5F09A

Structure of inactive gcpii mutant in complex with beta-citryl glutamate
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Comparison of human glutamate carboxypeptidases II and III reveals their divergent substrate specificities.
pubmed doi rcsb
source organism Homo sapiens
total genus 261
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 5f09A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5f09A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5f09A02
1UWYA 1HDUA 4P44A 2ZEEA 4ZYQA 4W9YA 4C9UA 3CT9A 3GLJA 2QYVA 4PXBA 4NFRA 3D7HA 5JGFA 4C9RA 4KSIA 3T8WA 3CDXA 4G1PA 5HVFA 3KASA 4C9VA 2PVVA 1TXRA 3LMSA 4NGPA 5LRJA 3QNVA 1IGBA 4IK2A 4DYOA 2IMOA 3V38A 2CTBA 4EFDA 3D67A 3B35A 1LOKA 4OC2A 3RBUA 2Q43A 1ZG8A 3SJGA 2V8DA 3FMCA 2O4HA 4PQAA 2AFMA 2DEAA 4FWUA 4C8AA 1DE4C 1YSJA 5LYLA 3CPXA 1LANA 2C1CA 4NJQA 4PXCA 1RTQA 3PB6X 2PJAA 3KI9A 4P6YA 4IHMA 3SJXA 3BHXA 4CDKA 3PB8X 1YW4A 2QJ8A 4EMEA 1LCPA 3K9TA 1EE3P 4CDJA 3BI0A 2BOAA 4OKOA 4UIBA 1XBUA 1ZG7A 4MCRA 2ZEPA 2CIJA 2HC9A 4FUUA 3FH4A 1IY7A 2ZEGA 4X3RA 4P4JA 3SI1A 4O23A 1Q7LA 3I6SA 4CPAA 2C6GA 1VHOA 1HDQA 2BO9A 1ARLA 4C8TA 7CPAA 4K3NA 4IAVA 4OP4A 2PRQA 1FNOA 2PJ9A 1LAMA 2ZEFA 3FEDA 1YW6A 4ONWA 3GUXA 3BXMA 3VATA 3H8GA 4ZY1A 4C9EA 2C6PA 1XMBA 3TX8A 4P10A 3DGVA 4ZX8A 4AXVA 2POKA 2RB7A 4KNGE 3GB0A 2PJ2A 5CPAA 4F8ZA 3K2KA 3IEHA 3MN8A 3FVLA 5LRGA 1TKJA 4MHYA 3SJFA 3FECA 4A94A 3VTAA 5JH9A 2AFUA 5D29A 3B3SA 4TJVA 3PB9X 3B3TA 3KR5A 4C99A 1CPXA 4OIDA 2XEGA 4C8CA 4UIAA 2ANPA 2ZELA 1Z5RA 3PBBA 2WYRA 1ELMP 4OMEA 2G9DA 3KGQA 4UEEA 1TF9A 3BI1A 4GM5A 3ISZA 3D7GA 2GLFA 3ICUA 5F09A 3PEIA 4X2TA 4C85A 1F57A 2XEIA 3L2NA 3B2YA 1BPMA 1AMPA 5ELYA 4MHNA 1ZG9A 4ZY0A 2PJ6A 2VL1A 4OC5A 5HVHA 5J1QA 2CF4A 2I3CA 2AFSA 3H8EA 1Y0YA 3LWUA 5HVGA 1TKFA 3B3WA 4BD9A 4A39A 2RFHA 2PVWA 4WWVA 8CPAA 3EIFA 3WC7A 1VGYA 1XF1A 3FEEA 4Q7AA 4F9VA 1QMUA 1PYTB 2PJ3A 3N5FA 3MRUA 4NGMA 5D8NA 2FVGA 2JBKA 3IWWA 1FT7A 3ISXA 4C86A 4P4FA 2PIZA 4P4IA 1ELLP 3NH8A 1HEEA 1AYEA 4ZX9A 3DLJA 4MHZA 4UEFA 4MCPA 4OC3A 1VHEA 3WT4A 3IO1A 2AFXA 4JYWA 4PPZA 4OC4A 3WC6A 3D4UA 1ZLIA 3I74A 3CPAA 4R7MA 2PJ4A 4UEZA 4ZY2A 4YU9A 3PBEA 1R3NA 3I1UA 1XFOA 4NGNA 4H2KA 4Z65A 4PXEA 1ZLHA 2PE3A 5LYFA 3NH4A 3WABA 4NGSA 1JQGA 4MCQA 3V7ZA 2GLJA 2AFOA 5IB9A 3KR4A 2V8HA 1QQ9A 1BLLE 4MRIA 2ZENA 4DJLA 4R76A 3PB7X 4P4EA 1WVMA 3KZWA 5K8NA 2NSMA 3IJ3A 6CPAA 1CP6A 2NYQA 3B3VA 2Q51A 4A37A 4TWEA 3H8FA 2ZEDA 2V77A 1M4LA 4NJRA 2IJZA 1KWMA 2AFZA 2J9AA 1TKHA 4DUKA 3RZAA 1PCAA 1BPNA 4X8IA 4TNUA 3D7FA 4NGRA 4C9AA 3JRUA 2ZEHA 3NH5A 4OC0A 1OBRA 1TF8A 5CBMA 2PJ8A 2CTCA 3PFOA 4F9UA 1LAPA 1VIXA 4NGTA 4UF4A 4JZ0A 2OOTA 1H8LA 2PJ1A 3KHXA 4YN3A 4C8UA 2QVPA 3HUVA 1Z8LA 4FAIA 4OIWA 1CBXA 4MHPA 2XEJA 2PJ5A 2OR4A 1F2OA 1Y0RA 2ABZA 1Y9ZA 3VH9A 1ARMA 4FBEA 4WJBA 2V8GA 3KQXA 3VARA 1GYTA 1Y7EA 2XEFA 2AFWA 2V8VA 3PFEA 1YMEA 2F7VA 2PJ0A 2ZOFA 5JM6A 1V6CA 2PIYA 2BCOA 2HB6A 5LYDA 3B7IA 5K8OA 5DS0A 3HLPA 4B6ZA 2EK9A 1XRYA 3FF3A 3S9MA 5K8PA 2ZEMA 3PRTA 2JEWA 3SI0A 4P4BA 4PXDA 2PJCA 2F8HA 4EWTA 4OC1A 3S9NA 2PJBA 3SJEA 4RUHA 5I4MA 4LQGA 2EK8A 3FX6A 5LYIA 1CP7A 5LRKA 3KL9A 5HXDA 4NGQA 4TJXA 3PB4X 2PCUA 3S9LA 1LFWA 3FJUA 4MXUA 2ZEOA 3NFZA 4C8FA 4R8FA 2GU2A 1Z2LA 1CX8A 1NSAA 3D66A 3D68A 1R43A 2PJ7A 3TC8A 1YLOA 2WZNA 3IIBA 4C8PA 2JBJA 1F2PA 2C6CA 4MMOA 2Q4ZA 1CPSA 3D7DA 4YWYA 3KHZA 2IQ6A 4P4DA 1DTDA 1XJOA 4MCSA 4R6TA 5K8MA 5THWA 4ZI6A 3SI2A 4A38A 3IFEA 4P45A 2GREA 3NA6A 3RAMA 3KQZA 3B3CA 3IC1A 1BAVA 2ZOGA 3WC5A 2EWBA 4C84A 2O53A 1CG2A
chains in the Genus database with same CATH superfamily
4GS4A 1UWYA 1HDUA 2R98A 2AUNA 1M4IA 4P44A 2ZEEA 1M4DA 2AJ6A 4UCMA 4ZYQA 4W9YA 3OAKA 1KUVA 2YNCA 4U9ZA 4C9UA 2DLAA 1RXTA 3CT9A 3IWGA 3CZXA 5IB0A 3GLJA 2XPLA 2DPTA 3N7ZA 4ONUA 2OZHA 2QYVA 4FD5A 4KSAA 2QMLA 4PSXA 5AXIA 4PXBA 4NFRA 3B8GA 3R1KA 3D7HA 5JGFA 4C9RA 4KSIA 3T8WA 3CDXA 2JDCA 4G1PA 3R96A 1T36B 5HVFA 3KASA 3NOJA 2X7BA 4C9VA 1S5KA 1QSRA 2PVVA 1TXRA 4E94A 3SXOA 4KVXA 3LMSA 4NGPA 5LRJA 2AUMA 1NXJA 2FL4A 3HMJG 2REEA 2GFQA 3QNVA 1IGBA 1S7KA 3SHPA 1MJBA 3TE4A 4IK2A 4DYOA 3PT1A 2IMOA 4KLWA 5F9MA 2FIAA 2Q7BA 3V38A 2CTBA 4EFDA 2CY2A 3D67A 1S60A 3I3GA 3B35A 4KOTA 2ARHA 4BPUB 1NMTA 1LOKA 4OC2A 3RBUA 1OZPA 2I00A 2Q43A 1ZG8A 1U6MA 4H6UA 1CE8B 4E8OA 5A28A 4EYSA 3SJGA 3CXPA 1XMTA 1S7LA 2V8DA 2VKZG 1QSNA 2O4HA 2AFMA 2YGWA 3EO4A 3FMCA 4PQAA 3T9YA 4F0YA 2DEAA 4FWUA 2MP0A 4C8AA 1DE4C 1YSJA 3D2PA 4B5OA 1FY7A 3IWEA 5LYLA 5K99A 1M44A 3CPXA 1LANA 2C1CA 4NJQA 1PU9A 1RTQA 3PB6X 4PXCA 1L0CA 3WR7A 2E28A 4BPWB 2IL4A 2PJAA 1KC7A 2Z0ZA 2CBLA 4QC6A 4COGA 3KI9A 4P6YA 4IHMA 4UWJA 1NBWA 3U1BA 3SJXA 3BHXA 1LRZA 2G3TA 4CDKA 5ISVA 3PB8X 1YW4A 1B6BA 4MBUA 2C5QA 3RNZA 2JLMA 2QJ8A 3LD2A 4EMEA 4E5SA 4LUAA 1LCPA 3BJ7A 3K9TA 4MJ8A 1EE3P 4JWPA 3BI0A 4CDJA 4HPSA 4HKFA 2BOAA 2VBQA 1S3ZA 4OKOA 4UIBA 1J3LA 2HQYA 3PFVA 3SR3A 3TLBA 1A2ZA 1IU8A 1XBUA 1ZG7A 4MCRA 4E2AA 2ZEPA 3S6HA 1IYKA 4CYPA 5AG6A 2CIJA 1N71A 1YR0A 2BSWA 2HC9A 3P2HA 2PR8A 4FUUA 3TO9A 4J3GA 3FBUA 1I12A 3FH4A 4C7IA 2P6FA 3ZNIA 1MK4A 3D8PA 3BUMB 1IY7A 1Z8TA 1XOVA 4B5PB 4A2ZA 1MJ9A 2ZEGA 4X3RA 4P4JA 2O28A 2RC4A 4R3KA 2ZW5A 4O23A 1Q7LA 4U5YA 3SI1A 4CPAA 4FD6A 4B12A 3I6SA 2C6GA 1VHOA 4IIYA 1HDQA 2GIVA 1ZYMA 4PK2A 2DXQA 2I79A 2PRBA 4UWIA 2BO9A 1ARLA 4AG9A 2VXKA 4C8TA 7CPAA 1YVKA 1EZAA 4K3NA 4IAVA 3KRVA 4QVTA 1NE9A 3I9SA 4OP4A 2PRQA 1FNOA 5H86A 1R57A 2PJ9A 5JQ4A 3DNSA 5F48A 1LAMA 2YNDA 2ZEFA 3FEDA 2Y1MA 1YW6A 2D4OA 3BLNA 3GUXA 3BXMA 2B58A 4ONWA 3VATA 3H4QA 3H8GA 4K30A 4RI1A 2B4DA 2Y0MA 4ZY1A 1IYLA 4KVME 4CAFA 2C6PA 1XMBA 3IGRA 4Y49B 4C9EA 1XEBA 3TX8A 4H1HA 4P10A 3DGVA 4ZX8A 4AXVA 1TIQA 2P6GA 2J8NA 5HKWA 2POKA 2RB7A 4KNGE 3GB0A 2HUZA 2PJ2A 2C27A 5CPAA 3ZJ0A 2F5IA 3VRQA 3GIUA 4F8ZA 5JVLA 3K2KA 4COBA 3H5ZA 4CGPA 2VI7A 4QUSA 4DNCA 3IEHA 3MN8A 5C88A 3FVLA 2Q44A 5LRGA 1TKJA 1YREA 2EZAA 4RS2A 2UV8G 3BUXB 4MHYA 3SJFA 3PGPA 3FECA 3PLFB 4A94A 4EVYA 2AFUA 5JH9A 2D4PA 4A32A 4BTFA 4AVCA 2HWGA 4JVOA 1EO0A 4QBJA 5D29A 1PUAA 1CJWA 3B3SA 1R61A 4MI1A 1B47A 2B5GB 3PB9X 3B3TA 4XNHB 4TJVA 4LQ6A 3KR5A 2EUIA 4C99A 3DDDA 1CPXA 4OIDA 2XEGA 2OH1A 4C8CA 4BBHA 4UIAA 2ANPA 2ZELA 1Q2CA 1Z5RA 3PBBA 4A30A 3F5BA 2FE7A 2WYRA 1ELMP 5G1ZA 4OMEA 2G9DA 3T90A 4C2YA 1ZO0A 2VEZA 3KGQA 4UEEA 1TF9A 4X5KA 3BI1A 4GM5A 4CAEA 2OZUA 3D7GA 2GLFA 3ISZA 5IV0A 3ICUA 1QSOA 3VGOA 2ODFA 2QECA 2HV2A 4B11A 5F09A 2QIRA 2OB0A 3K9UA 1GHEA 3PEIA 4X2TA 3NE8A 4KOVA 4Q38A 3V8IA 3T05A 4C85A 1WJTA 1ON0A 2Q0YA 4KS9A 1F57A 2XEIA 3L2NA 3B2YA 4L89A 1BPMA 3F9KC 4U9YA 4GXHA 2FS5A 4M85A 4XPDB 1AMPA 5ELYA 2D0OA 4MHNA 3TLGB 4I49A 3QAYA 4OAEA 4CRZB 4KLVA 1ZG9A 4ZY0A 2PJ6A 2VL1A 4Y49C 4OC5A 5HVHA 5C82A 5J1QA 2ZPAA 3TLCA 2CF4A 1ZL0A 2Z10A 4C68A 5F1YA 4JJXA 2A4NA 3VRNA 3VRRA 2I3CA 1YVOA 4OLLA 2PSWA 2AFSA 3H8EA 2OLSA 1Y0YA 3LWUA 5HVGA 4RR2B 1WK4A 4NF1A 2CXAA 1Z9EA 4HNXB 4F0XA 5DWMA 3W6XA 3EZAA 1KEEB 1TKFA 3B3WA 4BD9A 3GJZA 4A39A 2RFHA 2EZCA 2PVWA 3P2FA 3C26A 4MHDA 4CAWA 1X12A 4M8DA 4OADA 2WUUA 4WWVA 4UBRA 5KTAA 3S6KA 4CGNA 1Y9KA 1J4JA 2FIWA 8CPAA 4B13A 3PP9A 3EIFA 3OWCA 3WC7A 4XNHC 1VGYA 4MFQA 1VI4A 1XF1A 3FEEA 4Q7AA 4F9VA 1B87A 1RO5A 1QMUA 3GKRA 4MI4A 1PYTB 2PJ3A 3W6SA 5JPHA 2N3AB 3N5FA 4KUAA 3MRUA 1YX0A 4CYOA 4NGMA 1KUXA 5D8NA 4YGOA 1JDBC 2DF5A 2JBKA 2FVGA 2Z3MA 3IWWA 3PZJA 1VBHA 4GPLB 1FT7A 4PSWA 2AE6A 4AVAA 1VKCA 4AVBA 4B10A 4UCPA 2B3VA 2P6EA 3ISXA 1X10A 4C86A 4P4FA 3FIXA 1Z8WA 3BJ8A 2PIZA 1WWZA 3FRMA 4AB7A 4CGOA 5EMIA 3TO6A 4P4IA 1ELLP 4NCZA 3NH8A 3DR8A 1HEEA 4B14A 1DIKA 2OZGA 2EVNA 2Q4YA 1AYEA 2K5TA 4XPDC 5CNPA 2BEIA 3K4IA 4ZX9A 2GP4A 3NFQA 3DLJA 4UFXA 2GE3A 4MHZA 1Z4RA 4FD7A 4UEFA 1C3OB 2HROA 4JXRA 3TTHA 2ZXVA 4NEXA 3BUNB 3R9GA 1P4NA 3TOAA 4MCPA 1Q2DA 4OC3A 1VHEA 2J8RA 3WT4A 1Z8XA 4PV6A 5KTDA 3IO1A 4ZBGA 3W91A 2AFXA 4JYWA 3T5MA 4PPZA 2H5MA 4OC4A 3WC6A 2HI6A 2FCKA 3D4UA 1Q2YA 1ZLIA 3CPAA 3I74A 4L8AA 1SQHA 3D2MA 4R7MA 4AG7A 2Y1NA 4BINA 2Q04A 2PJ4A 4UEZA 1UFHA 3EFAA 3G8WA 4ZY2A 4YU9A 1JWQA 3PBEA 2XPPA 1R3NA 5A27A 2KCWA 5AG4A 5E96A 1EZBA 4YRHA 1KUYA 3I1UA 1XFOA 3EY5A 3R95A 2R8VA 5F5XA 4NGNA 4H2KA 4KZTA 4MJXA 1QSMA 4JXQA 4Z65A 1S7NA 4PXEA 1ZLHA 3HPHE 2G3AA 2PE3A 4M6GA 5LYFA 4CO9A 2R1IA 3FB3A 3NH4A 3JVNA 2ZW6A 4UFWA 3WABA 1Q5XA 4NGSA 3TT2A 1JQGA 2R82A 5KTCA 4MCQA 3V7ZA 3TOBA 2GLJA 2B4JC 4MFJA 4MFKA 4CGLA 2AFOA 5G21A 5IB9A 2PQ8A 1M1DA 4TJXA 5AGEA 3OP0A 4YFJA 3KR4A 4C2XA 4HNYB 1MJAA 3HPGG 3ZZIA 3VRPA 2G0BA 2V8HA 1GGOA 1QQ9A 1BOBA 3S6GA 1BLLE 4R57A 1K4JA 1KBLA 1AUGA 3QAHA 4M3SA 4MRIA 2ZENA 2FXFA 2Z3KA 4FD4A 4JD6A 4DJLA 4R76A 4F6AA 3VWDA 4IUSA 4Q36A 3PB7X 4P4EA 1WVMA 4ZGYB 1CS0B 4IF5A 4KOUA 1VBGA 3F0AA 3KZWA 3EZBA 3T07A 5J3XA 5K8NA 2NSMA 3IJ3A 4RN7A 6CPAA 1CP6A 2NYQA 3B3VA 3FNCA 5AG7A 1I21A 4CGMA 2Q7SA 4B5PA 2B0AA 3TYXA 4KVOE 4A31A 2Q51A 1Z4EA 2NMTA 2ATRA 4A37A 3G3SA 3R9EA 1YGHA 3H8FA 2ZEDA 2V77A 4TWEA 4CYQA 1M4LA 4NJRA 2IJZA 3UY5A 1KWMA 2AFZA 2CNTA 2J9AA 1TKHA 5IX3A 4DUKA 3RZAA 2YNCC 3EZEA 5I0CA 4A95A 2CNSA 1PCAA 1BPNA 3TLYA 4BPXB 2WPXA 3IU1A 2B4BA 4X8IA 4TNUA 4KOXA 3D7FA 5BWAB 4NGRA 4C9AA 2PC1A 1M4GA 1QSTA 3JRUA 2ZEHA 3NH5A 3OB2B 3TLAA 4OC0A 4KUBA 1OBRA 1TF8A 5F47A 2PJ8A 2CTCA 3PFOA 4MFPA 4F9UA 5CBMA 2VQYA 1LAPA 5HKYA 1VIXA 3TLZA 4NGTA 4MFZA 5GCNA 1IICA 4UF4A 3GYAA 2FT0A 1Z9UA 4JZ0A 4CZ1A 2OOTA 1H8LA 2PJ1A 3DR6A 2Z3LA 3KHXA 4YN3A 1V0CA 4C8UA 5F13A 5G20A 4A33A 2QVPA 2ZW7A 1VHSA 5EBVA 3HUVA 1Z8LA 4FAIA 4OIWA 1CBXA 4MHPA 2XEJA 1CM0A 2PJ5A 5HKZA 2OR4A 1F2OA 1Y0RA 2ABZA 3VWEA 1Y9ZA 4KOWA 3VH9A 5FD8A 1ARMA 4CS0B 4FBEA 3VTAA 2B5GA 4WJBA 2V8GA 3KQXA 5J8FA 3BUWB 1GYTA 1Y7EA 4ORFA 3VARA 2XEFA 2AFWA 2V8VA 3C8OA 3PFEA 1YMEA 2F7VA 2Z3PA 2PJ0A 2JEVA 2ZOFA 4R87A 5JM6A 2EZBA 5FVJA 3RO0A 1V6CA 1ZRSA 2PIYA 2BCOA 3D3SA 2HB6A 4MY3A 1BXRB 2YJTA 1P0HA 2B4DB 1S7FA 5LYDA 4J0NA 4INJA 3B7IA 5K8OA 5AG5A 5DS0A 3CXSA 3HLPA 4B6ZA 4C2ZA 2EK9A 3LACA 1XRYA 2B3UA 2PR1A 3FF3A 3VROA 3S9MA 4NSQA 4C7HA 5K8PA 2REFA 2Q4VA 2ZEMA 4KOSA 5JYBA 1YLEA 5BY0A 3TCVA 3O8ZA 3PRTA 5HMNA 3F8KA 2JEWA 2VZYA 3SI0A 4UCNA 2D0PA 1IIDA 1YQEA 3GY9A 4KOYA 4H89A 2ZW4A 3TLGA 4P4BA 4PXDA 2PJCA 3A9LA 4KORA 2F8HA 4NXYA 2OU2A 4EWTA 4OC1A 3S9NA 4UFVA 2PJBA 3EC4A 4CYNA 3JTKA 3SJEA 3E0KA 3R9FA 3FXTA 4LQGA 1XIXA 5H84A 2EK8A 1IOIA 4RUHA 5I4MA 3FX6A 5LYIA 4CAVA 1CP7A 2EO8A 2BL1A 5LRKA 3T0TA 3KL9A 2PCNA 5HXDA 4NGQA 3LODA 4A4BA 2DPSA 2R7HA 2VZZA 3PB4X 4XPLA 4HNWB 3U88C 2YNEA 3RYOA 1YVHA 4R9MA 2WPWA 2PCUA 3S9LA 2PDOA 2DIKA 2X0SA 1LFWA 3BUOB 3FJUA 2FSRA 5G22A 4MXUA 2ZEOA 2EBJA 3TFYA 1XF8A 1IB1E 3NE7A 3SXNA 3NFZA 2XPNA 3S6FA 3OB1B 3QB8A 4QB9A 4C8FA 4H6ZA 4R8FA 1KZFA 2GU2A 4MY0A 4UA3A 1Z2LA 1XE4A 1CX8A 1A9XB 1C30B 1NSAA 2P0WA 3D66A 4E0AA 2FM4A 3D68A 3G23A 3KKWA 4IIXA 4CAXA 1R43A 1FBVA 5J8CA 2PJ7A 3TC8A 1YLOA 4R3LA 2CNMA 2WZNA 3IIBA 5F49A 1NSLA 4C8PA 1Y9WA 2JBJA 1IOFA 1F2PA 3IU2A 4M6IA 2Z3OA 5DWNA 5F46A 4JLYA 4II9A 2C6CA 1Y7RA 3MGDA 4MFLA 4MMOA 2Q4ZA 1CPSA 3D7DA 2BUEA 3KHZA 4YWYA 2WSAA 2IQ6A 4P4DA 1DTDA 3TO7A 1XJOA 4MCSA 4R6TA 5EC4A 4PK3A 5K8MA 5IR2A 2GANA 2XPOA 3JUWA 5THWA 4CRYB 1I1DA 4ZI6A 3SI2A 1YK3A 3FYNA 4KSFA 4A38A 4M6HA 5HH1A 1M6VB 3IFEA 4P45A 2GREA 4LX9A 3EXNA 4BMHA 2Z3NA 4XPKA 3NA6A 3RAMA 2Z11A 3KQZA 3B3CA 3IC1A 2J8MA 1BAVA 2ZOGA 3WC5A 2EWBA 3TLEA 4C84A 2O53A 1JDEA 3CXQA 3DSBA 2YJVA 1BO4A 2JDDA 4A4CA 1CG2A
chains in the Genus database with same CATH topology
1UWYA 1HDUA 4P44A 2ZEEA 4ZYQA 4W9YA 4C9UA 3CT9A 3GLJA 2QYVA 4PXBA 4NFRA 3D7HA 5JGFA 4C9RA 4KSIA 3T8WA 3CDXA 4G1PA 5HVFA 3KASA 4C9VA 2PVVA 1TXRA 3LMSA 4NGPA 5LRJA 3QNVA 1IGBA 4IK2A 4DYOA 2IMOA 3V38A 2CTBA 4EFDA 3D67A 3B35A 1LOKA 4OC2A 3RBUA 2Q43A 1ZG8A 3SJGA 2V8DA 3FMCA 2O4HA 4PQAA 2AFMA 2DEAA 4FWUA 4C8AA 1DE4C 1YSJA 5LYLA 3CPXA 1LANA 2C1CA 4NJQA 4PXCA 1RTQA 3PB6X 2PJAA 3KI9A 4P6YA 4IHMA 3SJXA 3BHXA 4CDKA 3PB8X 1YW4A 2C5QA 2QJ8A 4EMEA 1LCPA 3K9TA 1EE3P 4CDJA 3BI0A 2BOAA 4OKOA 4UIBA 1XBUA 1ZG7A 4MCRA 2ZEPA 2CIJA 2HC9A 4FUUA 3FH4A 1IY7A 2ZEGA 4X3RA 4P4JA 3SI1A 4O23A 1Q7LA 3I6SA 4CPAA 2C6GA 1VHOA 1HDQA 2BO9A 1ARLA 4C8TA 7CPAA 4K3NA 4IAVA 4OP4A 2PRQA 1FNOA 2PJ9A 1LAMA 2ZEFA 3FEDA 1YW6A 4ONWA 3GUXA 3BXMA 3VATA 3H8GA 4ZY1A 4C9EA 2C6PA 1XMBA 3TX8A 4P10A 3DGVA 4ZX8A 4AXVA 2POKA 2RB7A 4KNGE 3GB0A 2PJ2A 5CPAA 4F8ZA 3K2KA 3IEHA 3MN8A 3FVLA 5LRGA 1TKJA 4MHYA 3SJFA 3FECA 4A94A 3VTAA 5JH9A 2AFUA 5D29A 3B3SA 4TJVA 3PB9X 3B3TA 3KR5A 4C99A 1CPXA 4OIDA 2XEGA 4C8CA 4UIAA 2ANPA 2ZELA 1Z5RA 3PBBA 2WYRA 1ELMP 4OMEA 2G9DA 3KGQA 4UEEA 1TF9A 3BI1A 4GM5A 3ISZA 3D7GA 2GLFA 3ICUA 5F09A 3PEIA 4X2TA 4C85A 1F57A 2XEIA 3L2NA 3B2YA 1BPMA 1AMPA 5ELYA 4MHNA 1ZG9A 4ZY0A 2PJ6A 2VL1A 4OC5A 5HVHA 5J1QA 2CF4A 2I3CA 2AFSA 3H8EA 1Y0YA 3LWUA 5HVGA 1TKFA 3B3WA 4BD9A 4A39A 2RFHA 2PVWA 4WWVA 8CPAA 3EIFA 3WC7A 1VGYA 1XF1A 3FEEA 4Q7AA 4F9VA 1QMUA 1PYTB 2PJ3A 3N5FA 3MRUA 4NGMA 5D8NA 2FVGA 2JBKA 3IWWA 1FT7A 3ISXA 4C86A 4P4FA 2PIZA 4P4IA 1ELLP 3NH8A 1HEEA 1AYEA 4ZX9A 2GP4A 3DLJA 4MHZA 4UEFA 4MCPA 4OC3A 1VHEA 3WT4A 3IO1A 2AFXA 4JYWA 4PPZA 4OC4A 3WC6A 3D4UA 1ZLIA 3I74A 3CPAA 4R7MA 2PJ4A 4UEZA 4ZY2A 4YU9A 3PBEA 1R3NA 3I1UA 1XFOA 4NGNA 4H2KA 4Z65A 4PXEA 1ZLHA 2PE3A 5LYFA 3NH4A 3WABA 4NGSA 1JQGA 4MCQA 3V7ZA 2GLJA 2AFOA 5IB9A 3KR4A 2V8HA 1QQ9A 1BLLE 4MRIA 2ZENA 4DJLA 4R76A 3PB7X 4P4EA 1WVMA 3KZWA 5K8NA 2NSMA 3IJ3A 6CPAA 1CP6A 2NYQA 3B3VA 2Q51A 4A37A 4TWEA 3H8FA 2ZEDA 2V77A 1M4LA 4NJRA 2IJZA 1KWMA 2AFZA 2J9AA 1TKHA 4DUKA 3RZAA 1PCAA 1BPNA 4X8IA 4TNUA 3D7FA 4NGRA 4C9AA 3JRUA 2ZEHA 3NH5A 4OC0A 1OBRA 1TF8A 5CBMA 2PJ8A 2CTCA 3PFOA 4F9UA 1LAPA 1VIXA 4NGTA 4UF4A 4JZ0A 2OOTA 1H8LA 2PJ1A 3KHXA 4YN3A 4C8UA 2QVPA 3HUVA 1Z8LA 4FAIA 4OIWA 1CBXA 4MHPA 2XEJA 2PJ5A 2OR4A 1F2OA 1Y0RA 2ABZA 1Y9ZA 3VH9A 1ARMA 4FBEA 4WJBA 2V8GA 3KQXA 3VARA 1GYTA 1Y7EA 2XEFA 2AFWA 2V8VA 3PFEA 1YMEA 2F7VA 2PJ0A 2ZOFA 5JM6A 1V6CA 2PIYA 2BCOA 2HB6A 5LYDA 3B7IA 5K8OA 5DS0A 3HLPA 4B6ZA 2EK9A 1XRYA 3FF3A 3S9MA 5K8PA 2ZEMA 3PRTA 2JEWA 3SI0A 4P4BA 4PXDA 2PJCA 2F8HA 4EWTA 4OC1A 3S9NA 2PJBA 3SJEA 4RUHA 5I4MA 4LQGA 2EK8A 3FX6A 5LYIA 1CP7A 5LRKA 3KL9A 5HXDA 4NGQA 4TJXA 3PB4X 2PCUA 3S9LA 1LFWA 3FJUA 4MXUA 2ZEOA 3NFZA 4C8FA 4R8FA 2GU2A 1Z2LA 1CX8A 1NSAA 3D66A 3D68A 1R43A 2PJ7A 3TC8A 1YLOA 2WZNA 3IIBA 4C8PA 2JBJA 1F2PA 2C6CA 4MMOA 2Q4ZA 1CPSA 3D7DA 4YWYA 3KHZA 2IQ6A 4P4DA 1DTDA 1XJOA 4MCSA 4R6TA 5K8MA 5IR2A 5THWA 4ZI6A 3SI2A 4A38A 3IFEA 4P45A 2GREA 3NA6A 3RAMA 3KQZA 3B3CA 3IC1A 1BAVA 2ZOGA 3WC5A 2EWBA 4C84A 2O53A 1CG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWY A;  1HDU A;  4P44 A;  2ZEE A;  4ZYQ A;  4W9Y A;  4C9U A;  3CT9 A;  3GLJ A;  2QYV A;  4PXB A;  4NFR A;  3D7H A;  5JGF A;  4C9R A;  4KSI A;  3T8W A;  3CDX A;  4G1P A;  5HVF A;  3KAS A;  4C9V A;  2PVV A;  1TXR A;  3LMS A;  4NGP A;  5LRJ A;  3QNV A;  1IGB A;  4IK2 A;  4DYO A;  2IMO A;  3V38 A;  2CTB A;  4EFD A;  3D67 A;  3B35 A;  1LOK A;  4OC2 A;  3RBU A;  2Q43 A;  1ZG8 A;  3SJG A;  2V8D A;  3FMC A;  2O4H A;  4PQA A;  2AFM A;  2DEA A;  4FWU A;  4C8A A;  1DE4 C;  1YSJ A;  5LYL A;  3CPX A;  1LAN A;  2C1C A;  4NJQ A;  4PXC A;  1RTQ A;  3PB6 X;  2PJA A;  3KI9 A;  4P6Y A;  4IHM A;  3SJX A;  3BHX A;  4CDK A;  3PB8 X;  1YW4 A;  2QJ8 A;  4EME A;  1LCP A;  3K9T A;  1EE3 P;  4CDJ A;  3BI0 A;  2BOA A;  4OKO A;  4UIB A;  1XBU A;  1ZG7 A;  4MCR A;  2ZEP A;  2CIJ A;  2HC9 A;  4FUU A;  3FH4 A;  1IY7 A;  2ZEG A;  4X3R A;  4P4J A;  3SI1 A;  4O23 A;  1Q7L A;  3I6S A;  4CPA A;  2C6G A;  1VHO A;  1HDQ A;  2BO9 A;  1ARL A;  4C8T A;  7CPA A;  4K3N A;  4IAV A;  4OP4 A;  2PRQ A;  1FNO A;  2PJ9 A;  1LAM A;  2ZEF A;  3FED A;  1YW6 A;  4ONW A;  3GUX A;  3BXM A;  3VAT A;  3H8G A;  4ZY1 A;  4C9E A;  2C6P A;  1XMB A;  3TX8 A;  4P10 A;  3DGV A;  4ZX8 A;  4AXV A;  2POK A;  2RB7 A;  4KNG E;  3GB0 A;  2PJ2 A;  5CPA A;  4F8Z A;  3K2K A;  3IEH A;  3MN8 A;  3FVL A;  5LRG A;  1TKJ A;  4MHY A;  3SJF A;  3FEC A;  4A94 A;  3VTA A;  5JH9 A;  2AFU A;  5D29 A;  3B3S A;  4TJV A;  3PB9 X;  3B3T A;  3KR5 A;  4C99 A;  1CPX A;  4OID A;  2XEG A;  4C8C A;  4UIA A;  2ANP A;  2ZEL A;  1Z5R A;  3PBB A;  2WYR A;  1ELM P;  4OME A;  2G9D A;  3KGQ A;  4UEE A;  1TF9 A;  3BI1 A;  4GM5 A;  3ISZ A;  3D7G A;  2GLF A;  3ICU A;  5F09 A;  3PEI A;  4X2T A;  4C85 A;  1F57 A;  2XEI A;  3L2N A;  3B2Y A;  1BPM A;  1AMP A;  5ELY A;  4MHN A;  1ZG9 A;  4ZY0 A;  2PJ6 A;  2VL1 A;  4OC5 A;  5HVH A;  5J1Q A;  2CF4 A;  2I3C A;  2AFS A;  3H8E A;  1Y0Y A;  3LWU A;  5HVG A;  1TKF A;  3B3W A;  4BD9 A;  4A39 A;  2RFH A;  2PVW A;  4WWV A;  8CPA A;  3EIF A;  3WC7 A;  1VGY A;  1XF1 A;  3FEE A;  4Q7A A;  4F9V A;  1QMU A;  1PYT B;  2PJ3 A;  3N5F A;  3MRU A;  4NGM A;  5D8N A;  2FVG A;  2JBK A;  3IWW A;  1FT7 A;  3ISX A;  4C86 A;  4P4F A;  2PIZ A;  4P4I A;  1ELL P;  3NH8 A;  1HEE A;  1AYE A;  4ZX9 A;  3DLJ A;  4MHZ A;  4UEF A;  4MCP A;  4OC3 A;  1VHE A;  3WT4 A;  3IO1 A;  2AFX A;  4JYW A;  4PPZ A;  4OC4 A;  3WC6 A;  3D4U A;  1ZLI A;  3I74 A;  3CPA A;  4R7M A;  2PJ4 A;  4UEZ A;  4ZY2 A;  4YU9 A;  3PBE A;  1R3N A;  3I1U A;  1XFO A;  4NGN A;  4H2K A;  4Z65 A;  4PXE A;  1ZLH A;  2PE3 A;  5LYF A;  3NH4 A;  3WAB A;  4NGS A;  1JQG A;  4MCQ A;  3V7Z A;  2GLJ A;  2AFO A;  5IB9 A;  3KR4 A;  2V8H A;  1QQ9 A;  1BLL E;  4MRI A;  2ZEN A;  4DJL A;  4R76 A;  3PB7 X;  4P4E A;  1WVM A;  3KZW A;  5K8N A;  2NSM A;  3IJ3 A;  6CPA A;  1CP6 A;  2NYQ A;  3B3V A;  2Q51 A;  4A37 A;  4TWE A;  3H8F A;  2ZED A;  2V77 A;  1M4L A;  4NJR A;  2IJZ A;  1KWM A;  2AFZ A;  2J9A A;  1TKH A;  4DUK A;  3RZA A;  1PCA A;  1BPN A;  4X8I A;  4TNU A;  3D7F A;  4NGR A;  4C9A A;  3JRU A;  2ZEH A;  3NH5 A;  4OC0 A;  1OBR A;  1TF8 A;  5CBM A;  2PJ8 A;  2CTC A;  3PFO A;  4F9U A;  1LAP A;  1VIX A;  4NGT A;  4UF4 A;  4JZ0 A;  2OOT A;  1H8L A;  2PJ1 A;  3KHX A;  4YN3 A;  4C8U A;  2QVP A;  3HUV A;  1Z8L A;  4FAI A;  4OIW A;  1CBX A;  4MHP A;  2XEJ A;  2PJ5 A;  2OR4 A;  1F2O A;  1Y0R A;  2ABZ A;  1Y9Z A;  3VH9 A;  1ARM A;  4FBE A;  4WJB A;  2V8G A;  3KQX A;  3VAR A;  1GYT A;  1Y7E A;  2XEF A;  2AFW A;  2V8V A;  3PFE A;  1YME A;  2F7V A;  2PJ0 A;  2ZOF A;  5JM6 A;  1V6C A;  2PIY A;  2BCO A;  2HB6 A;  5LYD A;  3B7I A;  5K8O A;  5DS0 A;  3HLP A;  4B6Z A;  2EK9 A;  1XRY A;  3FF3 A;  3S9M A;  5K8P A;  2ZEM A;  3PRT A;  2JEW A;  3SI0 A;  4P4B A;  4PXD A;  2PJC A;  2F8H A;  4EWT A;  4OC1 A;  3S9N A;  2PJB A;  3SJE A;  4RUH A;  5I4M A;  4LQG A;  2EK8 A;  3FX6 A;  5LYI A;  1CP7 A;  5LRK A;  3KL9 A;  5HXD A;  4NGQ A;  4TJX A;  3PB4 X;  2PCU A;  3S9L A;  1LFW A;  3FJU A;  4MXU A;  2ZEO A;  3NFZ A;  4C8F A;  4R8F A;  2GU2 A;  1Z2L A;  1CX8 A;  1NSA A;  3D66 A;  3D68 A;  1R43 A;  2PJ7 A;  3TC8 A;  1YLO A;  2WZN A;  3IIB A;  4C8P A;  2JBJ A;  1F2P A;  2C6C A;  4MMO A;  2Q4Z A;  1CPS A;  3D7D A;  4YWY A;  3KHZ A;  2IQ6 A;  4P4D A;  1DTD A;  1XJO A;  4MCS A;  4R6T A;  5K8M A;  5THW A;  4ZI6 A;  3SI2 A;  4A38 A;  3IFE A;  4P45 A;  2GRE A;  3NA6 A;  3RAM A;  3KQZ A;  3B3C A;  3IC1 A;  1BAV A;  2ZOG A;  3WC5 A;  2EWB A;  4C84 A;  2O53 A;  1CG2 A; 
#chains in the Genus database with same CATH topology
 4GS4 A;  1UWY A;  1HDU A;  2R98 A;  2AUN A;  1M4I A;  4P44 A;  2ZEE A;  1M4D A;  2AJ6 A;  4UCM A;  4ZYQ A;  4W9Y A;  3OAK A;  1KUV A;  2YNC A;  4U9Z A;  4C9U A;  2DLA A;  1RXT A;  3CT9 A;  3IWG A;  3CZX A;  5IB0 A;  3GLJ A;  2XPL A;  2DPT A;  3N7Z A;  4ONU A;  2OZH A;  2QYV A;  4FD5 A;  4KSA A;  2QML A;  4PSX A;  5AXI A;  4PXB A;  4NFR A;  3B8G A;  3R1K A;  3D7H A;  5JGF A;  4C9R A;  4KSI A;  3T8W A;  3CDX A;  2JDC A;  4G1P A;  3R96 A;  1T36 B;  5HVF A;  3KAS A;  3NOJ A;  2X7B A;  4C9V A;  1S5K A;  1QSR A;  2PVV A;  1TXR A;  4E94 A;  3SXO A;  4KVX A;  3LMS A;  4NGP A;  5LRJ A;  2AUM A;  1NXJ A;  2FL4 A;  3HMJ G;  2REE A;  2GFQ A;  3QNV A;  1IGB A;  1S7K A;  3SHP A;  1MJB A;  3TE4 A;  4IK2 A;  4DYO A;  3PT1 A;  2IMO A;  4KLW A;  5F9M A;  2FIA A;  2Q7B A;  3V38 A;  2CTB A;  4EFD A;  2CY2 A;  3D67 A;  1S60 A;  3I3G A;  3B35 A;  4KOT A;  2ARH A;  4BPU B;  1NMT A;  1LOK A;  4OC2 A;  3RBU A;  1OZP A;  2I00 A;  2Q43 A;  1ZG8 A;  1U6M A;  4H6U A;  1CE8 B;  4E8O A;  5A28 A;  4EYS A;  3SJG A;  3CXP A;  1XMT A;  1S7L A;  2V8D A;  2VKZ G;  1QSN A;  2O4H A;  2AFM A;  2YGW A;  3EO4 A;  3FMC A;  4PQA A;  3T9Y A;  4F0Y A;  2DEA A;  4FWU A;  2MP0 A;  4C8A A;  1DE4 C;  1YSJ A;  3D2P A;  4B5O A;  1FY7 A;  3IWE A;  5LYL A;  5K99 A;  1M44 A;  3CPX A;  1LAN A;  2C1C A;  4NJQ A;  1PU9 A;  1RTQ A;  3PB6 X;  4PXC A;  1L0C A;  3WR7 A;  2E28 A;  4BPW B;  2IL4 A;  2PJA A;  1KC7 A;  2Z0Z A;  2CBL A;  4QC6 A;  4COG A;  3KI9 A;  4P6Y A;  4IHM A;  4UWJ A;  1NBW A;  3U1B A;  3SJX A;  3BHX A;  1LRZ A;  2G3T A;  4CDK A;  5ISV A;  3PB8 X;  1YW4 A;  1B6B A;  4MBU A;  2C5Q A;  3RNZ A;  2JLM A;  2QJ8 A;  3LD2 A;  4EME A;  4E5S A;  4LUA A;  1LCP A;  3BJ7 A;  3K9T A;  4MJ8 A;  1EE3 P;  4JWP A;  3BI0 A;  4CDJ A;  4HPS A;  4HKF A;  2BOA A;  2VBQ A;  1S3Z A;  4OKO A;  4UIB A;  1J3L A;  2HQY A;  3PFV A;  3SR3 A;  3TLB A;  1A2Z A;  1IU8 A;  1XBU A;  1ZG7 A;  4MCR A;  4E2A A;  2ZEP A;  3S6H A;  1IYK A;  4CYP A;  5AG6 A;  2CIJ A;  1N71 A;  1YR0 A;  2BSW A;  2HC9 A;  3P2H A;  2PR8 A;  4FUU A;  3TO9 A;  4J3G A;  3FBU A;  1I12 A;  3FH4 A;  4C7I A;  2P6F A;  3ZNI A;  1MK4 A;  3D8P A;  3BUM B;  1IY7 A;  1Z8T A;  1XOV A;  4B5P B;  4A2Z A;  1MJ9 A;  2ZEG A;  4X3R A;  4P4J A;  2O28 A;  2RC4 A;  4R3K A;  2ZW5 A;  4O23 A;  1Q7L A;  4U5Y A;  3SI1 A;  4CPA A;  4FD6 A;  4B12 A;  3I6S A;  2C6G A;  1VHO A;  4IIY A;  1HDQ A;  2GIV A;  1ZYM A;  4PK2 A;  2DXQ A;  2I79 A;  2PRB A;  4UWI A;  2BO9 A;  1ARL A;  4AG9 A;  2VXK A;  4C8T A;  7CPA A;  1YVK A;  1EZA A;  4K3N A;  4IAV A;  3KRV A;  4QVT A;  1NE9 A;  3I9S A;  4OP4 A;  2PRQ A;  1FNO A;  5H86 A;  1R57 A;  2PJ9 A;  5JQ4 A;  3DNS A;  5F48 A;  1LAM A;  2YND A;  2ZEF A;  3FED A;  2Y1M A;  1YW6 A;  2D4O A;  3BLN A;  3GUX A;  3BXM A;  2B58 A;  4ONW A;  3VAT A;  3H4Q A;  3H8G A;  4K30 A;  4RI1 A;  2B4D A;  2Y0M A;  4ZY1 A;  1IYL A;  4KVM E;  4CAF A;  2C6P A;  1XMB A;  3IGR A;  4Y49 B;  4C9E A;  1XEB A;  3TX8 A;  4H1H A;  4P10 A;  3DGV A;  4ZX8 A;  4AXV A;  1TIQ A;  2P6G A;  2J8N A;  5HKW A;  2POK A;  2RB7 A;  4KNG E;  3GB0 A;  2HUZ A;  2PJ2 A;  2C27 A;  5CPA A;  3ZJ0 A;  2F5I A;  3VRQ A;  3GIU A;  4F8Z A;  5JVL A;  3K2K A;  4COB A;  3H5Z A;  4CGP A;  2VI7 A;  4QUS A;  4DNC A;  3IEH A;  3MN8 A;  5C88 A;  3FVL A;  2Q44 A;  5LRG A;  1TKJ A;  1YRE A;  2EZA A;  4RS2 A;  2UV8 G;  3BUX B;  4MHY A;  3SJF A;  3PGP A;  3FEC A;  3PLF B;  4A94 A;  4EVY A;  2AFU A;  5JH9 A;  2D4P A;  4A32 A;  4BTF A;  4AVC A;  2HWG A;  4JVO A;  1EO0 A;  4QBJ A;  5D29 A;  1PUA A;  1CJW A;  3B3S A;  1R61 A;  4MI1 A;  1B47 A;  2B5G B;  3PB9 X;  3B3T A;  4XNH B;  4TJV A;  4LQ6 A;  3KR5 A;  2EUI A;  4C99 A;  3DDD A;  1CPX A;  4OID A;  2XEG A;  2OH1 A;  4C8C A;  4BBH A;  4UIA A;  2ANP A;  2ZEL A;  1Q2C A;  1Z5R A;  3PBB A;  4A30 A;  3F5B A;  2FE7 A;  2WYR A;  1ELM P;  5G1Z A;  4OME A;  2G9D A;  3T90 A;  4C2Y A;  1ZO0 A;  2VEZ A;  3KGQ A;  4UEE A;  1TF9 A;  4X5K A;  3BI1 A;  4GM5 A;  4CAE A;  2OZU A;  3D7G A;  2GLF A;  3ISZ A;  5IV0 A;  3ICU A;  1QSO A;  3VGO A;  2ODF A;  2QEC A;  2HV2 A;  4B11 A;  5F09 A;  2QIR A;  2OB0 A;  3K9U A;  1GHE A;  3PEI A;  4X2T A;  3NE8 A;  4KOV A;  4Q38 A;  3V8I A;  3T05 A;  4C85 A;  1WJT A;  1ON0 A;  2Q0Y A;  4KS9 A;  1F57 A;  2XEI A;  3L2N A;  3B2Y A;  4L89 A;  1BPM A;  3F9K C;  4U9Y A;  4GXH A;  2FS5 A;  4M85 A;  4XPD B;  1AMP A;  5ELY A;  2D0O A;  4MHN A;  3TLG B;  4I49 A;  3QAY A;  4OAE A;  4CRZ B;  4KLV A;  1ZG9 A;  4ZY0 A;  2PJ6 A;  2VL1 A;  4Y49 C;  4OC5 A;  5HVH A;  5C82 A;  5J1Q A;  2ZPA A;  3TLC A;  2CF4 A;  1ZL0 A;  2Z10 A;  4C68 A;  5F1Y A;  4JJX A;  2A4N A;  3VRN A;  3VRR A;  2I3C A;  1YVO A;  4OLL A;  2PSW A;  2AFS A;  3H8E A;  2OLS A;  1Y0Y A;  3LWU A;  5HVG A;  4RR2 B;  1WK4 A;  4NF1 A;  2CXA A;  1Z9E A;  4HNX B;  4F0X A;  5DWM A;  3W6X A;  3EZA A;  1KEE B;  1TKF A;  3B3W A;  4BD9 A;  3GJZ A;  4A39 A;  2RFH A;  2EZC A;  2PVW A;  3P2F A;  3C26 A;  4MHD A;  4CAW A;  1X12 A;  4M8D A;  4OAD A;  2WUU A;  4WWV A;  4UBR A;  5KTA A;  3S6K A;  4CGN A;  1Y9K A;  1J4J A;  2FIW A;  8CPA A;  4B13 A;  3PP9 A;  3EIF A;  3OWC A;  3WC7 A;  4XNH C;  1VGY A;  4MFQ A;  1VI4 A;  1XF1 A;  3FEE A;  4Q7A A;  4F9V A;  1B87 A;  1RO5 A;  1QMU A;  3GKR A;  4MI4 A;  1PYT B;  2PJ3 A;  3W6S A;  5JPH A;  2N3A B;  3N5F A;  4KUA A;  3MRU A;  1YX0 A;  4CYO A;  4NGM A;  1KUX A;  5D8N A;  4YGO A;  1JDB C;  2DF5 A;  2JBK A;  2FVG A;  2Z3M A;  3IWW A;  3PZJ A;  1VBH A;  4GPL B;  1FT7 A;  4PSW A;  2AE6 A;  4AVA A;  1VKC A;  4AVB A;  4B10 A;  4UCP A;  2B3V A;  2P6E A;  3ISX A;  1X10 A;  4C86 A;  4P4F A;  3FIX A;  1Z8W A;  3BJ8 A;  2PIZ A;  1WWZ A;  3FRM A;  4AB7 A;  4CGO A;  5EMI A;  3TO6 A;  4P4I A;  1ELL P;  4NCZ A;  3NH8 A;  3DR8 A;  1HEE A;  4B14 A;  1DIK A;  2OZG A;  2EVN A;  2Q4Y A;  1AYE A;  2K5T A;  4XPD C;  5CNP A;  2BEI A;  3K4I A;  4ZX9 A;  2GP4 A;  3NFQ A;  3DLJ A;  4UFX A;  2GE3 A;  4MHZ A;  1Z4R A;  4FD7 A;  4UEF A;  1C3O B;  2HRO A;  4JXR A;  3TTH A;  2ZXV A;  4NEX A;  3BUN B;  3R9G A;  1P4N A;  3TOA A;  4MCP A;  1Q2D A;  4OC3 A;  1VHE A;  2J8R A;  3WT4 A;  1Z8X A;  4PV6 A;  5KTD A;  3IO1 A;  4ZBG A;  3W91 A;  2AFX A;  4JYW A;  3T5M A;  4PPZ A;  2H5M A;  4OC4 A;  3WC6 A;  2HI6 A;  2FCK A;  3D4U A;  1Q2Y A;  1ZLI A;  3CPA A;  3I74 A;  4L8A A;  1SQH A;  3D2M A;  4R7M A;  4AG7 A;  2Y1N A;  4BIN A;  2Q04 A;  2PJ4 A;  4UEZ A;  1UFH A;  3EFA A;  3G8W A;  4ZY2 A;  4YU9 A;  1JWQ A;  3PBE A;  2XPP A;  1R3N A;  5A27 A;  2KCW A;  5AG4 A;  5E96 A;  1EZB A;  4YRH A;  1KUY A;  3I1U A;  1XFO A;  3EY5 A;  3R95 A;  2R8V A;  5F5X A;  4NGN A;  4H2K A;  4KZT A;  4MJX A;  1QSM A;  4JXQ A;  4Z65 A;  1S7N A;  4PXE A;  1ZLH A;  3HPH E;  2G3A A;  2PE3 A;  4M6G A;  5LYF A;  4CO9 A;  2R1I A;  3FB3 A;  3NH4 A;  3JVN A;  2ZW6 A;  4UFW A;  3WAB A;  1Q5X A;  4NGS A;  3TT2 A;  1JQG A;  2R82 A;  5KTC A;  4MCQ A;  3V7Z A;  3TOB A;  2GLJ A;  2B4J C;  4MFJ A;  4MFK A;  4CGL A;  2AFO A;  5G21 A;  5IB9 A;  2PQ8 A;  1M1D A;  4TJX A;  5AGE A;  3OP0 A;  4YFJ A;  3KR4 A;  4C2X A;  4HNY B;  1MJA A;  3HPG G;  3ZZI A;  3VRP A;  2G0B A;  2V8H A;  1GGO A;  1QQ9 A;  1BOB A;  3S6G A;  1BLL E;  4R57 A;  1K4J A;  1KBL A;  1AUG A;  3QAH A;  4M3S A;  4MRI A;  2ZEN A;  2FXF A;  2Z3K A;  4FD4 A;  4JD6 A;  4DJL A;  4R76 A;  4F6A A;  3VWD A;  4IUS A;  4Q36 A;  3PB7 X;  4P4E A;  1WVM A;  4ZGY B;  1CS0 B;  4IF5 A;  4KOU A;  1VBG A;  3F0A A;  3KZW A;  3EZB A;  3T07 A;  5J3X A;  5K8N A;  2NSM A;  3IJ3 A;  4RN7 A;  6CPA A;  1CP6 A;  2NYQ A;  3B3V A;  3FNC A;  5AG7 A;  1I21 A;  4CGM A;  2Q7S A;  4B5P A;  2B0A A;  3TYX A;  4KVO E;  4A31 A;  2Q51 A;  1Z4E A;  2NMT A;  2ATR A;  4A37 A;  3G3S A;  3R9E A;  1YGH A;  3H8F A;  2ZED A;  2V77 A;  4TWE A;  4CYQ A;  1M4L A;  4NJR A;  2IJZ A;  3UY5 A;  1KWM A;  2AFZ A;  2CNT A;  2J9A A;  1TKH A;  5IX3 A;  4DUK A;  3RZA A;  2YNC C;  3EZE A;  5I0C A;  4A95 A;  2CNS A;  1PCA A;  1BPN A;  3TLY A;  4BPX B;  2WPX A;  3IU1 A;  2B4B A;  4X8I A;  4TNU A;  4KOX A;  3D7F A;  5BWA B;  4NGR A;  4C9A A;  2PC1 A;  1M4G A;  1QST A;  3JRU A;  2ZEH A;  3NH5 A;  3OB2 B;  3TLA A;  4OC0 A;  4KUB A;  1OBR A;  1TF8 A;  5F47 A;  2PJ8 A;  2CTC A;  3PFO A;  4MFP A;  4F9U A;  5CBM A;  2VQY A;  1LAP A;  5HKY A;  1VIX A;  3TLZ A;  4NGT A;  4MFZ A;  5GCN A;  1IIC A;  4UF4 A;  3GYA A;  2FT0 A;  1Z9U A;  4JZ0 A;  4CZ1 A;  2OOT A;  1H8L A;  2PJ1 A;  3DR6 A;  2Z3L A;  3KHX A;  4YN3 A;  1V0C A;  4C8U A;  5F13 A;  5G20 A;  4A33 A;  2QVP A;  2ZW7 A;  1VHS A;  5EBV A;  3HUV A;  1Z8L A;  4FAI A;  4OIW A;  1CBX A;  4MHP A;  2XEJ A;  1CM0 A;  2PJ5 A;  5HKZ A;  2OR4 A;  1F2O A;  1Y0R A;  2ABZ A;  3VWE A;  1Y9Z A;  4KOW A;  3VH9 A;  5FD8 A;  1ARM A;  4CS0 B;  4FBE A;  3VTA A;  2B5G A;  4WJB A;  2V8G A;  3KQX A;  5J8F A;  3BUW B;  1GYT A;  1Y7E A;  4ORF A;  3VAR A;  2XEF A;  2AFW A;  2V8V A;  3C8O A;  3PFE A;  1YME A;  2F7V A;  2Z3P A;  2PJ0 A;  2JEV A;  2ZOF A;  4R87 A;  5JM6 A;  2EZB A;  5FVJ A;  3RO0 A;  1V6C A;  1ZRS A;  2PIY A;  2BCO A;  3D3S A;  2HB6 A;  4MY3 A;  1BXR B;  2YJT A;  1P0H A;  2B4D B;  1S7F A;  5LYD A;  4J0N A;  4INJ A;  3B7I A;  5K8O A;  5AG5 A;  5DS0 A;  3CXS A;  3HLP A;  4B6Z A;  4C2Z A;  2EK9 A;  3LAC A;  1XRY A;  2B3U A;  2PR1 A;  3FF3 A;  3VRO A;  3S9M A;  4NSQ A;  4C7H A;  5K8P A;  2REF A;  2Q4V A;  2ZEM A;  4KOS A;  5JYB A;  1YLE A;  5BY0 A;  3TCV A;  3O8Z A;  3PRT A;  5HMN A;  3F8K A;  2JEW A;  2VZY A;  3SI0 A;  4UCN A;  2D0P A;  1IID A;  1YQE A;  3GY9 A;  4KOY A;  4H89 A;  2ZW4 A;  3TLG A;  4P4B A;  4PXD A;  2PJC A;  3A9L A;  4KOR A;  2F8H A;  4NXY A;  2OU2 A;  4EWT A;  4OC1 A;  3S9N A;  4UFV A;  2PJB A;  3EC4 A;  4CYN A;  3JTK A;  3SJE A;  3E0K A;  3R9F A;  3FXT A;  4LQG A;  1XIX A;  5H84 A;  2EK8 A;  1IOI A;  4RUH A;  5I4M A;  3FX6 A;  5LYI A;  4CAV A;  1CP7 A;  2EO8 A;  2BL1 A;  5LRK A;  3T0T A;  3KL9 A;  2PCN A;  5HXD A;  4NGQ A;  3LOD A;  4A4B A;  2DPS A;  2R7H A;  2VZZ A;  3PB4 X;  4XPL A;  4HNW B;  3U88 C;  2YNE A;  3RYO A;  1YVH A;  4R9M A;  2WPW A;  2PCU A;  3S9L A;  2PDO A;  2DIK A;  2X0S A;  1LFW A;  3BUO B;  3FJU A;  2FSR A;  5G22 A;  4MXU A;  2ZEO A;  2EBJ A;  3TFY A;  1XF8 A;  1IB1 E;  3NE7 A;  3SXN A;  3NFZ A;  2XPN A;  3S6F A;  3OB1 B;  3QB8 A;  4QB9 A;  4C8F A;  4H6Z A;  4R8F A;  1KZF A;  2GU2 A;  4MY0 A;  4UA3 A;  1Z2L A;  1XE4 A;  1CX8 A;  1A9X B;  1C30 B;  1NSA A;  2P0W A;  3D66 A;  4E0A A;  2FM4 A;  3D68 A;  3G23 A;  3KKW A;  4IIX A;  4CAX A;  1R43 A;  1FBV A;  5J8C A;  2PJ7 A;  3TC8 A;  1YLO A;  4R3L A;  2CNM A;  2WZN A;  3IIB A;  5F49 A;  1NSL A;  4C8P A;  1Y9W A;  2JBJ A;  1IOF A;  1F2P A;  3IU2 A;  4M6I A;  2Z3O A;  5DWN A;  5F46 A;  4JLY A;  4II9 A;  2C6C A;  1Y7R A;  3MGD A;  4MFL A;  4MMO A;  2Q4Z A;  1CPS A;  3D7D A;  2BUE A;  3KHZ A;  4YWY A;  2WSA A;  2IQ6 A;  4P4D A;  1DTD A;  3TO7 A;  1XJO A;  4MCS A;  4R6T A;  5EC4 A;  4PK3 A;  5K8M A;  5IR2 A;  2GAN A;  2XPO A;  3JUW A;  5THW A;  4CRY B;  1I1D A;  4ZI6 A;  3SI2 A;  1YK3 A;  3FYN A;  4KSF A;  4A38 A;  4M6H A;  5HH1 A;  1M6V B;  3IFE A;  4P45 A;  2GRE A;  4LX9 A;  3EXN A;  4BMH A;  2Z3N A;  4XPK A;  3NA6 A;  3RAM A;  2Z11 A;  3KQZ A;  3B3C A;  3IC1 A;  2J8M A;  1BAV A;  2ZOG A;  3WC5 A;  2EWB A;  3TLE A;  4C84 A;  2O53 A;  1JDE A;  3CXQ A;  3DSB A;  2YJV A;  1BO4 A;  2JDD A;  4A4C A;  1CG2 A; 
#chains in the Genus database with same CATH homology
 1UWY A;  1HDU A;  4P44 A;  2ZEE A;  4ZYQ A;  4W9Y A;  4C9U A;  3CT9 A;  3GLJ A;  2QYV A;  4PXB A;  4NFR A;  3D7H A;  5JGF A;  4C9R A;  4KSI A;  3T8W A;  3CDX A;  4G1P A;  5HVF A;  3KAS A;  4C9V A;  2PVV A;  1TXR A;  3LMS A;  4NGP A;  5LRJ A;  3QNV A;  1IGB A;  4IK2 A;  4DYO A;  2IMO A;  3V38 A;  2CTB A;  4EFD A;  3D67 A;  3B35 A;  1LOK A;  4OC2 A;  3RBU A;  2Q43 A;  1ZG8 A;  3SJG A;  2V8D A;  3FMC A;  2O4H A;  4PQA A;  2AFM A;  2DEA A;  4FWU A;  4C8A A;  1DE4 C;  1YSJ A;  5LYL A;  3CPX A;  1LAN A;  2C1C A;  4NJQ A;  4PXC A;  1RTQ A;  3PB6 X;  2PJA A;  3KI9 A;  4P6Y A;  4IHM A;  3SJX A;  3BHX A;  4CDK A;  3PB8 X;  1YW4 A;  2C5Q A;  2QJ8 A;  4EME A;  1LCP A;  3K9T A;  1EE3 P;  4CDJ A;  3BI0 A;  2BOA A;  4OKO A;  4UIB A;  1XBU A;  1ZG7 A;  4MCR A;  2ZEP A;  2CIJ A;  2HC9 A;  4FUU A;  3FH4 A;  1IY7 A;  2ZEG A;  4X3R A;  4P4J A;  3SI1 A;  4O23 A;  1Q7L A;  3I6S A;  4CPA A;  2C6G A;  1VHO A;  1HDQ A;  2BO9 A;  1ARL A;  4C8T A;  7CPA A;  4K3N A;  4IAV A;  4OP4 A;  2PRQ A;  1FNO A;  2PJ9 A;  1LAM A;  2ZEF A;  3FED A;  1YW6 A;  4ONW A;  3GUX A;  3BXM A;  3VAT A;  3H8G A;  4ZY1 A;  4C9E A;  2C6P A;  1XMB A;  3TX8 A;  4P10 A;  3DGV A;  4ZX8 A;  4AXV A;  2POK A;  2RB7 A;  4KNG E;  3GB0 A;  2PJ2 A;  5CPA A;  4F8Z A;  3K2K A;  3IEH A;  3MN8 A;  3FVL A;  5LRG A;  1TKJ A;  4MHY A;  3SJF A;  3FEC A;  4A94 A;  3VTA A;  5JH9 A;  2AFU A;  5D29 A;  3B3S A;  4TJV A;  3PB9 X;  3B3T A;  3KR5 A;  4C99 A;  1CPX A;  4OID A;  2XEG A;  4C8C A;  4UIA A;  2ANP A;  2ZEL A;  1Z5R A;  3PBB A;  2WYR A;  1ELM P;  4OME A;  2G9D A;  3KGQ A;  4UEE A;  1TF9 A;  3BI1 A;  4GM5 A;  3ISZ A;  3D7G A;  2GLF A;  3ICU A;  5F09 A;  3PEI A;  4X2T A;  4C85 A;  1F57 A;  2XEI A;  3L2N A;  3B2Y A;  1BPM A;  1AMP A;  5ELY A;  4MHN A;  1ZG9 A;  4ZY0 A;  2PJ6 A;  2VL1 A;  4OC5 A;  5HVH A;  5J1Q A;  2CF4 A;  2I3C A;  2AFS A;  3H8E A;  1Y0Y A;  3LWU A;  5HVG A;  1TKF A;  3B3W A;  4BD9 A;  4A39 A;  2RFH A;  2PVW A;  4WWV A;  8CPA A;  3EIF A;  3WC7 A;  1VGY A;  1XF1 A;  3FEE A;  4Q7A A;  4F9V A;  1QMU A;  1PYT B;  2PJ3 A;  3N5F A;  3MRU A;  4NGM A;  5D8N A;  2FVG A;  2JBK A;  3IWW A;  1FT7 A;  3ISX A;  4C86 A;  4P4F A;  2PIZ A;  4P4I A;  1ELL P;  3NH8 A;  1HEE A;  1AYE A;  4ZX9 A;  2GP4 A;  3DLJ A;  4MHZ A;  4UEF A;  4MCP A;  4OC3 A;  1VHE A;  3WT4 A;  3IO1 A;  2AFX A;  4JYW A;  4PPZ A;  4OC4 A;  3WC6 A;  3D4U A;  1ZLI A;  3I74 A;  3CPA A;  4R7M A;  2PJ4 A;  4UEZ A;  4ZY2 A;  4YU9 A;  3PBE A;  1R3N A;  3I1U A;  1XFO A;  4NGN A;  4H2K A;  4Z65 A;  4PXE A;  1ZLH A;  2PE3 A;  5LYF A;  3NH4 A;  3WAB A;  4NGS A;  1JQG A;  4MCQ A;  3V7Z A;  2GLJ A;  2AFO A;  5IB9 A;  3KR4 A;  2V8H A;  1QQ9 A;  1BLL E;  4MRI A;  2ZEN A;  4DJL A;  4R76 A;  3PB7 X;  4P4E A;  1WVM A;  3KZW A;  5K8N A;  2NSM A;  3IJ3 A;  6CPA A;  1CP6 A;  2NYQ A;  3B3V A;  2Q51 A;  4A37 A;  4TWE A;  3H8F A;  2ZED A;  2V77 A;  1M4L A;  4NJR A;  2IJZ A;  1KWM A;  2AFZ A;  2J9A A;  1TKH A;  4DUK A;  3RZA A;  1PCA A;  1BPN A;  4X8I A;  4TNU A;  3D7F A;  4NGR A;  4C9A A;  3JRU A;  2ZEH A;  3NH5 A;  4OC0 A;  1OBR A;  1TF8 A;  5CBM A;  2PJ8 A;  2CTC A;  3PFO A;  4F9U A;  1LAP A;  1VIX A;  4NGT A;  4UF4 A;  4JZ0 A;  2OOT A;  1H8L A;  2PJ1 A;  3KHX A;  4YN3 A;  4C8U A;  2QVP A;  3HUV A;  1Z8L A;  4FAI A;  4OIW A;  1CBX A;  4MHP A;  2XEJ A;  2PJ5 A;  2OR4 A;  1F2O A;  1Y0R A;  2ABZ A;  1Y9Z A;  3VH9 A;  1ARM A;  4FBE A;  4WJB A;  2V8G A;  3KQX A;  3VAR A;  1GYT A;  1Y7E A;  2XEF A;  2AFW A;  2V8V A;  3PFE A;  1YME A;  2F7V A;  2PJ0 A;  2ZOF A;  5JM6 A;  1V6C A;  2PIY A;  2BCO A;  2HB6 A;  5LYD A;  3B7I A;  5K8O A;  5DS0 A;  3HLP A;  4B6Z A;  2EK9 A;  1XRY A;  3FF3 A;  3S9M A;  5K8P A;  2ZEM A;  3PRT A;  2JEW A;  3SI0 A;  4P4B A;  4PXD A;  2PJC A;  2F8H A;  4EWT A;  4OC1 A;  3S9N A;  2PJB A;  3SJE A;  4RUH A;  5I4M A;  4LQG A;  2EK8 A;  3FX6 A;  5LYI A;  1CP7 A;  5LRK A;  3KL9 A;  5HXD A;  4NGQ A;  4TJX A;  3PB4 X;  2PCU A;  3S9L A;  1LFW A;  3FJU A;  4MXU A;  2ZEO A;  3NFZ A;  4C8F A;  4R8F A;  2GU2 A;  1Z2L A;  1CX8 A;  1NSA A;  3D66 A;  3D68 A;  1R43 A;  2PJ7 A;  3TC8 A;  1YLO A;  2WZN A;  3IIB A;  4C8P A;  2JBJ A;  1F2P A;  2C6C A;  4MMO A;  2Q4Z A;  1CPS A;  3D7D A;  4YWY A;  3KHZ A;  2IQ6 A;  4P4D A;  1DTD A;  1XJO A;  4MCS A;  4R6T A;  5K8M A;  5IR2 A;  5THW A;  4ZI6 A;  3SI2 A;  4A38 A;  3IFE A;  4P45 A;  2GRE A;  3NA6 A;  3RAM A;  3KQZ A;  3B3C A;  3IC1 A;  1BAV A;  2ZOG A;  3WC5 A;  2EWB A;  4C84 A;  2O53 A;  1CG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...