5F09A

Structure of inactive gcpii mutant in complex with beta-citryl glutamate
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
696
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Comparison of human glutamate carboxypeptidases II and III reveals their divergent substrate specificities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 261
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 5f09A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5f09A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5f09A02
4A39A 2PVWA 4OKOA 4C8AA 4FUUA 1R43A 1ARLA 3FJUA 1BAVA 2PCUA 3IEHA 3VTAA 3FECA 1CG2A 3D67A 3TX8A 3KI9A 3PEIA 1LOKA 4P4FA 1BPMA 3SJEA 3B3TA 3H8GA 1UWYA 2NYQA 2WYRA 2BOAA 3I1UA 2AFUA 4YWYA 4C9EA 2C6PA 4ZX9A 3B3SA 4P4DA 2ZOGA 4X8IA 4NGPA 4OIWA 3S9MA 1XJOA 3DLJA 5D8NA 3PB9X 3V38A 3KL9A 1CPXA 4PXBA 4YN3A 4ZY2A 4EWTA 4PXDA 1Z2LA 3K2KA 3B3VA 2Q51A 2ZEEA 4F9UA 5JM6A 2EK8A 2OOTA 4C85A 2ZEOA 3PB6X 5CBMA 4EFDA 5LYLA 4PXCA 4NFRA 1TKFA 1F2PA 3IFEA 1XF1A 3BHXA 4UEEA 3SI0A 1YW6A 4A38A 1Q7LA 1Z5RA 3B35A 1Y0RA 4Q7AA 1YLOA 4G1PA 6CPAA 1V6CA 4A94A 3S9LA 4YU9A 4OP4A 2C6CA 4H2KA 2PRQA 4MHZA 3D7FA 4JYWA 8CPAA 5LRGA 3NFZA 3S9NA 4Z65A 4WWVA 4R76A 1ZG8A 3D7HA 4MMOA 1M4LA 3RAMA 3LMSA 4F8ZA 4IAVA 5JH9A 4CPAA 2HC9A 2XEFA 1ZG9A 1QQ9A 2PJ7A 4WJBA 4MHPA 4DUKA 1HDUA 3VH9A 3CT9A 4KSIA 1ZLIA 4UEZA 2EWBA 5F09A 2C1CA 3FEEA 4MRIA 3KASA 4ZY0A 4GM5A 5LRKA 2G9DA 4W9YA 1DE4C 4TNUA 1H8LA 1LAMA 1YSJA 2DEAA 2F7VA 2GLJA 5LYDA 1HDQA 2CTCA 3CDXA 5LYFA 3MRUA 5DS0A 3QNVA 4TWEA 2ZOFA 1ZG7A 3D66A 1ARMA 2PJ3A 7CPAA 4C99A 3KQXA 1ELLP 3GUXA 4X3RA 2F8HA 2GREA 4MXUA 4R7MA 2ZEMA 4NGRA 3H8EA 2I3CA 2AFZA 4OC5A 2PJCA 3KZWA 4MHNA 5THWA 4FAIA 1ELMP 4EMEA 1TXRA 2PJAA 4R6TA 2GLFA 3B3CA 3VATA 2XEJA 4P4IA 1LCPA 3FVLA 1CP6A 3D7DA 4C8UA 2RFHA 3HLPA 2V8HA 1RTQA 2XEGA 2V8DA 2BO9A 5K8NA 4NGMA 2O4HA 1TF8A 2PJ6A 2POKA 2ZEFA 3KQZA 4TJVA 4MCPA 5HXDA 5LRJA 2NSMA 3EIFA 3WT4A 2CF4A 4F9VA 5D29A 3PBEA 2CIJA 1PYTB 3D68A 3BI0A 4A37A 3CPXA 2ZELA 3RBUA 4JZ0A 4K3NA 1WVMA 1XBUA 1QMUA 2XEIA 3IJ3A 3PRTA 3WC5A 1AYEA 4C9VA 1Y0YA 2ABZA 3D4UA 2ZENA 4UEFA 3WC6A 1NSAA 1KWMA 4MCRA 2PIZA 2PJBA 1HEEA 3PBBA 2JEWA 2ZEPA 3PFEA 2ZEDA 4PPZA 5K8OA 3WC7A 2WZNA 4FBEA 1OBRA 2PVVA 2VL1A 4FWUA 1Z8LA 4CDKA 1CP7A 1PCAA 4P4BA 1GYTA 1CPSA 3K9TA 4NGNA 5HVGA 4C9RA 5CPAA 3B3WA 1AMPA 4C8PA 2V8GA 3GB0A 4C86A 4P45A 1VHOA 1JQGA 1TKHA 3NH4A 5I4MA 2PJ5A 4C84A 2C6GA 4IK2A 2IMOA 3DGVA 1TKJA 3HUVA 3N5FA 2BCOA 3SI1A 2PJ2A 3VARA 3FEDA 1R3NA 4BD9A 2PJ0A 1CBXA 3FF3A 4UF4A 1LAPA 5HVFA 4OC4A 2IQ6A 3SI2A 1XRYA 2RB7A 3T8WA 4PQAA 1F2OA 4UIAA 4IHMA 2EK9A 5K8PA 2HB6A 3KR5A 3V7ZA 1ZLHA 4C8FA 5K8MA 3NH8A 4OC3A 3I6SA 1BLLE 4P44A 1VHEA 3WABA 3LWUA 4OC2A 1CX8A 3SJXA 1VGYA 1IY7A 1F57A 4C8TA 4C8CA 3GLJA 4AXVA 3D7GA 2PJ4A 2J9AA 4OC0A 3I74A 1EE3P 3SJGA 1XFOA 4O23A 2IJZA 2ZEGA 3ISXA 4C9AA 4ZY1A 4LQGA 2O53A 2QJ8A 1BPNA 1VIXA 4B6ZA 4PXEA 4P4EA 4UIBA 1IGBA 4OIDA 4ZYQA 4NGSA 4NGTA 4NGQA 2FVGA 4CDJA 1Y7EA 2V8VA 2GU2A 4MHYA 3B7IA 2QYVA 4P4JA 1YW4A 3FH4A 3NH5A 3NA6A 4NJRA 2ANPA 1LFWA 3KHXA 4OMEA 3IO1A 4P6YA 1TF9A 2PJ8A 2PJ9A 2ZEHA 1Y9ZA 3KHZA 2AFXA 4MCQA 1LANA 2PJ1A 3ISZA 4OC1A 3MN8A 1YMEA 5IB9A 3JRUA 2PIYA 4DYOA 4KNGE 2Q4ZA 1FT7A 3PB7X 3TC8A 4ZI6A 4RUHA 2AFWA 2JBJA 1FNOA 3BXMA 2QVPA 2JBKA 3IWWA 2AFSA 3CPAA 2AFOA 3ICUA 4X2TA 4R8FA 5JGFA 5ELYA 3BI1A 2OR4A 2CTBA 2PE3A 3FMCA 4P10A 3L2NA 5LYIA 1DTDA 3RZAA 3KR4A 3H8FA 3KGQA 4TJXA 4ZX8A 2Q43A 3PFOA 3IC1A 3PB8X 3B2YA 5J1QA 3SJFA 5HVHA 3FX6A 4MCSA 4DJLA 4ONWA 3IIBA 2AFMA 4NJQA 1XMBA 3PB4X 4C9UA 2V77A
chains in the Genus database with same CATH superfamily
3W6SA 4A39A 1Z8TA 2OH1A 3PFVA 1Y9WA 1XOVA 2X7BA 2PVWA 2Z3LA 4OKOA 4PK3A 1QSMA 2DLAA 1S7NA 1YVKA 4C8AA 4FUUA 1R43A 3IWEA 4CRZB 1ARLA 3FJUA 1BAVA 2PCUA 3IEHA 4GPLB 4JXRA 3G23A 4YRHA 4AVAA 3VTAA 3DR8A 4ONUA 3FECA 2GIVA 4BTFA 2EVNA 3R95A 1CG2A 3D67A 2P6GA 4PSWA 4UCNA 3TX8A 4ZBGA 3KI9A 2FIAA 3S6GA 3PEIA 1LOKA 3F9KC 4P4FA 3SJEA 1BPMA 3B3TA 3PGPA 3H8GA 1UWYA 2NYQA 4JLYA 2WYRA 4KOVA 5JQ4A 2R82A 2BOAA 3I1UA 2AFUA 2I79A 4M85A 4YWYA 4F0XA 4CGMA 4C9EA 5G1ZA 1YQEA 2VI7A 3FXTA 2C6PA 2DPTA 4ZX9A 1OZPA 4XNHC 4C8FA 4U9YA 1B47A 3P2HA 1KEEB 4R9MA 4IF5A 5AG4A 1X10A 5C82A 3I9SA 1A2ZA 1GHEA 3B3SA 4P4DA 2EUIA 3CXQA 2ZOGA 1MJ9A 2EZCA 1ON0A 4NGPA 1IOIA 1NMTA 3C26A 4OIWA 4X8IA 4MJXA 3S9MA 1XJOA 3DLJA 5AG6A 3U1BA 5D8NA 1BO4A 3G8WA 3PB9X 3V38A 3KL9A 5A28A 1Q2YA 2VEZA 4PXBA 1Z4EA 1XEBA 2Y1MA 2G3TA 2J8NA 4ZY2A 4MFZA 4PXDA 4EWTA 4YN3A 2Q04A 4H6ZA 2PQ8A 5EMIA 1Z2LA 3T9YA 3K2KA 3B3VA 2Q51A 2ZEEA 4F9UA 1KZFA 4MHDA 5JM6A 2EK8A 1M6VB 2OOTA 4FD7A 1EZBA 2YNCC 3VWEA 1RXTA 4C85A 2B5GB 2ZW6A 4HNYB 3UY5A 2ZEOA 2Z3KA 3PB6X 5AGEA 4MFJA 4AG9A 4XNHB 4CGOA 4EFDA 5CBMA 4KOWA 5AG5A 4PSXA 4KOTA 2HUZA 5LYLA 4UCMA 4PXCA 4NFRA 5HKZA 4A2ZA 1TKFA 5BWAB 3FYNA 4MI1A 1F2PA 3IFEA 1XF1A 3O8ZA 4B14A 3BHXA 4E0AA 5ISVA 3F8KA 4B13A 5FD8A 4UEEA 3SI0A 3NOJA 1YW6A 4A38A 1Q7LA 1Z5RA 1IICA 1R61A 2B4DB 4XPDC 3B35A 3G3SA 4FD6A 4NCZA 5GCNA 4BBHA 1Y0RA 5C88A 4Q7AA 1YLOA 4G1PA 6CPAA 1V6CA 2AJ6A 3OWCA 1DIKA 1WK4A 2J8RA 1Z4RA 2BSWA 2XPNA 3RNZA 1M4GA 2G3AA 4A94A 3S9LA 2XPOA 4YU9A 4OP4A 1IB1E 4AB7A 2C6CA 2FT0A 2PDOA 4H2KA 2PRQA 4MHZA 3BUXB 4MFLA 4QVTA 5A27A 3D7FA 4INJA 1LRZA 1CS0B 2ZW5A 4BINA 1VHSA 2OB0A 4LQ6A 5F46A 2G0BA 2OZHA 4JYWA 1KUXA 1SQHA 5LRGA 8CPAA 4QC6A 3NFZA 2YNCA 1YVHA 5KTDA 3S9NA 1IOFA 2CXAA 3QAYA 4Z65A 4WWVA 3HMJG 4CGLA 1ZRSA 4R76A 2Q0YA 1ZG8A 4UWJA 2REFA 1Q5XA 3D7HA 4MMOA 1ZYMA 1M4LA 2VZZA 3RAMA 4COBA 1Z8WA 3LMSA 4F8ZA 4IAVA 5JH9A 4CPAA 2B3VA 2FS5A 1X12A 2C5QA 4NF1A 3FIXA 1YK3A 2HC9A 4JD6A 4CAXA 4IIYA 2XEFA 1ZG9A 2GE3A 3P2FA 3R9FA 3TLAA 2VZYA 3VRPA 2FL4A 1QQ9A 2PJ7A 3QB8A 4WJBA 4MHPA 4DUKA 4UA3A 1HDUA 3TTHA 3TLGA 2B3UA 3VH9A 5EBVA 4CAVA 2RC4A 3CT9A 1MJBA 1ZLIA 4KSIA 3T0TA 1XF8A 4E8OA 1VKCA 2C27A 4UEZA 5F47A 2EWBA 5F09A 2YGWA 2ZXVA 3EFAA 3TFYA 1PU9A 2D0OA 5F1YA 2C1CA 5FVJA 5E96A 3FEEA 3GYAA 3KASA 4MRIA 4GM5A 4NEXA 3EC4A 4ZY0A 5LRKA 1M1DA 1QSNA 2KCWA 2G9DA 1DE4C 4W9YA 1CM0A 4TNUA 5KTAA 2GP4A 2WPWA 2FE7A 4IIXA 1H8LA 1LAMA 1YSJA 2DEAA 2VKZG 2F7VA 2GLJA 4M6HA 5LYDA 1HDQA 1JWQA 3T90A 4MI4A 2CTCA 1U6MA 3CDXA 5JPHA 2AUMA 4DNCA 1YLEA 5LYFA 2OLSA 4AVBA 3TYXA 1CJWA 2BUEA 2P0WA 2Y1NA 5G22A 2I00A 3D2MA 3IU2A 4YGOA 3MRUA 3TO7A 5DS0A 1V0CA 3QNVA 1EZAA 3DNSA 4TWEA 2ZOFA 3R9GA 3S6FA 1ZG7A 3D66A 1ARMA 2PJ3A 4HPSA 4MY3A 1S7KA 4B5PB 2HWGA 7CPAA 1XMTA 4C99A 3KQXA 1ELLP 3GUXA 4KVME 3IU1A 2GFQA 4X3RA 2F8HA 2GREA 3HPHE 4MXUA 2OZGA 3JUWA 4R7MA 2ZEMA 4MBUA 4NGRA 3H8EA 2DF5A 4B5PA 2I3CA 1RO5A 1J4JA 2AFZA 3LODA 4OC5A 2PJCA 3EO4A 3KZWA 1Z9EA 4MHNA 1NE9A 5THWA 4A95A 4CYQA 3TLZA 4FAIA 2XPLA 1ELMP 3PZJA 1YVOA 5IR2A 4A30A 1KBLA 5AXIA 4EMEA 3E0KA 3T07A 3B8GA 1TXRA 2PJAA 3CXSA 3EZEA 2ZW4A 2D4PA 1YREA 2EBJA 2GLFA 3MGDA 4KUBA 4MFKA 4R6TA 4R3LA 4A33A 3B3CA 5H84A 3TO6A 2XEJA 2NMTA 3VATA 4C2YA 4CYOA 4P4IA 3HPGG 1LCPA 1M44A 2A4NA 2FSRA 3FVLA 2B58A 1CP6A 3OAKA 3D7DA 4KUAA 2WSAA 3JTKA 4C8UA 1YR0A 2RFHA 1WWZA 4KLVA 3HLPA 4UFWA 4B10A 2Q4VA 2V8HA 4JWPA 1RTQA 3F5BA 1QSOA 2XEGA 5DWNA 3TLYA 4KZTA 2V8DA 3OP0A 4MFQA 4BPWB 2BO9A 3W6XA 5K8NA 4IUSA 4BPXB 4ZGYB 2HROA 4NGMA 2O4HA 1QSTA 2ATRA 2Y0MA 1TF8A 2PJ6A 2POKA 2ZEFA 3KQZA 4PV6A 4Q38A 3PT1A 4CYPA 5IV0A 4TJVA 2PSWA 2F5IA 4MCPA 4OAEA 4R3KA 5HXDA 2P6EA 5LRJA 2NSMA 3S6KA 3EIFA 3WT4A 4J3GA 3VWDA 4BMHA 1KC7A 2B5GA 2CF4A 3VRNA 3T05A 1PUAA 3K4IA 4CZ1A 1I1DA 1UFHA 4F9VA 5D29A 3PBEA 2CIJA 1MK4A 1PYTB 3D68A 2HV2A 4QBJA 3EZBA 3BI0A 4A37A 3FBUA 2OZUA 3CPXA 4B5OA 2ZELA 3RBUA 3QAHA 3TLCA 4JZ0A 4M6GA 4K3NA 3RO0A 3TCVA 1XBUA 3NE8A 1WVMA 1VBHA 1BXRB 2X0SA 1QMUA 2XEIA 2Z0ZA 3IJ3A 3PRTA 1IIDA 4UFXA 3R9EA 4EVYA 3WC5A 1AYEA 4HNWB 2B4DA 1Y0YA 4C9VA 4Y49B 3PLFB 2ABZA 4GXHA 4OLLA 4GS4A 4NXYA 3D4UA 2EO8A 2ZENA 4XPKA 3U88C 4UEFA 2Q7BA 1NSAA 3WC6A 3BUNB 1KWMA 4JJXA 4YFJA 4MCRA 2PIZA 2PJBA 2DIKA 1HEEA 3BUOB 3PBBA 4E2AA 2J8MA 1ZO0A 1NBWA 2JEWA 4KSFA 2ZEPA 1XIXA 3PFEA 2QECA 3RYOA 2ZEDA 4PPZA 3SXNA 5K8OA 4L89A 3WC7A 2D4OA 1I21A 5I0CA 4JVOA 2IL4A 2QIRA 2WZNA 4FBEA 2VQYA 2O28A 1P4NA 1OBRA 2PVVA 1GGOA 4JXQA 4KLWA 4L8AA 4C2XA 1VBGA 2VL1A 4FWUA 5J3XA 1L0CA 4C68A 4AG7A 3KKWA 1Z8LA 4CDKA 4KSAA 4XPLA 1CP7A 2WUUA 3S6HA 2H5MA 3ZNIA 4MY0A 1PCAA 4P4BA 2Z3OA 1GYTA 1CPSA 3K9TA 4NGNA 2JDDA 3V8IA 1B6BA 5HVGA 5CPAA 4C9RA 3D2PA 4CGNA 5HH1A 4ORFA 3B3WA 1AMPA 2B4JC 2V8GA 3GB0A 4C86A 4P45A 3A9LA 1KUVA 5G20A 3EZAA 1VHOA 1JQGA 1TKHA 3NH4A 4QB9A 5I4MA 2VXKA 3JVNA 2PJ5A 2Z10A 2R8VA 3BUMB 4C84A 1Q2DA 3BJ8A 4CO9A 2C6GA 3DSBA 4C2ZA 2REEA 2OU2A 4EYSA 4IK2A 2IMOA 3DGVA 1TKJA 1Q2CA 1JDEA 3TLEA 3GKRA 3BUWB 4RN7A 4X5KA 1S7FA 3HUVA 3N5FA 3ZZIA 2MP0A 2BCOA 1YX0A 4E94A 3ZJ0A 3N7ZA 5G21A 4COGA 3SI1A 2Q4YA 3WR7A 4KS9A 2PJ2A 3TLBA 2UV8G 3VARA 3FEDA 3I3GA 4LUAA 4OADA 3VGOA 4KOXA 2BL1A 3H4QA 5J8CA 1R3NA 3PP9A 4F0YA 3FRMA 1WJTA 4BD9A 2YJVA 4C8PA 2PJ0A 3GIUA 1Z9UA 4M6IA 1CBXA 2HQYA 3LD2A 3FF3A 4UF4A 1LAPA 4Q36A 5HVFA 4OC4A 2CY2A 2IQ6A 2R98A 2XPPA 1XRYA 4MFPA 3SI2A 2RB7A 3T8WA 5H86A 2PC1A 1Z8XA 4PQAA 1F2OA 2K5TA 4PK2A 4IHMA 4UIAA 2EK9A 5DWMA 5IB0A 5K8PA 2HB6A 3EY5A 3KR5A 3V7ZA 3IGRA 1ZLHA 4KVOE 4U5YA 2ARHA 5F49A 4CGPA 5K8MA 3TE4A 1JDBC 2YJTA 5F9MA 3NH8A 4OC3A 4CS0B 3KRVA 2AUNA 2B0AA 3I6SA 1BLLE 4P44A 1VHEA 3WABA 1T36B 3TT2A 5F48A 3BJ7A 1S5KA 3LWUA 1IYLA 2CNSA 4LX9A 2EZBA 2BEIA 4OC2A 1CX8A 1FY7A 3SJXA 2PRBA 1VGYA 2N3AB 3IWGA 5HMNA 4M3SA 2Z3NA 1IY7A 1F57A 4A32A 2Z3MA 3CZXA 4KOUA 4C8TA 3H5ZA 4H89A 4U9ZA 4C8CA 1KUYA 1EO0A 2DPSA 3GLJA 4AXVA 5AG7A 2JDCA 1TIQA 3SR3A 5JVLA 2PCNA 3D7GA 1N71A 2PJ4A 4BPUB 4Y49C 3SXOA 5IX3A 2V77A 1Y9KA 4UBRA 2J9AA 4OC0A 4A4BA 1R57A 1EE3P 3I74A 4R57A 3SJGA 1NXJA 2QMLA 1XFOA 4O23A 1BOBA 2IJZA 2ZEGA 3ISXA 3R1KA 4HNXB 3DDDA 1S7LA 4MJ8A 4C9AA 4KOSA 4CRYB 4ZY1A 2PR1A 5J8FA 4LQGA 2O53A 2CNMA 2QJ8A 2PR8A 5HKYA 4I49A 1ZL0A 1BPNA 1VIXA 4B6ZA 1J3LA 4PXEA 4P4EA 2GANA 1IGBA 4OIDA 4UIBA 4ZYQA 4NGSA 3VRQA 4NGTA 4NGQA 3F0AA 2FVGA 3NE7A 5F13A 1Y7EA 2R1IA 1M4DA 4CAFA 4CDJA 1B87A 3K9UA 3NFQA 1C3OB 2V8VA 2GU2A 4MHYA 3B7IA 2QYVA 4P4JA 1YW4A 3CXPA 3TOAA 3FH4A 3NH5A 4AVCA 4J0NA 1Y7RA 2R7HA 3D3SA 3TOBA 3NA6A 4NJRA 2ANPA 3VROA 1LFWA 2ODFA 2ZW7A 3R96A 2ZPAA 2D0PA 3KHXA 4F6AA 2Q7SA 4OMEA 2FIWA 3IO1A 4P6YA 1TF9A 1M4IA 2PJ8A 5K99A 4RR2B 4R87A 3GJZA 2E28A 4A4CA 2WPXA 2JLMA 2PJ9A 2ZEHA 4RI1A 3KHZA 2AFXA 4MCQA 1Y9ZA 1LANA 2AE6A 2PJ1A 1NSLA 3ISZA 4OC1A 1P0HA 3MN8A 4KVXA 4CAWA 1YMEA 1VI4A 5BY0A 1QSRA 1MJAA 2FCKA 3JRUA 5IB9A 2PIYA 4DYOA 4FD4A 4H6UA 4KNGE 2Q4ZA 5F5XA 3T5MA 4UWIA 4KOYA 1FT7A 3PB7X 2CNTA 3TC8A 4QUSA 4RUHA 4ZI6A 2AFWA 2EZAA 2JBJA 4C7HA 1FNOA 3BXMA 2QVPA 2JBKA 3IWWA 4C7IA 4E5SA 1AUGA 4FD5A 1K4JA 3SHPA 2DXQA 2AFSA 3EXNA 3CPAA 5HKWA 4CYNA 4UCPA 1C30B 4XPDB 2AFOA 2B4BA 3ICUA 4X2TA 4R8FA 3OB2B 3FNCA 3TLGB 5JGFA 3FB3A 1CE8B 5ELYA 5CNPA 3C8OA 3BI1A 3LACA 2HI6A 2FXFA 2YNEA 2OR4A 1FBVA 5KTCA 2CTBA 2PE3A 4HKFA 3TO9A 3FMCA 4P10A 4RS2A 5JYBA 1S3ZA 1IYKA 2Z11A 3L2NA 2Q44A 2JEVA 2YNDA 4KORA 5LYIA 1DTDA 2FM4A 4M8DA 4NSQA 3RZAA 2VBQA 3KR4A 3H8FA 3KGQA 4TJXA 4B11A 4ZX8A 3DR6A 4II9A 2Q43A 4UFVA 3PFOA 3IC1A 2CBLA 3PB8X 3B2YA 5J1QA 4K30A 3VRRA 4B12A 3SJFA 1S60A 1XE4A 5HVHA 2P6FA 2Z3PA 3FX6A 5EC4A 4MCSA 4DJLA 4ONWA 1A9XB 3GY9A 3IIBA 1I12A 1YGHA 3OB1B 3D8PA 4A31A 4H1HA 2AFMA 3BLNA 1IU8A 1XMBA 3PB4X 4NJQA 4C9UA 4CAEA 1CPXA 3W91A
chains in the Genus database with same CATH topology
4A39A 2PVWA 4OKOA 4C8AA 4FUUA 1R43A 1ARLA 3FJUA 1BAVA 2PCUA 3IEHA 3VTAA 3FECA 1CG2A 3D67A 3TX8A 3KI9A 3PEIA 1LOKA 4P4FA 1BPMA 3SJEA 3B3TA 3H8GA 1UWYA 2NYQA 2WYRA 2BOAA 3I1UA 2AFUA 4YWYA 4C9EA 2C6PA 4ZX9A 3B3SA 4P4DA 2ZOGA 4X8IA 4NGPA 4OIWA 3S9MA 1XJOA 3DLJA 5D8NA 3PB9X 3V38A 3KL9A 1CPXA 4PXBA 4YN3A 4ZY2A 4EWTA 4PXDA 1Z2LA 3K2KA 3B3VA 2Q51A 2ZEEA 4F9UA 5JM6A 2EK8A 2OOTA 4C85A 2ZEOA 3PB6X 5CBMA 4EFDA 5LYLA 4PXCA 4NFRA 1TKFA 1F2PA 3IFEA 1XF1A 3BHXA 4UEEA 3SI0A 1YW6A 4A38A 1Q7LA 1Z5RA 3B35A 1Y0RA 4Q7AA 1YLOA 4G1PA 6CPAA 1V6CA 4A94A 3S9LA 4YU9A 4OP4A 2C6CA 4H2KA 2PRQA 4MHZA 3D7FA 4JYWA 8CPAA 5LRGA 3NFZA 3S9NA 4Z65A 4WWVA 4R76A 1ZG8A 3D7HA 4MMOA 1M4LA 3RAMA 3LMSA 4F8ZA 4IAVA 5JH9A 4CPAA 2C5QA 2HC9A 2XEFA 1ZG9A 1QQ9A 2PJ7A 4WJBA 4MHPA 4DUKA 1HDUA 3VH9A 3CT9A 4KSIA 1ZLIA 4UEZA 2EWBA 5F09A 2C1CA 3FEEA 4MRIA 3KASA 4ZY0A 4GM5A 5LRKA 2G9DA 4W9YA 1DE4C 4TNUA 2GP4A 1H8LA 1LAMA 1YSJA 2DEAA 2F7VA 2GLJA 5LYDA 1HDQA 2CTCA 3CDXA 5LYFA 3MRUA 5DS0A 3QNVA 4TWEA 2ZOFA 1ZG7A 3D66A 1ARMA 2PJ3A 7CPAA 4C99A 3KQXA 1ELLP 3GUXA 4X3RA 2F8HA 2GREA 4MXUA 4R7MA 2ZEMA 4NGRA 3H8EA 2I3CA 2AFZA 4OC5A 2PJCA 3KZWA 4MHNA 5THWA 4FAIA 1ELMP 5IR2A 4EMEA 1TXRA 2PJAA 4R6TA 2GLFA 3B3CA 3VATA 2XEJA 4P4IA 1LCPA 3FVLA 1CP6A 3D7DA 4C8UA 2RFHA 3HLPA 2V8HA 1RTQA 2XEGA 2V8DA 2BO9A 5K8NA 4NGMA 2O4HA 1TF8A 2PJ6A 2POKA 2ZEFA 3KQZA 4TJVA 4MCPA 5HXDA 5LRJA 2NSMA 3EIFA 3WT4A 2CF4A 4F9VA 5D29A 3PBEA 2CIJA 1PYTB 3D68A 3BI0A 4A37A 3CPXA 2ZELA 3RBUA 4JZ0A 4K3NA 1WVMA 1XBUA 1QMUA 2XEIA 3IJ3A 3PRTA 3WC5A 1AYEA 4C9VA 1Y0YA 2ABZA 3D4UA 2ZENA 4UEFA 3WC6A 1NSAA 1KWMA 4MCRA 2PIZA 2PJBA 1HEEA 3PBBA 2JEWA 2ZEPA 3PFEA 2ZEDA 4PPZA 5K8OA 3WC7A 2WZNA 4FBEA 1OBRA 2PVVA 2VL1A 4FWUA 1Z8LA 4CDKA 1CP7A 1PCAA 4P4BA 1GYTA 1CPSA 3K9TA 4NGNA 5HVGA 4C9RA 5CPAA 3B3WA 1AMPA 4C8PA 2V8GA 3GB0A 4C86A 4P45A 1VHOA 1JQGA 1TKHA 3NH4A 5I4MA 2PJ5A 4C84A 2C6GA 4IK2A 2IMOA 3DGVA 1TKJA 3HUVA 3N5FA 2BCOA 3SI1A 2PJ2A 3VARA 3FEDA 1R3NA 4BD9A 2PJ0A 1CBXA 3FF3A 4UF4A 1LAPA 5HVFA 4OC4A 2IQ6A 3SI2A 1XRYA 2RB7A 3T8WA 4PQAA 1F2OA 4UIAA 4IHMA 2EK9A 5K8PA 2HB6A 3KR5A 3V7ZA 1ZLHA 4C8FA 5K8MA 3NH8A 4OC3A 3I6SA 1BLLE 4P44A 1VHEA 3WABA 3LWUA 4OC2A 1CX8A 3SJXA 1VGYA 1IY7A 1F57A 4C8TA 4C8CA 3GLJA 4AXVA 3D7GA 2PJ4A 2J9AA 4OC0A 3I74A 1EE3P 3SJGA 1XFOA 4O23A 2IJZA 2ZEGA 3ISXA 4C9AA 4ZY1A 4LQGA 2O53A 2QJ8A 1BPNA 1VIXA 4B6ZA 4PXEA 4P4EA 4UIBA 1IGBA 4OIDA 4ZYQA 4NGSA 4NGTA 4NGQA 2FVGA 4CDJA 1Y7EA 2V8VA 2GU2A 4MHYA 3B7IA 2QYVA 4P4JA 1YW4A 3FH4A 3NH5A 3NA6A 4NJRA 2ANPA 1LFWA 3KHXA 4OMEA 3IO1A 4P6YA 1TF9A 2PJ8A 2PJ9A 2ZEHA 1Y9ZA 3KHZA 2AFXA 4MCQA 1LANA 2PJ1A 3ISZA 4OC1A 3MN8A 1YMEA 5IB9A 3JRUA 2PIYA 4DYOA 4KNGE 2Q4ZA 1FT7A 3PB7X 3TC8A 4ZI6A 4RUHA 2AFWA 2JBJA 1FNOA 3BXMA 2QVPA 2JBKA 3IWWA 2AFSA 3CPAA 2AFOA 3ICUA 4X2TA 4R8FA 5JGFA 5ELYA 3BI1A 2OR4A 2CTBA 2PE3A 3FMCA 4P10A 3L2NA 5LYIA 1DTDA 3RZAA 3KR4A 3H8FA 3KGQA 4TJXA 4ZX8A 2Q43A 3PFOA 3IC1A 3PB8X 3B2YA 5J1QA 3SJFA 5HVHA 3FX6A 4MCSA 4DJLA 4ONWA 3IIBA 2AFMA 4NJQA 1XMBA 3PB4X 4C9UA 2V77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A39 A;  2PVW A;  4OKO A;  4C8A A;  4FUU A;  1R43 A;  1ARL A;  3FJU A;  1BAV A;  2PCU A;  3IEH A;  3VTA A;  3FEC A;  1CG2 A;  3D67 A;  3TX8 A;  3KI9 A;  3PEI A;  1LOK A;  4P4F A;  1BPM A;  3SJE A;  3B3T A;  3H8G A;  1UWY A;  2NYQ A;  2WYR A;  2BOA A;  3I1U A;  2AFU A;  4YWY A;  4C9E A;  2C6P A;  4ZX9 A;  3B3S A;  4P4D A;  2ZOG A;  4X8I A;  4NGP A;  4OIW A;  3S9M A;  1XJO A;  3DLJ A;  5D8N A;  3PB9 X;  3V38 A;  3KL9 A;  1CPX A;  4PXB A;  4YN3 A;  4ZY2 A;  4EWT A;  4PXD A;  1Z2L A;  3K2K A;  3B3V A;  2Q51 A;  2ZEE A;  4F9U A;  5JM6 A;  2EK8 A;  2OOT A;  4C85 A;  2ZEO A;  3PB6 X;  5CBM A;  4EFD A;  5LYL A;  4PXC A;  4NFR A;  1TKF A;  1F2P A;  3IFE A;  1XF1 A;  3BHX A;  4UEE A;  3SI0 A;  1YW6 A;  4A38 A;  1Q7L A;  1Z5R A;  3B35 A;  1Y0R A;  4Q7A A;  1YLO A;  4G1P A;  6CPA A;  1V6C A;  4A94 A;  3S9L A;  4YU9 A;  4OP4 A;  2C6C A;  4H2K A;  2PRQ A;  4MHZ A;  3D7F A;  4JYW A;  8CPA A;  5LRG A;  3NFZ A;  3S9N A;  4Z65 A;  4WWV A;  4R76 A;  1ZG8 A;  3D7H A;  4MMO A;  1M4L A;  3RAM A;  3LMS A;  4F8Z A;  4IAV A;  5JH9 A;  4CPA A;  2HC9 A;  2XEF A;  1ZG9 A;  1QQ9 A;  2PJ7 A;  4WJB A;  4MHP A;  4DUK A;  1HDU A;  3VH9 A;  3CT9 A;  4KSI A;  1ZLI A;  4UEZ A;  2EWB A;  5F09 A;  2C1C A;  3FEE A;  4MRI A;  3KAS A;  4ZY0 A;  4GM5 A;  5LRK A;  2G9D A;  4W9Y A;  1DE4 C;  4TNU A;  1H8L A;  1LAM A;  1YSJ A;  2DEA A;  2F7V A;  2GLJ A;  5LYD A;  1HDQ A;  2CTC A;  3CDX A;  5LYF A;  3MRU A;  5DS0 A;  3QNV A;  4TWE A;  2ZOF A;  1ZG7 A;  3D66 A;  1ARM A;  2PJ3 A;  7CPA A;  4C99 A;  3KQX A;  1ELL P;  3GUX A;  4X3R A;  2F8H A;  2GRE A;  4MXU A;  4R7M A;  2ZEM A;  4NGR A;  3H8E A;  2I3C A;  2AFZ A;  4OC5 A;  2PJC A;  3KZW A;  4MHN A;  5THW A;  4FAI A;  1ELM P;  4EME A;  1TXR A;  2PJA A;  4R6T A;  2GLF A;  3B3C A;  3VAT A;  2XEJ A;  4P4I A;  1LCP A;  3FVL A;  1CP6 A;  3D7D A;  4C8U A;  2RFH A;  3HLP A;  2V8H A;  1RTQ A;  2XEG A;  2V8D A;  2BO9 A;  5K8N A;  4NGM A;  2O4H A;  1TF8 A;  2PJ6 A;  2POK A;  2ZEF A;  3KQZ A;  4TJV A;  4MCP A;  5HXD A;  5LRJ A;  2NSM A;  3EIF A;  3WT4 A;  2CF4 A;  4F9V A;  5D29 A;  3PBE A;  2CIJ A;  1PYT B;  3D68 A;  3BI0 A;  4A37 A;  3CPX A;  2ZEL A;  3RBU A;  4JZ0 A;  4K3N A;  1WVM A;  1XBU A;  1QMU A;  2XEI A;  3IJ3 A;  3PRT A;  3WC5 A;  1AYE A;  4C9V A;  1Y0Y A;  2ABZ A;  3D4U A;  2ZEN A;  4UEF A;  3WC6 A;  1NSA A;  1KWM A;  4MCR A;  2PIZ A;  2PJB A;  1HEE A;  3PBB A;  2JEW A;  2ZEP A;  3PFE A;  2ZED A;  4PPZ A;  5K8O A;  3WC7 A;  2WZN A;  4FBE A;  1OBR A;  2PVV A;  2VL1 A;  4FWU A;  1Z8L A;  4CDK A;  1CP7 A;  1PCA A;  4P4B A;  1GYT A;  1CPS A;  3K9T A;  4NGN A;  5HVG A;  4C9R A;  5CPA A;  3B3W A;  1AMP A;  4C8P A;  2V8G A;  3GB0 A;  4C86 A;  4P45 A;  1VHO A;  1JQG A;  1TKH A;  3NH4 A;  5I4M A;  2PJ5 A;  4C84 A;  2C6G A;  4IK2 A;  2IMO A;  3DGV A;  1TKJ A;  3HUV A;  3N5F A;  2BCO A;  3SI1 A;  2PJ2 A;  3VAR A;  3FED A;  1R3N A;  4BD9 A;  2PJ0 A;  1CBX A;  3FF3 A;  4UF4 A;  1LAP A;  5HVF A;  4OC4 A;  2IQ6 A;  3SI2 A;  1XRY A;  2RB7 A;  3T8W A;  4PQA A;  1F2O A;  4UIA A;  4IHM A;  2EK9 A;  5K8P A;  2HB6 A;  3KR5 A;  3V7Z A;  1ZLH A;  4C8F A;  5K8M A;  3NH8 A;  4OC3 A;  3I6S A;  1BLL E;  4P44 A;  1VHE A;  3WAB A;  3LWU A;  4OC2 A;  1CX8 A;  3SJX A;  1VGY A;  1IY7 A;  1F57 A;  4C8T A;  4C8C A;  3GLJ A;  4AXV A;  3D7G A;  2PJ4 A;  2J9A A;  4OC0 A;  3I74 A;  1EE3 P;  3SJG A;  1XFO A;  4O23 A;  2IJZ A;  2ZEG A;  3ISX A;  4C9A A;  4ZY1 A;  4LQG A;  2O53 A;  2QJ8 A;  1BPN A;  1VIX A;  4B6Z A;  4PXE A;  4P4E A;  4UIB A;  1IGB A;  4OID A;  4ZYQ A;  4NGS A;  4NGT A;  4NGQ A;  2FVG A;  4CDJ A;  1Y7E A;  2V8V A;  2GU2 A;  4MHY A;  3B7I A;  2QYV A;  4P4J A;  1YW4 A;  3FH4 A;  3NH5 A;  3NA6 A;  4NJR A;  2ANP A;  1LFW A;  3KHX A;  4OME A;  3IO1 A;  4P6Y A;  1TF9 A;  2PJ8 A;  2PJ9 A;  2ZEH A;  1Y9Z A;  3KHZ A;  2AFX A;  4MCQ A;  1LAN A;  2PJ1 A;  3ISZ A;  4OC1 A;  3MN8 A;  1YME A;  5IB9 A;  3JRU A;  2PIY A;  4DYO A;  4KNG E;  2Q4Z A;  1FT7 A;  3PB7 X;  3TC8 A;  4ZI6 A;  4RUH A;  2AFW A;  2JBJ A;  1FNO A;  3BXM A;  2QVP A;  2JBK A;  3IWW A;  2AFS A;  3CPA A;  2AFO A;  3ICU A;  4X2T A;  4R8F A;  5JGF A;  5ELY A;  3BI1 A;  2OR4 A;  2CTB A;  2PE3 A;  3FMC A;  4P10 A;  3L2N A;  5LYI A;  1DTD A;  3RZA A;  3KR4 A;  3H8F A;  3KGQ A;  4TJX A;  4ZX8 A;  2Q43 A;  3PFO A;  3IC1 A;  3PB8 X;  3B2Y A;  5J1Q A;  3SJF A;  5HVH A;  3FX6 A;  4MCS A;  4DJL A;  4ONW A;  3IIB A;  2AFM A;  4NJQ A;  1XMB A;  3PB4 X;  4C9U A;  2V77 A; 
#chains in the Genus database with same CATH topology
 3W6S A;  4A39 A;  1Z8T A;  2OH1 A;  3PFV A;  1Y9W A;  1XOV A;  2X7B A;  2PVW A;  2Z3L A;  4OKO A;  4PK3 A;  1QSM A;  2DLA A;  1S7N A;  1YVK A;  4C8A A;  4FUU A;  1R43 A;  3IWE A;  4CRZ B;  1ARL A;  3FJU A;  1BAV A;  2PCU A;  3IEH A;  4GPL B;  4JXR A;  3G23 A;  4YRH A;  4AVA A;  3VTA A;  3DR8 A;  4ONU A;  3FEC A;  2GIV A;  4BTF A;  2EVN A;  3R95 A;  1CG2 A;  3D67 A;  2P6G A;  4PSW A;  4UCN A;  3TX8 A;  4ZBG A;  3KI9 A;  2FIA A;  3S6G A;  3PEI A;  1LOK A;  3F9K C;  4P4F A;  3SJE A;  1BPM A;  3B3T A;  3PGP A;  3H8G A;  1UWY A;  2NYQ A;  4JLY A;  2WYR A;  4KOV A;  5JQ4 A;  2R82 A;  2BOA A;  3I1U A;  2AFU A;  2I79 A;  4M85 A;  4YWY A;  4F0X A;  4CGM A;  4C9E A;  5G1Z A;  1YQE A;  2VI7 A;  3FXT A;  2C6P A;  2DPT A;  4ZX9 A;  1OZP A;  4XNH C;  4C8F A;  4U9Y A;  1B47 A;  3P2H A;  1KEE B;  4R9M A;  4IF5 A;  5AG4 A;  1X10 A;  5C82 A;  3I9S A;  1A2Z A;  1GHE A;  3B3S A;  4P4D A;  2EUI A;  3CXQ A;  2ZOG A;  1MJ9 A;  2EZC A;  1ON0 A;  4NGP A;  1IOI A;  1NMT A;  3C26 A;  4OIW A;  4X8I A;  4MJX A;  3S9M A;  1XJO A;  3DLJ A;  5AG6 A;  3U1B A;  5D8N A;  1BO4 A;  3G8W A;  3PB9 X;  3V38 A;  3KL9 A;  5A28 A;  1Q2Y A;  2VEZ A;  4PXB A;  1Z4E A;  1XEB A;  2Y1M A;  2G3T A;  2J8N A;  4ZY2 A;  4MFZ A;  4PXD A;  4EWT A;  4YN3 A;  2Q04 A;  4H6Z A;  2PQ8 A;  5EMI A;  1Z2L A;  3T9Y A;  3K2K A;  3B3V A;  2Q51 A;  2ZEE A;  4F9U A;  1KZF A;  4MHD A;  5JM6 A;  2EK8 A;  1M6V B;  2OOT A;  4FD7 A;  1EZB A;  2YNC C;  3VWE A;  1RXT A;  4C85 A;  2B5G B;  2ZW6 A;  4HNY B;  3UY5 A;  2ZEO A;  2Z3K A;  3PB6 X;  5AGE A;  4MFJ A;  4AG9 A;  4XNH B;  4CGO A;  4EFD A;  5CBM A;  4KOW A;  5AG5 A;  4PSX A;  4KOT A;  2HUZ A;  5LYL A;  4UCM A;  4PXC A;  4NFR A;  5HKZ A;  4A2Z A;  1TKF A;  5BWA B;  3FYN A;  4MI1 A;  1F2P A;  3IFE A;  1XF1 A;  3O8Z A;  4B14 A;  3BHX A;  4E0A A;  5ISV A;  3F8K A;  4B13 A;  5FD8 A;  4UEE A;  3SI0 A;  3NOJ A;  1YW6 A;  4A38 A;  1Q7L A;  1Z5R A;  1IIC A;  1R61 A;  2B4D B;  4XPD C;  3B35 A;  3G3S A;  4FD6 A;  4NCZ A;  5GCN A;  4BBH A;  1Y0R A;  5C88 A;  4Q7A A;  1YLO A;  4G1P A;  6CPA A;  1V6C A;  2AJ6 A;  3OWC A;  1DIK A;  1WK4 A;  2J8R A;  1Z4R A;  2BSW A;  2XPN A;  3RNZ A;  1M4G A;  2G3A A;  4A94 A;  3S9L A;  2XPO A;  4YU9 A;  4OP4 A;  1IB1 E;  4AB7 A;  2C6C A;  2FT0 A;  2PDO A;  4H2K A;  2PRQ A;  4MHZ A;  3BUX B;  4MFL A;  4QVT A;  5A27 A;  3D7F A;  4INJ A;  1LRZ A;  1CS0 B;  2ZW5 A;  4BIN A;  1VHS A;  2OB0 A;  4LQ6 A;  5F46 A;  2G0B A;  2OZH A;  4JYW A;  1KUX A;  1SQH A;  5LRG A;  8CPA A;  4QC6 A;  3NFZ A;  2YNC A;  1YVH A;  5KTD A;  3S9N A;  1IOF A;  2CXA A;  3QAY A;  4Z65 A;  4WWV A;  3HMJ G;  4CGL A;  1ZRS A;  4R76 A;  2Q0Y A;  1ZG8 A;  4UWJ A;  2REF A;  1Q5X A;  3D7H A;  4MMO A;  1ZYM A;  1M4L A;  2VZZ A;  3RAM A;  4COB A;  1Z8W A;  3LMS A;  4F8Z A;  4IAV A;  5JH9 A;  4CPA A;  2B3V A;  2FS5 A;  1X12 A;  2C5Q A;  4NF1 A;  3FIX A;  1YK3 A;  2HC9 A;  4JD6 A;  4CAX A;  4IIY A;  2XEF A;  1ZG9 A;  2GE3 A;  3P2F A;  3R9F A;  3TLA A;  2VZY A;  3VRP A;  2FL4 A;  1QQ9 A;  2PJ7 A;  3QB8 A;  4WJB A;  4MHP A;  4DUK A;  4UA3 A;  1HDU A;  3TTH A;  3TLG A;  2B3U A;  3VH9 A;  5EBV A;  4CAV A;  2RC4 A;  3CT9 A;  1MJB A;  1ZLI A;  4KSI A;  3T0T A;  1XF8 A;  4E8O A;  1VKC A;  2C27 A;  4UEZ A;  5F47 A;  2EWB A;  5F09 A;  2YGW A;  2ZXV A;  3EFA A;  3TFY A;  1PU9 A;  2D0O A;  5F1Y A;  2C1C A;  5FVJ A;  5E96 A;  3FEE A;  3GYA A;  3KAS A;  4MRI A;  4GM5 A;  4NEX A;  3EC4 A;  4ZY0 A;  5LRK A;  1M1D A;  1QSN A;  2KCW A;  2G9D A;  1DE4 C;  4W9Y A;  1CM0 A;  4TNU A;  5KTA A;  2GP4 A;  2WPW A;  2FE7 A;  4IIX A;  1H8L A;  1LAM A;  1YSJ A;  2DEA A;  2VKZ G;  2F7V A;  2GLJ A;  4M6H A;  5LYD A;  1HDQ A;  1JWQ A;  3T90 A;  4MI4 A;  2CTC A;  1U6M A;  3CDX A;  5JPH A;  2AUM A;  4DNC A;  1YLE A;  5LYF A;  2OLS A;  4AVB A;  3TYX A;  1CJW A;  2BUE A;  2P0W A;  2Y1N A;  5G22 A;  2I00 A;  3D2M A;  3IU2 A;  4YGO A;  3MRU A;  3TO7 A;  5DS0 A;  1V0C A;  3QNV A;  1EZA A;  3DNS A;  4TWE A;  2ZOF A;  3R9G A;  3S6F A;  1ZG7 A;  3D66 A;  1ARM A;  2PJ3 A;  4HPS A;  4MY3 A;  1S7K A;  4B5P B;  2HWG A;  7CPA A;  1XMT A;  4C99 A;  3KQX A;  1ELL P;  3GUX A;  4KVM E;  3IU1 A;  2GFQ A;  4X3R A;  2F8H A;  2GRE A;  3HPH E;  4MXU A;  2OZG A;  3JUW A;  4R7M A;  2ZEM A;  4MBU A;  4NGR A;  3H8E A;  2DF5 A;  4B5P A;  2I3C A;  1RO5 A;  1J4J A;  2AFZ A;  3LOD A;  4OC5 A;  2PJC A;  3EO4 A;  3KZW A;  1Z9E A;  4MHN A;  1NE9 A;  5THW A;  4A95 A;  4CYQ A;  3TLZ A;  4FAI A;  2XPL A;  1ELM P;  3PZJ A;  1YVO A;  5IR2 A;  4A30 A;  1KBL A;  5AXI A;  4EME A;  3E0K A;  3T07 A;  3B8G A;  1TXR A;  2PJA A;  3CXS A;  3EZE A;  2ZW4 A;  2D4P A;  1YRE A;  2EBJ A;  2GLF A;  3MGD A;  4KUB A;  4MFK A;  4R6T A;  4R3L A;  4A33 A;  3B3C A;  5H84 A;  3TO6 A;  2XEJ A;  2NMT A;  3VAT A;  4C2Y A;  4CYO A;  4P4I A;  3HPG G;  1LCP A;  1M44 A;  2A4N A;  2FSR A;  3FVL A;  2B58 A;  1CP6 A;  3OAK A;  3D7D A;  4KUA A;  2WSA A;  3JTK A;  4C8U A;  1YR0 A;  2RFH A;  1WWZ A;  4KLV A;  3HLP A;  4UFW A;  4B10 A;  2Q4V A;  2V8H A;  4JWP A;  1RTQ A;  3F5B A;  1QSO A;  2XEG A;  5DWN A;  3TLY A;  4KZT A;  2V8D A;  3OP0 A;  4MFQ A;  4BPW B;  2BO9 A;  3W6X A;  5K8N A;  4IUS A;  4BPX B;  4ZGY B;  2HRO A;  4NGM A;  2O4H A;  1QST A;  2ATR A;  2Y0M A;  1TF8 A;  2PJ6 A;  2POK A;  2ZEF A;  3KQZ A;  4PV6 A;  4Q38 A;  3PT1 A;  4CYP A;  5IV0 A;  4TJV A;  2PSW A;  2F5I A;  4MCP A;  4OAE A;  4R3K A;  5HXD A;  2P6E A;  5LRJ A;  2NSM A;  3S6K A;  3EIF A;  3WT4 A;  4J3G A;  3VWD A;  4BMH A;  1KC7 A;  2B5G A;  2CF4 A;  3VRN A;  3T05 A;  1PUA A;  3K4I A;  4CZ1 A;  1I1D A;  1UFH A;  4F9V A;  5D29 A;  3PBE A;  2CIJ A;  1MK4 A;  1PYT B;  3D68 A;  2HV2 A;  4QBJ A;  3EZB A;  3BI0 A;  4A37 A;  3FBU A;  2OZU A;  3CPX A;  4B5O A;  2ZEL A;  3RBU A;  3QAH A;  3TLC A;  4JZ0 A;  4M6G A;  4K3N A;  3RO0 A;  3TCV A;  1XBU A;  3NE8 A;  1WVM A;  1VBH A;  1BXR B;  2X0S A;  1QMU A;  2XEI A;  2Z0Z A;  3IJ3 A;  3PRT A;  1IID A;  4UFX A;  3R9E A;  4EVY A;  3WC5 A;  1AYE A;  4HNW B;  2B4D A;  1Y0Y A;  4C9V A;  4Y49 B;  3PLF B;  2ABZ A;  4GXH A;  4OLL A;  4GS4 A;  4NXY A;  3D4U A;  2EO8 A;  2ZEN A;  4XPK A;  3U88 C;  4UEF A;  2Q7B A;  1NSA A;  3WC6 A;  3BUN B;  1KWM A;  4JJX A;  4YFJ A;  4MCR A;  2PIZ A;  2PJB A;  2DIK A;  1HEE A;  3BUO B;  3PBB A;  4E2A A;  2J8M A;  1ZO0 A;  1NBW A;  2JEW A;  4KSF A;  2ZEP A;  1XIX A;  3PFE A;  2QEC A;  3RYO A;  2ZED A;  4PPZ A;  3SXN A;  5K8O A;  4L89 A;  3WC7 A;  2D4O A;  1I21 A;  5I0C A;  4JVO A;  2IL4 A;  2QIR A;  2WZN A;  4FBE A;  2VQY A;  2O28 A;  1P4N A;  1OBR A;  2PVV A;  1GGO A;  4JXQ A;  4KLW A;  4L8A A;  4C2X A;  1VBG A;  2VL1 A;  4FWU A;  5J3X A;  1L0C A;  4C68 A;  4AG7 A;  3KKW A;  1Z8L A;  4CDK A;  4KSA A;  4XPL A;  1CP7 A;  2WUU A;  3S6H A;  2H5M A;  3ZNI A;  4MY0 A;  1PCA A;  4P4B A;  2Z3O A;  1GYT A;  1CPS A;  3K9T A;  4NGN A;  2JDD A;  3V8I A;  1B6B A;  5HVG A;  5CPA A;  4C9R A;  3D2P A;  4CGN A;  5HH1 A;  4ORF A;  3B3W A;  1AMP A;  2B4J C;  2V8G A;  3GB0 A;  4C86 A;  4P45 A;  3A9L A;  1KUV A;  5G20 A;  3EZA A;  1VHO A;  1JQG A;  1TKH A;  3NH4 A;  4QB9 A;  5I4M A;  2VXK A;  3JVN A;  2PJ5 A;  2Z10 A;  2R8V A;  3BUM B;  4C84 A;  1Q2D A;  3BJ8 A;  4CO9 A;  2C6G A;  3DSB A;  4C2Z A;  2REE A;  2OU2 A;  4EYS A;  4IK2 A;  2IMO A;  3DGV A;  1TKJ A;  1Q2C A;  1JDE A;  3TLE A;  3GKR A;  3BUW B;  4RN7 A;  4X5K A;  1S7F A;  3HUV A;  3N5F A;  3ZZI A;  2MP0 A;  2BCO A;  1YX0 A;  4E94 A;  3ZJ0 A;  3N7Z A;  5G21 A;  4COG A;  3SI1 A;  2Q4Y A;  3WR7 A;  4KS9 A;  2PJ2 A;  3TLB A;  2UV8 G;  3VAR A;  3FED A;  3I3G A;  4LUA A;  4OAD A;  3VGO A;  4KOX A;  2BL1 A;  3H4Q A;  5J8C A;  1R3N A;  3PP9 A;  4F0Y A;  3FRM A;  1WJT A;  4BD9 A;  2YJV A;  4C8P A;  2PJ0 A;  3GIU A;  1Z9U A;  4M6I A;  1CBX A;  2HQY A;  3LD2 A;  3FF3 A;  4UF4 A;  1LAP A;  4Q36 A;  5HVF A;  4OC4 A;  2CY2 A;  2IQ6 A;  2R98 A;  2XPP A;  1XRY A;  4MFP A;  3SI2 A;  2RB7 A;  3T8W A;  5H86 A;  2PC1 A;  1Z8X A;  4PQA A;  1F2O A;  2K5T A;  4PK2 A;  4IHM A;  4UIA A;  2EK9 A;  5DWM A;  5IB0 A;  5K8P A;  2HB6 A;  3EY5 A;  3KR5 A;  3V7Z A;  3IGR A;  1ZLH A;  4KVO E;  4U5Y A;  2ARH A;  5F49 A;  4CGP A;  5K8M A;  3TE4 A;  1JDB C;  2YJT A;  5F9M A;  3NH8 A;  4OC3 A;  4CS0 B;  3KRV A;  2AUN A;  2B0A A;  3I6S A;  1BLL E;  4P44 A;  1VHE A;  3WAB A;  1T36 B;  3TT2 A;  5F48 A;  3BJ7 A;  1S5K A;  3LWU A;  1IYL A;  2CNS A;  4LX9 A;  2EZB A;  2BEI A;  4OC2 A;  1CX8 A;  1FY7 A;  3SJX A;  2PRB A;  1VGY A;  2N3A B;  3IWG A;  5HMN A;  4M3S A;  2Z3N A;  1IY7 A;  1F57 A;  4A32 A;  2Z3M A;  3CZX A;  4KOU A;  4C8T A;  3H5Z A;  4H89 A;  4U9Z A;  4C8C A;  1KUY A;  1EO0 A;  2DPS A;  3GLJ A;  4AXV A;  5AG7 A;  2JDC A;  1TIQ A;  3SR3 A;  5JVL A;  2PCN A;  3D7G A;  1N71 A;  2PJ4 A;  4BPU B;  4Y49 C;  3SXO A;  5IX3 A;  2V77 A;  1Y9K A;  4UBR A;  2J9A A;  4OC0 A;  4A4B A;  1R57 A;  1EE3 P;  3I74 A;  4R57 A;  3SJG A;  1NXJ A;  2QML A;  1XFO A;  4O23 A;  1BOB A;  2IJZ A;  2ZEG A;  3ISX A;  3R1K A;  4HNX B;  3DDD A;  1S7L A;  4MJ8 A;  4C9A A;  4KOS A;  4CRY B;  4ZY1 A;  2PR1 A;  5J8F A;  4LQG A;  2O53 A;  2CNM A;  2QJ8 A;  2PR8 A;  5HKY A;  4I49 A;  1ZL0 A;  1BPN A;  1VIX A;  4B6Z A;  1J3L A;  4PXE A;  4P4E A;  2GAN A;  1IGB A;  4OID A;  4UIB A;  4ZYQ A;  4NGS A;  3VRQ A;  4NGT A;  4NGQ A;  3F0A A;  2FVG A;  3NE7 A;  5F13 A;  1Y7E A;  2R1I A;  1M4D A;  4CAF A;  4CDJ A;  1B87 A;  3K9U A;  3NFQ A;  1C3O B;  2V8V A;  2GU2 A;  4MHY A;  3B7I A;  2QYV A;  4P4J A;  1YW4 A;  3CXP A;  3TOA A;  3FH4 A;  3NH5 A;  4AVC A;  4J0N A;  1Y7R A;  2R7H A;  3D3S A;  3TOB A;  3NA6 A;  4NJR A;  2ANP A;  3VRO A;  1LFW A;  2ODF A;  2ZW7 A;  3R96 A;  2ZPA A;  2D0P A;  3KHX A;  4F6A A;  2Q7S A;  4OME A;  2FIW A;  3IO1 A;  4P6Y A;  1TF9 A;  1M4I A;  2PJ8 A;  5K99 A;  4RR2 B;  4R87 A;  3GJZ A;  2E28 A;  4A4C A;  2WPX A;  2JLM A;  2PJ9 A;  2ZEH A;  4RI1 A;  3KHZ A;  2AFX A;  4MCQ A;  1Y9Z A;  1LAN A;  2AE6 A;  2PJ1 A;  1NSL A;  3ISZ A;  4OC1 A;  1P0H A;  3MN8 A;  4KVX A;  4CAW A;  1YME A;  1VI4 A;  5BY0 A;  1QSR A;  1MJA A;  2FCK A;  3JRU A;  5IB9 A;  2PIY A;  4DYO A;  4FD4 A;  4H6U A;  4KNG E;  2Q4Z A;  5F5X A;  3T5M A;  4UWI A;  4KOY A;  1FT7 A;  3PB7 X;  2CNT A;  3TC8 A;  4QUS A;  4RUH A;  4ZI6 A;  2AFW A;  2EZA A;  2JBJ A;  4C7H A;  1FNO A;  3BXM A;  2QVP A;  2JBK A;  3IWW A;  4C7I A;  4E5S A;  1AUG A;  4FD5 A;  1K4J A;  3SHP A;  2DXQ A;  2AFS A;  3EXN A;  3CPA A;  5HKW A;  4CYN A;  4UCP A;  1C30 B;  4XPD B;  2AFO A;  2B4B A;  3ICU A;  4X2T A;  4R8F A;  3OB2 B;  3FNC A;  3TLG B;  5JGF A;  3FB3 A;  1CE8 B;  5ELY A;  5CNP A;  3C8O A;  3BI1 A;  3LAC A;  2HI6 A;  2FXF A;  2YNE A;  2OR4 A;  1FBV A;  5KTC A;  2CTB A;  2PE3 A;  4HKF A;  3TO9 A;  3FMC A;  4P10 A;  4RS2 A;  5JYB A;  1S3Z A;  1IYK A;  2Z11 A;  3L2N A;  2Q44 A;  2JEV A;  2YND A;  4KOR A;  5LYI A;  1DTD A;  2FM4 A;  4M8D A;  4NSQ A;  3RZA A;  2VBQ A;  3KR4 A;  3H8F A;  3KGQ A;  4TJX A;  4B11 A;  4ZX8 A;  3DR6 A;  4II9 A;  2Q43 A;  4UFV A;  3PFO A;  3IC1 A;  2CBL A;  3PB8 X;  3B2Y A;  5J1Q A;  4K30 A;  3VRR A;  4B12 A;  3SJF A;  1S60 A;  1XE4 A;  5HVH A;  2P6F A;  2Z3P A;  3FX6 A;  5EC4 A;  4MCS A;  4DJL A;  4ONW A;  1A9X B;  3GY9 A;  3IIB A;  1I12 A;  1YGH A;  3OB1 B;  3D8P A;  4A31 A;  4H1H A;  2AFM A;  3BLN A;  1IU8 A;  1XMB A;  3PB4 X;  4NJQ A;  4C9U A;  4CAE A;  1CPX A;  3W91 A; 
#chains in the Genus database with same CATH homology
 4A39 A;  2PVW A;  4OKO A;  4C8A A;  4FUU A;  1R43 A;  1ARL A;  3FJU A;  1BAV A;  2PCU A;  3IEH A;  3VTA A;  3FEC A;  1CG2 A;  3D67 A;  3TX8 A;  3KI9 A;  3PEI A;  1LOK A;  4P4F A;  1BPM A;  3SJE A;  3B3T A;  3H8G A;  1UWY A;  2NYQ A;  2WYR A;  2BOA A;  3I1U A;  2AFU A;  4YWY A;  4C9E A;  2C6P A;  4ZX9 A;  3B3S A;  4P4D A;  2ZOG A;  4X8I A;  4NGP A;  4OIW A;  3S9M A;  1XJO A;  3DLJ A;  5D8N A;  3PB9 X;  3V38 A;  3KL9 A;  1CPX A;  4PXB A;  4YN3 A;  4ZY2 A;  4EWT A;  4PXD A;  1Z2L A;  3K2K A;  3B3V A;  2Q51 A;  2ZEE A;  4F9U A;  5JM6 A;  2EK8 A;  2OOT A;  4C85 A;  2ZEO A;  3PB6 X;  5CBM A;  4EFD A;  5LYL A;  4PXC A;  4NFR A;  1TKF A;  1F2P A;  3IFE A;  1XF1 A;  3BHX A;  4UEE A;  3SI0 A;  1YW6 A;  4A38 A;  1Q7L A;  1Z5R A;  3B35 A;  1Y0R A;  4Q7A A;  1YLO A;  4G1P A;  6CPA A;  1V6C A;  4A94 A;  3S9L A;  4YU9 A;  4OP4 A;  2C6C A;  4H2K A;  2PRQ A;  4MHZ A;  3D7F A;  4JYW A;  8CPA A;  5LRG A;  3NFZ A;  3S9N A;  4Z65 A;  4WWV A;  4R76 A;  1ZG8 A;  3D7H A;  4MMO A;  1M4L A;  3RAM A;  3LMS A;  4F8Z A;  4IAV A;  5JH9 A;  4CPA A;  2C5Q A;  2HC9 A;  2XEF A;  1ZG9 A;  1QQ9 A;  2PJ7 A;  4WJB A;  4MHP A;  4DUK A;  1HDU A;  3VH9 A;  3CT9 A;  4KSI A;  1ZLI A;  4UEZ A;  2EWB A;  5F09 A;  2C1C A;  3FEE A;  4MRI A;  3KAS A;  4ZY0 A;  4GM5 A;  5LRK A;  2G9D A;  4W9Y A;  1DE4 C;  4TNU A;  2GP4 A;  1H8L A;  1LAM A;  1YSJ A;  2DEA A;  2F7V A;  2GLJ A;  5LYD A;  1HDQ A;  2CTC A;  3CDX A;  5LYF A;  3MRU A;  5DS0 A;  3QNV A;  4TWE A;  2ZOF A;  1ZG7 A;  3D66 A;  1ARM A;  2PJ3 A;  7CPA A;  4C99 A;  3KQX A;  1ELL P;  3GUX A;  4X3R A;  2F8H A;  2GRE A;  4MXU A;  4R7M A;  2ZEM A;  4NGR A;  3H8E A;  2I3C A;  2AFZ A;  4OC5 A;  2PJC A;  3KZW A;  4MHN A;  5THW A;  4FAI A;  1ELM P;  5IR2 A;  4EME A;  1TXR A;  2PJA A;  4R6T A;  2GLF A;  3B3C A;  3VAT A;  2XEJ A;  4P4I A;  1LCP A;  3FVL A;  1CP6 A;  3D7D A;  4C8U A;  2RFH A;  3HLP A;  2V8H A;  1RTQ A;  2XEG A;  2V8D A;  2BO9 A;  5K8N A;  4NGM A;  2O4H A;  1TF8 A;  2PJ6 A;  2POK A;  2ZEF A;  3KQZ A;  4TJV A;  4MCP A;  5HXD A;  5LRJ A;  2NSM A;  3EIF A;  3WT4 A;  2CF4 A;  4F9V A;  5D29 A;  3PBE A;  2CIJ A;  1PYT B;  3D68 A;  3BI0 A;  4A37 A;  3CPX A;  2ZEL A;  3RBU A;  4JZ0 A;  4K3N A;  1WVM A;  1XBU A;  1QMU A;  2XEI A;  3IJ3 A;  3PRT A;  3WC5 A;  1AYE A;  4C9V A;  1Y0Y A;  2ABZ A;  3D4U A;  2ZEN A;  4UEF A;  3WC6 A;  1NSA A;  1KWM A;  4MCR A;  2PIZ A;  2PJB A;  1HEE A;  3PBB A;  2JEW A;  2ZEP A;  3PFE A;  2ZED A;  4PPZ A;  5K8O A;  3WC7 A;  2WZN A;  4FBE A;  1OBR A;  2PVV A;  2VL1 A;  4FWU A;  1Z8L A;  4CDK A;  1CP7 A;  1PCA A;  4P4B A;  1GYT A;  1CPS A;  3K9T A;  4NGN A;  5HVG A;  4C9R A;  5CPA A;  3B3W A;  1AMP A;  4C8P A;  2V8G A;  3GB0 A;  4C86 A;  4P45 A;  1VHO A;  1JQG A;  1TKH A;  3NH4 A;  5I4M A;  2PJ5 A;  4C84 A;  2C6G A;  4IK2 A;  2IMO A;  3DGV A;  1TKJ A;  3HUV A;  3N5F A;  2BCO A;  3SI1 A;  2PJ2 A;  3VAR A;  3FED A;  1R3N A;  4BD9 A;  2PJ0 A;  1CBX A;  3FF3 A;  4UF4 A;  1LAP A;  5HVF A;  4OC4 A;  2IQ6 A;  3SI2 A;  1XRY A;  2RB7 A;  3T8W A;  4PQA A;  1F2O A;  4UIA A;  4IHM A;  2EK9 A;  5K8P A;  2HB6 A;  3KR5 A;  3V7Z A;  1ZLH A;  4C8F A;  5K8M A;  3NH8 A;  4OC3 A;  3I6S A;  1BLL E;  4P44 A;  1VHE A;  3WAB A;  3LWU A;  4OC2 A;  1CX8 A;  3SJX A;  1VGY A;  1IY7 A;  1F57 A;  4C8T A;  4C8C A;  3GLJ A;  4AXV A;  3D7G A;  2PJ4 A;  2J9A A;  4OC0 A;  3I74 A;  1EE3 P;  3SJG A;  1XFO A;  4O23 A;  2IJZ A;  2ZEG A;  3ISX A;  4C9A A;  4ZY1 A;  4LQG A;  2O53 A;  2QJ8 A;  1BPN A;  1VIX A;  4B6Z A;  4PXE A;  4P4E A;  4UIB A;  1IGB A;  4OID A;  4ZYQ A;  4NGS A;  4NGT A;  4NGQ A;  2FVG A;  4CDJ A;  1Y7E A;  2V8V A;  2GU2 A;  4MHY A;  3B7I A;  2QYV A;  4P4J A;  1YW4 A;  3FH4 A;  3NH5 A;  3NA6 A;  4NJR A;  2ANP A;  1LFW A;  3KHX A;  4OME A;  3IO1 A;  4P6Y A;  1TF9 A;  2PJ8 A;  2PJ9 A;  2ZEH A;  1Y9Z A;  3KHZ A;  2AFX A;  4MCQ A;  1LAN A;  2PJ1 A;  3ISZ A;  4OC1 A;  3MN8 A;  1YME A;  5IB9 A;  3JRU A;  2PIY A;  4DYO A;  4KNG E;  2Q4Z A;  1FT7 A;  3PB7 X;  3TC8 A;  4ZI6 A;  4RUH A;  2AFW A;  2JBJ A;  1FNO A;  3BXM A;  2QVP A;  2JBK A;  3IWW A;  2AFS A;  3CPA A;  2AFO A;  3ICU A;  4X2T A;  4R8F A;  5JGF A;  5ELY A;  3BI1 A;  2OR4 A;  2CTB A;  2PE3 A;  3FMC A;  4P10 A;  3L2N A;  5LYI A;  1DTD A;  3RZA A;  3KR4 A;  3H8F A;  3KGQ A;  4TJX A;  4ZX8 A;  2Q43 A;  3PFO A;  3IC1 A;  3PB8 X;  3B2Y A;  5J1Q A;  3SJF A;  5HVH A;  3FX6 A;  4MCS A;  4DJL A;  4ONW A;  3IIB A;  2AFM A;  4NJQ A;  1XMB A;  3PB4 X;  4C9U A;  2V77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...