5F09A

Structure of inactive gcpii mutant in complex with beta-citryl glutamate
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Comparison of human glutamate carboxypeptidases II and III reveals their divergent substrate specificities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 261
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 5f09A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5f09A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5f09A02
2XEIA 3GB0A 5CPAA 1CP7A 3WC6A 5JGFA 3JRUA 2PJ8A 4FWUA 2NSMA 2ZEDA 3BXMA 7CPAA 2ZEHA 1HDUA 2PCUA 2VL1A 1BLLE 2WZNA 5HVGA 4A39A 1XBUA 4IAVA 3WT4A 3KHXA 4C84A 2ZOGA 2AFMA 2HC9A 2JEWA 1KWMA 5ELYA 3FEDA 4NGSA 2CF4A 4MXUA 4P4BA 3EIFA 1EE3P 4P4DA 3KR5A 4YWYA 1ELLP 2AFXA 4OC4A 3NH5A 3I1UA 1IY7A 4TJXA 1LAPA 3GUXA 3PEIA 3ISXA 2PJ4A 3PFEA 4KNGE 4O23A 2EWBA 2O53A 2ANPA 1AYEA 1DTDA 4EWTA 4R6TA 2PIZA 3BI0A 3TX8A 4Q7AA 3B35A 4A38A 2BO9A 4Z65A 3KI9A 1Y0RA 4JYWA 3B3VA 1YSJA 5CBMA 1LAMA 2Q4ZA 3MN8A 2IMOA 5LRJA 4PQAA 2GLJA 2PJAA 1HDQA 4PXCA 2I3CA 3HLPA 6CPAA 3NH4A 1ARMA 4P4FA 3IIBA 4RUHA 2RFHA 2F7VA 3D7HA 2PVWA 4PXBA 4BD9A 5LRKA 1UWYA 1AMPA 4NJQA 1CBXA 1F2PA 1FT7A 1TF9A 3IC1A 2ZENA 5K8MA 4UEFA 2XEJA 4R8FA 2GLFA 1Z8LA 3PFOA 2PJ1A 5LYLA 2PIYA 3DGVA 4H2KA 2F8HA 2ABZA 4P44A 4C8FA 3D68A 1F2OA 1Y0YA 1V6CA 1Q7LA 1PYTB 4NGNA 4C8PA 1VHOA 4F9UA 5K8NA 4C99A 3CPAA 3PBEA 3I6SA 5HVFA 3FF3A 3SJEA 4C8TA 4OIDA 3NH8A 5JH9A 4NGRA 3T8WA 3KGQA 4C9EA 3SJGA 3BI1A 3D7GA 4MHPA 2PJCA 3B3TA 3S9NA 4OC0A 1VGYA 3PB6X 3PB9X 1ARLA 1WVMA 3IFEA 1ELMP 3FECA 2PJ6A 4MCQA 3H8EA 1CPSA 5DS0A 1VIXA 2AFSA 2J9AA 4ZY1A 4KSIA 4UEZA 2PJ5A 4F8ZA 1M4LA 5THWA 2IQ6A 2DEAA 4C8CA 2RB7A 4NJRA 1TF8A 3NFZA 4MHNA 4DJLA 4C8UA 2CTCA 3PB7X 1XF1A 4DYOA 2GREA 2JBKA 2JBJA 3IO1A 2V8DA 4OC3A 1ZLHA 4K3NA 4PXDA 2HB6A 3DLJA 4OC5A 3N5FA 3I74A 2BCOA 2EK9A 3FX6A 4UIBA 4C9RA 1CPXA 3LMSA 2PJ9A 3K2KA 3KASA 4ZY2A 2QYVA 4PXEA 2V77A 4OC2A 3KL9A 1ZG8A 1LFWA 2AFUA 1Z2LA 3D4UA 3PB8X 4EFDA 3KQXA 4UEEA 2POKA 4ONWA 1XJOA 2ZEPA 2PJBA 3NA6A 3B3WA 3K9TA 3RBUA 5I4MA 3CPXA 5LYDA 4P4EA 1DE4C 5D8NA 3B7IA 3WABA 3WC7A 2AFOA 3IEHA 5D29A 2ZEFA 3S9MA 2WYRA 3B2YA 2PVVA 1XFOA 2ZEGA 4ZYQA 2FVGA 1VHEA 4ZX9A 4NFRA 1CG2A 3VARA 4TJVA 1YMEA 4UF4A 1F57A 1YW6A 1RTQA 2C6GA 4PPZA 2QJ8A 3SI1A 1QMUA 1GYTA 4P6YA 2V8HA 3V38A 3B3SA 3QNVA 2QVPA 2BOAA 1TKHA 4C9VA 1CP6A 4MHZA 4TNUA 4DUKA 3L2NA 4UIAA 5HVHA 3D7DA 3CT9A 1FNOA 4MCRA 1LCPA 4OKOA 5IB9A 4ZX8A 4P4JA 4GM5A 4P4IA 2PE3A 4ZI6A 4MMOA 3KQZA 1R43A 2G9DA 4IK2A 3GLJA 3MRUA 3FMCA 3LWUA 2C1CA 3CDXA 4MCSA 1PCAA 4MCPA 5F09A 1HEEA 4OMEA 5HXDA 4WJBA 4X3RA 1BPMA 4TWEA 4B6ZA 1ZLIA 3H8FA 4WWVA 5LYIA 1JQGA 1XMBA 4W9YA 4NGPA 2GU2A 5J1QA 2ZEEA 3KR4A 4R76A 4P45A 1Z5RA 4X8IA 3FJUA 2XEFA 5LYFA 1TXRA 2ZOFA 4G1PA 4FUUA 4C86A 3V7ZA 4P10A 1H8LA 2AFWA 5K8PA 4NGTA 4A94A 2ZELA 3SJXA 2NYQA 3VATA 2CIJA 1NSAA 2PJ7A 4NGMA 1Y7EA 4CDKA 4X2TA 1BPNA 3D7FA 3S9LA 5LRGA 2IJZA 3RAMA 3VH9A 3IWWA 2Q43A 2ZEMA 2O4HA 4EMEA 4YN3A 2PJ0A 4IHMA 8CPAA 2Q51A 3WC5A 3SJFA 2PJ2A 4CDJA 5K8OA 2CTBA 4C9AA 3FEEA 3ICUA 1ZG7A 1ZG9A 3D67A 4FBEA 4OIWA 4NGQA 3IJ3A 1OBRA 4F9VA 1IGBA 3B3CA 4FAIA 2AFZA 3VTAA 4AXVA 4A37A 1CX8A 1YLOA 3TC8A 2C6PA 4MHYA 4R7MA 4CPAA 3SI2A 1LANA 4OP4A 2EK8A 2C6CA 2OR4A 1BAVA 2V8GA 3HUVA 4C85A 4LQGA 5JM6A 4MRIA 1Y9ZA 2XEGA 4OC1A 2V8VA 4C9UA 4JZ0A 3RZAA 4ZY0A 1TKFA 2PRQA 1QQ9A 3D66A 3FH4A 3PB4X 3BHXA 3ISZA 4C8AA 1YW4A 3KZWA 2OOTA 1TKJA 1R3NA 3SI0A 3FVLA 3PRTA 2PJ3A 4YU9A 1XRYA 2ZEOA 3PBBA 3KHZA 3H8GA 1LOKA
chains in the Genus database with same CATH superfamily
2XEIA 3GB0A 3JUWA 1CP7A 4FD7A 4M85A 4NXYA 5CPAA 3JRUA 2PJ8A 2FXFA 3WC6A 4FWUA 5JGFA 2NSMA 1Z8XA 2ZEDA 3BXMA 7CPAA 2AE6A 2Q4YA 3GJZA 2HQYA 2WUUA 2ZEHA 5AGEA 1XF8A 1HDUA 2PCUA 2VL1A 1BLLE 2WZNA 3EY5A 5HVGA 2VXKA 2CNSA 2X7BA 4A39A 4A4CA 4A32A 1XBUA 2D4OA 4IAVA 3KHXA 3WT4A 1A9XB 2XPOA 4C84A 2ZOGA 2AFMA 2HC9A 2JEWA 1U6MA 1KWMA 5ELYA 3FEDA 4NGSA 2CF4A 2P6EA 2AUNA 4B13A 4MXUA 4P4BA 2R82A 3EIFA 4MY3A 5H84A 1EE3P 1S60A 3FRMA 3N7ZA 4F0XA 4P4DA 5I0CA 1R57A 3KKWA 2FCKA 3KR5A 4YWYA 1ELLP 3B8GA 4QUSA 1Q2YA 1WJTA 2E28A 4KORA 4MFJA 2AFXA 2OU2A 2KCWA 4C7HA 4CYOA 4C8FA 2XPLA 4OC4A 3BUNB 3NH5A 2C5QA 3V8IA 3I1UA 4UWJA 1S5KA 5F48A 1IY7A 1I1DA 4TJXA 1LAPA 4GPLB 1Z9UA 4CGLA 3CZXA 1GGOA 3T0TA 3GUXA 4B12A 4BINA 4COBA 3PEIA 3ISXA 2PJ4A 3PFEA 4KNGE 4MFZA 4O23A 2ZW6A 2EWBA 4JXQA 4CYQA 4PSWA 2O53A 1S7NA 2Q7BA 2ANPA 1Q5XA 4MFQA 1AYEA 1DTDA 3DR8A 4R9MA 4R6TA 4ZBGA 2PIZA 3BUOB 4C2YA 4EWTA 1YGHA 2PR8A 4B14A 1XEBA 3BI0A 3T9YA 3TX8A 4Q7AA 4QB9A 4CZ1A 4MFLA 1FY7A 3KRVA 1SQHA 5CNPA 3B35A 4KUAA 3GY9A 4A38A 1S7KA 2BO9A 4Z65A 4PK3A 3K4IA 1MK4A 4M6GA 4M3SA 3UY5A 4UFWA 1M6VB 1S7LA 1ZYMA 4U9ZA 5J3XA 2ZW4A 5F49A 3KI9A 1EZBA 4A2ZA 1Y0RA 4JYWA 3B3VA 3VGOA 4KLWA 2D0OA 1P0HA 4NEXA 1YSJA 3I9SA 4FD6A 5CBMA 4B5OA 1JDBC 2PCNA 1LAMA 1QSMA 2B5GB 2Q4ZA 2VZYA 4CAXA 3MN8A 2IMOA 3GIUA 5LRJA 1X12A 1GHEA 4PQAA 4QBJA 2GLJA 3SR3A 3TLAA 3E0KA 3P2FA 4UCNA 2I00A 2PJAA 1HDQA 4KOVA 4IUSA 4PXCA 2Z3OA 4JWPA 4UFXA 2I3CA 1I12A 2ZW5A 3HLPA 1VBHA 2AUMA 6CPAA 2JDCA 3NH4A 3PFVA 2Z11A 1ARMA 4P4FA 3IIBA 4RUHA 2EZAA 3LD2A 3NE7A 2B0AA 3R1KA 2RFHA 4J3GA 4KSFA 1IOFA 1T36B 1DIKA 1NE9A 2F7VA 3LACA 3IGRA 3TOBA 3D7HA 2PVWA 3ZNIA 4PXBA 2ATRA 1IIDA 1Z4RA 4UA3A 4BD9A 3S6KA 5LRKA 4MI1A 1UWYA 4XNHB 4KZTA 1JWQA 2REEA 1MJBA 1AMPA 2REFA 4NJQA 4MHDA 1CBXA 1F2PA 1FT7A 2MP0A 3S6GA 1TF9A 2R1IA 3IU1A 2G0BA 4INJA 3IC1A 4FD5A 2F5IA 3TLCA 4KSAA 2ZENA 1TIQA 2FE7A 5K8MA 2YJTA 3ZZIA 3TOAA 4UEFA 5BWAB 2XEJA 3D8PA 1QSOA 2PSWA 4R8FA 5A28A 4YFJA 5EBVA 2GLFA 1Z8LA 1IOIA 3PFOA 4XPLA 2PJ1A 5LYLA 3P2HA 2PIYA 2OB0A 3T90A 3DGVA 3FIXA 1EO0A 2AJ6A 3LODA 3NE8A 2VKZG 4H2KA 2A4NA 2F8HA 2J8RA 2ABZA 4P44A 3D2PA 4IF5A 3BUWB 5DWNA 1B47A 4XPKA 5G22A 2DLAA 1F2OA 2B4JC 1Y0YA 1Y9WA 3D68A 1NSLA 3RO0A 1V6CA 1Q7LA 1PYTB 1YREA 2Q7SA 1Q2CA 3K9UA 2P6FA 3TO7A 4NGNA 4L89A 2X0SA 3HPGG 4C8PA 1L0CA 3PT1A 1VHOA 2B3UA 3R95A 4F9UA 3TLGB 5K8NA 1VHSA 4C99A 2PDOA 3CPAA 3PBEA 3PLFB 2G3AA 4KLVA 3I6SA 5HVFA 3DNSA 1Y9KA 1RO5A 4HNWB 1VBGA 3FF3A 1YK3A 1KUYA 4MJXA 4C7IA 3SJEA 4C2XA 4OIDA 2B4BA 4R87A 4C8TA 3NH8A 5JH9A 2GP4A 3FB3A 4NGRA 3T8WA 3TE4A 4AVAA 3R96A 3KGQA 4C9EA 3SJGA 3BI1A 3D7GA 1BO4A 1XIXA 2PJCA 1ZO0A 4MHPA 1KZFA 3R9FA 3B3TA 3S9NA 4L8AA 4KVME 4KUBA 3TFYA 4OC0A 5KTAA 4R3LA 2ZPAA 4XNHC 3EZEA 4HKFA 5EMIA 3BLNA 3F5BA 1VGYA 5JVLA 3PB6X 2Q44A 3PB9X 1ARLA 1M1DA 1WVMA 4AB7A 5IX3A 3IFEA 3VRQA 1ELMP 3FECA 2PJ6A 5HH1A 4MCQA 3H8EA 5J8FA 1CPSA 2EO8A 1QSRA 2OH1A 4RI1A 5DS0A 1N71A 1VIXA 1OZPA 2AFSA 2J9AA 4ZY1A 1B6BA 4KSIA 1Z9EA 2PJ5A 1IYLA 3A9LA 4UEZA 5AG5A 4F8ZA 4KVXA 4F6AA 1M4LA 5THWA 2IQ6A 3I3GA 4CO9A 2DEAA 1YR0A 3WR7A 4C8CA 3VRNA 2G3TA 4MY0A 2DIKA 2RC4A 2RB7A 4NJRA 2R8VA 5HKZA 1IICA 4COGA 2JDDA 2DPSA 1TF8A 3NFZA 4MHNA 4QC6A 3SXOA 4DJLA 3NOJA 2YNDA 4GS4A 4OADA 2CTCA 1VKCA 4HNYB 3PB7X 5F5XA 4B10A 4FD4A 1XF1A 5IR2A 4DYOA 2GREA 3FXTA 2JBKA 1R61A 1BOBA 2QMLA 2JBJA 3IO1A 2V8DA 4OC3A 1ZLHA 2B4DA 4K3NA 4LX9A 3BJ8A 4PXDA 2HB6A 2EZCA 2HV2A 3DLJA 4OC5A 3N5FA 3I74A 3RNZA 2BCOA 5AG7A 4CAFA 2EK9A 3FX6A 3PZJA 4KVOE 1IU8A 2JEVA 1YX0A 4UIBA 2Y1MA 5FVJA 4A33A 4C9RA 1CPXA 3CXQA 3LMSA 4KOSA 4M6IA 2BUEA 2PJ9A 3K2KA 3KASA 4ZY2A 2QYVA 4CRYB 2DPTA 2ODFA 4PXEA 5G1ZA 5DWMA 5KTCA 2V77A 4OC2A 4C68A 3OAKA 3KL9A 1M4IA 4MFPA 1EZAA 1ZG8A 3HPHE 1LFWA 2AFUA 2K5TA 3OWCA 4PV6A 4XPDB 4A30A 4E2AA 1Z2LA 3F9KC 4LUAA 1ZRSA 3TLYA 1WWZA 1Z8TA 4NF1A 4IIYA 2C27A 3IU2A 3U1BA 2EVNA 3D4UA 4UBRA 2Z3MA 3PB8X 4DNCA 4EFDA 2ZW7A 3KQXA 4H6UA 4CGPA 1CM0A 4I49A 1M4DA 4UEEA 2POKA 2HUZA 4CRZB 4JVOA 4RR2B 2VBQA 4ONWA 3G3SA 3W6SA 1XJOA 3D2MA 2ZEPA 2PJBA 3NA6A 5E96A 3JVNA 2PC1A 4U5YA 1NMTA 2J8NA 3B3WA 4CGNA 3K9TA 3RBUA 4BPWB 2O28A 5I4MA 3CPXA 1KUVA 2Y0MA 3FBUA 3VROA 4ORFA 4P4EA 5LYDA 3W6XA 1YVHA 2CNTA 1KC7A 1DE4C 3TYXA 5H86A 5D8NA 4AG7A 3B7IA 4CAWA 3WABA 3WC7A 2AFOA 3IEHA 3FYNA 5D29A 2ZEFA 2EZBA 3S9MA 2GIVA 4UFVA 2YJVA 2WYRA 3B2YA 1Z4EA 3T5MA 2PVVA 5JPHA 5HKWA 1CE8B 1XFOA 2ZEGA 1RXTA 3MGDA 4ZYQA 5F46A 2FVGA 2GFQA 4KOTA 3VWEA 2FSRA 3RYOA 1VHEA 4ZX9A 4NFRA 1CG2A 2VI7A 4MI4A 1FBVA 3VARA 4TJVA 1YMEA 4UF4A 4X5KA 1F57A 1YW6A 2FIWA 4ZGYB 4BMHA 1RTQA 2C6GA 2OZUA 3R9EA 1KBLA 4PPZA 4H89A 4CYPA 2Z3LA 3R9GA 2QJ8A 3SI1A 4B5PA 1QMUA 1GYTA 4P6YA 2V8HA 4RS2A 4BPXB 3B3SA 3V38A 1KUXA 4BPUB 3GKRA 3G23A 3QNVA 2QVPA 2XPPA 4CYNA 2BOAA 1TKHA 2PQ8A 2NMTA 4C9VA 3T07A 3W91A 2B3VA 3QAYA 4KOUA 1CP6A 4MHZA 4TNUA 4XPDC 4DUKA 3L2NA 2H5MA 4UIAA 5HVHA 3D7DA 1UFHA 3CT9A 1FNOA 3S6HA 4AVBA 3TLZA 1LRZA 4MCRA 1XOVA 4UCMA 1CJWA 4AG9A 1LCPA 2B58A 2YNCA 2JLMA 4OKOA 5AG6A 3EZBA 5IB9A 4ZX8A 5HKYA 3C8OA 3BUMB 4P4JA 4GM5A 3TLEA 1ON0A 1B87A 1XE4A 4QVTA 1YVKA 4P4IA 1NBWA 2PE3A 4RN7A 4ZI6A 2BSWA 5F13A 2OZHA 3D3SA 4MMOA 3CXPA 1R43A 3KQZA 4HNXB 2G9DA 4IK2A 2IL4A 3GLJA 3MRUA 1Q2DA 3PP9A 3FMCA 4HPSA 1M4GA 1Y7RA 2C1CA 3CDXA 4MCSA 1PCAA 3LWUA 4MCPA 3PGPA 3JTKA 4ONUA 4CAEA 5F09A 1HEEA 1V0CA 3FNCA 4LQ6A 3EXNA 4E8OA 4OMEA 3TT2A 5IV0A 5HXDA 4WJBA 4X3RA 1BPMA 4TWEA 4IIXA 4YRHA 2WPWA 4B6ZA 3DDDA 2VQYA 1ZLIA 3H8FA 3C26A 2I79A 5HMNA 2OLSA 2N3AB 4EVYA 4OAEA 4WWVA 4MJ8A 3EC4A 5LYIA 2CBLA 1JQGA 3VRPA 2BL1A 5JQ4A 1XMBA 4W9YA 5G20A 4NGPA 2Z10A 5IB0A 1WK4A 2GU2A 4M6HA 2Z0ZA 5FD8A 3G8WA 3F8KA 3S6FA 5J1QA 2ZEEA 3KR4A 4R76A 4P45A 2BEIA 4E5SA 1Z5RA 2DXQA 2VZZA 4X8IA 3U88C 3FJUA 2XEFA 1PU9A 2CNMA 4CS0B 1TXRA 4R3KA 2ZOFA 4A4BA 4NSQA 5G21A 4G1PA 4FUUA 5LYFA 2P6GA 3V7ZA 4AVCA 4MBUA 4C86A 5BY0A 1MJAA 1H8LA 2CXAA 2Z3KA 3DSBA 1YQEA 1XMTA 2AFWA 4KS9A 4P10A 1KEEB 4EYSA 5K8PA 2Q4VA 4NGTA 4Q38A 3H4QA 4A94A 2PRBA 4GXHA 2ZELA 1YLEA 5KTDA 3SJXA 2NYQA 5F47A 3IWEA 3VATA 3O8ZA 4JD6A 2Z3NA 2CIJA 1CS0B 1NSAA 2B4DB 2PJ7A 2ZXVA 4K30A 4NGMA 1Y7EA 2FT0A 2D4PA 4CDKA 1IB1E 5C88A 4X2TA 3VRRA 1PUAA 4R57A 1BPNA 1S7FA 4H6ZA 5JYBA 3D7FA 3S9LA 2B5GA 2IJZA 5LRGA 3GYAA 3RAMA 3IWWA 3VH9A 5A27A 2ARHA 5J8CA 1C30B 2Q43A 2ZEMA 2FM4A 4M8DA 2O4HA 4EMEA 4F0YA 1IYKA 3OP0A 2PJ0A 4IHMA 1BXRB 2D0PA 4YN3A 8CPAA 2Q51A 3NFQA 2YNCC 3CXSA 3IWGA 2DF5A 2GANA 1A2ZA 1M44A 1MJ9A 2P0WA 1AUGA 3WC5A 4E0AA 3SJFA 2PJ2A 4CDJA 1C3OB 4A95A 3SHPA 5K8OA 2CTBA 4JLYA 1X10A 2QECA 2Q0YA 3EZAA 3FEEA 1J4JA 4Y49B 4C9AA 3ICUA 1ZG7A 1ZG9A 3D67A 4YGOA 4OLLA 4FBEA 4OIWA 4NGQA 3IJ3A 1J3LA 5GCNA 1OBRA 4F9VA 2EUIA 1QSTA 2PR1A 5C82A 1IGBA 1S3ZA 1Z8WA 3EO4A 3B3CA 4MFKA 4FAIA 2AFZA 4PSXA 4UCPA 2UV8G 4AXVA 3VTAA 4CAVA 4J0NA 3HMJG 4A37A 4NCZA 1CX8A 1YLOA 1JDEA 3SXNA 3DR6A 2R98A 3TC8A 3TLBA 2HI6A 4H1HA 5K99A 2YGWA 4UWIA 2C6PA 3QAHA 1I21A 2FL4A 4JXRA 3TO6A 1ZL0A 4MHYA 2Z3PA 2YNEA 4JJXA 4R7MA 2VEZA 4CPAA 3SI2A 2HWGA 1LANA 4OP4A 5EC4A 2EK8A 2Y1NA 3OB2B 2C6CA 3BJ7A 4C2ZA 1K4JA 4U9YA 2OR4A 3TCVA 1BAVA 2J8MA 2V8GA 3HUVA 4C85A 4LQGA 4Q36A 2WSAA 4KOXA 5JM6A 4II9A 2FIAA 2FS5A 5F9MA 3BUXB 4MRIA 1Y9ZA 2Q04A 3VWDA 5F1YA 1QSNA 4B11A 4CGOA 2XEGA 4OC1A 4A31A 4KOYA 2V8VA 1YVOA 2OZGA 4C9UA 4JZ0A 3RZAA 3EFAA 2HROA 4ZY0A 1TKFA 2PRQA 1QQ9A 5AG4A 3D66A 3FH4A 4B5PB 3PB4X 5ISVA 3BHXA 2GE3A 3ISZA 2CY2A 4PK2A 5AXIA 2R7HA 1YW4A 3T05A 4C8AA 3KZWA 2OOTA 3OB1B 1TKJA 3TLGA 1R3NA 4KOWA 3SI0A 2WPXA 3FVLA 3ZJ0A 2EBJA 3PRTA 4CGMA 1P4NA 2PJ3A 4BTFA 4YU9A 1XRYA 2QIRA 2ZEOA 3TTHA 3F0AA 4BBHA 2XPNA 3PBBA 1VI4A 1NXJA 3KHZA 3H5ZA 3TO9A 4Y49C 3QB8A 3H8GA 4E94A 1LOKA 4C8UA
chains in the Genus database with same CATH topology
2XEIA 3GB0A 5CPAA 1CP7A 3WC6A 5JGFA 3JRUA 2PJ8A 4FWUA 2NSMA 2ZEDA 3BXMA 7CPAA 2ZEHA 1HDUA 2PCUA 2VL1A 1BLLE 2WZNA 5HVGA 4A39A 1XBUA 4IAVA 3WT4A 3KHXA 4C84A 2ZOGA 2AFMA 2HC9A 2JEWA 1KWMA 5ELYA 3FEDA 4NGSA 2CF4A 4MXUA 4P4BA 3EIFA 1EE3P 4P4DA 3KR5A 4YWYA 1ELLP 2AFXA 4OC4A 3NH5A 2C5QA 3I1UA 1IY7A 4TJXA 1LAPA 3GUXA 3PEIA 3ISXA 2PJ4A 3PFEA 4KNGE 4O23A 2EWBA 2O53A 2ANPA 1AYEA 1DTDA 4EWTA 4R6TA 2PIZA 3BI0A 3TX8A 4Q7AA 3B35A 4A38A 2BO9A 4Z65A 3KI9A 1Y0RA 4JYWA 3B3VA 1YSJA 5CBMA 1LAMA 2Q4ZA 3MN8A 2IMOA 5LRJA 4PQAA 2GLJA 2PJAA 1HDQA 4PXCA 2I3CA 3HLPA 6CPAA 3NH4A 1ARMA 4P4FA 3IIBA 4RUHA 2RFHA 2F7VA 3D7HA 2PVWA 4PXBA 4BD9A 5LRKA 1UWYA 1AMPA 4NJQA 1CBXA 1F2PA 1FT7A 1TF9A 3IC1A 2ZENA 5K8MA 4UEFA 2XEJA 4R8FA 2GLFA 1Z8LA 3PFOA 2PJ1A 5LYLA 2PIYA 3DGVA 4H2KA 2F8HA 2ABZA 4P44A 4C8FA 3D68A 1F2OA 1Y0YA 1V6CA 1Q7LA 1PYTB 4NGNA 4C8PA 1VHOA 4F9UA 5K8NA 4C99A 3CPAA 3PBEA 3I6SA 5HVFA 3FF3A 3SJEA 4C8TA 4OIDA 3NH8A 5JH9A 2GP4A 4NGRA 3T8WA 3KGQA 4C9EA 3SJGA 3BI1A 3D7GA 4MHPA 2PJCA 3B3TA 3S9NA 4OC0A 1VGYA 3PB6X 3PB9X 1ARLA 1WVMA 3IFEA 1ELMP 3FECA 2PJ6A 4MCQA 3H8EA 1CPSA 5DS0A 1VIXA 2AFSA 2J9AA 4ZY1A 4KSIA 4UEZA 2PJ5A 4F8ZA 1M4LA 5THWA 2IQ6A 2DEAA 4C8CA 2RB7A 4NJRA 1TF8A 3NFZA 4MHNA 4DJLA 4C8UA 2CTCA 3PB7X 1XF1A 5IR2A 4DYOA 2GREA 2JBKA 2JBJA 3IO1A 2V8DA 4OC3A 1ZLHA 4K3NA 4PXDA 2HB6A 3DLJA 4OC5A 3N5FA 3I74A 2BCOA 2EK9A 3FX6A 4UIBA 4C9RA 1CPXA 3LMSA 2PJ9A 3K2KA 3KASA 4ZY2A 2QYVA 4PXEA 2V77A 4OC2A 3KL9A 1ZG8A 1LFWA 2AFUA 1Z2LA 3D4UA 3PB8X 4EFDA 3KQXA 4UEEA 2POKA 4ONWA 1XJOA 2ZEPA 2PJBA 3NA6A 3B3WA 3K9TA 3RBUA 5I4MA 3CPXA 5LYDA 4P4EA 1DE4C 5D8NA 3B7IA 3WABA 3WC7A 2AFOA 3IEHA 5D29A 2ZEFA 3S9MA 2WYRA 3B2YA 2PVVA 1XFOA 2ZEGA 4ZYQA 2FVGA 1VHEA 4ZX9A 4NFRA 1CG2A 3VARA 4TJVA 1YMEA 4UF4A 1F57A 1YW6A 1RTQA 2C6GA 4PPZA 2QJ8A 3SI1A 1QMUA 1GYTA 4P6YA 2V8HA 3V38A 3B3SA 3QNVA 2QVPA 2BOAA 1TKHA 4C9VA 1CP6A 4MHZA 4TNUA 4DUKA 3L2NA 4UIAA 5HVHA 3D7DA 3CT9A 1FNOA 4MCRA 1LCPA 4OKOA 5IB9A 4ZX8A 4P4JA 4GM5A 4P4IA 2PE3A 4ZI6A 4MMOA 3KQZA 1R43A 2G9DA 4IK2A 3GLJA 3MRUA 3FMCA 3LWUA 2C1CA 3CDXA 4MCSA 1PCAA 4MCPA 5F09A 1HEEA 4OMEA 5HXDA 4WJBA 4X3RA 1BPMA 4TWEA 4B6ZA 1ZLIA 3H8FA 4WWVA 5LYIA 1JQGA 1XMBA 4W9YA 4NGPA 2GU2A 5J1QA 2ZEEA 3KR4A 4R76A 4P45A 1Z5RA 4X8IA 3FJUA 2XEFA 5LYFA 1TXRA 2ZOFA 4G1PA 4FUUA 4C86A 3V7ZA 4P10A 1H8LA 2AFWA 5K8PA 4NGTA 4A94A 2ZELA 3SJXA 2NYQA 3VATA 2CIJA 1NSAA 2PJ7A 4NGMA 1Y7EA 4CDKA 4X2TA 1BPNA 3D7FA 3S9LA 5LRGA 2IJZA 3RAMA 3VH9A 3IWWA 2Q43A 2ZEMA 2O4HA 4EMEA 4YN3A 2PJ0A 4IHMA 8CPAA 2Q51A 3WC5A 3SJFA 2PJ2A 4CDJA 5K8OA 2CTBA 4C9AA 3FEEA 3ICUA 1ZG7A 1ZG9A 3D67A 4FBEA 4OIWA 4NGQA 3IJ3A 1OBRA 4F9VA 1IGBA 3B3CA 4FAIA 2AFZA 3VTAA 4AXVA 4A37A 1CX8A 1YLOA 3TC8A 2C6PA 4MHYA 4R7MA 4CPAA 3SI2A 1LANA 4OP4A 2EK8A 2C6CA 2OR4A 1BAVA 2V8GA 3HUVA 4C85A 4LQGA 5JM6A 4MRIA 1Y9ZA 2XEGA 4OC1A 2V8VA 4C9UA 4JZ0A 3RZAA 4ZY0A 1TKFA 2PRQA 1QQ9A 3D66A 3FH4A 3PB4X 3BHXA 3ISZA 4C8AA 1YW4A 3KZWA 2OOTA 1TKJA 1R3NA 3SI0A 3FVLA 3PRTA 2PJ3A 4YU9A 1XRYA 2ZEOA 3PBBA 3KHZA 3H8GA 1LOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEI A;  3GB0 A;  5CPA A;  1CP7 A;  3WC6 A;  5JGF A;  3JRU A;  2PJ8 A;  4FWU A;  2NSM A;  2ZED A;  3BXM A;  7CPA A;  2ZEH A;  1HDU A;  2PCU A;  2VL1 A;  1BLL E;  2WZN A;  5HVG A;  4A39 A;  1XBU A;  4IAV A;  3WT4 A;  3KHX A;  4C84 A;  2ZOG A;  2AFM A;  2HC9 A;  2JEW A;  1KWM A;  5ELY A;  3FED A;  4NGS A;  2CF4 A;  4MXU A;  4P4B A;  3EIF A;  1EE3 P;  4P4D A;  3KR5 A;  4YWY A;  1ELL P;  2AFX A;  4OC4 A;  3NH5 A;  3I1U A;  1IY7 A;  4TJX A;  1LAP A;  3GUX A;  3PEI A;  3ISX A;  2PJ4 A;  3PFE A;  4KNG E;  4O23 A;  2EWB A;  2O53 A;  2ANP A;  1AYE A;  1DTD A;  4EWT A;  4R6T A;  2PIZ A;  3BI0 A;  3TX8 A;  4Q7A A;  3B35 A;  4A38 A;  2BO9 A;  4Z65 A;  3KI9 A;  1Y0R A;  4JYW A;  3B3V A;  1YSJ A;  5CBM A;  1LAM A;  2Q4Z A;  3MN8 A;  2IMO A;  5LRJ A;  4PQA A;  2GLJ A;  2PJA A;  1HDQ A;  4PXC A;  2I3C A;  3HLP A;  6CPA A;  3NH4 A;  1ARM A;  4P4F A;  3IIB A;  4RUH A;  2RFH A;  2F7V A;  3D7H A;  2PVW A;  4PXB A;  4BD9 A;  5LRK A;  1UWY A;  1AMP A;  4NJQ A;  1CBX A;  1F2P A;  1FT7 A;  1TF9 A;  3IC1 A;  2ZEN A;  5K8M A;  4UEF A;  2XEJ A;  4R8F A;  2GLF A;  1Z8L A;  3PFO A;  2PJ1 A;  5LYL A;  2PIY A;  3DGV A;  4H2K A;  2F8H A;  2ABZ A;  4P44 A;  4C8F A;  3D68 A;  1F2O A;  1Y0Y A;  1V6C A;  1Q7L A;  1PYT B;  4NGN A;  4C8P A;  1VHO A;  4F9U A;  5K8N A;  4C99 A;  3CPA A;  3PBE A;  3I6S A;  5HVF A;  3FF3 A;  3SJE A;  4C8T A;  4OID A;  3NH8 A;  5JH9 A;  4NGR A;  3T8W A;  3KGQ A;  4C9E A;  3SJG A;  3BI1 A;  3D7G A;  4MHP A;  2PJC A;  3B3T A;  3S9N A;  4OC0 A;  1VGY A;  3PB6 X;  3PB9 X;  1ARL A;  1WVM A;  3IFE A;  1ELM P;  3FEC A;  2PJ6 A;  4MCQ A;  3H8E A;  1CPS A;  5DS0 A;  1VIX A;  2AFS A;  2J9A A;  4ZY1 A;  4KSI A;  4UEZ A;  2PJ5 A;  4F8Z A;  1M4L A;  5THW A;  2IQ6 A;  2DEA A;  4C8C A;  2RB7 A;  4NJR A;  1TF8 A;  3NFZ A;  4MHN A;  4DJL A;  4C8U A;  2CTC A;  3PB7 X;  1XF1 A;  4DYO A;  2GRE A;  2JBK A;  2JBJ A;  3IO1 A;  2V8D A;  4OC3 A;  1ZLH A;  4K3N A;  4PXD A;  2HB6 A;  3DLJ A;  4OC5 A;  3N5F A;  3I74 A;  2BCO A;  2EK9 A;  3FX6 A;  4UIB A;  4C9R A;  1CPX A;  3LMS A;  2PJ9 A;  3K2K A;  3KAS A;  4ZY2 A;  2QYV A;  4PXE A;  2V77 A;  4OC2 A;  3KL9 A;  1ZG8 A;  1LFW A;  2AFU A;  1Z2L A;  3D4U A;  3PB8 X;  4EFD A;  3KQX A;  4UEE A;  2POK A;  4ONW A;  1XJO A;  2ZEP A;  2PJB A;  3NA6 A;  3B3W A;  3K9T A;  3RBU A;  5I4M A;  3CPX A;  5LYD A;  4P4E A;  1DE4 C;  5D8N A;  3B7I A;  3WAB A;  3WC7 A;  2AFO A;  3IEH A;  5D29 A;  2ZEF A;  3S9M A;  2WYR A;  3B2Y A;  2PVV A;  1XFO A;  2ZEG A;  4ZYQ A;  2FVG A;  1VHE A;  4ZX9 A;  4NFR A;  1CG2 A;  3VAR A;  4TJV A;  1YME A;  4UF4 A;  1F57 A;  1YW6 A;  1RTQ A;  2C6G A;  4PPZ A;  2QJ8 A;  3SI1 A;  1QMU A;  1GYT A;  4P6Y A;  2V8H A;  3V38 A;  3B3S A;  3QNV A;  2QVP A;  2BOA A;  1TKH A;  4C9V A;  1CP6 A;  4MHZ A;  4TNU A;  4DUK A;  3L2N A;  4UIA A;  5HVH A;  3D7D A;  3CT9 A;  1FNO A;  4MCR A;  1LCP A;  4OKO A;  5IB9 A;  4ZX8 A;  4P4J A;  4GM5 A;  4P4I A;  2PE3 A;  4ZI6 A;  4MMO A;  3KQZ A;  1R43 A;  2G9D A;  4IK2 A;  3GLJ A;  3MRU A;  3FMC A;  3LWU A;  2C1C A;  3CDX A;  4MCS A;  1PCA A;  4MCP A;  5F09 A;  1HEE A;  4OME A;  5HXD A;  4WJB A;  4X3R A;  1BPM A;  4TWE A;  4B6Z A;  1ZLI A;  3H8F A;  4WWV A;  5LYI A;  1JQG A;  1XMB A;  4W9Y A;  4NGP A;  2GU2 A;  5J1Q A;  2ZEE A;  3KR4 A;  4R76 A;  4P45 A;  1Z5R A;  4X8I A;  3FJU A;  2XEF A;  5LYF A;  1TXR A;  2ZOF A;  4G1P A;  4FUU A;  4C86 A;  3V7Z A;  4P10 A;  1H8L A;  2AFW A;  5K8P A;  4NGT A;  4A94 A;  2ZEL A;  3SJX A;  2NYQ A;  3VAT A;  2CIJ A;  1NSA A;  2PJ7 A;  4NGM A;  1Y7E A;  4CDK A;  4X2T A;  1BPN A;  3D7F A;  3S9L A;  5LRG A;  2IJZ A;  3RAM A;  3VH9 A;  3IWW A;  2Q43 A;  2ZEM A;  2O4H A;  4EME A;  4YN3 A;  2PJ0 A;  4IHM A;  8CPA A;  2Q51 A;  3WC5 A;  3SJF A;  2PJ2 A;  4CDJ A;  5K8O A;  2CTB A;  4C9A A;  3FEE A;  3ICU A;  1ZG7 A;  1ZG9 A;  3D67 A;  4FBE A;  4OIW A;  4NGQ A;  3IJ3 A;  1OBR A;  4F9V A;  1IGB A;  3B3C A;  4FAI A;  2AFZ A;  3VTA A;  4AXV A;  4A37 A;  1CX8 A;  1YLO A;  3TC8 A;  2C6P A;  4MHY A;  4R7M A;  4CPA A;  3SI2 A;  1LAN A;  4OP4 A;  2EK8 A;  2C6C A;  2OR4 A;  1BAV A;  2V8G A;  3HUV A;  4C85 A;  4LQG A;  5JM6 A;  4MRI A;  1Y9Z A;  2XEG A;  4OC1 A;  2V8V A;  4C9U A;  4JZ0 A;  3RZA A;  4ZY0 A;  1TKF A;  2PRQ A;  1QQ9 A;  3D66 A;  3FH4 A;  3PB4 X;  3BHX A;  3ISZ A;  4C8A A;  1YW4 A;  3KZW A;  2OOT A;  1TKJ A;  1R3N A;  3SI0 A;  3FVL A;  3PRT A;  2PJ3 A;  4YU9 A;  1XRY A;  2ZEO A;  3PBB A;  3KHZ A;  3H8G A;  1LOK A; 
#chains in the Genus database with same CATH topology
 2XEI A;  3GB0 A;  3JUW A;  1CP7 A;  4FD7 A;  4M85 A;  4NXY A;  5CPA A;  3JRU A;  2PJ8 A;  2FXF A;  3WC6 A;  4FWU A;  5JGF A;  2NSM A;  1Z8X A;  2ZED A;  3BXM A;  7CPA A;  2AE6 A;  2Q4Y A;  3GJZ A;  2HQY A;  2WUU A;  2ZEH A;  5AGE A;  1XF8 A;  1HDU A;  2PCU A;  2VL1 A;  1BLL E;  2WZN A;  3EY5 A;  5HVG A;  2VXK A;  2CNS A;  2X7B A;  4A39 A;  4A4C A;  4A32 A;  1XBU A;  2D4O A;  4IAV A;  3KHX A;  3WT4 A;  1A9X B;  2XPO A;  4C84 A;  2ZOG A;  2AFM A;  2HC9 A;  2JEW A;  1U6M A;  1KWM A;  5ELY A;  3FED A;  4NGS A;  2CF4 A;  2P6E A;  2AUN A;  4B13 A;  4MXU A;  4P4B A;  2R82 A;  3EIF A;  4MY3 A;  5H84 A;  1EE3 P;  1S60 A;  3FRM A;  3N7Z A;  4F0X A;  4P4D A;  5I0C A;  1R57 A;  3KKW A;  2FCK A;  3KR5 A;  4YWY A;  1ELL P;  3B8G A;  4QUS A;  1Q2Y A;  1WJT A;  2E28 A;  4KOR A;  4MFJ A;  2AFX A;  2OU2 A;  2KCW A;  4C7H A;  4CYO A;  4C8F A;  2XPL A;  4OC4 A;  3BUN B;  3NH5 A;  2C5Q A;  3V8I A;  3I1U A;  4UWJ A;  1S5K A;  5F48 A;  1IY7 A;  1I1D A;  4TJX A;  1LAP A;  4GPL B;  1Z9U A;  4CGL A;  3CZX A;  1GGO A;  3T0T A;  3GUX A;  4B12 A;  4BIN A;  4COB A;  3PEI A;  3ISX A;  2PJ4 A;  3PFE A;  4KNG E;  4MFZ A;  4O23 A;  2ZW6 A;  2EWB A;  4JXQ A;  4CYQ A;  4PSW A;  2O53 A;  1S7N A;  2Q7B A;  2ANP A;  1Q5X A;  4MFQ A;  1AYE A;  1DTD A;  3DR8 A;  4R9M A;  4R6T A;  4ZBG A;  2PIZ A;  3BUO B;  4C2Y A;  4EWT A;  1YGH A;  2PR8 A;  4B14 A;  1XEB A;  3BI0 A;  3T9Y A;  3TX8 A;  4Q7A A;  4QB9 A;  4CZ1 A;  4MFL A;  1FY7 A;  3KRV A;  1SQH A;  5CNP A;  3B35 A;  4KUA A;  3GY9 A;  4A38 A;  1S7K A;  2BO9 A;  4Z65 A;  4PK3 A;  3K4I A;  1MK4 A;  4M6G A;  4M3S A;  3UY5 A;  4UFW A;  1M6V B;  1S7L A;  1ZYM A;  4U9Z A;  5J3X A;  2ZW4 A;  5F49 A;  3KI9 A;  1EZB A;  4A2Z A;  1Y0R A;  4JYW A;  3B3V A;  3VGO A;  4KLW A;  2D0O A;  1P0H A;  4NEX A;  1YSJ A;  3I9S A;  4FD6 A;  5CBM A;  4B5O A;  1JDB C;  2PCN A;  1LAM A;  1QSM A;  2B5G B;  2Q4Z A;  2VZY A;  4CAX A;  3MN8 A;  2IMO A;  3GIU A;  5LRJ A;  1X12 A;  1GHE A;  4PQA A;  4QBJ A;  2GLJ A;  3SR3 A;  3TLA A;  3E0K A;  3P2F A;  4UCN A;  2I00 A;  2PJA A;  1HDQ A;  4KOV A;  4IUS A;  4PXC A;  2Z3O A;  4JWP A;  4UFX A;  2I3C A;  1I12 A;  2ZW5 A;  3HLP A;  1VBH A;  2AUM A;  6CPA A;  2JDC A;  3NH4 A;  3PFV A;  2Z11 A;  1ARM A;  4P4F A;  3IIB A;  4RUH A;  2EZA A;  3LD2 A;  3NE7 A;  2B0A A;  3R1K A;  2RFH A;  4J3G A;  4KSF A;  1IOF A;  1T36 B;  1DIK A;  1NE9 A;  2F7V A;  3LAC A;  3IGR A;  3TOB A;  3D7H A;  2PVW A;  3ZNI A;  4PXB A;  2ATR A;  1IID A;  1Z4R A;  4UA3 A;  4BD9 A;  3S6K A;  5LRK A;  4MI1 A;  1UWY A;  4XNH B;  4KZT A;  1JWQ A;  2REE A;  1MJB A;  1AMP A;  2REF A;  4NJQ A;  4MHD A;  1CBX A;  1F2P A;  1FT7 A;  2MP0 A;  3S6G A;  1TF9 A;  2R1I A;  3IU1 A;  2G0B A;  4INJ A;  3IC1 A;  4FD5 A;  2F5I A;  3TLC A;  4KSA A;  2ZEN A;  1TIQ A;  2FE7 A;  5K8M A;  2YJT A;  3ZZI A;  3TOA A;  4UEF A;  5BWA B;  2XEJ A;  3D8P A;  1QSO A;  2PSW A;  4R8F A;  5A28 A;  4YFJ A;  5EBV A;  2GLF A;  1Z8L A;  1IOI A;  3PFO A;  4XPL A;  2PJ1 A;  5LYL A;  3P2H A;  2PIY A;  2OB0 A;  3T90 A;  3DGV A;  3FIX A;  1EO0 A;  2AJ6 A;  3LOD A;  3NE8 A;  2VKZ G;  4H2K A;  2A4N A;  2F8H A;  2J8R A;  2ABZ A;  4P44 A;  3D2P A;  4IF5 A;  3BUW B;  5DWN A;  1B47 A;  4XPK A;  5G22 A;  2DLA A;  1F2O A;  2B4J C;  1Y0Y A;  1Y9W A;  3D68 A;  1NSL A;  3RO0 A;  1V6C A;  1Q7L A;  1PYT B;  1YRE A;  2Q7S A;  1Q2C A;  3K9U A;  2P6F A;  3TO7 A;  4NGN A;  4L89 A;  2X0S A;  3HPG G;  4C8P A;  1L0C A;  3PT1 A;  1VHO A;  2B3U A;  3R95 A;  4F9U A;  3TLG B;  5K8N A;  1VHS A;  4C99 A;  2PDO A;  3CPA A;  3PBE A;  3PLF B;  2G3A A;  4KLV A;  3I6S A;  5HVF A;  3DNS A;  1Y9K A;  1RO5 A;  4HNW B;  1VBG A;  3FF3 A;  1YK3 A;  1KUY A;  4MJX A;  4C7I A;  3SJE A;  4C2X A;  4OID A;  2B4B A;  4R87 A;  4C8T A;  3NH8 A;  5JH9 A;  2GP4 A;  3FB3 A;  4NGR A;  3T8W A;  3TE4 A;  4AVA A;  3R96 A;  3KGQ A;  4C9E A;  3SJG A;  3BI1 A;  3D7G A;  1BO4 A;  1XIX A;  2PJC A;  1ZO0 A;  4MHP A;  1KZF A;  3R9F A;  3B3T A;  3S9N A;  4L8A A;  4KVM E;  4KUB A;  3TFY A;  4OC0 A;  5KTA A;  4R3L A;  2ZPA A;  4XNH C;  3EZE A;  4HKF A;  5EMI A;  3BLN A;  3F5B A;  1VGY A;  5JVL A;  3PB6 X;  2Q44 A;  3PB9 X;  1ARL A;  1M1D A;  1WVM A;  4AB7 A;  5IX3 A;  3IFE A;  3VRQ A;  1ELM P;  3FEC A;  2PJ6 A;  5HH1 A;  4MCQ A;  3H8E A;  5J8F A;  1CPS A;  2EO8 A;  1QSR A;  2OH1 A;  4RI1 A;  5DS0 A;  1N71 A;  1VIX A;  1OZP A;  2AFS A;  2J9A A;  4ZY1 A;  1B6B A;  4KSI A;  1Z9E A;  2PJ5 A;  1IYL A;  3A9L A;  4UEZ A;  5AG5 A;  4F8Z A;  4KVX A;  4F6A A;  1M4L A;  5THW A;  2IQ6 A;  3I3G A;  4CO9 A;  2DEA A;  1YR0 A;  3WR7 A;  4C8C A;  3VRN A;  2G3T A;  4MY0 A;  2DIK A;  2RC4 A;  2RB7 A;  4NJR A;  2R8V A;  5HKZ A;  1IIC A;  4COG A;  2JDD A;  2DPS A;  1TF8 A;  3NFZ A;  4MHN A;  4QC6 A;  3SXO A;  4DJL A;  3NOJ A;  2YND A;  4GS4 A;  4OAD A;  2CTC A;  1VKC A;  4HNY B;  3PB7 X;  5F5X A;  4B10 A;  4FD4 A;  1XF1 A;  5IR2 A;  4DYO A;  2GRE A;  3FXT A;  2JBK A;  1R61 A;  1BOB A;  2QML A;  2JBJ A;  3IO1 A;  2V8D A;  4OC3 A;  1ZLH A;  2B4D A;  4K3N A;  4LX9 A;  3BJ8 A;  4PXD A;  2HB6 A;  2EZC A;  2HV2 A;  3DLJ A;  4OC5 A;  3N5F A;  3I74 A;  3RNZ A;  2BCO A;  5AG7 A;  4CAF A;  2EK9 A;  3FX6 A;  3PZJ A;  4KVO E;  1IU8 A;  2JEV A;  1YX0 A;  4UIB A;  2Y1M A;  5FVJ A;  4A33 A;  4C9R A;  1CPX A;  3CXQ A;  3LMS A;  4KOS A;  4M6I A;  2BUE A;  2PJ9 A;  3K2K A;  3KAS A;  4ZY2 A;  2QYV A;  4CRY B;  2DPT A;  2ODF A;  4PXE A;  5G1Z A;  5DWM A;  5KTC A;  2V77 A;  4OC2 A;  4C68 A;  3OAK A;  3KL9 A;  1M4I A;  4MFP A;  1EZA A;  1ZG8 A;  3HPH E;  1LFW A;  2AFU A;  2K5T A;  3OWC A;  4PV6 A;  4XPD B;  4A30 A;  4E2A A;  1Z2L A;  3F9K C;  4LUA A;  1ZRS A;  3TLY A;  1WWZ A;  1Z8T A;  4NF1 A;  4IIY A;  2C27 A;  3IU2 A;  3U1B A;  2EVN A;  3D4U A;  4UBR A;  2Z3M A;  3PB8 X;  4DNC A;  4EFD A;  2ZW7 A;  3KQX A;  4H6U A;  4CGP A;  1CM0 A;  4I49 A;  1M4D A;  4UEE A;  2POK A;  2HUZ A;  4CRZ B;  4JVO A;  4RR2 B;  2VBQ A;  4ONW A;  3G3S A;  3W6S A;  1XJO A;  3D2M A;  2ZEP A;  2PJB A;  3NA6 A;  5E96 A;  3JVN A;  2PC1 A;  4U5Y A;  1NMT A;  2J8N A;  3B3W A;  4CGN A;  3K9T A;  3RBU A;  4BPW B;  2O28 A;  5I4M A;  3CPX A;  1KUV A;  2Y0M A;  3FBU A;  3VRO A;  4ORF A;  4P4E A;  5LYD A;  3W6X A;  1YVH A;  2CNT A;  1KC7 A;  1DE4 C;  3TYX A;  5H86 A;  5D8N A;  4AG7 A;  3B7I A;  4CAW A;  3WAB A;  3WC7 A;  2AFO A;  3IEH A;  3FYN A;  5D29 A;  2ZEF A;  2EZB A;  3S9M A;  2GIV A;  4UFV A;  2YJV A;  2WYR A;  3B2Y A;  1Z4E A;  3T5M A;  2PVV A;  5JPH A;  5HKW A;  1CE8 B;  1XFO A;  2ZEG A;  1RXT A;  3MGD A;  4ZYQ A;  5F46 A;  2FVG A;  2GFQ A;  4KOT A;  3VWE A;  2FSR A;  3RYO A;  1VHE A;  4ZX9 A;  4NFR A;  1CG2 A;  2VI7 A;  4MI4 A;  1FBV A;  3VAR A;  4TJV A;  1YME A;  4UF4 A;  4X5K A;  1F57 A;  1YW6 A;  2FIW A;  4ZGY B;  4BMH A;  1RTQ A;  2C6G A;  2OZU A;  3R9E A;  1KBL A;  4PPZ A;  4H89 A;  4CYP A;  2Z3L A;  3R9G A;  2QJ8 A;  3SI1 A;  4B5P A;  1QMU A;  1GYT A;  4P6Y A;  2V8H A;  4RS2 A;  4BPX B;  3B3S A;  3V38 A;  1KUX A;  4BPU B;  3GKR A;  3G23 A;  3QNV A;  2QVP A;  2XPP A;  4CYN A;  2BOA A;  1TKH A;  2PQ8 A;  2NMT A;  4C9V A;  3T07 A;  3W91 A;  2B3V A;  3QAY A;  4KOU A;  1CP6 A;  4MHZ A;  4TNU A;  4XPD C;  4DUK A;  3L2N A;  2H5M A;  4UIA A;  5HVH A;  3D7D A;  1UFH A;  3CT9 A;  1FNO A;  3S6H A;  4AVB A;  3TLZ A;  1LRZ A;  4MCR A;  1XOV A;  4UCM A;  1CJW A;  4AG9 A;  1LCP A;  2B58 A;  2YNC A;  2JLM A;  4OKO A;  5AG6 A;  3EZB A;  5IB9 A;  4ZX8 A;  5HKY A;  3C8O A;  3BUM B;  4P4J A;  4GM5 A;  3TLE A;  1ON0 A;  1B87 A;  1XE4 A;  4QVT A;  1YVK A;  4P4I A;  1NBW A;  2PE3 A;  4RN7 A;  4ZI6 A;  2BSW A;  5F13 A;  2OZH A;  3D3S A;  4MMO A;  3CXP A;  1R43 A;  3KQZ A;  4HNX B;  2G9D A;  4IK2 A;  2IL4 A;  3GLJ A;  3MRU A;  1Q2D A;  3PP9 A;  3FMC A;  4HPS A;  1M4G A;  1Y7R A;  2C1C A;  3CDX A;  4MCS A;  1PCA A;  3LWU A;  4MCP A;  3PGP A;  3JTK A;  4ONU A;  4CAE A;  5F09 A;  1HEE A;  1V0C A;  3FNC A;  4LQ6 A;  3EXN A;  4E8O A;  4OME A;  3TT2 A;  5IV0 A;  5HXD A;  4WJB A;  4X3R A;  1BPM A;  4TWE A;  4IIX A;  4YRH A;  2WPW A;  4B6Z A;  3DDD A;  2VQY A;  1ZLI A;  3H8F A;  3C26 A;  2I79 A;  5HMN A;  2OLS A;  2N3A B;  4EVY A;  4OAE A;  4WWV A;  4MJ8 A;  3EC4 A;  5LYI A;  2CBL A;  1JQG A;  3VRP A;  2BL1 A;  5JQ4 A;  1XMB A;  4W9Y A;  5G20 A;  4NGP A;  2Z10 A;  5IB0 A;  1WK4 A;  2GU2 A;  4M6H A;  2Z0Z A;  5FD8 A;  3G8W A;  3F8K A;  3S6F A;  5J1Q A;  2ZEE A;  3KR4 A;  4R76 A;  4P45 A;  2BEI A;  4E5S A;  1Z5R A;  2DXQ A;  2VZZ A;  4X8I A;  3U88 C;  3FJU A;  2XEF A;  1PU9 A;  2CNM A;  4CS0 B;  1TXR A;  4R3K A;  2ZOF A;  4A4B A;  4NSQ A;  5G21 A;  4G1P A;  4FUU A;  5LYF A;  2P6G A;  3V7Z A;  4AVC A;  4MBU A;  4C86 A;  5BY0 A;  1MJA A;  1H8L A;  2CXA A;  2Z3K A;  3DSB A;  1YQE A;  1XMT A;  2AFW A;  4KS9 A;  4P10 A;  1KEE B;  4EYS A;  5K8P A;  2Q4V A;  4NGT A;  4Q38 A;  3H4Q A;  4A94 A;  2PRB A;  4GXH A;  2ZEL A;  1YLE A;  5KTD A;  3SJX A;  2NYQ A;  5F47 A;  3IWE A;  3VAT A;  3O8Z A;  4JD6 A;  2Z3N A;  2CIJ A;  1CS0 B;  1NSA A;  2B4D B;  2PJ7 A;  2ZXV A;  4K30 A;  4NGM A;  1Y7E A;  2FT0 A;  2D4P A;  4CDK A;  1IB1 E;  5C88 A;  4X2T A;  3VRR A;  1PUA A;  4R57 A;  1BPN A;  1S7F A;  4H6Z A;  5JYB A;  3D7F A;  3S9L A;  2B5G A;  2IJZ A;  5LRG A;  3GYA A;  3RAM A;  3IWW A;  3VH9 A;  5A27 A;  2ARH A;  5J8C A;  1C30 B;  2Q43 A;  2ZEM A;  2FM4 A;  4M8D A;  2O4H A;  4EME A;  4F0Y A;  1IYK A;  3OP0 A;  2PJ0 A;  4IHM A;  1BXR B;  2D0P A;  4YN3 A;  8CPA A;  2Q51 A;  3NFQ A;  2YNC C;  3CXS A;  3IWG A;  2DF5 A;  2GAN A;  1A2Z A;  1M44 A;  1MJ9 A;  2P0W A;  1AUG A;  3WC5 A;  4E0A A;  3SJF A;  2PJ2 A;  4CDJ A;  1C3O B;  4A95 A;  3SHP A;  5K8O A;  2CTB A;  4JLY A;  1X10 A;  2QEC A;  2Q0Y A;  3EZA A;  3FEE A;  1J4J A;  4Y49 B;  4C9A A;  3ICU A;  1ZG7 A;  1ZG9 A;  3D67 A;  4YGO A;  4OLL A;  4FBE A;  4OIW A;  4NGQ A;  3IJ3 A;  1J3L A;  5GCN A;  1OBR A;  4F9V A;  2EUI A;  1QST A;  2PR1 A;  5C82 A;  1IGB A;  1S3Z A;  1Z8W A;  3EO4 A;  3B3C A;  4MFK A;  4FAI A;  2AFZ A;  4PSX A;  4UCP A;  2UV8 G;  4AXV A;  3VTA A;  4CAV A;  4J0N A;  3HMJ G;  4A37 A;  4NCZ A;  1CX8 A;  1YLO A;  1JDE A;  3SXN A;  3DR6 A;  2R98 A;  3TC8 A;  3TLB A;  2HI6 A;  4H1H A;  5K99 A;  2YGW A;  4UWI A;  2C6P A;  3QAH A;  1I21 A;  2FL4 A;  4JXR A;  3TO6 A;  1ZL0 A;  4MHY A;  2Z3P A;  2YNE A;  4JJX A;  4R7M A;  2VEZ A;  4CPA A;  3SI2 A;  2HWG A;  1LAN A;  4OP4 A;  5EC4 A;  2EK8 A;  2Y1N A;  3OB2 B;  2C6C A;  3BJ7 A;  4C2Z A;  1K4J A;  4U9Y A;  2OR4 A;  3TCV A;  1BAV A;  2J8M A;  2V8G A;  3HUV A;  4C85 A;  4LQG A;  4Q36 A;  2WSA A;  4KOX A;  5JM6 A;  4II9 A;  2FIA A;  2FS5 A;  5F9M A;  3BUX B;  4MRI A;  1Y9Z A;  2Q04 A;  3VWD A;  5F1Y A;  1QSN A;  4B11 A;  4CGO A;  2XEG A;  4OC1 A;  4A31 A;  4KOY A;  2V8V A;  1YVO A;  2OZG A;  4C9U A;  4JZ0 A;  3RZA A;  3EFA A;  2HRO A;  4ZY0 A;  1TKF A;  2PRQ A;  1QQ9 A;  5AG4 A;  3D66 A;  3FH4 A;  4B5P B;  3PB4 X;  5ISV A;  3BHX A;  2GE3 A;  3ISZ A;  2CY2 A;  4PK2 A;  5AXI A;  2R7H A;  1YW4 A;  3T05 A;  4C8A A;  3KZW A;  2OOT A;  3OB1 B;  1TKJ A;  3TLG A;  1R3N A;  4KOW A;  3SI0 A;  2WPX A;  3FVL A;  3ZJ0 A;  2EBJ A;  3PRT A;  4CGM A;  1P4N A;  2PJ3 A;  4BTF A;  4YU9 A;  1XRY A;  2QIR A;  2ZEO A;  3TTH A;  3F0A A;  4BBH A;  2XPN A;  3PBB A;  1VI4 A;  1NXJ A;  3KHZ A;  3H5Z A;  3TO9 A;  4Y49 C;  3QB8 A;  3H8G A;  4E94 A;  1LOK A;  4C8U A; 
#chains in the Genus database with same CATH homology
 2XEI A;  3GB0 A;  5CPA A;  1CP7 A;  3WC6 A;  5JGF A;  3JRU A;  2PJ8 A;  4FWU A;  2NSM A;  2ZED A;  3BXM A;  7CPA A;  2ZEH A;  1HDU A;  2PCU A;  2VL1 A;  1BLL E;  2WZN A;  5HVG A;  4A39 A;  1XBU A;  4IAV A;  3WT4 A;  3KHX A;  4C84 A;  2ZOG A;  2AFM A;  2HC9 A;  2JEW A;  1KWM A;  5ELY A;  3FED A;  4NGS A;  2CF4 A;  4MXU A;  4P4B A;  3EIF A;  1EE3 P;  4P4D A;  3KR5 A;  4YWY A;  1ELL P;  2AFX A;  4OC4 A;  3NH5 A;  2C5Q A;  3I1U A;  1IY7 A;  4TJX A;  1LAP A;  3GUX A;  3PEI A;  3ISX A;  2PJ4 A;  3PFE A;  4KNG E;  4O23 A;  2EWB A;  2O53 A;  2ANP A;  1AYE A;  1DTD A;  4EWT A;  4R6T A;  2PIZ A;  3BI0 A;  3TX8 A;  4Q7A A;  3B35 A;  4A38 A;  2BO9 A;  4Z65 A;  3KI9 A;  1Y0R A;  4JYW A;  3B3V A;  1YSJ A;  5CBM A;  1LAM A;  2Q4Z A;  3MN8 A;  2IMO A;  5LRJ A;  4PQA A;  2GLJ A;  2PJA A;  1HDQ A;  4PXC A;  2I3C A;  3HLP A;  6CPA A;  3NH4 A;  1ARM A;  4P4F A;  3IIB A;  4RUH A;  2RFH A;  2F7V A;  3D7H A;  2PVW A;  4PXB A;  4BD9 A;  5LRK A;  1UWY A;  1AMP A;  4NJQ A;  1CBX A;  1F2P A;  1FT7 A;  1TF9 A;  3IC1 A;  2ZEN A;  5K8M A;  4UEF A;  2XEJ A;  4R8F A;  2GLF A;  1Z8L A;  3PFO A;  2PJ1 A;  5LYL A;  2PIY A;  3DGV A;  4H2K A;  2F8H A;  2ABZ A;  4P44 A;  4C8F A;  3D68 A;  1F2O A;  1Y0Y A;  1V6C A;  1Q7L A;  1PYT B;  4NGN A;  4C8P A;  1VHO A;  4F9U A;  5K8N A;  4C99 A;  3CPA A;  3PBE A;  3I6S A;  5HVF A;  3FF3 A;  3SJE A;  4C8T A;  4OID A;  3NH8 A;  5JH9 A;  2GP4 A;  4NGR A;  3T8W A;  3KGQ A;  4C9E A;  3SJG A;  3BI1 A;  3D7G A;  4MHP A;  2PJC A;  3B3T A;  3S9N A;  4OC0 A;  1VGY A;  3PB6 X;  3PB9 X;  1ARL A;  1WVM A;  3IFE A;  1ELM P;  3FEC A;  2PJ6 A;  4MCQ A;  3H8E A;  1CPS A;  5DS0 A;  1VIX A;  2AFS A;  2J9A A;  4ZY1 A;  4KSI A;  4UEZ A;  2PJ5 A;  4F8Z A;  1M4L A;  5THW A;  2IQ6 A;  2DEA A;  4C8C A;  2RB7 A;  4NJR A;  1TF8 A;  3NFZ A;  4MHN A;  4DJL A;  4C8U A;  2CTC A;  3PB7 X;  1XF1 A;  5IR2 A;  4DYO A;  2GRE A;  2JBK A;  2JBJ A;  3IO1 A;  2V8D A;  4OC3 A;  1ZLH A;  4K3N A;  4PXD A;  2HB6 A;  3DLJ A;  4OC5 A;  3N5F A;  3I74 A;  2BCO A;  2EK9 A;  3FX6 A;  4UIB A;  4C9R A;  1CPX A;  3LMS A;  2PJ9 A;  3K2K A;  3KAS A;  4ZY2 A;  2QYV A;  4PXE A;  2V77 A;  4OC2 A;  3KL9 A;  1ZG8 A;  1LFW A;  2AFU A;  1Z2L A;  3D4U A;  3PB8 X;  4EFD A;  3KQX A;  4UEE A;  2POK A;  4ONW A;  1XJO A;  2ZEP A;  2PJB A;  3NA6 A;  3B3W A;  3K9T A;  3RBU A;  5I4M A;  3CPX A;  5LYD A;  4P4E A;  1DE4 C;  5D8N A;  3B7I A;  3WAB A;  3WC7 A;  2AFO A;  3IEH A;  5D29 A;  2ZEF A;  3S9M A;  2WYR A;  3B2Y A;  2PVV A;  1XFO A;  2ZEG A;  4ZYQ A;  2FVG A;  1VHE A;  4ZX9 A;  4NFR A;  1CG2 A;  3VAR A;  4TJV A;  1YME A;  4UF4 A;  1F57 A;  1YW6 A;  1RTQ A;  2C6G A;  4PPZ A;  2QJ8 A;  3SI1 A;  1QMU A;  1GYT A;  4P6Y A;  2V8H A;  3V38 A;  3B3S A;  3QNV A;  2QVP A;  2BOA A;  1TKH A;  4C9V A;  1CP6 A;  4MHZ A;  4TNU A;  4DUK A;  3L2N A;  4UIA A;  5HVH A;  3D7D A;  3CT9 A;  1FNO A;  4MCR A;  1LCP A;  4OKO A;  5IB9 A;  4ZX8 A;  4P4J A;  4GM5 A;  4P4I A;  2PE3 A;  4ZI6 A;  4MMO A;  3KQZ A;  1R43 A;  2G9D A;  4IK2 A;  3GLJ A;  3MRU A;  3FMC A;  3LWU A;  2C1C A;  3CDX A;  4MCS A;  1PCA A;  4MCP A;  5F09 A;  1HEE A;  4OME A;  5HXD A;  4WJB A;  4X3R A;  1BPM A;  4TWE A;  4B6Z A;  1ZLI A;  3H8F A;  4WWV A;  5LYI A;  1JQG A;  1XMB A;  4W9Y A;  4NGP A;  2GU2 A;  5J1Q A;  2ZEE A;  3KR4 A;  4R76 A;  4P45 A;  1Z5R A;  4X8I A;  3FJU A;  2XEF A;  5LYF A;  1TXR A;  2ZOF A;  4G1P A;  4FUU A;  4C86 A;  3V7Z A;  4P10 A;  1H8L A;  2AFW A;  5K8P A;  4NGT A;  4A94 A;  2ZEL A;  3SJX A;  2NYQ A;  3VAT A;  2CIJ A;  1NSA A;  2PJ7 A;  4NGM A;  1Y7E A;  4CDK A;  4X2T A;  1BPN A;  3D7F A;  3S9L A;  5LRG A;  2IJZ A;  3RAM A;  3VH9 A;  3IWW A;  2Q43 A;  2ZEM A;  2O4H A;  4EME A;  4YN3 A;  2PJ0 A;  4IHM A;  8CPA A;  2Q51 A;  3WC5 A;  3SJF A;  2PJ2 A;  4CDJ A;  5K8O A;  2CTB A;  4C9A A;  3FEE A;  3ICU A;  1ZG7 A;  1ZG9 A;  3D67 A;  4FBE A;  4OIW A;  4NGQ A;  3IJ3 A;  1OBR A;  4F9V A;  1IGB A;  3B3C A;  4FAI A;  2AFZ A;  3VTA A;  4AXV A;  4A37 A;  1CX8 A;  1YLO A;  3TC8 A;  2C6P A;  4MHY A;  4R7M A;  4CPA A;  3SI2 A;  1LAN A;  4OP4 A;  2EK8 A;  2C6C A;  2OR4 A;  1BAV A;  2V8G A;  3HUV A;  4C85 A;  4LQG A;  5JM6 A;  4MRI A;  1Y9Z A;  2XEG A;  4OC1 A;  2V8V A;  4C9U A;  4JZ0 A;  3RZA A;  4ZY0 A;  1TKF A;  2PRQ A;  1QQ9 A;  3D66 A;  3FH4 A;  3PB4 X;  3BHX A;  3ISZ A;  4C8A A;  1YW4 A;  3KZW A;  2OOT A;  1TKJ A;  1R3N A;  3SI0 A;  3FVL A;  3PRT A;  2PJ3 A;  4YU9 A;  1XRY A;  2ZEO A;  3PBB A;  3KHZ A;  3H8G A;  1LOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...