4MCQA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyldi-gamma-l-glutamic acid (pteroyltri-gamma-l-glutamic acid)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
695
structure length
692
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 268
structure length 692
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcqA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcqA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcqA02
2XEFA 5LRGA 4C8UA 3KGQA 4C9VA 4NGPA 3K2KA 4P4FA 4MRIA 4MCRA 2EK8A 4WJBA 1CG2A 4R6TA 2JBJA 2ABZA 1ARLA 1Y0YA 3WABA 1XRYA 2HB6A 4NGTA 1HDUA 1H8LA 3ISXA 4JZ0A 3MRUA 3SJEA 2F7VA 1WVMA 2JBKA 3ISZA 3DGVA 4ZX8A 3FEEA 4NFRA 3SI0A 4UEEA 1IY7A 2G9DA 3N5FA 2Q43A 3SJGA 4P4DA 5IB9A 3V7ZA 1XBUA 3KASA 2AFWA 3FVLA 1RTQA 1VHEA 4R8FA 2GU2A 4CDJA 4LQGA 1HDQA 3H8EA 2CTBA 3SJXA 1LCPA 3D67A 5CBMA 4OC5A 1F2OA 2XEGA 6CPAA 3D7HA 3D7GA 3FF3A 2AFOA 4P4BA 5K8PA 3GUXA 3H8FA 4OC4A 4TJXA 3D7DA 1AYEA 3IIBA 4OIDA 5D8NA 4X2TA 3WC5A 3CPXA 1ZLIA 4PXDA 1PCAA 3CDXA 4IK2A 5THWA 2OR4A 1TF8A 2WZNA 4PQAA 3WC6A 1VHOA 3VH9A 2WYRA 1Z2LA 1LAMA 3FH4A 3PB7X 2C6PA 2ZEPA 4P4EA 1YSJA 2OOTA 1PYTB 3VATA 2PJ6A 1ARMA 1F2PA 5K8MA 1VGYA 4P6YA 4P4JA 3B3TA 4NGQA 2HC9A 3PB4X 2CF4A 2V77A 2GLFA 1HEEA 2PJ3A 3ICUA 1CX8A 4F9UA 4C9AA 4Q7AA 3RAMA 3PB9X 3D7FA 4DUKA 3SI2A 1GYTA 5LRJA 4C8TA 4UIAA 4A39A 1LAPA 1BLLE 1V6CA 3IC1A 2RB7A 3TX8A 3IJ3A 3D66A 2BO9A 2ZEEA 5HXDA 4C99A 1Z8LA 3FJUA 3KI9A 1CPXA 5HVHA 4MHZA 2BCOA 2VL1A 4WWVA 4FBEA 5LYDA 2IJZA 4AXVA 1M4LA 4P4IA 1R43A 1R3NA 3B3SA 4PXCA 2QYVA 4TNUA 3S9NA 5LYLA 2NSMA 1XMBA 2XEJA 2PRQA 7CPAA 2PJ0A 5D29A 1ZG7A 3NH5A 3PB6X 4PXEA 3S9MA 3SI1A 5LYFA 1XF1A 4MMOA 2PJAA 2RFHA 2XEIA 4OMEA 3IO1A 2PVVA 2V8DA 5LRKA 1YW4A 2I3CA 4FAIA 4P44A 3KR5A 3EIFA 4X8IA 4KSIA 2PJ4A 4MHPA 1Z5RA 4A94A 4MCSA 1QQ9A 3L2NA 1DTDA 3VARA 3I6SA 3V38A 1Y9ZA 2O4HA 4W9YA 2PE3A 4YU9A 1ZG9A 2PJ1A 4ZY1A 2PJ7A 2AFXA 4PXBA 2ZOFA 4OIWA 3B35A 4C8PA 4ZY0A 3CPAA 3FEDA 4NGSA 3RBUA 4K3NA 2C6GA 5HVGA 1TKFA 2PVWA 3LWUA 1Y0RA 1TKHA 4UEZA 1LOKA 4Z65A 4ZX9A 3B2YA 4A37A 1TKJA 1QMUA 4CDKA 3TC8A 1LFWA 4EFDA 1YMEA 2V8GA 1TF9A 3PB8X 3FECA 2V8VA 3WC7A 3PRTA 5I4MA 4TJVA 2ZEGA 4YWYA 4O23A 4P45A 4FWUA 1VIXA 4MHNA 3SJFA 3KQZA 1CPSA 4R76A 3HLPA 3D4UA 4EWTA 4IAVA 4OC3A 5J1QA 2ZOGA 1CP6A 2PJBA 2ZEMA 3DLJA 1ELLP 1CP7A 1XFOA 4BD9A 4YN3A 3LMSA 1LANA 2PJ2A 2ZELA 3NH8A 3RZAA 4ONWA 3S9LA 1TXRA 2GLJA 4OC0A 4F8ZA 4NGNA 3K9TA 3GB0A 4OP4A 1F57A 5ELYA 2JEWA 4EMEA 4C85A 1Q7LA 3I74A 4ZY2A 3MN8A 1UWYA 3BI0A 3PBEA 5HVFA 4OC2A 4RUHA 1BPNA 1XJOA 1EE3P 1YW6A 3IFEA 3BXMA 4C9EA 4TWEA 1OBRA 4ZYQA 5K8NA 4C8FA 4MHYA 3IWWA 5K8OA 5JH9A 4C9UA 3WT4A 3KZWA 4PPZA 4C8AA 1ZLHA 4ZI6A 2ZEFA 3FX6A 4DJLA 4OC1A 4GM5A 3T8WA 2AFMA 2PJCA 2F8HA 3D68A 4H2KA 1ZG8A 4NJRA 1AMPA 3B3CA 3GLJA 2DEAA 1DE4C 4MCQA 1ELMP 2C1CA 4A38A 2PIYA 2ANPA 4C8CA 3BI1A 3B7IA 4NJQA 1YLOA 4UIBA 4KNGE 2NYQA 3B3VA 2PJ9A 5JM6A 3KHZA 3I1UA 3JRUA 3CT9A 3PBBA 2O53A 4C84A 2PJ8A 5LYIA 2Q4ZA 4UEFA 2GREA 3B3WA 4MXUA 3FMCA 5JGFA 4C9RA 3PFEA 3IEHA 2POKA 2ZENA 3KL9A 2EWBA 4NGMA 4NGRA 2ZEHA 2CIJA 2IMOA 3NFZA 2EK9A 2CTCA 3KQXA 2AFUA 2PCUA 1FNOA 4FUUA 3NH4A 4C86A 2AFSA 5DS0A 1NSAA 4R7MA 4F9VA 2PJ5A 4G1PA 4JYWA 4DYOA 4CPAA 1KWMA 4MCPA 1CBXA 3PFOA 3VTAA 2J9AA 3KHXA 2AFZA 4OKOA 3QNVA 4X3RA 3BHXA 2C6CA 4P10A 5F09A 1BPMA 4IHMA 3HUVA 3NA6A 4B6ZA 8CPAA 3PEIA 2QJ8A 1Y7EA 5CPAA 1BAVA 1JQGA 2PIZA 2ZEDA 2QVPA 1IGBA 2IQ6A 2Q51A 1FT7A 2FVGA 2V8HA 3H8GA 4UF4A 2BOAA 2ZEOA 3KR4A
chains in the Genus database with same CATH superfamily
2XEFA 4GXHA 4H89A 1YLEA 1XMTA 4MY3A 5LRGA 4C8UA 2Z11A 3KGQA 4C9VA 4NGPA 3IEHA 3K2KA 3PT1A 3WR7A 4JD6A 3OB2B 1GGOA 4R87A 2Q7SA 4P4FA 2DPSA 4MRIA 4OAEA 3VRQA 1KUXA 3F5BA 4EVYA 5I0CA 4NF1A 1JDBC 1S7LA 1CE8B 2Q4YA 5AG4A 5E96A 3T07A 4MCRA 2EK8A 4WJBA 2XPLA 1J4JA 4A32A 1CG2A 1DIKA 3BJ7A 4CGLA 1U6MA 4R6TA 4M8DA 2JBJA 2ABZA 1ARLA 3G23A 3JVNA 4UFWA 2Y1MA 1Y0YA 5G1ZA 3WABA 1XRYA 2HB6A 4JVOA 2VXKA 4IUSA 3OP0A 4NGTA 4BPUB 1HDUA 3IU1A 1NXJA 2Q4VA 1H8LA 3JTKA 3BUWB 3ISXA 4JZ0A 3GKRA 3MRUA 3SJEA 1QSOA 2PSWA 2VKZG 2OH1A 2F7VA 4KOWA 1WVMA 2JBKA 2J8RA 4AB7A 4Y49C 1TIQA 3D3SA 3PGPA 2G3TA 2X7BA 4HNWB 4C68A 2EZBA 1IOIA 3ISZA 3LD2A 4RI1A 4B10A 3DGVA 4MFJA 4ZX8A 1YVHA 3FEEA 4AVAA 4NFRA 3KRVA 3SI0A 2K5TA 1KEEB 4UEEA 1R61A 2ATRA 5GCNA 3T90A 3EXNA 1IY7A 4B12A 4CAXA 2Y1NA 2VI7A 3FIXA 1XF8A 2G9DA 2KCWA 3N5FA 4KZTA 2Q43A 2X0SA 3SJGA 4P4DA 1V0CA 4HKFA 2PR1A 5AGEA 5IB9A 3V7ZA 3P2HA 1XBUA 4B5PA 3KASA 2AFWA 1VI4A 3FVLA 4KOSA 1RTQA 3F9KC 1QSMA 1VHEA 2CNTA 2REEA 2GU2A 4R8FA 5EBVA 4LQGA 2JEVA 5HH1A 4AG7A 4IIYA 2R8VA 1HDQA 4CDJA 4UA3A 4YRHA 2YNDA 3W6SA 3H8EA 1S5KA 2ZW7A 2CTBA 2PC1A 3SJXA 1LCPA 3D67A 5CBMA 4OC5A 4KVME 2MP0A 1F2OA 2N3AB 2XEGA 1QSTA 6CPAA 4GPLB 3D7HA 2A4NA 4JXQA 2WUUA 2IL4A 3D7GA 1ZO0A 2J8NA 1S7FA 3FF3A 2AFOA 1S7KA 3BUXB 4P4BA 3EZAA 3F0AA 2H5MA 2R7HA 5K8PA 2JDCA 3GUXA 3H8FA 1KC7A 4OC4A 4TJXA 3D7DA 2B5GB 1AYEA 2AE6A 4ZBGA 3U88C 3IIBA 5C88A 4OIDA 2VEZA 5D8NA 5IB0A 2FL4A 2WSAA 3TLZA 4CO9A 4X2TA 3WC5A 3CPXA 2Y0MA 1ZLIA 4PXDA 5HKZA 1PCAA 1S3ZA 3CDXA 4IK2A 5THWA 4MY0A 4CAVA 2OR4A 1TF8A 2WZNA 4PQAA 3WC6A 1VHOA 3VH9A 3ZZIA 2WYRA 4E5SA 3S6FA 1Z2LA 1LAMA 2VBQA 2PDOA 4M6IA 4A30A 3TLEA 3FH4A 3TO9A 4BMHA 4JWPA 3PB7X 2C6PA 2ZEPA 4P4EA 2VQYA 2Z3MA 1YSJA 4MFZA 2OOTA 4KSFA 4BPWB 1PYTB 3TYXA 5F5XA 3VATA 3HPHE 1IB1E 2PJ6A 1ARMA 1F2PA 3I9SA 4J3GA 5K8MA 1VGYA 4P6YA 4P4JA 3B3TA 4NGQA 2HC9A 4C2ZA 3PB4X 2CF4A 4MHDA 2V77A 1R57A 4II9A 2GLFA 1HEEA 2PJ3A 2YNCC 4HPSA 4U5YA 1I21A 2DIKA 3W6XA 3GJZA 3ICUA 1CX8A 4F9UA 1S60A 4C9AA 4X5KA 4Q7AA 2EUIA 4IF5A 4UCPA 1M6VB 3H5ZA 1KBLA 2HROA 4FD6A 2WPWA 1QSRA 4CYQA 3RAMA 1JDEA 3IGRA 1RO5A 3PB9X 3D7FA 3TLBA 2ZXVA 3JUWA 4CAEA 5ISVA 4DUKA 3QAYA 2G3AA 3SI2A 4FD5A 1GYTA 1P4NA 2XPNA 5J3XA 3OAKA 4E94A 5J8FA 3UY5A 5LRJA 4C8TA 4KOVA 4UIAA 4A39A 1LAPA 1BLLE 1V6CA 3IC1A 1WWZA 2P6EA 2RB7A 2BUEA 4B5PB 3TX8A 3IJ3A 3IU2A 2Q7BA 3D66A 5AG7A 2BO9A 2EZAA 2ZEEA 5HXDA 4C99A 3GYAA 4MFQA 1Z8LA 4KOXA 1YX0A 5H84A 3FJUA 3KI9A 4H6UA 1CPXA 1MJAA 1KUVA 5HVHA 4MHZA 2BCOA 4XPDB 2VL1A 2VZZA 4QUSA 4KLWA 3IWEA 4WWVA 4FBEA 5LYDA 1UFHA 2IJZA 4PSWA 2GANA 2GFQA 3DR8A 4AXVA 3VGOA 1M4LA 4HNXB 5IX3A 3PLFB 4P4IA 1SQHA 1YREA 1R43A 1XOVA 3LODA 4KUBA 1YK3A 4NEXA 3D2PA 2D0PA 1Z9UA 1Z8TA 1R3NA 4UCNA 3B3SA 1BXRB 4PXCA 1M4IA 2QYVA 4TNUA 3S9NA 5EC4A 4UCMA 5LYLA 2NSMA 1XMBA 4E8OA 3EC4A 2XEJA 2PRQA 4FD4A 7CPAA 1A2ZA 3R96A 1Z8WA 4MI4A 3B8GA 4Q38A 2WPXA 4QVTA 4QBJA 2PJ0A 4CYNA 1QSNA 5D29A 1FY7A 3TLAA 1ZG7A 2AJ6A 3NH5A 4FD7A 2J8MA 5F49A 3PB6X 4PXEA 4DNCA 5AXIA 1EZAA 5HKWA 3S9MA 3ZNIA 3BUMB 2FSRA 2HI6A 2HV2A 3SI1A 4KORA 2PR8A 5LYFA 1ZYMA 3C26A 4MMOA 1XF1A 2PJAA 5F47A 2FS5A 2RFHA 4LQ6A 5AG6A 2XEIA 4BTFA 2B3UA 1ON0A 4OMEA 1OZPA 1XIXA 3DDDA 3IO1A 2PVVA 4M6GA 1I1DA 2V8DA 3BUOB 4UFXA 4C7HA 3OWCA 5LRKA 1YW4A 2I3CA 3F8KA 5HKYA 4P44A 3TOAA 4FAIA 3KR5A 1YGHA 4X8IA 4KSIA 3EIFA 2PJ4A 4LUAA 4MHPA 5A27A 3C8OA 4M85A 2GP4A 1Z5RA 4A94A 1IYLA 4H1HA 2OLSA 2C5QA 4MCSA 5G20A 1QQ9A 3L2NA 4NXYA 1DTDA 3VARA 4R3KA 4CS0B 3I6SA 3FRMA 3V38A 2R82A 1Y9ZA 2O4HA 4GS4A 4W9YA 3RYOA 2PE3A 4YU9A 4B13A 4IIXA 2B4BA 2P0WA 2GE3A 2I00A 1ZG9A 3NE7A 1Z4RA 4CGMA 2PJ1A 3HMJG 2GIVA 5DWNA 3H4QA 4ZY1A 2PJ7A 2AFXA 3QB8A 4KSAA 4PXBA 4MFKA 2B4JC 5FVJA 3T05A 2Q04A 1YR0A 2ZOFA 4OIWA 3B35A 3E0KA 5G22A 4C8PA 4ZY0A 2CY2A 3CPAA 3FEDA 2REFA 4CRYB 4NGSA 3W91A 2B4DA 3RBUA 3VRPA 4K3NA 2C6GA 5HVGA 1TKFA 3T0TA 2PVWA 2Z0ZA 4KOTA 4I49A 3TE4A 3LWUA 1Y0RA 1TKHA 2ODFA 4ONUA 4UEZA 1YVKA 1LOKA 3S6GA 3R9GA 3TTHA 1CS0B 1IICA 2VZYA 3DR6A 4F6AA 4R3LA 4Z65A 3CXPA 1X10A 4KVOE 2B3VA 4ZX9A 3TLGA 2Z10A 2O28A 3EY5A 1X12A 1Y7RA 3QAHA 2EO8A 3B2YA 5G21A 4A37A 4F0YA 5EMIA 4C7IA 1TKJA 1QMUA 3PZJA 1FBVA 4CDKA 2R98A 3TC8A 2EBJA 4QB9A 1LFWA 4PK2A 5AG5A 4EFDA 1M4DA 4C9RA 2B58A 4COGA 4PK3A 4INJA 1YMEA 4JXRA 2V8GA 1TF9A 3PB8X 3FECA 2V8VA 4B11A 1NE9A 3WC7A 5JVLA 3PRTA 5I4MA 1NBWA 4TJVA 2YGWA 4UFVA 1A9XB 2D0OA 1Z4EA 4E0AA 3EZBA 3D2MA 2ZEGA 4YWYA 4O23A 4P45A 4FWUA 5K99A 1B6BA 1VIXA 3SXOA 4QC6A 4CGNA 4MHNA 4CYOA 3SJFA 1NMTA 3KQZA 3O8ZA 1CPSA 3FBUA 4R76A 4C2XA 4CRZB 5J8CA 5KTAA 3HLPA 2BL1A 3D4UA 4B5OA 4EWTA 2BSWA 1PUAA 2Z3LA 3BJ8A 4MJXA 2DPTA 3R9EA 2EZCA 3U1BA 4IAVA 4OC3A 5J1QA 2ZOGA 1C3OB 3OB1B 4JJXA 1CP6A 3V8IA 2PJBA 3EZEA 2ZEMA 3DLJA 4A95A 3RO0A 2ZPAA 1JWQA 1KZFA 3TO7A 4R9MA 1ELLP 2R1IA 2YJTA 5F9MA 1B47A 2BEIA 2NMTA 4LX9A 3TOBA 4CAFA 2YJVA 2OZHA 1CP7A 4HNYB 3VRRA 1XFOA 2OZGA 5HMNA 4BD9A 4YN3A 4MI1A 1Z9EA 3LMSA 5IR2A 3NE8A 2UV8G 3CXSA 4XNHB 1Q2YA 1LANA 2HQYA 4BBHA 3G8WA 2D4OA 2PJ2A 2ZELA 2DLAA 3NH8A 1XE4A 3LACA 3RZAA 4CGOA 5F1YA 2DF5A 4U9YA 2Z3OA 5H86A 4ONWA 3TT2A 3TLYA 3GY9A 3S9LA 1TXRA 4MFLA 4Q36A 1VKCA 2GLJA 4OC0A 4UWIA 3SHPA 4AVBA 4NGNA 2OU2A 4KLVA 4F8ZA 5KTDA 2FM4A 3A9LA 3R1KA 5F48A 1VBGA 1T36B 3K9TA 2YNCA 3TCVA 1RXTA 5CNPA 4YGOA 2HWGA 3GB0A 1L0CA 4OP4A 1F57A 2FE7A 5ELYA 1EO0A 1Q2DA 2B4DB 2JEWA 3T9YA 4EMEA 4XNHC 3BLNA 4XPDC 4C85A 1Q7LA 2Z3PA 3I74A 1VHSA 4ZY2A 3FYNA 3S6HA 3MN8A 1UWYA 3BUNB 3BI0A 3FB3A 4A4CA 3KKWA 4RR2B 3G3SA 3PBEA 4Y49B 4AVCA 2ZW5A 2B0AA 1Z8XA 5BWAB 5HVFA 4OC2A 3TFYA 4AG9A 1IOFA 1BPNA 1KUYA 1XJOA 1EE3P 1YW6A 4RUHA 1BO4A 3BXMA 3IFEA 4CYPA 4C9EA 4TWEA 4YFJA 1OBRA 1ZRSA 3TLGB 3IWGA 2PQ8A 4ZYQA 5K8NA 3SR3A 3HPGG 2D4PA 4L8AA 3TO6A 4PSXA 4A33A 4C8FA 4MHYA 1AUGA 3IWWA 2ZW4A 5K8OA 1N71A 4CGPA 4A2ZA 5A28A 4UBRA 5JH9A 3VRNA 4C9UA 1CM0A 3WT4A 3KZWA 3DNSA 4JLYA 4PPZA 3TLCA 3I3GA 4C8AA 3PP9A 1ZLHA 3FXTA 1IIDA 2HUZA 4ZI6A 2FIAA 1MK4A 2QMLA 2ZEFA 3FX6A 3P2FA 4DJLA 4OC1A 2Q44A 5KTCA 2CBLA 4C2YA 4GM5A 3MGDA 3T8WA 3VWEA 2AFMA 4BINA 5IV0A 2PJCA 2F8HA 3D68A 4H2KA 1Y9WA 1YVOA 1ZG8A 2QIRA 3CXQA 1IU8A 1IYKA 4NJRA 2Q0YA 1AMPA 2F5IA 2XPPA 3B3CA 1J3LA 3GLJA 4EYSA 4KS9A 2DEAA 1DE4C 4MCQA 2CNSA 3CZXA 1ZL0A 1ELMP 5C82A 2C1CA 4CZ1A 4A38A 2PIYA 2ANPA 2P6GA 3VWDA 1Q5XA 4C8CA 1EZBA 3BI1A 3B7IA 4NJQA 2OZUA 3VROA 1YLOA 4UIBA 4KNGE 4R57A 2NYQA 3EFAA 3D8PA 2PRBA 2Z3KA 4A31A 1M1DA 2PJ9A 3B3VA 3EO4A 5JM6A 5DWMA 4J0NA 4K30A 3KHZA 3I1UA 3JRUA 4PV6A 4U9ZA 2G0BA 5FD8A 1WJTA 2ZW6A 3ZJ0A 3CT9A 3PBBA 1VBHA 5JYBA 2O53A 4KVXA 1M4GA 2PJ8A 4C84A 5LYIA 4XPKA 4A4BA 2C27A 2Q4ZA 4UEFA 2GREA 3B3WA 4MXUA 3FMCA 2Z3NA 3SXNA 1BOBA 1M44A 3PFEA 5JGFA 3K4IA 1I12A 2FIWA 2AUMA 2OB0A 4OLLA 2FT0A 2CNMA 2POKA 2EWBA 2ZEHA 4NGMA 4NGRA 2FXFA 1PU9A 2ZENA 3KL9A 3GIUA 4KOYA 3R9FA 3S6KA 2CIJA 3K9UA 2IMOA 3FNCA 2XPOA 2JDDA 3NFZA 1XEBA 2EK9A 5JPHA 2CTCA 3KQXA 3T5MA 2P6FA 2AFUA 1NSLA 2PCUA 1WK4A 1FNOA 2ARHA 4MBUA 4FUUA 3NH4A 2E28A 4C86A 4XPLA 2AFSA 4NSQA 5DS0A 1MJ9A 1NSAA 2AUNA 1K4JA 4OADA 4R7MA 2DXQA 4F9VA 1YQEA 2PJ5A 4JYWA 4G1PA 4CAWA 1Y9KA 4KOUA 4DYOA 4CPAA 1C30B 2QECA 4ZGYB 1GHEA 1KWMA 4MCPA 4COBA 1CBXA 3NFQA 3PFOA 3VTAA 2J9AA 3KHXA 2AFZA 3RNZA 3NOJA 4OKOA 4KUAA 3QNVA 5F13A 4X3RA 3BHXA 1LRZA 2C6CA 4P10A 5F09A 1BPMA 2RC4A 3HUVA 4IHMA 4UWJA 4F0XA 2EVNA 3NA6A 1CJWA 4B6ZA 8CPAA 3PEIA 4MJ8A 2QJ8A 4RS2A 1Y7EA 2CXAA 4ORFA 4L89A 2B5GA 2FCKA 4H6ZA 5BY0A 1S7NA 4NCZA 5CPAA 4BPXB 1BAVA 1JQGA 3N7ZA 3PFVA 2PIZA 4M6HA 3R95A 2ZEDA 2QVPA 4MFPA 1IGBA 2IQ6A 1B87A 2JLMA 1FT7A 2Q51A 5F46A 2FVGA 2YNEA 5JQ4A 1MJBA 1Q2CA 2V8HA 3H8GA 4B14A 2I79A 4M3SA 4RN7A 3DSBA 4UF4A 2BOAA 1P0HA 2ZEOA 2PCNA 3KR4A 4E2AA
chains in the Genus database with same CATH topology
2XEFA 5LRGA 4C8UA 3KGQA 4C9VA 4NGPA 3K2KA 4P4FA 4MRIA 4MCRA 2EK8A 4WJBA 1CG2A 4R6TA 2JBJA 2ABZA 1ARLA 1Y0YA 3WABA 1XRYA 2HB6A 4NGTA 1HDUA 1H8LA 3ISXA 4JZ0A 3MRUA 3SJEA 2F7VA 1WVMA 2JBKA 3ISZA 3DGVA 4ZX8A 3FEEA 4NFRA 3SI0A 4UEEA 1IY7A 2G9DA 3N5FA 2Q43A 3SJGA 4P4DA 5IB9A 3V7ZA 1XBUA 3KASA 2AFWA 3FVLA 1RTQA 1VHEA 4R8FA 2GU2A 4CDJA 4LQGA 1HDQA 3H8EA 2CTBA 3SJXA 1LCPA 3D67A 5CBMA 4OC5A 1F2OA 2XEGA 6CPAA 3D7HA 3D7GA 3FF3A 2AFOA 4P4BA 5K8PA 3GUXA 3H8FA 4OC4A 4TJXA 3D7DA 1AYEA 3IIBA 4OIDA 5D8NA 4X2TA 3WC5A 3CPXA 1ZLIA 4PXDA 1PCAA 3CDXA 4IK2A 5THWA 2OR4A 1TF8A 2WZNA 4PQAA 3WC6A 1VHOA 3VH9A 2WYRA 1Z2LA 1LAMA 3FH4A 3PB7X 2C6PA 2ZEPA 4P4EA 1YSJA 2OOTA 1PYTB 3VATA 2PJ6A 1ARMA 1F2PA 5K8MA 1VGYA 4P6YA 4P4JA 3B3TA 4NGQA 2HC9A 3PB4X 2CF4A 2V77A 2GLFA 1HEEA 2PJ3A 3ICUA 1CX8A 4F9UA 4C9AA 4Q7AA 3RAMA 3PB9X 3D7FA 4DUKA 3SI2A 1GYTA 5LRJA 4C8TA 4UIAA 4A39A 1LAPA 1BLLE 1V6CA 3IC1A 2RB7A 3TX8A 3IJ3A 3D66A 2BO9A 2ZEEA 5HXDA 4C99A 1Z8LA 3FJUA 3KI9A 1CPXA 5HVHA 4MHZA 2BCOA 2VL1A 4WWVA 4FBEA 5LYDA 2IJZA 4AXVA 1M4LA 4P4IA 1R43A 1R3NA 3B3SA 4PXCA 2QYVA 4TNUA 3S9NA 5LYLA 2NSMA 1XMBA 2XEJA 2PRQA 7CPAA 2PJ0A 5D29A 1ZG7A 3NH5A 3PB6X 4PXEA 3S9MA 3SI1A 5LYFA 1XF1A 4MMOA 2PJAA 2RFHA 2XEIA 4OMEA 3IO1A 2PVVA 2V8DA 5LRKA 1YW4A 2I3CA 4FAIA 4P44A 3KR5A 3EIFA 4X8IA 4KSIA 2PJ4A 4MHPA 2GP4A 1Z5RA 4A94A 2C5QA 4MCSA 1QQ9A 3L2NA 1DTDA 3VARA 3I6SA 3V38A 1Y9ZA 2O4HA 4W9YA 2PE3A 4YU9A 1ZG9A 2PJ1A 4ZY1A 2PJ7A 2AFXA 4PXBA 2ZOFA 4OIWA 3B35A 4C8PA 4ZY0A 3CPAA 3FEDA 4NGSA 3RBUA 4K3NA 2C6GA 5HVGA 1TKFA 2PVWA 3LWUA 1Y0RA 1TKHA 4UEZA 1LOKA 4Z65A 4ZX9A 3B2YA 4A37A 1TKJA 1QMUA 4CDKA 3TC8A 1LFWA 4EFDA 1YMEA 2V8GA 1TF9A 3PB8X 3FECA 2V8VA 3WC7A 3PRTA 5I4MA 4TJVA 2ZEGA 4YWYA 4O23A 4P45A 4FWUA 1VIXA 4MHNA 3SJFA 3KQZA 1CPSA 4R76A 3HLPA 3D4UA 4EWTA 4IAVA 4OC3A 5J1QA 2ZOGA 1CP6A 2PJBA 2ZEMA 3DLJA 1ELLP 1CP7A 1XFOA 4BD9A 4YN3A 5IR2A 3LMSA 1LANA 2PJ2A 2ZELA 3NH8A 3RZAA 4ONWA 3S9LA 1TXRA 2GLJA 4OC0A 4F8ZA 4NGNA 3K9TA 3GB0A 4OP4A 1F57A 5ELYA 2JEWA 4EMEA 4C85A 1Q7LA 3I74A 4ZY2A 3MN8A 1UWYA 3BI0A 3PBEA 5HVFA 4OC2A 4RUHA 1BPNA 1XJOA 1EE3P 1YW6A 3IFEA 3BXMA 4C9EA 4TWEA 1OBRA 4ZYQA 5K8NA 4C8FA 4MHYA 3IWWA 5K8OA 5JH9A 4C9UA 3WT4A 3KZWA 4PPZA 4C8AA 1ZLHA 4ZI6A 2ZEFA 3FX6A 4DJLA 4OC1A 4GM5A 3T8WA 2AFMA 2PJCA 2F8HA 3D68A 4H2KA 1ZG8A 4NJRA 1AMPA 3B3CA 3GLJA 2DEAA 1DE4C 4MCQA 1ELMP 2C1CA 4A38A 2PIYA 2ANPA 4C8CA 3BI1A 3B7IA 4NJQA 1YLOA 4UIBA 4KNGE 2NYQA 3B3VA 2PJ9A 5JM6A 3KHZA 3I1UA 3JRUA 3CT9A 3PBBA 2O53A 4C84A 2PJ8A 5LYIA 2Q4ZA 4UEFA 2GREA 3B3WA 4MXUA 3FMCA 5JGFA 4C9RA 3PFEA 3IEHA 2POKA 2ZENA 3KL9A 2EWBA 4NGMA 4NGRA 2ZEHA 2CIJA 2IMOA 3NFZA 2EK9A 2CTCA 3KQXA 2AFUA 2PCUA 1FNOA 4FUUA 3NH4A 4C86A 2AFSA 5DS0A 1NSAA 4R7MA 4F9VA 2PJ5A 4G1PA 4JYWA 4DYOA 4CPAA 1KWMA 4MCPA 1CBXA 3PFOA 3VTAA 2J9AA 3KHXA 2AFZA 4OKOA 3QNVA 4X3RA 3BHXA 2C6CA 4P10A 5F09A 1BPMA 4IHMA 3HUVA 3NA6A 4B6ZA 8CPAA 3PEIA 2QJ8A 1Y7EA 5CPAA 1BAVA 1JQGA 2PIZA 2ZEDA 2QVPA 1IGBA 2IQ6A 2Q51A 1FT7A 2FVGA 2V8HA 3H8GA 4UF4A 2BOAA 2ZEOA 3KR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEF A;  5LRG A;  4C8U A;  3KGQ A;  4C9V A;  4NGP A;  3K2K A;  4P4F A;  4MRI A;  4MCR A;  2EK8 A;  4WJB A;  1CG2 A;  4R6T A;  2JBJ A;  2ABZ A;  1ARL A;  1Y0Y A;  3WAB A;  1XRY A;  2HB6 A;  4NGT A;  1HDU A;  1H8L A;  3ISX A;  4JZ0 A;  3MRU A;  3SJE A;  2F7V A;  1WVM A;  2JBK A;  3ISZ A;  3DGV A;  4ZX8 A;  3FEE A;  4NFR A;  3SI0 A;  4UEE A;  1IY7 A;  2G9D A;  3N5F A;  2Q43 A;  3SJG A;  4P4D A;  5IB9 A;  3V7Z A;  1XBU A;  3KAS A;  2AFW A;  3FVL A;  1RTQ A;  1VHE A;  4R8F A;  2GU2 A;  4CDJ A;  4LQG A;  1HDQ A;  3H8E A;  2CTB A;  3SJX A;  1LCP A;  3D67 A;  5CBM A;  4OC5 A;  1F2O A;  2XEG A;  6CPA A;  3D7H A;  3D7G A;  3FF3 A;  2AFO A;  4P4B A;  5K8P A;  3GUX A;  3H8F A;  4OC4 A;  4TJX A;  3D7D A;  1AYE A;  3IIB A;  4OID A;  5D8N A;  4X2T A;  3WC5 A;  3CPX A;  1ZLI A;  4PXD A;  1PCA A;  3CDX A;  4IK2 A;  5THW A;  2OR4 A;  1TF8 A;  2WZN A;  4PQA A;  3WC6 A;  1VHO A;  3VH9 A;  2WYR A;  1Z2L A;  1LAM A;  3FH4 A;  3PB7 X;  2C6P A;  2ZEP A;  4P4E A;  1YSJ A;  2OOT A;  1PYT B;  3VAT A;  2PJ6 A;  1ARM A;  1F2P A;  5K8M A;  1VGY A;  4P6Y A;  4P4J A;  3B3T A;  4NGQ A;  2HC9 A;  3PB4 X;  2CF4 A;  2V77 A;  2GLF A;  1HEE A;  2PJ3 A;  3ICU A;  1CX8 A;  4F9U A;  4C9A A;  4Q7A A;  3RAM A;  3PB9 X;  3D7F A;  4DUK A;  3SI2 A;  1GYT A;  5LRJ A;  4C8T A;  4UIA A;  4A39 A;  1LAP A;  1BLL E;  1V6C A;  3IC1 A;  2RB7 A;  3TX8 A;  3IJ3 A;  3D66 A;  2BO9 A;  2ZEE A;  5HXD A;  4C99 A;  1Z8L A;  3FJU A;  3KI9 A;  1CPX A;  5HVH A;  4MHZ A;  2BCO A;  2VL1 A;  4WWV A;  4FBE A;  5LYD A;  2IJZ A;  4AXV A;  1M4L A;  4P4I A;  1R43 A;  1R3N A;  3B3S A;  4PXC A;  2QYV A;  4TNU A;  3S9N A;  5LYL A;  2NSM A;  1XMB A;  2XEJ A;  2PRQ A;  7CPA A;  2PJ0 A;  5D29 A;  1ZG7 A;  3NH5 A;  3PB6 X;  4PXE A;  3S9M A;  3SI1 A;  5LYF A;  1XF1 A;  4MMO A;  2PJA A;  2RFH A;  2XEI A;  4OME A;  3IO1 A;  2PVV A;  2V8D A;  5LRK A;  1YW4 A;  2I3C A;  4FAI A;  4P44 A;  3KR5 A;  3EIF A;  4X8I A;  4KSI A;  2PJ4 A;  4MHP A;  1Z5R A;  4A94 A;  4MCS A;  1QQ9 A;  3L2N A;  1DTD A;  3VAR A;  3I6S A;  3V38 A;  1Y9Z A;  2O4H A;  4W9Y A;  2PE3 A;  4YU9 A;  1ZG9 A;  2PJ1 A;  4ZY1 A;  2PJ7 A;  2AFX A;  4PXB A;  2ZOF A;  4OIW A;  3B35 A;  4C8P A;  4ZY0 A;  3CPA A;  3FED A;  4NGS A;  3RBU A;  4K3N A;  2C6G A;  5HVG A;  1TKF A;  2PVW A;  3LWU A;  1Y0R A;  1TKH A;  4UEZ A;  1LOK A;  4Z65 A;  4ZX9 A;  3B2Y A;  4A37 A;  1TKJ A;  1QMU A;  4CDK A;  3TC8 A;  1LFW A;  4EFD A;  1YME A;  2V8G A;  1TF9 A;  3PB8 X;  3FEC A;  2V8V A;  3WC7 A;  3PRT A;  5I4M A;  4TJV A;  2ZEG A;  4YWY A;  4O23 A;  4P45 A;  4FWU A;  1VIX A;  4MHN A;  3SJF A;  3KQZ A;  1CPS A;  4R76 A;  3HLP A;  3D4U A;  4EWT A;  4IAV A;  4OC3 A;  5J1Q A;  2ZOG A;  1CP6 A;  2PJB A;  2ZEM A;  3DLJ A;  1ELL P;  1CP7 A;  1XFO A;  4BD9 A;  4YN3 A;  3LMS A;  1LAN A;  2PJ2 A;  2ZEL A;  3NH8 A;  3RZA A;  4ONW A;  3S9L A;  1TXR A;  2GLJ A;  4OC0 A;  4F8Z A;  4NGN A;  3K9T A;  3GB0 A;  4OP4 A;  1F57 A;  5ELY A;  2JEW A;  4EME A;  4C85 A;  1Q7L A;  3I74 A;  4ZY2 A;  3MN8 A;  1UWY A;  3BI0 A;  3PBE A;  5HVF A;  4OC2 A;  4RUH A;  1BPN A;  1XJO A;  1EE3 P;  1YW6 A;  3IFE A;  3BXM A;  4C9E A;  4TWE A;  1OBR A;  4ZYQ A;  5K8N A;  4C8F A;  4MHY A;  3IWW A;  5K8O A;  5JH9 A;  4C9U A;  3WT4 A;  3KZW A;  4PPZ A;  4C8A A;  1ZLH A;  4ZI6 A;  2ZEF A;  3FX6 A;  4DJL A;  4OC1 A;  4GM5 A;  3T8W A;  2AFM A;  2PJC A;  2F8H A;  3D68 A;  4H2K A;  1ZG8 A;  4NJR A;  1AMP A;  3B3C A;  3GLJ A;  2DEA A;  1DE4 C;  4MCQ A;  1ELM P;  2C1C A;  4A38 A;  2PIY A;  2ANP A;  4C8C A;  3BI1 A;  3B7I A;  4NJQ A;  1YLO A;  4UIB A;  4KNG E;  2NYQ A;  3B3V A;  2PJ9 A;  5JM6 A;  3KHZ A;  3I1U A;  3JRU A;  3CT9 A;  3PBB A;  2O53 A;  4C84 A;  2PJ8 A;  5LYI A;  2Q4Z A;  4UEF A;  2GRE A;  3B3W A;  4MXU A;  3FMC A;  5JGF A;  4C9R A;  3PFE A;  3IEH A;  2POK A;  2ZEN A;  3KL9 A;  2EWB A;  4NGM A;  4NGR A;  2ZEH A;  2CIJ A;  2IMO A;  3NFZ A;  2EK9 A;  2CTC A;  3KQX A;  2AFU A;  2PCU A;  1FNO A;  4FUU A;  3NH4 A;  4C86 A;  2AFS A;  5DS0 A;  1NSA A;  4R7M A;  4F9V A;  2PJ5 A;  4G1P A;  4JYW A;  4DYO A;  4CPA A;  1KWM A;  4MCP A;  1CBX A;  3PFO A;  3VTA A;  2J9A A;  3KHX A;  2AFZ A;  4OKO A;  3QNV A;  4X3R A;  3BHX A;  2C6C A;  4P10 A;  5F09 A;  1BPM A;  4IHM A;  3HUV A;  3NA6 A;  4B6Z A;  8CPA A;  3PEI A;  2QJ8 A;  1Y7E A;  5CPA A;  1BAV A;  1JQG A;  2PIZ A;  2ZED A;  2QVP A;  1IGB A;  2IQ6 A;  2Q51 A;  1FT7 A;  2FVG A;  2V8H A;  3H8G A;  4UF4 A;  2BOA A;  2ZEO A;  3KR4 A; 
#chains in the Genus database with same CATH topology
 2XEF A;  4GXH A;  4H89 A;  1YLE A;  1XMT A;  4MY3 A;  5LRG A;  4C8U A;  2Z11 A;  3KGQ A;  4C9V A;  4NGP A;  3IEH A;  3K2K A;  3PT1 A;  3WR7 A;  4JD6 A;  3OB2 B;  1GGO A;  4R87 A;  2Q7S A;  4P4F A;  2DPS A;  4MRI A;  4OAE A;  3VRQ A;  1KUX A;  3F5B A;  4EVY A;  5I0C A;  4NF1 A;  1JDB C;  1S7L A;  1CE8 B;  2Q4Y A;  5AG4 A;  5E96 A;  3T07 A;  4MCR A;  2EK8 A;  4WJB A;  2XPL A;  1J4J A;  4A32 A;  1CG2 A;  1DIK A;  3BJ7 A;  4CGL A;  1U6M A;  4R6T A;  4M8D A;  2JBJ A;  2ABZ A;  1ARL A;  3G23 A;  3JVN A;  4UFW A;  2Y1M A;  1Y0Y A;  5G1Z A;  3WAB A;  1XRY A;  2HB6 A;  4JVO A;  2VXK A;  4IUS A;  3OP0 A;  4NGT A;  4BPU B;  1HDU A;  3IU1 A;  1NXJ A;  2Q4V A;  1H8L A;  3JTK A;  3BUW B;  3ISX A;  4JZ0 A;  3GKR A;  3MRU A;  3SJE A;  1QSO A;  2PSW A;  2VKZ G;  2OH1 A;  2F7V A;  4KOW A;  1WVM A;  2JBK A;  2J8R A;  4AB7 A;  4Y49 C;  1TIQ A;  3D3S A;  3PGP A;  2G3T A;  2X7B A;  4HNW B;  4C68 A;  2EZB A;  1IOI A;  3ISZ A;  3LD2 A;  4RI1 A;  4B10 A;  3DGV A;  4MFJ A;  4ZX8 A;  1YVH A;  3FEE A;  4AVA A;  4NFR A;  3KRV A;  3SI0 A;  2K5T A;  1KEE B;  4UEE A;  1R61 A;  2ATR A;  5GCN A;  3T90 A;  3EXN A;  1IY7 A;  4B12 A;  4CAX A;  2Y1N A;  2VI7 A;  3FIX A;  1XF8 A;  2G9D A;  2KCW A;  3N5F A;  4KZT A;  2Q43 A;  2X0S A;  3SJG A;  4P4D A;  1V0C A;  4HKF A;  2PR1 A;  5AGE A;  5IB9 A;  3V7Z A;  3P2H A;  1XBU A;  4B5P A;  3KAS A;  2AFW A;  1VI4 A;  3FVL A;  4KOS A;  1RTQ A;  3F9K C;  1QSM A;  1VHE A;  2CNT A;  2REE A;  2GU2 A;  4R8F A;  5EBV A;  4LQG A;  2JEV A;  5HH1 A;  4AG7 A;  4IIY A;  2R8V A;  1HDQ A;  4CDJ A;  4UA3 A;  4YRH A;  2YND A;  3W6S A;  3H8E A;  1S5K A;  2ZW7 A;  2CTB A;  2PC1 A;  3SJX A;  1LCP A;  3D67 A;  5CBM A;  4OC5 A;  4KVM E;  2MP0 A;  1F2O A;  2N3A B;  2XEG A;  1QST A;  6CPA A;  4GPL B;  3D7H A;  2A4N A;  4JXQ A;  2WUU A;  2IL4 A;  3D7G A;  1ZO0 A;  2J8N A;  1S7F A;  3FF3 A;  2AFO A;  1S7K A;  3BUX B;  4P4B A;  3EZA A;  3F0A A;  2H5M A;  2R7H A;  5K8P A;  2JDC A;  3GUX A;  3H8F A;  1KC7 A;  4OC4 A;  4TJX A;  3D7D A;  2B5G B;  1AYE A;  2AE6 A;  4ZBG A;  3U88 C;  3IIB A;  5C88 A;  4OID A;  2VEZ A;  5D8N A;  5IB0 A;  2FL4 A;  2WSA A;  3TLZ A;  4CO9 A;  4X2T A;  3WC5 A;  3CPX A;  2Y0M A;  1ZLI A;  4PXD A;  5HKZ A;  1PCA A;  1S3Z A;  3CDX A;  4IK2 A;  5THW A;  4MY0 A;  4CAV A;  2OR4 A;  1TF8 A;  2WZN A;  4PQA A;  3WC6 A;  1VHO A;  3VH9 A;  3ZZI A;  2WYR A;  4E5S A;  3S6F A;  1Z2L A;  1LAM A;  2VBQ A;  2PDO A;  4M6I A;  4A30 A;  3TLE A;  3FH4 A;  3TO9 A;  4BMH A;  4JWP A;  3PB7 X;  2C6P A;  2ZEP A;  4P4E A;  2VQY A;  2Z3M A;  1YSJ A;  4MFZ A;  2OOT A;  4KSF A;  4BPW B;  1PYT B;  3TYX A;  5F5X A;  3VAT A;  3HPH E;  1IB1 E;  2PJ6 A;  1ARM A;  1F2P A;  3I9S A;  4J3G A;  5K8M A;  1VGY A;  4P6Y A;  4P4J A;  3B3T A;  4NGQ A;  2HC9 A;  4C2Z A;  3PB4 X;  2CF4 A;  4MHD A;  2V77 A;  1R57 A;  4II9 A;  2GLF A;  1HEE A;  2PJ3 A;  2YNC C;  4HPS A;  4U5Y A;  1I21 A;  2DIK A;  3W6X A;  3GJZ A;  3ICU A;  1CX8 A;  4F9U A;  1S60 A;  4C9A A;  4X5K A;  4Q7A A;  2EUI A;  4IF5 A;  4UCP A;  1M6V B;  3H5Z A;  1KBL A;  2HRO A;  4FD6 A;  2WPW A;  1QSR A;  4CYQ A;  3RAM A;  1JDE A;  3IGR A;  1RO5 A;  3PB9 X;  3D7F A;  3TLB A;  2ZXV A;  3JUW A;  4CAE A;  5ISV A;  4DUK A;  3QAY A;  2G3A A;  3SI2 A;  4FD5 A;  1GYT A;  1P4N A;  2XPN A;  5J3X A;  3OAK A;  4E94 A;  5J8F A;  3UY5 A;  5LRJ A;  4C8T A;  4KOV A;  4UIA A;  4A39 A;  1LAP A;  1BLL E;  1V6C A;  3IC1 A;  1WWZ A;  2P6E A;  2RB7 A;  2BUE A;  4B5P B;  3TX8 A;  3IJ3 A;  3IU2 A;  2Q7B A;  3D66 A;  5AG7 A;  2BO9 A;  2EZA A;  2ZEE A;  5HXD A;  4C99 A;  3GYA A;  4MFQ A;  1Z8L A;  4KOX A;  1YX0 A;  5H84 A;  3FJU A;  3KI9 A;  4H6U A;  1CPX A;  1MJA A;  1KUV A;  5HVH A;  4MHZ A;  2BCO A;  4XPD B;  2VL1 A;  2VZZ A;  4QUS A;  4KLW A;  3IWE A;  4WWV A;  4FBE A;  5LYD A;  1UFH A;  2IJZ A;  4PSW A;  2GAN A;  2GFQ A;  3DR8 A;  4AXV A;  3VGO A;  1M4L A;  4HNX B;  5IX3 A;  3PLF B;  4P4I A;  1SQH A;  1YRE A;  1R43 A;  1XOV A;  3LOD A;  4KUB A;  1YK3 A;  4NEX A;  3D2P A;  2D0P A;  1Z9U A;  1Z8T A;  1R3N A;  4UCN A;  3B3S A;  1BXR B;  4PXC A;  1M4I A;  2QYV A;  4TNU A;  3S9N A;  5EC4 A;  4UCM A;  5LYL A;  2NSM A;  1XMB A;  4E8O A;  3EC4 A;  2XEJ A;  2PRQ A;  4FD4 A;  7CPA A;  1A2Z A;  3R96 A;  1Z8W A;  4MI4 A;  3B8G A;  4Q38 A;  2WPX A;  4QVT A;  4QBJ A;  2PJ0 A;  4CYN A;  1QSN A;  5D29 A;  1FY7 A;  3TLA A;  1ZG7 A;  2AJ6 A;  3NH5 A;  4FD7 A;  2J8M A;  5F49 A;  3PB6 X;  4PXE A;  4DNC A;  5AXI A;  1EZA A;  5HKW A;  3S9M A;  3ZNI A;  3BUM B;  2FSR A;  2HI6 A;  2HV2 A;  3SI1 A;  4KOR A;  2PR8 A;  5LYF A;  1ZYM A;  3C26 A;  4MMO A;  1XF1 A;  2PJA A;  5F47 A;  2FS5 A;  2RFH A;  4LQ6 A;  5AG6 A;  2XEI A;  4BTF A;  2B3U A;  1ON0 A;  4OME A;  1OZP A;  1XIX A;  3DDD A;  3IO1 A;  2PVV A;  4M6G A;  1I1D A;  2V8D A;  3BUO B;  4UFX A;  4C7H A;  3OWC A;  5LRK A;  1YW4 A;  2I3C A;  3F8K A;  5HKY A;  4P44 A;  3TOA A;  4FAI A;  3KR5 A;  1YGH A;  4X8I A;  4KSI A;  3EIF A;  2PJ4 A;  4LUA A;  4MHP A;  5A27 A;  3C8O A;  4M85 A;  2GP4 A;  1Z5R A;  4A94 A;  1IYL A;  4H1H A;  2OLS A;  2C5Q A;  4MCS A;  5G20 A;  1QQ9 A;  3L2N A;  4NXY A;  1DTD A;  3VAR A;  4R3K A;  4CS0 B;  3I6S A;  3FRM A;  3V38 A;  2R82 A;  1Y9Z A;  2O4H A;  4GS4 A;  4W9Y A;  3RYO A;  2PE3 A;  4YU9 A;  4B13 A;  4IIX A;  2B4B A;  2P0W A;  2GE3 A;  2I00 A;  1ZG9 A;  3NE7 A;  1Z4R A;  4CGM A;  2PJ1 A;  3HMJ G;  2GIV A;  5DWN A;  3H4Q A;  4ZY1 A;  2PJ7 A;  2AFX A;  3QB8 A;  4KSA A;  4PXB A;  4MFK A;  2B4J C;  5FVJ A;  3T05 A;  2Q04 A;  1YR0 A;  2ZOF A;  4OIW A;  3B35 A;  3E0K A;  5G22 A;  4C8P A;  4ZY0 A;  2CY2 A;  3CPA A;  3FED A;  2REF A;  4CRY B;  4NGS A;  3W91 A;  2B4D A;  3RBU A;  3VRP A;  4K3N A;  2C6G A;  5HVG A;  1TKF A;  3T0T A;  2PVW A;  2Z0Z A;  4KOT A;  4I49 A;  3TE4 A;  3LWU A;  1Y0R A;  1TKH A;  2ODF A;  4ONU A;  4UEZ A;  1YVK A;  1LOK A;  3S6G A;  3R9G A;  3TTH A;  1CS0 B;  1IIC A;  2VZY A;  3DR6 A;  4F6A A;  4R3L A;  4Z65 A;  3CXP A;  1X10 A;  4KVO E;  2B3V A;  4ZX9 A;  3TLG A;  2Z10 A;  2O28 A;  3EY5 A;  1X12 A;  1Y7R A;  3QAH A;  2EO8 A;  3B2Y A;  5G21 A;  4A37 A;  4F0Y A;  5EMI A;  4C7I A;  1TKJ A;  1QMU A;  3PZJ A;  1FBV A;  4CDK A;  2R98 A;  3TC8 A;  2EBJ A;  4QB9 A;  1LFW A;  4PK2 A;  5AG5 A;  4EFD A;  1M4D A;  4C9R A;  2B58 A;  4COG A;  4PK3 A;  4INJ A;  1YME A;  4JXR A;  2V8G A;  1TF9 A;  3PB8 X;  3FEC A;  2V8V A;  4B11 A;  1NE9 A;  3WC7 A;  5JVL A;  3PRT A;  5I4M A;  1NBW A;  4TJV A;  2YGW A;  4UFV A;  1A9X B;  2D0O A;  1Z4E A;  4E0A A;  3EZB A;  3D2M A;  2ZEG A;  4YWY A;  4O23 A;  4P45 A;  4FWU A;  5K99 A;  1B6B A;  1VIX A;  3SXO A;  4QC6 A;  4CGN A;  4MHN A;  4CYO A;  3SJF A;  1NMT A;  3KQZ A;  3O8Z A;  1CPS A;  3FBU A;  4R76 A;  4C2X A;  4CRZ B;  5J8C A;  5KTA A;  3HLP A;  2BL1 A;  3D4U A;  4B5O A;  4EWT A;  2BSW A;  1PUA A;  2Z3L A;  3BJ8 A;  4MJX A;  2DPT A;  3R9E A;  2EZC A;  3U1B A;  4IAV A;  4OC3 A;  5J1Q A;  2ZOG A;  1C3O B;  3OB1 B;  4JJX A;  1CP6 A;  3V8I A;  2PJB A;  3EZE A;  2ZEM A;  3DLJ A;  4A95 A;  3RO0 A;  2ZPA A;  1JWQ A;  1KZF A;  3TO7 A;  4R9M A;  1ELL P;  2R1I A;  2YJT A;  5F9M A;  1B47 A;  2BEI A;  2NMT A;  4LX9 A;  3TOB A;  4CAF A;  2YJV A;  2OZH A;  1CP7 A;  4HNY B;  3VRR A;  1XFO A;  2OZG A;  5HMN A;  4BD9 A;  4YN3 A;  4MI1 A;  1Z9E A;  3LMS A;  5IR2 A;  3NE8 A;  2UV8 G;  3CXS A;  4XNH B;  1Q2Y A;  1LAN A;  2HQY A;  4BBH A;  3G8W A;  2D4O A;  2PJ2 A;  2ZEL A;  2DLA A;  3NH8 A;  1XE4 A;  3LAC A;  3RZA A;  4CGO A;  5F1Y A;  2DF5 A;  4U9Y A;  2Z3O A;  5H86 A;  4ONW A;  3TT2 A;  3TLY A;  3GY9 A;  3S9L A;  1TXR A;  4MFL A;  4Q36 A;  1VKC A;  2GLJ A;  4OC0 A;  4UWI A;  3SHP A;  4AVB A;  4NGN A;  2OU2 A;  4KLV A;  4F8Z A;  5KTD A;  2FM4 A;  3A9L A;  3R1K A;  5F48 A;  1VBG A;  1T36 B;  3K9T A;  2YNC A;  3TCV A;  1RXT A;  5CNP A;  4YGO A;  2HWG A;  3GB0 A;  1L0C A;  4OP4 A;  1F57 A;  2FE7 A;  5ELY A;  1EO0 A;  1Q2D A;  2B4D B;  2JEW A;  3T9Y A;  4EME A;  4XNH C;  3BLN A;  4XPD C;  4C85 A;  1Q7L A;  2Z3P A;  3I74 A;  1VHS A;  4ZY2 A;  3FYN A;  3S6H A;  3MN8 A;  1UWY A;  3BUN B;  3BI0 A;  3FB3 A;  4A4C A;  3KKW A;  4RR2 B;  3G3S A;  3PBE A;  4Y49 B;  4AVC A;  2ZW5 A;  2B0A A;  1Z8X A;  5BWA B;  5HVF A;  4OC2 A;  3TFY A;  4AG9 A;  1IOF A;  1BPN A;  1KUY A;  1XJO A;  1EE3 P;  1YW6 A;  4RUH A;  1BO4 A;  3BXM A;  3IFE A;  4CYP A;  4C9E A;  4TWE A;  4YFJ A;  1OBR A;  1ZRS A;  3TLG B;  3IWG A;  2PQ8 A;  4ZYQ A;  5K8N A;  3SR3 A;  3HPG G;  2D4P A;  4L8A A;  3TO6 A;  4PSX A;  4A33 A;  4C8F A;  4MHY A;  1AUG A;  3IWW A;  2ZW4 A;  5K8O A;  1N71 A;  4CGP A;  4A2Z A;  5A28 A;  4UBR A;  5JH9 A;  3VRN A;  4C9U A;  1CM0 A;  3WT4 A;  3KZW A;  3DNS A;  4JLY A;  4PPZ A;  3TLC A;  3I3G A;  4C8A A;  3PP9 A;  1ZLH A;  3FXT A;  1IID A;  2HUZ A;  4ZI6 A;  2FIA A;  1MK4 A;  2QML A;  2ZEF A;  3FX6 A;  3P2F A;  4DJL A;  4OC1 A;  2Q44 A;  5KTC A;  2CBL A;  4C2Y A;  4GM5 A;  3MGD A;  3T8W A;  3VWE A;  2AFM A;  4BIN A;  5IV0 A;  2PJC A;  2F8H A;  3D68 A;  4H2K A;  1Y9W A;  1YVO A;  1ZG8 A;  2QIR A;  3CXQ A;  1IU8 A;  1IYK A;  4NJR A;  2Q0Y A;  1AMP A;  2F5I A;  2XPP A;  3B3C A;  1J3L A;  3GLJ A;  4EYS A;  4KS9 A;  2DEA A;  1DE4 C;  4MCQ A;  2CNS A;  3CZX A;  1ZL0 A;  1ELM P;  5C82 A;  2C1C A;  4CZ1 A;  4A38 A;  2PIY A;  2ANP A;  2P6G A;  3VWD A;  1Q5X A;  4C8C A;  1EZB A;  3BI1 A;  3B7I A;  4NJQ A;  2OZU A;  3VRO A;  1YLO A;  4UIB A;  4KNG E;  4R57 A;  2NYQ A;  3EFA A;  3D8P A;  2PRB A;  2Z3K A;  4A31 A;  1M1D A;  2PJ9 A;  3B3V A;  3EO4 A;  5JM6 A;  5DWM A;  4J0N A;  4K30 A;  3KHZ A;  3I1U A;  3JRU A;  4PV6 A;  4U9Z A;  2G0B A;  5FD8 A;  1WJT A;  2ZW6 A;  3ZJ0 A;  3CT9 A;  3PBB A;  1VBH A;  5JYB A;  2O53 A;  4KVX A;  1M4G A;  2PJ8 A;  4C84 A;  5LYI A;  4XPK A;  4A4B A;  2C27 A;  2Q4Z A;  4UEF A;  2GRE A;  3B3W A;  4MXU A;  3FMC A;  2Z3N A;  3SXN A;  1BOB A;  1M44 A;  3PFE A;  5JGF A;  3K4I A;  1I12 A;  2FIW A;  2AUM A;  2OB0 A;  4OLL A;  2FT0 A;  2CNM A;  2POK A;  2EWB A;  2ZEH A;  4NGM A;  4NGR A;  2FXF A;  1PU9 A;  2ZEN A;  3KL9 A;  3GIU A;  4KOY A;  3R9F A;  3S6K A;  2CIJ A;  3K9U A;  2IMO A;  3FNC A;  2XPO A;  2JDD A;  3NFZ A;  1XEB A;  2EK9 A;  5JPH A;  2CTC A;  3KQX A;  3T5M A;  2P6F A;  2AFU A;  1NSL A;  2PCU A;  1WK4 A;  1FNO A;  2ARH A;  4MBU A;  4FUU A;  3NH4 A;  2E28 A;  4C86 A;  4XPL A;  2AFS A;  4NSQ A;  5DS0 A;  1MJ9 A;  1NSA A;  2AUN A;  1K4J A;  4OAD A;  4R7M A;  2DXQ A;  4F9V A;  1YQE A;  2PJ5 A;  4JYW A;  4G1P A;  4CAW A;  1Y9K A;  4KOU A;  4DYO A;  4CPA A;  1C30 B;  2QEC A;  4ZGY B;  1GHE A;  1KWM A;  4MCP A;  4COB A;  1CBX A;  3NFQ A;  3PFO A;  3VTA A;  2J9A A;  3KHX A;  2AFZ A;  3RNZ A;  3NOJ A;  4OKO A;  4KUA A;  3QNV A;  5F13 A;  4X3R A;  3BHX A;  1LRZ A;  2C6C A;  4P10 A;  5F09 A;  1BPM A;  2RC4 A;  3HUV A;  4IHM A;  4UWJ A;  4F0X A;  2EVN A;  3NA6 A;  1CJW A;  4B6Z A;  8CPA A;  3PEI A;  4MJ8 A;  2QJ8 A;  4RS2 A;  1Y7E A;  2CXA A;  4ORF A;  4L89 A;  2B5G A;  2FCK A;  4H6Z A;  5BY0 A;  1S7N A;  4NCZ A;  5CPA A;  4BPX B;  1BAV A;  1JQG A;  3N7Z A;  3PFV A;  2PIZ A;  4M6H A;  3R95 A;  2ZED A;  2QVP A;  4MFP A;  1IGB A;  2IQ6 A;  1B87 A;  2JLM A;  1FT7 A;  2Q51 A;  5F46 A;  2FVG A;  2YNE A;  5JQ4 A;  1MJB A;  1Q2C A;  2V8H A;  3H8G A;  4B14 A;  2I79 A;  4M3S A;  4RN7 A;  3DSB A;  4UF4 A;  2BOA A;  1P0H A;  2ZEO A;  2PCN A;  3KR4 A;  4E2A A; 
#chains in the Genus database with same CATH homology
 2XEF A;  5LRG A;  4C8U A;  3KGQ A;  4C9V A;  4NGP A;  3K2K A;  4P4F A;  4MRI A;  4MCR A;  2EK8 A;  4WJB A;  1CG2 A;  4R6T A;  2JBJ A;  2ABZ A;  1ARL A;  1Y0Y A;  3WAB A;  1XRY A;  2HB6 A;  4NGT A;  1HDU A;  1H8L A;  3ISX A;  4JZ0 A;  3MRU A;  3SJE A;  2F7V A;  1WVM A;  2JBK A;  3ISZ A;  3DGV A;  4ZX8 A;  3FEE A;  4NFR A;  3SI0 A;  4UEE A;  1IY7 A;  2G9D A;  3N5F A;  2Q43 A;  3SJG A;  4P4D A;  5IB9 A;  3V7Z A;  1XBU A;  3KAS A;  2AFW A;  3FVL A;  1RTQ A;  1VHE A;  4R8F A;  2GU2 A;  4CDJ A;  4LQG A;  1HDQ A;  3H8E A;  2CTB A;  3SJX A;  1LCP A;  3D67 A;  5CBM A;  4OC5 A;  1F2O A;  2XEG A;  6CPA A;  3D7H A;  3D7G A;  3FF3 A;  2AFO A;  4P4B A;  5K8P A;  3GUX A;  3H8F A;  4OC4 A;  4TJX A;  3D7D A;  1AYE A;  3IIB A;  4OID A;  5D8N A;  4X2T A;  3WC5 A;  3CPX A;  1ZLI A;  4PXD A;  1PCA A;  3CDX A;  4IK2 A;  5THW A;  2OR4 A;  1TF8 A;  2WZN A;  4PQA A;  3WC6 A;  1VHO A;  3VH9 A;  2WYR A;  1Z2L A;  1LAM A;  3FH4 A;  3PB7 X;  2C6P A;  2ZEP A;  4P4E A;  1YSJ A;  2OOT A;  1PYT B;  3VAT A;  2PJ6 A;  1ARM A;  1F2P A;  5K8M A;  1VGY A;  4P6Y A;  4P4J A;  3B3T A;  4NGQ A;  2HC9 A;  3PB4 X;  2CF4 A;  2V77 A;  2GLF A;  1HEE A;  2PJ3 A;  3ICU A;  1CX8 A;  4F9U A;  4C9A A;  4Q7A A;  3RAM A;  3PB9 X;  3D7F A;  4DUK A;  3SI2 A;  1GYT A;  5LRJ A;  4C8T A;  4UIA A;  4A39 A;  1LAP A;  1BLL E;  1V6C A;  3IC1 A;  2RB7 A;  3TX8 A;  3IJ3 A;  3D66 A;  2BO9 A;  2ZEE A;  5HXD A;  4C99 A;  1Z8L A;  3FJU A;  3KI9 A;  1CPX A;  5HVH A;  4MHZ A;  2BCO A;  2VL1 A;  4WWV A;  4FBE A;  5LYD A;  2IJZ A;  4AXV A;  1M4L A;  4P4I A;  1R43 A;  1R3N A;  3B3S A;  4PXC A;  2QYV A;  4TNU A;  3S9N A;  5LYL A;  2NSM A;  1XMB A;  2XEJ A;  2PRQ A;  7CPA A;  2PJ0 A;  5D29 A;  1ZG7 A;  3NH5 A;  3PB6 X;  4PXE A;  3S9M A;  3SI1 A;  5LYF A;  1XF1 A;  4MMO A;  2PJA A;  2RFH A;  2XEI A;  4OME A;  3IO1 A;  2PVV A;  2V8D A;  5LRK A;  1YW4 A;  2I3C A;  4FAI A;  4P44 A;  3KR5 A;  3EIF A;  4X8I A;  4KSI A;  2PJ4 A;  4MHP A;  2GP4 A;  1Z5R A;  4A94 A;  2C5Q A;  4MCS A;  1QQ9 A;  3L2N A;  1DTD A;  3VAR A;  3I6S A;  3V38 A;  1Y9Z A;  2O4H A;  4W9Y A;  2PE3 A;  4YU9 A;  1ZG9 A;  2PJ1 A;  4ZY1 A;  2PJ7 A;  2AFX A;  4PXB A;  2ZOF A;  4OIW A;  3B35 A;  4C8P A;  4ZY0 A;  3CPA A;  3FED A;  4NGS A;  3RBU A;  4K3N A;  2C6G A;  5HVG A;  1TKF A;  2PVW A;  3LWU A;  1Y0R A;  1TKH A;  4UEZ A;  1LOK A;  4Z65 A;  4ZX9 A;  3B2Y A;  4A37 A;  1TKJ A;  1QMU A;  4CDK A;  3TC8 A;  1LFW A;  4EFD A;  1YME A;  2V8G A;  1TF9 A;  3PB8 X;  3FEC A;  2V8V A;  3WC7 A;  3PRT A;  5I4M A;  4TJV A;  2ZEG A;  4YWY A;  4O23 A;  4P45 A;  4FWU A;  1VIX A;  4MHN A;  3SJF A;  3KQZ A;  1CPS A;  4R76 A;  3HLP A;  3D4U A;  4EWT A;  4IAV A;  4OC3 A;  5J1Q A;  2ZOG A;  1CP6 A;  2PJB A;  2ZEM A;  3DLJ A;  1ELL P;  1CP7 A;  1XFO A;  4BD9 A;  4YN3 A;  5IR2 A;  3LMS A;  1LAN A;  2PJ2 A;  2ZEL A;  3NH8 A;  3RZA A;  4ONW A;  3S9L A;  1TXR A;  2GLJ A;  4OC0 A;  4F8Z A;  4NGN A;  3K9T A;  3GB0 A;  4OP4 A;  1F57 A;  5ELY A;  2JEW A;  4EME A;  4C85 A;  1Q7L A;  3I74 A;  4ZY2 A;  3MN8 A;  1UWY A;  3BI0 A;  3PBE A;  5HVF A;  4OC2 A;  4RUH A;  1BPN A;  1XJO A;  1EE3 P;  1YW6 A;  3IFE A;  3BXM A;  4C9E A;  4TWE A;  1OBR A;  4ZYQ A;  5K8N A;  4C8F A;  4MHY A;  3IWW A;  5K8O A;  5JH9 A;  4C9U A;  3WT4 A;  3KZW A;  4PPZ A;  4C8A A;  1ZLH A;  4ZI6 A;  2ZEF A;  3FX6 A;  4DJL A;  4OC1 A;  4GM5 A;  3T8W A;  2AFM A;  2PJC A;  2F8H A;  3D68 A;  4H2K A;  1ZG8 A;  4NJR A;  1AMP A;  3B3C A;  3GLJ A;  2DEA A;  1DE4 C;  4MCQ A;  1ELM P;  2C1C A;  4A38 A;  2PIY A;  2ANP A;  4C8C A;  3BI1 A;  3B7I A;  4NJQ A;  1YLO A;  4UIB A;  4KNG E;  2NYQ A;  3B3V A;  2PJ9 A;  5JM6 A;  3KHZ A;  3I1U A;  3JRU A;  3CT9 A;  3PBB A;  2O53 A;  4C84 A;  2PJ8 A;  5LYI A;  2Q4Z A;  4UEF A;  2GRE A;  3B3W A;  4MXU A;  3FMC A;  5JGF A;  4C9R A;  3PFE A;  3IEH A;  2POK A;  2ZEN A;  3KL9 A;  2EWB A;  4NGM A;  4NGR A;  2ZEH A;  2CIJ A;  2IMO A;  3NFZ A;  2EK9 A;  2CTC A;  3KQX A;  2AFU A;  2PCU A;  1FNO A;  4FUU A;  3NH4 A;  4C86 A;  2AFS A;  5DS0 A;  1NSA A;  4R7M A;  4F9V A;  2PJ5 A;  4G1P A;  4JYW A;  4DYO A;  4CPA A;  1KWM A;  4MCP A;  1CBX A;  3PFO A;  3VTA A;  2J9A A;  3KHX A;  2AFZ A;  4OKO A;  3QNV A;  4X3R A;  3BHX A;  2C6C A;  4P10 A;  5F09 A;  1BPM A;  4IHM A;  3HUV A;  3NA6 A;  4B6Z A;  8CPA A;  3PEI A;  2QJ8 A;  1Y7E A;  5CPA A;  1BAV A;  1JQG A;  2PIZ A;  2ZED A;  2QVP A;  1IGB A;  2IQ6 A;  2Q51 A;  1FT7 A;  2FVG A;  2V8H A;  3H8G A;  4UF4 A;  2BOA A;  2ZEO A;  3KR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...