4MCQA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyldi-gamma-l-glutamic acid (pteroyltri-gamma-l-glutamic acid)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
695
structure length
692
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 268
structure length 692
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcqA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcqA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcqA02
3V7ZA 1Q7LA 1YMEA 4OIDA 2V77A 2JEWA 3FX6A 5LYIA 2PJ7A 5HVFA 5D8NA 1LCPA 4A94A 4C85A 4P4EA 4MXUA 5K8NA 1RTQA 4DUKA 2QJ8A 5IB9A 1ZG7A 4NGQA 2C6GA 1TXRA 2IQ6A 4FAIA 4MCRA 2V8GA 3B3SA 2AFUA 4UEZA 5ELYA 1Z8LA 4EFDA 1PCAA 2AFXA 1EE3P 2PE3A 3LMSA 3SI1A 3PRTA 2DEAA 4DYOA 3D67A 1F2OA 2O53A 4ZY0A 3D7FA 5JGFA 2V8VA 3SI0A 3PB6X 3KQZA 2PJ0A 4P4FA 1TKJA 4P4DA 3PFEA 2C6CA 4A38A 4KNGE 4MMOA 5K8MA 2EWBA 4K3NA 3S9NA 1V6CA 4MHNA 3JRUA 4P10A 3IIBA 1QQ9A 3IWWA 1F57A 4G1PA 1DE4C 4OC3A 2GLJA 2GREA 2ZEPA 1XBUA 2RFHA 3B3WA 1BPNA 4JYWA 4Z65A 2AFOA 2ZEDA 3PFOA 4C8PA 4DJLA 2FVGA 2Q43A 4C8CA 2QVPA 3VTAA 1XJOA 5LYLA 3ICUA 4C9RA 3PB8X 3N5FA 2IMOA 1ZG9A 4MCQA 4NGRA 3LWUA 2F8HA 3I6SA 1ARLA 3B35A 4X8IA 2ZEOA 1XFOA 2VL1A 3D7DA 5HVHA 4YWYA 4UF4A 2WYRA 3RZAA 1CP6A 1M4LA 5JH9A 4TJVA 3B3CA 4F9VA 1XF1A 2NSMA 4OP4A 1CBXA 2PJ5A 2ZOFA 3HLPA 1CP7A 3KHXA 1BAVA 3NH5A 5CBMA 4PPZA 2WZNA 1AYEA 2C1CA 1ZG8A 4UEFA 1JQGA 3I1UA 2XEIA 3VARA 4TJXA 2ABZA 3SJGA 3KGQA 2ZELA 3S9MA 3QNVA 2PJ4A 3KHZA 5HVGA 4A37A 3L2NA 2PJ3A 2POKA 4FBEA 3BI1A 1TKFA 4P44A 3TC8A 4WWVA 4ZY1A 3GUXA 1VGYA 5LYFA 5HXDA 2OR4A 3VH9A 4AXVA 6CPAA 2PRQA 1Y7EA 8CPAA 3TX8A 4MCSA 4R6TA 2C6PA 2XEFA 4R8FA 2Q51A 4IK2A 3S9LA 4ZX8A 4C84A 2PJ8A 4NGTA 4C8UA 4OIWA 2JBKA 1HDQA 3DGVA 4C9AA 2PVVA 3WC7A 4FWUA 4IAVA 1XMBA 2PIZA 2EK9A 4OC4A 3KASA 1PYTB 3PB4X 3ISZA 1YW6A 2GLFA 3RBUA 4C9UA 1ARMA 4C8FA 5JM6A 1XRYA 3FF3A 3WC5A 2HC9A 3PB7X 2I3CA 3KL9A 2BOAA 3IC1A 2Q4ZA 2AFZA 2PJAA 1H8LA 4A39A 3HUVA 4MHYA 1YLOA 3SJEA 3RAMA 1Y9ZA 4OC2A 5J1QA 4GM5A 4H2KA 1FNOA 3T8WA 1FT7A 4OMEA 4NGSA 1Z5RA 1R3NA 1GYTA 1UWYA 1WVMA 2EK8A 4F8ZA 4FUUA 5LRKA 5LRGA 4NFRA 3GLJA 1AMPA 2ZEGA 3IEHA 1YSJA 2ZENA 3D4UA 2RB7A 4P4IA 3BHXA 1VIXA 1CX8A 2AFSA 4O23A 2XEGA 4ZI6A 5CPAA 1F2PA 4YU9A 2ANPA 3BI0A 1OBRA 2CTBA 5THWA 4RUHA 4PXDA 2PIYA 3MN8A 1BLLE 2AFMA 1TF9A 4EMEA 1IY7A 3CT9A 4R7MA 1Y0YA 3IFEA 5K8OA 4C8AA 1CPXA 3H8EA 1LANA 4P45A 3FVLA 3K2KA 5K8PA 4C8TA 4C99A 3CPXA 1ZLIA 4CDKA 3KZWA 3SJXA 4P6YA 4C86A 2PJ9A 4MHPA 3FECA 4W9YA 2ZEMA 4TNUA 4WJBA 4Q7AA 3FEDA 1Y0RA 1CG2A 1DTDA 1LAPA 2J9AA 1KWMA 2PJCA 1HEEA 4NGPA 3NA6A 4ZYQA 2ZEFA 2NYQA 3IO1A 3ISXA 3D7GA 3PEIA 4JZ0A 2CF4A 4NGMA 4IHMA 4ZX9A 3DLJA 2IJZA 2BO9A 3FJUA 3MRUA 2ZEHA 2HB6A 2PJ6A 3FH4A 4ONWA 4PXBA 4X3RA 2O4HA 1TKHA 3I74A 2G9DA 4B6ZA 1IGBA 2BCOA 1ZLHA 1YW4A 3GB0A 2PJ1A 4OC0A 3SI2A 5D29A 2V8HA 3CPAA 7CPAA 4UEEA 2GU2A 4PQAA 3H8FA 3KI9A 2CIJA 4OC5A 2JBJA 1CPSA 3PBEA 4X2TA 2OOTA 4PXEA 1Z2LA 3B3TA 4NJQA 4EWTA 3D68A 4NJRA 4BD9A 3H8GA 4F9UA 4MHZA 3B7IA 4MCPA 3B3VA 4NGNA 3VATA 4P4JA 2F7VA 1LFWA 1LOKA 3CDXA 3WABA 1NSAA 4CDJA 3KR5A 1LAMA 1ELLP 4OKOA 3NH4A 2PCUA 5LRJA 1R43A 3BXMA 3FMCA 1TF8A 3NFZA 3EIFA 2AFWA 4TWEA 4LQGA 4MRIA 4C9VA 3V38A 1QMUA 4ZY2A 1HDUA 2ZEEA 1VHOA 3B2YA 3D66A 3WC6A 4P4BA 3NH8A 4PXCA 4OC1A 3IJ3A 4C9EA 1VHEA 3KR4A 3D7HA 1BPMA 3WT4A 4KSIA 3SJFA 2XEJA 1ELMP 5LYDA 2CTCA 2V8DA 3PBBA 2ZOGA 4UIBA 3KQXA 5DS0A 4CPAA 4YN3A 4R76A 4UIAA 3K9TA 2PVWA 2PJBA 3PB9X 2PJ2A 5F09A 2QYVA 5I4MA 3FEEA
chains in the Genus database with same CATH superfamily
1N71A 5C88A 3V7ZA 5J3XA 1YX0A 2VQYA 1Q7LA 1YMEA 1VKCA 2Z3NA 3DR8A 2V77A 4OIDA 2OZGA 1WK4A 1Y7RA 5BWAB 2QIRA 3F8KA 2JEWA 3FX6A 1LRZA 2Q7BA 4QBJA 2EUIA 5LYIA 3IGRA 4DNCA 3PGPA 1X10A 3HPGG 2D4PA 2J8MA 2PJ7A 3BJ8A 5HVFA 2Q4VA 5D8NA 1LCPA 4A94A 2B0AA 1CE8B 5JPHA 4C85A 2ZPAA 4P4EA 4MXUA 5EC4A 2Z3LA 5K8NA 3E0KA 1RTQA 4DUKA 1KC7A 1IOIA 4YFJA 1M4DA 2QJ8A 1EO0A 1B6BA 5IB9A 2JLMA 1ZG7A 5HKYA 4NGQA 5AXIA 2B4BA 2C6GA 1TXRA 2IQ6A 4FAIA 1NE9A 4MCRA 4RN7A 4MJ8A 2V8GA 3B3SA 2AFUA 4UEZA 5ELYA 1PUAA 1Z8LA 1ZYMA 3QB8A 4XNHB 2Y1MA 4EFDA 1PCAA 2HI6A 3DDDA 2FS5A 2AFXA 3CXSA 1EE3P 1C3OB 4L8AA 1VI4A 3R95A 2PE3A 3LMSA 3FRMA 4J3GA 1QSMA 4YRHA 3U88C 3HPHE 3SI1A 1J4JA 3JVNA 3IWEA 3PRTA 2J8RA 2DEAA 2K5TA 1ZO0A 4DYOA 4A32A 3D67A 4CYQA 2YGWA 5FD8A 2RC4A 1F2OA 5E96A 2O53A 4ZY0A 3D7FA 3TLGB 5AG7A 1RO5A 2V8VA 3SI0A 5DWNA 2OB0A 2Q4YA 5JGFA 1CS0B 3PB6X 4B5PA 4IUSA 3TT2A 3KQZA 4M85A 4QVTA 2PJ0A 4KOSA 4P4FA 1TKJA 3I3GA 1M6VB 4P4DA 1PU9A 1KEEB 3PFEA 4AG7A 1X12A 2WSAA 1S7FA 2CNTA 2C6CA 4QC6A 4A38A 2OLSA 3BUXB 2FIAA 4PK3A 5HMNA 4KNGE 4MMOA 5K8MA 2EWBA 4K3NA 3LD2A 3S9NA 5G20A 3FIXA 1YVOA 1V6CA 3NE7A 1CM0A 1WJTA 3JRUA 4MHNA 4P10A 3IIBA 4K30A 1QQ9A 2HQYA 1A2ZA 2FSRA 3IWWA 3PZJA 4XPKA 1F57A 3C8OA 1S7LA 3H5ZA 4G1PA 4F6AA 1DE4C 1R61A 2N3AB 3VRRA 4OC3A 1M44A 1OZPA 2GLJA 2GREA 4XPLA 3T90A 2FE7A 2QECA 2ZEPA 4B10A 3DR6A 3BLNA 4KOYA 4KZTA 5IX3A 1P0HA 4H6UA 4KOUA 1XBUA 4UFVA 2RFHA 3B3WA 2B4DA 2B5GA 1BPNA 4JYWA 4H89A 2B3VA 4KS9A 4MHDA 4RS2A 2AFOA 1IIDA 2ZEDA 3WR7A 3PFOA 4E94A 3BUWB 2AUMA 4C8PA 4DJLA 1Z4EA 1T36B 5AGEA 2FVGA 2Q43A 4C8CA 2QVPA 3VTAA 4J0NA 5AG5A 1XJOA 5LYLA 3TE4A 3BUOB 2P6FA 4UWIA 4XPDC 4CGPA 3ICUA 4C9RA 2DPSA 1P4NA 4CRZB 5H86A 3GJZA 1Z8TA 3GIUA 3PB8X 3N5FA 4JD6A 2IMOA 3D2MA 1ZG9A 5KTDA 2VEZA 4MCQA 4NGRA 3LWUA 3R9EA 3TTHA 2F8HA 4CRYB 3TFYA 2DPTA 3I6SA 2FL4A 4M3SA 1ARLA 3B35A 4X8IA 4C68A 1R57A 4CAWA 2ZEOA 1XFOA 3S6FA 5F48A 3UY5A 2VL1A 1KUVA 1J3LA 3D7DA 5GCNA 3ZJ0A 5HVHA 4MI1A 4YWYA 3FNCA 4UF4A 2WYRA 3RZAA 1CP6A 1M4LA 5JH9A 3B8GA 4HNYB 4JLYA 4TJVA 4CGMA 3B3CA 4F9VA 4Y49C 1XF1A 2NSMA 4OP4A 1CBXA 4U9YA 2PJ5A 5HKZA 2ZOFA 4M6GA 3VWEA 2HWGA 1B87A 5IB0A 3HLPA 4FD7A 1CP7A 2HUZA 3KHXA 1BAVA 3NH5A 5CBMA 1FY7A 4PPZA 1KUXA 2A4NA 1XF8A 2WZNA 2VXKA 3KRVA 2Z3OA 2EVNA 1AYEA 4FD6A 2C1CA 4HPSA 2CXAA 3R1KA 4UA3A 1ZG8A 4MFLA 4UEFA 1JQGA 3C26A 3I1UA 1GGOA 4E5SA 4ZGYB 5F13A 2XEIA 5KTAA 4B5OA 2DIKA 4BBHA 3PT1A 1BO4A 3VARA 2CY2A 4TJXA 5AG4A 2P6GA 2AUNA 2ABZA 2IL4A 2Z11A 3SJGA 3GY9A 2Q44A 3KGQA 2ODFA 2ZW5A 2I79A 4I49A 5G21A 2ZELA 2WPXA 4GS4A 4BINA 3S9MA 3KKWA 3QNVA 2PJ4A 3F5BA 3KHZA 5HVGA 2X0SA 4A37A 3L2NA 2PJ3A 2POKA 3NE8A 4FBEA 3BI1A 1TKFA 4P44A 4GXHA 1XMTA 4WWVA 3T9YA 3TC8A 4ZY1A 3GUXA 4II9A 1ZRSA 1VGYA 1KUYA 2D0PA 1I1DA 2BSWA 2PSWA 5HXDA 5LYFA 2OR4A 4KLVA 3VH9A 4KSFA 2B5GB 4ZBGA 4AXVA 4Z65A 4H6ZA 1WWZA 6CPAA 1L0CA 1Y7EA 2PRQA 4KOVA 3FB3A 3I9SA 3S6HA 4A2ZA 4MJXA 8CPAA 2PR1A 1Z9EA 4CYOA 1QSNA 4MCSA 3P2HA 4R6TA 3TX8A 3VWDA 4MFZA 4A95A 5I0CA 4LQ6A 3R9GA 1JDBC 2C6PA 1JWQA 2XEFA 1Q2DA 4LUAA 4CAXA 2DF5A 4R8FA 4COBA 1VHSA 2Q51A 2VZYA 4IK2A 3S9LA 2JEVA 2Y0MA 4ZX8A 3W91A 4C84A 2OZHA 5JYBA 2Q0YA 5AG6A 2PJ8A 4NGTA 4HNXB 4B13A 3EZAA 4C8UA 3ZNIA 4OIWA 2JBKA 1HDQA 3DGVA 4C9AA 2PVVA 1U6MA 3GKRA 1M4IA 3WC7A 5F47A 1SQHA 1Q2YA 4FWUA 4IAVA 1XMBA 2PIZA 4JVOA 2XPLA 4CGOA 2EK9A 4OC4A 4MFJA 4CGLA 5EMIA 3V8IA 5F46A 3KASA 4Q38A 1IYKA 1PYTB 3PB4X 2P0WA 3ISZA 4MFPA 1YREA 2OZUA 2AJ6A 4JJXA 2B3UA 1YW6A 3CXPA 2I00A 4CGNA 2FT0A 4A4BA 1TIQA 2GLFA 3RBUA 4OADA 2OU2A 4C9UA 2Q7SA 1A9XB 1ARMA 2YNCC 3S6GA 1Y9WA 4PK2A 1C30B 5F9MA 4C8FA 2Z3KA 5JM6A 4R57A 4UBRA 1XRYA 5IR2A 3FF3A 3QAYA 4R87A 2HC9A 3WC5A 3PB7X 2J8NA 2I3CA 2C5QA 3KL9A 4UWJA 2BOAA 5CNPA 4PSWA 3OB2B 2WUUA 3IC1A 2Q4ZA 3NFQA 2AFZA 2PJAA 1I21A 1H8LA 2DXQA 4FD5A 4A39A 3SXNA 2YJVA 1I12A 3HUVA 1YLOA 3SJEA 4BTFA 4MHYA 4UCMA 1K4JA 3RAMA 3G23A 1YK3A 4LX9A 1Y9ZA 4OC2A 1S5KA 1S7KA 5J1QA 3FYNA 1ZL0A 4GM5A 4H2KA 1FNOA 5C82A 1DIKA 3T8WA 2DLAA 2PR8A 2XPNA 2GP4A 2FIWA 4CO9A 1FT7A 4OMEA 3VRQA 3TLCA 1IB1E 2B4DB 1NBWA 4IIXA 3EZBA 4NGSA 3TO9A 3SHPA 1XOVA 1Z5RA 1NSLA 1R3NA 1VBHA 3EXNA 2UV8G 1GYTA 1UWYA 3CXQA 3TLZA 2O28A 4IF5A 2ZW6A 1WVMA 1IU8A 2EK8A 2GE3A 4KOXA 4F8ZA 5IV0A 2D0OA 3BUMB 1CJWA 1S60A 4FUUA 3D2PA 4OLLA 2CNMA 5LRKA 5LRGA 3T05A 4KOTA 1BXRB 4NFRA 3GLJA 5FVJA 1AMPA 4MY3A 2ZEGA 4NCZA 2HROA 3IEHA 3P2FA 1YSJA 4MFQA 2ZENA 4KORA 3D4UA 4A31A 4M8DA 2RB7A 2B4JC 2BL1A 4P4IA 3BHXA 1VIXA 2X7BA 4KSAA 3SXOA 4E2AA 1NXJA 5H84A 5F49A 2VZZA 1CX8A 4JXQA 2AFSA 4O23A 2XEGA 1EZAA 4ZI6A 2QMLA 5CPAA 1F2PA 4YU9A 5DWMA 2ANPA 3G8WA 3BI0A 1OBRA 2CTBA 2PRBA 2F5IA 4KVXA 4PXDA 3O8ZA 2PIYA 3JUWA 5THWA 3MN8A 1BLLE 2AFMA 1TF9A 2R1IA 4AB7A 1XE4A 4EMEA 2EZBA 1YLEA 1IY7A 2Y1NA 2H5MA 3JTKA 2G3TA 2XPPA 3CT9A 5JQ4A 1VBGA 3NOJA 3EZEA 4R7MA 4INJA 2G3AA 4A4CA 1Y0YA 3F0AA 1Z4RA 1Q5XA 4RUHA 3IFEA 5K8OA 4C8AA 1CPXA 3H8EA 5G1ZA 3OB1B 3RYOA 1IOFA 1MJAA 1LANA 2YJTA 4P45A 3FVLA 2PCNA 3K2KA 5K8PA 2BEIA 4C8TA 3TOAA 2NMTA 4C99A 5J8FA 3TO7A 3CPXA 4XPDB 1ZLIA 5A28A 1IYLA 4CDKA 3EC4A 3KZWA 2D4OA 4R3LA 4XNHC 3SJXA 3PFVA 4F0XA 2EZCA 2AE6A 4P6YA 4Q36A 3PLFB 4MBUA 3BUNB 2FM4A 3TOBA 4C86A 4AG9A 4B14A 2PJ9A 3FECA 4W9YA 1XEBA 4MHPA 1KBLA 2ZEMA 4RR2B 1GHEA 2GANA 4BPXB 4HNWB 4TNUA 4JWPA 4Q7AA 3FEDA 1Y0RA 4WJBA 3BJ7A 5EBVA 3RO0A 3K4IA 5K99A 1CG2A 2Z0ZA 1DTDA 1LAPA 2JDDA 2J9AA 3EY5A 3GYAA 3K9UA 3U1BA 2CNSA 4Y49B 4NEXA 1KWMA 1QSOA 2PJCA 3IU2A 4C7HA 1HEEA 3RNZA 1Z8XA 4NGPA 1Y9KA 3T07A 4QUSA 2ARHA 3LACA 3NA6A 4C2YA 2ZW7A 2ZEFA 4KOWA 4ZYQA 4NSQA 2NYQA 3IO1A 4IIYA 3TLGA 5BY0A 1ON0A 3ISXA 2EO8A 3D7GA 5HH1A 3DSBA 3PEIA 4JZ0A 2PC1A 1KZFA 2ZXVA 3EO4A 3T5MA 2FCKA 1YR0A 2CF4A 4CAFA 4E8OA 4NGMA 3R9FA 4C2ZA 3TLEA 4U5YA 4IHMA 4E0AA 4BMHA 4F0YA 4ZX9A 1YGHA 2IJZA 3DLJA 5JVLA 3OP0A 2BO9A 2MP0A 4AVAA 3FJUA 2WPWA 1Z9UA 5HKWA 2VBQA 3MRUA 2ZEHA 3W6SA 4CAVA 2HB6A 2PJ6A 4COGA 3OAKA 3FH4A 4NF1A 4ONWA 4BPUB 4PXBA 4X3RA 2O4HA 1Z8WA 4UFWA 1S7NA 2BUEA 1TKHA 2YNEA 4MFKA 3I74A 2G9DA 4B12A 4B6ZA 3N7ZA 4KLWA 1IGBA 2BCOA 5F1YA 3A9LA 1ZLHA 1YW4A 4UCNA 4GPLB 2EBJA 3GB0A 3R96A 2P6EA 1S3ZA 2PJ1A 3S6KA 3IU1A 4FD4A 1B47A 2Z3PA 4QB9A 4A33A 1YVHA 4AVCA 4NXYA 4OC0A 2Q04A 2YNDA 4AVBA 3TO6A 3SI2A 5D29A 4CAEA 4H1HA 2V8HA 3CPAA 3PP9A 4PSXA 2R7HA 7CPAA 3H4QA 3D8PA 4MY0A 4UEEA 2GU2A 2OH1A 4KUAA 4PQAA 3H8FA 3HMJG 3MGDA 4C2XA 3KI9A 5G22A 4PV6A 2CIJA 2R8VA 4OC5A 2JBJA 1CPSA 1QSTA 3PBEA 2B58A 2OOTA 4PXEA 4X2TA 2EZAA 4HKFA 1FBVA 1Z2LA 4B11A 3B3TA 1YQEA 4ORFA 3TYXA 2VKZG 4BPWB 1Q2CA 3W6XA 4NJQA 3DNSA 4EWTA 3D68A 4CYNA 3VGOA 1RXTA 1MJBA 3QAHA 3H8GA 4KVME 2GFQA 4NJRA 4OAEA 4BD9A 1MJ9A 4F9UA 4MHZA 2XPOA 4M6IA 3B7IA 4MCPA 3B3VA 1YVKA 3TLBA 4NGNA 4M6HA 3FXTA 2VI7A 3VATA 4CS0B 4P4JA 2F7VA 5A27A 1LFWA 1LOKA 2ZW4A 3EFAA 3LODA 3CDXA 2GIVA 4X5KA 5ISVA 2Z10A 1UFHA 3WABA 1NSAA 3D3SA 4CDJA 3KR5A 2G0BA 3OWCA 5F5XA 4C7IA 3F9KC 4UFXA 4CYPA 1LAMA 1ELLP 2R82A 4OKOA 3NH4A 2PCUA 5LRJA 3VROA 1R43A 3BXMA 2CBLA 2REFA 3FMCA 1TF8A 3NFZA 3EIFA 2AFWA 3G3SA 4TWEA 2REEA 4LQGA 1EZBA 2PDOA 4MRIA 4CZ1A 2Z3MA 4C9VA 2FXFA 1BOBA 3V38A 1QMUA 3IWGA 1HDUA 1XIXA 4ZY2A 3ZZIA 4U9ZA 2PQ8A 2ZEEA 1VHOA 4RI1A 4EVYA 3B2YA 1NMTA 3D66A 4KUBA 3WC6A 2JDCA 3CZXA 4KVOE 4L89A 4P4BA 3VRPA 3NH8A 4B5PB 2HV2A 2ATRA 4PXCA 4OC1A 3IJ3A 4C9EA 1VHEA 2C27A 3KR4A 3D7HA 1BPMA 4ONUA 1QSRA 4JXRA 4KSIA 3TCVA 3WT4A 3TLAA 3SJFA 2YNCA 3VRNA 1MK4A 2E28A 3SR3A 4YGOA 2XEJA 1ELMP 1V0CA 2R98A 5LYDA 3FBUA 2CTCA 4R9MA 4EYSA 1IICA 2V8DA 4A30A 5KTCA 3PBBA 2ZOGA 1M1DA 1M4GA 4UIBA 3KQXA 5DS0A 4CPAA 4YN3A 2KCWA 4MI4A 4R76A 3T0TA 4UIAA 3K9TA 2PVWA 1AUGA 2PJ2A 2PJBA 3PB9X 4UCPA 4R3KA 3TLYA 5F09A 2QYVA 5J8CA 5I4MA 3FEEA 1JDEA
chains in the Genus database with same CATH topology
3V7ZA 1Q7LA 1YMEA 4OIDA 2V77A 2JEWA 3FX6A 5LYIA 2PJ7A 5HVFA 5D8NA 1LCPA 4A94A 4C85A 4P4EA 4MXUA 5K8NA 1RTQA 4DUKA 2QJ8A 5IB9A 1ZG7A 4NGQA 2C6GA 1TXRA 2IQ6A 4FAIA 4MCRA 2V8GA 3B3SA 2AFUA 4UEZA 5ELYA 1Z8LA 4EFDA 1PCAA 2AFXA 1EE3P 2PE3A 3LMSA 3SI1A 3PRTA 2DEAA 4DYOA 3D67A 1F2OA 2O53A 4ZY0A 3D7FA 5JGFA 2V8VA 3SI0A 3PB6X 3KQZA 2PJ0A 4P4FA 1TKJA 4P4DA 3PFEA 2C6CA 4A38A 4KNGE 4MMOA 5K8MA 2EWBA 4K3NA 3S9NA 1V6CA 4MHNA 3JRUA 4P10A 3IIBA 1QQ9A 3IWWA 1F57A 4G1PA 1DE4C 4OC3A 2GLJA 2GREA 2ZEPA 1XBUA 2RFHA 3B3WA 1BPNA 4JYWA 4Z65A 2AFOA 2ZEDA 3PFOA 4C8PA 4DJLA 2FVGA 2Q43A 4C8CA 2QVPA 3VTAA 1XJOA 5LYLA 3ICUA 4C9RA 3PB8X 3N5FA 2IMOA 1ZG9A 4MCQA 4NGRA 3LWUA 2F8HA 3I6SA 1ARLA 3B35A 4X8IA 2ZEOA 1XFOA 2VL1A 3D7DA 5HVHA 4YWYA 4UF4A 2WYRA 3RZAA 1CP6A 1M4LA 5JH9A 4TJVA 3B3CA 4F9VA 1XF1A 2NSMA 4OP4A 1CBXA 2PJ5A 2ZOFA 3HLPA 1CP7A 3KHXA 1BAVA 3NH5A 5CBMA 4PPZA 2WZNA 1AYEA 2C1CA 1ZG8A 4UEFA 1JQGA 3I1UA 2XEIA 3VARA 4TJXA 2ABZA 3SJGA 3KGQA 2ZELA 3S9MA 3QNVA 2PJ4A 3KHZA 5HVGA 4A37A 3L2NA 2PJ3A 2POKA 4FBEA 3BI1A 1TKFA 4P44A 3TC8A 4WWVA 4ZY1A 3GUXA 1VGYA 5LYFA 5HXDA 2OR4A 3VH9A 4AXVA 6CPAA 2PRQA 1Y7EA 8CPAA 3TX8A 4MCSA 4R6TA 2C6PA 2XEFA 4R8FA 2Q51A 4IK2A 3S9LA 4ZX8A 4C84A 2PJ8A 4NGTA 4C8UA 4OIWA 2JBKA 1HDQA 3DGVA 4C9AA 2PVVA 3WC7A 4FWUA 4IAVA 1XMBA 2PIZA 2EK9A 4OC4A 3KASA 1PYTB 3PB4X 3ISZA 1YW6A 2GLFA 3RBUA 4C9UA 1ARMA 4C8FA 5JM6A 1XRYA 5IR2A 3FF3A 3WC5A 2HC9A 3PB7X 2I3CA 2C5QA 3KL9A 2BOAA 3IC1A 2Q4ZA 2AFZA 2PJAA 1H8LA 4A39A 3HUVA 4MHYA 1YLOA 3SJEA 3RAMA 1Y9ZA 4OC2A 5J1QA 4GM5A 4H2KA 1FNOA 3T8WA 2GP4A 1FT7A 4OMEA 4NGSA 1Z5RA 1R3NA 1GYTA 1UWYA 1WVMA 2EK8A 4F8ZA 4FUUA 5LRKA 5LRGA 4NFRA 3GLJA 1AMPA 2ZEGA 3IEHA 1YSJA 2ZENA 3D4UA 2RB7A 4P4IA 3BHXA 1VIXA 1CX8A 2AFSA 4O23A 2XEGA 4ZI6A 5CPAA 1F2PA 4YU9A 2ANPA 3BI0A 1OBRA 2CTBA 5THWA 4RUHA 4PXDA 2PIYA 3MN8A 1BLLE 2AFMA 1TF9A 4EMEA 1IY7A 3CT9A 4R7MA 1Y0YA 3IFEA 5K8OA 4C8AA 1CPXA 3H8EA 1LANA 4P45A 3FVLA 3K2KA 5K8PA 4C8TA 4C99A 3CPXA 1ZLIA 4CDKA 3KZWA 3SJXA 4P6YA 4C86A 2PJ9A 4MHPA 3FECA 4W9YA 2ZEMA 4TNUA 4WJBA 4Q7AA 3FEDA 1Y0RA 1CG2A 1DTDA 1LAPA 2J9AA 1KWMA 2PJCA 1HEEA 4NGPA 3NA6A 4ZYQA 2ZEFA 2NYQA 3IO1A 3ISXA 3D7GA 3PEIA 4JZ0A 2CF4A 4NGMA 4IHMA 4ZX9A 3DLJA 2IJZA 2BO9A 3FJUA 3MRUA 2ZEHA 2HB6A 2PJ6A 3FH4A 4ONWA 4PXBA 4X3RA 2O4HA 1TKHA 3I74A 2G9DA 4B6ZA 1IGBA 2BCOA 1ZLHA 1YW4A 3GB0A 2PJ1A 4OC0A 3SI2A 5D29A 2V8HA 3CPAA 7CPAA 4UEEA 2GU2A 4PQAA 3H8FA 3KI9A 2CIJA 4OC5A 2JBJA 1CPSA 3PBEA 4X2TA 2OOTA 4PXEA 1Z2LA 3B3TA 4NJQA 4EWTA 3D68A 4NJRA 4BD9A 3H8GA 4F9UA 4MHZA 3B7IA 4MCPA 3B3VA 4NGNA 3VATA 4P4JA 2F7VA 1LFWA 1LOKA 3CDXA 3WABA 1NSAA 4CDJA 3KR5A 1LAMA 1ELLP 4OKOA 3NH4A 2PCUA 5LRJA 1R43A 3BXMA 3FMCA 1TF8A 3NFZA 3EIFA 2AFWA 4TWEA 4LQGA 4MRIA 4C9VA 3V38A 1QMUA 4ZY2A 1HDUA 2ZEEA 1VHOA 3B2YA 3D66A 3WC6A 4P4BA 3NH8A 4PXCA 4OC1A 3IJ3A 4C9EA 1VHEA 3KR4A 3D7HA 1BPMA 3WT4A 4KSIA 3SJFA 2XEJA 1ELMP 5LYDA 2CTCA 2V8DA 3PBBA 2ZOGA 4UIBA 3KQXA 5DS0A 4CPAA 4YN3A 4R76A 4UIAA 3K9TA 2PVWA 2PJBA 3PB9X 2PJ2A 5F09A 2QYVA 5I4MA 3FEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7Z A;  1Q7L A;  1YME A;  4OID A;  2V77 A;  2JEW A;  3FX6 A;  5LYI A;  2PJ7 A;  5HVF A;  5D8N A;  1LCP A;  4A94 A;  4C85 A;  4P4E A;  4MXU A;  5K8N A;  1RTQ A;  4DUK A;  2QJ8 A;  5IB9 A;  1ZG7 A;  4NGQ A;  2C6G A;  1TXR A;  2IQ6 A;  4FAI A;  4MCR A;  2V8G A;  3B3S A;  2AFU A;  4UEZ A;  5ELY A;  1Z8L A;  4EFD A;  1PCA A;  2AFX A;  1EE3 P;  2PE3 A;  3LMS A;  3SI1 A;  3PRT A;  2DEA A;  4DYO A;  3D67 A;  1F2O A;  2O53 A;  4ZY0 A;  3D7F A;  5JGF A;  2V8V A;  3SI0 A;  3PB6 X;  3KQZ A;  2PJ0 A;  4P4F A;  1TKJ A;  4P4D A;  3PFE A;  2C6C A;  4A38 A;  4KNG E;  4MMO A;  5K8M A;  2EWB A;  4K3N A;  3S9N A;  1V6C A;  4MHN A;  3JRU A;  4P10 A;  3IIB A;  1QQ9 A;  3IWW A;  1F57 A;  4G1P A;  1DE4 C;  4OC3 A;  2GLJ A;  2GRE A;  2ZEP A;  1XBU A;  2RFH A;  3B3W A;  1BPN A;  4JYW A;  4Z65 A;  2AFO A;  2ZED A;  3PFO A;  4C8P A;  4DJL A;  2FVG A;  2Q43 A;  4C8C A;  2QVP A;  3VTA A;  1XJO A;  5LYL A;  3ICU A;  4C9R A;  3PB8 X;  3N5F A;  2IMO A;  1ZG9 A;  4MCQ A;  4NGR A;  3LWU A;  2F8H A;  3I6S A;  1ARL A;  3B35 A;  4X8I A;  2ZEO A;  1XFO A;  2VL1 A;  3D7D A;  5HVH A;  4YWY A;  4UF4 A;  2WYR A;  3RZA A;  1CP6 A;  1M4L A;  5JH9 A;  4TJV A;  3B3C A;  4F9V A;  1XF1 A;  2NSM A;  4OP4 A;  1CBX A;  2PJ5 A;  2ZOF A;  3HLP A;  1CP7 A;  3KHX A;  1BAV A;  3NH5 A;  5CBM A;  4PPZ A;  2WZN A;  1AYE A;  2C1C A;  1ZG8 A;  4UEF A;  1JQG A;  3I1U A;  2XEI A;  3VAR A;  4TJX A;  2ABZ A;  3SJG A;  3KGQ A;  2ZEL A;  3S9M A;  3QNV A;  2PJ4 A;  3KHZ A;  5HVG A;  4A37 A;  3L2N A;  2PJ3 A;  2POK A;  4FBE A;  3BI1 A;  1TKF A;  4P44 A;  3TC8 A;  4WWV A;  4ZY1 A;  3GUX A;  1VGY A;  5LYF A;  5HXD A;  2OR4 A;  3VH9 A;  4AXV A;  6CPA A;  2PRQ A;  1Y7E A;  8CPA A;  3TX8 A;  4MCS A;  4R6T A;  2C6P A;  2XEF A;  4R8F A;  2Q51 A;  4IK2 A;  3S9L A;  4ZX8 A;  4C84 A;  2PJ8 A;  4NGT A;  4C8U A;  4OIW A;  2JBK A;  1HDQ A;  3DGV A;  4C9A A;  2PVV A;  3WC7 A;  4FWU A;  4IAV A;  1XMB A;  2PIZ A;  2EK9 A;  4OC4 A;  3KAS A;  1PYT B;  3PB4 X;  3ISZ A;  1YW6 A;  2GLF A;  3RBU A;  4C9U A;  1ARM A;  4C8F A;  5JM6 A;  1XRY A;  3FF3 A;  3WC5 A;  2HC9 A;  3PB7 X;  2I3C A;  3KL9 A;  2BOA A;  3IC1 A;  2Q4Z A;  2AFZ A;  2PJA A;  1H8L A;  4A39 A;  3HUV A;  4MHY A;  1YLO A;  3SJE A;  3RAM A;  1Y9Z A;  4OC2 A;  5J1Q A;  4GM5 A;  4H2K A;  1FNO A;  3T8W A;  1FT7 A;  4OME A;  4NGS A;  1Z5R A;  1R3N A;  1GYT A;  1UWY A;  1WVM A;  2EK8 A;  4F8Z A;  4FUU A;  5LRK A;  5LRG A;  4NFR A;  3GLJ A;  1AMP A;  2ZEG A;  3IEH A;  1YSJ A;  2ZEN A;  3D4U A;  2RB7 A;  4P4I A;  3BHX A;  1VIX A;  1CX8 A;  2AFS A;  4O23 A;  2XEG A;  4ZI6 A;  5CPA A;  1F2P A;  4YU9 A;  2ANP A;  3BI0 A;  1OBR A;  2CTB A;  5THW A;  4RUH A;  4PXD A;  2PIY A;  3MN8 A;  1BLL E;  2AFM A;  1TF9 A;  4EME A;  1IY7 A;  3CT9 A;  4R7M A;  1Y0Y A;  3IFE A;  5K8O A;  4C8A A;  1CPX A;  3H8E A;  1LAN A;  4P45 A;  3FVL A;  3K2K A;  5K8P A;  4C8T A;  4C99 A;  3CPX A;  1ZLI A;  4CDK A;  3KZW A;  3SJX A;  4P6Y A;  4C86 A;  2PJ9 A;  4MHP A;  3FEC A;  4W9Y A;  2ZEM A;  4TNU A;  4WJB A;  4Q7A A;  3FED A;  1Y0R A;  1CG2 A;  1DTD A;  1LAP A;  2J9A A;  1KWM A;  2PJC A;  1HEE A;  4NGP A;  3NA6 A;  4ZYQ A;  2ZEF A;  2NYQ A;  3IO1 A;  3ISX A;  3D7G A;  3PEI A;  4JZ0 A;  2CF4 A;  4NGM A;  4IHM A;  4ZX9 A;  3DLJ A;  2IJZ A;  2BO9 A;  3FJU A;  3MRU A;  2ZEH A;  2HB6 A;  2PJ6 A;  3FH4 A;  4ONW A;  4PXB A;  4X3R A;  2O4H A;  1TKH A;  3I74 A;  2G9D A;  4B6Z A;  1IGB A;  2BCO A;  1ZLH A;  1YW4 A;  3GB0 A;  2PJ1 A;  4OC0 A;  3SI2 A;  5D29 A;  2V8H A;  3CPA A;  7CPA A;  4UEE A;  2GU2 A;  4PQA A;  3H8F A;  3KI9 A;  2CIJ A;  4OC5 A;  2JBJ A;  1CPS A;  3PBE A;  4X2T A;  2OOT A;  4PXE A;  1Z2L A;  3B3T A;  4NJQ A;  4EWT A;  3D68 A;  4NJR A;  4BD9 A;  3H8G A;  4F9U A;  4MHZ A;  3B7I A;  4MCP A;  3B3V A;  4NGN A;  3VAT A;  4P4J A;  2F7V A;  1LFW A;  1LOK A;  3CDX A;  3WAB A;  1NSA A;  4CDJ A;  3KR5 A;  1LAM A;  1ELL P;  4OKO A;  3NH4 A;  2PCU A;  5LRJ A;  1R43 A;  3BXM A;  3FMC A;  1TF8 A;  3NFZ A;  3EIF A;  2AFW A;  4TWE A;  4LQG A;  4MRI A;  4C9V A;  3V38 A;  1QMU A;  4ZY2 A;  1HDU A;  2ZEE A;  1VHO A;  3B2Y A;  3D66 A;  3WC6 A;  4P4B A;  3NH8 A;  4PXC A;  4OC1 A;  3IJ3 A;  4C9E A;  1VHE A;  3KR4 A;  3D7H A;  1BPM A;  3WT4 A;  4KSI A;  3SJF A;  2XEJ A;  1ELM P;  5LYD A;  2CTC A;  2V8D A;  3PBB A;  2ZOG A;  4UIB A;  3KQX A;  5DS0 A;  4CPA A;  4YN3 A;  4R76 A;  4UIA A;  3K9T A;  2PVW A;  2PJB A;  3PB9 X;  2PJ2 A;  5F09 A;  2QYV A;  5I4M A;  3FEE A; 
#chains in the Genus database with same CATH topology
 1N71 A;  5C88 A;  3V7Z A;  5J3X A;  1YX0 A;  2VQY A;  1Q7L A;  1YME A;  1VKC A;  2Z3N A;  3DR8 A;  2V77 A;  4OID A;  2OZG A;  1WK4 A;  1Y7R A;  5BWA B;  2QIR A;  3F8K A;  2JEW A;  3FX6 A;  1LRZ A;  2Q7B A;  4QBJ A;  2EUI A;  5LYI A;  3IGR A;  4DNC A;  3PGP A;  1X10 A;  3HPG G;  2D4P A;  2J8M A;  2PJ7 A;  3BJ8 A;  5HVF A;  2Q4V A;  5D8N A;  1LCP A;  4A94 A;  2B0A A;  1CE8 B;  5JPH A;  4C85 A;  2ZPA A;  4P4E A;  4MXU A;  5EC4 A;  2Z3L A;  5K8N A;  3E0K A;  1RTQ A;  4DUK A;  1KC7 A;  1IOI A;  4YFJ A;  1M4D A;  2QJ8 A;  1EO0 A;  1B6B A;  5IB9 A;  2JLM A;  1ZG7 A;  5HKY A;  4NGQ A;  5AXI A;  2B4B A;  2C6G A;  1TXR A;  2IQ6 A;  4FAI A;  1NE9 A;  4MCR A;  4RN7 A;  4MJ8 A;  2V8G A;  3B3S A;  2AFU A;  4UEZ A;  5ELY A;  1PUA A;  1Z8L A;  1ZYM A;  3QB8 A;  4XNH B;  2Y1M A;  4EFD A;  1PCA A;  2HI6 A;  3DDD A;  2FS5 A;  2AFX A;  3CXS A;  1EE3 P;  1C3O B;  4L8A A;  1VI4 A;  3R95 A;  2PE3 A;  3LMS A;  3FRM A;  4J3G A;  1QSM A;  4YRH A;  3U88 C;  3HPH E;  3SI1 A;  1J4J A;  3JVN A;  3IWE A;  3PRT A;  2J8R A;  2DEA A;  2K5T A;  1ZO0 A;  4DYO A;  4A32 A;  3D67 A;  4CYQ A;  2YGW A;  5FD8 A;  2RC4 A;  1F2O A;  5E96 A;  2O53 A;  4ZY0 A;  3D7F A;  3TLG B;  5AG7 A;  1RO5 A;  2V8V A;  3SI0 A;  5DWN A;  2OB0 A;  2Q4Y A;  5JGF A;  1CS0 B;  3PB6 X;  4B5P A;  4IUS A;  3TT2 A;  3KQZ A;  4M85 A;  4QVT A;  2PJ0 A;  4KOS A;  4P4F A;  1TKJ A;  3I3G A;  1M6V B;  4P4D A;  1PU9 A;  1KEE B;  3PFE A;  4AG7 A;  1X12 A;  2WSA A;  1S7F A;  2CNT A;  2C6C A;  4QC6 A;  4A38 A;  2OLS A;  3BUX B;  2FIA A;  4PK3 A;  5HMN A;  4KNG E;  4MMO A;  5K8M A;  2EWB A;  4K3N A;  3LD2 A;  3S9N A;  5G20 A;  3FIX A;  1YVO A;  1V6C A;  3NE7 A;  1CM0 A;  1WJT A;  3JRU A;  4MHN A;  4P10 A;  3IIB A;  4K30 A;  1QQ9 A;  2HQY A;  1A2Z A;  2FSR A;  3IWW A;  3PZJ A;  4XPK A;  1F57 A;  3C8O A;  1S7L A;  3H5Z A;  4G1P A;  4F6A A;  1DE4 C;  1R61 A;  2N3A B;  3VRR A;  4OC3 A;  1M44 A;  1OZP A;  2GLJ A;  2GRE A;  4XPL A;  3T90 A;  2FE7 A;  2QEC A;  2ZEP A;  4B10 A;  3DR6 A;  3BLN A;  4KOY A;  4KZT A;  5IX3 A;  1P0H A;  4H6U A;  4KOU A;  1XBU A;  4UFV A;  2RFH A;  3B3W A;  2B4D A;  2B5G A;  1BPN A;  4JYW A;  4H89 A;  2B3V A;  4KS9 A;  4MHD A;  4RS2 A;  2AFO A;  1IID A;  2ZED A;  3WR7 A;  3PFO A;  4E94 A;  3BUW B;  2AUM A;  4C8P A;  4DJL A;  1Z4E A;  1T36 B;  5AGE A;  2FVG A;  2Q43 A;  4C8C A;  2QVP A;  3VTA A;  4J0N A;  5AG5 A;  1XJO A;  5LYL A;  3TE4 A;  3BUO B;  2P6F A;  4UWI A;  4XPD C;  4CGP A;  3ICU A;  4C9R A;  2DPS A;  1P4N A;  4CRZ B;  5H86 A;  3GJZ A;  1Z8T A;  3GIU A;  3PB8 X;  3N5F A;  4JD6 A;  2IMO A;  3D2M A;  1ZG9 A;  5KTD A;  2VEZ A;  4MCQ A;  4NGR A;  3LWU A;  3R9E A;  3TTH A;  2F8H A;  4CRY B;  3TFY A;  2DPT A;  3I6S A;  2FL4 A;  4M3S A;  1ARL A;  3B35 A;  4X8I A;  4C68 A;  1R57 A;  4CAW A;  2ZEO A;  1XFO A;  3S6F A;  5F48 A;  3UY5 A;  2VL1 A;  1KUV A;  1J3L A;  3D7D A;  5GCN A;  3ZJ0 A;  5HVH A;  4MI1 A;  4YWY A;  3FNC A;  4UF4 A;  2WYR A;  3RZA A;  1CP6 A;  1M4L A;  5JH9 A;  3B8G A;  4HNY B;  4JLY A;  4TJV A;  4CGM A;  3B3C A;  4F9V A;  4Y49 C;  1XF1 A;  2NSM A;  4OP4 A;  1CBX A;  4U9Y A;  2PJ5 A;  5HKZ A;  2ZOF A;  4M6G A;  3VWE A;  2HWG A;  1B87 A;  5IB0 A;  3HLP A;  4FD7 A;  1CP7 A;  2HUZ A;  3KHX A;  1BAV A;  3NH5 A;  5CBM A;  1FY7 A;  4PPZ A;  1KUX A;  2A4N A;  1XF8 A;  2WZN A;  2VXK A;  3KRV A;  2Z3O A;  2EVN A;  1AYE A;  4FD6 A;  2C1C A;  4HPS A;  2CXA A;  3R1K A;  4UA3 A;  1ZG8 A;  4MFL A;  4UEF A;  1JQG A;  3C26 A;  3I1U A;  1GGO A;  4E5S A;  4ZGY B;  5F13 A;  2XEI A;  5KTA A;  4B5O A;  2DIK A;  4BBH A;  3PT1 A;  1BO4 A;  3VAR A;  2CY2 A;  4TJX A;  5AG4 A;  2P6G A;  2AUN A;  2ABZ A;  2IL4 A;  2Z11 A;  3SJG A;  3GY9 A;  2Q44 A;  3KGQ A;  2ODF A;  2ZW5 A;  2I79 A;  4I49 A;  5G21 A;  2ZEL A;  2WPX A;  4GS4 A;  4BIN A;  3S9M A;  3KKW A;  3QNV A;  2PJ4 A;  3F5B A;  3KHZ A;  5HVG A;  2X0S A;  4A37 A;  3L2N A;  2PJ3 A;  2POK A;  3NE8 A;  4FBE A;  3BI1 A;  1TKF A;  4P44 A;  4GXH A;  1XMT A;  4WWV A;  3T9Y A;  3TC8 A;  4ZY1 A;  3GUX A;  4II9 A;  1ZRS A;  1VGY A;  1KUY A;  2D0P A;  1I1D A;  2BSW A;  2PSW A;  5HXD A;  5LYF A;  2OR4 A;  4KLV A;  3VH9 A;  4KSF A;  2B5G B;  4ZBG A;  4AXV A;  4Z65 A;  4H6Z A;  1WWZ A;  6CPA A;  1L0C A;  1Y7E A;  2PRQ A;  4KOV A;  3FB3 A;  3I9S A;  3S6H A;  4A2Z A;  4MJX A;  8CPA A;  2PR1 A;  1Z9E A;  4CYO A;  1QSN A;  4MCS A;  3P2H A;  4R6T A;  3TX8 A;  3VWD A;  4MFZ A;  4A95 A;  5I0C A;  4LQ6 A;  3R9G A;  1JDB C;  2C6P A;  1JWQ A;  2XEF A;  1Q2D A;  4LUA A;  4CAX A;  2DF5 A;  4R8F A;  4COB A;  1VHS A;  2Q51 A;  2VZY A;  4IK2 A;  3S9L A;  2JEV A;  2Y0M A;  4ZX8 A;  3W91 A;  4C84 A;  2OZH A;  5JYB A;  2Q0Y A;  5AG6 A;  2PJ8 A;  4NGT A;  4HNX B;  4B13 A;  3EZA A;  4C8U A;  3ZNI A;  4OIW A;  2JBK A;  1HDQ A;  3DGV A;  4C9A A;  2PVV A;  1U6M A;  3GKR A;  1M4I A;  3WC7 A;  5F47 A;  1SQH A;  1Q2Y A;  4FWU A;  4IAV A;  1XMB A;  2PIZ A;  4JVO A;  2XPL A;  4CGO A;  2EK9 A;  4OC4 A;  4MFJ A;  4CGL A;  5EMI A;  3V8I A;  5F46 A;  3KAS A;  4Q38 A;  1IYK A;  1PYT B;  3PB4 X;  2P0W A;  3ISZ A;  4MFP A;  1YRE A;  2OZU A;  2AJ6 A;  4JJX A;  2B3U A;  1YW6 A;  3CXP A;  2I00 A;  4CGN A;  2FT0 A;  4A4B A;  1TIQ A;  2GLF A;  3RBU A;  4OAD A;  2OU2 A;  4C9U A;  2Q7S A;  1A9X B;  1ARM A;  2YNC C;  3S6G A;  1Y9W A;  4PK2 A;  1C30 B;  5F9M A;  4C8F A;  2Z3K A;  5JM6 A;  4R57 A;  4UBR A;  1XRY A;  5IR2 A;  3FF3 A;  3QAY A;  4R87 A;  2HC9 A;  3WC5 A;  3PB7 X;  2J8N A;  2I3C A;  2C5Q A;  3KL9 A;  4UWJ A;  2BOA A;  5CNP A;  4PSW A;  3OB2 B;  2WUU A;  3IC1 A;  2Q4Z A;  3NFQ A;  2AFZ A;  2PJA A;  1I21 A;  1H8L A;  2DXQ A;  4FD5 A;  4A39 A;  3SXN A;  2YJV A;  1I12 A;  3HUV A;  1YLO A;  3SJE A;  4BTF A;  4MHY A;  4UCM A;  1K4J A;  3RAM A;  3G23 A;  1YK3 A;  4LX9 A;  1Y9Z A;  4OC2 A;  1S5K A;  1S7K A;  5J1Q A;  3FYN A;  1ZL0 A;  4GM5 A;  4H2K A;  1FNO A;  5C82 A;  1DIK A;  3T8W A;  2DLA A;  2PR8 A;  2XPN A;  2GP4 A;  2FIW A;  4CO9 A;  1FT7 A;  4OME A;  3VRQ A;  3TLC A;  1IB1 E;  2B4D B;  1NBW A;  4IIX A;  3EZB A;  4NGS A;  3TO9 A;  3SHP A;  1XOV A;  1Z5R A;  1NSL A;  1R3N A;  1VBH A;  3EXN A;  2UV8 G;  1GYT A;  1UWY A;  3CXQ A;  3TLZ A;  2O28 A;  4IF5 A;  2ZW6 A;  1WVM A;  1IU8 A;  2EK8 A;  2GE3 A;  4KOX A;  4F8Z A;  5IV0 A;  2D0O A;  3BUM B;  1CJW A;  1S60 A;  4FUU A;  3D2P A;  4OLL A;  2CNM A;  5LRK A;  5LRG A;  3T05 A;  4KOT A;  1BXR B;  4NFR A;  3GLJ A;  5FVJ A;  1AMP A;  4MY3 A;  2ZEG A;  4NCZ A;  2HRO A;  3IEH A;  3P2F A;  1YSJ A;  4MFQ A;  2ZEN A;  4KOR A;  3D4U A;  4A31 A;  4M8D A;  2RB7 A;  2B4J C;  2BL1 A;  4P4I A;  3BHX A;  1VIX A;  2X7B A;  4KSA A;  3SXO A;  4E2A A;  1NXJ A;  5H84 A;  5F49 A;  2VZZ A;  1CX8 A;  4JXQ A;  2AFS A;  4O23 A;  2XEG A;  1EZA A;  4ZI6 A;  2QML A;  5CPA A;  1F2P A;  4YU9 A;  5DWM A;  2ANP A;  3G8W A;  3BI0 A;  1OBR A;  2CTB A;  2PRB A;  2F5I A;  4KVX A;  4PXD A;  3O8Z A;  2PIY A;  3JUW A;  5THW A;  3MN8 A;  1BLL E;  2AFM A;  1TF9 A;  2R1I A;  4AB7 A;  1XE4 A;  4EME A;  2EZB A;  1YLE A;  1IY7 A;  2Y1N A;  2H5M A;  3JTK A;  2G3T A;  2XPP A;  3CT9 A;  5JQ4 A;  1VBG A;  3NOJ A;  3EZE A;  4R7M A;  4INJ A;  2G3A A;  4A4C A;  1Y0Y A;  3F0A A;  1Z4R A;  1Q5X A;  4RUH A;  3IFE A;  5K8O A;  4C8A A;  1CPX A;  3H8E A;  5G1Z A;  3OB1 B;  3RYO A;  1IOF A;  1MJA A;  1LAN A;  2YJT A;  4P45 A;  3FVL A;  2PCN A;  3K2K A;  5K8P A;  2BEI A;  4C8T A;  3TOA A;  2NMT A;  4C99 A;  5J8F A;  3TO7 A;  3CPX A;  4XPD B;  1ZLI A;  5A28 A;  1IYL A;  4CDK A;  3EC4 A;  3KZW A;  2D4O A;  4R3L A;  4XNH C;  3SJX A;  3PFV A;  4F0X A;  2EZC A;  2AE6 A;  4P6Y A;  4Q36 A;  3PLF B;  4MBU A;  3BUN B;  2FM4 A;  3TOB A;  4C86 A;  4AG9 A;  4B14 A;  2PJ9 A;  3FEC A;  4W9Y A;  1XEB A;  4MHP A;  1KBL A;  2ZEM A;  4RR2 B;  1GHE A;  2GAN A;  4BPX B;  4HNW B;  4TNU A;  4JWP A;  4Q7A A;  3FED A;  1Y0R A;  4WJB A;  3BJ7 A;  5EBV A;  3RO0 A;  3K4I A;  5K99 A;  1CG2 A;  2Z0Z A;  1DTD A;  1LAP A;  2JDD A;  2J9A A;  3EY5 A;  3GYA A;  3K9U A;  3U1B A;  2CNS A;  4Y49 B;  4NEX A;  1KWM A;  1QSO A;  2PJC A;  3IU2 A;  4C7H A;  1HEE A;  3RNZ A;  1Z8X A;  4NGP A;  1Y9K A;  3T07 A;  4QUS A;  2ARH A;  3LAC A;  3NA6 A;  4C2Y A;  2ZW7 A;  2ZEF A;  4KOW A;  4ZYQ A;  4NSQ A;  2NYQ A;  3IO1 A;  4IIY A;  3TLG A;  5BY0 A;  1ON0 A;  3ISX A;  2EO8 A;  3D7G A;  5HH1 A;  3DSB A;  3PEI A;  4JZ0 A;  2PC1 A;  1KZF A;  2ZXV A;  3EO4 A;  3T5M A;  2FCK A;  1YR0 A;  2CF4 A;  4CAF A;  4E8O A;  4NGM A;  3R9F A;  4C2Z A;  3TLE A;  4U5Y A;  4IHM A;  4E0A A;  4BMH A;  4F0Y A;  4ZX9 A;  1YGH A;  2IJZ A;  3DLJ A;  5JVL A;  3OP0 A;  2BO9 A;  2MP0 A;  4AVA A;  3FJU A;  2WPW A;  1Z9U A;  5HKW A;  2VBQ A;  3MRU A;  2ZEH A;  3W6S A;  4CAV A;  2HB6 A;  2PJ6 A;  4COG A;  3OAK A;  3FH4 A;  4NF1 A;  4ONW A;  4BPU B;  4PXB A;  4X3R A;  2O4H A;  1Z8W A;  4UFW A;  1S7N A;  2BUE A;  1TKH A;  2YNE A;  4MFK A;  3I74 A;  2G9D A;  4B12 A;  4B6Z A;  3N7Z A;  4KLW A;  1IGB A;  2BCO A;  5F1Y A;  3A9L A;  1ZLH A;  1YW4 A;  4UCN A;  4GPL B;  2EBJ A;  3GB0 A;  3R96 A;  2P6E A;  1S3Z A;  2PJ1 A;  3S6K A;  3IU1 A;  4FD4 A;  1B47 A;  2Z3P A;  4QB9 A;  4A33 A;  1YVH A;  4AVC A;  4NXY A;  4OC0 A;  2Q04 A;  2YND A;  4AVB A;  3TO6 A;  3SI2 A;  5D29 A;  4CAE A;  4H1H A;  2V8H A;  3CPA A;  3PP9 A;  4PSX A;  2R7H A;  7CPA A;  3H4Q A;  3D8P A;  4MY0 A;  4UEE A;  2GU2 A;  2OH1 A;  4KUA A;  4PQA A;  3H8F A;  3HMJ G;  3MGD A;  4C2X A;  3KI9 A;  5G22 A;  4PV6 A;  2CIJ A;  2R8V A;  4OC5 A;  2JBJ A;  1CPS A;  1QST A;  3PBE A;  2B58 A;  2OOT A;  4PXE A;  4X2T A;  2EZA A;  4HKF A;  1FBV A;  1Z2L A;  4B11 A;  3B3T A;  1YQE A;  4ORF A;  3TYX A;  2VKZ G;  4BPW B;  1Q2C A;  3W6X A;  4NJQ A;  3DNS A;  4EWT A;  3D68 A;  4CYN A;  3VGO A;  1RXT A;  1MJB A;  3QAH A;  3H8G A;  4KVM E;  2GFQ A;  4NJR A;  4OAE A;  4BD9 A;  1MJ9 A;  4F9U A;  4MHZ A;  2XPO A;  4M6I A;  3B7I A;  4MCP A;  3B3V A;  1YVK A;  3TLB A;  4NGN A;  4M6H A;  3FXT A;  2VI7 A;  3VAT A;  4CS0 B;  4P4J A;  2F7V A;  5A27 A;  1LFW A;  1LOK A;  2ZW4 A;  3EFA A;  3LOD A;  3CDX A;  2GIV A;  4X5K A;  5ISV A;  2Z10 A;  1UFH A;  3WAB A;  1NSA A;  3D3S A;  4CDJ A;  3KR5 A;  2G0B A;  3OWC A;  5F5X A;  4C7I A;  3F9K C;  4UFX A;  4CYP A;  1LAM A;  1ELL P;  2R82 A;  4OKO A;  3NH4 A;  2PCU A;  5LRJ A;  3VRO A;  1R43 A;  3BXM A;  2CBL A;  2REF A;  3FMC A;  1TF8 A;  3NFZ A;  3EIF A;  2AFW A;  3G3S A;  4TWE A;  2REE A;  4LQG A;  1EZB A;  2PDO A;  4MRI A;  4CZ1 A;  2Z3M A;  4C9V A;  2FXF A;  1BOB A;  3V38 A;  1QMU A;  3IWG A;  1HDU A;  1XIX A;  4ZY2 A;  3ZZI A;  4U9Z A;  2PQ8 A;  2ZEE A;  1VHO A;  4RI1 A;  4EVY A;  3B2Y A;  1NMT A;  3D66 A;  4KUB A;  3WC6 A;  2JDC A;  3CZX A;  4KVO E;  4L89 A;  4P4B A;  3VRP A;  3NH8 A;  4B5P B;  2HV2 A;  2ATR A;  4PXC A;  4OC1 A;  3IJ3 A;  4C9E A;  1VHE A;  2C27 A;  3KR4 A;  3D7H A;  1BPM A;  4ONU A;  1QSR A;  4JXR A;  4KSI A;  3TCV A;  3WT4 A;  3TLA A;  3SJF A;  2YNC A;  3VRN A;  1MK4 A;  2E28 A;  3SR3 A;  4YGO A;  2XEJ A;  1ELM P;  1V0C A;  2R98 A;  5LYD A;  3FBU A;  2CTC A;  4R9M A;  4EYS A;  1IIC A;  2V8D A;  4A30 A;  5KTC A;  3PBB A;  2ZOG A;  1M1D A;  1M4G A;  4UIB A;  3KQX A;  5DS0 A;  4CPA A;  4YN3 A;  2KCW A;  4MI4 A;  4R76 A;  3T0T A;  4UIA A;  3K9T A;  2PVW A;  1AUG A;  2PJ2 A;  2PJB A;  3PB9 X;  4UCP A;  4R3K A;  3TLY A;  5F09 A;  2QYV A;  5J8C A;  5I4M A;  3FEE A;  1JDE A; 
#chains in the Genus database with same CATH homology
 3V7Z A;  1Q7L A;  1YME A;  4OID A;  2V77 A;  2JEW A;  3FX6 A;  5LYI A;  2PJ7 A;  5HVF A;  5D8N A;  1LCP A;  4A94 A;  4C85 A;  4P4E A;  4MXU A;  5K8N A;  1RTQ A;  4DUK A;  2QJ8 A;  5IB9 A;  1ZG7 A;  4NGQ A;  2C6G A;  1TXR A;  2IQ6 A;  4FAI A;  4MCR A;  2V8G A;  3B3S A;  2AFU A;  4UEZ A;  5ELY A;  1Z8L A;  4EFD A;  1PCA A;  2AFX A;  1EE3 P;  2PE3 A;  3LMS A;  3SI1 A;  3PRT A;  2DEA A;  4DYO A;  3D67 A;  1F2O A;  2O53 A;  4ZY0 A;  3D7F A;  5JGF A;  2V8V A;  3SI0 A;  3PB6 X;  3KQZ A;  2PJ0 A;  4P4F A;  1TKJ A;  4P4D A;  3PFE A;  2C6C A;  4A38 A;  4KNG E;  4MMO A;  5K8M A;  2EWB A;  4K3N A;  3S9N A;  1V6C A;  4MHN A;  3JRU A;  4P10 A;  3IIB A;  1QQ9 A;  3IWW A;  1F57 A;  4G1P A;  1DE4 C;  4OC3 A;  2GLJ A;  2GRE A;  2ZEP A;  1XBU A;  2RFH A;  3B3W A;  1BPN A;  4JYW A;  4Z65 A;  2AFO A;  2ZED A;  3PFO A;  4C8P A;  4DJL A;  2FVG A;  2Q43 A;  4C8C A;  2QVP A;  3VTA A;  1XJO A;  5LYL A;  3ICU A;  4C9R A;  3PB8 X;  3N5F A;  2IMO A;  1ZG9 A;  4MCQ A;  4NGR A;  3LWU A;  2F8H A;  3I6S A;  1ARL A;  3B35 A;  4X8I A;  2ZEO A;  1XFO A;  2VL1 A;  3D7D A;  5HVH A;  4YWY A;  4UF4 A;  2WYR A;  3RZA A;  1CP6 A;  1M4L A;  5JH9 A;  4TJV A;  3B3C A;  4F9V A;  1XF1 A;  2NSM A;  4OP4 A;  1CBX A;  2PJ5 A;  2ZOF A;  3HLP A;  1CP7 A;  3KHX A;  1BAV A;  3NH5 A;  5CBM A;  4PPZ A;  2WZN A;  1AYE A;  2C1C A;  1ZG8 A;  4UEF A;  1JQG A;  3I1U A;  2XEI A;  3VAR A;  4TJX A;  2ABZ A;  3SJG A;  3KGQ A;  2ZEL A;  3S9M A;  3QNV A;  2PJ4 A;  3KHZ A;  5HVG A;  4A37 A;  3L2N A;  2PJ3 A;  2POK A;  4FBE A;  3BI1 A;  1TKF A;  4P44 A;  3TC8 A;  4WWV A;  4ZY1 A;  3GUX A;  1VGY A;  5LYF A;  5HXD A;  2OR4 A;  3VH9 A;  4AXV A;  6CPA A;  2PRQ A;  1Y7E A;  8CPA A;  3TX8 A;  4MCS A;  4R6T A;  2C6P A;  2XEF A;  4R8F A;  2Q51 A;  4IK2 A;  3S9L A;  4ZX8 A;  4C84 A;  2PJ8 A;  4NGT A;  4C8U A;  4OIW A;  2JBK A;  1HDQ A;  3DGV A;  4C9A A;  2PVV A;  3WC7 A;  4FWU A;  4IAV A;  1XMB A;  2PIZ A;  2EK9 A;  4OC4 A;  3KAS A;  1PYT B;  3PB4 X;  3ISZ A;  1YW6 A;  2GLF A;  3RBU A;  4C9U A;  1ARM A;  4C8F A;  5JM6 A;  1XRY A;  5IR2 A;  3FF3 A;  3WC5 A;  2HC9 A;  3PB7 X;  2I3C A;  2C5Q A;  3KL9 A;  2BOA A;  3IC1 A;  2Q4Z A;  2AFZ A;  2PJA A;  1H8L A;  4A39 A;  3HUV A;  4MHY A;  1YLO A;  3SJE A;  3RAM A;  1Y9Z A;  4OC2 A;  5J1Q A;  4GM5 A;  4H2K A;  1FNO A;  3T8W A;  2GP4 A;  1FT7 A;  4OME A;  4NGS A;  1Z5R A;  1R3N A;  1GYT A;  1UWY A;  1WVM A;  2EK8 A;  4F8Z A;  4FUU A;  5LRK A;  5LRG A;  4NFR A;  3GLJ A;  1AMP A;  2ZEG A;  3IEH A;  1YSJ A;  2ZEN A;  3D4U A;  2RB7 A;  4P4I A;  3BHX A;  1VIX A;  1CX8 A;  2AFS A;  4O23 A;  2XEG A;  4ZI6 A;  5CPA A;  1F2P A;  4YU9 A;  2ANP A;  3BI0 A;  1OBR A;  2CTB A;  5THW A;  4RUH A;  4PXD A;  2PIY A;  3MN8 A;  1BLL E;  2AFM A;  1TF9 A;  4EME A;  1IY7 A;  3CT9 A;  4R7M A;  1Y0Y A;  3IFE A;  5K8O A;  4C8A A;  1CPX A;  3H8E A;  1LAN A;  4P45 A;  3FVL A;  3K2K A;  5K8P A;  4C8T A;  4C99 A;  3CPX A;  1ZLI A;  4CDK A;  3KZW A;  3SJX A;  4P6Y A;  4C86 A;  2PJ9 A;  4MHP A;  3FEC A;  4W9Y A;  2ZEM A;  4TNU A;  4WJB A;  4Q7A A;  3FED A;  1Y0R A;  1CG2 A;  1DTD A;  1LAP A;  2J9A A;  1KWM A;  2PJC A;  1HEE A;  4NGP A;  3NA6 A;  4ZYQ A;  2ZEF A;  2NYQ A;  3IO1 A;  3ISX A;  3D7G A;  3PEI A;  4JZ0 A;  2CF4 A;  4NGM A;  4IHM A;  4ZX9 A;  3DLJ A;  2IJZ A;  2BO9 A;  3FJU A;  3MRU A;  2ZEH A;  2HB6 A;  2PJ6 A;  3FH4 A;  4ONW A;  4PXB A;  4X3R A;  2O4H A;  1TKH A;  3I74 A;  2G9D A;  4B6Z A;  1IGB A;  2BCO A;  1ZLH A;  1YW4 A;  3GB0 A;  2PJ1 A;  4OC0 A;  3SI2 A;  5D29 A;  2V8H A;  3CPA A;  7CPA A;  4UEE A;  2GU2 A;  4PQA A;  3H8F A;  3KI9 A;  2CIJ A;  4OC5 A;  2JBJ A;  1CPS A;  3PBE A;  4X2T A;  2OOT A;  4PXE A;  1Z2L A;  3B3T A;  4NJQ A;  4EWT A;  3D68 A;  4NJR A;  4BD9 A;  3H8G A;  4F9U A;  4MHZ A;  3B7I A;  4MCP A;  3B3V A;  4NGN A;  3VAT A;  4P4J A;  2F7V A;  1LFW A;  1LOK A;  3CDX A;  3WAB A;  1NSA A;  4CDJ A;  3KR5 A;  1LAM A;  1ELL P;  4OKO A;  3NH4 A;  2PCU A;  5LRJ A;  1R43 A;  3BXM A;  3FMC A;  1TF8 A;  3NFZ A;  3EIF A;  2AFW A;  4TWE A;  4LQG A;  4MRI A;  4C9V A;  3V38 A;  1QMU A;  4ZY2 A;  1HDU A;  2ZEE A;  1VHO A;  3B2Y A;  3D66 A;  3WC6 A;  4P4B A;  3NH8 A;  4PXC A;  4OC1 A;  3IJ3 A;  4C9E A;  1VHE A;  3KR4 A;  3D7H A;  1BPM A;  3WT4 A;  4KSI A;  3SJF A;  2XEJ A;  1ELM P;  5LYD A;  2CTC A;  2V8D A;  3PBB A;  2ZOG A;  4UIB A;  3KQX A;  5DS0 A;  4CPA A;  4YN3 A;  4R76 A;  4UIA A;  3K9T A;  2PVW A;  2PJB A;  3PB9 X;  2PJ2 A;  5F09 A;  2QYV A;  5I4M A;  3FEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...