY0A 1GHEA 1XJOA 1YQEA 2WYRA 4R57A 3H8GA 3EC4A 1LOKA 1M4LA 2PRBA 3D7FA 3LD2A 2HUZA 4A37A 4B14A 4DUKA 3NH5A 3G8WA 2YGWA 2REFA 4U9ZA 4UCMA 3W6XA 2ZEDA 2ZW6A 3QB8A 4UWJA 2AJ6A 4YWYA 4CAFA 4WWVA 4MHNA 5F48A 4FWUA 2AFOA 1CPXA 2AFXA 3KI9A 4A94A 3FECA 2VL1A 3T8WA 3GIUA 1EZBA 1SQHA 2PE3A 2B4JC 2ZEMA 4GM5A 2R82A 3TOBA 4NF1A 1GYTA 2EWBA 4E0AA 1VBGA 5AGEA 3I74A 5AG6A 4MHYA 1R43A 4OC0A 5F47A 1S7KA 1LCPA 2PCNA 3D66A 1AUGA 1XFOA 1TXRA 3CXSA 1PU9A 3KR4A 1Z4RA 3NFQA 4PK3A 4X2TA 1M4IA 1M4DA 2XPLA 2ARHA 5LRGA 2PVWA 2CNTA 4R7MA 2XEIA 1B47A 4P44A 4GS4A 3BUMB 4QVTA 5HVHA 4PK2A 3FEDA 4NGPA 3DSBA 4MRIA 1V6CA 1HDQA 2R8VA 4NEXA 4U5YA 3V7ZA 1X12A 4B10A 2FL4A 4B13A 1T36B 3CPAA 2PDOA 3HMJG 4KOSA 1RTQA 4CAXA 5DS0A 4KLWA 1XIXA 4NFRA 4ZGYB 4JVOA 3GJZA 3I6SA 4M6GA 3VWDA 2OOTA 2ZEHA 3KHXA 4C84A 1TKFA 3PEIA 4Y49C 3IC1A 4MFQA 4CYNA 4B11A 4EMEA 1YSJA 5HKWA 1TKJA 2DEAA 2PJ1A 2AFZA 4MHPA 3EZAA 3EO4A 3FH4A 4MXUA 5HVGA 4CAVA 1Y7EA 2Q04A 3U1BA 5C82A 5ISVA 3TLAA 2G9DA 2VZZA 3HLPA 4LQ6A 1Q2CA 3DR6A 3SHPA 4A4CA 2QMLA 3C26A 2FSRA 4RN7A 4AG9A 2BSWA 4C8CA 2Q0YA 5JQ4A 3VRNA 3H8EA 2AE6A 3FVLA 3S6KA 1TF9A 3MGDA 3RO0A 3JRUA 4ZY2A 1QSRA 4KORA 3S6FA 1N71A 3CXPA 4H89A 4XPLA 1LAMA 3WC5A 4BMHA 1KZFA 2GIVA 2IL4A 4DJLA 4C8TA 2EO8A 2PJ0A 3W91A 1P4NA 4PV6A 3FX6A 3I1UA 3TFYA 4P4BA 1ZL0A 2YJVA 3FXTA 1CBXA 1Z5RA 4DYOA 2DLAA 3PT1A 3T05A 4IAVA 4KVXA 2J8MA 4XPKA 2EK8A 4UA3A 2B58A 3WC7A 2B4DB 5ELYA 3TT2A 2OZUA 4LUAA 4UF4A 2Z3PA 4B5OA 5KTCA 2QECA 1WWZA 1WJTA 2WPWA 3PB4X 2X0SA 1EZAA 3SJGA 2B3VA 4RI1A 2H5MA 1XEBA 1J4JA 1YX0A 2KCWA 2ZEPA 4KOTA 4MJXA 2G3AA 4IIYA 3CXQA 2PJ2A 1KC7A 4C8UA 5CNPA 4YRHA 3D2MA 3SI0A 4C2YA 1J3LA 1EO0A 2PIZA 4IK2A 2DIKA 4Q36A 3T0TA 4KOWA 4H6ZA 2GP4A 1IYKA 4R87A 4UFWA 3TC8A 4B5PB 5AG5A 1XF1A 2B4DA 3SR3A 1BPMA 2PJ4A 5LYDA 5DWNA 4QC6A 4KUAA 3SXNA 3NH8A 4OAEA 4ORFA 4AG7A 4MFPA 1NBWA 3LODA 2Z0ZA 2NSMA 2Q4YA 4R76A 1CS0B 4CPAA 2VZYA 2CTBA 1CPSA 3F9KC 4E5SA 1IOIA 4MHDA 1KWMA 2PIYA 4NGSA 1R3NA 3FRMA 4A95A 1NSAA 4BD9A 1NXJA 4C8PA 4F6AA 4A32A 2BL1A 5GCNA 1F57A 2ZOGA 3A9LA 1XE4A 2Q7SA 3QAYA 3KRVA 3CZXA 4UEZA 2Y1NA 2HQYA 4UEEA 4OIDA 3IJ3A 1Z9EA 1RXTA 2FVGA 1VIXA 3V8IA 2XEGA 1ELMP 5K8OA 4KOUA 3RZAA 2POKA 2V8GA 2PRQA 1JDEA 4IIXA 1KUXA 4U9YA 4CYOA 2OR4A 3V38A 3SJFA 2CBLA 1YLEA 2EBJA 4XNHB 4JZ0A 4MCSA 3FB3A 2RB7A 1S60A 4MFJA 4CZ1A 3B3VA 4II9A 2PR1A 2B5GB 2QJ8A 4UFVA 4OKOA 4LQGA 4AVCA 3TOAA 6CPAA 3BHXA 2DPSA 3GKRA 2O53A 1YW6A 2P6EA 4A31A 1YMEA 2AFSA 4HNWB 4UCNA 4K30A 4MFLA 2D4OA 2WUUA 5G20A 4P4IA 2V8VA 2HWGA 3HPHE 2HV2A 3T5MA 4C9UA 2WSAA 1XBUA 3CPXA 4UIBA 4CGMA 5F1YA 1FY7A 2DF5A 1YGHA 1S3ZA 2B4BA 2OZGA 5E96A 3BUXB 1XRYA 1QMUA 5G1ZA 1ARMA 3PP9A
chains in the Genus database with same CATH topology
1HDUA 2AFWA 5CPAA 2C1CA 4OC1A 3H8FA 3B2YA 4MCPA 1FT7A 2GLJA 4ONWA 4C9AA 5JGFA 4NJQA 4C8FA 1TKHA 2PJBA 4NGTA 5I4MA 1JQGA 2IJZA 3B3CA 4G1PA 1ZG7A 3DGVA 1ARLA 1VHOA 3HUVA 3PB6X 4EFDA 4C8AA 2PVVA 4OP4A 3S9MA 1Z8LA 2HC9A 5F09A 4F9VA 3PBBA 3SI1A 4ZY0A 4CDJA 3PBEA 3QNVA 2IQ6A 4NGMA 1UWYA 4F8ZA 4MCQA 1ZG9A 2V8HA 5LRKA 3KZWA 2QYVA 4H2KA 4TJVA 4KNGE 2O4HA 4P45A 1Y0RA 3KGQA 4ZI6A 2BOAA 5HVFA 4CDKA 4X8IA 1BAVA 1FNOA 5J1QA 1DTDA 3KASA 3RAMA 3D67A 4AXVA 5HXDA 2Q51A 1Q7LA 4C85A 3GB0A 3PRTA 4A38A 1IGBA 4TNUA 2QVPA 4OC5A 8CPAA 2PJ3A 3D7DA 3FEEA 3WC6A 3L2NA 3K2KA 3VH9A 2CF4A 3D7GA 2C6GA 4PPZA 4ZX8A 1PYTB 3CDXA 4C9EA 4OC2A 4WJBA 3GLJA 2PJ9A 2ANPA 2V8DA 5D8NA 4W9YA 3N5FA 2Q43A 1VHEA 2ZENA 4IHMA 1AMPA 3DLJA 4UIAA 1OBRA 2PJ5A 1CX8A 2BO9A 1ELLP 5K8MA 2ZEOA 3B35A 3IEHA 3SJXA 3B3TA 2HB6A 4PXDA 5LYIA 1F2OA 5THWA 7CPAA 4X3RA 4ZX9A 3KQXA 2F7VA 1ZG8A 4ZYQA 3LMSA 4MCRA 2WZNA 4PXBA 4OC3A 1H8LA 4NGRA 4RUHA 3NFZA 1DE4C 2C5QA 2XEJA 3B3SA 4MHZA 4P6YA 5D29A 5K8PA 3CT9A 2V77A 4PXEA 5JH9A 3D4UA 3PB7X 2CIJA 2PCUA 3FJUA 4R6TA 4OIWA 2RFHA 2GREA 3EIFA 2AFUA 2ABZA 3K9TA 3KL9A 4KSIA 4TJXA 2C6CA 3VTAA 3B7IA 4C86A 2JBKA 2ZEFA 3IO1A 5LRJA 2ZOFA 1LFWA 1Y9ZA 2PJ8A 4O23A 3KHZA 5IR2A 1ZLHA 3GUXA 4P10A 2ZEGA 5LYLA 3PFOA 3KQZA 3SI2A 2I3CA 3FMCA 2PJ6A 4FBEA 2ZEEA 4PXCA 1F2PA 1Y0YA 2EK9A 4R8FA 3S9LA 1VGYA 3ISZA 1BLLE 1EE3P 1ZLIA 1HEEA 3IFEA 4OC4A 3PFEA 3ICUA 4C9RA 4OMEA 3BXMA 1Z2LA 3WABA 3IIBA 3NH4A 1PCAA 4P4FA 3VATA 3TX8A 3RBUA 2NYQA 2PJAA 3MN8A 4FAIA 3D7HA 1WVMA 5JM6A 2GLFA 5LYFA 4C99A 4Q7AA 2JBJA 2CTCA 3D68A 3ISXA 3LWUA 4UEFA 2ZELA 4P4DA 1LAPA 1CP6A 4FUUA 5IB9A 3SJEA 2F8HA 1YW4A 3BI1A 1LANA 3VARA 4MMOA 2J9AA 3B3WA 4NGQA 2C6PA 2PJ7A 1CP7A 4TWEA 4NJRA 2PJCA 5K8NA 4F9UA 4P4JA 2JEWA 3PB8X 2BCOA 3MRUA 1YLOA 2AFMA 4ZY1A 2GU2A 4B6ZA 4EWTA 4PQAA 4K3NA 1IY7A 4NGNA 3PB9X 4JYWA 1CG2A 4P4EA 1QQ9A 3NA6A 2IMOA 1TF8A 3KR5A 1XMBA 3BI0A 2Q4ZA 4Z65A 2XEFA 1AYEA 4YU9A 5CBMA 4A39A 4C9VA 3FF3A 3IWWA 3S9NA 1BPNA 3WT4A 4YN3A 1XJOA 2WYRA 3H8GA 1LOKA 1M4LA 3D7FA 4A37A 4DUKA 3NH5A 2ZEDA 4YWYA 4WWVA 4MHNA 4FWUA 2AFOA 1CPXA 2AFXA 3KI9A 4A94A 3FECA 2VL1A 3T8WA 2PE3A 4GM5A 2ZEMA 1GYTA 2EWBA 3I74A 4MHYA 1R43A 4OC0A 1LCPA 3D66A 1XFOA 1TXRA 3KR4A 4X2TA 5LRGA 2PVWA 4R7MA 2XEIA 4P44A 5HVHA 3FEDA 4NGPA 4MRIA 1V6CA 1HDQA 3V7ZA 3CPAA 1RTQA 5DS0A 4NFRA 3I6SA 2OOTA 2ZEHA 3KHXA 4C84A 1TKFA 3PEIA 3IC1A 4EMEA 1YSJA 1TKJA 2DEAA 2PJ1A 2AFZA 4MHPA 3FH4A 4MXUA 5HVGA 1Y7EA 2G9DA 3HLPA 4C8CA 3H8EA 3FVLA 1TF9A 3JRUA 4ZY2A 1LAMA 3WC5A 4C8TA 4DJLA 2PJ0A 3FX6A 3I1UA 4P4BA 1CBXA 1Z5RA 4DYOA 4IAVA 2EK8A 3WC7A 5ELYA 4UF4A 3PB4X 3SJGA 2ZEPA 2PJ2A 4C8UA 3SI0A 2PIZA 4IK2A 2GP4A 3TC8A 1XF1A 1BPMA 2PJ4A 5LYDA 3NH8A 2NSMA 4R76A 4CPAA 2CTBA 1CPSA 1KWMA 2PIYA 4NGSA 1R3NA 4BD9A 4C8PA 1NSAA 1F57A 2ZOGA 4UEZA 4UEEA 4OIDA 3IJ3A 2FVGA 1VIXA 2XEGA 1ELMP 5K8OA 3RZAA 2POKA 2V8GA 2PRQA 2OR4A 3V38A 3SJFA 4JZ0A 4MCSA 2RB7A 3B3VA 2QJ8A 4OKOA 4LQGA 6CPAA 3BHXA 2O53A 1YW6A 1YMEA 2AFSA 4C9UA 4P4IA 2V8VA 1XBUA 3CPXA 4UIBA 1XRYA 1QMUA 1ARMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDU A;  2AFW A;  5CPA A;  2C1C A;  4OC1 A;  3H8F A;  3B2Y A;  4MCP A;  1FT7 A;  2GLJ A;  4ONW A;  4C9A A;  5JGF A;  4NJQ A;  4C8F A;  1TKH A;  2PJB A;  4NGT A;  5I4M A;  1JQG A;  2IJZ A;  3B3C A;  4G1P A;  1ZG7 A;  3DGV A;  1ARL A;  1VHO A;  3HUV A;  3PB6 X;  4EFD A;  4C8A A;  2PVV A;  4OP4 A;  3S9M A;  1Z8L A;  2HC9 A;  5F09 A;  4F9V A;  3PBB A;  3SI1 A;  4ZY0 A;  4CDJ A;  3PBE A;  3QNV A;  2IQ6 A;  4NGM A;  1UWY A;  4F8Z A;  4MCQ A;  1ZG9 A;  2V8H A;  5LRK A;  3KZW A;  2QYV A;  4H2K A;  4TJV A;  4KNG E;  2O4H A;  4P45 A;  1Y0R A;  3KGQ A;  4ZI6 A;  2BOA A;  5HVF A;  4CDK A;  4X8I A;  1BAV A;  1FNO A;  5J1Q A;  1DTD A;  3KAS A;  3RAM A;  3D67 A;  4AXV A;  5HXD A;  2Q51 A;  1Q7L A;  4C85 A;  3GB0 A;  3PRT A;  4A38 A;  1IGB A;  4TNU A;  2QVP A;  4OC5 A;  8CPA A;  2PJ3 A;  3D7D A;  3FEE A;  3WC6 A;  3L2N A;  3K2K A;  3VH9 A;  2CF4 A;  3D7G A;  2C6G A;  4PPZ A;  4ZX8 A;  1PYT B;  3CDX A;  4C9E A;  4OC2 A;  4WJB A;  3GLJ A;  2PJ9 A;  2ANP A;  2V8D A;  5D8N A;  4W9Y A;  3N5F A;  2Q43 A;  1VHE A;  2ZEN A;  4IHM A;  1AMP A;  3DLJ A;  4UIA A;  1OBR A;  2PJ5 A;  1CX8 A;  2BO9 A;  1ELL P;  5K8M A;  2ZEO A;  3B35 A;  3IEH A;  3SJX A;  3B3T A;  2HB6 A;  4PXD A;  5LYI A;  1F2O A;  5THW A;  7CPA A;  4X3R A;  4ZX9 A;  3KQX A;  2F7V A;  1ZG8 A;  4ZYQ A;  3LMS A;  4MCR A;  2WZN A;  4PXB A;  4OC3 A;  1H8L A;  4NGR A;  4RUH A;  3NFZ A;  1DE4 C;  2XEJ A;  3B3S A;  4MHZ A;  4P6Y A;  5D29 A;  5K8P A;  3CT9 A;  2V77 A;  4PXE A;  5JH9 A;  3D4U A;  3PB7 X;  2CIJ A;  2PCU A;  3FJU A;  4R6T A;  4OIW A;  2RFH A;  2GRE A;  3EIF A;  2AFU A;  2ABZ A;  3K9T A;  3KL9 A;  4KSI A;  4TJX A;  2C6C A;  3VTA A;  3B7I A;  4C86 A;  2JBK A;  2ZEF A;  3IO1 A;  5LRJ A;  2ZOF A;  1LFW A;  1Y9Z A;  2PJ8 A;  4O23 A;  3KHZ A;  1ZLH A;  3GUX A;  4P10 A;  2ZEG A;  5LYL A;  3PFO A;  3KQZ A;  3SI2 A;  2I3C A;  3FMC A;  2PJ6 A;  4FBE A;  2ZEE A;  4PXC A;  1F2P A;  1Y0Y A;  2EK9 A;  4R8F A;  3S9L A;  1VGY A;  3ISZ A;  1BLL E;  1EE3 P;  1ZLI A;  1HEE A;  3IFE A;  4OC4 A;  3PFE A;  3ICU A;  4C9R A;  4OME A;  3BXM A;  1Z2L A;  3WAB A;  3IIB A;  3NH4 A;  1PCA A;  4P4F A;  3VAT A;  3TX8 A;  3RBU A;  2NYQ A;  2PJA A;  3MN8 A;  4FAI A;  3D7H A;  1WVM A;  5JM6 A;  2GLF A;  5LYF A;  4C99 A;  4Q7A A;  2JBJ A;  2CTC A;  3D68 A;  3ISX A;  3LWU A;  4UEF A;  2ZEL A;  4P4D A;  1LAP A;  1CP6 A;  4FUU A;  5IB9 A;  3SJE A;  2F8H A;  1YW4 A;  3BI1 A;  1LAN A;  3VAR A;  4MMO A;  2J9A A;  3B3W A;  4NGQ A;  2C6P A;  2PJ7 A;  1CP7 A;  4TWE A;  4NJR A;  2PJC A;  5K8N A;  4F9U A;  4P4J A;  2JEW A;  3PB8 X;  2BCO A;  3MRU A;  1YLO A;  2AFM A;  4ZY1 A;  2GU2 A;  4B6Z A;  4EWT A;  4PQA A;  4K3N A;  1IY7 A;  4NGN A;  3PB9 X;  4JYW A;  1CG2 A;  4P4E A;  1QQ9 A;  3NA6 A;  2IMO A;  1TF8 A;  3KR5 A;  1XMB A;  3BI0 A;  2Q4Z A;  4Z65 A;  2XEF A;  1AYE A;  4YU9 A;  5CBM A;  4A39 A;  4C9V A;  3FF3 A;  3IWW A;  3S9N A;  1BPN A;  3WT4 A;  4YN3 A;  1XJO A;  2WYR A;  3H8G A;  1LOK A;  1M4L A;  3D7F A;  4A37 A;  4DUK A;  3NH5 A;  2ZED A;  4YWY A;  4WWV A;  4MHN A;  4FWU A;  2AFO A;  1CPX A;  2AFX A;  3KI9 A;  4A94 A;  3FEC A;  2VL1 A;  3T8W A;  2PE3 A;  4GM5 A;  2ZEM A;  1GYT A;  2EWB A;  3I74 A;  4MHY A;  1R43 A;  4OC0 A;  1LCP A;  3D66 A;  1XFO A;  1TXR A;  3KR4 A;  4X2T A;  5LRG A;  2PVW A;  4R7M A;  2XEI A;  4P44 A;  5HVH A;  3FED A;  4NGP A;  4MRI A;  1V6C A;  1HDQ A;  3V7Z A;  3CPA A;  1RTQ A;  5DS0 A;  4NFR A;  3I6S A;  2OOT A;  2ZEH A;  3KHX A;  4C84 A;  1TKF A;  3PEI A;  3IC1 A;  4EME A;  1YSJ A;  1TKJ A;  2DEA A;  2PJ1 A;  2AFZ A;  4MHP A;  3FH4 A;  4MXU A;  5HVG A;  1Y7E A;  2G9D A;  3HLP A;  4C8C A;  3H8E A;  3FVL A;  1TF9 A;  3JRU A;  4ZY2 A;  1LAM A;  3WC5 A;  4C8T A;  4DJL A;  2PJ0 A;  3FX6 A;  3I1U A;  4P4B A;  1CBX A;  1Z5R A;  4DYO A;  4IAV A;  2EK8 A;  3WC7 A;  5ELY A;  4UF4 A;  3PB4 X;  3SJG A;  2ZEP A;  2PJ2 A;  4C8U A;  3SI0 A;  2PIZ A;  4IK2 A;  3TC8 A;  1XF1 A;  1BPM A;  2PJ4 A;  5LYD A;  3NH8 A;  2NSM A;  4R76 A;  4CPA A;  2CTB A;  1CPS A;  1KWM A;  2PIY A;  4NGS A;  1R3N A;  4BD9 A;  4C8P A;  1NSA A;  1F57 A;  2ZOG A;  4UEZ A;  4UEE A;  4OID A;  3IJ3 A;  2FVG A;  1VIX A;  2XEG A;  1ELM P;  5K8O A;  3RZA A;  2POK A;  2V8G A;  2PRQ A;  2OR4 A;  3V38 A;  3SJF A;  4JZ0 A;  4MCS A;  2RB7 A;  3B3V A;  2QJ8 A;  4OKO A;  4LQG A;  6CPA A;  3BHX A;  2O53 A;  1YW6 A;  1YME A;  2AFS A;  4C9U A;  4P4I A;  2V8V A;  1XBU A;  3CPX A;  4UIB A;  1XRY A;  1QMU A;  1ARM A; 
#chains in the Genus database with same CATH topology
 1HDU A;  2PC1 A;  1VBH A;  2B5G A;  2AFW A;  2ZW4 A;  5CPA A;  2C1C A;  1FBV A;  4J3G A;  1Z8W A;  1B6B A;  3VRQ A;  2OZH A;  2Z3K A;  4HPS A;  4OC1 A;  4NXY A;  1CJW A;  3H5Z A;  3RYO A;  3H8F A;  1TIQ A;  1QSN A;  1BXR B;  2JDC A;  3B2Y A;  4MCP A;  4BIN A;  1FT7 A;  4UFX A;  3VRP A;  2A4N A;  1JWQ A;  2GLJ A;  4ONW A;  4C9A A;  4GXH A;  4HNY B;  3VWE A;  2AUN A;  5JGF A;  3JVN A;  4NJQ A;  4XPD B;  3U88 C;  4C8F A;  1TKH A;  2NMT A;  2VKZ G;  2PJB A;  4NGT A;  3IU2 A;  1LRZ A;  5I4M A;  1Y7R A;  3TLC A;  5HKY A;  1Y9W A;  4CAE A;  2Q4V A;  2REE A;  3BLN A;  1JQG A;  2DPT A;  2IJZ A;  3B3C A;  4G1P A;  4ONU A;  3EXN A;  4Q38 A;  5F46 A;  3P2F A;  1ZG7 A;  3DGV A;  1IIC A;  2P6F A;  4KSA A;  1ARL A;  1V0C A;  1VHO A;  3HUV A;  3PB6 X;  4EFD A;  3IWG A;  2Z3M A;  2PVV A;  1UFH A;  4OP4 A;  2R98 A;  4RS2 A;  2XPN A;  4A33 A;  3S9M A;  1YK3 A;  4BBH A;  5K99 A;  1Z8L A;  4MFZ A;  1OZP A;  2HC9 A;  4HKF A;  5F09 A;  3PZJ A;  4F9V A;  5AXI A;  4NCZ A;  3PBB A;  3SI1 A;  4ZY0 A;  5F9M A;  4CDJ A;  5J8F A;  4PSW A;  2RC4 A;  1MJ9 A;  5AG7 A;  3PBE A;  3QNV A;  5JPH A;  2IQ6 A;  3IU1 A;  4NGM A;  1UWY A;  3R9E A;  4F8Z A;  2Z3L A;  4MCQ A;  1KEE B;  2EZC A;  1ZG9 A;  4EVY A;  5HMN A;  3TLB A;  2V8H A;  5LRK A;  5HH1 A;  3T90 A;  2YNC C;  1NMT A;  2WPX A;  3KZW A;  2QYV A;  4A30 A;  4H2K A;  3W6S A;  4KNG E;  4TJV A;  4UWI A;  2XPP A;  2EZA A;  4AVB A;  2O4H A;  2OU2 A;  2BUE A;  4JD6 A;  4P45 A;  1Y0R A;  5H84 A;  3KGQ A;  1Q2D A;  1VKC A;  5G21 A;  4FD4 A;  4M6I A;  2C27 A;  5G22 A;  3TLG B;  4ZI6 A;  2BOA A;  5HVF A;  3SXO A;  3R1K A;  3DR8 A;  4CDK A;  4DNC A;  4CS0 B;  3I3G A;  4X8I A;  1BAV A;  1FNO A;  4KOX A;  2JEV A;  5J1Q A;  1DTD A;  5IV0 A;  3EZE A;  3QAH A;  3KAS A;  3RAM A;  4EYS A;  3D67 A;  4AXV A;  5HXD A;  2Q51 A;  1Q7L A;  3JTK A;  4M8D A;  3VRO A;  2VQY A;  4UBR A;  5HKZ A;  4C85 A;  3GB0 A;  3PRT A;  4A38 A;  1IGB A;  3OB1 B;  2GE3 A;  2Y0M A;  2ZXV A;  2QVP A;  4L8A A;  4TNU A;  4OC5 A;  2P6G A;  8CPA A;  1M6V B;  2PJ3 A;  3D7D A;  1I1D A;  2VEZ A;  3GYA A;  2Q7B A;  3TO9 A;  4C8A A;  3I9S A;  1NSL A;  2YNC A;  5KTA A;  3ZJ0 A;  3FEE A;  2B3U A;  3WC6 A;  3L2N A;  3K2K A;  3VH9 A;  2PQ8 A;  3UY5 A;  4M3S A;  2CF4 A;  3D2P A;  3D7G A;  3FIX A;  1B87 A;  5F13 A;  2Z3O A;  5F49 A;  3TO7 A;  2C6G A;  2FXF A;  4JXR A;  4NSQ A;  4PPZ A;  4ZX8 A;  5IB0 A;  1YVK A;  5EC4 A;  4CYQ A;  3TLE A;  1PYT B;  4GPL B;  2Q44 A;  2VBQ A;  3OB2 B;  3CDX A;  5EMI A;  4OC2 A;  4WJB A;  3RNZ A;  4C9E A;  3GLJ A;  5J3X A;  3TTH A;  2PJ9 A;  2ANP A;  2V8D A;  3G23 A;  5D8N A;  4L89 A;  4W9Y A;  3OAK A;  3DNS A;  3N5F A;  2Q43 A;  1VHE A;  2ZEN A;  5A28 A;  4IHM A;  1AMP A;  3IWE A;  3DLJ A;  2PSW A;  1M1D A;  2X7B A;  4UIA A;  2YJT A;  4B5P A;  4JXQ A;  1OBR A;  2PJ5 A;  1CX8 A;  2BO9 A;  1ELL P;  5KTD A;  5K8M A;  2ZEO A;  2CXA A;  2JDD A;  1YRE A;  3B35 A;  3IEH A;  3FYN A;  4MY3 A;  3SJX A;  3LAC A;  1GGO A;  2OLS A;  3B3T A;  1ZYM A;  1VHS A;  4YN3 A;  2D0O A;  2G3T A;  3VGO A;  2HB6 A;  5IX3 A;  1MK4 A;  3ZNI A;  4PXD A;  5LYI A;  1F2O A;  1Z9U A;  4KVO E;  2FS5 A;  5A27 A;  4R3L A;  4KUB A;  2CY2 A;  4MFK A;  4C2X A;  2CNM A;  5THW A;  7CPA A;  4X3R A;  1NE9 A;  4ZX9 A;  3DDD A;  3KQX A;  1Z8X A;  2F7V A;  1ZG8 A;  1I12 A;  1S7L A;  4ZYQ A;  3LMS A;  1XOV A;  4AVA A;  4MCR A;  2ZPA A;  2WZN A;  4PXB A;  1ON0 A;  4OC3 A;  1H8L A;  4NGR A;  4RUH A;  4HNX B;  5J8C A;  3NFZ A;  3WR7 A;  4C2Z A;  1DE4 C;  4BPW B;  4CGP A;  2C5Q A;  4E2A A;  2XEJ A;  4YGO A;  3B3S A;  3K9U A;  4MHZ A;  4P6Y A;  5FD8 A;  4E94 A;  5D29 A;  2PR8 A;  3BJ8 A;  4XPD C;  5K8P A;  3CT9 A;  5AG4 A;  2V77 A;  3O8Z A;  4CGL A;  1S7F A;  4KZT A;  4PXE A;  2YND A;  5JH9 A;  2BEI A;  3BUW B;  2K5T A;  4BTF A;  2D0P A;  4H1H A;  1YVO A;  4IF5 A;  4B12 A;  2VI7 A;  3D4U A;  3PB7 X;  4RR2 B;  4H6U A;  2CIJ A;  3BUO B;  2PCU A;  4C7I A;  5DWM A;  1XMT A;  3FJU A;  4R6T A;  1I21 A;  1KUY A;  1U6M A;  2RFH A;  1QSO A;  2GRE A;  3E0K A;  4OIW A;  3C8O A;  2G0B A;  3T9Y A;  3EIF A;  2AFU A;  2ABZ A;  2QIR A;  3K9T A;  3KL9 A;  4KSI A;  3NE8 A;  4TJX A;  1M44 A;  3FBU A;  2C6C A;  3P2H A;  1IB1 E;  1IID A;  2D4P A;  4FD7 A;  2E28 A;  3B7I A;  3VTA A;  3VRR A;  4C86 A;  2JBK A;  1IU8 A;  1P0H A;  2ZEF A;  3IO1 A;  3F0A A;  3IGR A;  1Y9K A;  4A2Z A;  5LRJ A;  2ZOF A;  1MJB A;  1LFW A;  3B8G A;  1IOF A;  4I49 A;  5EBV A;  4C7H A;  2MP0 A;  1Y9Z A;  2PJ8 A;  4O23 A;  3KHZ A;  4YFJ A;  5IR2 A;  1ZLH A;  3GUX A;  4OAD A;  4P10 A;  3R9G A;  2ZEG A;  3T07 A;  3G3S A;  3K4I A;  5LYL A;  1WK4 A;  3PFO A;  1C3O B;  3TYX A;  1L0C A;  2FT0 A;  3H4Q A;  3KQZ A;  3SI2 A;  1ZRS A;  3EZB A;  1JDB C;  2AUM A;  4A4B A;  1QST A;  2I3C A;  3FMC A;  1C30 B;  2PJ6 A;  4CRZ B;  2Z10 A;  4FBE A;  2ZEE A;  4C68 A;  3OWC A;  4PXC A;  5BWA B;  4MY0 A;  1MJA A;  1F2P A;  2EZB A;  1Y0Y A;  3EFA A;  3PGP A;  3R9F A;  1KBL A;  4JWP A;  2Y1M A;  2EK9 A;  2ODF A;  4R8F A;  4F0Y A;  2YNE A;  1VI4 A;  3S9L A;  1VGY A;  2I00 A;  3ISZ A;  1QSM A;  1BLL E;  1M4G A;  4X5K A;  4AB7 A;  4QB9 A;  1EE3 P;  2JLM A;  1ZLI A;  2FIW A;  3FNC A;  3GY9 A;  1DIK A;  4MI1 A;  1HEE A;  3IFE A;  4R3K A;  4OC4 A;  3PFE A;  3ICU A;  2FCK A;  4C9R A;  2DXQ A;  1K4J A;  2HRO A;  3OP0 A;  4OME A;  3TLZ A;  4UCP A;  3BXM A;  5F5X A;  2P0W A;  1Z2L A;  3BJ7 A;  4JJX A;  3WAB A;  3S6G A;  2J8N A;  1A9X B;  1Z4E A;  3IIB A;  3NH4 A;  1A2Z A;  1PCA A;  4P4F A;  3VAT A;  1PUA A;  4IUS A;  4KVM E;  3TX8 A;  3RBU A;  1KUV A;  4Y49 B;  2NYQ A;  1Q5X A;  4OLL A;  2PJA A;  1Z8T A;  4R9M A;  3ZZI A;  3MN8 A;  4FAI A;  3TLG A;  3D7H A;  4MJ8 A;  1WVM A;  4COB A;  2CNS A;  5JM6 A;  2R7H A;  2GLF A;  5LYF A;  2EVN A;  4BPU B;  4Q7A A;  4CGO A;  4C99 A;  4COG A;  2OB0 A;  3R96 A;  3NOJ A;  2JBJ A;  2CTC A;  3D68 A;  3D8P A;  3ISX A;  3LWU A;  3JUW A;  4QUS A;  2I79 A;  3KKW A;  4JLY A;  4UEF A;  4FD5 A;  2ZEL A;  4P4D A;  1LAP A;  4KS9 A;  1CP6 A;  4MBU A;  4FUU A;  2ZW5 A;  2FIA A;  3SJE A;  5IB9 A;  2F8H A;  1CE8 B;  1IYL A;  4QBJ A;  1YR0 A;  1YW4 A;  5JVL A;  3TO6 A;  4E8O A;  4LX9 A;  3BI1 A;  3N7Z A;  4M6H A;  3S6H A;  3TE4 A;  2N3A B;  1BO4 A;  3D3S A;  2ZW7 A;  1XF8 A;  4CYP A;  1LAN A;  2FM4 A;  4J0N A;  3VAR A;  1CM0 A;  4MMO A;  2J9A A;  4KOY A;  3B3W A;  4NGQ A;  4CAW A;  4INJ A;  1ZO0 A;  2O28 A;  2C6P A;  1RO5 A;  4XNH C;  5FVJ A;  2PJ7 A;  1R57 A;  1CP7 A;  4TWE A;  3TCV A;  4NJR A;  2F5I A;  1S7N A;  2PJC A;  5K8N A;  2EUI A;  4F9U A;  2Z11 A;  4P4J A;  5C88 A;  2JEW A;  3R95 A;  3PB8 X;  2BCO A;  3MRU A;  1YLO A;  4M85 A;  4F0X A;  2AFM A;  4ZY1 A;  2GU2 A;  5I0C A;  4B6Z A;  3EY5 A;  4EWT A;  2ATR A;  4PQA A;  3F8K A;  4FD6 A;  4K3N A;  1IY7 A;  4CRY B;  2J8R A;  4NGN A;  3PB9 X;  4JYW A;  1CG2 A;  4CGN A;  3PLF B;  4CO9 A;  4P4E A;  1QQ9 A;  3NA6 A;  2Z3N A;  2IMO A;  4KLV A;  2R1I A;  1TF8 A;  3KR5 A;  1XMB A;  3BI0 A;  3HPG G;  2Q4Z A;  4ZBG A;  1Q2Y A;  1BOB A;  2OH1 A;  4Z65 A;  4KOV A;  4BPX B;  2XEF A;  1AYE A;  3F5B A;  4YU9 A;  2GAN A;  2GFQ A;  1R61 A;  2VXK A;  5CBM A;  4A39 A;  1YVH A;  3BUN B;  3TLY A;  3PFV A;  5H86 A;  4C9V A;  2UV8 G;  5JYB A;  1S5K A;  3FF3 A;  1X10 A;  3IWW A;  3S9N A;  1BPN A;  2XPO A;  2FE7 A;  3NE7 A;  4PSX A;  4KSF A;  3WT4 A;  2B0A A;  4MI4 A;  2HI6 A;  5BY0 A;  1GHE A;  1XJO A;  1YQE A;  2WYR A;  4R57 A;  3H8G A;  3EC4 A;  1LOK A;  1M4L A;  2PRB A;  3D7F A;  3LD2 A;  2HUZ A;  4A37 A;  4B14 A;  4DUK A;  3NH5 A;  3G8W A;  2YGW A;  2REF A;  4U9Z A;  4UCM A;  3W6X A;  2ZED A;  2ZW6 A;  3QB8 A;  4UWJ A;  2AJ6 A;  4YWY A;  4CAF A;  4WWV A;  4MHN A;  5F48 A;  4FWU A;  2AFO A;  1CPX A;  2AFX A;  3KI9 A;  4A94 A;  3FEC A;  2VL1 A;  3T8W A;  3GIU A;  1EZB A;  1SQH A;  2PE3 A;  2B4J C;  2ZEM A;  4GM5 A;  2R82 A;  3TOB A;  4NF1 A;  1GYT A;  2EWB A;  4E0A A;  1VBG A;  5AGE A;  3I74 A;  5AG6 A;  4MHY A;  1R43 A;  4OC0 A;  5F47 A;  1S7K A;  1LCP A;  2PCN A;  3D66 A;  1AUG A;  1XFO A;  1TXR A;  3CXS A;  1PU9 A;  3KR4 A;  1Z4R A;  3NFQ A;  4PK3 A;  4X2T A;  1M4I A;  1M4D A;  2XPL A;  2ARH A;  5LRG A;  2PVW A;  2CNT A;  4R7M A;  2XEI A;  1B47 A;  4P44 A;  4GS4 A;  3BUM B;  4QVT A;  5HVH A;  4PK2 A;  3FED A;  4NGP A;  3DSB A;  4MRI A;  1V6C A;  1HDQ A;  2R8V A;  4NEX A;  4U5Y A;  3V7Z A;  1X12 A;  4B10 A;  2FL4 A;  4B13 A;  1T36 B;  3CPA A;  2PDO A;  3HMJ G;  4KOS A;  1RTQ A;  4CAX A;  5DS0 A;  4KLW A;  1XIX A;  4NFR A;  4ZGY B;  4JVO A;  3GJZ A;  3I6S A;  4M6G A;  3VWD A;  2OOT A;  2ZEH A;  3KHX A;  4C84 A;  1TKF A;  3PEI A;  4Y49 C;  3IC1 A;  4MFQ A;  4CYN A;  4B11 A;  4EME A;  1YSJ A;  5HKW A;  1TKJ A;  2DEA A;  2PJ1 A;  2AFZ A;  4MHP A;  3EZA A;  3EO4 A;  3FH4 A;  4MXU A;  5HVG A;  4CAV A;  1Y7E A;  2Q04 A;  3U1B A;  5C82 A;  5ISV A;  3TLA A;  2G9D A;  2VZZ A;  3HLP A;  4LQ6 A;  1Q2C A;  3DR6 A;  3SHP A;  4A4C A;  2QML A;  3C26 A;  2FSR A;  4RN7 A;  4AG9 A;  2BSW A;  4C8C A;  2Q0Y A;  5JQ4 A;  3VRN A;  3H8E A;  2AE6 A;  3FVL A;  3S6K A;  1TF9 A;  3MGD A;  3RO0 A;  3JRU A;  4ZY2 A;  1QSR A;  4KOR A;  3S6F A;  1N71 A;  3CXP A;  4H89 A;  4XPL A;  1LAM A;  3WC5 A;  4BMH A;  1KZF A;  2GIV A;  2IL4 A;  4DJL A;  4C8T A;  2EO8 A;  2PJ0 A;  3W91 A;  1P4N A;  4PV6 A;  3FX6 A;  3I1U A;  3TFY A;  4P4B A;  1ZL0 A;  2YJV A;  3FXT A;  1CBX A;  1Z5R A;  4DYO A;  2DLA A;  3PT1 A;  3T05 A;  4IAV A;  4KVX A;  2J8M A;  4XPK A;  2EK8 A;  4UA3 A;  2B58 A;  3WC7 A;  2B4D B;  5ELY A;  3TT2 A;  2OZU A;  4LUA A;  4UF4 A;  2Z3P A;  4B5O A;  5KTC A;  2QEC A;  1WWZ A;  1WJT A;  2WPW A;  3PB4 X;  2X0S A;  1EZA A;  3SJG A;  2B3V A;  4RI1 A;  2H5M A;  1XEB A;  1J4J A;  1YX0 A;  2KCW A;  2ZEP A;  4KOT A;  4MJX A;  2G3A A;  4IIY A;  3CXQ A;  2PJ2 A;  1KC7 A;  4C8U A;  5CNP A;  4YRH A;  3D2M A;  3SI0 A;  4C2Y A;  1J3L A;  1EO0 A;  2PIZ A;  4IK2 A;  2DIK A;  4Q36 A;  3T0T A;  4KOW A;  4H6Z A;  2GP4 A;  1IYK A;  4R87 A;  4UFW A;  3TC8 A;  4B5P B;  5AG5 A;  1XF1 A;  2B4D A;  3SR3 A;  1BPM A;  2PJ4 A;  5LYD A;  5DWN A;  4QC6 A;  4KUA A;  3SXN A;  3NH8 A;  4OAE A;  4ORF A;  4AG7 A;  4MFP A;  1NBW A;  3LOD A;  2Z0Z A;  2NSM A;  2Q4Y A;  4R76 A;  1CS0 B;  4CPA A;  2VZY A;  2CTB A;  1CPS A;  3F9K C;  4E5S A;  1IOI A;  4MHD A;  1KWM A;  2PIY A;  4NGS A;  1R3N A;  3FRM A;  4A95 A;  1NSA A;  4BD9 A;  1NXJ A;  4C8P A;  4F6A A;  4A32 A;  2BL1 A;  5GCN A;  1F57 A;  2ZOG A;  3A9L A;  1XE4 A;  2Q7S A;  3QAY A;  3KRV A;  3CZX A;  4UEZ A;  2Y1N A;  2HQY A;  4UEE A;  4OID A;  3IJ3 A;  1Z9E A;  1RXT A;  2FVG A;  1VIX A;  3V8I A;  2XEG A;  1ELM P;  5K8O A;  4KOU A;  3RZA A;  2POK A;  2V8G A;  2PRQ A;  1JDE A;  4IIX A;  1KUX A;  4U9Y A;  4CYO A;  2OR4 A;  3V38 A;  3SJF A;  2CBL A;  1YLE A;  2EBJ A;  4XNH B;  4JZ0 A;  4MCS A;  3FB3 A;  2RB7 A;  1S60 A;  4MFJ A;  4CZ1 A;  3B3V A;  4II9 A;  2PR1 A;  2B5G B;  2QJ8 A;  4UFV A;  4OKO A;  4LQG A;  4AVC A;  3TOA A;  6CPA A;  3BHX A;  2DPS A;  3GKR A;  2O53 A;  1YW6 A;  2P6E A;  4A31 A;  1YME A;  2AFS A;  4HNW B;  4UCN A;  4K30 A;  4MFL A;  2D4O A;  2WUU A;  5G20 A;  4P4I A;  2V8V A;  2HWG A;  3HPH E;  2HV2 A;  3T5M A;  4C9U A;  2WSA A;  1XBU A;  3CPX A;  4UIB A;  4CGM A;  5F1Y A;  1FY7 A;  2DF5 A;  1YGH A;  1S3Z A;  2B4B A;  2OZG A;  5E96 A;  3BUX B;  1XRY A;  1QMU A;  5G1Z A;  1ARM A;  3PP9 A; 
#chains in the Genus database with same CATH homology
 1HDU A;  2AFW A;  5CPA A;  2C1C A;  4OC1 A;  3H8F A;  3B2Y A;  4MCP A;  1FT7 A;  2GLJ A;  4ONW A;  4C9A A;  5JGF A;  4NJQ A;  4C8F A;  1TKH A;  2PJB A;  4NGT A;  5I4M A;  1JQG A;  2IJZ A;  3B3C A;  4G1P A;  1ZG7 A;  3DGV A;  1ARL A;  1VHO A;  3HUV A;  3PB6 X;  4EFD A;  4C8A A;  2PVV A;  4OP4 A;  3S9M A;  1Z8L A;  2HC9 A;  5F09 A;  4F9V A;  3PBB A;  3SI1 A;  4ZY0 A;  4CDJ A;  3PBE A;  3QNV A;  2IQ6 A;  4NGM A;  1UWY A;  4F8Z A;  4MCQ A;  1ZG9 A;  2V8H A;  5LRK A;  3KZW A;  2QYV A;  4H2K A;  4TJV A;  4KNG E;  2O4H A;  4P45 A;  1Y0R A;  3KGQ A;  4ZI6 A;  2BOA A;  5HVF A;  4CDK A;  4X8I A;  1BAV A;  1FNO A;  5J1Q A;  1DTD A;  3KAS A;  3RAM A;  3D67 A;  4AXV A;  5HXD A;  2Q51 A;  1Q7L A;  4C85 A;  3GB0 A;  3PRT A;  4A38 A;  1IGB A;  4TNU A;  2QVP A;  4OC5 A;  8CPA A;  2PJ3 A;  3D7D A;  3FEE A;  3WC6 A;  3L2N A;  3K2K A;  3VH9 A;  2CF4 A;  3D7G A;  2C6G A;  4PPZ A;  4ZX8 A;  1PYT B;  3CDX A;  4C9E A;  4OC2 A;  4WJB A;  3GLJ A;  2PJ9 A;  2ANP A;  2V8D A;  5D8N A;  4W9Y A;  3N5F A;  2Q43 A;  1VHE A;  2ZEN A;  4IHM A;  1AMP A;  3DLJ A;  4UIA A;  1OBR A;  2PJ5 A;  1CX8 A;  2BO9 A;  1ELL P;  5K8M A;  2ZEO A;  3B35 A;  3IEH A;  3SJX A;  3B3T A;  2HB6 A;  4PXD A;  5LYI A;  1F2O A;  5THW A;  7CPA A;  4X3R A;  4ZX9 A;  3KQX A;  2F7V A;  1ZG8 A;  4ZYQ A;  3LMS A;  4MCR A;  2WZN A;  4PXB A;  4OC3 A;  1H8L A;  4NGR A;  4RUH A;  3NFZ A;  1DE4 C;  2C5Q A;  2XEJ A;  3B3S A;  4MHZ A;  4P6Y A;  5D29 A;  5K8P A;  3CT9 A;  2V77 A;  4PXE A;  5JH9 A;  3D4U A;  3PB7 X;  2CIJ A;  2PCU A;  3FJU A;  4R6T A;  4OIW A;  2RFH A;  2GRE A;  3EIF A;  2AFU A;  2ABZ A;  3K9T A;  3KL9 A;  4KSI A;  4TJX A;  2C6C A;  3VTA A;  3B7I A;  4C86 A;  2JBK A;  2ZEF A;  3IO1 A;  5LRJ A;  2ZOF A;  1LFW A;  1Y9Z A;  2PJ8 A;  4O23 A;  3KHZ A;  5IR2 A;  1ZLH A;  3GUX A;  4P10 A;  2ZEG A;  5LYL A;  3PFO A;  3KQZ A;  3SI2 A;  2I3C A;  3FMC A;  2PJ6 A;  4FBE A;  2ZEE A;  4PXC A;  1F2P A;  1Y0Y A;  2EK9 A;  4R8F A;  3S9L A;  1VGY A;  3ISZ A;  1BLL E;  1EE3 P;  1ZLI A;  1HEE A;  3IFE A;  4OC4 A;  3PFE A;  3ICU A;  4C9R A;  4OME A;  3BXM A;  1Z2L A;  3WAB A;  3IIB A;  3NH4 A;  1PCA A;  4P4F A;  3VAT A;  3TX8 A;  3RBU A;  2NYQ A;  2PJA A;  3MN8 A;  4FAI A;  3D7H A;  1WVM A;  5JM6 A;  2GLF A;  5LYF A;  4C99 A;  4Q7A A;  2JBJ A;  2CTC A;  3D68 A;  3ISX A;  3LWU A;  4UEF A;  2ZEL A;  4P4D A;  1LAP A;  1CP6 A;  4FUU A;  5IB9 A;  3SJE A;  2F8H A;  1YW4 A;  3BI1 A;  1LAN A;  3VAR A;  4MMO A;  2J9A A;  3B3W A;  4NGQ A;  2C6P A;  2PJ7 A;  1CP7 A;  4TWE A;  4NJR A;  2PJC A;  5K8N A;  4F9U A;  4P4J A;  2JEW A;  3PB8 X;  2BCO A;  3MRU A;  1YLO A;  2AFM A;  4ZY1 A;  2GU2 A;  4B6Z A;  4EWT A;  4PQA A;  4K3N A;  1IY7 A;  4NGN A;  3PB9 X;  4JYW A;  1CG2 A;  4P4E A;  1QQ9 A;  3NA6 A;  2IMO A;  1TF8 A;  3KR5 A;  1XMB A;  3BI0 A;  2Q4Z A;  4Z65 A;  2XEF A;  1AYE A;  4YU9 A;  5CBM A;  4A39 A;  4C9V A;  3FF3 A;  3IWW A;  3S9N A;  1BPN A;  3WT4 A;  4YN3 A;  1XJO A;  2WYR A;  3H8G A;  1LOK A;  1M4L A;  3D7F A;  4A37 A;  4DUK A;  3NH5 A;  2ZED A;  4YWY A;  4WWV A;  4MHN A;  4FWU A;  2AFO A;  1CPX A;  2AFX A;  3KI9 A;  4A94 A;  3FEC A;  2VL1 A;  3T8W A;  2PE3 A;  4GM5 A;  2ZEM A;  1GYT A;  2EWB A;  3I74 A;  4MHY A;  1R43 A;  4OC0 A;  1LCP A;  3D66 A;  1XFO A;  1TXR A;  3KR4 A;  4X2T A;  5LRG A;  2PVW A;  4R7M A;  2XEI A;  4P44 A;  5HVH A;  3FED A;  4NGP A;  4MRI A;  1V6C A;  1HDQ A;  3V7Z A;  3CPA A;  1RTQ A;  5DS0 A;  4NFR A;  3I6S A;  2OOT A;  2ZEH A;  3KHX A;  4C84 A;  1TKF A;  3PEI A;  3IC1 A;  4EME A;  1YSJ A;  1TKJ A;  2DEA A;  2PJ1 A;  2AFZ A;  4MHP A;  3FH4 A;  4MXU A;  5HVG A;  1Y7E A;  2G9D A;  3HLP A;  4C8C A;  3H8E A;  3FVL A;  1TF9 A;  3JRU A;  4ZY2 A;  1LAM A;  3WC5 A;  4C8T A;  4DJL A;  2PJ0 A;  3FX6 A;  3I1U A;  4P4B A;  1CBX A;  1Z5R A;  4DYO A;  4IAV A;  2EK8 A;  3WC7 A;  5ELY A;  4UF4 A;  3PB4 X;  3SJG A;  2ZEP A;  2PJ2 A;  4C8U A;  3SI0 A;  2PIZ A;  4IK2 A;  2GP4 A;  3TC8 A;  1XF1 A;  1BPM A;  2PJ4 A;  5LYD A;  3NH8 A;  2NSM A;  4R76 A;  4CPA A;  2CTB A;  1CPS A;  1KWM A;  2PIY A;  4NGS A;  1R3N A;  4BD9 A;  4C8P A;  1NSA A;  1F57 A;  2ZOG A;  4UEZ A;  4UEE A;  4OID A;  3IJ3 A;  2FVG A;  1VIX A;  2XEG A;  1ELM P;  5K8O A;  3RZA A;  2POK A;  2V8G A;  2PRQ A;  2OR4 A;  3V38 A;  3SJF A;  4JZ0 A;  4MCS A;  2RB7 A;  3B3V A;  2QJ8 A;  4OKO A;  4LQG A;  6CPA A;  3BHX A;  2O53 A;  1YW6 A;  1YME A;  2AFS A;  4C9U A;  4P4I A;  2V8V A;  1XBU A;  3CPX A;  4UIB A;  1XRY A;  1QMU A;  1ARM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...