4MCQA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyldi-gamma-l-glutamic acid (pteroyltri-gamma-l-glutamic acid)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
695
structure length
692
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 268
structure length 692
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcqA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcqA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcqA02
1YLOA 4C8FA 3ICUA 4ZX9A 1ZG9A 3DGVA 4TWEA 2EWBA 1PCAA 3S9NA 1ARMA 4F9UA 4K3NA 1QQ9A 2AFOA 3D7HA 3WC7A 3D67A 5LRJA 3KR5A 3SJGA 4C99A 2I3CA 1TF9A 2Q51A 4C85A 5K8MA 4W9YA 2F7VA 4CDKA 1XBUA 1PYTB 1XFOA 1NSAA 3NH4A 3D66A 4RUHA 2PE3A 5JH9A 3PBBA 3MRUA 5LYDA 3IEHA 4DJLA 2CTBA 5K8NA 2F8HA 4MCSA 2AFWA 2ZEDA 3KASA 1TXRA 2EK9A 3QNVA 5D8NA 4MXUA 3FF3A 1HDQA 4F8ZA 2C6CA 4OC4A 2ZENA 4P45A 2WZNA 2V8VA 2O53A 3FMCA 4NGNA 1LCPA 4OC5A 3KL9A 4P44A 1TKJA 2VL1A 5ELYA 4P4JA 3D7FA 2IMOA 3B2YA 2ZEMA 1CX8A 2XEGA 2BCOA 2AFZA 1VHOA 1UWYA 2C6GA 4PPZA 4ZI6A 3V7ZA 3CT9A 3N5FA 4MCRA 7CPAA 3I1UA 2V8DA 1FT7A 4ZY0A 3IWWA 4TNUA 4YWYA 3NA6A 3B7IA 4NGMA 4FAIA 3NFZA 4UEZA 3IJ3A 2HB6A 4FBEA 3VH9A 1TF8A 5IB9A 2ZEPA 4PXCA 3NH5A 5I4MA 4R6TA 2WYRA 2AFSA 3SJXA 3KQXA 4ONWA 2IQ6A 5LYIA 2ZEOA 4Q7AA 1Y7EA 1CPXA 5CBMA 3SI0A 4O23A 4C8PA 4NJQA 3WABA 3KZWA 4NGPA 4IAVA 4MMOA 3PFEA 4FUUA 3KHZA 4P6YA 1XF1A 2HC9A 3FJUA 3FH4A 3HLPA 4KSIA 4C9VA 3RBUA 4X8IA 5LRKA 4NGTA 3MN8A 4UIAA 1LAPA 2JBKA 3JRUA 4OC1A 2EK8A 2ZOGA 3KQZA 3TC8A 1Z5RA 2PJ4A 2XEIA 2GU2A 3PB6X 2NYQA 2QYVA 4NGRA 1HDUA 3B35A 2ZEFA 4OKOA 3V38A 1QMUA 4UIBA 2V8HA 1CP6A 4WWVA 1LAMA 1KWMA 6CPAA 5D29A 2QVPA 1BPMA 3B3SA 3DLJA 1LANA 2ZEHA 2PJCA 3BI0A 4ZX8A 3ISXA 5THWA 2PCUA 4OC2A 4YN3A 2XEJA 4H2KA 4OC0A 4P4BA 4AXVA 3HUVA 2PJBA 3PB9X 4C8CA 1BPNA 1ARLA 2J9AA 1ELLP 3H8EA 3I74A 3SI1A 4NFRA 3B3TA 4JZ0A 3LMSA 4FWUA 4CPAA 3B3VA 3PEIA 1IGBA 2PJAA 2ZEEA 3RAMA 5JGFA 4MRIA 1YSJA 2PIYA 3VARA 3GLJA 5CPAA 4TJXA 2PJ3A 3PBEA 1H8LA 2PJ9A 3FEDA 3PB8X 3I6SA 4PXDA 4ZY2A 4UEEA 4G1PA 4EWTA 1ZG7A 3H8FA 2AFUA 5K8PA 2PJ8A 1XRYA 4A38A 3PFOA 2NSMA 5DS0A 1CPSA 1Y9ZA 1F57A 1XMBA 3VATA 4PXEA 1AYEA 2PJ1A 4OMEA 1TKFA 2PJ7A 3SI2A 3FECA 1OBRA 4EMEA 1EE3P 4MHZA 4B6ZA 3T8WA 2Q43A 1CBXA 4DUKA 4OC3A 4X3RA 3TX8A 1VGYA 2PJ6A 4TJVA 1V6CA 3LWUA 1CP7A 3K2KA 1LFWA 3KI9A 3FVLA 4OIWA 4UEFA 3KHXA 4KNGE 4P4EA 1XJOA 3BHXA 4ZY1A 1DE4C 3NH8A 2ZELA 4C86A 1ZLHA 1Z8LA 1CG2A 1ELMP 4CDJA 4NJRA 3IO1A 4NGSA 4MCPA 2O4HA 1R3NA 3SJFA 3CDXA 2ANPA 4OIDA 4A94A 1HEEA 2FVGA 5J1QA 2QJ8A 4P10A 1R43A 1M4LA 2CTCA 2Q4ZA 4MCQA 2OR4A 1VHEA 4C9RA 2ABZA 2PJ2A 4C8AA 3B3CA 3D7DA 4PXBA 5HVFA 5K8OA 3PB7X 3K9TA 3WC6A 1DTDA 2CIJA 2GLJA 2CF4A 4OP4A 1ZLIA 3CPAA 3D4UA 4BD9A 2RB7A 2C6PA 3EIFA 1Q7LA 3GB0A 3IIBA 5HXDA 2PRQA 1GYTA 2PJ0A 2ZOFA 2GLFA 1YW4A 4PQAA 4MHNA 4LQGA 2V77A 3GUXA 1Z2LA 1BLLE 5HVHA 1IY7A 3PRTA 2RFHA 4P4IA 2PJ5A 2OOTA 3ISZA 3WC5A 4C9UA 3VTAA 2BO9A 2V8GA 2AFMA 3PB4X 4YU9A 4WJBA 2XEFA 1TKHA 3FEEA 2IJZA 1WVMA 4C9AA 4JYWA 3FX6A 4Z65A 3H8GA 4P4DA 4F9VA 2PIZA 1ZG8A 5LRGA 1Y0YA 4C8UA 2ZEGA 1LOKA 4NGQA 4UF4A 3RZAA 2BOAA 3BXMA 1JQGA 4A37A 2JEWA 3D68A 1YMEA 4C9EA 4MHYA 4C8TA 5LYLA 5JM6A 2AFXA 5F09A 4R76A 1YW6A 3WT4A 4IK2A 3D7GA 3S9LA 3KR4A 4R7MA 2GREA 1BAVA 4A39A 3S9MA 3KGQA 5HVGA 4DYOA 3IC1A 2JBJA 3L2NA 3BI1A 4GM5A 2C1CA 2PVWA 1Y0RA 2DEAA 3SJEA 3IFEA 2G9DA 1F2OA 5LYFA 4EFDA 3CPXA 4ZYQA 1FNOA 3B3WA 1F2PA 1VIXA 4IHMA 4MHPA 4R8FA 4X2TA 4P4FA 1RTQA 1AMPA 2PVVA 4C84A 2POKA 8CPAA
chains in the Genus database with same CATH superfamily
1YLOA 4C8FA 2FIWA 4GPLB 4XPKA 4ZX9A 1YR0A 3TO7A 3ICUA 4MFLA 3TCVA 5F1YA 1ZG9A 1QSMA 3T05A 1S7KA 4MI4A 3DGVA 5ISVA 5I0CA 2ZPAA 3CZXA 4TWEA 1M44A 2EWBA 2HWGA 1PCAA 3S9NA 1IOIA 2QECA 3DSBA 1YQEA 4XPLA 1ARMA 2WUUA 4XNHB 3TLGA 2CY2A 4F9UA 4K3NA 1QQ9A 2AFOA 3D7HA 3WC7A 3VWDA 3D67A 5GCNA 5LRJA 4NCZA 4A33A 2EBJA 3KR5A 1XEBA 2FCKA 3CXQA 3SJGA 4C99A 2I3CA 1TF9A 2D4PA 5KTCA 4UBRA 2AUNA 2Q51A 3FXTA 2JEVA 4C85A 5K8MA 2VI7A 4H6ZA 3EFAA 1XF8A 4EYSA 2YNEA 4W9YA 5F13A 4KOTA 1VI4A 2F7VA 3JTKA 4H6UA 4CDKA 3NOJA 3T90A 1CJWA 3F0AA 1KEEB 3TLGB 1VHSA 1XBUA 1PYTB 1XFOA 2H5MA 4RI1A 4A95A 3IU1A 1NSAA 5F49A 3VRNA 2EZAA 3NH4A 1R57A 4CRZB 1KUXA 3D66A 4RUHA 5F9MA 4FD6A 2PE3A 4AVCA 3TOAA 5JH9A 3PBBA 3MRUA 2BL1A 2VZYA 5LYDA 5KTAA 3IEHA 1JDEA 4DJLA 2CTBA 4UWJA 4CGPA 2D4OA 5K8NA 2F8HA 4U9ZA 2P0WA 1PU9A 1NXJA 3OAKA 1KBLA 4MCSA 2AFWA 2ZEDA 3KKWA 4NSQA 3GY9A 3KASA 1TXRA 2EK9A 1I21A 3QNVA 5D8NA 5JVLA 3LODA 1XOVA 2REEA 4MFKA 4A2ZA 5F48A 3U88C 4CZ1A 4Y49C 2Z3OA 4KOVA 3R9EA 5F46A 4MXUA 5CNPA 3FF3A 5F5XA 1HDQA 4F8ZA 1KUYA 1RO5A 2VBQA 2C6CA 4QB9A 4COGA 2GIVA 2PR1A 1Q2YA 4OC4A 1NMTA 3SXNA 1MJAA 2ZENA 4P45A 3IWGA 3GJZA 1IU8A 2V8VA 2O53A 2WZNA 3FMCA 1QSRA 2FE7A 5EMIA 4CS0B 4NGNA 4EVYA 1LCPA 3D8PA 4A32A 4OC5A 3KL9A 2JLMA 4P44A 1TKJA 2VL1A 2R82A 2XPLA 4CRYB 5ELYA 4P4JA 4F6AA 3D7FA 1M1DA 2IMOA 2I79A 4E2AA 2PQ8A 3EO4A 3SHPA 4CGLA 3B2YA 5JQ4A 1NE9A 2FS5A 4JXQA 2ZEMA 4BPWB 1CX8A 2WSAA 2Z0ZA 3QB8A 2ZW5A 4FD7A 4OAEA 3DDDA 2D0PA 3I9SA 2WPWA 2XEGA 1X12A 2BCOA 4PV6A 2AFZA 1VHOA 1UWYA 3G3SA 2C6GA 4U9YA 4PPZA 5C82A 4ZI6A 3V7ZA 3GIUA 3OB1B 3BLNA 3CT9A 2B4JC 1WJTA 3N5FA 3R9FA 1BO4A 1SQHA 2Z3MA 4MCRA 7CPAA 5KTDA 3I1UA 3C26A 1FT7A 2V8DA 4M6IA 1B87A 1NSLA 4ZY0A 2YJTA 1B47A 3IWWA 4TNUA 1YVKA 2QMLA 2OB0A 3B7IA 3BJ7A 3NA6A 4YWYA 4AVBA 4C2XA 4R3KA 4Y49B 4NGMA 3R9GA 2C27A 4FAIA 4MFZA 4IIXA 5BY0A 3LD2A 2C5QA 3NFZA 4UEZA 1KUVA 3BUWB 1QSNA 2HB6A 3IJ3A 5AG5A 2Z11A 4FBEA 3U1BA 3VH9A 1TF8A 3KRVA 5IB9A 2ZEPA 4PXCA 3NH5A 2Y0MA 2FXFA 1S3ZA 4QUSA 4UA3A 2KCWA 4R6TA 5A28A 5I4MA 2ZXVA 1A2ZA 1I12A 2WYRA 2AFSA 3RNZA 4B10A 2CBLA 4KSAA 4NF1A 3SJXA 1VKCA 1XIXA 3KQXA 4ONWA 2IQ6A 5LYIA 4CGOA 2ZEOA 4Q7AA 3BUXB 4JXRA 1Y7EA 1CPXA 2FIAA 4CGMA 3NE7A 5AG6A 3TTHA 2REFA 5CBMA 4IF5A 3SI0A 1YVOA 4O23A 2ZW4A 3B8GA 3HPGG 3TOBA 4NJQA 3WABA 4C8PA 3KZWA 4UWIA 4NGPA 4OADA 4A31A 4R3LA 3PZJA 1LRZA 2EVNA 4IAVA 4MMOA 4LQ6A 4XPDC 4LX9A 3PFEA 4FUUA 1IYKA 4MFQA 2DPSA 2Z3LA 3KHZA 4P6YA 4UFVA 4DNCA 2HC9A 3FJUA 5JPHA 1XF1A 2G0BA 3TLBA 2B4DA 3FH4A 3HLPA 1IIDA 3S6FA 2BSWA 1Q2CA 4KSIA 4C9VA 3RBUA 4X8IA 5LRKA 4NGTA 4GXHA 3MN8A 4QC6A 4UIAA 2UV8G 4C7HA 3EZAA 1LAPA 2JBKA 1DIKA 3JRUA 3N7ZA 3IU2A 4JVOA 4CAEA 2PC1A 4OC1A 3G23A 2N3AB 2F5IA 4INJA 4UCNA 2EK8A 1S7LA 2G3AA 2JDCA 2ZOGA 4B12A 5FD8A 3UY5A 3BJ8A 1YVHA 3H4QA 3KQZA 3VROA 1Z5RA 3TC8A 1M6VB 1EZAA 1YX0A 4E0AA 2CNMA 4E94A 2PJ4A 2XEIA 2GU2A 4HPSA 3PB6X 2B4DB 2NYQA 4BINA 2QYVA 4NGRA 1HDUA 5BWAB 2B58A 1IYLA 3B35A 2AE6A 2ZEFA 3FYNA 4OKOA 4UCMA 3FIXA 3K9UA 4KVOE 4ORFA 1QMUA 2JDDA 3V38A 3V8IA 4JWPA 4UIBA 3PGPA 5JYBA 4CYQA 3QAHA 3BUOB 1J3LA 3EC4A 4PSXA 2V8HA 1CP6A 4WWVA 1LAMA 2PRBA 4MY3A 1KWMA 4KOYA 4CAFA 6CPAA 3W6XA 1JDBC 2J8MA 4B5PA 4F0YA 3D3SA 4U5YA 1M4GA 5D29A 2XPNA 1CM0A 2QVPA 1BPMA 4XPDB 3NFQA 4Q38A 1Z9EA 3T07A 3B3SA 4E8OA 3DLJA 2XPOA 1LANA 3OWCA 2GE3A 2Q04A 2PJCA 2ZEHA 1P4NA 2FSRA 4KS9A 3TO9A 3BI0A 1XE4A 3VRQA 4ZX8A 1MJBA 4H1HA 3ISXA 5THWA 3R96A 2PCUA 3IWEA 4OC2A 1Q2DA 2R7HA 5J8FA 2YJVA 4YN3A 4J3GA 2XEJA 3PFVA 2PSWA 4BTFA 2X7BA 1NBWA 4H2KA 4OC0A 4P4BA 2DPTA 4AXVA 2AJ6A 3HUVA 3SXOA 2B3VA 4B5PB 2PJBA 4KOWA 3R1KA 3PB9X 2EZCA 4C8CA 1BPNA 1ARLA 2YNDA 2ODFA 2XPPA 2J9AA 3C8OA 1ELLP 1YREA 3FB3A 3HMJG 2WPXA 3H8EA 5H86A 3SI1A 4QBJA 1ZL0A 3I74A 3S6HA 4NFRA 4BPXB 2DLAA 4RR2B 2P6GA 3B3TA 4JZ0A 3LMSA 4FWUA 4CPAA 3B3VA 5J3XA 1IGBA 2PJAA 2HV2A 2ZEEA 3PEIA 3NE8A 3RAMA 1Z9UA 4MRIA 5JGFA 2BUEA 2Q44A 2DF5A 1YSJA 3TT2A 2PIYA 3VARA 3GLJA 5IX3A 2CNSA 5CPAA 1PUAA 2EO8A 4F0XA 4TJXA 2PJ3A 3PBEA 1H8LA 2PJ9A 3FEDA 3TLYA 4CYNA 3PB8X 2VKZG 3I6SA 4C7IA 1JWQA 4PXDA 5DWNA 4MI1A 2Q4YA 4PK2A 4ZY2A 4ONUA 2R8VA 4M6GA 4UEEA 3EZEA 4G1PA 3LACA 3TE4A 4EWTA 4IIYA 1ZG7A 2OH1A 3H8FA 2AFUA 1S60A 5K8PA 1VBGA 3VWEA 4C68A 2PJ8A 1XRYA 3JUWA 5HH1A 3PFOA 3S6GA 3HPHE 2NSMA 3W91A 4A38A 3F9KC 4M3SA 1Z4RA 3OP0A 1CPSA 5DS0A 4AG7A 1Y9ZA 1GGOA 3K4IA 1F57A 1XMBA 1Z8XA 3VATA 4PXEA 5AG4A 1N71A 1AYEA 2VEZA 4B5OA 2PJ1A 4OMEA 1M4DA 1TKFA 2PJ7A 3SI2A 2Y1MA 2AUMA 4CYOA 3FECA 4CAXA 1J4JA 4A4CA 1OBRA 4CAWA 3GYAA 2E28A 4L89A 1S5KA 1L0CA 2HUZA 2Z3PA 4AVAA 4EMEA 3ZNIA 4X5KA 3CXPA 1EE3P 4MHZA 4B13A 2GFQA 2EUIA 4HNWB 4B6ZA 1Y9KA 3T8WA 1TIQA 2PCNA 2POKA 2Q43A 1CBXA 3T0TA 4DUKA 4KLVA 5AXIA 4OC3A 4X3RA 1IB1E 3TX8A 2ZW6A 2VQYA 4PK3A 1VGYA 2PJ6A 4TJVA 1V6CA 3VGOA 4KSFA 1Z4EA 3LWUA 4MFPA 4J0NA 1CP7A 5AGEA 3TYXA 3K2KA 1I1DA 1LFWA 1P0HA 2R98A 4M6HA 1KC7A 3KI9A 3FVLA 4OIWA 5AG7A 4UEFA 4MFJA 4KUBA 4CGNA 3P2FA 5G20A 4C9AA 2B4BA 3F8KA 3VRPA 3A9LA 5G1ZA 5C88A 4KOSA 3KHXA 1Z8TA 4KNGE 4P4EA 1S7NA 1XJOA 2QIRA 5HKZA 4RN7A 3BHXA 4ZGYB 4ZY1A 4BPUB 4IUSA 1DE4C 2J8NA 4GS4A 1GHEA 3NH8A 3IGRA 2DIKA 2ZELA 2DXQA 4C86A 1WWZA 1ZLHA 2P6FA 4OLLA 1Z8LA 1CG2A 1ELMP 3G8WA 1VBHA 2ZW7A 2BEIA 4CDJA 3D2PA 1U6MA 3PP9A 4NJRA 4K30A 3IO1A 2GP4A 4NGSA 3RYOA 1CE8B 2Z3NA 4JJXA 4MCPA 2O4HA 2HI6A 4M8DA 3O8ZA 1R3NA 3H5ZA 3BUNB 3EXNA 3SJFA 3CDXA 2ANPA 3TLCA 4OIDA 3DNSA 4H89A 2FM4A 3TO6A 3SR3A 4A94A 2MP0A 2Q7SA 4PSWA 1HEEA 5G22A 2FVGA 4COBA 5J1QA 2QJ8A 3FNCA 2B5GA 5IB0A 2K5TA 4L8AA 4P10A 4I49A 1Y7RA 1R43A 1M4LA 5FVJA 2CTCA 2Q4ZA 5A27A 4MCQA 2OR4A 2YNCC 5DWMA 1VHEA 1YGHA 1T36B 4YGOA 4C9RA 4AB7A 2ABZA 3E0KA 2PJ2A 4NEXA 3B3CA 3D7DA 4PXBA 5HVFA 4C8AA 2D0OA 5HMNA 3JVNA 2IL4A 1B6BA 2OZHA 3TLEA 3DR8A 5K8OA 3F5BA 3PB7X 3K9TA 4KOXA 3PLFB 1IOFA 3QAYA 3WR7A 3WC6A 2NMTA 4AG9A 1BOBA 1YLEA 1UFHA 4KVXA 1DTDA 2CIJA 2B5GB 4MJXA 2GLJA 2A4NA 2CF4A 4OP4A 5IV0A 4HNYB 1ZLIA 3CPAA 2B3UA 3D4UA 4BD9A 2RB7A 1ZRSA 4RS2A 2OU2A 4A30A 5HKWA 2C6PA 1QSTA 3EIFA 1CS0B 4KZTA 4B14A 1Q7LA 1MK4A 3GB0A 3IIBA 2YNCA 5HXDA 2PRQA 4UFXA 4C2YA 1GYTA 2PJ0A 2ZOFA 3T5MA 2GLFA 1YW4A 2CNTA 4PQAA 4MHNA 3ZJ0A 4LQGA 4FD5A 4KUAA 4B11A 2J8RA 2V77A 3GUXA 4KLWA 1Z2LA 1BLLE 1BXRB 4R87A 2Z10A 5HVHA 1IY7A 3PRTA 2Z3KA 2Q7BA 1FY7A 2FL4A 2RFHA 2O28A 4P4IA 2PJ5A 4KOUA 2OOTA 3ISZA 3WC5A 4C9UA 1OZPA 4KORA 1C3OB 3VTAA 3FBUA 1A9XB 2BO9A 4MJ8A 2V8GA 3MGDA 4C2ZA 2AFMA 4II9A 3PT1A 3PB4X 4YU9A 4WJBA 3P2HA 2XEFA 1TKHA 3FEEA 2IJZA 2OZUA 4M85A 4MHDA 1QSOA 2RC4A 1WVMA 4HNXB 4CAVA 3OB2B 4JYWA 1S7FA 3FX6A 3H8GA 4Z65A 4Q36A 1Q5XA 2Q0YA 3DR6A 1R61A 2P6EA 2YGWA 4YFJA 2FT0A 4P4DA 5J8CA 4A4BA 4F9VA 1XMTA 1ZG8A 2PIZA 4JD6A 2VZZA 5H84A 5LRGA 4NXYA 1C30B 1Y0YA 4C8UA 2ZEGA 1LOKA 4NGQA 4UF4A 2HQYA 4YRHA 4BMHA 3RZAA 3R95A 2BOAA 4R9MA 3BXMA 1JQGA 1Z8WA 2JEWA 4FD4A 4A37A 3D68A 4UFWA 1FBVA 1YMEA 1AUGA 2PDOA 2CXAA 4MHYA 1V0CA 3ZZIA 1ZYMA 4C9EA 5LYLA 4C8TA 5JM6A 2AFXA 5F09A 4R76A 1YW6A 4KVME 2VXKA 4QVTA 3WT4A 2X0SA 3CXSA 2GANA 3BUMB 4IK2A 3TLZA 2B0AA 4XNHC 3D7GA 3S9LA 2G3TA 1K4JA 3KR4A 1EZBA 5HKYA 4R7MA 2GREA 4BBHA 3RO0A 1BAVA 4HKFA 3I3GA 4A39A 3TFYA 3S9MA 1EO0A 5K99A 2EZBA 3KGQA 5IR2A 2Y1NA 5HVGA 1MJ9A 4DYOA 1RXTA 3T9YA 2PR8A 3IC1A 2JBJA 2I00A 4JLYA 3L2NA 1WK4A 3BI1A 3FRMA 2HROA 5G21A 4ZBGA 4R57A 3EY5A 1KZFA 1ON0A 3GKRA 2C1CA 4GM5A 2PVWA 4MBUA 3VRRA 3EZBA 1YK3A 2OLSA 1M4IA 4E5SA 2ARHA 1Y0RA 2DEAA 3SJEA 3IFEA 5F47A 3TLAA 2G9DA 5E96A 2OZGA 4CO9A 1F2OA 1IICA 3D2MA 4MY0A 3S6KA 5LYFA 4EFDA 1X10A 2Q4VA 1FNOA 3CPXA 4ZYQA 5EC4A 3W6SA 4CYPA 3B3WA 1F2PA 1VIXA 4LUAA 5EBVA 1Y9WA 2ATRA 4IHMA 2R1IA 4MHPA 4R8FA 4UCPA 4P4FA 1RTQA 1AMPA 2PVVA 4X2TA 1ZO0A 8CPAA 4C84A
chains in the Genus database with same CATH topology
1YLOA 4C8FA 3ICUA 4ZX9A 1ZG9A 3DGVA 4TWEA 2EWBA 1PCAA 3S9NA 1ARMA 4F9UA 4K3NA 1QQ9A 2AFOA 3D7HA 3WC7A 3D67A 5LRJA 3KR5A 3SJGA 4C99A 2I3CA 1TF9A 2Q51A 4C85A 5K8MA 4W9YA 2F7VA 4CDKA 1XBUA 1PYTB 1XFOA 1NSAA 3NH4A 3D66A 4RUHA 2PE3A 5JH9A 3PBBA 3MRUA 5LYDA 3IEHA 4DJLA 2CTBA 5K8NA 2F8HA 4MCSA 2AFWA 2ZEDA 3KASA 1TXRA 2EK9A 3QNVA 5D8NA 4MXUA 3FF3A 1HDQA 4F8ZA 2C6CA 4OC4A 2ZENA 4P45A 2WZNA 2V8VA 2O53A 3FMCA 4NGNA 1LCPA 4OC5A 3KL9A 4P44A 1TKJA 2VL1A 5ELYA 4P4JA 3D7FA 2IMOA 3B2YA 2ZEMA 1CX8A 2XEGA 2BCOA 2AFZA 1VHOA 1UWYA 2C6GA 4PPZA 4ZI6A 3V7ZA 3CT9A 3N5FA 4MCRA 7CPAA 3I1UA 2V8DA 1FT7A 4ZY0A 3IWWA 4TNUA 4YWYA 3NA6A 3B7IA 4NGMA 4FAIA 2C5QA 3NFZA 4UEZA 3IJ3A 2HB6A 4FBEA 3VH9A 1TF8A 5IB9A 2ZEPA 4PXCA 3NH5A 5I4MA 4R6TA 2WYRA 2AFSA 3SJXA 3KQXA 4ONWA 2IQ6A 5LYIA 2ZEOA 4Q7AA 1Y7EA 1CPXA 5CBMA 3SI0A 4O23A 4C8PA 4NJQA 3WABA 3KZWA 4NGPA 4IAVA 4MMOA 3PFEA 4FUUA 3KHZA 4P6YA 1XF1A 2HC9A 3FJUA 3FH4A 3HLPA 4KSIA 4C9VA 3RBUA 4X8IA 5LRKA 4NGTA 3MN8A 4UIAA 1LAPA 2JBKA 3JRUA 4OC1A 2EK8A 2ZOGA 3KQZA 3TC8A 1Z5RA 2PJ4A 2XEIA 2GU2A 3PB6X 2NYQA 2QYVA 4NGRA 1HDUA 3B35A 2ZEFA 4OKOA 3V38A 1QMUA 4UIBA 2V8HA 1CP6A 4WWVA 1LAMA 1KWMA 6CPAA 5D29A 2QVPA 1BPMA 3B3SA 3DLJA 1LANA 2ZEHA 2PJCA 3BI0A 4ZX8A 3ISXA 5THWA 2PCUA 4OC2A 4YN3A 2XEJA 4H2KA 4OC0A 4P4BA 4AXVA 3HUVA 2PJBA 3PB9X 4C8CA 1BPNA 1ARLA 2J9AA 1ELLP 3H8EA 3I74A 3SI1A 4NFRA 3B3TA 4JZ0A 3LMSA 4FWUA 4CPAA 3B3VA 3PEIA 1IGBA 2PJAA 2ZEEA 3RAMA 5JGFA 4MRIA 1YSJA 2PIYA 3VARA 3GLJA 5CPAA 4TJXA 2PJ3A 3PBEA 1H8LA 2PJ9A 3FEDA 3PB8X 3I6SA 4PXDA 4ZY2A 4UEEA 4G1PA 4EWTA 1ZG7A 3H8FA 2AFUA 5K8PA 2PJ8A 1XRYA 4A38A 3PFOA 2NSMA 5DS0A 1CPSA 1Y9ZA 1F57A 1XMBA 3VATA 4PXEA 1AYEA 2PJ1A 4OMEA 1TKFA 2PJ7A 3SI2A 3FECA 1OBRA 4EMEA 1EE3P 4MHZA 4B6ZA 3T8WA 2Q43A 1CBXA 4DUKA 4OC3A 4X3RA 3TX8A 1VGYA 2PJ6A 4TJVA 1V6CA 3LWUA 1CP7A 3K2KA 1LFWA 3KI9A 3FVLA 4OIWA 4UEFA 3KHXA 4KNGE 4P4EA 1XJOA 3BHXA 4ZY1A 1DE4C 3NH8A 2ZELA 4C86A 1ZLHA 1Z8LA 1CG2A 1ELMP 4CDJA 4NJRA 2GP4A 3IO1A 4NGSA 4MCPA 2O4HA 1R3NA 3SJFA 3CDXA 2ANPA 4OIDA 4A94A 1HEEA 2FVGA 5J1QA 2QJ8A 4P10A 1R43A 1M4LA 2CTCA 2Q4ZA 4MCQA 2OR4A 1VHEA 4C9RA 2ABZA 2PJ2A 4C8AA 3B3CA 3D7DA 4PXBA 5HVFA 5K8OA 3PB7X 3K9TA 3WC6A 1DTDA 2CIJA 2GLJA 2CF4A 4OP4A 1ZLIA 3CPAA 3D4UA 4BD9A 2RB7A 2C6PA 3EIFA 1Q7LA 3GB0A 3IIBA 5HXDA 2PRQA 1GYTA 2PJ0A 2ZOFA 2GLFA 1YW4A 4PQAA 4MHNA 4LQGA 2V77A 3GUXA 1Z2LA 1BLLE 5HVHA 1IY7A 3PRTA 2RFHA 4P4IA 2PJ5A 2OOTA 3ISZA 3WC5A 4C9UA 3VTAA 2BO9A 2V8GA 2AFMA 3PB4X 4YU9A 4WJBA 2XEFA 1TKHA 3FEEA 2IJZA 1WVMA 4C9AA 4JYWA 3FX6A 4Z65A 3H8GA 4P4DA 4F9VA 2PIZA 1ZG8A 5LRGA 1Y0YA 4C8UA 2ZEGA 1LOKA 4NGQA 4UF4A 3RZAA 2BOAA 3BXMA 1JQGA 4A37A 2JEWA 3D68A 1YMEA 4C9EA 4MHYA 4C8TA 5LYLA 5JM6A 2AFXA 5F09A 4R76A 1YW6A 3WT4A 4IK2A 3D7GA 3S9LA 3KR4A 4R7MA 2GREA 1BAVA 4A39A 3S9MA 3KGQA 5IR2A 5HVGA 4DYOA 3IC1A 2JBJA 3L2NA 3BI1A 4GM5A 2C1CA 2PVWA 1Y0RA 2DEAA 3SJEA 3IFEA 2G9DA 1F2OA 5LYFA 4EFDA 3CPXA 4ZYQA 1FNOA 3B3WA 1F2PA 1VIXA 4IHMA 4MHPA 4R8FA 4X2TA 4P4FA 1RTQA 1AMPA 2PVVA 4C84A 2POKA 8CPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLO A;  4C8F A;  3ICU A;  4ZX9 A;  1ZG9 A;  3DGV A;  4TWE A;  2EWB A;  1PCA A;  3S9N A;  1ARM A;  4F9U A;  4K3N A;  1QQ9 A;  2AFO A;  3D7H A;  3WC7 A;  3D67 A;  5LRJ A;  3KR5 A;  3SJG A;  4C99 A;  2I3C A;  1TF9 A;  2Q51 A;  4C85 A;  5K8M A;  4W9Y A;  2F7V A;  4CDK A;  1XBU A;  1PYT B;  1XFO A;  1NSA A;  3NH4 A;  3D66 A;  4RUH A;  2PE3 A;  5JH9 A;  3PBB A;  3MRU A;  5LYD A;  3IEH A;  4DJL A;  2CTB A;  5K8N A;  2F8H A;  4MCS A;  2AFW A;  2ZED A;  3KAS A;  1TXR A;  2EK9 A;  3QNV A;  5D8N A;  4MXU A;  3FF3 A;  1HDQ A;  4F8Z A;  2C6C A;  4OC4 A;  2ZEN A;  4P45 A;  2WZN A;  2V8V A;  2O53 A;  3FMC A;  4NGN A;  1LCP A;  4OC5 A;  3KL9 A;  4P44 A;  1TKJ A;  2VL1 A;  5ELY A;  4P4J A;  3D7F A;  2IMO A;  3B2Y A;  2ZEM A;  1CX8 A;  2XEG A;  2BCO A;  2AFZ A;  1VHO A;  1UWY A;  2C6G A;  4PPZ A;  4ZI6 A;  3V7Z A;  3CT9 A;  3N5F A;  4MCR A;  7CPA A;  3I1U A;  2V8D A;  1FT7 A;  4ZY0 A;  3IWW A;  4TNU A;  4YWY A;  3NA6 A;  3B7I A;  4NGM A;  4FAI A;  3NFZ A;  4UEZ A;  3IJ3 A;  2HB6 A;  4FBE A;  3VH9 A;  1TF8 A;  5IB9 A;  2ZEP A;  4PXC A;  3NH5 A;  5I4M A;  4R6T A;  2WYR A;  2AFS A;  3SJX A;  3KQX A;  4ONW A;  2IQ6 A;  5LYI A;  2ZEO A;  4Q7A A;  1Y7E A;  1CPX A;  5CBM A;  3SI0 A;  4O23 A;  4C8P A;  4NJQ A;  3WAB A;  3KZW A;  4NGP A;  4IAV A;  4MMO A;  3PFE A;  4FUU A;  3KHZ A;  4P6Y A;  1XF1 A;  2HC9 A;  3FJU A;  3FH4 A;  3HLP A;  4KSI A;  4C9V A;  3RBU A;  4X8I A;  5LRK A;  4NGT A;  3MN8 A;  4UIA A;  1LAP A;  2JBK A;  3JRU A;  4OC1 A;  2EK8 A;  2ZOG A;  3KQZ A;  3TC8 A;  1Z5R A;  2PJ4 A;  2XEI A;  2GU2 A;  3PB6 X;  2NYQ A;  2QYV A;  4NGR A;  1HDU A;  3B35 A;  2ZEF A;  4OKO A;  3V38 A;  1QMU A;  4UIB A;  2V8H A;  1CP6 A;  4WWV A;  1LAM A;  1KWM A;  6CPA A;  5D29 A;  2QVP A;  1BPM A;  3B3S A;  3DLJ A;  1LAN A;  2ZEH A;  2PJC A;  3BI0 A;  4ZX8 A;  3ISX A;  5THW A;  2PCU A;  4OC2 A;  4YN3 A;  2XEJ A;  4H2K A;  4OC0 A;  4P4B A;  4AXV A;  3HUV A;  2PJB A;  3PB9 X;  4C8C A;  1BPN A;  1ARL A;  2J9A A;  1ELL P;  3H8E A;  3I74 A;  3SI1 A;  4NFR A;  3B3T A;  4JZ0 A;  3LMS A;  4FWU A;  4CPA A;  3B3V A;  3PEI A;  1IGB A;  2PJA A;  2ZEE A;  3RAM A;  5JGF A;  4MRI A;  1YSJ A;  2PIY A;  3VAR A;  3GLJ A;  5CPA A;  4TJX A;  2PJ3 A;  3PBE A;  1H8L A;  2PJ9 A;  3FED A;  3PB8 X;  3I6S A;  4PXD A;  4ZY2 A;  4UEE A;  4G1P A;  4EWT A;  1ZG7 A;  3H8F A;  2AFU A;  5K8P A;  2PJ8 A;  1XRY A;  4A38 A;  3PFO A;  2NSM A;  5DS0 A;  1CPS A;  1Y9Z A;  1F57 A;  1XMB A;  3VAT A;  4PXE A;  1AYE A;  2PJ1 A;  4OME A;  1TKF A;  2PJ7 A;  3SI2 A;  3FEC A;  1OBR A;  4EME A;  1EE3 P;  4MHZ A;  4B6Z A;  3T8W A;  2Q43 A;  1CBX A;  4DUK A;  4OC3 A;  4X3R A;  3TX8 A;  1VGY A;  2PJ6 A;  4TJV A;  1V6C A;  3LWU A;  1CP7 A;  3K2K A;  1LFW A;  3KI9 A;  3FVL A;  4OIW A;  4UEF A;  3KHX A;  4KNG E;  4P4E A;  1XJO A;  3BHX A;  4ZY1 A;  1DE4 C;  3NH8 A;  2ZEL A;  4C86 A;  1ZLH A;  1Z8L A;  1CG2 A;  1ELM P;  4CDJ A;  4NJR A;  3IO1 A;  4NGS A;  4MCP A;  2O4H A;  1R3N A;  3SJF A;  3CDX A;  2ANP A;  4OID A;  4A94 A;  1HEE A;  2FVG A;  5J1Q A;  2QJ8 A;  4P10 A;  1R43 A;  1M4L A;  2CTC A;  2Q4Z A;  4MCQ A;  2OR4 A;  1VHE A;  4C9R A;  2ABZ A;  2PJ2 A;  4C8A A;  3B3C A;  3D7D A;  4PXB A;  5HVF A;  5K8O A;  3PB7 X;  3K9T A;  3WC6 A;  1DTD A;  2CIJ A;  2GLJ A;  2CF4 A;  4OP4 A;  1ZLI A;  3CPA A;  3D4U A;  4BD9 A;  2RB7 A;  2C6P A;  3EIF A;  1Q7L A;  3GB0 A;  3IIB A;  5HXD A;  2PRQ A;  1GYT A;  2PJ0 A;  2ZOF A;  2GLF A;  1YW4 A;  4PQA A;  4MHN A;  4LQG A;  2V77 A;  3GUX A;  1Z2L A;  1BLL E;  5HVH A;  1IY7 A;  3PRT A;  2RFH A;  4P4I A;  2PJ5 A;  2OOT A;  3ISZ A;  3WC5 A;  4C9U A;  3VTA A;  2BO9 A;  2V8G A;  2AFM A;  3PB4 X;  4YU9 A;  4WJB A;  2XEF A;  1TKH A;  3FEE A;  2IJZ A;  1WVM A;  4C9A A;  4JYW A;  3FX6 A;  4Z65 A;  3H8G A;  4P4D A;  4F9V A;  2PIZ A;  1ZG8 A;  5LRG A;  1Y0Y A;  4C8U A;  2ZEG A;  1LOK A;  4NGQ A;  4UF4 A;  3RZA A;  2BOA A;  3BXM A;  1JQG A;  4A37 A;  2JEW A;  3D68 A;  1YME A;  4C9E A;  4MHY A;  4C8T A;  5LYL A;  5JM6 A;  2AFX A;  5F09 A;  4R76 A;  1YW6 A;  3WT4 A;  4IK2 A;  3D7G A;  3S9L A;  3KR4 A;  4R7M A;  2GRE A;  1BAV A;  4A39 A;  3S9M A;  3KGQ A;  5HVG A;  4DYO A;  3IC1 A;  2JBJ A;  3L2N A;  3BI1 A;  4GM5 A;  2C1C A;  2PVW A;  1Y0R A;  2DEA A;  3SJE A;  3IFE A;  2G9D A;  1F2O A;  5LYF A;  4EFD A;  3CPX A;  4ZYQ A;  1FNO A;  3B3W A;  1F2P A;  1VIX A;  4IHM A;  4MHP A;  4R8F A;  4X2T A;  4P4F A;  1RTQ A;  1AMP A;  2PVV A;  4C84 A;  2POK A;  8CPA A; 
#chains in the Genus database with same CATH topology
 1YLO A;  4C8F A;  2FIW A;  4GPL B;  4XPK A;  4ZX9 A;  1YR0 A;  3TO7 A;  3ICU A;  4MFL A;  3TCV A;  5F1Y A;  1ZG9 A;  1QSM A;  3T05 A;  1S7K A;  4MI4 A;  3DGV A;  5ISV A;  5I0C A;  2ZPA A;  3CZX A;  4TWE A;  1M44 A;  2EWB A;  2HWG A;  1PCA A;  3S9N A;  1IOI A;  2QEC A;  3DSB A;  1YQE A;  4XPL A;  1ARM A;  2WUU A;  4XNH B;  3TLG A;  2CY2 A;  4F9U A;  4K3N A;  1QQ9 A;  2AFO A;  3D7H A;  3WC7 A;  3VWD A;  3D67 A;  5GCN A;  5LRJ A;  4NCZ A;  4A33 A;  2EBJ A;  3KR5 A;  1XEB A;  2FCK A;  3CXQ A;  3SJG A;  4C99 A;  2I3C A;  1TF9 A;  2D4P A;  5KTC A;  4UBR A;  2AUN A;  2Q51 A;  3FXT A;  2JEV A;  4C85 A;  5K8M A;  2VI7 A;  4H6Z A;  3EFA A;  1XF8 A;  4EYS A;  2YNE A;  4W9Y A;  5F13 A;  4KOT A;  1VI4 A;  2F7V A;  3JTK A;  4H6U A;  4CDK A;  3NOJ A;  3T90 A;  1CJW A;  3F0A A;  1KEE B;  3TLG B;  1VHS A;  1XBU A;  1PYT B;  1XFO A;  2H5M A;  4RI1 A;  4A95 A;  3IU1 A;  1NSA A;  5F49 A;  3VRN A;  2EZA A;  3NH4 A;  1R57 A;  4CRZ B;  1KUX A;  3D66 A;  4RUH A;  5F9M A;  4FD6 A;  2PE3 A;  4AVC A;  3TOA A;  5JH9 A;  3PBB A;  3MRU A;  2BL1 A;  2VZY A;  5LYD A;  5KTA A;  3IEH A;  1JDE A;  4DJL A;  2CTB A;  4UWJ A;  4CGP A;  2D4O A;  5K8N A;  2F8H A;  4U9Z A;  2P0W A;  1PU9 A;  1NXJ A;  3OAK A;  1KBL A;  4MCS A;  2AFW A;  2ZED A;  3KKW A;  4NSQ A;  3GY9 A;  3KAS A;  1TXR A;  2EK9 A;  1I21 A;  3QNV A;  5D8N A;  5JVL A;  3LOD A;  1XOV A;  2REE A;  4MFK A;  4A2Z A;  5F48 A;  3U88 C;  4CZ1 A;  4Y49 C;  2Z3O A;  4KOV A;  3R9E A;  5F46 A;  4MXU A;  5CNP A;  3FF3 A;  5F5X A;  1HDQ A;  4F8Z A;  1KUY A;  1RO5 A;  2VBQ A;  2C6C A;  4QB9 A;  4COG A;  2GIV A;  2PR1 A;  1Q2Y A;  4OC4 A;  1NMT A;  3SXN A;  1MJA A;  2ZEN A;  4P45 A;  3IWG A;  3GJZ A;  1IU8 A;  2V8V A;  2O53 A;  2WZN A;  3FMC A;  1QSR A;  2FE7 A;  5EMI A;  4CS0 B;  4NGN A;  4EVY A;  1LCP A;  3D8P A;  4A32 A;  4OC5 A;  3KL9 A;  2JLM A;  4P44 A;  1TKJ A;  2VL1 A;  2R82 A;  2XPL A;  4CRY B;  5ELY A;  4P4J A;  4F6A A;  3D7F A;  1M1D A;  2IMO A;  2I79 A;  4E2A A;  2PQ8 A;  3EO4 A;  3SHP A;  4CGL A;  3B2Y A;  5JQ4 A;  1NE9 A;  2FS5 A;  4JXQ A;  2ZEM A;  4BPW B;  1CX8 A;  2WSA A;  2Z0Z A;  3QB8 A;  2ZW5 A;  4FD7 A;  4OAE A;  3DDD A;  2D0P A;  3I9S A;  2WPW A;  2XEG A;  1X12 A;  2BCO A;  4PV6 A;  2AFZ A;  1VHO A;  1UWY A;  3G3S A;  2C6G A;  4U9Y A;  4PPZ A;  5C82 A;  4ZI6 A;  3V7Z A;  3GIU A;  3OB1 B;  3BLN A;  3CT9 A;  2B4J C;  1WJT A;  3N5F A;  3R9F A;  1BO4 A;  1SQH A;  2Z3M A;  4MCR A;  7CPA A;  5KTD A;  3I1U A;  3C26 A;  1FT7 A;  2V8D A;  4M6I A;  1B87 A;  1NSL A;  4ZY0 A;  2YJT A;  1B47 A;  3IWW A;  4TNU A;  1YVK A;  2QML A;  2OB0 A;  3B7I A;  3BJ7 A;  3NA6 A;  4YWY A;  4AVB A;  4C2X A;  4R3K A;  4Y49 B;  4NGM A;  3R9G A;  2C27 A;  4FAI A;  4MFZ A;  4IIX A;  5BY0 A;  3LD2 A;  2C5Q A;  3NFZ A;  4UEZ A;  1KUV A;  3BUW B;  1QSN A;  2HB6 A;  3IJ3 A;  5AG5 A;  2Z11 A;  4FBE A;  3U1B A;  3VH9 A;  1TF8 A;  3KRV A;  5IB9 A;  2ZEP A;  4PXC A;  3NH5 A;  2Y0M A;  2FXF A;  1S3Z A;  4QUS A;  4UA3 A;  2KCW A;  4R6T A;  5A28 A;  5I4M A;  2ZXV A;  1A2Z A;  1I12 A;  2WYR A;  2AFS A;  3RNZ A;  4B10 A;  2CBL A;  4KSA A;  4NF1 A;  3SJX A;  1VKC A;  1XIX A;  3KQX A;  4ONW A;  2IQ6 A;  5LYI A;  4CGO A;  2ZEO A;  4Q7A A;  3BUX B;  4JXR A;  1Y7E A;  1CPX A;  2FIA A;  4CGM A;  3NE7 A;  5AG6 A;  3TTH A;  2REF A;  5CBM A;  4IF5 A;  3SI0 A;  1YVO A;  4O23 A;  2ZW4 A;  3B8G A;  3HPG G;  3TOB A;  4NJQ A;  3WAB A;  4C8P A;  3KZW A;  4UWI A;  4NGP A;  4OAD A;  4A31 A;  4R3L A;  3PZJ A;  1LRZ A;  2EVN A;  4IAV A;  4MMO A;  4LQ6 A;  4XPD C;  4LX9 A;  3PFE A;  4FUU A;  1IYK A;  4MFQ A;  2DPS A;  2Z3L A;  3KHZ A;  4P6Y A;  4UFV A;  4DNC A;  2HC9 A;  3FJU A;  5JPH A;  1XF1 A;  2G0B A;  3TLB A;  2B4D A;  3FH4 A;  3HLP A;  1IID A;  3S6F A;  2BSW A;  1Q2C A;  4KSI A;  4C9V A;  3RBU A;  4X8I A;  5LRK A;  4NGT A;  4GXH A;  3MN8 A;  4QC6 A;  4UIA A;  2UV8 G;  4C7H A;  3EZA A;  1LAP A;  2JBK A;  1DIK A;  3JRU A;  3N7Z A;  3IU2 A;  4JVO A;  4CAE A;  2PC1 A;  4OC1 A;  3G23 A;  2N3A B;  2F5I A;  4INJ A;  4UCN A;  2EK8 A;  1S7L A;  2G3A A;  2JDC A;  2ZOG A;  4B12 A;  5FD8 A;  3UY5 A;  3BJ8 A;  1YVH A;  3H4Q A;  3KQZ A;  3VRO A;  1Z5R A;  3TC8 A;  1M6V B;  1EZA A;  1YX0 A;  4E0A A;  2CNM A;  4E94 A;  2PJ4 A;  2XEI A;  2GU2 A;  4HPS A;  3PB6 X;  2B4D B;  2NYQ A;  4BIN A;  2QYV A;  4NGR A;  1HDU A;  5BWA B;  2B58 A;  1IYL A;  3B35 A;  2AE6 A;  2ZEF A;  3FYN A;  4OKO A;  4UCM A;  3FIX A;  3K9U A;  4KVO E;  4ORF A;  1QMU A;  2JDD A;  3V38 A;  3V8I A;  4JWP A;  4UIB A;  3PGP A;  5JYB A;  4CYQ A;  3QAH A;  3BUO B;  1J3L A;  3EC4 A;  4PSX A;  2V8H A;  1CP6 A;  4WWV A;  1LAM A;  2PRB A;  4MY3 A;  1KWM A;  4KOY A;  4CAF A;  6CPA A;  3W6X A;  1JDB C;  2J8M A;  4B5P A;  4F0Y A;  3D3S A;  4U5Y A;  1M4G A;  5D29 A;  2XPN A;  1CM0 A;  2QVP A;  1BPM A;  4XPD B;  3NFQ A;  4Q38 A;  1Z9E A;  3T07 A;  3B3S A;  4E8O A;  3DLJ A;  2XPO A;  1LAN A;  3OWC A;  2GE3 A;  2Q04 A;  2PJC A;  2ZEH A;  1P4N A;  2FSR A;  4KS9 A;  3TO9 A;  3BI0 A;  1XE4 A;  3VRQ A;  4ZX8 A;  1MJB A;  4H1H A;  3ISX A;  5THW A;  3R96 A;  2PCU A;  3IWE A;  4OC2 A;  1Q2D A;  2R7H A;  5J8F A;  2YJV A;  4YN3 A;  4J3G A;  2XEJ A;  3PFV A;  2PSW A;  4BTF A;  2X7B A;  1NBW A;  4H2K A;  4OC0 A;  4P4B A;  2DPT A;  4AXV A;  2AJ6 A;  3HUV A;  3SXO A;  2B3V A;  4B5P B;  2PJB A;  4KOW A;  3R1K A;  3PB9 X;  2EZC A;  4C8C A;  1BPN A;  1ARL A;  2YND A;  2ODF A;  2XPP A;  2J9A A;  3C8O A;  1ELL P;  1YRE A;  3FB3 A;  3HMJ G;  2WPX A;  3H8E A;  5H86 A;  3SI1 A;  4QBJ A;  1ZL0 A;  3I74 A;  3S6H A;  4NFR A;  4BPX B;  2DLA A;  4RR2 B;  2P6G A;  3B3T A;  4JZ0 A;  3LMS A;  4FWU A;  4CPA A;  3B3V A;  5J3X A;  1IGB A;  2PJA A;  2HV2 A;  2ZEE A;  3PEI A;  3NE8 A;  3RAM A;  1Z9U A;  4MRI A;  5JGF A;  2BUE A;  2Q44 A;  2DF5 A;  1YSJ A;  3TT2 A;  2PIY A;  3VAR A;  3GLJ A;  5IX3 A;  2CNS A;  5CPA A;  1PUA A;  2EO8 A;  4F0X A;  4TJX A;  2PJ3 A;  3PBE A;  1H8L A;  2PJ9 A;  3FED A;  3TLY A;  4CYN A;  3PB8 X;  2VKZ G;  3I6S A;  4C7I A;  1JWQ A;  4PXD A;  5DWN A;  4MI1 A;  2Q4Y A;  4PK2 A;  4ZY2 A;  4ONU A;  2R8V A;  4M6G A;  4UEE A;  3EZE A;  4G1P A;  3LAC A;  3TE4 A;  4EWT A;  4IIY A;  1ZG7 A;  2OH1 A;  3H8F A;  2AFU A;  1S60 A;  5K8P A;  1VBG A;  3VWE A;  4C68 A;  2PJ8 A;  1XRY A;  3JUW A;  5HH1 A;  3PFO A;  3S6G A;  3HPH E;  2NSM A;  3W91 A;  4A38 A;  3F9K C;  4M3S A;  1Z4R A;  3OP0 A;  1CPS A;  5DS0 A;  4AG7 A;  1Y9Z A;  1GGO A;  3K4I A;  1F57 A;  1XMB A;  1Z8X A;  3VAT A;  4PXE A;  5AG4 A;  1N71 A;  1AYE A;  2VEZ A;  4B5O A;  2PJ1 A;  4OME A;  1M4D A;  1TKF A;  2PJ7 A;  3SI2 A;  2Y1M A;  2AUM A;  4CYO A;  3FEC A;  4CAX A;  1J4J A;  4A4C A;  1OBR A;  4CAW A;  3GYA A;  2E28 A;  4L89 A;  1S5K A;  1L0C A;  2HUZ A;  2Z3P A;  4AVA A;  4EME A;  3ZNI A;  4X5K A;  3CXP A;  1EE3 P;  4MHZ A;  4B13 A;  2GFQ A;  2EUI A;  4HNW B;  4B6Z A;  1Y9K A;  3T8W A;  1TIQ A;  2PCN A;  2POK A;  2Q43 A;  1CBX A;  3T0T A;  4DUK A;  4KLV A;  5AXI A;  4OC3 A;  4X3R A;  1IB1 E;  3TX8 A;  2ZW6 A;  2VQY A;  4PK3 A;  1VGY A;  2PJ6 A;  4TJV A;  1V6C A;  3VGO A;  4KSF A;  1Z4E A;  3LWU A;  4MFP A;  4J0N A;  1CP7 A;  5AGE A;  3TYX A;  3K2K A;  1I1D A;  1LFW A;  1P0H A;  2R98 A;  4M6H A;  1KC7 A;  3KI9 A;  3FVL A;  4OIW A;  5AG7 A;  4UEF A;  4MFJ A;  4KUB A;  4CGN A;  3P2F A;  5G20 A;  4C9A A;  2B4B A;  3F8K A;  3VRP A;  3A9L A;  5G1Z A;  5C88 A;  4KOS A;  3KHX A;  1Z8T A;  4KNG E;  4P4E A;  1S7N A;  1XJO A;  2QIR A;  5HKZ A;  4RN7 A;  3BHX A;  4ZGY B;  4ZY1 A;  4BPU B;  4IUS A;  1DE4 C;  2J8N A;  4GS4 A;  1GHE A;  3NH8 A;  3IGR A;  2DIK A;  2ZEL A;  2DXQ A;  4C86 A;  1WWZ A;  1ZLH A;  2P6F A;  4OLL A;  1Z8L A;  1CG2 A;  1ELM P;  3G8W A;  1VBH A;  2ZW7 A;  2BEI A;  4CDJ A;  3D2P A;  1U6M A;  3PP9 A;  4NJR A;  4K30 A;  3IO1 A;  2GP4 A;  4NGS A;  3RYO A;  1CE8 B;  2Z3N A;  4JJX A;  4MCP A;  2O4H A;  2HI6 A;  4M8D A;  3O8Z A;  1R3N A;  3H5Z A;  3BUN B;  3EXN A;  3SJF A;  3CDX A;  2ANP A;  3TLC A;  4OID A;  3DNS A;  4H89 A;  2FM4 A;  3TO6 A;  3SR3 A;  4A94 A;  2MP0 A;  2Q7S A;  4PSW A;  1HEE A;  5G22 A;  2FVG A;  4COB A;  5J1Q A;  2QJ8 A;  3FNC A;  2B5G A;  5IB0 A;  2K5T A;  4L8A A;  4P10 A;  4I49 A;  1Y7R A;  1R43 A;  1M4L A;  5FVJ A;  2CTC A;  2Q4Z A;  5A27 A;  4MCQ A;  2OR4 A;  2YNC C;  5DWM A;  1VHE A;  1YGH A;  1T36 B;  4YGO A;  4C9R A;  4AB7 A;  2ABZ A;  3E0K A;  2PJ2 A;  4NEX A;  3B3C A;  3D7D A;  4PXB A;  5HVF A;  4C8A A;  2D0O A;  5HMN A;  3JVN A;  2IL4 A;  1B6B A;  2OZH A;  3TLE A;  3DR8 A;  5K8O A;  3F5B A;  3PB7 X;  3K9T A;  4KOX A;  3PLF B;  1IOF A;  3QAY A;  3WR7 A;  3WC6 A;  2NMT A;  4AG9 A;  1BOB A;  1YLE A;  1UFH A;  4KVX A;  1DTD A;  2CIJ A;  2B5G B;  4MJX A;  2GLJ A;  2A4N A;  2CF4 A;  4OP4 A;  5IV0 A;  4HNY B;  1ZLI A;  3CPA A;  2B3U A;  3D4U A;  4BD9 A;  2RB7 A;  1ZRS A;  4RS2 A;  2OU2 A;  4A30 A;  5HKW A;  2C6P A;  1QST A;  3EIF A;  1CS0 B;  4KZT A;  4B14 A;  1Q7L A;  1MK4 A;  3GB0 A;  3IIB A;  2YNC A;  5HXD A;  2PRQ A;  4UFX A;  4C2Y A;  1GYT A;  2PJ0 A;  2ZOF A;  3T5M A;  2GLF A;  1YW4 A;  2CNT A;  4PQA A;  4MHN A;  3ZJ0 A;  4LQG A;  4FD5 A;  4KUA A;  4B11 A;  2J8R A;  2V77 A;  3GUX A;  4KLW A;  1Z2L A;  1BLL E;  1BXR B;  4R87 A;  2Z10 A;  5HVH A;  1IY7 A;  3PRT A;  2Z3K A;  2Q7B A;  1FY7 A;  2FL4 A;  2RFH A;  2O28 A;  4P4I A;  2PJ5 A;  4KOU A;  2OOT A;  3ISZ A;  3WC5 A;  4C9U A;  1OZP A;  4KOR A;  1C3O B;  3VTA A;  3FBU A;  1A9X B;  2BO9 A;  4MJ8 A;  2V8G A;  3MGD A;  4C2Z A;  2AFM A;  4II9 A;  3PT1 A;  3PB4 X;  4YU9 A;  4WJB A;  3P2H A;  2XEF A;  1TKH A;  3FEE A;  2IJZ A;  2OZU A;  4M85 A;  4MHD A;  1QSO A;  2RC4 A;  1WVM A;  4HNX B;  4CAV A;  3OB2 B;  4JYW A;  1S7F A;  3FX6 A;  3H8G A;  4Z65 A;  4Q36 A;  1Q5X A;  2Q0Y A;  3DR6 A;  1R61 A;  2P6E A;  2YGW A;  4YFJ A;  2FT0 A;  4P4D A;  5J8C A;  4A4B A;  4F9V A;  1XMT A;  1ZG8 A;  2PIZ A;  4JD6 A;  2VZZ A;  5H84 A;  5LRG A;  4NXY A;  1C30 B;  1Y0Y A;  4C8U A;  2ZEG A;  1LOK A;  4NGQ A;  4UF4 A;  2HQY A;  4YRH A;  4BMH A;  3RZA A;  3R95 A;  2BOA A;  4R9M A;  3BXM A;  1JQG A;  1Z8W A;  2JEW A;  4FD4 A;  4A37 A;  3D68 A;  4UFW A;  1FBV A;  1YME A;  1AUG A;  2PDO A;  2CXA A;  4MHY A;  1V0C A;  3ZZI A;  1ZYM A;  4C9E A;  5LYL A;  4C8T A;  5JM6 A;  2AFX A;  5F09 A;  4R76 A;  1YW6 A;  4KVM E;  2VXK A;  4QVT A;  3WT4 A;  2X0S A;  3CXS A;  2GAN A;  3BUM B;  4IK2 A;  3TLZ A;  2B0A A;  4XNH C;  3D7G A;  3S9L A;  2G3T A;  1K4J A;  3KR4 A;  1EZB A;  5HKY A;  4R7M A;  2GRE A;  4BBH A;  3RO0 A;  1BAV A;  4HKF A;  3I3G A;  4A39 A;  3TFY A;  3S9M A;  1EO0 A;  5K99 A;  2EZB A;  3KGQ A;  5IR2 A;  2Y1N A;  5HVG A;  1MJ9 A;  4DYO A;  1RXT A;  3T9Y A;  2PR8 A;  3IC1 A;  2JBJ A;  2I00 A;  4JLY A;  3L2N A;  1WK4 A;  3BI1 A;  3FRM A;  2HRO A;  5G21 A;  4ZBG A;  4R57 A;  3EY5 A;  1KZF A;  1ON0 A;  3GKR A;  2C1C A;  4GM5 A;  2PVW A;  4MBU A;  3VRR A;  3EZB A;  1YK3 A;  2OLS A;  1M4I A;  4E5S A;  2ARH A;  1Y0R A;  2DEA A;  3SJE A;  3IFE A;  5F47 A;  3TLA A;  2G9D A;  5E96 A;  2OZG A;  4CO9 A;  1F2O A;  1IIC A;  3D2M A;  4MY0 A;  3S6K A;  5LYF A;  4EFD A;  1X10 A;  2Q4V A;  1FNO A;  3CPX A;  4ZYQ A;  5EC4 A;  3W6S A;  4CYP A;  3B3W A;  1F2P A;  1VIX A;  4LUA A;  5EBV A;  1Y9W A;  2ATR A;  4IHM A;  2R1I A;  4MHP A;  4R8F A;  4UCP A;  4P4F A;  1RTQ A;  1AMP A;  2PVV A;  4X2T A;  1ZO0 A;  8CPA A;  4C84 A; 
#chains in the Genus database with same CATH homology
 1YLO A;  4C8F A;  3ICU A;  4ZX9 A;  1ZG9 A;  3DGV A;  4TWE A;  2EWB A;  1PCA A;  3S9N A;  1ARM A;  4F9U A;  4K3N A;  1QQ9 A;  2AFO A;  3D7H A;  3WC7 A;  3D67 A;  5LRJ A;  3KR5 A;  3SJG A;  4C99 A;  2I3C A;  1TF9 A;  2Q51 A;  4C85 A;  5K8M A;  4W9Y A;  2F7V A;  4CDK A;  1XBU A;  1PYT B;  1XFO A;  1NSA A;  3NH4 A;  3D66 A;  4RUH A;  2PE3 A;  5JH9 A;  3PBB A;  3MRU A;  5LYD A;  3IEH A;  4DJL A;  2CTB A;  5K8N A;  2F8H A;  4MCS A;  2AFW A;  2ZED A;  3KAS A;  1TXR A;  2EK9 A;  3QNV A;  5D8N A;  4MXU A;  3FF3 A;  1HDQ A;  4F8Z A;  2C6C A;  4OC4 A;  2ZEN A;  4P45 A;  2WZN A;  2V8V A;  2O53 A;  3FMC A;  4NGN A;  1LCP A;  4OC5 A;  3KL9 A;  4P44 A;  1TKJ A;  2VL1 A;  5ELY A;  4P4J A;  3D7F A;  2IMO A;  3B2Y A;  2ZEM A;  1CX8 A;  2XEG A;  2BCO A;  2AFZ A;  1VHO A;  1UWY A;  2C6G A;  4PPZ A;  4ZI6 A;  3V7Z A;  3CT9 A;  3N5F A;  4MCR A;  7CPA A;  3I1U A;  2V8D A;  1FT7 A;  4ZY0 A;  3IWW A;  4TNU A;  4YWY A;  3NA6 A;  3B7I A;  4NGM A;  4FAI A;  2C5Q A;  3NFZ A;  4UEZ A;  3IJ3 A;  2HB6 A;  4FBE A;  3VH9 A;  1TF8 A;  5IB9 A;  2ZEP A;  4PXC A;  3NH5 A;  5I4M A;  4R6T A;  2WYR A;  2AFS A;  3SJX A;  3KQX A;  4ONW A;  2IQ6 A;  5LYI A;  2ZEO A;  4Q7A A;  1Y7E A;  1CPX A;  5CBM A;  3SI0 A;  4O23 A;  4C8P A;  4NJQ A;  3WAB A;  3KZW A;  4NGP A;  4IAV A;  4MMO A;  3PFE A;  4FUU A;  3KHZ A;  4P6Y A;  1XF1 A;  2HC9 A;  3FJU A;  3FH4 A;  3HLP A;  4KSI A;  4C9V A;  3RBU A;  4X8I A;  5LRK A;  4NGT A;  3MN8 A;  4UIA A;  1LAP A;  2JBK A;  3JRU A;  4OC1 A;  2EK8 A;  2ZOG A;  3KQZ A;  3TC8 A;  1Z5R A;  2PJ4 A;  2XEI A;  2GU2 A;  3PB6 X;  2NYQ A;  2QYV A;  4NGR A;  1HDU A;  3B35 A;  2ZEF A;  4OKO A;  3V38 A;  1QMU A;  4UIB A;  2V8H A;  1CP6 A;  4WWV A;  1LAM A;  1KWM A;  6CPA A;  5D29 A;  2QVP A;  1BPM A;  3B3S A;  3DLJ A;  1LAN A;  2ZEH A;  2PJC A;  3BI0 A;  4ZX8 A;  3ISX A;  5THW A;  2PCU A;  4OC2 A;  4YN3 A;  2XEJ A;  4H2K A;  4OC0 A;  4P4B A;  4AXV A;  3HUV A;  2PJB A;  3PB9 X;  4C8C A;  1BPN A;  1ARL A;  2J9A A;  1ELL P;  3H8E A;  3I74 A;  3SI1 A;  4NFR A;  3B3T A;  4JZ0 A;  3LMS A;  4FWU A;  4CPA A;  3B3V A;  3PEI A;  1IGB A;  2PJA A;  2ZEE A;  3RAM A;  5JGF A;  4MRI A;  1YSJ A;  2PIY A;  3VAR A;  3GLJ A;  5CPA A;  4TJX A;  2PJ3 A;  3PBE A;  1H8L A;  2PJ9 A;  3FED A;  3PB8 X;  3I6S A;  4PXD A;  4ZY2 A;  4UEE A;  4G1P A;  4EWT A;  1ZG7 A;  3H8F A;  2AFU A;  5K8P A;  2PJ8 A;  1XRY A;  4A38 A;  3PFO A;  2NSM A;  5DS0 A;  1CPS A;  1Y9Z A;  1F57 A;  1XMB A;  3VAT A;  4PXE A;  1AYE A;  2PJ1 A;  4OME A;  1TKF A;  2PJ7 A;  3SI2 A;  3FEC A;  1OBR A;  4EME A;  1EE3 P;  4MHZ A;  4B6Z A;  3T8W A;  2Q43 A;  1CBX A;  4DUK A;  4OC3 A;  4X3R A;  3TX8 A;  1VGY A;  2PJ6 A;  4TJV A;  1V6C A;  3LWU A;  1CP7 A;  3K2K A;  1LFW A;  3KI9 A;  3FVL A;  4OIW A;  4UEF A;  3KHX A;  4KNG E;  4P4E A;  1XJO A;  3BHX A;  4ZY1 A;  1DE4 C;  3NH8 A;  2ZEL A;  4C86 A;  1ZLH A;  1Z8L A;  1CG2 A;  1ELM P;  4CDJ A;  4NJR A;  2GP4 A;  3IO1 A;  4NGS A;  4MCP A;  2O4H A;  1R3N A;  3SJF A;  3CDX A;  2ANP A;  4OID A;  4A94 A;  1HEE A;  2FVG A;  5J1Q A;  2QJ8 A;  4P10 A;  1R43 A;  1M4L A;  2CTC A;  2Q4Z A;  4MCQ A;  2OR4 A;  1VHE A;  4C9R A;  2ABZ A;  2PJ2 A;  4C8A A;  3B3C A;  3D7D A;  4PXB A;  5HVF A;  5K8O A;  3PB7 X;  3K9T A;  3WC6 A;  1DTD A;  2CIJ A;  2GLJ A;  2CF4 A;  4OP4 A;  1ZLI A;  3CPA A;  3D4U A;  4BD9 A;  2RB7 A;  2C6P A;  3EIF A;  1Q7L A;  3GB0 A;  3IIB A;  5HXD A;  2PRQ A;  1GYT A;  2PJ0 A;  2ZOF A;  2GLF A;  1YW4 A;  4PQA A;  4MHN A;  4LQG A;  2V77 A;  3GUX A;  1Z2L A;  1BLL E;  5HVH A;  1IY7 A;  3PRT A;  2RFH A;  4P4I A;  2PJ5 A;  2OOT A;  3ISZ A;  3WC5 A;  4C9U A;  3VTA A;  2BO9 A;  2V8G A;  2AFM A;  3PB4 X;  4YU9 A;  4WJB A;  2XEF A;  1TKH A;  3FEE A;  2IJZ A;  1WVM A;  4C9A A;  4JYW A;  3FX6 A;  4Z65 A;  3H8G A;  4P4D A;  4F9V A;  2PIZ A;  1ZG8 A;  5LRG A;  1Y0Y A;  4C8U A;  2ZEG A;  1LOK A;  4NGQ A;  4UF4 A;  3RZA A;  2BOA A;  3BXM A;  1JQG A;  4A37 A;  2JEW A;  3D68 A;  1YME A;  4C9E A;  4MHY A;  4C8T A;  5LYL A;  5JM6 A;  2AFX A;  5F09 A;  4R76 A;  1YW6 A;  3WT4 A;  4IK2 A;  3D7G A;  3S9L A;  3KR4 A;  4R7M A;  2GRE A;  1BAV A;  4A39 A;  3S9M A;  3KGQ A;  5IR2 A;  5HVG A;  4DYO A;  3IC1 A;  2JBJ A;  3L2N A;  3BI1 A;  4GM5 A;  2C1C A;  2PVW A;  1Y0R A;  2DEA A;  3SJE A;  3IFE A;  2G9D A;  1F2O A;  5LYF A;  4EFD A;  3CPX A;  4ZYQ A;  1FNO A;  3B3W A;  1F2P A;  1VIX A;  4IHM A;  4MHP A;  4R8F A;  4X2T A;  4P4F A;  1RTQ A;  1AMP A;  2PVV A;  4C84 A;  2POK A;  8CPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...