5F09A

Structure of inactive gcpii mutant in complex with beta-citryl glutamate
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Comparison of human glutamate carboxypeptidases II and III reveals their divergent substrate specificities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 261
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 5f09A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5f09A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5f09A02
3D7HA 4DYOA 4P4IA 2PIYA 2QJ8A 1Y9ZA 1Q7LA 1R3NA 5DS0A 4OMEA 1HDQA 2V8DA 1Z8LA 1RTQA 1Y0RA 3KZWA 2PRQA 1BLLE 1ZLHA 1LAMA 5JGFA 3L2NA 3K2KA 1CPXA 4X8IA 1XBUA 3FEEA 2RB7A 1VGYA 1V6CA 4MCQA 4FWUA 1GYTA 2OOTA 1CP7A 2OR4A 4EWTA 4OIWA 2V8HA 3NH4A 3FJUA 5J1QA 2BCOA 5CPAA 7CPAA 4WWVA 4ZY2A 4KNGE 4ONWA 3KR5A 4C99A 5K8PA 3ISZA 1TF8A 2PJ4A 4P10A 3FMCA 4R76A 2ABZA 1TXRA 3B3TA 1ELLP 4C84A 4FUUA 1Y7EA 2XEJA 3VH9A 2ZEHA 4A39A 4YN3A 1PCAA 3H8EA 3PFOA 2PJ0A 4FBEA 2CF4A 1UWYA 5THWA 4UIBA 2IMOA 2C1CA 2PVVA 5D29A 2G9DA 2ZEEA 2ZELA 3PB9X 4OP4A 1EE3P 2WZNA 1ARLA 2GLJA 2PVWA 4C8UA 4ZI6A 3FF3A 3IJ3A 1ZG9A 3KQXA 4OIDA 2PJ5A 3IIBA 2PJ8A 3ISXA 4UF4A 3I6SA 3K9TA 2ZOGA 4OC4A 2ZEOA 2IJZA 4KSIA 2PJBA 2JBJA 4R7MA 1Z2LA 2PJ2A 1XF1A 2NYQA 1CX8A 4JYWA 4PQAA 4TNUA 1M4LA 2PE3A 1XJOA 4Q7AA 3MRUA 1VHOA 2O53A 3NH8A 2PIZA 1CBXA 2JEWA 1YW4A 3QNVA 4ZX9A 4OC1A 3D7FA 3D66A 4MCPA 3SI2A 4BD9A 4C8FA 2I3CA 1ZG8A 1ARMA 4MCRA 1ZLIA 3FVLA 3PFEA 2AFZA 3PB4X 2Q43A 2PJ7A 4DJLA 2QVPA 4EMEA 1CP6A 1OBRA 3FH4A 2PCUA 6CPAA 5CBMA 3WC6A 4C9VA 5JH9A 3PRTA 2BOAA 3WC7A 4C9AA 2V77A 2ANPA 1F2PA 1TKHA 4C8TA 4C85A 1TF9A 3I74A 4NGTA 4PXEA 3NA6A 1YLOA 2ZEDA 5K8MA 5F09A 2RFHA 4P4EA 4IHMA 3LWUA 2C6PA 3I1UA 5ELYA 3B3SA 3PBEA 3TC8A 4X3RA 4CDKA 3DGVA 5LRGA 2JBKA 2GLFA 1ELMP 3SJGA 2F7VA 4A94A 3NH5A 3RBUA 2O4HA 4ZY1A 4ZYQA 3KASA 4W9YA 3B3VA 3D7DA 1ZG7A 4CPAA 4MHZA 1R43A 2Q4ZA 5JM6A 1F57A 1HEEA 1XFOA 4MCSA 2J9AA 3GLJA 1FNOA 4C9UA 3IEHA 3WABA 1WVMA 4DUKA 3ICUA 4C9EA 2XEFA 1AMPA 4F9VA 1CPSA 2EWBA 1LOKA 4P44A 2VL1A 4NFRA 4NGSA 4R8FA 2CIJA 2AFWA 3NFZA 4PXBA 2C6CA 3VARA 4F9UA 2XEGA 5HVFA 2EK8A 3B35A 3PB7X 4NGNA 3GB0A 3VTAA 3H8FA 1TKFA 1Z5RA 3VATA 3PB8X 3FEDA 3KHZA 3DLJA 3V38A 4GM5A 3D7GA 4PPZA 2EK9A 4P4DA 5HXDA 1VHEA 1AYEA 4IAVA 8CPAA 4OC0A 3S9LA 4MHNA 4ZY0A 3B7IA 2ZEMA 1DTDA 2GU2A 3HLPA 3B3CA 2ZEGA 3GUXA 3CPAA 3S9NA 1LANA 1F2OA 3KGQA 2CTCA 5HVHA 3N5FA 3HUVA 4TJVA 3BHXA 1Y0YA 3SJEA 1TKJA 1XRYA 3RZAA 3BXMA 5HVGA 2PJ3A 2FVGA 3B3WA 4B6ZA 1VIXA 2ZEPA 2BO9A 2ZOFA 4OC3A 2Q51A 3CDXA 3CPXA 3PEIA 4OKOA 1XMBA 2F8HA 2QYVA 3B2YA 4MHPA 5LYDA 4P4BA 2C6GA 4MMOA 2PJ1A 4UEZA 2XEIA 2POKA 2V8VA 5D8NA 3LMSA 4PXCA 3PBBA 4ZX8A 3H8GA 3KQZA 5K8NA 2AFSA 5K8OA 3RAMA 2AFMA 2WYRA 4FAIA 1LFWA 4WJBA 4NGRA 1YW6A 4X2TA 2PJ9A 2ZEFA 2HC9A 1HDUA 4P4FA 4MXUA 3TX8A 1DE4C 5LRJA 4UEEA 3PB6X 4NGMA 4NGPA 3KR4A 3BI0A 4C8AA 3SJXA 4UEFA 2HB6A 4AXVA 5LYLA 4G1PA 2IQ6A 4NJRA 3SJFA 1CG2A 4C9RA 3IWWA 3KL9A 3FECA 1IGBA 2ZENA 4MRIA 3S9MA 4TWEA 4CDJA 4EFDA 4PXDA 4H2KA 3T8WA 4P6YA 4O23A 4YWYA 3SI0A 4TJXA 3WC5A 4NJQA 3KHXA 3SI1A 1QMUA 5LYFA 3CT9A 4A38A 4C86A 3BI1A 1YMEA 3FX6A 2PJCA 4P45A 2CTBA 3WT4A 1PYTB 2GREA 4K3NA 1BPMA 4JZ0A 4C8CA 1IY7A 3IC1A 3V7ZA 1BAVA 2AFOA 3MN8A 1KWMA 1QQ9A 4IK2A 1YSJA 4F8ZA 3D68A 4P4JA 2NSMA 4Z65A 3EIFA 4R6TA 3IO1A 5LRKA 1JQGA 4C8PA 4NGQA 3JRUA 5I4MA 4LQGA 5IB9A 4UIAA 1NSAA 3KI9A 3D4UA 3D67A 2AFXA 4OC5A 1LCPA 5LYIA 1H8LA 4A37A 1LAPA 2PJ6A 3IFEA 4MHYA 4OC2A 2AFUA 4YU9A 2PJAA 4RUHA 1FT7A 2V8GA 1BPNA 2DEAA
chains in the Genus database with same CATH superfamily
3D7HA 4DYOA 1R61A 2P0WA 4NXYA 4P4IA 1R57A 4BMHA 2DXQA 3I9SA 1S7NA 2Z3NA 2ARHA 2P6GA 2PIYA 2QJ8A 1Y9ZA 2REEA 1ON0A 1Q7LA 2PQ8A 4R57A 1R3NA 1BXRB 2N3AB 2XPOA 4OMEA 1HDQA 2WPXA 3D2MA 1S3ZA 2V8DA 3NE8A 5DS0A 1Z8LA 1YREA 3R9EA 3GY9A 5AG4A 1VBHA 3VROA 1RTQA 1Y0RA 2DPTA 2J8RA 2RC4A 4MI4A 3KZWA 2PRQA 1BLLE 1ZLHA 2PRBA 2B5GA 3VGOA 4LUAA 1LAMA 3TLBA 4CGLA 5JGFA 3L2NA 3K2KA 1CPXA 3OP0A 4X8IA 4CAEA 1IB1E 1YR0A 5BY0A 1XBUA 2HV2A 1EZBA 4F0YA 3FEEA 3TLGB 2RB7A 1C3OB 1VGYA 1V6CA 1Z9EA 4ZGYB 1RXTA 4MCQA 4FWUA 1GYTA 2OZGA 2OOTA 1CP7A 2OR4A 4EWTA 2B4DB 3R9FA 4OIWA 2V8HA 4AVAA 3NH4A 4H6ZA 5F48A 3FJUA 3D3SA 4H6UA 4E2AA 5J1QA 1NBWA 2BCOA 1IYKA 5CPAA 7CPAA 2HI6A 4YGOA 4CDJA 4WWVA 1Z4RA 2Z3MA 3HPGG 4II9A 4ZY2A 3PLFB 4KNGE 3KRVA 3PZJA 2ODFA 3KR5A 4ONWA 4MFJA 4AG9A 5HKYA 4AVBA 1YVKA 5JPHA 3TLZA 4C99A 4COBA 5K8PA 2F5IA 1TF8A 2PJ4A 3ISZA 5G20A 4EYSA 4P10A 3FMCA 2FS5A 3BJ7A 4RS2A 4M6GA 4ONUA 4R76A 1CE8B 4RR2B 2GANA 1JWQA 4A95A 1L0CA 2VI7A 3D2PA 3W91A 2ABZA 1Y9WA 1TXRA 2VZZA 3B3TA 3WR7A 1ELLP 1KUVA 4JWPA 3CZXA 1QSNA 2HUZA 3DSBA 4C84A 4FUUA 1Y7EA 2XEJA 3VH9A 1J4JA 2ZEHA 4A39A 3TTHA 4GXHA 4YN3A 2OB0A 1Z9UA 2B4BA 1KC7A 5DWNA 1PCAA 2JDCA 3H8EA 4MY0A 4NEXA 3W6XA 3PFOA 4FD5A 2PJ0A 4FBEA 2CF4A 2GE3A 2ZXVA 4KOYA 3FYNA 1UWYA 5THWA 4LQ6A 4UIBA 2YNEA 4R3KA 2IMOA 2C1CA 3TCVA 2PVVA 5D29A 3BJ8A 2G9DA 2ZEEA 2ZELA 3R96A 1DIKA 2X0SA 3BUOB 4IUSA 3PB9X 4OP4A 2OU2A 1EE3P 1OZPA 2WZNA 1NE9A 1ARLA 2GLJA 3EXNA 4GS4A 2PVWA 1YLEA 1M1DA 4C8UA 5HKZA 2G3TA 4HNWB 4B11A 4ZI6A 4A2ZA 4B12A 1VBGA 3FF3A 2OZHA 2JDDA 1ZG9A 3IJ3A 3KQXA 1JDBC 2R82A 2HROA 2FXFA 4OIDA 4GPLB 2PJ5A 3IIBA 1XIXA 2PJ8A 3JTKA 3ISXA 1IOIA 4JXRA 4UF4A 3I6SA 4CAVA 5E96A 4QUSA 2FIWA 3K9TA 2ZOGA 4OC4A 2ZEOA 5I0CA 2HWGA 2IJZA 3T07A 4KSIA 4C2ZA 2VBQA 3VRQA 2PJBA 2JBJA 3NFQA 3OB2B 2WUUA 2FL4A 4KLVA 4R7MA 5AGEA 1M44A 1Z2LA 2PJ2A 4COGA 1XF1A 2G0BA 1CX8A 4JYWA 2NYQA 4PQAA 4TNUA 1M4LA 4H89A 2PE3A 4UFXA 1XJOA 4XPDB 4Q7AA 4CO9A 3MRUA 2BSWA 3QB8A 3TE4A 3QAHA 4R87A 4XNHC 2Q0YA 1VHOA 2EBJA 4C2XA 4L8AA 2O53A 3NH8A 2PIZA 4A32A 1CBXA 2O28A 2JEWA 4JVOA 1YW4A 3QNVA 4ZX9A 4OC1A 4XPDC 3D7FA 3D66A 4CGMA 1Q2YA 4BINA 4MCPA 5AG5A 3HPHE 3IWEA 3V8IA 3SI2A 4BD9A 3FXTA 2BUEA 1IICA 2I3CA 4C8FA 2YNCC 1ZG8A 1JDEA 1ARMA 3EFAA 1XMTA 1XE4A 4MCRA 1ZLIA 3BUXB 2D4PA 2DIKA 3T0TA 3FVLA 3H5ZA 2AFZA 3PFEA 2JEVA 3PB4X 3TFYA 4IIYA 4MRIA 4KUAA 2Q43A 2ZW4A 2PJ7A 4DJLA 2QVPA 4EMEA 1PU9A 2G3AA 1B87A 2WSAA 1CP6A 1OBRA 4C68A 3DR6A 1CS0B 5JYBA 3FH4A 1KBLA 2PCUA 6CPAA 3A9LA 5CBMA 3S6GA 3VRPA 3S6FA 3WC6A 4PK2A 4C9VA 3D8PA 5JH9A 1S5KA 1CJWA 3TO9A 2AUNA 1IIDA 4KSFA 3PRTA 2GIVA 5C82A 1BO4A 2BOAA 2CNSA 3RO0A 3WC7A 2IL4A 4C9AA 2V77A 5H86A 3F9KC 2ANPA 2Z3LA 1EO0A 1F2PA 4PSXA 1TKHA 4C8TA 4C85A 3U1BA 2H5MA 3EC4A 1TF9A 2XPPA 4NGTA 3I74A 4PXEA 2CXAA 2CY2A 3IGRA 3IU1A 4YFJA 3NA6A 4EVYA 2YJTA 1XEBA 1T36B 5KTCA 3G3SA 4UBRA 4CRYB 5A28A 5J8FA 4B5PA 1YLOA 4BBHA 2ZEDA 3H4QA 3FBUA 5K8MA 5F09A 4FD7A 3R9GA 5KTAA 3VRRA 4CAFA 3JVNA 4BPWB 2RFHA 3KKWA 4B13A 2FIAA 4P4EA 4IHMA 4F0XA 3LWUA 1Z4EA 3LACA 2C6PA 4IF5A 3I1UA 5AG7A 3SR3A 2Z3OA 2BEIA 1VI4A 5ELYA 3B3SA 3PBEA 2YJVA 1YX0A 1EZAA 2DPSA 3LD2A 4PK3A 2FSRA 3TC8A 3SHPA 4X3RA 1M4GA 2ZW6A 4M85A 2EZBA 4CDKA 3QAYA 4R3LA 2VXKA 5J3XA 3DGVA 5LRGA 5K99A 2Y0MA 4A30A 3NE7A 3TOBA 2JBKA 2GLFA 1ELMP 3SJGA 1QSRA 2F7VA 2OZUA 3NH5A 3RBUA 2O4HA 4MJ8A 2P6FA 4ZYQA 4ZY1A 1ZYMA 3KASA 3HMJG 2ATRA 4OLLA 3VWEA 1LRZA 2Q7BA 4KZTA 1IOFA 4W9YA 2VZYA 3B3VA 4IIXA 2B58A 4CYOA 3D7DA 1ZG7A 4CPAA 4MHZA 1R43A 4BPXB 2D4OA 2Q4ZA 5JM6A 1AUGA 4MFQA 1Y7RA 1F57A 1HEEA 2Q04A 2FM4A 1XFOA 3T05A 4MCSA 2J9AA 4CYNA 3GLJA 1FNOA 4C9UA 3EZEA 3IEHA 2Q4VA 1B47A 4MFLA 4UWJA 4CGOA 5BWAB 3WABA 1WVMA 4C7IA 4DUKA 4HNXB 3CXSA 1P0HA 2PR8A 1K4JA 4OADA 5F49A 3ICUA 4C9EA 3BUMB 1KUXA 2EUIA 3EO4A 5F46A 2XEFA 5F1YA 3K4IA 1AMPA 3UY5A 2B5GB 4F9VA 2MP0A 1ZL0A 1YVHA 4RI1A 1CPSA 2X7BA 3ZZIA 2EWBA 4U9ZA 5A27A 4CGNA 4CYPA 5EBVA 1YK3A 1ZRSA 1MK4A 4PSWA 1LOKA 4P44A 2VL1A 2R8VA 4B10A 3PGPA 1QSOA 4NFRA 4XNHB 4NGSA 3GJZA 4R8FA 2CIJA 1PUAA 1SQHA 4YRHA 4UCMA 2Y1NA 4KVME 5AXIA 3T90A 5DWMA 2AFWA 4MFKA 3NFZA 4A4BA 3MGDA 4PXBA 4K30A 2C6CA 4M8DA 3VARA 3CXPA 3O8ZA 3VRNA 2YGWA 4MFZA 2XEGA 4F9UA 4KVOE 2YNDA 5HMNA 4UFWA 4B14A 2Z11A 1RO5A 5FD8A 2PCNA 4MFPA 4KS9A 5HVFA 4DNCA 2EK8A 3B35A 3EZAA 3PB7X 4X5KA 1MJAA 4NGNA 3GB0A 4HKFA 1A9XB 3VTAA 2AJ6A 1WWZA 4E8OA 3TLGA 3SXNA 3H8FA 3BUWB 1IYLA 1TKFA 1Z5RA 3P2FA 3PB8X 3FEDA 5G21A 3VATA 3TLEA 4A4CA 3KHZA 3DLJA 3V38A 2B4DA 1XF8A 4Q36A 4GM5A 3D7GA 4PPZA 3E0KA 2UV8G 4CGPA 4E94A 3PFVA 1Q2DA 2B0AA 2EK9A 2EVNA 2PC1A 4P4DA 1VKCA 4UCNA 5EMIA 1VHEA 1AYEA 5HXDA 3G23A 2GFQA 4IAVA 2DLAA 3U88C 8CPAA 4OC0A 3S9LA 4JD6A 3C8OA 4QB9A 3F8KA 4MHNA 3DNSA 4ZY0A 4PV6A 3BUNB 3B7IA 2ZEMA 2VQYA 1DTDA 2GU2A 2OH1A 4M6HA 3HLPA 3F5BA 4U9YA 3B3CA 4HPSA 2ZEGA 5ISVA 3GUXA 4ORFA 3CPAA 3PT1A 1GHEA 5JQ4A 3S9NA 3BLNA 3LODA 1NSLA 3FRMA 1S60A 1LANA 1NXJA 3TLYA 5EC4A 2FT0A 2ZPAA 1F2OA 3KGQA 2CTCA 5HVHA 4J3GA 3N5FA 2HQYA 3HUVA 3TT2A 1QSMA 4TJVA 2ZW5A 4UCPA 3BHXA 1Y0YA 3W6SA 3IU2A 3SJEA 4AG7A 1TKJA 4JLYA 1XRYA 2I00A 4NSQA 2PDOA 3RZAA 3BXMA 5HVGA 3I3GA 2PJ3A 2FVGA 4I49A 1MJBA 3B3WA 4B6ZA 1M6VB 3TOAA 4KOUA 1VIXA 5F5XA 2ZEPA 2BO9A 1KEEB 2XPLA 2ZOFA 4OC3A 2Q51A 2QMLA 2R98A 2QECA 3CDXA 2EZAA 1YGHA 5F13A 3CPXA 3PEIA 4JJXA 4OKOA 1XMBA 2AUMA 2F8HA 3FIXA 2QYVA 3B2YA 3JUWA 4MHPA 5LYDA 5J8CA 2CBLA 4P4BA 4M3SA 4B5OA 1I1DA 2C6GA 4MMOA 3R95A 2PJ1A 4E5SA 4UEZA 2GP4A 2XEIA 3ZJ0A 1ZO0A 2POKA 2V8VA 4B5PB 2REFA 5D8NA 3LMSA 4PXCA 1Z8WA 3PBBA 1M4IA 3H8GA 4Q38A 3KQZA 4HNYB 4UA3A 2AFSA 4ZX8A 5K8NA 4KOWA 5K8OA 3RAMA 2ZW7A 3CXQA 2B3VA 2AFMA 2C27A 2WYRA 4FAIA 1LFWA 3K9UA 4WJBA 2A4NA 4MHDA 3GIUA 5F9MA 2J8NA 4J0NA 2Y1MA 1J3LA 2CNMA 1Q5XA 3TLAA 4NGRA 2Z10A 2I79A 1YW6A 4LX9A 4KSAA 2YNCA 4X2TA 3B8GA 3F0AA 5G22A 1BOBA 4KUBA 1Z8XA 2PJ9A 2ZEFA 5FVJA 4QC6A 2D0PA 4INJA 2P6EA 4MJXA 5HKWA 1HDUA 2HC9A 1XOVA 4P4FA 4MXUA 3TX8A 1DE4C 2XPNA 5LRJA 1I12A 4CRZB 4UEEA 2R7HA 2FE7A 2NMTA 1KUYA 3PB6X 3GKRA 1I21A 4BPUB 5IB0A 2Q4YA 4OAEA 4ZBGA 5CNPA 3R1KA 4NCZA 4U5YA 2D0OA 4UWIA 4CAWA 4MI1A 4A94A 4NGMA 4NGPA 3DDDA 3KR4A 3BI0A 2K5TA 4C8AA 3SJXA 4UEFA 2HB6A 4AXVA 3OB1B 4KOXA 2DF5A 5LYLA 1C30B 3TO7A 4G1PA 2IQ6A 3P2HA 4NJRA 3SJFA 1CG2A 2R1IA 4C9RA 3IWWA 5GCNA 1P4NA 4KORA 3FNCA 3FECA 1IGBA 1M4DA 2B3UA 3S9MA 2QIRA 1Y9KA 2ZENA 3KL9A 4JXQA 4TWEA 5HH1A 4C2YA 4EFDA 4PXDA 5KTDA 2WPWA 3GYAA 4H2KA 4P6YA 3T8WA 4CS0B 4O23A 4YWYA 3SI0A 3S6HA 3ZNIA 4TJXA 1Q2CA 4R9MA 3WC5A 5IX3A 4NJQA 2EZCA 3KHXA 3N7ZA 4Y49B 1MJ9A 1S7FA 1QMUA 3SI1A 3RYOA 4AB7A 5LYFA 3CT9A 2Z3KA 4L89A 4A38A 4C86A 3BI1A 2J8MA 2VKZG 1KZFA 1YMEA 3FX6A 1GGOA 3S6KA 2PJCA 4P45A 1YQEA 2CTBA 3WT4A 1PYTB 2GREA 2Z0ZA 3SXOA 4A33A 4QBJA 4MY3A 4K3NA 1BPMA 4JZ0A 4NF1A 4C8CA 3NOJA 4XPKA 1IY7A 5H84A 4H1HA 4Y49C 3IC1A 3V7ZA 4MBUA 2B4JC 1BAVA 2AFOA 5G1ZA 4AVCA 2KCWA 3OAKA 1UFHA 1TIQA 2FCKA 2JLMA 3MN8A 1IU8A 3EY5A 1WK4A 1KWMA 1QQ9A 1VHSA 1QSTA 4IK2A 5F47A 4C7HA 4E0AA 5IR2A 1YSJA 4F8ZA 3D68A 4P4JA 2NSMA 3T5MA 1S7LA 1U6MA 4UFVA 1S7KA 4Z65A 3EIFA 2PR1A 4KOSA 2E28A 4R6TA 3IO1A 5LRKA 5JVLA 1N71A 2VEZA 1FY7A 1WJTA 1JQGA 4NGQA 3JRUA 1B6BA 3OWCA 3VWDA 4A31A 4CYQA 4C8PA 2Z3PA 2PSWA 3DR8A 4KOVA 2OLSA 5IV0A 1NMTA 3G8WA 2Q7SA 5I4MA 4LQGA 1YVOA 4XPLA 4UIAA 5IB9A 1NSAA 1X10A 5AG6A 2AE6A 3KI9A 3FB3A 1Z8TA 3D4UA 2EO8A 4F6AA 3D67A 4CAXA 3TYXA 3IWGA 2AFXA 4BTFA 1X12A 3PP9A 4OC5A 4FD6A 1LCPA 5LYIA 1H8LA 3RNZA 4A37A 5C88A 1LAPA 2CNTA 4KLWA 2C5QA 1V0CA 2PJ6A 3IFEA 4FD4A 4MHYA 1A2ZA 4KVXA 4OC2A 3TO6A 2AFUA 2BL1A 4QVTA 4YU9A 4M6IA 3T9YA 3TLCA 2PJAA 3C26A 1FBVA 4RN7A 4CZ1A 4RUHA 1FT7A 2V8GA 4KOTA 1BPNA 2DEAA 1CM0A 3EZBA 2Q44A
chains in the Genus database with same CATH topology
3D7HA 4DYOA 4P4IA 2PIYA 2QJ8A 1Y9ZA 1Q7LA 1R3NA 5DS0A 4OMEA 1HDQA 2V8DA 1Z8LA 1RTQA 1Y0RA 3KZWA 2PRQA 1BLLE 1ZLHA 1LAMA 5JGFA 3L2NA 3K2KA 1CPXA 4X8IA 1XBUA 3FEEA 2RB7A 1VGYA 1V6CA 4MCQA 4FWUA 1GYTA 2OOTA 1CP7A 2OR4A 4EWTA 4OIWA 2V8HA 3NH4A 3FJUA 5J1QA 2BCOA 5CPAA 7CPAA 4WWVA 4ZY2A 4KNGE 4ONWA 3KR5A 4C99A 5K8PA 3ISZA 1TF8A 2PJ4A 4P10A 3FMCA 4R76A 2ABZA 1TXRA 3B3TA 1ELLP 4C84A 4FUUA 1Y7EA 2XEJA 3VH9A 2ZEHA 4A39A 4YN3A 1PCAA 3H8EA 3PFOA 2PJ0A 4FBEA 2CF4A 1UWYA 5THWA 4UIBA 2IMOA 2C1CA 2PVVA 5D29A 2G9DA 2ZEEA 2ZELA 3PB9X 4OP4A 1EE3P 2WZNA 1ARLA 2GLJA 2PVWA 4C8UA 4ZI6A 3FF3A 3IJ3A 1ZG9A 3KQXA 4OIDA 2PJ5A 3IIBA 2PJ8A 3ISXA 4UF4A 3I6SA 3K9TA 2ZOGA 4OC4A 2ZEOA 2IJZA 4KSIA 2PJBA 2JBJA 4R7MA 1Z2LA 2PJ2A 1XF1A 2NYQA 1CX8A 4JYWA 4PQAA 4TNUA 1M4LA 2PE3A 1XJOA 4Q7AA 3MRUA 1VHOA 2O53A 3NH8A 2PIZA 1CBXA 2JEWA 1YW4A 3QNVA 4ZX9A 4OC1A 3D7FA 3D66A 4MCPA 3SI2A 4BD9A 4C8FA 2I3CA 1ZG8A 1ARMA 4MCRA 1ZLIA 3FVLA 3PFEA 2AFZA 3PB4X 2Q43A 2PJ7A 4DJLA 2QVPA 4EMEA 1CP6A 1OBRA 3FH4A 2PCUA 6CPAA 5CBMA 3WC6A 4C9VA 5JH9A 3PRTA 2BOAA 3WC7A 4C9AA 2V77A 2ANPA 1F2PA 1TKHA 4C8TA 4C85A 1TF9A 3I74A 4NGTA 4PXEA 3NA6A 1YLOA 2ZEDA 5K8MA 5F09A 2RFHA 4P4EA 4IHMA 3LWUA 2C6PA 3I1UA 5ELYA 3B3SA 3PBEA 3TC8A 4X3RA 4CDKA 3DGVA 5LRGA 2JBKA 2GLFA 1ELMP 3SJGA 2F7VA 4A94A 3NH5A 3RBUA 2O4HA 4ZY1A 4ZYQA 3KASA 4W9YA 3B3VA 3D7DA 1ZG7A 4CPAA 4MHZA 1R43A 2Q4ZA 5JM6A 1F57A 1HEEA 1XFOA 4MCSA 2J9AA 3GLJA 1FNOA 4C9UA 3IEHA 3WABA 1WVMA 4DUKA 3ICUA 4C9EA 2XEFA 1AMPA 4F9VA 1CPSA 2EWBA 1LOKA 4P44A 2VL1A 4NFRA 4NGSA 4R8FA 2CIJA 2AFWA 3NFZA 4PXBA 2C6CA 3VARA 4F9UA 2XEGA 5HVFA 2EK8A 3B35A 3PB7X 4NGNA 3GB0A 3VTAA 3H8FA 1TKFA 1Z5RA 3VATA 3PB8X 3FEDA 3KHZA 3DLJA 3V38A 4GM5A 3D7GA 4PPZA 2EK9A 4P4DA 5HXDA 1VHEA 1AYEA 4IAVA 8CPAA 4OC0A 3S9LA 4MHNA 4ZY0A 3B7IA 2ZEMA 1DTDA 2GU2A 3HLPA 3B3CA 2ZEGA 3GUXA 3CPAA 3S9NA 1LANA 1F2OA 3KGQA 2CTCA 5HVHA 3N5FA 3HUVA 4TJVA 3BHXA 1Y0YA 3SJEA 1TKJA 1XRYA 3RZAA 3BXMA 5HVGA 2PJ3A 2FVGA 3B3WA 4B6ZA 1VIXA 2ZEPA 2BO9A 2ZOFA 4OC3A 2Q51A 3CDXA 3CPXA 3PEIA 4OKOA 1XMBA 2F8HA 2QYVA 3B2YA 4MHPA 5LYDA 4P4BA 2C6GA 4MMOA 2PJ1A 4UEZA 2GP4A 2XEIA 2POKA 2V8VA 5D8NA 3LMSA 4PXCA 3PBBA 4ZX8A 3H8GA 3KQZA 5K8NA 2AFSA 5K8OA 3RAMA 2AFMA 2WYRA 4FAIA 1LFWA 4WJBA 4NGRA 1YW6A 4X2TA 2PJ9A 2ZEFA 2HC9A 1HDUA 4P4FA 4MXUA 3TX8A 1DE4C 5LRJA 4UEEA 3PB6X 4NGMA 4NGPA 3KR4A 3BI0A 4C8AA 3SJXA 4UEFA 2HB6A 4AXVA 5LYLA 4G1PA 2IQ6A 4NJRA 3SJFA 1CG2A 4C9RA 3IWWA 3KL9A 3FECA 1IGBA 2ZENA 4MRIA 3S9MA 4TWEA 4CDJA 4EFDA 4PXDA 4H2KA 3T8WA 4P6YA 4O23A 4YWYA 3SI0A 4TJXA 3WC5A 4NJQA 3KHXA 3SI1A 1QMUA 5LYFA 3CT9A 4A38A 4C86A 3BI1A 1YMEA 3FX6A 2PJCA 4P45A 2CTBA 3WT4A 1PYTB 2GREA 4K3NA 1BPMA 4JZ0A 4C8CA 1IY7A 3IC1A 3V7ZA 1BAVA 2AFOA 3MN8A 1KWMA 1QQ9A 4IK2A 5IR2A 1YSJA 4F8ZA 3D68A 4P4JA 2NSMA 4Z65A 3EIFA 4R6TA 3IO1A 5LRKA 1JQGA 4C8PA 4NGQA 3JRUA 5I4MA 4LQGA 5IB9A 4UIAA 1NSAA 3KI9A 3D4UA 3D67A 2AFXA 4OC5A 1LCPA 5LYIA 1H8LA 4A37A 1LAPA 2C5QA 2PJ6A 3IFEA 4MHYA 4OC2A 2AFUA 4YU9A 2PJAA 4RUHA 1FT7A 2V8GA 1BPNA 2DEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D7H A;  4DYO A;  4P4I A;  2PIY A;  2QJ8 A;  1Y9Z A;  1Q7L A;  1R3N A;  5DS0 A;  4OME A;  1HDQ A;  2V8D A;  1Z8L A;  1RTQ A;  1Y0R A;  3KZW A;  2PRQ A;  1BLL E;  1ZLH A;  1LAM A;  5JGF A;  3L2N A;  3K2K A;  1CPX A;  4X8I A;  1XBU A;  3FEE A;  2RB7 A;  1VGY A;  1V6C A;  4MCQ A;  4FWU A;  1GYT A;  2OOT A;  1CP7 A;  2OR4 A;  4EWT A;  4OIW A;  2V8H A;  3NH4 A;  3FJU A;  5J1Q A;  2BCO A;  5CPA A;  7CPA A;  4WWV A;  4ZY2 A;  4KNG E;  4ONW A;  3KR5 A;  4C99 A;  5K8P A;  3ISZ A;  1TF8 A;  2PJ4 A;  4P10 A;  3FMC A;  4R76 A;  2ABZ A;  1TXR A;  3B3T A;  1ELL P;  4C84 A;  4FUU A;  1Y7E A;  2XEJ A;  3VH9 A;  2ZEH A;  4A39 A;  4YN3 A;  1PCA A;  3H8E A;  3PFO A;  2PJ0 A;  4FBE A;  2CF4 A;  1UWY A;  5THW A;  4UIB A;  2IMO A;  2C1C A;  2PVV A;  5D29 A;  2G9D A;  2ZEE A;  2ZEL A;  3PB9 X;  4OP4 A;  1EE3 P;  2WZN A;  1ARL A;  2GLJ A;  2PVW A;  4C8U A;  4ZI6 A;  3FF3 A;  3IJ3 A;  1ZG9 A;  3KQX A;  4OID A;  2PJ5 A;  3IIB A;  2PJ8 A;  3ISX A;  4UF4 A;  3I6S A;  3K9T A;  2ZOG A;  4OC4 A;  2ZEO A;  2IJZ A;  4KSI A;  2PJB A;  2JBJ A;  4R7M A;  1Z2L A;  2PJ2 A;  1XF1 A;  2NYQ A;  1CX8 A;  4JYW A;  4PQA A;  4TNU A;  1M4L A;  2PE3 A;  1XJO A;  4Q7A A;  3MRU A;  1VHO A;  2O53 A;  3NH8 A;  2PIZ A;  1CBX A;  2JEW A;  1YW4 A;  3QNV A;  4ZX9 A;  4OC1 A;  3D7F A;  3D66 A;  4MCP A;  3SI2 A;  4BD9 A;  4C8F A;  2I3C A;  1ZG8 A;  1ARM A;  4MCR A;  1ZLI A;  3FVL A;  3PFE A;  2AFZ A;  3PB4 X;  2Q43 A;  2PJ7 A;  4DJL A;  2QVP A;  4EME A;  1CP6 A;  1OBR A;  3FH4 A;  2PCU A;  6CPA A;  5CBM A;  3WC6 A;  4C9V A;  5JH9 A;  3PRT A;  2BOA A;  3WC7 A;  4C9A A;  2V77 A;  2ANP A;  1F2P A;  1TKH A;  4C8T A;  4C85 A;  1TF9 A;  3I74 A;  4NGT A;  4PXE A;  3NA6 A;  1YLO A;  2ZED A;  5K8M A;  5F09 A;  2RFH A;  4P4E A;  4IHM A;  3LWU A;  2C6P A;  3I1U A;  5ELY A;  3B3S A;  3PBE A;  3TC8 A;  4X3R A;  4CDK A;  3DGV A;  5LRG A;  2JBK A;  2GLF A;  1ELM P;  3SJG A;  2F7V A;  4A94 A;  3NH5 A;  3RBU A;  2O4H A;  4ZY1 A;  4ZYQ A;  3KAS A;  4W9Y A;  3B3V A;  3D7D A;  1ZG7 A;  4CPA A;  4MHZ A;  1R43 A;  2Q4Z A;  5JM6 A;  1F57 A;  1HEE A;  1XFO A;  4MCS A;  2J9A A;  3GLJ A;  1FNO A;  4C9U A;  3IEH A;  3WAB A;  1WVM A;  4DUK A;  3ICU A;  4C9E A;  2XEF A;  1AMP A;  4F9V A;  1CPS A;  2EWB A;  1LOK A;  4P44 A;  2VL1 A;  4NFR A;  4NGS A;  4R8F A;  2CIJ A;  2AFW A;  3NFZ A;  4PXB A;  2C6C A;  3VAR A;  4F9U A;  2XEG A;  5HVF A;  2EK8 A;  3B35 A;  3PB7 X;  4NGN A;  3GB0 A;  3VTA A;  3H8F A;  1TKF A;  1Z5R A;  3VAT A;  3PB8 X;  3FED A;  3KHZ A;  3DLJ A;  3V38 A;  4GM5 A;  3D7G A;  4PPZ A;  2EK9 A;  4P4D A;  5HXD A;  1VHE A;  1AYE A;  4IAV A;  8CPA A;  4OC0 A;  3S9L A;  4MHN A;  4ZY0 A;  3B7I A;  2ZEM A;  1DTD A;  2GU2 A;  3HLP A;  3B3C A;  2ZEG A;  3GUX A;  3CPA A;  3S9N A;  1LAN A;  1F2O A;  3KGQ A;  2CTC A;  5HVH A;  3N5F A;  3HUV A;  4TJV A;  3BHX A;  1Y0Y A;  3SJE A;  1TKJ A;  1XRY A;  3RZA A;  3BXM A;  5HVG A;  2PJ3 A;  2FVG A;  3B3W A;  4B6Z A;  1VIX A;  2ZEP A;  2BO9 A;  2ZOF A;  4OC3 A;  2Q51 A;  3CDX A;  3CPX A;  3PEI A;  4OKO A;  1XMB A;  2F8H A;  2QYV A;  3B2Y A;  4MHP A;  5LYD A;  4P4B A;  2C6G A;  4MMO A;  2PJ1 A;  4UEZ A;  2XEI A;  2POK A;  2V8V A;  5D8N A;  3LMS A;  4PXC A;  3PBB A;  4ZX8 A;  3H8G A;  3KQZ A;  5K8N A;  2AFS A;  5K8O A;  3RAM A;  2AFM A;  2WYR A;  4FAI A;  1LFW A;  4WJB A;  4NGR A;  1YW6 A;  4X2T A;  2PJ9 A;  2ZEF A;  2HC9 A;  1HDU A;  4P4F A;  4MXU A;  3TX8 A;  1DE4 C;  5LRJ A;  4UEE A;  3PB6 X;  4NGM A;  4NGP A;  3KR4 A;  3BI0 A;  4C8A A;  3SJX A;  4UEF A;  2HB6 A;  4AXV A;  5LYL A;  4G1P A;  2IQ6 A;  4NJR A;  3SJF A;  1CG2 A;  4C9R A;  3IWW A;  3KL9 A;  3FEC A;  1IGB A;  2ZEN A;  4MRI A;  3S9M A;  4TWE A;  4CDJ A;  4EFD A;  4PXD A;  4H2K A;  3T8W A;  4P6Y A;  4O23 A;  4YWY A;  3SI0 A;  4TJX A;  3WC5 A;  4NJQ A;  3KHX A;  3SI1 A;  1QMU A;  5LYF A;  3CT9 A;  4A38 A;  4C86 A;  3BI1 A;  1YME A;  3FX6 A;  2PJC A;  4P45 A;  2CTB A;  3WT4 A;  1PYT B;  2GRE A;  4K3N A;  1BPM A;  4JZ0 A;  4C8C A;  1IY7 A;  3IC1 A;  3V7Z A;  1BAV A;  2AFO A;  3MN8 A;  1KWM A;  1QQ9 A;  4IK2 A;  1YSJ A;  4F8Z A;  3D68 A;  4P4J A;  2NSM A;  4Z65 A;  3EIF A;  4R6T A;  3IO1 A;  5LRK A;  1JQG A;  4C8P A;  4NGQ A;  3JRU A;  5I4M A;  4LQG A;  5IB9 A;  4UIA A;  1NSA A;  3KI9 A;  3D4U A;  3D67 A;  2AFX A;  4OC5 A;  1LCP A;  5LYI A;  1H8L A;  4A37 A;  1LAP A;  2PJ6 A;  3IFE A;  4MHY A;  4OC2 A;  2AFU A;  4YU9 A;  2PJA A;  4RUH A;  1FT7 A;  2V8G A;  1BPN A;  2DEA A; 
#chains in the Genus database with same CATH topology
 3D7H A;  4DYO A;  1R61 A;  2P0W A;  4NXY A;  4P4I A;  1R57 A;  4BMH A;  2DXQ A;  3I9S A;  1S7N A;  2Z3N A;  2ARH A;  2P6G A;  2PIY A;  2QJ8 A;  1Y9Z A;  2REE A;  1ON0 A;  1Q7L A;  2PQ8 A;  4R57 A;  1R3N A;  1BXR B;  2N3A B;  2XPO A;  4OME A;  1HDQ A;  2WPX A;  3D2M A;  1S3Z A;  2V8D A;  3NE8 A;  5DS0 A;  1Z8L A;  1YRE A;  3R9E A;  3GY9 A;  5AG4 A;  1VBH A;  3VRO A;  1RTQ A;  1Y0R A;  2DPT A;  2J8R A;  2RC4 A;  4MI4 A;  3KZW A;  2PRQ A;  1BLL E;  1ZLH A;  2PRB A;  2B5G A;  3VGO A;  4LUA A;  1LAM A;  3TLB A;  4CGL A;  5JGF A;  3L2N A;  3K2K A;  1CPX A;  3OP0 A;  4X8I A;  4CAE A;  1IB1 E;  1YR0 A;  5BY0 A;  1XBU A;  2HV2 A;  1EZB A;  4F0Y A;  3FEE A;  3TLG B;  2RB7 A;  1C3O B;  1VGY A;  1V6C A;  1Z9E A;  4ZGY B;  1RXT A;  4MCQ A;  4FWU A;  1GYT A;  2OZG A;  2OOT A;  1CP7 A;  2OR4 A;  4EWT A;  2B4D B;  3R9F A;  4OIW A;  2V8H A;  4AVA A;  3NH4 A;  4H6Z A;  5F48 A;  3FJU A;  3D3S A;  4H6U A;  4E2A A;  5J1Q A;  1NBW A;  2BCO A;  1IYK A;  5CPA A;  7CPA A;  2HI6 A;  4YGO A;  4CDJ A;  4WWV A;  1Z4R A;  2Z3M A;  3HPG G;  4II9 A;  4ZY2 A;  3PLF B;  4KNG E;  3KRV A;  3PZJ A;  2ODF A;  3KR5 A;  4ONW A;  4MFJ A;  4AG9 A;  5HKY A;  4AVB A;  1YVK A;  5JPH A;  3TLZ A;  4C99 A;  4COB A;  5K8P A;  2F5I A;  1TF8 A;  2PJ4 A;  3ISZ A;  5G20 A;  4EYS A;  4P10 A;  3FMC A;  2FS5 A;  3BJ7 A;  4RS2 A;  4M6G A;  4ONU A;  4R76 A;  1CE8 B;  4RR2 B;  2GAN A;  1JWQ A;  4A95 A;  1L0C A;  2VI7 A;  3D2P A;  3W91 A;  2ABZ A;  1Y9W A;  1TXR A;  2VZZ A;  3B3T A;  3WR7 A;  1ELL P;  1KUV A;  4JWP A;  3CZX A;  1QSN A;  2HUZ A;  3DSB A;  4C84 A;  4FUU A;  1Y7E A;  2XEJ A;  3VH9 A;  1J4J A;  2ZEH A;  4A39 A;  3TTH A;  4GXH A;  4YN3 A;  2OB0 A;  1Z9U A;  2B4B A;  1KC7 A;  5DWN A;  1PCA A;  2JDC A;  3H8E A;  4MY0 A;  4NEX A;  3W6X A;  3PFO A;  4FD5 A;  2PJ0 A;  4FBE A;  2CF4 A;  2GE3 A;  2ZXV A;  4KOY A;  3FYN A;  1UWY A;  5THW A;  4LQ6 A;  4UIB A;  2YNE A;  4R3K A;  2IMO A;  2C1C A;  3TCV A;  2PVV A;  5D29 A;  3BJ8 A;  2G9D A;  2ZEE A;  2ZEL A;  3R96 A;  1DIK A;  2X0S A;  3BUO B;  4IUS A;  3PB9 X;  4OP4 A;  2OU2 A;  1EE3 P;  1OZP A;  2WZN A;  1NE9 A;  1ARL A;  2GLJ A;  3EXN A;  4GS4 A;  2PVW A;  1YLE A;  1M1D A;  4C8U A;  5HKZ A;  2G3T A;  4HNW B;  4B11 A;  4ZI6 A;  4A2Z A;  4B12 A;  1VBG A;  3FF3 A;  2OZH A;  2JDD A;  1ZG9 A;  3IJ3 A;  3KQX A;  1JDB C;  2R82 A;  2HRO A;  2FXF A;  4OID A;  4GPL B;  2PJ5 A;  3IIB A;  1XIX A;  2PJ8 A;  3JTK A;  3ISX A;  1IOI A;  4JXR A;  4UF4 A;  3I6S A;  4CAV A;  5E96 A;  4QUS A;  2FIW A;  3K9T A;  2ZOG A;  4OC4 A;  2ZEO A;  5I0C A;  2HWG A;  2IJZ A;  3T07 A;  4KSI A;  4C2Z A;  2VBQ A;  3VRQ A;  2PJB A;  2JBJ A;  3NFQ A;  3OB2 B;  2WUU A;  2FL4 A;  4KLV A;  4R7M A;  5AGE A;  1M44 A;  1Z2L A;  2PJ2 A;  4COG A;  1XF1 A;  2G0B A;  1CX8 A;  4JYW A;  2NYQ A;  4PQA A;  4TNU A;  1M4L A;  4H89 A;  2PE3 A;  4UFX A;  1XJO A;  4XPD B;  4Q7A A;  4CO9 A;  3MRU A;  2BSW A;  3QB8 A;  3TE4 A;  3QAH A;  4R87 A;  4XNH C;  2Q0Y A;  1VHO A;  2EBJ A;  4C2X A;  4L8A A;  2O53 A;  3NH8 A;  2PIZ A;  4A32 A;  1CBX A;  2O28 A;  2JEW A;  4JVO A;  1YW4 A;  3QNV A;  4ZX9 A;  4OC1 A;  4XPD C;  3D7F A;  3D66 A;  4CGM A;  1Q2Y A;  4BIN A;  4MCP A;  5AG5 A;  3HPH E;  3IWE A;  3V8I A;  3SI2 A;  4BD9 A;  3FXT A;  2BUE A;  1IIC A;  2I3C A;  4C8F A;  2YNC C;  1ZG8 A;  1JDE A;  1ARM A;  3EFA A;  1XMT A;  1XE4 A;  4MCR A;  1ZLI A;  3BUX B;  2D4P A;  2DIK A;  3T0T A;  3FVL A;  3H5Z A;  2AFZ A;  3PFE A;  2JEV A;  3PB4 X;  3TFY A;  4IIY A;  4MRI A;  4KUA A;  2Q43 A;  2ZW4 A;  2PJ7 A;  4DJL A;  2QVP A;  4EME A;  1PU9 A;  2G3A A;  1B87 A;  2WSA A;  1CP6 A;  1OBR A;  4C68 A;  3DR6 A;  1CS0 B;  5JYB A;  3FH4 A;  1KBL A;  2PCU A;  6CPA A;  3A9L A;  5CBM A;  3S6G A;  3VRP A;  3S6F A;  3WC6 A;  4PK2 A;  4C9V A;  3D8P A;  5JH9 A;  1S5K A;  1CJW A;  3TO9 A;  2AUN A;  1IID A;  4KSF A;  3PRT A;  2GIV A;  5C82 A;  1BO4 A;  2BOA A;  2CNS A;  3RO0 A;  3WC7 A;  2IL4 A;  4C9A A;  2V77 A;  5H86 A;  3F9K C;  2ANP A;  2Z3L A;  1EO0 A;  1F2P A;  4PSX A;  1TKH A;  4C8T A;  4C85 A;  3U1B A;  2H5M A;  3EC4 A;  1TF9 A;  2XPP A;  4NGT A;  3I74 A;  4PXE A;  2CXA A;  2CY2 A;  3IGR A;  3IU1 A;  4YFJ A;  3NA6 A;  4EVY A;  2YJT A;  1XEB A;  1T36 B;  5KTC A;  3G3S A;  4UBR A;  4CRY B;  5A28 A;  5J8F A;  4B5P A;  1YLO A;  4BBH A;  2ZED A;  3H4Q A;  3FBU A;  5K8M A;  5F09 A;  4FD7 A;  3R9G A;  5KTA A;  3VRR A;  4CAF A;  3JVN A;  4BPW B;  2RFH A;  3KKW A;  4B13 A;  2FIA A;  4P4E A;  4IHM A;  4F0X A;  3LWU A;  1Z4E A;  3LAC A;  2C6P A;  4IF5 A;  3I1U A;  5AG7 A;  3SR3 A;  2Z3O A;  2BEI A;  1VI4 A;  5ELY A;  3B3S A;  3PBE A;  2YJV A;  1YX0 A;  1EZA A;  2DPS A;  3LD2 A;  4PK3 A;  2FSR A;  3TC8 A;  3SHP A;  4X3R A;  1M4G A;  2ZW6 A;  4M85 A;  2EZB A;  4CDK A;  3QAY A;  4R3L A;  2VXK A;  5J3X A;  3DGV A;  5LRG A;  5K99 A;  2Y0M A;  4A30 A;  3NE7 A;  3TOB A;  2JBK A;  2GLF A;  1ELM P;  3SJG A;  1QSR A;  2F7V A;  2OZU A;  3NH5 A;  3RBU A;  2O4H A;  4MJ8 A;  2P6F A;  4ZYQ A;  4ZY1 A;  1ZYM A;  3KAS A;  3HMJ G;  2ATR A;  4OLL A;  3VWE A;  1LRZ A;  2Q7B A;  4KZT A;  1IOF A;  4W9Y A;  2VZY A;  3B3V A;  4IIX A;  2B58 A;  4CYO A;  3D7D A;  1ZG7 A;  4CPA A;  4MHZ A;  1R43 A;  4BPX B;  2D4O A;  2Q4Z A;  5JM6 A;  1AUG A;  4MFQ A;  1Y7R A;  1F57 A;  1HEE A;  2Q04 A;  2FM4 A;  1XFO A;  3T05 A;  4MCS A;  2J9A A;  4CYN A;  3GLJ A;  1FNO A;  4C9U A;  3EZE A;  3IEH A;  2Q4V A;  1B47 A;  4MFL A;  4UWJ A;  4CGO A;  5BWA B;  3WAB A;  1WVM A;  4C7I A;  4DUK A;  4HNX B;  3CXS A;  1P0H A;  2PR8 A;  1K4J A;  4OAD A;  5F49 A;  3ICU A;  4C9E A;  3BUM B;  1KUX A;  2EUI A;  3EO4 A;  5F46 A;  2XEF A;  5F1Y A;  3K4I A;  1AMP A;  3UY5 A;  2B5G B;  4F9V A;  2MP0 A;  1ZL0 A;  1YVH A;  4RI1 A;  1CPS A;  2X7B A;  3ZZI A;  2EWB A;  4U9Z A;  5A27 A;  4CGN A;  4CYP A;  5EBV A;  1YK3 A;  1ZRS A;  1MK4 A;  4PSW A;  1LOK A;  4P44 A;  2VL1 A;  2R8V A;  4B10 A;  3PGP A;  1QSO A;  4NFR A;  4XNH B;  4NGS A;  3GJZ A;  4R8F A;  2CIJ A;  1PUA A;  1SQH A;  4YRH A;  4UCM A;  2Y1N A;  4KVM E;  5AXI A;  3T90 A;  5DWM A;  2AFW A;  4MFK A;  3NFZ A;  4A4B A;  3MGD A;  4PXB A;  4K30 A;  2C6C A;  4M8D A;  3VAR A;  3CXP A;  3O8Z A;  3VRN A;  2YGW A;  4MFZ A;  2XEG A;  4F9U A;  4KVO E;  2YND A;  5HMN A;  4UFW A;  4B14 A;  2Z11 A;  1RO5 A;  5FD8 A;  2PCN A;  4MFP A;  4KS9 A;  5HVF A;  4DNC A;  2EK8 A;  3B35 A;  3EZA A;  3PB7 X;  4X5K A;  1MJA A;  4NGN A;  3GB0 A;  4HKF A;  1A9X B;  3VTA A;  2AJ6 A;  1WWZ A;  4E8O A;  3TLG A;  3SXN A;  3H8F A;  3BUW B;  1IYL A;  1TKF A;  1Z5R A;  3P2F A;  3PB8 X;  3FED A;  5G21 A;  3VAT A;  3TLE A;  4A4C A;  3KHZ A;  3DLJ A;  3V38 A;  2B4D A;  1XF8 A;  4Q36 A;  4GM5 A;  3D7G A;  4PPZ A;  3E0K A;  2UV8 G;  4CGP A;  4E94 A;  3PFV A;  1Q2D A;  2B0A A;  2EK9 A;  2EVN A;  2PC1 A;  4P4D A;  1VKC A;  4UCN A;  5EMI A;  1VHE A;  1AYE A;  5HXD A;  3G23 A;  2GFQ A;  4IAV A;  2DLA A;  3U88 C;  8CPA A;  4OC0 A;  3S9L A;  4JD6 A;  3C8O A;  4QB9 A;  3F8K A;  4MHN A;  3DNS A;  4ZY0 A;  4PV6 A;  3BUN B;  3B7I A;  2ZEM A;  2VQY A;  1DTD A;  2GU2 A;  2OH1 A;  4M6H A;  3HLP A;  3F5B A;  4U9Y A;  3B3C A;  4HPS A;  2ZEG A;  5ISV A;  3GUX A;  4ORF A;  3CPA A;  3PT1 A;  1GHE A;  5JQ4 A;  3S9N A;  3BLN A;  3LOD A;  1NSL A;  3FRM A;  1S60 A;  1LAN A;  1NXJ A;  3TLY A;  5EC4 A;  2FT0 A;  2ZPA A;  1F2O A;  3KGQ A;  2CTC A;  5HVH A;  4J3G A;  3N5F A;  2HQY A;  3HUV A;  3TT2 A;  1QSM A;  4TJV A;  2ZW5 A;  4UCP A;  3BHX A;  1Y0Y A;  3W6S A;  3IU2 A;  3SJE A;  4AG7 A;  1TKJ A;  4JLY A;  1XRY A;  2I00 A;  4NSQ A;  2PDO A;  3RZA A;  3BXM A;  5HVG A;  3I3G A;  2PJ3 A;  2FVG A;  4I49 A;  1MJB A;  3B3W A;  4B6Z A;  1M6V B;  3TOA A;  4KOU A;  1VIX A;  5F5X A;  2ZEP A;  2BO9 A;  1KEE B;  2XPL A;  2ZOF A;  4OC3 A;  2Q51 A;  2QML A;  2R98 A;  2QEC A;  3CDX A;  2EZA A;  1YGH A;  5F13 A;  3CPX A;  3PEI A;  4JJX A;  4OKO A;  1XMB A;  2AUM A;  2F8H A;  3FIX A;  2QYV A;  3B2Y A;  3JUW A;  4MHP A;  5LYD A;  5J8C A;  2CBL A;  4P4B A;  4M3S A;  4B5O A;  1I1D A;  2C6G A;  4MMO A;  3R95 A;  2PJ1 A;  4E5S A;  4UEZ A;  2GP4 A;  2XEI A;  3ZJ0 A;  1ZO0 A;  2POK A;  2V8V A;  4B5P B;  2REF A;  5D8N A;  3LMS A;  4PXC A;  1Z8W A;  3PBB A;  1M4I A;  3H8G A;  4Q38 A;  3KQZ A;  4HNY B;  4UA3 A;  2AFS A;  4ZX8 A;  5K8N A;  4KOW A;  5K8O A;  3RAM A;  2ZW7 A;  3CXQ A;  2B3V A;  2AFM A;  2C27 A;  2WYR A;  4FAI A;  1LFW A;  3K9U A;  4WJB A;  2A4N A;  4MHD A;  3GIU A;  5F9M A;  2J8N A;  4J0N A;  2Y1M A;  1J3L A;  2CNM A;  1Q5X A;  3TLA A;  4NGR A;  2Z10 A;  2I79 A;  1YW6 A;  4LX9 A;  4KSA A;  2YNC A;  4X2T A;  3B8G A;  3F0A A;  5G22 A;  1BOB A;  4KUB A;  1Z8X A;  2PJ9 A;  2ZEF A;  5FVJ A;  4QC6 A;  2D0P A;  4INJ A;  2P6E A;  4MJX A;  5HKW A;  1HDU A;  2HC9 A;  1XOV A;  4P4F A;  4MXU A;  3TX8 A;  1DE4 C;  2XPN A;  5LRJ A;  1I12 A;  4CRZ B;  4UEE A;  2R7H A;  2FE7 A;  2NMT A;  1KUY A;  3PB6 X;  3GKR A;  1I21 A;  4BPU B;  5IB0 A;  2Q4Y A;  4OAE A;  4ZBG A;  5CNP A;  3R1K A;  4NCZ A;  4U5Y A;  2D0O A;  4UWI A;  4CAW A;  4MI1 A;  4A94 A;  4NGM A;  4NGP A;  3DDD A;  3KR4 A;  3BI0 A;  2K5T A;  4C8A A;  3SJX A;  4UEF A;  2HB6 A;  4AXV A;  3OB1 B;  4KOX A;  2DF5 A;  5LYL A;  1C30 B;  3TO7 A;  4G1P A;  2IQ6 A;  3P2H A;  4NJR A;  3SJF A;  1CG2 A;  2R1I A;  4C9R A;  3IWW A;  5GCN A;  1P4N A;  4KOR A;  3FNC A;  3FEC A;  1IGB A;  1M4D A;  2B3U A;  3S9M A;  2QIR A;  1Y9K A;  2ZEN A;  3KL9 A;  4JXQ A;  4TWE A;  5HH1 A;  4C2Y A;  4EFD A;  4PXD A;  5KTD A;  2WPW A;  3GYA A;  4H2K A;  4P6Y A;  3T8W A;  4CS0 B;  4O23 A;  4YWY A;  3SI0 A;  3S6H A;  3ZNI A;  4TJX A;  1Q2C A;  4R9M A;  3WC5 A;  5IX3 A;  4NJQ A;  2EZC A;  3KHX A;  3N7Z A;  4Y49 B;  1MJ9 A;  1S7F A;  1QMU A;  3SI1 A;  3RYO A;  4AB7 A;  5LYF A;  3CT9 A;  2Z3K A;  4L89 A;  4A38 A;  4C86 A;  3BI1 A;  2J8M A;  2VKZ G;  1KZF A;  1YME A;  3FX6 A;  1GGO A;  3S6K A;  2PJC A;  4P45 A;  1YQE A;  2CTB A;  3WT4 A;  1PYT B;  2GRE A;  2Z0Z A;  3SXO A;  4A33 A;  4QBJ A;  4MY3 A;  4K3N A;  1BPM A;  4JZ0 A;  4NF1 A;  4C8C A;  3NOJ A;  4XPK A;  1IY7 A;  5H84 A;  4H1H A;  4Y49 C;  3IC1 A;  3V7Z A;  4MBU A;  2B4J C;  1BAV A;  2AFO A;  5G1Z A;  4AVC A;  2KCW A;  3OAK A;  1UFH A;  1TIQ A;  2FCK A;  2JLM A;  3MN8 A;  1IU8 A;  3EY5 A;  1WK4 A;  1KWM A;  1QQ9 A;  1VHS A;  1QST A;  4IK2 A;  5F47 A;  4C7H A;  4E0A A;  5IR2 A;  1YSJ A;  4F8Z A;  3D68 A;  4P4J A;  2NSM A;  3T5M A;  1S7L A;  1U6M A;  4UFV A;  1S7K A;  4Z65 A;  3EIF A;  2PR1 A;  4KOS A;  2E28 A;  4R6T A;  3IO1 A;  5LRK A;  5JVL A;  1N71 A;  2VEZ A;  1FY7 A;  1WJT A;  1JQG A;  4NGQ A;  3JRU A;  1B6B A;  3OWC A;  3VWD A;  4A31 A;  4CYQ A;  4C8P A;  2Z3P A;  2PSW A;  3DR8 A;  4KOV A;  2OLS A;  5IV0 A;  1NMT A;  3G8W A;  2Q7S A;  5I4M A;  4LQG A;  1YVO A;  4XPL A;  4UIA A;  5IB9 A;  1NSA A;  1X10 A;  5AG6 A;  2AE6 A;  3KI9 A;  3FB3 A;  1Z8T A;  3D4U A;  2EO8 A;  4F6A A;  3D67 A;  4CAX A;  3TYX A;  3IWG A;  2AFX A;  4BTF A;  1X12 A;  3PP9 A;  4OC5 A;  4FD6 A;  1LCP A;  5LYI A;  1H8L A;  3RNZ A;  4A37 A;  5C88 A;  1LAP A;  2CNT A;  4KLW A;  2C5Q A;  1V0C A;  2PJ6 A;  3IFE A;  4FD4 A;  4MHY A;  1A2Z A;  4KVX A;  4OC2 A;  3TO6 A;  2AFU A;  2BL1 A;  4QVT A;  4YU9 A;  4M6I A;  3T9Y A;  3TLC A;  2PJA A;  3C26 A;  1FBV A;  4RN7 A;  4CZ1 A;  4RUH A;  1FT7 A;  2V8G A;  4KOT A;  1BPN A;  2DEA A;  1CM0 A;  3EZB A;  2Q44 A; 
#chains in the Genus database with same CATH homology
 3D7H A;  4DYO A;  4P4I A;  2PIY A;  2QJ8 A;  1Y9Z A;  1Q7L A;  1R3N A;  5DS0 A;  4OME A;  1HDQ A;  2V8D A;  1Z8L A;  1RTQ A;  1Y0R A;  3KZW A;  2PRQ A;  1BLL E;  1ZLH A;  1LAM A;  5JGF A;  3L2N A;  3K2K A;  1CPX A;  4X8I A;  1XBU A;  3FEE A;  2RB7 A;  1VGY A;  1V6C A;  4MCQ A;  4FWU A;  1GYT A;  2OOT A;  1CP7 A;  2OR4 A;  4EWT A;  4OIW A;  2V8H A;  3NH4 A;  3FJU A;  5J1Q A;  2BCO A;  5CPA A;  7CPA A;  4WWV A;  4ZY2 A;  4KNG E;  4ONW A;  3KR5 A;  4C99 A;  5K8P A;  3ISZ A;  1TF8 A;  2PJ4 A;  4P10 A;  3FMC A;  4R76 A;  2ABZ A;  1TXR A;  3B3T A;  1ELL P;  4C84 A;  4FUU A;  1Y7E A;  2XEJ A;  3VH9 A;  2ZEH A;  4A39 A;  4YN3 A;  1PCA A;  3H8E A;  3PFO A;  2PJ0 A;  4FBE A;  2CF4 A;  1UWY A;  5THW A;  4UIB A;  2IMO A;  2C1C A;  2PVV A;  5D29 A;  2G9D A;  2ZEE A;  2ZEL A;  3PB9 X;  4OP4 A;  1EE3 P;  2WZN A;  1ARL A;  2GLJ A;  2PVW A;  4C8U A;  4ZI6 A;  3FF3 A;  3IJ3 A;  1ZG9 A;  3KQX A;  4OID A;  2PJ5 A;  3IIB A;  2PJ8 A;  3ISX A;  4UF4 A;  3I6S A;  3K9T A;  2ZOG A;  4OC4 A;  2ZEO A;  2IJZ A;  4KSI A;  2PJB A;  2JBJ A;  4R7M A;  1Z2L A;  2PJ2 A;  1XF1 A;  2NYQ A;  1CX8 A;  4JYW A;  4PQA A;  4TNU A;  1M4L A;  2PE3 A;  1XJO A;  4Q7A A;  3MRU A;  1VHO A;  2O53 A;  3NH8 A;  2PIZ A;  1CBX A;  2JEW A;  1YW4 A;  3QNV A;  4ZX9 A;  4OC1 A;  3D7F A;  3D66 A;  4MCP A;  3SI2 A;  4BD9 A;  4C8F A;  2I3C A;  1ZG8 A;  1ARM A;  4MCR A;  1ZLI A;  3FVL A;  3PFE A;  2AFZ A;  3PB4 X;  2Q43 A;  2PJ7 A;  4DJL A;  2QVP A;  4EME A;  1CP6 A;  1OBR A;  3FH4 A;  2PCU A;  6CPA A;  5CBM A;  3WC6 A;  4C9V A;  5JH9 A;  3PRT A;  2BOA A;  3WC7 A;  4C9A A;  2V77 A;  2ANP A;  1F2P A;  1TKH A;  4C8T A;  4C85 A;  1TF9 A;  3I74 A;  4NGT A;  4PXE A;  3NA6 A;  1YLO A;  2ZED A;  5K8M A;  5F09 A;  2RFH A;  4P4E A;  4IHM A;  3LWU A;  2C6P A;  3I1U A;  5ELY A;  3B3S A;  3PBE A;  3TC8 A;  4X3R A;  4CDK A;  3DGV A;  5LRG A;  2JBK A;  2GLF A;  1ELM P;  3SJG A;  2F7V A;  4A94 A;  3NH5 A;  3RBU A;  2O4H A;  4ZY1 A;  4ZYQ A;  3KAS A;  4W9Y A;  3B3V A;  3D7D A;  1ZG7 A;  4CPA A;  4MHZ A;  1R43 A;  2Q4Z A;  5JM6 A;  1F57 A;  1HEE A;  1XFO A;  4MCS A;  2J9A A;  3GLJ A;  1FNO A;  4C9U A;  3IEH A;  3WAB A;  1WVM A;  4DUK A;  3ICU A;  4C9E A;  2XEF A;  1AMP A;  4F9V A;  1CPS A;  2EWB A;  1LOK A;  4P44 A;  2VL1 A;  4NFR A;  4NGS A;  4R8F A;  2CIJ A;  2AFW A;  3NFZ A;  4PXB A;  2C6C A;  3VAR A;  4F9U A;  2XEG A;  5HVF A;  2EK8 A;  3B35 A;  3PB7 X;  4NGN A;  3GB0 A;  3VTA A;  3H8F A;  1TKF A;  1Z5R A;  3VAT A;  3PB8 X;  3FED A;  3KHZ A;  3DLJ A;  3V38 A;  4GM5 A;  3D7G A;  4PPZ A;  2EK9 A;  4P4D A;  5HXD A;  1VHE A;  1AYE A;  4IAV A;  8CPA A;  4OC0 A;  3S9L A;  4MHN A;  4ZY0 A;  3B7I A;  2ZEM A;  1DTD A;  2GU2 A;  3HLP A;  3B3C A;  2ZEG A;  3GUX A;  3CPA A;  3S9N A;  1LAN A;  1F2O A;  3KGQ A;  2CTC A;  5HVH A;  3N5F A;  3HUV A;  4TJV A;  3BHX A;  1Y0Y A;  3SJE A;  1TKJ A;  1XRY A;  3RZA A;  3BXM A;  5HVG A;  2PJ3 A;  2FVG A;  3B3W A;  4B6Z A;  1VIX A;  2ZEP A;  2BO9 A;  2ZOF A;  4OC3 A;  2Q51 A;  3CDX A;  3CPX A;  3PEI A;  4OKO A;  1XMB A;  2F8H A;  2QYV A;  3B2Y A;  4MHP A;  5LYD A;  4P4B A;  2C6G A;  4MMO A;  2PJ1 A;  4UEZ A;  2GP4 A;  2XEI A;  2POK A;  2V8V A;  5D8N A;  3LMS A;  4PXC A;  3PBB A;  4ZX8 A;  3H8G A;  3KQZ A;  5K8N A;  2AFS A;  5K8O A;  3RAM A;  2AFM A;  2WYR A;  4FAI A;  1LFW A;  4WJB A;  4NGR A;  1YW6 A;  4X2T A;  2PJ9 A;  2ZEF A;  2HC9 A;  1HDU A;  4P4F A;  4MXU A;  3TX8 A;  1DE4 C;  5LRJ A;  4UEE A;  3PB6 X;  4NGM A;  4NGP A;  3KR4 A;  3BI0 A;  4C8A A;  3SJX A;  4UEF A;  2HB6 A;  4AXV A;  5LYL A;  4G1P A;  2IQ6 A;  4NJR A;  3SJF A;  1CG2 A;  4C9R A;  3IWW A;  3KL9 A;  3FEC A;  1IGB A;  2ZEN A;  4MRI A;  3S9M A;  4TWE A;  4CDJ A;  4EFD A;  4PXD A;  4H2K A;  3T8W A;  4P6Y A;  4O23 A;  4YWY A;  3SI0 A;  4TJX A;  3WC5 A;  4NJQ A;  3KHX A;  3SI1 A;  1QMU A;  5LYF A;  3CT9 A;  4A38 A;  4C86 A;  3BI1 A;  1YME A;  3FX6 A;  2PJC A;  4P45 A;  2CTB A;  3WT4 A;  1PYT B;  2GRE A;  4K3N A;  1BPM A;  4JZ0 A;  4C8C A;  1IY7 A;  3IC1 A;  3V7Z A;  1BAV A;  2AFO A;  3MN8 A;  1KWM A;  1QQ9 A;  4IK2 A;  5IR2 A;  1YSJ A;  4F8Z A;  3D68 A;  4P4J A;  2NSM A;  4Z65 A;  3EIF A;  4R6T A;  3IO1 A;  5LRK A;  1JQG A;  4C8P A;  4NGQ A;  3JRU A;  5I4M A;  4LQG A;  5IB9 A;  4UIA A;  1NSA A;  3KI9 A;  3D4U A;  3D67 A;  2AFX A;  4OC5 A;  1LCP A;  5LYI A;  1H8L A;  4A37 A;  1LAP A;  2C5Q A;  2PJ6 A;  3IFE A;  4MHY A;  4OC2 A;  2AFU A;  4YU9 A;  2PJA A;  4RUH A;  1FT7 A;  2V8G A;  1BPN A;  2DEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...