4MCQA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyldi-gamma-l-glutamic acid (pteroyltri-gamma-l-glutamic acid)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
695
structure length
692
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 268
structure length 692
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcqA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcqA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcqA02
3LWUA 3RZAA 1V6CA 4H2KA 3CPAA 4C8CA 2CF4A 1NSAA 1BAVA 3WC6A 2PJ9A 4F9UA 1LOKA 3D66A 3SI2A 4WWVA 3FJUA 1R43A 3PRTA 1BPNA 4DUKA 2VL1A 3D4UA 3PB6X 3NFZA 2PJ4A 1CG2A 4C9RA 2PJ7A 3FECA 3QNVA 5LYLA 1VHOA 4CPAA 3FEDA 2WZNA 2O53A 1XJOA 3VARA 2CIJA 3T8WA 4AXVA 1UWYA 3I6SA 1HDUA 4A37A 3S9NA 2BOAA 4NGRA 3HUVA 1Y9ZA 2G9DA 3NH8A 2GLFA 4OC3A 3SJXA 2ZOGA 2PJ5A 1XFOA 3FX6A 2PJ0A 1ELMP 4RUHA 4C85A 5ELYA 5K8OA 4P44A 1ZG9A 1DE4C 2ZOFA 4Z65A 4EMEA 3RBUA 2ANPA 3H8EA 4LQGA 5CPAA 2AFUA 2HC9A 3KZWA 2EK8A 3H8GA 4X2TA 3V7ZA 3IJ3A 2PJ1A 3B3VA 4NGMA 3LMSA 4NJRA 3ICUA 5CBMA 4CDKA 3JRUA 1VIXA 2CTCA 4EFDA 3B3TA 2Q51A 4C9AA 1VGYA 1Z5RA 3WT4A 1Y7EA 5IB9A 2NSMA 2GLJA 5F09A 2C6GA 1CP6A 4IAVA 3B3WA 2EWBA 2PJBA 2J9AA 2ZEMA 1TF9A 1H8LA 1F57A 3D67A 2ZEEA 4P45A 4O23A 2ZEHA 3KL9A 4TJVA 2Q4ZA 5DS0A 4YN3A 4C9UA 4YU9A 4PXCA 3SJFA 5JGFA 4FUUA 3SJGA 4PQAA 4CDJA 4C8UA 2IQ6A 4PXBA 2RFHA 4F8ZA 2JBJA 2XEJA 4ZY2A 4UF4A 3KI9A 4IHMA 4C8PA 1WVMA 4W9YA 3VATA 3CPXA 3D7DA 2PRQA 2XEGA 4YWYA 3CDXA 3DLJA 5K8PA 4P6YA 2AFMA 4P4EA 3I1UA 3MRUA 4G1PA 1ARMA 4NGSA 2F7VA 3KR4A 3ISZA 3V38A 4FAIA 3B3CA 2AFOA 2WYRA 3D68A 2BCOA 3FMCA 4PPZA 4ZX9A 4ZI6A 2OR4A 3SI1A 4OC0A 3IIBA 5K8NA 3BHXA 1YW4A 1AMPA 1LAMA 4R76A 1ZLIA 1CBXA 1TKHA 3B3SA 4DYOA 4ZYQA 4MRIA 2ZEOA 4OKOA 1ARLA 3B2YA 3NH5A 3PB7X 3N5FA 3S9MA 4C86A 3PFOA 1PCAA 2C6PA 4C9EA 2XEIA 4FBEA 2JBKA 3SJEA 1LAPA 4OC4A 3PEIA 2EK9A 4MCQA 1FT7A 4BD9A 3BI0A 1QMUA 4EWTA 2HB6A 3BI1A 3FEEA 3KQZA 3KQXA 3PBEA 5JH9A 3D7FA 1TKJA 4K3NA 1TF8A 4A94A 2ZEDA 4MXUA 3RAMA 3PFEA 4C99A 3H8FA 2AFWA 1XF1A 4TJXA 3L2NA 3TC8A 4UEFA 1RTQA 3TX8A 3SI0A 5K8MA 2FVGA 1XRYA 4OC2A 1CPXA 5LRJA 4P4JA 4WJBA 3D7GA 4Q7AA 2Q43A 4R6TA 4OMEA 1CX8A 2V77A 1ZLHA 2AFSA 5LYIA 3DGVA 4IK2A 3B7IA 3NH4A 3I74A 3FVLA 1ELLP 4OC1A 4R8FA 2V8HA 2JEWA 4KSIA 3KGQA 5HVHA 1XMBA 3PBBA 2I3CA 3EIFA 2ZEGA 3HLPA 2QVPA 3CT9A 1GYTA 4UIAA 1Y0YA 2RB7A 4MCPA 3GLJA 2PJ6A 1FNOA 1F2OA 1BPMA 1R3NA 5LRKA 1AYEA 2V8DA 4NJQA 1VHEA 3PB4X 1JQGA 5I4MA 4JYWA 5THWA 1M4LA 3PB8X 1HEEA 1DTDA 4ONWA 4P4FA 2ZELA 4A39A 5HVGA 3KHZA 1ZG7A 4UEZA 4TWEA 2ABZA 7CPAA 5D8NA 1BLLE 4A38A 4PXDA 4TNUA 1XBUA 2IMOA 4MCSA 3S9LA 4P4BA 3BXMA 2PVVA 2AFZA 4KNGE 2QYVA 2OOTA 4PXEA 1IY7A 4UIBA 2IJZA 3K9TA 4F9VA 5LRGA 2XEFA 4NGQA 4X8IA 2CTBA 3D7HA 2NYQA 1QQ9A 3KASA 4OP4A 1Y0RA 2ZENA 2PVWA 3ISXA 4OC5A 4DJLA 4P4IA 1F2PA 4NGPA 3IC1A 3KHXA 4R7MA 4NFRA 3VTAA 4C8AA 2PCUA 4MHPA 5D29A 1PYTB 1TKFA 2PIYA 5LYFA 2BO9A 4ZY0A 2ZEFA 1EE3P 2F8HA 4OIDA 4JZ0A 4C8TA 2V8VA 2QJ8A 3KR5A 2PJ8A 4MHZA 1LANA 4C84A 5JM6A 4B6ZA 2GREA 1Z2LA 4NGTA 3IO1A 1KWMA 4X3RA 1CPSA 1YSJA 1Z8LA 4P10A 4ZX8A 2O4HA 8CPAA 2PJAA 4NGNA 3PB9X 2GU2A 1IGBA 3FH4A 4MHYA 4GM5A 2PJ2A 3VH9A 2PE3A 1YW6A 3IFEA 1LCPA 4FWUA 2C6CA 3WC5A 3WC7A 3MN8A 1YLOA 3B35A 3WABA 2AFXA 4MMOA 4P4DA 5LYDA 3IEHA 5HXDA 5HVFA 1LFWA 3K2KA 2PJCA 1TXRA 2ZEPA 4C9VA 3GB0A 3IWWA 3GUXA 5J1QA 1Q7LA 4UEEA 4OIWA 1ZG8A 4C8FA 6CPAA 3FF3A 1HDQA 1OBRA 4MHNA 1YMEA 2PIZA 2V8GA 4MCRA 3NA6A 2POKA 2DEAA 4ZY1A 1CP7A 2PJ3A 2C1CA
chains in the Genus database with same CATH superfamily
2PC1A 4II9A 3LWUA 3DR6A 3RZAA 4Y49C 4H2KA 1V6CA 3CPAA 4C8CA 4BBHA 2C27A 2CF4A 5J8CA 3SHPA 2Q4YA 1NSAA 1ON0A 5BY0A 1BAVA 2B5GA 1LOKA 2PJ9A 3CXSA 4A4BA 3D66A 3R96A 3SI2A 4WWVA 1KEEB 1ZL0A 3TLYA 3FJUA 4COGA 1R43A 3S6FA 4KSAA 4F9UA 3PRTA 3TLZA 1BPNA 4DUKA 2VL1A 3D4UA 3PB6X 3NFZA 1Z8WA 5I0CA 2PJ4A 5AXIA 1CG2A 2J8MA 2PJ7A 1XF8A 4C9RA 1U6MA 2Z3OA 4KVXA 3D8PA 1KUYA 2EO8A 1JDEA 3FECA 2GANA 3C26A 3ICUA 3JUWA 3QNVA 4MI4A 2J8RA 1VBHA 5LYLA 2EZAA 2X7BA 3T07A 3PZJA 4B13A 1VHOA 4CPAA 2R1IA 4CZ1A 2Y1MA 5AG7A 3VROA 3FEDA 1TIQA 4X5KA 4MFLA 2WZNA 4UCMA 2O53A 1XJOA 5G21A 3ZZIA 3K4IA 3IWEA 3VARA 3S6GA 4H89A 2CIJA 2Z3KA 3K9UA 4OAEA 3OWCA 4ZGYB 3F0AA 3T90A 1CE8B 3PT1A 1X12A 4KOYA 3T8WA 4AXVA 2P0WA 1UWYA 5H86A 5E96A 1NE9A 1Q2YA 3UY5A 3VWEA 3I6SA 1HDUA 2GIVA 2KCWA 3TCVA 3VGOA 4UCPA 1QSOA 4A37A 3S9NA 2BOAA 2JLMA 3W91A 5ISVA 4NGRA 3HUVA 1Y9ZA 2G9DA 4C68A 2CY2A 3NH8A 2GLFA 4OC3A 4M6IA 4UWJA 4JXQA 3SJXA 2ZOGA 1IICA 4QBJA 3NOJA 2PJ5A 4OADA 4UFVA 5JPHA 5KTCA 1QSNA 4BPUB 1XFOA 3SXOA 1QSTA 3FX6A 4MBUA 2Y0MA 4YGOA 1XEBA 2PJ0A 1BOBA 1ELMP 4NEXA 4RUHA 5GCNA 2HWGA 4C85A 5ELYA 4HNYB 1M4DA 3F5BA 5K8OA 1UFHA 4P44A 1AUGA 4JJXA 5J8FA 1ZG9A 4PK2A 1DE4C 2QMLA 3U88C 4L8AA 2ZOFA 2VZYA 4BINA 3SXNA 5C82A 4Z65A 2K5TA 4EMEA 3RBUA 2ANPA 3H8EA 4LQGA 3JVNA 4ZBGA 1IYLA 5HH1A 1VHSA 4QUSA 1BO4A 4A95A 1N71A 1IU8A 5CPAA 2AFUA 3V8IA 5F5XA 4K30A 5CNPA 4HKFA 4IIXA 2DPSA 2GP4A 2HC9A 3G23A 2XPNA 4BPWB 1P4NA 3BUXB 1XMTA 4Y49B 2BSWA 3KZWA 2EK8A 4M3SA 3H8GA 3R95A 4CAEA 4CS0B 5AG6A 4X2TA 3V7ZA 3T5MA 3E0KA 4KORA 2FE7A 2YNCC 3IJ3A 2FCKA 2PJ1A 2Z3LA 4NGMA 2B4DB 3B3VA 3LODA 3LMSA 4KOXA 4NJRA 4RI1A 3JRUA 5CBMA 4CDKA 1VIXA 2CTCA 4EFDA 3B3TA 4HNXB 2X0SA 3TLGB 2G3TA 2Q51A 4C9AA 1VGYA 1Z5RA 4INJA 3W6SA 3WT4A 1Y7EA 5IB9A 1B47A 3FRMA 4MHDA 1FY7A 4E2AA 3W6XA 4F0XA 3T05A 2FXFA 2NSMA 4KOSA 1S5KA 3P2HA 2GLJA 3PGPA 5F09A 2C5QA 2C6GA 2CBLA 1CP6A 2FT0A 3A9LA 3B3WA 4IAVA 2Q7BA 3I74A 2EWBA 2BL1A 2B4BA 2IL4A 2Q7SA 4KVOE 3PP9A 2PJBA 4IUSA 2ATRA 2HV2A 2J9AA 3BUMB 3FXTA 2ZEMA 4KUAA 2B4JC 1TF9A 3EZBA 1H8LA 1F57A 3D67A 2O28A 2ZEEA 4P45A 4O23A 1K4JA 4PK3A 2VKZG 4CYNA 1Z8TA 2ZEHA 3KL9A 4TJVA 3H4QA 2Q4ZA 1OZPA 1QSMA 5DS0A 1B87A 4YU9A 3RO0A 4YN3A 4C9UA 4GXHA 3WC6A 1IOIA 2OB0A 5KTAA 1KBLA 2FL4A 4PXCA 3SJFA 1Q5XA 1KC7A 2OZGA 5JGFA 1M1DA 2REFA 4FUUA 2EVNA 4M6HA 4XNHC 5F49A 3SJGA 1S7LA 4PQAA 3R9FA 1Z9UA 2DPTA 3JTKA 4CDJA 4C8UA 2IQ6A 4PXBA 3RYOA 3U1BA 4E5SA 4JVOA 4KLWA 5F48A 2RFHA 4CYPA 4F8ZA 4CGOA 3EZAA 2CNTA 5KTDA 2JBJA 3KKWA 2XEJA 4ZY2A 4UF4A 1EZAA 3VRNA 3KI9A 4IHMA 4C8PA 3I9SA 1S3ZA 2ZW6A 3T9YA 4QB9A 1VI4A 2R7HA 2Z3MA 1WVMA 2B58A 4W9YA 4PSWA 3VATA 3CPXA 2FM4A 4CO9A 3D7DA 2PRQA 2H5MA 2XEGA 4HPSA 3SR3A 1DIKA 2Z10A 4H6UA 1VBGA 4YWYA 3CDXA 3DLJA 3BLNA 4B10A 4LQ6A 1C30B 4KS9A 5K8PA 4CAVA 1WK4A 4COBA 4LX9A 1CJWA 4P6YA 2AFMA 3TOBA 4R57A 4P4EA 3I1UA 3MRUA 4G1PA 4B5PB 1ARMA 2D0OA 4NGSA 2F7VA 3H5ZA 4AG9A 5A27A 3GJZA 3KR4A 3ISZA 1A9XB 3V38A 4FAIA 3B3CA 2OLSA 2AFOA 2DIKA 2PCNA 2WYRA 3D68A 2YJTA 2BCOA 3FMCA 4CGPA 2EZBA 4KOWA 4PPZA 4EYSA 1NBWA 2PR8A 4ZX9A 3I3GA 1P0HA 4ZI6A 1S7KA 4KOUA 2OR4A 3GKRA 4R9MA 3SI1A 4E94A 3HPGG 4OC0A 2WPWA 3IIBA 3LD2A 3PLFB 3BHXA 1YW4A 5DWMA 4YFJA 4J3GA 5K8NA 2B0AA 4CGLA 4F0YA 3KRVA 3OB1B 1AMPA 2ZW7A 1LAMA 1XE4A 2QIRA 4R76A 4MFQA 1ZLIA 4NXYA 2OU2A 3R9GA 3C8OA 3TO7A 4H6ZA 5IR2A 3ZJ0A 3CXPA 3VRPA 3OP0A 1CBXA 1TKHA 3B3SA 3OB2B 3R1KA 2UV8G 4DYOA 4MRIA 4ZYQA 2ZEOA 3IU1A 4OKOA 1ARLA 4MFKA 1ZRSA 2HQYA 2B4DA 3B2YA 1YX0A 1YVOA 3NH5A 3PB7X 4AG7A 3FBUA 5IB0A 3D2PA 3N5FA 2YGWA 3S9MA 3S6HA 5DWNA 4CGNA 3PFOA 4MJ8A 1PCAA 4C86A 2MP0A 2C6PA 4C9EA 1YVHA 3O8ZA 4XNHB 2XEIA 1QSRA 3TYXA 4FBEA 2JBKA 2PDOA 2N3AB 3PFVA 3SJEA 1LAPA 2AJ6A 4OC4A 3PEIA 2EK9A 2RC4A 1J3LA 4MCQA 1FT7A 4BD9A 5G22A 4C2YA 1M44A 3BI0A 1QMUA 4LUAA 4EWTA 2HB6A 3BI1A 3FEEA 4MJXA 3KQZA 1CS0B 3KQXA 4CYOA 2OZUA 3PBEA 5JH9A 4XPDC 3D7FA 1TKJA 4JD6A 2D0PA 4K3NA 1TF8A 4A94A 2ZEDA 1PU9A 4MXUA 3RAMA 4CRYB 2D4PA 3PFEA 5HKWA 4R3KA 4C7HA 3BUNB 5HKYA 3H8FA 4C99A 3OAKA 2AFWA 2VXKA 3HPHE 3QB8A 1XF1A 2WSAA 3S6KA 2PR1A 4Q36A 4U9ZA 2AE6A 4TJXA 4FD4A 3D2MA 3L2NA 1RXTA 4RR2B 1GGOA 3TC8A 2XPOA 1ZYMA 3BJ7A 4XPKA 4UEFA 1RTQA 3TX8A 2CXAA 4GPLB 3DR8A 3SI0A 5K8MA 2PQ8A 2FSRA 2FVGA 3GIUA 4H1HA 1LRZA 1XRYA 5EMIA 4OC2A 4UCNA 3TLBA 4A33A 1CPXA 5LRJA 3BJ8A 2Q4VA 4JWPA 2XPPA 4P4JA 2GE3A 1Z9EA 1IOFA 1M4GA 2QECA 4UFXA 4WJBA 3D7GA 5AGEA 4Q7AA 2Q43A 4DNCA 4E0AA 4R87A 1YQEA 4C2XA 5HMNA 2VZZA 3DDDA 4R6TA 3F9KC 1PUAA 1JDBC 2R82A 4UWIA 4OMEA 1CX8A 5F1YA 3HMJG 3RNZA 1Z4EA 1ZLHA 2AFSA 2V77A 4KOTA 5LYIA 1M6VB 4A2ZA 2NMTA 3DGVA 4CAWA 2R98A 4IK2A 3B7IA 3NH4A 2Z11A 4NSQA 3FVLA 3P2FA 1ELLP 5AG4A 3GYAA 4OC1A 5C88A 4L89A 4MY0A 2JDDA 4IIYA 4B12A 4R8FA 2EZCA 3IGRA 5AG5A 1Z4RA 2V8HA 1FBVA 3VWDA 2OH1A 3IWGA 2HUZA 4CAFA 2JEWA 5G1ZA 1V0CA 1YK3A 5F47A 2VI7A 4KSIA 2YNCA 3KGQA 5HVHA 1XMBA 3PBBA 2I3CA 4OLLA 3R9EA 4A30A 4IF5A 2ZEGA 3HLPA 3EIFA 5F46A 4RS2A 4YRHA 2QVPA 3CT9A 1IB1E 5K99A 1GYTA 1MJ9A 4UIAA 2F5IA 1Y0YA 3BUWB 4MCPA 2RB7A 3GLJA 5IX3A 2AUNA 5JYBA 1YGHA 4FD7A 1KUVA 2PJ6A 1FNOA 1VKCA 2D4OA 2I79A 1Y9WA 2WUUA 1F2OA 4CYQA 2Z3NA 3QAHA 1BPMA 1R3NA 4KZTA 4MY3A 5LRKA 3TLCA 1C3OB 1AYEA 1R57A 2V8DA 4NJQA 2CNMA 4AB7A 1VHEA 3EC4A 4A4CA 3PB4X 4NF1A 1JQGA 2I00A 2PRBA 5I4MA 1RO5A 1KZFA 4JYWA 1Z8XA 5THWA 2YNDA 2BUEA 1M4LA 2R8VA 4KVME 4XPDB 4AVCA 3PB8X 1HEEA 3TFYA 1DTDA 1YVKA 4ONWA 1IIDA 4P4FA 2ZELA 4A39A 5HVGA 3KHZA 1ZG7A 4M8DA 2ARHA 4UEZA 2ODFA 2Q0YA 2Y1NA 4XPLA 4TWEA 2XPLA 1I1DA 2ABZA 5H84A 7CPAA 3F8KA 5D8NA 4F6AA 1BLLE 3TTHA 3VRRA 4A38A 4PXDA 5FVJA 4CRZB 1YREA 3B8GA 3TT2A 4TNUA 1XBUA 1I12A 2IMOA 4MCSA 3DSBA 4MFJA 4ORFA 3S9LA 4J0NA 4P4BA 3BXMA 4U5YA 2PVVA 1A2ZA 2P6GA 2AFZA 4KNGE 4FD5A 1R61A 4I49A 5BWAB 2QYVA 1S7FA 1L0CA 2JEVA 2YJVA 2OOTA 5F13A 1IY7A 4PXEA 3MGDA 4MFZA 1S60A 2A4NA 3TOAA 4UIBA 3TO6A 2IJZA 3K9TA 1SQHA 3G8WA 4F9VA 4AVBA 4MI1A 2B3VA 2VQYA 5LRGA 1XIXA 2XEFA 2WPXA 4NGQA 4JLYA 1MK4A 2B5GB 4X8IA 2CTBA 3D7HA 2NYQA 3EZEA 3NE7A 1BXRB 1QQ9A 3TLGA 1WJTA 3KASA 3NFQA 2E28A 2DXQA 1Y0RA 2ZENA 4OP4A 4B14A 4MFPA 5F9MA 2PVWA 1Y7RA 3BUOB 3ISXA 4OC5A 3EFAA 4PV6A 4UBRA 4DJLA 4QC6A 2FIWA 2HI6A 1WWZA 4P4IA 1F2PA 2ZPAA 2G0BA 2DLAA 4E8OA 4FD6A 4NGPA 3IC1A 3KHXA 4R7MA 4NFRA 4M85A 3VTAA 4C8AA 2PSWA 1JWQA 4NCZA 2AUMA 4BTFA 1J4JA 2PCUA 2ZW4A 4MHPA 5EBVA 2ZW5A 2P6FA 5J3XA 3FB3A 4GS4A 5D29A 1NXJA 1PYTB 4B11A 2BEIA 1EZBA 1TKFA 2PIYA 4CGMA 5LYFA 4C7IA 2BO9A 2OZHA 3N7ZA 4ZY0A 2Q44A 2ZEFA 1EE3P 3FNCA 1ZO0A 4AVAA 4BPXB 4KLVA 2F8HA 2EUIA 3IU2A 4OIDA 4JZ0A 3TLAA 2Z3PA 4C8TA 2V8VA 2QJ8A 3KR5A 1YLEA 2PJ8A 2J8NA 4MHZA 1MJAA 4PSXA 1NSLA 1LANA 5FD8A 4C84A 5JM6A 4B6ZA 4U9YA 1YR0A 2GREA 4R3LA 1Z2LA 3QAYA 4NGTA 4KUBA 3IO1A 3FIXA 3FYNA 1KWMA 4X3RA 1CPSA 1YSJA 4HNWB 4ONUA 1Z8LA 4P10A 4QVTA 4ZX8A 1X10A 2O4HA 2PJAA 3CZXA 8CPAA 1KUXA 4NGNA 3PB9X 2GU2A 1IGBA 3FH4A 4MHYA 1T36B 3T0TA 4GM5A 1CM0A 1M4IA 2Q04A 2EBJA 2VBQA 3D3SA 4B5OA 4C2ZA 2PJ2A 2VEZA 3VH9A 4CAXA 2FS5A 2FIAA 2GFQA 2PE3A 4A31A 1YW6A 4UFWA 1Q2DA 3IFEA 4EVYA 3TLEA 3DNSA 3TO9A 1LCPA 4FWUA 2C6CA 1GHEA 3WC5A 3WC7A 2G3AA 5JVLA 3MN8A 1YLOA 3B35A 3WABA 2AFXA 4KSFA 2REEA 3GY9A 4MMOA 4BMHA 5A28A 3TE4A 4P4DA 4B5PA 5LYDA 3IEHA 3NE8A 5HXDA 5HVFA 1LFWA 4Q38A 4A32A 3WR7A 2HROA 4JXRA 4M6GA 3ZNIA 3K2KA 3CXQA 2PJCA 1TXRA 3LACA 2DF5A 1MJBA 2ZEPA 4C9VA 3GB0A 3IWWA 1NMTA 3G3SA 3GUXA 5J1QA 1Q7LA 4UEEA 4OIWA 1XOVA 1ZG8A 1EO0A 2P6EA 2Z0ZA 4C8FA 3EY5A 3EXNA 4RN7A 5G20A 1Q2CA 6CPAA 5JQ4A 4KOVA 1B6BA 5EC4A 1S7NA 1I21A 2JDCA 2CNSA 5HKZA 3FF3A 1HDQA 1OBRA 4MHNA 1YMEA 2PIZA 2YNEA 2V8GA 4MCRA 3NA6A 2ZXVA 2POKA 1IYKA 2B3UA 1Y9KA 2DEAA 5IV0A 3EO4A 4ZY1A 3VRQA 1CP7A 2PJ3A 2C1CA 4UA3A
chains in the Genus database with same CATH topology
3LWUA 3RZAA 1V6CA 4H2KA 3CPAA 4C8CA 2CF4A 1NSAA 1BAVA 3WC6A 2PJ9A 4F9UA 1LOKA 3D66A 3SI2A 4WWVA 3FJUA 1R43A 3PRTA 1BPNA 4DUKA 2VL1A 3D4UA 3PB6X 3NFZA 2PJ4A 1CG2A 4C9RA 2PJ7A 3FECA 3QNVA 5LYLA 1VHOA 4CPAA 3FEDA 2WZNA 2O53A 1XJOA 3VARA 2CIJA 3T8WA 4AXVA 1UWYA 3I6SA 1HDUA 4A37A 3S9NA 2BOAA 4NGRA 3HUVA 1Y9ZA 2G9DA 3NH8A 2GLFA 4OC3A 3SJXA 2ZOGA 2PJ5A 1XFOA 3FX6A 2PJ0A 1ELMP 4RUHA 4C85A 5ELYA 5K8OA 4P44A 1ZG9A 1DE4C 2ZOFA 4Z65A 4EMEA 3RBUA 2ANPA 3H8EA 4LQGA 5CPAA 2AFUA 2GP4A 2HC9A 5IR2A 3KZWA 2EK8A 3H8GA 4X2TA 3V7ZA 3IJ3A 2PJ1A 3B3VA 4NGMA 3LMSA 4NJRA 3ICUA 5CBMA 4CDKA 3JRUA 1VIXA 2CTCA 4EFDA 3B3TA 2Q51A 4C9AA 1VGYA 1Z5RA 3WT4A 1Y7EA 5IB9A 2NSMA 2GLJA 5F09A 2C5QA 2C6GA 1CP6A 4IAVA 3B3WA 2EWBA 2PJBA 2J9AA 2ZEMA 1TF9A 1H8LA 1F57A 3D67A 2ZEEA 4P45A 4O23A 2ZEHA 3KL9A 4TJVA 2Q4ZA 5DS0A 4YN3A 4C9UA 4YU9A 4PXCA 3SJFA 5JGFA 4FUUA 3SJGA 4PQAA 4CDJA 4C8UA 2IQ6A 4PXBA 2RFHA 4F8ZA 2JBJA 2XEJA 4ZY2A 4UF4A 3KI9A 4IHMA 4C8PA 1WVMA 4W9YA 3VATA 3CPXA 3D7DA 2PRQA 2XEGA 4YWYA 3CDXA 3DLJA 5K8PA 4P6YA 2AFMA 4P4EA 3I1UA 3MRUA 4G1PA 1ARMA 4NGSA 2F7VA 3KR4A 3ISZA 3V38A 4FAIA 3B3CA 2AFOA 2WYRA 3D68A 2BCOA 3FMCA 4PPZA 4ZX9A 4ZI6A 2OR4A 3SI1A 4OC0A 3IIBA 5K8NA 3BHXA 1YW4A 1AMPA 1LAMA 4R76A 1ZLIA 1CBXA 1TKHA 3B3SA 4DYOA 4ZYQA 4MRIA 2ZEOA 4OKOA 1ARLA 3B2YA 3NH5A 3PB7X 3N5FA 3S9MA 4C86A 3PFOA 1PCAA 2C6PA 4C9EA 2XEIA 4FBEA 2JBKA 3SJEA 1LAPA 4OC4A 3PEIA 2EK9A 4MCQA 1FT7A 4BD9A 3BI0A 1QMUA 4EWTA 2HB6A 3BI1A 3FEEA 3KQZA 3KQXA 3PBEA 5JH9A 3D7FA 1TKJA 4K3NA 1TF8A 4A94A 2ZEDA 4MXUA 3RAMA 3PFEA 4C99A 3H8FA 2AFWA 1XF1A 4TJXA 3L2NA 3TC8A 4UEFA 1RTQA 3TX8A 3SI0A 5K8MA 2FVGA 1XRYA 4OC2A 1CPXA 5LRJA 4P4JA 4WJBA 3D7GA 4Q7AA 2Q43A 4R6TA 4OMEA 1CX8A 2V77A 1ZLHA 2AFSA 5LYIA 3DGVA 4IK2A 3B7IA 3NH4A 3I74A 3FVLA 1ELLP 4OC1A 4R8FA 2V8HA 2JEWA 4KSIA 3KGQA 5HVHA 1XMBA 3PBBA 2I3CA 3EIFA 2ZEGA 3HLPA 2QVPA 3CT9A 1GYTA 4UIAA 1Y0YA 2RB7A 4MCPA 3GLJA 2PJ6A 1FNOA 1F2OA 1BPMA 1R3NA 5LRKA 1AYEA 2V8DA 4NJQA 1VHEA 3PB4X 1JQGA 5I4MA 4JYWA 5THWA 1M4LA 3PB8X 1HEEA 1DTDA 4ONWA 4P4FA 2ZELA 4A39A 5HVGA 3KHZA 1ZG7A 4UEZA 4TWEA 2ABZA 7CPAA 5D8NA 1BLLE 4A38A 4PXDA 4TNUA 1XBUA 2IMOA 4MCSA 3S9LA 4P4BA 3BXMA 2PVVA 2AFZA 4KNGE 2QYVA 2OOTA 4PXEA 1IY7A 4UIBA 2IJZA 3K9TA 4F9VA 5LRGA 2XEFA 4NGQA 4X8IA 2CTBA 3D7HA 2NYQA 1QQ9A 3KASA 4OP4A 1Y0RA 2ZENA 2PVWA 3ISXA 4OC5A 4DJLA 4P4IA 1F2PA 4NGPA 3IC1A 3KHXA 4R7MA 4NFRA 3VTAA 4C8AA 2PCUA 4MHPA 5D29A 1PYTB 1TKFA 2PIYA 5LYFA 2BO9A 4ZY0A 2ZEFA 1EE3P 2F8HA 4OIDA 4JZ0A 4C8TA 2V8VA 2QJ8A 3KR5A 2PJ8A 4MHZA 1LANA 4C84A 5JM6A 4B6ZA 2GREA 1Z2LA 4NGTA 3IO1A 1KWMA 4X3RA 1CPSA 1YSJA 1Z8LA 4P10A 4ZX8A 2O4HA 8CPAA 2PJAA 4NGNA 3PB9X 2GU2A 1IGBA 3FH4A 4MHYA 4GM5A 2PJ2A 3VH9A 2PE3A 1YW6A 3IFEA 1LCPA 4FWUA 2C6CA 3WC5A 3WC7A 3MN8A 1YLOA 3B35A 3WABA 2AFXA 4MMOA 4P4DA 5LYDA 3IEHA 5HXDA 5HVFA 1LFWA 3K2KA 2PJCA 1TXRA 2ZEPA 4C9VA 3GB0A 3IWWA 3GUXA 5J1QA 1Q7LA 4UEEA 4OIWA 1ZG8A 4C8FA 6CPAA 3FF3A 1HDQA 1OBRA 4MHNA 1YMEA 2PIZA 2V8GA 4MCRA 3NA6A 2POKA 2DEAA 4ZY1A 1CP7A 2PJ3A 2C1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWU A;  3RZA A;  1V6C A;  4H2K A;  3CPA A;  4C8C A;  2CF4 A;  1NSA A;  1BAV A;  3WC6 A;  2PJ9 A;  4F9U A;  1LOK A;  3D66 A;  3SI2 A;  4WWV A;  3FJU A;  1R43 A;  3PRT A;  1BPN A;  4DUK A;  2VL1 A;  3D4U A;  3PB6 X;  3NFZ A;  2PJ4 A;  1CG2 A;  4C9R A;  2PJ7 A;  3FEC A;  3QNV A;  5LYL A;  1VHO A;  4CPA A;  3FED A;  2WZN A;  2O53 A;  1XJO A;  3VAR A;  2CIJ A;  3T8W A;  4AXV A;  1UWY A;  3I6S A;  1HDU A;  4A37 A;  3S9N A;  2BOA A;  4NGR A;  3HUV A;  1Y9Z A;  2G9D A;  3NH8 A;  2GLF A;  4OC3 A;  3SJX A;  2ZOG A;  2PJ5 A;  1XFO A;  3FX6 A;  2PJ0 A;  1ELM P;  4RUH A;  4C85 A;  5ELY A;  5K8O A;  4P44 A;  1ZG9 A;  1DE4 C;  2ZOF A;  4Z65 A;  4EME A;  3RBU A;  2ANP A;  3H8E A;  4LQG A;  5CPA A;  2AFU A;  2HC9 A;  3KZW A;  2EK8 A;  3H8G A;  4X2T A;  3V7Z A;  3IJ3 A;  2PJ1 A;  3B3V A;  4NGM A;  3LMS A;  4NJR A;  3ICU A;  5CBM A;  4CDK A;  3JRU A;  1VIX A;  2CTC A;  4EFD A;  3B3T A;  2Q51 A;  4C9A A;  1VGY A;  1Z5R A;  3WT4 A;  1Y7E A;  5IB9 A;  2NSM A;  2GLJ A;  5F09 A;  2C6G A;  1CP6 A;  4IAV A;  3B3W A;  2EWB A;  2PJB A;  2J9A A;  2ZEM A;  1TF9 A;  1H8L A;  1F57 A;  3D67 A;  2ZEE A;  4P45 A;  4O23 A;  2ZEH A;  3KL9 A;  4TJV A;  2Q4Z A;  5DS0 A;  4YN3 A;  4C9U A;  4YU9 A;  4PXC A;  3SJF A;  5JGF A;  4FUU A;  3SJG A;  4PQA A;  4CDJ A;  4C8U A;  2IQ6 A;  4PXB A;  2RFH A;  4F8Z A;  2JBJ A;  2XEJ A;  4ZY2 A;  4UF4 A;  3KI9 A;  4IHM A;  4C8P A;  1WVM A;  4W9Y A;  3VAT A;  3CPX A;  3D7D A;  2PRQ A;  2XEG A;  4YWY A;  3CDX A;  3DLJ A;  5K8P A;  4P6Y A;  2AFM A;  4P4E A;  3I1U A;  3MRU A;  4G1P A;  1ARM A;  4NGS A;  2F7V A;  3KR4 A;  3ISZ A;  3V38 A;  4FAI A;  3B3C A;  2AFO A;  2WYR A;  3D68 A;  2BCO A;  3FMC A;  4PPZ A;  4ZX9 A;  4ZI6 A;  2OR4 A;  3SI1 A;  4OC0 A;  3IIB A;  5K8N A;  3BHX A;  1YW4 A;  1AMP A;  1LAM A;  4R76 A;  1ZLI A;  1CBX A;  1TKH A;  3B3S A;  4DYO A;  4ZYQ A;  4MRI A;  2ZEO A;  4OKO A;  1ARL A;  3B2Y A;  3NH5 A;  3PB7 X;  3N5F A;  3S9M A;  4C86 A;  3PFO A;  1PCA A;  2C6P A;  4C9E A;  2XEI A;  4FBE A;  2JBK A;  3SJE A;  1LAP A;  4OC4 A;  3PEI A;  2EK9 A;  4MCQ A;  1FT7 A;  4BD9 A;  3BI0 A;  1QMU A;  4EWT A;  2HB6 A;  3BI1 A;  3FEE A;  3KQZ A;  3KQX A;  3PBE A;  5JH9 A;  3D7F A;  1TKJ A;  4K3N A;  1TF8 A;  4A94 A;  2ZED A;  4MXU A;  3RAM A;  3PFE A;  4C99 A;  3H8F A;  2AFW A;  1XF1 A;  4TJX A;  3L2N A;  3TC8 A;  4UEF A;  1RTQ A;  3TX8 A;  3SI0 A;  5K8M A;  2FVG A;  1XRY A;  4OC2 A;  1CPX A;  5LRJ A;  4P4J A;  4WJB A;  3D7G A;  4Q7A A;  2Q43 A;  4R6T A;  4OME A;  1CX8 A;  2V77 A;  1ZLH A;  2AFS A;  5LYI A;  3DGV A;  4IK2 A;  3B7I A;  3NH4 A;  3I74 A;  3FVL A;  1ELL P;  4OC1 A;  4R8F A;  2V8H A;  2JEW A;  4KSI A;  3KGQ A;  5HVH A;  1XMB A;  3PBB A;  2I3C A;  3EIF A;  2ZEG A;  3HLP A;  2QVP A;  3CT9 A;  1GYT A;  4UIA A;  1Y0Y A;  2RB7 A;  4MCP A;  3GLJ A;  2PJ6 A;  1FNO A;  1F2O A;  1BPM A;  1R3N A;  5LRK A;  1AYE A;  2V8D A;  4NJQ A;  1VHE A;  3PB4 X;  1JQG A;  5I4M A;  4JYW A;  5THW A;  1M4L A;  3PB8 X;  1HEE A;  1DTD A;  4ONW A;  4P4F A;  2ZEL A;  4A39 A;  5HVG A;  3KHZ A;  1ZG7 A;  4UEZ A;  4TWE A;  2ABZ A;  7CPA A;  5D8N A;  1BLL E;  4A38 A;  4PXD A;  4TNU A;  1XBU A;  2IMO A;  4MCS A;  3S9L A;  4P4B A;  3BXM A;  2PVV A;  2AFZ A;  4KNG E;  2QYV A;  2OOT A;  4PXE A;  1IY7 A;  4UIB A;  2IJZ A;  3K9T A;  4F9V A;  5LRG A;  2XEF A;  4NGQ A;  4X8I A;  2CTB A;  3D7H A;  2NYQ A;  1QQ9 A;  3KAS A;  4OP4 A;  1Y0R A;  2ZEN A;  2PVW A;  3ISX A;  4OC5 A;  4DJL A;  4P4I A;  1F2P A;  4NGP A;  3IC1 A;  3KHX A;  4R7M A;  4NFR A;  3VTA A;  4C8A A;  2PCU A;  4MHP A;  5D29 A;  1PYT B;  1TKF A;  2PIY A;  5LYF A;  2BO9 A;  4ZY0 A;  2ZEF A;  1EE3 P;  2F8H A;  4OID A;  4JZ0 A;  4C8T A;  2V8V A;  2QJ8 A;  3KR5 A;  2PJ8 A;  4MHZ A;  1LAN A;  4C84 A;  5JM6 A;  4B6Z A;  2GRE A;  1Z2L A;  4NGT A;  3IO1 A;  1KWM A;  4X3R A;  1CPS A;  1YSJ A;  1Z8L A;  4P10 A;  4ZX8 A;  2O4H A;  8CPA A;  2PJA A;  4NGN A;  3PB9 X;  2GU2 A;  1IGB A;  3FH4 A;  4MHY A;  4GM5 A;  2PJ2 A;  3VH9 A;  2PE3 A;  1YW6 A;  3IFE A;  1LCP A;  4FWU A;  2C6C A;  3WC5 A;  3WC7 A;  3MN8 A;  1YLO A;  3B35 A;  3WAB A;  2AFX A;  4MMO A;  4P4D A;  5LYD A;  3IEH A;  5HXD A;  5HVF A;  1LFW A;  3K2K A;  2PJC A;  1TXR A;  2ZEP A;  4C9V A;  3GB0 A;  3IWW A;  3GUX A;  5J1Q A;  1Q7L A;  4UEE A;  4OIW A;  1ZG8 A;  4C8F A;  6CPA A;  3FF3 A;  1HDQ A;  1OBR A;  4MHN A;  1YME A;  2PIZ A;  2V8G A;  4MCR A;  3NA6 A;  2POK A;  2DEA A;  4ZY1 A;  1CP7 A;  2PJ3 A;  2C1C A; 
#chains in the Genus database with same CATH topology
 2PC1 A;  4II9 A;  3LWU A;  3DR6 A;  3RZA A;  4Y49 C;  4H2K A;  1V6C A;  3CPA A;  4C8C A;  4BBH A;  2C27 A;  2CF4 A;  5J8C A;  3SHP A;  2Q4Y A;  1NSA A;  1ON0 A;  5BY0 A;  1BAV A;  2B5G A;  1LOK A;  2PJ9 A;  3CXS A;  4A4B A;  3D66 A;  3R96 A;  3SI2 A;  4WWV A;  1KEE B;  1ZL0 A;  3TLY A;  3FJU A;  4COG A;  1R43 A;  3S6F A;  4KSA A;  4F9U A;  3PRT A;  3TLZ A;  1BPN A;  4DUK A;  2VL1 A;  3D4U A;  3PB6 X;  3NFZ A;  1Z8W A;  5I0C A;  2PJ4 A;  5AXI A;  1CG2 A;  2J8M A;  2PJ7 A;  1XF8 A;  4C9R A;  1U6M A;  2Z3O A;  4KVX A;  3D8P A;  1KUY A;  2EO8 A;  1JDE A;  3FEC A;  2GAN A;  3C26 A;  3ICU A;  3JUW A;  3QNV A;  4MI4 A;  2J8R A;  1VBH A;  5LYL A;  2EZA A;  2X7B A;  3T07 A;  3PZJ A;  4B13 A;  1VHO A;  4CPA A;  2R1I A;  4CZ1 A;  2Y1M A;  5AG7 A;  3VRO A;  3FED A;  1TIQ A;  4X5K A;  4MFL A;  2WZN A;  4UCM A;  2O53 A;  1XJO A;  5G21 A;  3ZZI A;  3K4I A;  3IWE A;  3VAR A;  3S6G A;  4H89 A;  2CIJ A;  2Z3K A;  3K9U A;  4OAE A;  3OWC A;  4ZGY B;  3F0A A;  3T90 A;  1CE8 B;  3PT1 A;  1X12 A;  4KOY A;  3T8W A;  4AXV A;  2P0W A;  1UWY A;  5H86 A;  5E96 A;  1NE9 A;  1Q2Y A;  3UY5 A;  3VWE A;  3I6S A;  1HDU A;  2GIV A;  2KCW A;  3TCV A;  3VGO A;  4UCP A;  1QSO A;  4A37 A;  3S9N A;  2BOA A;  2JLM A;  3W91 A;  5ISV A;  4NGR A;  3HUV A;  1Y9Z A;  2G9D A;  4C68 A;  2CY2 A;  3NH8 A;  2GLF A;  4OC3 A;  4M6I A;  4UWJ A;  4JXQ A;  3SJX A;  2ZOG A;  1IIC A;  4QBJ A;  3NOJ A;  2PJ5 A;  4OAD A;  4UFV A;  5JPH A;  5KTC A;  1QSN A;  4BPU B;  1XFO A;  3SXO A;  1QST A;  3FX6 A;  4MBU A;  2Y0M A;  4YGO A;  1XEB A;  2PJ0 A;  1BOB A;  1ELM P;  4NEX A;  4RUH A;  5GCN A;  2HWG A;  4C85 A;  5ELY A;  4HNY B;  1M4D A;  3F5B A;  5K8O A;  1UFH A;  4P44 A;  1AUG A;  4JJX A;  5J8F A;  1ZG9 A;  4PK2 A;  1DE4 C;  2QML A;  3U88 C;  4L8A A;  2ZOF A;  2VZY A;  4BIN A;  3SXN A;  5C82 A;  4Z65 A;  2K5T A;  4EME A;  3RBU A;  2ANP A;  3H8E A;  4LQG A;  3JVN A;  4ZBG A;  1IYL A;  5HH1 A;  1VHS A;  4QUS A;  1BO4 A;  4A95 A;  1N71 A;  1IU8 A;  5CPA A;  2AFU A;  3V8I A;  5F5X A;  4K30 A;  5CNP A;  4HKF A;  4IIX A;  2DPS A;  2GP4 A;  2HC9 A;  3G23 A;  2XPN A;  4BPW B;  1P4N A;  3BUX B;  1XMT A;  4Y49 B;  2BSW A;  3KZW A;  2EK8 A;  4M3S A;  3H8G A;  3R95 A;  4CAE A;  4CS0 B;  5AG6 A;  4X2T A;  3V7Z A;  3T5M A;  3E0K A;  4KOR A;  2FE7 A;  2YNC C;  3IJ3 A;  2FCK A;  2PJ1 A;  2Z3L A;  4NGM A;  2B4D B;  3B3V A;  3LOD A;  3LMS A;  4KOX A;  4NJR A;  4RI1 A;  3JRU A;  5CBM A;  4CDK A;  1VIX A;  2CTC A;  4EFD A;  3B3T A;  4HNX B;  2X0S A;  3TLG B;  2G3T A;  2Q51 A;  4C9A A;  1VGY A;  1Z5R A;  4INJ A;  3W6S A;  3WT4 A;  1Y7E A;  5IB9 A;  1B47 A;  3FRM A;  4MHD A;  1FY7 A;  4E2A A;  3W6X A;  4F0X A;  3T05 A;  2FXF A;  2NSM A;  4KOS A;  1S5K A;  3P2H A;  2GLJ A;  3PGP A;  5F09 A;  2C5Q A;  2C6G A;  2CBL A;  1CP6 A;  2FT0 A;  3A9L A;  3B3W A;  4IAV A;  2Q7B A;  3I74 A;  2EWB A;  2BL1 A;  2B4B A;  2IL4 A;  2Q7S A;  4KVO E;  3PP9 A;  2PJB A;  4IUS A;  2ATR A;  2HV2 A;  2J9A A;  3BUM B;  3FXT A;  2ZEM A;  4KUA A;  2B4J C;  1TF9 A;  3EZB A;  1H8L A;  1F57 A;  3D67 A;  2O28 A;  2ZEE A;  4P45 A;  4O23 A;  1K4J A;  4PK3 A;  2VKZ G;  4CYN A;  1Z8T A;  2ZEH A;  3KL9 A;  4TJV A;  3H4Q A;  2Q4Z A;  1OZP A;  1QSM A;  5DS0 A;  1B87 A;  4YU9 A;  3RO0 A;  4YN3 A;  4C9U A;  4GXH A;  3WC6 A;  1IOI A;  2OB0 A;  5KTA A;  1KBL A;  2FL4 A;  4PXC A;  3SJF A;  1Q5X A;  1KC7 A;  2OZG A;  5JGF A;  1M1D A;  2REF A;  4FUU A;  2EVN A;  4M6H A;  4XNH C;  5F49 A;  3SJG A;  1S7L A;  4PQA A;  3R9F A;  1Z9U A;  2DPT A;  3JTK A;  4CDJ A;  4C8U A;  2IQ6 A;  4PXB A;  3RYO A;  3U1B A;  4E5S A;  4JVO A;  4KLW A;  5F48 A;  2RFH A;  4CYP A;  4F8Z A;  4CGO A;  3EZA A;  2CNT A;  5KTD A;  2JBJ A;  3KKW A;  2XEJ A;  4ZY2 A;  4UF4 A;  1EZA A;  3VRN A;  3KI9 A;  4IHM A;  4C8P A;  3I9S A;  1S3Z A;  2ZW6 A;  3T9Y A;  4QB9 A;  1VI4 A;  2R7H A;  2Z3M A;  1WVM A;  2B58 A;  4W9Y A;  4PSW A;  3VAT A;  3CPX A;  2FM4 A;  4CO9 A;  3D7D A;  2PRQ A;  2H5M A;  2XEG A;  4HPS A;  3SR3 A;  1DIK A;  2Z10 A;  4H6U A;  1VBG A;  4YWY A;  3CDX A;  3DLJ A;  3BLN A;  4B10 A;  4LQ6 A;  1C30 B;  4KS9 A;  5K8P A;  4CAV A;  1WK4 A;  4COB A;  4LX9 A;  1CJW A;  4P6Y A;  2AFM A;  3TOB A;  4R57 A;  4P4E A;  3I1U A;  3MRU A;  4G1P A;  4B5P B;  1ARM A;  2D0O A;  4NGS A;  2F7V A;  3H5Z A;  4AG9 A;  5A27 A;  3GJZ A;  3KR4 A;  3ISZ A;  1A9X B;  3V38 A;  4FAI A;  3B3C A;  2OLS A;  2AFO A;  2DIK A;  2PCN A;  2WYR A;  3D68 A;  2YJT A;  2BCO A;  3FMC A;  4CGP A;  2EZB A;  4KOW A;  4PPZ A;  4EYS A;  1NBW A;  2PR8 A;  4ZX9 A;  3I3G A;  1P0H A;  4ZI6 A;  1S7K A;  4KOU A;  2OR4 A;  3GKR A;  4R9M A;  3SI1 A;  4E94 A;  3HPG G;  4OC0 A;  2WPW A;  3IIB A;  3LD2 A;  3PLF B;  3BHX A;  1YW4 A;  5DWM A;  4YFJ A;  4J3G A;  5K8N A;  2B0A A;  4CGL A;  4F0Y A;  3KRV A;  3OB1 B;  1AMP A;  2ZW7 A;  1LAM A;  1XE4 A;  2QIR A;  4R76 A;  4MFQ A;  1ZLI A;  4NXY A;  2OU2 A;  3R9G A;  3C8O A;  3TO7 A;  4H6Z A;  5IR2 A;  3ZJ0 A;  3CXP A;  3VRP A;  3OP0 A;  1CBX A;  1TKH A;  3B3S A;  3OB2 B;  3R1K A;  2UV8 G;  4DYO A;  4MRI A;  4ZYQ A;  2ZEO A;  3IU1 A;  4OKO A;  1ARL A;  4MFK A;  1ZRS A;  2HQY A;  2B4D A;  3B2Y A;  1YX0 A;  1YVO A;  3NH5 A;  3PB7 X;  4AG7 A;  3FBU A;  5IB0 A;  3D2P A;  3N5F A;  2YGW A;  3S9M A;  3S6H A;  5DWN A;  4CGN A;  3PFO A;  4MJ8 A;  1PCA A;  4C86 A;  2MP0 A;  2C6P A;  4C9E A;  1YVH A;  3O8Z A;  4XNH B;  2XEI A;  1QSR A;  3TYX A;  4FBE A;  2JBK A;  2PDO A;  2N3A B;  3PFV A;  3SJE A;  1LAP A;  2AJ6 A;  4OC4 A;  3PEI A;  2EK9 A;  2RC4 A;  1J3L A;  4MCQ A;  1FT7 A;  4BD9 A;  5G22 A;  4C2Y A;  1M44 A;  3BI0 A;  1QMU A;  4LUA A;  4EWT A;  2HB6 A;  3BI1 A;  3FEE A;  4MJX A;  3KQZ A;  1CS0 B;  3KQX A;  4CYO A;  2OZU A;  3PBE A;  5JH9 A;  4XPD C;  3D7F A;  1TKJ A;  4JD6 A;  2D0P A;  4K3N A;  1TF8 A;  4A94 A;  2ZED A;  1PU9 A;  4MXU A;  3RAM A;  4CRY B;  2D4P A;  3PFE A;  5HKW A;  4R3K A;  4C7H A;  3BUN B;  5HKY A;  3H8F A;  4C99 A;  3OAK A;  2AFW A;  2VXK A;  3HPH E;  3QB8 A;  1XF1 A;  2WSA A;  3S6K A;  2PR1 A;  4Q36 A;  4U9Z A;  2AE6 A;  4TJX A;  4FD4 A;  3D2M A;  3L2N A;  1RXT A;  4RR2 B;  1GGO A;  3TC8 A;  2XPO A;  1ZYM A;  3BJ7 A;  4XPK A;  4UEF A;  1RTQ A;  3TX8 A;  2CXA A;  4GPL B;  3DR8 A;  3SI0 A;  5K8M A;  2PQ8 A;  2FSR A;  2FVG A;  3GIU A;  4H1H A;  1LRZ A;  1XRY A;  5EMI A;  4OC2 A;  4UCN A;  3TLB A;  4A33 A;  1CPX A;  5LRJ A;  3BJ8 A;  2Q4V A;  4JWP A;  2XPP A;  4P4J A;  2GE3 A;  1Z9E A;  1IOF A;  1M4G A;  2QEC A;  4UFX A;  4WJB A;  3D7G A;  5AGE A;  4Q7A A;  2Q43 A;  4DNC A;  4E0A A;  4R87 A;  1YQE A;  4C2X A;  5HMN A;  2VZZ A;  3DDD A;  4R6T A;  3F9K C;  1PUA A;  1JDB C;  2R82 A;  4UWI A;  4OME A;  1CX8 A;  5F1Y A;  3HMJ G;  3RNZ A;  1Z4E A;  1ZLH A;  2AFS A;  2V77 A;  4KOT A;  5LYI A;  1M6V B;  4A2Z A;  2NMT A;  3DGV A;  4CAW A;  2R98 A;  4IK2 A;  3B7I A;  3NH4 A;  2Z11 A;  4NSQ A;  3FVL A;  3P2F A;  1ELL P;  5AG4 A;  3GYA A;  4OC1 A;  5C88 A;  4L89 A;  4MY0 A;  2JDD A;  4IIY A;  4B12 A;  4R8F A;  2EZC A;  3IGR A;  5AG5 A;  1Z4R A;  2V8H A;  1FBV A;  3VWD A;  2OH1 A;  3IWG A;  2HUZ A;  4CAF A;  2JEW A;  5G1Z A;  1V0C A;  1YK3 A;  5F47 A;  2VI7 A;  4KSI A;  2YNC A;  3KGQ A;  5HVH A;  1XMB A;  3PBB A;  2I3C A;  4OLL A;  3R9E A;  4A30 A;  4IF5 A;  2ZEG A;  3HLP A;  3EIF A;  5F46 A;  4RS2 A;  4YRH A;  2QVP A;  3CT9 A;  1IB1 E;  5K99 A;  1GYT A;  1MJ9 A;  4UIA A;  2F5I A;  1Y0Y A;  3BUW B;  4MCP A;  2RB7 A;  3GLJ A;  5IX3 A;  2AUN A;  5JYB A;  1YGH A;  4FD7 A;  1KUV A;  2PJ6 A;  1FNO A;  1VKC A;  2D4O A;  2I79 A;  1Y9W A;  2WUU A;  1F2O A;  4CYQ A;  2Z3N A;  3QAH A;  1BPM A;  1R3N A;  4KZT A;  4MY3 A;  5LRK A;  3TLC A;  1C3O B;  1AYE A;  1R57 A;  2V8D A;  4NJQ A;  2CNM A;  4AB7 A;  1VHE A;  3EC4 A;  4A4C A;  3PB4 X;  4NF1 A;  1JQG A;  2I00 A;  2PRB A;  5I4M A;  1RO5 A;  1KZF A;  4JYW A;  1Z8X A;  5THW A;  2YND A;  2BUE A;  1M4L A;  2R8V A;  4KVM E;  4XPD B;  4AVC A;  3PB8 X;  1HEE A;  3TFY A;  1DTD A;  1YVK A;  4ONW A;  1IID A;  4P4F A;  2ZEL A;  4A39 A;  5HVG A;  3KHZ A;  1ZG7 A;  4M8D A;  2ARH A;  4UEZ A;  2ODF A;  2Q0Y A;  2Y1N A;  4XPL A;  4TWE A;  2XPL A;  1I1D A;  2ABZ A;  5H84 A;  7CPA A;  3F8K A;  5D8N A;  4F6A A;  1BLL E;  3TTH A;  3VRR A;  4A38 A;  4PXD A;  5FVJ A;  4CRZ B;  1YRE A;  3B8G A;  3TT2 A;  4TNU A;  1XBU A;  1I12 A;  2IMO A;  4MCS A;  3DSB A;  4MFJ A;  4ORF A;  3S9L A;  4J0N A;  4P4B A;  3BXM A;  4U5Y A;  2PVV A;  1A2Z A;  2P6G A;  2AFZ A;  4KNG E;  4FD5 A;  1R61 A;  4I49 A;  5BWA B;  2QYV A;  1S7F A;  1L0C A;  2JEV A;  2YJV A;  2OOT A;  5F13 A;  1IY7 A;  4PXE A;  3MGD A;  4MFZ A;  1S60 A;  2A4N A;  3TOA A;  4UIB A;  3TO6 A;  2IJZ A;  3K9T A;  1SQH A;  3G8W A;  4F9V A;  4AVB A;  4MI1 A;  2B3V A;  2VQY A;  5LRG A;  1XIX A;  2XEF A;  2WPX A;  4NGQ A;  4JLY A;  1MK4 A;  2B5G B;  4X8I A;  2CTB A;  3D7H A;  2NYQ A;  3EZE A;  3NE7 A;  1BXR B;  1QQ9 A;  3TLG A;  1WJT A;  3KAS A;  3NFQ A;  2E28 A;  2DXQ A;  1Y0R A;  2ZEN A;  4OP4 A;  4B14 A;  4MFP A;  5F9M A;  2PVW A;  1Y7R A;  3BUO B;  3ISX A;  4OC5 A;  3EFA A;  4PV6 A;  4UBR A;  4DJL A;  4QC6 A;  2FIW A;  2HI6 A;  1WWZ A;  4P4I A;  1F2P A;  2ZPA A;  2G0B A;  2DLA A;  4E8O A;  4FD6 A;  4NGP A;  3IC1 A;  3KHX A;  4R7M A;  4NFR A;  4M85 A;  3VTA A;  4C8A A;  2PSW A;  1JWQ A;  4NCZ A;  2AUM A;  4BTF A;  1J4J A;  2PCU A;  2ZW4 A;  4MHP A;  5EBV A;  2ZW5 A;  2P6F A;  5J3X A;  3FB3 A;  4GS4 A;  5D29 A;  1NXJ A;  1PYT B;  4B11 A;  2BEI A;  1EZB A;  1TKF A;  2PIY A;  4CGM A;  5LYF A;  4C7I A;  2BO9 A;  2OZH A;  3N7Z A;  4ZY0 A;  2Q44 A;  2ZEF A;  1EE3 P;  3FNC A;  1ZO0 A;  4AVA A;  4BPX B;  4KLV A;  2F8H A;  2EUI A;  3IU2 A;  4OID A;  4JZ0 A;  3TLA A;  2Z3P A;  4C8T A;  2V8V A;  2QJ8 A;  3KR5 A;  1YLE A;  2PJ8 A;  2J8N A;  4MHZ A;  1MJA A;  4PSX A;  1NSL A;  1LAN A;  5FD8 A;  4C84 A;  5JM6 A;  4B6Z A;  4U9Y A;  1YR0 A;  2GRE A;  4R3L A;  1Z2L A;  3QAY A;  4NGT A;  4KUB A;  3IO1 A;  3FIX A;  3FYN A;  1KWM A;  4X3R A;  1CPS A;  1YSJ A;  4HNW B;  4ONU A;  1Z8L A;  4P10 A;  4QVT A;  4ZX8 A;  1X10 A;  2O4H A;  2PJA A;  3CZX A;  8CPA A;  1KUX A;  4NGN A;  3PB9 X;  2GU2 A;  1IGB A;  3FH4 A;  4MHY A;  1T36 B;  3T0T A;  4GM5 A;  1CM0 A;  1M4I A;  2Q04 A;  2EBJ A;  2VBQ A;  3D3S A;  4B5O A;  4C2Z A;  2PJ2 A;  2VEZ A;  3VH9 A;  4CAX A;  2FS5 A;  2FIA A;  2GFQ A;  2PE3 A;  4A31 A;  1YW6 A;  4UFW A;  1Q2D A;  3IFE A;  4EVY A;  3TLE A;  3DNS A;  3TO9 A;  1LCP A;  4FWU A;  2C6C A;  1GHE A;  3WC5 A;  3WC7 A;  2G3A A;  5JVL A;  3MN8 A;  1YLO A;  3B35 A;  3WAB A;  2AFX A;  4KSF A;  2REE A;  3GY9 A;  4MMO A;  4BMH A;  5A28 A;  3TE4 A;  4P4D A;  4B5P A;  5LYD A;  3IEH A;  3NE8 A;  5HXD A;  5HVF A;  1LFW A;  4Q38 A;  4A32 A;  3WR7 A;  2HRO A;  4JXR A;  4M6G A;  3ZNI A;  3K2K A;  3CXQ A;  2PJC A;  1TXR A;  3LAC A;  2DF5 A;  1MJB A;  2ZEP A;  4C9V A;  3GB0 A;  3IWW A;  1NMT A;  3G3S A;  3GUX A;  5J1Q A;  1Q7L A;  4UEE A;  4OIW A;  1XOV A;  1ZG8 A;  1EO0 A;  2P6E A;  2Z0Z A;  4C8F A;  3EY5 A;  3EXN A;  4RN7 A;  5G20 A;  1Q2C A;  6CPA A;  5JQ4 A;  4KOV A;  1B6B A;  5EC4 A;  1S7N A;  1I21 A;  2JDC A;  2CNS A;  5HKZ A;  3FF3 A;  1HDQ A;  1OBR A;  4MHN A;  1YME A;  2PIZ A;  2YNE A;  2V8G A;  4MCR A;  3NA6 A;  2ZXV A;  2POK A;  1IYK A;  2B3U A;  1Y9K A;  2DEA A;  5IV0 A;  3EO4 A;  4ZY1 A;  3VRQ A;  1CP7 A;  2PJ3 A;  2C1C A;  4UA3 A; 
#chains in the Genus database with same CATH homology
 3LWU A;  3RZA A;  1V6C A;  4H2K A;  3CPA A;  4C8C A;  2CF4 A;  1NSA A;  1BAV A;  3WC6 A;  2PJ9 A;  4F9U A;  1LOK A;  3D66 A;  3SI2 A;  4WWV A;  3FJU A;  1R43 A;  3PRT A;  1BPN A;  4DUK A;  2VL1 A;  3D4U A;  3PB6 X;  3NFZ A;  2PJ4 A;  1CG2 A;  4C9R A;  2PJ7 A;  3FEC A;  3QNV A;  5LYL A;  1VHO A;  4CPA A;  3FED A;  2WZN A;  2O53 A;  1XJO A;  3VAR A;  2CIJ A;  3T8W A;  4AXV A;  1UWY A;  3I6S A;  1HDU A;  4A37 A;  3S9N A;  2BOA A;  4NGR A;  3HUV A;  1Y9Z A;  2G9D A;  3NH8 A;  2GLF A;  4OC3 A;  3SJX A;  2ZOG A;  2PJ5 A;  1XFO A;  3FX6 A;  2PJ0 A;  1ELM P;  4RUH A;  4C85 A;  5ELY A;  5K8O A;  4P44 A;  1ZG9 A;  1DE4 C;  2ZOF A;  4Z65 A;  4EME A;  3RBU A;  2ANP A;  3H8E A;  4LQG A;  5CPA A;  2AFU A;  2GP4 A;  2HC9 A;  5IR2 A;  3KZW A;  2EK8 A;  3H8G A;  4X2T A;  3V7Z A;  3IJ3 A;  2PJ1 A;  3B3V A;  4NGM A;  3LMS A;  4NJR A;  3ICU A;  5CBM A;  4CDK A;  3JRU A;  1VIX A;  2CTC A;  4EFD A;  3B3T A;  2Q51 A;  4C9A A;  1VGY A;  1Z5R A;  3WT4 A;  1Y7E A;  5IB9 A;  2NSM A;  2GLJ A;  5F09 A;  2C5Q A;  2C6G A;  1CP6 A;  4IAV A;  3B3W A;  2EWB A;  2PJB A;  2J9A A;  2ZEM A;  1TF9 A;  1H8L A;  1F57 A;  3D67 A;  2ZEE A;  4P45 A;  4O23 A;  2ZEH A;  3KL9 A;  4TJV A;  2Q4Z A;  5DS0 A;  4YN3 A;  4C9U A;  4YU9 A;  4PXC A;  3SJF A;  5JGF A;  4FUU A;  3SJG A;  4PQA A;  4CDJ A;  4C8U A;  2IQ6 A;  4PXB A;  2RFH A;  4F8Z A;  2JBJ A;  2XEJ A;  4ZY2 A;  4UF4 A;  3KI9 A;  4IHM A;  4C8P A;  1WVM A;  4W9Y A;  3VAT A;  3CPX A;  3D7D A;  2PRQ A;  2XEG A;  4YWY A;  3CDX A;  3DLJ A;  5K8P A;  4P6Y A;  2AFM A;  4P4E A;  3I1U A;  3MRU A;  4G1P A;  1ARM A;  4NGS A;  2F7V A;  3KR4 A;  3ISZ A;  3V38 A;  4FAI A;  3B3C A;  2AFO A;  2WYR A;  3D68 A;  2BCO A;  3FMC A;  4PPZ A;  4ZX9 A;  4ZI6 A;  2OR4 A;  3SI1 A;  4OC0 A;  3IIB A;  5K8N A;  3BHX A;  1YW4 A;  1AMP A;  1LAM A;  4R76 A;  1ZLI A;  1CBX A;  1TKH A;  3B3S A;  4DYO A;  4ZYQ A;  4MRI A;  2ZEO A;  4OKO A;  1ARL A;  3B2Y A;  3NH5 A;  3PB7 X;  3N5F A;  3S9M A;  4C86 A;  3PFO A;  1PCA A;  2C6P A;  4C9E A;  2XEI A;  4FBE A;  2JBK A;  3SJE A;  1LAP A;  4OC4 A;  3PEI A;  2EK9 A;  4MCQ A;  1FT7 A;  4BD9 A;  3BI0 A;  1QMU A;  4EWT A;  2HB6 A;  3BI1 A;  3FEE A;  3KQZ A;  3KQX A;  3PBE A;  5JH9 A;  3D7F A;  1TKJ A;  4K3N A;  1TF8 A;  4A94 A;  2ZED A;  4MXU A;  3RAM A;  3PFE A;  4C99 A;  3H8F A;  2AFW A;  1XF1 A;  4TJX A;  3L2N A;  3TC8 A;  4UEF A;  1RTQ A;  3TX8 A;  3SI0 A;  5K8M A;  2FVG A;  1XRY A;  4OC2 A;  1CPX A;  5LRJ A;  4P4J A;  4WJB A;  3D7G A;  4Q7A A;  2Q43 A;  4R6T A;  4OME A;  1CX8 A;  2V77 A;  1ZLH A;  2AFS A;  5LYI A;  3DGV A;  4IK2 A;  3B7I A;  3NH4 A;  3I74 A;  3FVL A;  1ELL P;  4OC1 A;  4R8F A;  2V8H A;  2JEW A;  4KSI A;  3KGQ A;  5HVH A;  1XMB A;  3PBB A;  2I3C A;  3EIF A;  2ZEG A;  3HLP A;  2QVP A;  3CT9 A;  1GYT A;  4UIA A;  1Y0Y A;  2RB7 A;  4MCP A;  3GLJ A;  2PJ6 A;  1FNO A;  1F2O A;  1BPM A;  1R3N A;  5LRK A;  1AYE A;  2V8D A;  4NJQ A;  1VHE A;  3PB4 X;  1JQG A;  5I4M A;  4JYW A;  5THW A;  1M4L A;  3PB8 X;  1HEE A;  1DTD A;  4ONW A;  4P4F A;  2ZEL A;  4A39 A;  5HVG A;  3KHZ A;  1ZG7 A;  4UEZ A;  4TWE A;  2ABZ A;  7CPA A;  5D8N A;  1BLL E;  4A38 A;  4PXD A;  4TNU A;  1XBU A;  2IMO A;  4MCS A;  3S9L A;  4P4B A;  3BXM A;  2PVV A;  2AFZ A;  4KNG E;  2QYV A;  2OOT A;  4PXE A;  1IY7 A;  4UIB A;  2IJZ A;  3K9T A;  4F9V A;  5LRG A;  2XEF A;  4NGQ A;  4X8I A;  2CTB A;  3D7H A;  2NYQ A;  1QQ9 A;  3KAS A;  4OP4 A;  1Y0R A;  2ZEN A;  2PVW A;  3ISX A;  4OC5 A;  4DJL A;  4P4I A;  1F2P A;  4NGP A;  3IC1 A;  3KHX A;  4R7M A;  4NFR A;  3VTA A;  4C8A A;  2PCU A;  4MHP A;  5D29 A;  1PYT B;  1TKF A;  2PIY A;  5LYF A;  2BO9 A;  4ZY0 A;  2ZEF A;  1EE3 P;  2F8H A;  4OID A;  4JZ0 A;  4C8T A;  2V8V A;  2QJ8 A;  3KR5 A;  2PJ8 A;  4MHZ A;  1LAN A;  4C84 A;  5JM6 A;  4B6Z A;  2GRE A;  1Z2L A;  4NGT A;  3IO1 A;  1KWM A;  4X3R A;  1CPS A;  1YSJ A;  1Z8L A;  4P10 A;  4ZX8 A;  2O4H A;  8CPA A;  2PJA A;  4NGN A;  3PB9 X;  2GU2 A;  1IGB A;  3FH4 A;  4MHY A;  4GM5 A;  2PJ2 A;  3VH9 A;  2PE3 A;  1YW6 A;  3IFE A;  1LCP A;  4FWU A;  2C6C A;  3WC5 A;  3WC7 A;  3MN8 A;  1YLO A;  3B35 A;  3WAB A;  2AFX A;  4MMO A;  4P4D A;  5LYD A;  3IEH A;  5HXD A;  5HVF A;  1LFW A;  3K2K A;  2PJC A;  1TXR A;  2ZEP A;  4C9V A;  3GB0 A;  3IWW A;  3GUX A;  5J1Q A;  1Q7L A;  4UEE A;  4OIW A;  1ZG8 A;  4C8F A;  6CPA A;  3FF3 A;  1HDQ A;  1OBR A;  4MHN A;  1YME A;  2PIZ A;  2V8G A;  4MCR A;  3NA6 A;  2POK A;  2DEA A;  4ZY1 A;  1CP7 A;  2PJ3 A;  2C1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...