4MCQA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyldi-gamma-l-glutamic acid (pteroyltri-gamma-l-glutamic acid)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
695
structure length
692
Chain Sequence
b'HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 268
structure length 692
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcqA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcqA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcqA02
1Z8LA 2NYQA 2RFHA 3JRUA 3NA6A 3ISZA 4O23A 3D68A 3PRTA 2QJ8A 4ZY1A 5D8NA 4F8ZA 4C8FA 2PCUA 2CTCA 4UIBA 4OMEA 1LANA 2Q43A 4CPAA 1Y0YA 4RUHA 2JBKA 4DJLA 2PJ1A 2WZNA 3RAMA 3KGQA 4PXDA 2CTBA 1CPSA 3NFZA 4MCSA 4JYWA 2IMOA 1XJOA 2ZEHA 1YSJA 1QQ9A 3PEIA 3D4UA 2PJ4A 4ZX9A 3S9NA 4PPZA 2GLFA 4UF4A 3RBUA 2PJ9A 1Z5RA 2PJBA 4GM5A 2AFSA 2V8HA 4Q7AA 3TC8A 2C1CA 3S9MA 3PBEA 4C8UA 4NGPA 4EFDA 4A39A 3FECA 1R3NA 5DS0A 1ELLP 3NH8A 2NSMA 3B3WA 4F9VA 3DLJA 1HDQA 1XMBA 3PB6X 1CBXA 3I74A 4UEFA 1HEEA 3VTAA 4OP4A 2PJ0A 1LAMA 3B2YA 3B35A 4TNUA 2PRQA 1AMPA 3L2NA 5JGFA 3SI2A 4FAIA 5LYIA 3I1UA 5JM6A 1Z2LA 4OC1A 4MMOA 2AFWA 4C84A 4WWVA 1CP6A 4JZ0A 1LCPA 3IJ3A 2QYVA 1M4LA 4OIWA 6CPAA 3SI1A 4YWYA 2V8DA 4MHNA 3D7HA 3QNVA 2AFOA 2PJCA 2AFZA 2PJ2A 4X2TA 2I3CA 3CT9A 4C85A 2CF4A 3D7GA 3SJEA 1HDUA 1IY7A 4P44A 1TF8A 3CDXA 1Y7EA 4TWEA 3WC6A 5THWA 1F2OA 1EE3P 4B6ZA 4C8TA 5HXDA 4IAVA 1XF1A 2IJZA 3BI0A 1OBRA 1F57A 4AXVA 4P4BA 3S9LA 4NJQA 4EWTA 2ANPA 3FJUA 1XBUA 2QVPA 4MCRA 3KQZA 3GLJA 5D29A 2PJ7A 2C6CA 2RB7A 2CIJA 4X8IA 1QMUA 1YMEA 4OC4A 2EK9A 1CG2A 1BLLE 4UEEA 2ZEGA 4R7MA 4PXCA 1VGYA 2OR4A 3WC5A 2C6GA 4LQGA 4P4IA 3IFEA 5LYFA 1CX8A 1TF9A 2BCOA 1ELMP 1ZG9A 2IQ6A 3PBBA 3ICUA 1JQGA 3D66A 3FEEA 4H2KA 4MHZA 2O53A 3KASA 3V38A 2PVWA 2ZEOA 2ZEPA 4P4EA 2AFUA 3KQXA 1LOKA 4ZY0A 2ZOGA 2PJAA 4OC3A 4IK2A 3PB9X 1ZG7A 3I6SA 2PJ8A 3BI1A 4MRIA 3WABA 4NGRA 3FMCA 1TKJA 3IEHA 3VATA 5K8NA 3BHXA 3NH5A 3D7DA 3PB4X 2EWBA 5JH9A 3K9TA 1NSAA 3H8FA 3RZAA 2ABZA 7CPAA 1PYTB 4A94A 2GU2A 4KSIA 4NFRA 1UWYA 1XRYA 5K8OA 5K8PA 2PJ5A 5HVHA 3LMSA 8CPAA 3B7IA 1YW6A 4A37A 1PCAA 4ONWA 2AFMA 4WJBA 4R6TA 2POKA 3ISXA 4NGTA 4NJRA 3GUXA 3HUVA 1VHOA 3WC7A 5J1QA 4CDKA 4BD9A 4Z65A 3FH4A 4YU9A 1R43A 4MCPA 4MXUA 5I4MA 3KHXA 1CPXA 1LAPA 1VIXA 1AYEA 4P10A 4F9UA 2FVGA 4G1PA 4MHPA 4R8FA 2BO9A 1RTQA 2DEAA 2WYRA 3B3CA 4W9YA 1TKFA 2F7VA 3IO1A 3T8WA 2XEIA 2JEWA 2VL1A 1H8LA 5LRGA 5HVGA 4DYOA 3IC1A 2J9AA 3D7FA 2PJ3A 3CPXA 3NH4A 4C9UA 3HLPA 2GLJA 2G9DA 3H8EA 3SI0A 4FBEA 5CBMA 4P4DA 3KR5A 2PJ6A 1ARLA 4P4FA 2HB6A 1CP7A 2AFXA 5LYDA 4TJXA 4NGNA 3D67A 4MCQA 4C99A 3N5FA 4PXBA 2V8VA 2XEFA 1KWMA 4C86A 3EIFA 4P45A 3DGVA 1Y9ZA 1FNOA 4X3RA 4IHMA 1BPNA 3KL9A 1XFOA 2F8HA 1YW4A 2C6PA 5F09A 3B3TA 3VH9A 5HVFA 4ZI6A 2EK8A 3KI9A 3V7ZA 1BPMA 3PB7X 4YN3A 2HC9A 1BAVA 3SJGA 4C8AA 4OKOA 4OC2A 3KR4A 3SJXA 1YLOA 5ELYA 1LFWA 1TXRA 5K8MA 1FT7A 3FF3A 2JBJA 1ZLIA 2OOTA 2Q51A 3B3VA 4A38A 1Y0RA 3FVLA 2ZEMA 2PIYA 3IIBA 2PE3A 1Q7LA 2XEGA 5IB9A 1ZG8A 3FEDA 2XEJA 4R76A 3MRUA 4P6YA 4CDJA 4PQAA 1ARMA 3BXMA 4NGQA 3SJFA 2ZEDA 1F2PA 5LRKA 2ZEEA 4TJVA 3VARA 4C9VA 2PIZA 3TX8A 1IGBA 3K2KA 1GYTA 4DUKA 3PB8X 3PFEA 4P4JA 3KHZA 4OC0A 1DTDA 2BOAA 4ZYQA 4EMEA 3GB0A 4PXEA 3WT4A 4C9EA 2V8GA 4C8CA 5LYLA 1DE4C 3KZWA 4C8PA 2PVVA 2ZENA 4NGMA 3PFOA 3B3SA 3LWUA 4ZY2A 2ZELA 4KNGE 4FUUA 4C9AA 4UEZA 4OC5A 1ZLHA 5LRJA 1WVMA 3IWWA 2Q4ZA 2V77A 3CPAA 4C9RA 3MN8A 1TKHA 3H8GA 1V6CA 3FX6A 2ZOFA 4NGSA 2O4HA 4ZX8A 4OIDA 4MHYA 4UIAA 2ZEFA 2GREA 4K3NA 5CPAA 1VHEA 4FWUA
chains in the Genus database with same CATH superfamily
1Z8LA 4HNYB 2VXKA 3TLYA 1M4IA 2NYQA 2RFHA 4OAEA 4AB7A 3GYAA 5G20A 3VRPA 3DDDA 1T36B 2VBQA 3JRUA 3OP0A 3PLFB 4UCNA 3NA6A 3ISZA 2DF5A 4O23A 3D68A 3PRTA 2QJ8A 4J0NA 2Y1NA 2WPWA 5D8NA 4F8ZA 4ZY1A 4R87A 3OWCA 1YR0A 3CXPA 3NE7A 1MJAA 4Y49C 2PCUA 4C8FA 2CTCA 2I79A 2GP4A 4UIBA 2GFQA 1EO0A 2FXFA 3HPHE 4OMEA 1LANA 4JJXA 2Q43A 3FXTA 4UBRA 4UCMA 3QB8A 2D0PA 1GHEA 1YLEA 4CPAA 3LODA 5E96A 4R9MA 4B11A 1Y0YA 4RUHA 2JBKA 1CM0A 1FBVA 1QSTA 2PRBA 2VI7A 3R96A 4DJLA 5HMNA 5F46A 1CE8B 2PJ1A 2OZGA 4CGPA 5EMIA 4H6UA 4ZBGA 3R9EA 4IIYA 2WZNA 3RAMA 4FD7A 4AG9A 4B5OA 4GPLB 3KGQA 4A2ZA 4CZ1A 1B47A 2HQYA 4II9A 4PXDA 4Q38A 3TOBA 2CTBA 1CPSA 3NFZA 4MCSA 3FRMA 4JYWA 4YGOA 2IMOA 2B0AA 2O28A 2Q4YA 1XJOA 2CBLA 5I0CA 1SQHA 2ZEHA 4BPUB 5AG6A 5FD8A 1YSJA 3TLGA 1QQ9A 4OADA 3PEIA 4CYOA 2GE3A 2JLMA 3D4UA 1Z9UA 2D4OA 2PJ4A 4XPDC 4M6IA 4ZX9A 4CGNA 2R8VA 3S9NA 1Z8WA 4PPZA 2GLFA 5JQ4A 4UF4A 4AG7A 3RBUA 5GCNA 4A4BA 2PJ9A 1Z5RA 2PJBA 4AVBA 2X7BA 1NMTA 4JXQA 2CNTA 4GM5A 3BUWB 4FD4A 4MFKA 2AFSA 4A31A 2V8HA 5FVJA 4Q7AA 2VKZG 3TC8A 1KUYA 1GGOA 3R1KA 2C1CA 3C26A 3E0KA 3S9MA 3PBEA 2Z3NA 4C8UA 3OB1B 4NGPA 1IIDA 1N71A 3CZXA 4FD5A 4EFDA 4A39A 3FECA 1P4NA 1R3NA 3BUMB 3HMJG 5DS0A 1ELLP 4F0YA 1C3OB 4J3GA 1S7FA 3NH8A 4A33A 2NSMA 3B3WA 2H5MA 1NE9A 2JDDA 4PSXA 4F9VA 5KTCA 3DLJA 1HDQA 1XMBA 4RR2B 3PB6X 1CBXA 3BUXB 1S3ZA 4KOVA 3RNZA 3I74A 2DXQA 4M6GA 3TLGB 1EZAA 2CXAA 4UEFA 4KOSA 1NSLA 2PR8A 1HEEA 3G8WA 3VTAA 2ZW5A 4ONUA 4UWJA 1Z4EA 3PP9A 4KVXA 4OP4A 2PJ0A 1S5KA 3S6HA 1LAMA 2B58A 3B2YA 3B35A 4KSAA 2PRQA 1AMPA 3L2NA 3MGDA 3D3SA 4TNUA 3SI2A 4FAIA 5LYIA 1ZL0A 2OLSA 3I1UA 3D8PA 5JM6A 1Z9EA 1Z2LA 2N3AB 2Z3OA 3BUOB 4OC1A 3FNCA 4R3KA 1A9XB 5C88A 4MMOA 4CAEA 2YNEA 2AFWA 3VROA 4U9ZA 1ON0A 3IWEA 4HNWB 3W6XA 4YRHA 4C84A 3ZJ0A 4MI1A 4MFLA 4WWVA 4CYQA 4COGA 1CP6A 4JZ0A 4E2AA 1LCPA 1M4DA 2QYVA 3VRNA 1M4LA 3IJ3A 4OIWA 3SI1A 6CPAA 1TIQA 4YWYA 2V8DA 4NEXA 4L8AA 2YNCA 3EZAA 4MHNA 3D7HA 3QNVA 2AFOA 2PJCA 1C30B 2AFZA 2PJ2A 4X2TA 2I3CA 3CT9A 1J3LA 4C85A 4HKFA 2CF4A 2P0WA 4LX9A 3D7GA 3SJEA 1HDUA 4C2XA 1IY7A 4P44A 3B8GA 1TF8A 4B5PA 3CDXA 1Y7EA 4TWEA 2B3VA 4NXYA 3S6FA 3VWEA 5F49A 5THWA 3WC6A 1R61A 1F2OA 1EE3P 4FD6A 4B6ZA 4MFPA 3T05A 2BUEA 2FIAA 2P6EA 1PUAA 4C8TA 5HXDA 4IAVA 4MJ8A 1XF1A 3K9UA 4MFQA 4KOXA 2IJZA 2Q7SA 3BI0A 3VGOA 3BJ7A 5F47A 3ZZIA 3TFYA 1IYKA 2D0OA 1OBRA 1F57A 3GIUA 4P4BA 1IOIA 3S9LA 4NJQA 4AXVA 4TJVA 3QAHA 4EWTA 2ANPA 4MJXA 3OAKA 3TOAA 3FJUA 3CXQA 4E0AA 1XBUA 2DLAA 3OB2B 4MY3A 4H6ZA 1I21A 2QVPA 3S6GA 4MCRA 2Z11A 3KQZA 1S7LA 1CJWA 4C68A 2G3TA 3GLJA 3SR3A 5D29A 1KC7A 2PJ7A 2C6CA 2RB7A 2CIJA 3FIXA 3PT1A 1KZFA 1QMUA 1YMEA 4X8IA 5H84A 4Q36A 2YJTA 4OC4A 2EK9A 1CG2A 2C27A 4IUSA 1BLLE 4KOYA 1FY7A 4UEEA 4IIXA 2ZEGA 4R7MA 1Q5XA 4PXCA 4NCZA 4KVME 5HKZA 4B5PB 4CGMA 1VGYA 2OR4A 3WC5A 2C6GA 4LQGA 3O8ZA 4P4IA 2FL4A 3K4IA 1KUVA 3IFEA 2GANA 5LYFA 2REEA 1Q2CA 2XPOA 2HV2A 4NSQA 1S7KA 1Q2YA 1CX8A 3T07A 1TF9A 1OZPA 2BCOA 5JYBA 1ELMP 1ZG9A 4QBJA 2IQ6A 4A30A 3PBBA 1IYLA 3A9LA 3F8KA 3ICUA 1JQGA 1YGHA 3V8IA 3D66A 5IR2A 3FEEA 1ZRSA 3U1BA 2QMLA 4H2KA 4MHZA 2O53A 3KASA 2YNDA 1I1DA 3DSBA 3V38A 2PVWA 1BOBA 2EO8A 1KEEB 3TLCA 1ZO0A 2ZEOA 2ZEPA 4P4EA 5F13A 2AFUA 2R7HA 3NE8A 4MFJA 3P2FA 3LD2A 3HPGG 1M6VB 3KQXA 2X0SA 1LOKA 4ZY0A 2XPLA 2ZOGA 2PJAA 4OC3A 4IK2A 3PB9X 1ZG7A 1MJBA 3VRRA 3BI1A 2PJ8A 3I6SA 3TT2A 1Z8XA 3T90A 2KCWA 4BBHA 3EZEA 4MRIA 3WABA 5JVLA 2R98A 4NGRA 1VI4A 3FMCA 3QAYA 4RN7A 1TKJA 2PR1A 3IEHA 2FM4A 4KVOE 3VATA 3SXNA 3IWGA 5K8NA 3BHXA 5AXIA 4BPWB 3DR8A 3JUWA 3NH5A 3D7DA 3PB4X 4E94A 2EUIA 2EWBA 5JH9A 3DNSA 3K9TA 1NSAA 1WK4A 3H8FA 3RZAA 3TO9A 3NOJA 2ABZA 7CPAA 3TLZA 4B12A 1PYTB 4A94A 1NBWA 3U88C 4GS4A 2GU2A 4KSIA 4NFRA 1UWYA 1XRYA 3I3GA 2CY2A 3R9FA 3T9YA 4F0XA 5K8OA 5EC4A 3RO0A 2PJ5A 5HVHA 2WSAA 4R57A 4XPLA 3PZJA 3R95A 3VWDA 4JVOA 1J4JA 4PV6A 3LMSA 8CPAA 4M6HA 1JDEA 1MK4A 3B7IA 1YW6A 4A37A 1PCAA 4ONWA 1JWQA 2AFMA 2VEZA 1VBGA 2E28A 4WJBA 4R6TA 2POKA 3ISXA 4NGTA 4NJRA 2Z3PA 2VZZA 3GY9A 4KOWA 4B13A 2ARHA 4CAWA 3GUXA 3HUVA 1VHOA 4QC6A 3WC7A 1KUXA 4CAXA 5J1QA 2YJVA 4BD9A 3P2HA 4CDKA 5IV0A 4BINA 4Z65A 5J8CA 2Y0MA 3FH4A 4YU9A 3KKWA 1R43A 4MCPA 1DIKA 4MXUA 3RYOA 5I4MA 1M44A 2P6GA 5HKYA 3GKRA 3KHXA 4C9VA 3BLNA 4BPXB 1I12A 2Z3LA 3T0TA 3TLAA 1CPXA 1LAPA 1VKCA 1VIXA 2EZCA 1AYEA 2AJ6A 3IU1A 2Z3KA 3G23A 4UCPA 4AVAA 5F9MA 2B4DA 3LACA 4CO9A 5EBVA 2ZW6A 1NXJA 2ATRA 1R57A 3PFVA 2HUZA 4P10A 4QUSA 1CS0B 1EZBA 2Q0YA 3TCVA 4F9UA 3FBUA 3TYXA 2ODFA 2FVGA 4G1PA 5JPHA 2EZAA 2XPPA 4MHPA 4R8FA 2BO9A 4PK2A 1IU8A 4RS2A 1RTQA 2DEAA 2WYRA 3B3CA 4W9YA 3TO6A 1Y9KA 1TKFA 2R1IA 4KSFA 2F7VA 3IO1A 5F48A 4EVYA 2B5GA 4A4CA 2WUUA 3T8WA 3TLEA 2XEIA 4COBA 5HKWA 1XF8A 2J8NA 2JEWA 2QIRA 2PC1A 2VL1A 5IB0A 1H8LA 1P0HA 4C2YA 1XIXA 5LRGA 5G1ZA 4MBUA 4MFZA 1VBHA 1M1DA 5HVGA 4DYOA 5AG7A 1B6BA 3IC1A 2C5QA 2G0BA 2J9AA 2FCKA 4UWIA 3D7FA 4JXRA 2F5IA 3EXNA 2OB0A 2PJ3A 3CPXA 3NH4A 4KZTA 2HROA 3F0AA 1V0CA 2HWGA 3T5MA 4C9UA 4AVCA 4LUAA 5AG5A 3SXOA 2DPTA 3G3SA 3HLPA 5K99A 3VRQA 2IL4A 2D4PA 1Y9WA 2FT0A 3BJ8A 2GLJA 1YX0A 2G9DA 3N7ZA 4CRYB 3H8EA 2VZYA 3SI0A 1JDBC 4UFXA 4MHDA 4FBEA 5KTAA 2B4BA 2PDOA 4I49A 4KLVA 4MY0A 5CBMA 4P4DA 3KR5A 4M8DA 2PJ6A 1ARLA 2B5GB 4P4FA 1BXRB 2HB6A 1VHSA 1M4GA 3EO4A 4PK3A 4DNCA 2DIKA 1CP7A 2AFXA 5LYDA 1X12A 3F5BA 4E5SA 3SHPA 2BSWA 2ZXVA 2G3AA 2A4NA 3H4QA 4LQ6A 2Z0ZA 3TO7A 4NGNA 4TJXA 3TLBA 3D67A 1Z8TA 4MCQA 2ZW4A 4C99A 2ZPAA 5KTDA 3IU2A 4C7HA 4CYPA 3N5FA 1ZYMA 4PXBA 4UA3A 1S7NA 2V8VA 4OLLA 1XOVA 4QB9A 2XEFA 1IB1E 5BY0A 2AE6A 1KWMA 4C86A 2PQ8A 4X5KA 4YFJA 3EIFA 2Q44A 4P45A 4EYSA 3DGVA 2FIWA 1Y9ZA 1IOFA 1FNOA 1XEBA 4X3RA 2J8RA 4JD6A 4IHMA 1BPNA 3KL9A 2R82A 1XFOA 1QSRA 1XMTA 2F8HA 1YW4A 2C6PA 5F09A 5DWNA 1YQEA 5H86A 4M85A 4R3LA 2J8MA 3CXSA 1X10A 3B3TA 5HVFA 3VH9A 2EZBA 2AUMA 4ZI6A 1WJTA 5HH1A 2EK8A 2Y1MA 3KI9A 3I9SA 2BEIA 1BPMA 4MI4A 3V7ZA 3R9GA 4CRZB 4NF1A 3PB7X 4YN3A 2HC9A 4KUAA 1BAVA 3SJGA 5CNPA 2FE7A 4C2ZA 1Y7RA 4C8AA 5K8PA 3S6KA 2DPSA 4F6AA 4OKOA 4OC2A 4CGOA 2FSRA 3D2MA 5BWAB 1QSNA 4HPSA 1LRZA 3KR4A 2ZW7A 4L89A 3SJXA 1K4JA 2JEVA 1YLOA 4CAVA 5G22A 5ELYA 1LFWA 1TXRA 5K8MA 1FT7A 2Z10A 4KLWA 3GJZA 3FF3A 2JBJA 1ZLIA 2YNCC 4RI1A 2OOTA 2P6FA 2Q51A 1YVHA 3B3VA 4JWPA 1Y0RA 3D2PA 4A38A 3FVLA 4B10A 2ZEMA 2PIYA 3H5ZA 2PE3A 2CNSA 2OZHA 3IIBA 4IF5A 1Q7LA 2XEGA 3ZNIA 1PU9A 4H89A 4PSWA 5IB9A 1ZG8A 4XNHC 1B87A 3W6SA 2B3UA 4BTFA 3FEDA 2MP0A 3JTKA 3TTHA 3W91A 2XEJA 1Q2DA 2I00A 4R76A 1U6MA 4CYNA 2QECA 3MRUA 4P6YA 4A95A 1KBLA 2K5TA 3FYNA 4CDJA 2BL1A 2OZUA 2VQYA 4PQAA 4ZGYB 1ARMA 2JDCA 4E8OA 3BXMA 4NGQA 4B14A 2AUNA 3SJFA 2B4JC 1F2PA 2ZEDA 1YVKA 2ZEEA 5AGEA 3VARA 2OU2A 5LRKA 2PIZA 2WPXA 1IGBA 3K2KA 1GYTA 3TX8A 4DUKA 2EVNA 3PB8X 3PFEA 4XPKA 4C7IA 4P4JA 5J3XA 4JLYA 3KHZA 1QSOA 4UFWA 3TE4A 4OC0A 5A27A 4Y49B 3DR6A 4INJA 2OH1A 1DTDA 2BOAA 2Q4VA 5G21A 2Z3MA 4ZYQA 1UFHA 2FS5A 4EMEA 1A2ZA 3GB0A 3C8OA 4PXEA 3EFAA 3EC4A 4UFVA 3WT4A 4C9EA 2V8GA 1YK3A 4C8CA 4U9YA 1RXTA 4ORFA 4QVTA 3EY5A 4CGLA 1DE4C 5LYLA 4KS9A 3F9KC 3NFQA 4U5YA 3KZWA 2REFA 1IICA 2NMTA 4C8PA 1AUGA 2PVVA 1XE4A 2ZENA 4H1HA 1RO5A 4NGMA 3PFOA 3UY5A 5J8FA 5A28A 3B3SA 5C82A 3LWUA 2PSWA 1WWZA 4ZY2A 2ZELA 1S60A 4FUUA 4KNGE 5ISVA 4UEZA 3WR7A 4C9AA 4OC5A 1ZLHA 5LRJA 1WVMA 3IWWA 1MJ9A 2HI6A 1YREA 2Q4ZA 2V77A 2XPNA 1QSMA 4A32A 2GIVA 3CPAA 4C9RA 5F1YA 5DWMA 3MN8A 4CAFA 2YGWA 4KOUA 4XPDB 2CNMA 3FB3A 3IGRA 4KUBA 2B4DB 1TKHA 3EZBA 2UV8G 3H8GA 4CS0B 3KRVA 1V6CA 3FX6A 4K30A 4KORA 4M3SA 2ZOFA 4NGSA 2O4HA 5AG4A 4ZX8A 5IX3A 2PCNA 2RC4A 3BUNB 1YVOA 2Q7BA 1L0CA 4OIDA 4KOTA 4MHYA 4UIAA 2ZEFA 2Q04A 2GREA 3JVNA 1Z4RA 3PGPA 4K3NA 4BMHA 4XNHB 1BO4A 2EBJA 4HNXB 5F5XA 5JGFA 5CPAA 1VHEA 4GXHA 4FWUA
chains in the Genus database with same CATH topology
1Z8LA 2NYQA 2RFHA 3JRUA 3NA6A 3ISZA 4O23A 3D68A 3PRTA 2QJ8A 4ZY1A 5D8NA 4F8ZA 4C8FA 2PCUA 2CTCA 2GP4A 4UIBA 4OMEA 1LANA 2Q43A 4CPAA 1Y0YA 4RUHA 2JBKA 4DJLA 2PJ1A 2WZNA 3RAMA 3KGQA 4PXDA 2CTBA 1CPSA 3NFZA 4MCSA 4JYWA 2IMOA 1XJOA 2ZEHA 1YSJA 1QQ9A 3PEIA 3D4UA 2PJ4A 4ZX9A 3S9NA 4PPZA 2GLFA 4UF4A 3RBUA 2PJ9A 1Z5RA 2PJBA 4GM5A 2AFSA 2V8HA 4Q7AA 3TC8A 2C1CA 3S9MA 3PBEA 4C8UA 4NGPA 4EFDA 4A39A 3FECA 1R3NA 5DS0A 1ELLP 3NH8A 2NSMA 3B3WA 4F9VA 3DLJA 1HDQA 1XMBA 3PB6X 1CBXA 3I74A 4UEFA 1HEEA 3VTAA 4OP4A 2PJ0A 1LAMA 3B2YA 3B35A 4TNUA 2PRQA 1AMPA 3L2NA 5JGFA 3SI2A 4FAIA 5LYIA 3I1UA 5JM6A 1Z2LA 4OC1A 4MMOA 2AFWA 4C84A 4WWVA 1CP6A 4JZ0A 1LCPA 3IJ3A 2QYVA 1M4LA 4OIWA 6CPAA 3SI1A 4YWYA 2V8DA 4MHNA 3D7HA 3QNVA 2AFOA 2PJCA 2AFZA 2PJ2A 4X2TA 2I3CA 3CT9A 4C85A 2CF4A 3D7GA 3SJEA 1HDUA 1IY7A 4P44A 1TF8A 3CDXA 1Y7EA 4TWEA 3WC6A 5THWA 1F2OA 1EE3P 4B6ZA 4C8TA 5HXDA 4IAVA 1XF1A 2IJZA 3BI0A 1OBRA 1F57A 4AXVA 4P4BA 3S9LA 4NJQA 4EWTA 2ANPA 3FJUA 1XBUA 2QVPA 4MCRA 3KQZA 3GLJA 5D29A 2PJ7A 2C6CA 2RB7A 2CIJA 4X8IA 1QMUA 1YMEA 4OC4A 2EK9A 1CG2A 1BLLE 4UEEA 2ZEGA 4R7MA 4PXCA 1VGYA 2OR4A 3WC5A 2C6GA 4LQGA 4P4IA 3IFEA 5LYFA 1CX8A 1TF9A 2BCOA 1ELMP 1ZG9A 2IQ6A 3PBBA 3ICUA 1JQGA 3D66A 5IR2A 3FEEA 4H2KA 4MHZA 2O53A 3KASA 3V38A 2PVWA 2ZEOA 2ZEPA 4P4EA 2AFUA 3KQXA 1LOKA 4ZY0A 2ZOGA 2PJAA 4OC3A 4IK2A 3PB9X 1ZG7A 3I6SA 2PJ8A 3BI1A 4MRIA 3WABA 4NGRA 3FMCA 1TKJA 3IEHA 3VATA 5K8NA 3BHXA 3NH5A 3D7DA 3PB4X 2EWBA 5JH9A 3K9TA 1NSAA 3H8FA 3RZAA 2ABZA 7CPAA 1PYTB 4A94A 2GU2A 4KSIA 4NFRA 1UWYA 1XRYA 5K8OA 5K8PA 2PJ5A 5HVHA 3LMSA 8CPAA 3B7IA 1YW6A 4A37A 1PCAA 4ONWA 2AFMA 4WJBA 4R6TA 2POKA 3ISXA 4NGTA 4NJRA 3GUXA 3HUVA 1VHOA 3WC7A 5J1QA 4CDKA 4BD9A 4Z65A 3FH4A 4YU9A 1R43A 4MCPA 4MXUA 5I4MA 3KHXA 1CPXA 1LAPA 1VIXA 1AYEA 4P10A 4F9UA 2FVGA 4G1PA 4MHPA 4R8FA 2BO9A 1RTQA 2DEAA 2WYRA 3B3CA 4W9YA 1TKFA 2F7VA 3IO1A 3T8WA 2XEIA 2JEWA 2VL1A 1H8LA 5LRGA 5HVGA 4DYOA 3IC1A 2C5QA 2J9AA 3D7FA 2PJ3A 3CPXA 3NH4A 4C9UA 3HLPA 2GLJA 2G9DA 3H8EA 3SI0A 4FBEA 5CBMA 4P4DA 3KR5A 2PJ6A 1ARLA 4P4FA 2HB6A 1CP7A 2AFXA 5LYDA 4TJXA 4NGNA 3D67A 4MCQA 4C99A 3N5FA 4PXBA 2V8VA 2XEFA 1KWMA 4C86A 3EIFA 4P45A 3DGVA 1Y9ZA 1FNOA 4X3RA 4IHMA 1BPNA 3KL9A 1XFOA 2F8HA 1YW4A 2C6PA 5F09A 3B3TA 3VH9A 5HVFA 4ZI6A 2EK8A 3KI9A 3V7ZA 1BPMA 3PB7X 4YN3A 2HC9A 1BAVA 3SJGA 4C8AA 4OKOA 4OC2A 3KR4A 3SJXA 1YLOA 5ELYA 1LFWA 1TXRA 5K8MA 1FT7A 3FF3A 2JBJA 1ZLIA 2OOTA 2Q51A 3B3VA 4A38A 1Y0RA 3FVLA 2ZEMA 2PIYA 3IIBA 2PE3A 1Q7LA 2XEGA 5IB9A 1ZG8A 3FEDA 2XEJA 4R76A 3MRUA 4P6YA 4CDJA 4PQAA 1ARMA 3BXMA 4NGQA 3SJFA 2ZEDA 1F2PA 5LRKA 2ZEEA 4TJVA 3VARA 4C9VA 2PIZA 3TX8A 1IGBA 3K2KA 1GYTA 4DUKA 3PB8X 3PFEA 4P4JA 3KHZA 4OC0A 1DTDA 2BOAA 4ZYQA 4EMEA 3GB0A 4PXEA 3WT4A 4C9EA 2V8GA 4C8CA 5LYLA 1DE4C 3KZWA 4C8PA 2PVVA 2ZENA 4NGMA 3PFOA 3B3SA 3LWUA 4ZY2A 2ZELA 4KNGE 4FUUA 4C9AA 4UEZA 4OC5A 1ZLHA 5LRJA 1WVMA 3IWWA 2Q4ZA 2V77A 3CPAA 4C9RA 3MN8A 1TKHA 3H8GA 1V6CA 3FX6A 2ZOFA 4NGSA 2O4HA 4ZX8A 4OIDA 4MHYA 4UIAA 2ZEFA 2GREA 4K3NA 5CPAA 1VHEA 4FWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z8L A;  2NYQ A;  2RFH A;  3JRU A;  3NA6 A;  3ISZ A;  4O23 A;  3D68 A;  3PRT A;  2QJ8 A;  4ZY1 A;  5D8N A;  4F8Z A;  4C8F A;  2PCU A;  2CTC A;  4UIB A;  4OME A;  1LAN A;  2Q43 A;  4CPA A;  1Y0Y A;  4RUH A;  2JBK A;  4DJL A;  2PJ1 A;  2WZN A;  3RAM A;  3KGQ A;  4PXD A;  2CTB A;  1CPS A;  3NFZ A;  4MCS A;  4JYW A;  2IMO A;  1XJO A;  2ZEH A;  1YSJ A;  1QQ9 A;  3PEI A;  3D4U A;  2PJ4 A;  4ZX9 A;  3S9N A;  4PPZ A;  2GLF A;  4UF4 A;  3RBU A;  2PJ9 A;  1Z5R A;  2PJB A;  4GM5 A;  2AFS A;  2V8H A;  4Q7A A;  3TC8 A;  2C1C A;  3S9M A;  3PBE A;  4C8U A;  4NGP A;  4EFD A;  4A39 A;  3FEC A;  1R3N A;  5DS0 A;  1ELL P;  3NH8 A;  2NSM A;  3B3W A;  4F9V A;  3DLJ A;  1HDQ A;  1XMB A;  3PB6 X;  1CBX A;  3I74 A;  4UEF A;  1HEE A;  3VTA A;  4OP4 A;  2PJ0 A;  1LAM A;  3B2Y A;  3B35 A;  4TNU A;  2PRQ A;  1AMP A;  3L2N A;  5JGF A;  3SI2 A;  4FAI A;  5LYI A;  3I1U A;  5JM6 A;  1Z2L A;  4OC1 A;  4MMO A;  2AFW A;  4C84 A;  4WWV A;  1CP6 A;  4JZ0 A;  1LCP A;  3IJ3 A;  2QYV A;  1M4L A;  4OIW A;  6CPA A;  3SI1 A;  4YWY A;  2V8D A;  4MHN A;  3D7H A;  3QNV A;  2AFO A;  2PJC A;  2AFZ A;  2PJ2 A;  4X2T A;  2I3C A;  3CT9 A;  4C85 A;  2CF4 A;  3D7G A;  3SJE A;  1HDU A;  1IY7 A;  4P44 A;  1TF8 A;  3CDX A;  1Y7E A;  4TWE A;  3WC6 A;  5THW A;  1F2O A;  1EE3 P;  4B6Z A;  4C8T A;  5HXD A;  4IAV A;  1XF1 A;  2IJZ A;  3BI0 A;  1OBR A;  1F57 A;  4AXV A;  4P4B A;  3S9L A;  4NJQ A;  4EWT A;  2ANP A;  3FJU A;  1XBU A;  2QVP A;  4MCR A;  3KQZ A;  3GLJ A;  5D29 A;  2PJ7 A;  2C6C A;  2RB7 A;  2CIJ A;  4X8I A;  1QMU A;  1YME A;  4OC4 A;  2EK9 A;  1CG2 A;  1BLL E;  4UEE A;  2ZEG A;  4R7M A;  4PXC A;  1VGY A;  2OR4 A;  3WC5 A;  2C6G A;  4LQG A;  4P4I A;  3IFE A;  5LYF A;  1CX8 A;  1TF9 A;  2BCO A;  1ELM P;  1ZG9 A;  2IQ6 A;  3PBB A;  3ICU A;  1JQG A;  3D66 A;  3FEE A;  4H2K A;  4MHZ A;  2O53 A;  3KAS A;  3V38 A;  2PVW A;  2ZEO A;  2ZEP A;  4P4E A;  2AFU A;  3KQX A;  1LOK A;  4ZY0 A;  2ZOG A;  2PJA A;  4OC3 A;  4IK2 A;  3PB9 X;  1ZG7 A;  3I6S A;  2PJ8 A;  3BI1 A;  4MRI A;  3WAB A;  4NGR A;  3FMC A;  1TKJ A;  3IEH A;  3VAT A;  5K8N A;  3BHX A;  3NH5 A;  3D7D A;  3PB4 X;  2EWB A;  5JH9 A;  3K9T A;  1NSA A;  3H8F A;  3RZA A;  2ABZ A;  7CPA A;  1PYT B;  4A94 A;  2GU2 A;  4KSI A;  4NFR A;  1UWY A;  1XRY A;  5K8O A;  5K8P A;  2PJ5 A;  5HVH A;  3LMS A;  8CPA A;  3B7I A;  1YW6 A;  4A37 A;  1PCA A;  4ONW A;  2AFM A;  4WJB A;  4R6T A;  2POK A;  3ISX A;  4NGT A;  4NJR A;  3GUX A;  3HUV A;  1VHO A;  3WC7 A;  5J1Q A;  4CDK A;  4BD9 A;  4Z65 A;  3FH4 A;  4YU9 A;  1R43 A;  4MCP A;  4MXU A;  5I4M A;  3KHX A;  1CPX A;  1LAP A;  1VIX A;  1AYE A;  4P10 A;  4F9U A;  2FVG A;  4G1P A;  4MHP A;  4R8F A;  2BO9 A;  1RTQ A;  2DEA A;  2WYR A;  3B3C A;  4W9Y A;  1TKF A;  2F7V A;  3IO1 A;  3T8W A;  2XEI A;  2JEW A;  2VL1 A;  1H8L A;  5LRG A;  5HVG A;  4DYO A;  3IC1 A;  2J9A A;  3D7F A;  2PJ3 A;  3CPX A;  3NH4 A;  4C9U A;  3HLP A;  2GLJ A;  2G9D A;  3H8E A;  3SI0 A;  4FBE A;  5CBM A;  4P4D A;  3KR5 A;  2PJ6 A;  1ARL A;  4P4F A;  2HB6 A;  1CP7 A;  2AFX A;  5LYD A;  4TJX A;  4NGN A;  3D67 A;  4MCQ A;  4C99 A;  3N5F A;  4PXB A;  2V8V A;  2XEF A;  1KWM A;  4C86 A;  3EIF A;  4P45 A;  3DGV A;  1Y9Z A;  1FNO A;  4X3R A;  4IHM A;  1BPN A;  3KL9 A;  1XFO A;  2F8H A;  1YW4 A;  2C6P A;  5F09 A;  3B3T A;  3VH9 A;  5HVF A;  4ZI6 A;  2EK8 A;  3KI9 A;  3V7Z A;  1BPM A;  3PB7 X;  4YN3 A;  2HC9 A;  1BAV A;  3SJG A;  4C8A A;  4OKO A;  4OC2 A;  3KR4 A;  3SJX A;  1YLO A;  5ELY A;  1LFW A;  1TXR A;  5K8M A;  1FT7 A;  3FF3 A;  2JBJ A;  1ZLI A;  2OOT A;  2Q51 A;  3B3V A;  4A38 A;  1Y0R A;  3FVL A;  2ZEM A;  2PIY A;  3IIB A;  2PE3 A;  1Q7L A;  2XEG A;  5IB9 A;  1ZG8 A;  3FED A;  2XEJ A;  4R76 A;  3MRU A;  4P6Y A;  4CDJ A;  4PQA A;  1ARM A;  3BXM A;  4NGQ A;  3SJF A;  2ZED A;  1F2P A;  5LRK A;  2ZEE A;  4TJV A;  3VAR A;  4C9V A;  2PIZ A;  3TX8 A;  1IGB A;  3K2K A;  1GYT A;  4DUK A;  3PB8 X;  3PFE A;  4P4J A;  3KHZ A;  4OC0 A;  1DTD A;  2BOA A;  4ZYQ A;  4EME A;  3GB0 A;  4PXE A;  3WT4 A;  4C9E A;  2V8G A;  4C8C A;  5LYL A;  1DE4 C;  3KZW A;  4C8P A;  2PVV A;  2ZEN A;  4NGM A;  3PFO A;  3B3S A;  3LWU A;  4ZY2 A;  2ZEL A;  4KNG E;  4FUU A;  4C9A A;  4UEZ A;  4OC5 A;  1ZLH A;  5LRJ A;  1WVM A;  3IWW A;  2Q4Z A;  2V77 A;  3CPA A;  4C9R A;  3MN8 A;  1TKH A;  3H8G A;  1V6C A;  3FX6 A;  2ZOF A;  4NGS A;  2O4H A;  4ZX8 A;  4OID A;  4MHY A;  4UIA A;  2ZEF A;  2GRE A;  4K3N A;  5CPA A;  1VHE A;  4FWU A; 
#chains in the Genus database with same CATH topology
 1Z8L A;  4HNY B;  2VXK A;  3TLY A;  1M4I A;  2NYQ A;  2RFH A;  4OAE A;  4AB7 A;  3GYA A;  5G20 A;  3VRP A;  3DDD A;  1T36 B;  2VBQ A;  3JRU A;  3OP0 A;  3PLF B;  4UCN A;  3NA6 A;  3ISZ A;  2DF5 A;  4O23 A;  3D68 A;  3PRT A;  2QJ8 A;  4J0N A;  2Y1N A;  2WPW A;  5D8N A;  4F8Z A;  4ZY1 A;  4R87 A;  3OWC A;  1YR0 A;  3CXP A;  3NE7 A;  1MJA A;  4Y49 C;  2PCU A;  4C8F A;  2CTC A;  2I79 A;  2GP4 A;  4UIB A;  2GFQ A;  1EO0 A;  2FXF A;  3HPH E;  4OME A;  1LAN A;  4JJX A;  2Q43 A;  3FXT A;  4UBR A;  4UCM A;  3QB8 A;  2D0P A;  1GHE A;  1YLE A;  4CPA A;  3LOD A;  5E96 A;  4R9M A;  4B11 A;  1Y0Y A;  4RUH A;  2JBK A;  1CM0 A;  1FBV A;  1QST A;  2PRB A;  2VI7 A;  3R96 A;  4DJL A;  5HMN A;  5F46 A;  1CE8 B;  2PJ1 A;  2OZG A;  4CGP A;  5EMI A;  4H6U A;  4ZBG A;  3R9E A;  4IIY A;  2WZN A;  3RAM A;  4FD7 A;  4AG9 A;  4B5O A;  4GPL B;  3KGQ A;  4A2Z A;  4CZ1 A;  1B47 A;  2HQY A;  4II9 A;  4PXD A;  4Q38 A;  3TOB A;  2CTB A;  1CPS A;  3NFZ A;  4MCS A;  3FRM A;  4JYW A;  4YGO A;  2IMO A;  2B0A A;  2O28 A;  2Q4Y A;  1XJO A;  2CBL A;  5I0C A;  1SQH A;  2ZEH A;  4BPU B;  5AG6 A;  5FD8 A;  1YSJ A;  3TLG A;  1QQ9 A;  4OAD A;  3PEI A;  4CYO A;  2GE3 A;  2JLM A;  3D4U A;  1Z9U A;  2D4O A;  2PJ4 A;  4XPD C;  4M6I A;  4ZX9 A;  4CGN A;  2R8V A;  3S9N A;  1Z8W A;  4PPZ A;  2GLF A;  5JQ4 A;  4UF4 A;  4AG7 A;  3RBU A;  5GCN A;  4A4B A;  2PJ9 A;  1Z5R A;  2PJB A;  4AVB A;  2X7B A;  1NMT A;  4JXQ A;  2CNT A;  4GM5 A;  3BUW B;  4FD4 A;  4MFK A;  2AFS A;  4A31 A;  2V8H A;  5FVJ A;  4Q7A A;  2VKZ G;  3TC8 A;  1KUY A;  1GGO A;  3R1K A;  2C1C A;  3C26 A;  3E0K A;  3S9M A;  3PBE A;  2Z3N A;  4C8U A;  3OB1 B;  4NGP A;  1IID A;  1N71 A;  3CZX A;  4FD5 A;  4EFD A;  4A39 A;  3FEC A;  1P4N A;  1R3N A;  3BUM B;  3HMJ G;  5DS0 A;  1ELL P;  4F0Y A;  1C3O B;  4J3G A;  1S7F A;  3NH8 A;  4A33 A;  2NSM A;  3B3W A;  2H5M A;  1NE9 A;  2JDD A;  4PSX A;  4F9V A;  5KTC A;  3DLJ A;  1HDQ A;  1XMB A;  4RR2 B;  3PB6 X;  1CBX A;  3BUX B;  1S3Z A;  4KOV A;  3RNZ A;  3I74 A;  2DXQ A;  4M6G A;  3TLG B;  1EZA A;  2CXA A;  4UEF A;  4KOS A;  1NSL A;  2PR8 A;  1HEE A;  3G8W A;  3VTA A;  2ZW5 A;  4ONU A;  4UWJ A;  1Z4E A;  3PP9 A;  4KVX A;  4OP4 A;  2PJ0 A;  1S5K A;  3S6H A;  1LAM A;  2B58 A;  3B2Y A;  3B35 A;  4KSA A;  2PRQ A;  1AMP A;  3L2N A;  3MGD A;  3D3S A;  4TNU A;  3SI2 A;  4FAI A;  5LYI A;  1ZL0 A;  2OLS A;  3I1U A;  3D8P A;  5JM6 A;  1Z9E A;  1Z2L A;  2N3A B;  2Z3O A;  3BUO B;  4OC1 A;  3FNC A;  4R3K A;  1A9X B;  5C88 A;  4MMO A;  4CAE A;  2YNE A;  2AFW A;  3VRO A;  4U9Z A;  1ON0 A;  3IWE A;  4HNW B;  3W6X A;  4YRH A;  4C84 A;  3ZJ0 A;  4MI1 A;  4MFL A;  4WWV A;  4CYQ A;  4COG A;  1CP6 A;  4JZ0 A;  4E2A A;  1LCP A;  1M4D A;  2QYV A;  3VRN A;  1M4L A;  3IJ3 A;  4OIW A;  3SI1 A;  6CPA A;  1TIQ A;  4YWY A;  2V8D A;  4NEX A;  4L8A A;  2YNC A;  3EZA A;  4MHN A;  3D7H A;  3QNV A;  2AFO A;  2PJC A;  1C30 B;  2AFZ A;  2PJ2 A;  4X2T A;  2I3C A;  3CT9 A;  1J3L A;  4C85 A;  4HKF A;  2CF4 A;  2P0W A;  4LX9 A;  3D7G A;  3SJE A;  1HDU A;  4C2X A;  1IY7 A;  4P44 A;  3B8G A;  1TF8 A;  4B5P A;  3CDX A;  1Y7E A;  4TWE A;  2B3V A;  4NXY A;  3S6F A;  3VWE A;  5F49 A;  5THW A;  3WC6 A;  1R61 A;  1F2O A;  1EE3 P;  4FD6 A;  4B6Z A;  4MFP A;  3T05 A;  2BUE A;  2FIA A;  2P6E A;  1PUA A;  4C8T A;  5HXD A;  4IAV A;  4MJ8 A;  1XF1 A;  3K9U A;  4MFQ A;  4KOX A;  2IJZ A;  2Q7S A;  3BI0 A;  3VGO A;  3BJ7 A;  5F47 A;  3ZZI A;  3TFY A;  1IYK A;  2D0O A;  1OBR A;  1F57 A;  3GIU A;  4P4B A;  1IOI A;  3S9L A;  4NJQ A;  4AXV A;  4TJV A;  3QAH A;  4EWT A;  2ANP A;  4MJX A;  3OAK A;  3TOA A;  3FJU A;  3CXQ A;  4E0A A;  1XBU A;  2DLA A;  3OB2 B;  4MY3 A;  4H6Z A;  1I21 A;  2QVP A;  3S6G A;  4MCR A;  2Z11 A;  3KQZ A;  1S7L A;  1CJW A;  4C68 A;  2G3T A;  3GLJ A;  3SR3 A;  5D29 A;  1KC7 A;  2PJ7 A;  2C6C A;  2RB7 A;  2CIJ A;  3FIX A;  3PT1 A;  1KZF A;  1QMU A;  1YME A;  4X8I A;  5H84 A;  4Q36 A;  2YJT A;  4OC4 A;  2EK9 A;  1CG2 A;  2C27 A;  4IUS A;  1BLL E;  4KOY A;  1FY7 A;  4UEE A;  4IIX A;  2ZEG A;  4R7M A;  1Q5X A;  4PXC A;  4NCZ A;  4KVM E;  5HKZ A;  4B5P B;  4CGM A;  1VGY A;  2OR4 A;  3WC5 A;  2C6G A;  4LQG A;  3O8Z A;  4P4I A;  2FL4 A;  3K4I A;  1KUV A;  3IFE A;  2GAN A;  5LYF A;  2REE A;  1Q2C A;  2XPO A;  2HV2 A;  4NSQ A;  1S7K A;  1Q2Y A;  1CX8 A;  3T07 A;  1TF9 A;  1OZP A;  2BCO A;  5JYB A;  1ELM P;  1ZG9 A;  4QBJ A;  2IQ6 A;  4A30 A;  3PBB A;  1IYL A;  3A9L A;  3F8K A;  3ICU A;  1JQG A;  1YGH A;  3V8I A;  3D66 A;  5IR2 A;  3FEE A;  1ZRS A;  3U1B A;  2QML A;  4H2K A;  4MHZ A;  2O53 A;  3KAS A;  2YND A;  1I1D A;  3DSB A;  3V38 A;  2PVW A;  1BOB A;  2EO8 A;  1KEE B;  3TLC A;  1ZO0 A;  2ZEO A;  2ZEP A;  4P4E A;  5F13 A;  2AFU A;  2R7H A;  3NE8 A;  4MFJ A;  3P2F A;  3LD2 A;  3HPG G;  1M6V B;  3KQX A;  2X0S A;  1LOK A;  4ZY0 A;  2XPL A;  2ZOG A;  2PJA A;  4OC3 A;  4IK2 A;  3PB9 X;  1ZG7 A;  1MJB A;  3VRR A;  3BI1 A;  2PJ8 A;  3I6S A;  3TT2 A;  1Z8X A;  3T90 A;  2KCW A;  4BBH A;  3EZE A;  4MRI A;  3WAB A;  5JVL A;  2R98 A;  4NGR A;  1VI4 A;  3FMC A;  3QAY A;  4RN7 A;  1TKJ A;  2PR1 A;  3IEH A;  2FM4 A;  4KVO E;  3VAT A;  3SXN A;  3IWG A;  5K8N A;  3BHX A;  5AXI A;  4BPW B;  3DR8 A;  3JUW A;  3NH5 A;  3D7D A;  3PB4 X;  4E94 A;  2EUI A;  2EWB A;  5JH9 A;  3DNS A;  3K9T A;  1NSA A;  1WK4 A;  3H8F A;  3RZA A;  3TO9 A;  3NOJ A;  2ABZ A;  7CPA A;  3TLZ A;  4B12 A;  1PYT B;  4A94 A;  1NBW A;  3U88 C;  4GS4 A;  2GU2 A;  4KSI A;  4NFR A;  1UWY A;  1XRY A;  3I3G A;  2CY2 A;  3R9F A;  3T9Y A;  4F0X A;  5K8O A;  5EC4 A;  3RO0 A;  2PJ5 A;  5HVH A;  2WSA A;  4R57 A;  4XPL A;  3PZJ A;  3R95 A;  3VWD A;  4JVO A;  1J4J A;  4PV6 A;  3LMS A;  8CPA A;  4M6H A;  1JDE A;  1MK4 A;  3B7I A;  1YW6 A;  4A37 A;  1PCA A;  4ONW A;  1JWQ A;  2AFM A;  2VEZ A;  1VBG A;  2E28 A;  4WJB A;  4R6T A;  2POK A;  3ISX A;  4NGT A;  4NJR A;  2Z3P A;  2VZZ A;  3GY9 A;  4KOW A;  4B13 A;  2ARH A;  4CAW A;  3GUX A;  3HUV A;  1VHO A;  4QC6 A;  3WC7 A;  1KUX A;  4CAX A;  5J1Q A;  2YJV A;  4BD9 A;  3P2H A;  4CDK A;  5IV0 A;  4BIN A;  4Z65 A;  5J8C A;  2Y0M A;  3FH4 A;  4YU9 A;  3KKW A;  1R43 A;  4MCP A;  1DIK A;  4MXU A;  3RYO A;  5I4M A;  1M44 A;  2P6G A;  5HKY A;  3GKR A;  3KHX A;  4C9V A;  3BLN A;  4BPX B;  1I12 A;  2Z3L A;  3T0T A;  3TLA A;  1CPX A;  1LAP A;  1VKC A;  1VIX A;  2EZC A;  1AYE A;  2AJ6 A;  3IU1 A;  2Z3K A;  3G23 A;  4UCP A;  4AVA A;  5F9M A;  2B4D A;  3LAC A;  4CO9 A;  5EBV A;  2ZW6 A;  1NXJ A;  2ATR A;  1R57 A;  3PFV A;  2HUZ A;  4P10 A;  4QUS A;  1CS0 B;  1EZB A;  2Q0Y A;  3TCV A;  4F9U A;  3FBU A;  3TYX A;  2ODF A;  2FVG A;  4G1P A;  5JPH A;  2EZA A;  2XPP A;  4MHP A;  4R8F A;  2BO9 A;  4PK2 A;  1IU8 A;  4RS2 A;  1RTQ A;  2DEA A;  2WYR A;  3B3C A;  4W9Y A;  3TO6 A;  1Y9K A;  1TKF A;  2R1I A;  4KSF A;  2F7V A;  3IO1 A;  5F48 A;  4EVY A;  2B5G A;  4A4C A;  2WUU A;  3T8W A;  3TLE A;  2XEI A;  4COB A;  5HKW A;  1XF8 A;  2J8N A;  2JEW A;  2QIR A;  2PC1 A;  2VL1 A;  5IB0 A;  1H8L A;  1P0H A;  4C2Y A;  1XIX A;  5LRG A;  5G1Z A;  4MBU A;  4MFZ A;  1VBH A;  1M1D A;  5HVG A;  4DYO A;  5AG7 A;  1B6B A;  3IC1 A;  2C5Q A;  2G0B A;  2J9A A;  2FCK A;  4UWI A;  3D7F A;  4JXR A;  2F5I A;  3EXN A;  2OB0 A;  2PJ3 A;  3CPX A;  3NH4 A;  4KZT A;  2HRO A;  3F0A A;  1V0C A;  2HWG A;  3T5M A;  4C9U A;  4AVC A;  4LUA A;  5AG5 A;  3SXO A;  2DPT A;  3G3S A;  3HLP A;  5K99 A;  3VRQ A;  2IL4 A;  2D4P A;  1Y9W A;  2FT0 A;  3BJ8 A;  2GLJ A;  1YX0 A;  2G9D A;  3N7Z A;  4CRY B;  3H8E A;  2VZY A;  3SI0 A;  1JDB C;  4UFX A;  4MHD A;  4FBE A;  5KTA A;  2B4B A;  2PDO A;  4I49 A;  4KLV A;  4MY0 A;  5CBM A;  4P4D A;  3KR5 A;  4M8D A;  2PJ6 A;  1ARL A;  2B5G B;  4P4F A;  1BXR B;  2HB6 A;  1VHS A;  1M4G A;  3EO4 A;  4PK3 A;  4DNC A;  2DIK A;  1CP7 A;  2AFX A;  5LYD A;  1X12 A;  3F5B A;  4E5S A;  3SHP A;  2BSW A;  2ZXV A;  2G3A A;  2A4N A;  3H4Q A;  4LQ6 A;  2Z0Z A;  3TO7 A;  4NGN A;  4TJX A;  3TLB A;  3D67 A;  1Z8T A;  4MCQ A;  2ZW4 A;  4C99 A;  2ZPA A;  5KTD A;  3IU2 A;  4C7H A;  4CYP A;  3N5F A;  1ZYM A;  4PXB A;  4UA3 A;  1S7N A;  2V8V A;  4OLL A;  1XOV A;  4QB9 A;  2XEF A;  1IB1 E;  5BY0 A;  2AE6 A;  1KWM A;  4C86 A;  2PQ8 A;  4X5K A;  4YFJ A;  3EIF A;  2Q44 A;  4P45 A;  4EYS A;  3DGV A;  2FIW A;  1Y9Z A;  1IOF A;  1FNO A;  1XEB A;  4X3R A;  2J8R A;  4JD6 A;  4IHM A;  1BPN A;  3KL9 A;  2R82 A;  1XFO A;  1QSR A;  1XMT A;  2F8H A;  1YW4 A;  2C6P A;  5F09 A;  5DWN A;  1YQE A;  5H86 A;  4M85 A;  4R3L A;  2J8M A;  3CXS A;  1X10 A;  3B3T A;  5HVF A;  3VH9 A;  2EZB A;  2AUM A;  4ZI6 A;  1WJT A;  5HH1 A;  2EK8 A;  2Y1M A;  3KI9 A;  3I9S A;  2BEI A;  1BPM A;  4MI4 A;  3V7Z A;  3R9G A;  4CRZ B;  4NF1 A;  3PB7 X;  4YN3 A;  2HC9 A;  4KUA A;  1BAV A;  3SJG A;  5CNP A;  2FE7 A;  4C2Z A;  1Y7R A;  4C8A A;  5K8P A;  3S6K A;  2DPS A;  4F6A A;  4OKO A;  4OC2 A;  4CGO A;  2FSR A;  3D2M A;  5BWA B;  1QSN A;  4HPS A;  1LRZ A;  3KR4 A;  2ZW7 A;  4L89 A;  3SJX A;  1K4J A;  2JEV A;  1YLO A;  4CAV A;  5G22 A;  5ELY A;  1LFW A;  1TXR A;  5K8M A;  1FT7 A;  2Z10 A;  4KLW A;  3GJZ A;  3FF3 A;  2JBJ A;  1ZLI A;  2YNC C;  4RI1 A;  2OOT A;  2P6F A;  2Q51 A;  1YVH A;  3B3V A;  4JWP A;  1Y0R A;  3D2P A;  4A38 A;  3FVL A;  4B10 A;  2ZEM A;  2PIY A;  3H5Z A;  2PE3 A;  2CNS A;  2OZH A;  3IIB A;  4IF5 A;  1Q7L A;  2XEG A;  3ZNI A;  1PU9 A;  4H89 A;  4PSW A;  5IB9 A;  1ZG8 A;  4XNH C;  1B87 A;  3W6S A;  2B3U A;  4BTF A;  3FED A;  2MP0 A;  3JTK A;  3TTH A;  3W91 A;  2XEJ A;  1Q2D A;  2I00 A;  4R76 A;  1U6M A;  4CYN A;  2QEC A;  3MRU A;  4P6Y A;  4A95 A;  1KBL A;  2K5T A;  3FYN A;  4CDJ A;  2BL1 A;  2OZU A;  2VQY A;  4PQA A;  4ZGY B;  1ARM A;  2JDC A;  4E8O A;  3BXM A;  4NGQ A;  4B14 A;  2AUN A;  3SJF A;  2B4J C;  1F2P A;  2ZED A;  1YVK A;  2ZEE A;  5AGE A;  3VAR A;  2OU2 A;  5LRK A;  2PIZ A;  2WPX A;  1IGB A;  3K2K A;  1GYT A;  3TX8 A;  4DUK A;  2EVN A;  3PB8 X;  3PFE A;  4XPK A;  4C7I A;  4P4J A;  5J3X A;  4JLY A;  3KHZ A;  1QSO A;  4UFW A;  3TE4 A;  4OC0 A;  5A27 A;  4Y49 B;  3DR6 A;  4INJ A;  2OH1 A;  1DTD A;  2BOA A;  2Q4V A;  5G21 A;  2Z3M A;  4ZYQ A;  1UFH A;  2FS5 A;  4EME A;  1A2Z A;  3GB0 A;  3C8O A;  4PXE A;  3EFA A;  3EC4 A;  4UFV A;  3WT4 A;  4C9E A;  2V8G A;  1YK3 A;  4C8C A;  4U9Y A;  1RXT A;  4ORF A;  4QVT A;  3EY5 A;  4CGL A;  1DE4 C;  5LYL A;  4KS9 A;  3F9K C;  3NFQ A;  4U5Y A;  3KZW A;  2REF A;  1IIC A;  2NMT A;  4C8P A;  1AUG A;  2PVV A;  1XE4 A;  2ZEN A;  4H1H A;  1RO5 A;  4NGM A;  3PFO A;  3UY5 A;  5J8F A;  5A28 A;  3B3S A;  5C82 A;  3LWU A;  2PSW A;  1WWZ A;  4ZY2 A;  2ZEL A;  1S60 A;  4FUU A;  4KNG E;  5ISV A;  4UEZ A;  3WR7 A;  4C9A A;  4OC5 A;  1ZLH A;  5LRJ A;  1WVM A;  3IWW A;  1MJ9 A;  2HI6 A;  1YRE A;  2Q4Z A;  2V77 A;  2XPN A;  1QSM A;  4A32 A;  2GIV A;  3CPA A;  4C9R A;  5F1Y A;  5DWM A;  3MN8 A;  4CAF A;  2YGW A;  4KOU A;  4XPD B;  2CNM A;  3FB3 A;  3IGR A;  4KUB A;  2B4D B;  1TKH A;  3EZB A;  2UV8 G;  3H8G A;  4CS0 B;  3KRV A;  1V6C A;  3FX6 A;  4K30 A;  4KOR A;  4M3S A;  2ZOF A;  4NGS A;  2O4H A;  5AG4 A;  4ZX8 A;  5IX3 A;  2PCN A;  2RC4 A;  3BUN B;  1YVO A;  2Q7B A;  1L0C A;  4OID A;  4KOT A;  4MHY A;  4UIA A;  2ZEF A;  2Q04 A;  2GRE A;  3JVN A;  1Z4R A;  3PGP A;  4K3N A;  4BMH A;  4XNH B;  1BO4 A;  2EBJ A;  4HNX B;  5F5X A;  5JGF A;  5CPA A;  1VHE A;  4GXH A;  4FWU A; 
#chains in the Genus database with same CATH homology
 1Z8L A;  2NYQ A;  2RFH A;  3JRU A;  3NA6 A;  3ISZ A;  4O23 A;  3D68 A;  3PRT A;  2QJ8 A;  4ZY1 A;  5D8N A;  4F8Z A;  4C8F A;  2PCU A;  2CTC A;  2GP4 A;  4UIB A;  4OME A;  1LAN A;  2Q43 A;  4CPA A;  1Y0Y A;  4RUH A;  2JBK A;  4DJL A;  2PJ1 A;  2WZN A;  3RAM A;  3KGQ A;  4PXD A;  2CTB A;  1CPS A;  3NFZ A;  4MCS A;  4JYW A;  2IMO A;  1XJO A;  2ZEH A;  1YSJ A;  1QQ9 A;  3PEI A;  3D4U A;  2PJ4 A;  4ZX9 A;  3S9N A;  4PPZ A;  2GLF A;  4UF4 A;  3RBU A;  2PJ9 A;  1Z5R A;  2PJB A;  4GM5 A;  2AFS A;  2V8H A;  4Q7A A;  3TC8 A;  2C1C A;  3S9M A;  3PBE A;  4C8U A;  4NGP A;  4EFD A;  4A39 A;  3FEC A;  1R3N A;  5DS0 A;  1ELL P;  3NH8 A;  2NSM A;  3B3W A;  4F9V A;  3DLJ A;  1HDQ A;  1XMB A;  3PB6 X;  1CBX A;  3I74 A;  4UEF A;  1HEE A;  3VTA A;  4OP4 A;  2PJ0 A;  1LAM A;  3B2Y A;  3B35 A;  4TNU A;  2PRQ A;  1AMP A;  3L2N A;  5JGF A;  3SI2 A;  4FAI A;  5LYI A;  3I1U A;  5JM6 A;  1Z2L A;  4OC1 A;  4MMO A;  2AFW A;  4C84 A;  4WWV A;  1CP6 A;  4JZ0 A;  1LCP A;  3IJ3 A;  2QYV A;  1M4L A;  4OIW A;  6CPA A;  3SI1 A;  4YWY A;  2V8D A;  4MHN A;  3D7H A;  3QNV A;  2AFO A;  2PJC A;  2AFZ A;  2PJ2 A;  4X2T A;  2I3C A;  3CT9 A;  4C85 A;  2CF4 A;  3D7G A;  3SJE A;  1HDU A;  1IY7 A;  4P44 A;  1TF8 A;  3CDX A;  1Y7E A;  4TWE A;  3WC6 A;  5THW A;  1F2O A;  1EE3 P;  4B6Z A;  4C8T A;  5HXD A;  4IAV A;  1XF1 A;  2IJZ A;  3BI0 A;  1OBR A;  1F57 A;  4AXV A;  4P4B A;  3S9L A;  4NJQ A;  4EWT A;  2ANP A;  3FJU A;  1XBU A;  2QVP A;  4MCR A;  3KQZ A;  3GLJ A;  5D29 A;  2PJ7 A;  2C6C A;  2RB7 A;  2CIJ A;  4X8I A;  1QMU A;  1YME A;  4OC4 A;  2EK9 A;  1CG2 A;  1BLL E;  4UEE A;  2ZEG A;  4R7M A;  4PXC A;  1VGY A;  2OR4 A;  3WC5 A;  2C6G A;  4LQG A;  4P4I A;  3IFE A;  5LYF A;  1CX8 A;  1TF9 A;  2BCO A;  1ELM P;  1ZG9 A;  2IQ6 A;  3PBB A;  3ICU A;  1JQG A;  3D66 A;  5IR2 A;  3FEE A;  4H2K A;  4MHZ A;  2O53 A;  3KAS A;  3V38 A;  2PVW A;  2ZEO A;  2ZEP A;  4P4E A;  2AFU A;  3KQX A;  1LOK A;  4ZY0 A;  2ZOG A;  2PJA A;  4OC3 A;  4IK2 A;  3PB9 X;  1ZG7 A;  3I6S A;  2PJ8 A;  3BI1 A;  4MRI A;  3WAB A;  4NGR A;  3FMC A;  1TKJ A;  3IEH A;  3VAT A;  5K8N A;  3BHX A;  3NH5 A;  3D7D A;  3PB4 X;  2EWB A;  5JH9 A;  3K9T A;  1NSA A;  3H8F A;  3RZA A;  2ABZ A;  7CPA A;  1PYT B;  4A94 A;  2GU2 A;  4KSI A;  4NFR A;  1UWY A;  1XRY A;  5K8O A;  5K8P A;  2PJ5 A;  5HVH A;  3LMS A;  8CPA A;  3B7I A;  1YW6 A;  4A37 A;  1PCA A;  4ONW A;  2AFM A;  4WJB A;  4R6T A;  2POK A;  3ISX A;  4NGT A;  4NJR A;  3GUX A;  3HUV A;  1VHO A;  3WC7 A;  5J1Q A;  4CDK A;  4BD9 A;  4Z65 A;  3FH4 A;  4YU9 A;  1R43 A;  4MCP A;  4MXU A;  5I4M A;  3KHX A;  1CPX A;  1LAP A;  1VIX A;  1AYE A;  4P10 A;  4F9U A;  2FVG A;  4G1P A;  4MHP A;  4R8F A;  2BO9 A;  1RTQ A;  2DEA A;  2WYR A;  3B3C A;  4W9Y A;  1TKF A;  2F7V A;  3IO1 A;  3T8W A;  2XEI A;  2JEW A;  2VL1 A;  1H8L A;  5LRG A;  5HVG A;  4DYO A;  3IC1 A;  2C5Q A;  2J9A A;  3D7F A;  2PJ3 A;  3CPX A;  3NH4 A;  4C9U A;  3HLP A;  2GLJ A;  2G9D A;  3H8E A;  3SI0 A;  4FBE A;  5CBM A;  4P4D A;  3KR5 A;  2PJ6 A;  1ARL A;  4P4F A;  2HB6 A;  1CP7 A;  2AFX A;  5LYD A;  4TJX A;  4NGN A;  3D67 A;  4MCQ A;  4C99 A;  3N5F A;  4PXB A;  2V8V A;  2XEF A;  1KWM A;  4C86 A;  3EIF A;  4P45 A;  3DGV A;  1Y9Z A;  1FNO A;  4X3R A;  4IHM A;  1BPN A;  3KL9 A;  1XFO A;  2F8H A;  1YW4 A;  2C6P A;  5F09 A;  3B3T A;  3VH9 A;  5HVF A;  4ZI6 A;  2EK8 A;  3KI9 A;  3V7Z A;  1BPM A;  3PB7 X;  4YN3 A;  2HC9 A;  1BAV A;  3SJG A;  4C8A A;  4OKO A;  4OC2 A;  3KR4 A;  3SJX A;  1YLO A;  5ELY A;  1LFW A;  1TXR A;  5K8M A;  1FT7 A;  3FF3 A;  2JBJ A;  1ZLI A;  2OOT A;  2Q51 A;  3B3V A;  4A38 A;  1Y0R A;  3FVL A;  2ZEM A;  2PIY A;  3IIB A;  2PE3 A;  1Q7L A;  2XEG A;  5IB9 A;  1ZG8 A;  3FED A;  2XEJ A;  4R76 A;  3MRU A;  4P6Y A;  4CDJ A;  4PQA A;  1ARM A;  3BXM A;  4NGQ A;  3SJF A;  2ZED A;  1F2P A;  5LRK A;  2ZEE A;  4TJV A;  3VAR A;  4C9V A;  2PIZ A;  3TX8 A;  1IGB A;  3K2K A;  1GYT A;  4DUK A;  3PB8 X;  3PFE A;  4P4J A;  3KHZ A;  4OC0 A;  1DTD A;  2BOA A;  4ZYQ A;  4EME A;  3GB0 A;  4PXE A;  3WT4 A;  4C9E A;  2V8G A;  4C8C A;  5LYL A;  1DE4 C;  3KZW A;  4C8P A;  2PVV A;  2ZEN A;  4NGM A;  3PFO A;  3B3S A;  3LWU A;  4ZY2 A;  2ZEL A;  4KNG E;  4FUU A;  4C9A A;  4UEZ A;  4OC5 A;  1ZLH A;  5LRJ A;  1WVM A;  3IWW A;  2Q4Z A;  2V77 A;  3CPA A;  4C9R A;  3MN8 A;  1TKH A;  3H8G A;  1V6C A;  3FX6 A;  2ZOF A;  4NGS A;  2O4H A;  4ZX8 A;  4OID A;  4MHY A;  4UIA A;  2ZEF A;  2GRE A;  4K3N A;  5CPA A;  1VHE A;  4FWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...