3SJEA

X-ray structure of human glutamate carboxypeptidase ii (the e424a inactive mutant) in complex with n-acetyl-aspartyl-aminononanoic acid
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
690
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
molecule keywords Glutamate carboxypeptidase 2
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjeA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjeA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjeA02
4P10A 4TJVA 4NFRA 2F7VA 4K3NA 2ZEEA 4ZX8A 3IFEA 1OBRA 2QVPA 3SJFA 1GYTA 4C9RA 2PJAA 3VARA 1LANA 2BCOA 1Y0YA 4C8UA 4G1PA 1UWYA 3MRUA 2WZNA 3IWWA 3HLPA 3DGVA 1EE3P 2NSMA 2JBJA 1BAVA 3K2KA 2PRQA 4P44A 2Q4ZA 2XEFA 4FWUA 4KSIA 1TKJA 5LYDA 4OKOA 1YLOA 1XMBA 2ZENA 2FVGA 4ZY0A 3FEEA 2Q51A 3SJGA 1AMPA 3NH4A 2ZEFA 3BI1A 4W9YA 4P4BA 3T8WA 1ELMP 5K8PA 4ZX9A 3NFZA 3D7DA 2ANPA 4UEZA 4UEEA 2RFHA 3KHZA 4JYWA 4C9EA 2AFMA 4LQGA 2PJBA 3DLJA 2BO9A 4MRIA 1DTDA 3FX6A 3S9MA 1AYEA 4PXEA 4NGRA 1LFWA 3CPXA 5CPAA 1TKFA 2V8VA 1ZG9A 2PJ8A 2ZEGA 3D7GA 3D7FA 5D29A 1XJOA 3D67A 4PXCA 5JH9A 3GB0A 4DYOA 1Y0RA 2PCUA 1CP7A 4MCPA 2C6PA 3SI2A 2CTBA 3ISXA 5IB9A 8CPAA 1VGYA 4MXUA 2ZEOA 1ARMA 3GUXA 5LRGA 3FF3A 1F57A 1LCPA 4MHZA 3JRUA 4JZ0A 3PRTA 3SI0A 4CDKA 4WJBA 3I1UA 3IIBA 1Z2LA 4P4DA 3B3TA 4F9VA 5J1QA 3GLJA 3ISZA 2O4HA 3WC5A 4IAVA 5LYIA 4PXDA 1Y9ZA 3SJXA 4C9AA 4TJXA 5I4MA 5LYFA 2AFXA 1RTQA 3MN8A 3B3VA 2QJ8A 4NJRA 3NA6A 2GU2A 4P4FA 3B2YA 1ZG7A 2AFWA 4C8PA 2JBKA 2POKA 3B3CA 3IC1A 4PPZA 4OC4A 4OC1A 1ZLHA 3KZWA 2PJ1A 4ONWA 4R7MA 4UIBA 4PQAA 1FNOA 4NGQA 4TNUA 2ZEPA 1H8LA 2ZEMA 1Y7EA 1F2PA 5LRKA 1WVMA 1BPMA 4C85A 3WT4A 3FMCA 2QYVA 4MHYA 3I74A 3S9NA 1VHOA 3PEIA 2ZELA 1LAPA 1R43A 3H8EA 3PBBA 4DJLA 3I6SA 2PVWA 4KNGE 3VTAA 4Q7AA 4FBEA 3PB6X 2PJ4A 1F2OA 1TKHA 3D7HA 3IJ3A 1M4LA 3KQXA 4YN3A 1HDUA 3PB7X 3WABA 4NGTA 4NGPA 2RB7A 2C1CA 2PJ0A 4FAIA 3PFEA 4GM5A 3B3WA 1LOKA 1KWMA 2Q43A 4IHMA 1LAMA 3H8GA 3ICUA 3PB8X 4OIWA 1XRYA 1FT7A 4C99A 4EFDA 4P4EA 4EWTA 6CPAA 2PE3A 4B6ZA 4MCSA 3PFOA 1CBXA 3D68A 4YU9A 3KR4A 2EWBA 1TF9A 2PJ3A 4UEFA 3SI1A 1TF8A 4PXBA 5LRJA 4OC3A 3SJEA 2WYRA 4P6YA 1ARLA 4MCQA 4ZY2A 4A94A 3KGQA 2PJ5A 5F09A 2PIYA 1IY7A 1NSAA 1Z5RA 5JM6A 1JQGA 3VATA 1QMUA 4MHPA 3B35A 2XEGA 1IGBA 1XF1A 3WC7A 2GLFA 2V8HA 1CPSA 3RAMA 2ABZA 2ZEHA 3V7ZA 3FVLA 5HVFA 3NH8A 3VH9A 3QNVA 2HB6A 2V8DA 3B3SA 1PYTB 1TXRA 1ZG8A 2PJ7A 4A37A 4ZI6A 3NH5A 4TWEA 5K8OA 5K8MA 3WC6A 4A39A 4IK2A 4BD9A 3HUVA 4NGSA 1BLLE 3B7IA 4DUKA 4Z65A 4FUUA 2NYQA 2V77A 4C8TA 4A38A 1VHEA 2AFUA 3N5FA 2DEAA 2JEWA 3KASA 4R76A 4F9UA 1XFOA 4F8ZA 4CPAA 3V38A 5LYLA 4C8FA 3CT9A 5HVGA 1YSJA 4C84A 3KQZA 4C8CA 4OP4A 4OC5A 2IMOA 3KI9A 2ZOGA 4MMOA 3BXMA 4OC2A 1XBUA 4UF4A 1VIXA 2PVVA 3KL9A 4WWVA 1R3NA 2GLJA 2IJZA 4ZYQA 2G9DA 2HC9A 3H8FA 2I3CA 5CBMA 3RZAA 2CF4A 2C6CA 3KR5A 1YMEA 4NJQA 2IQ6A 4X8IA 3D4UA 2VL1A 3K9TA 5HXDA 2CTCA 4RUHA 4MHNA 1HEEA 4X3RA 2PJ9A 3IO1A 5DS0A 3CDXA 3BI0A 2F8HA 4EMEA 2J9AA 2PJ6A 2PJCA 3TX8A 3KHXA 2C6GA 3LMSA 4YWYA 7CPAA 3FH4A 4MCRA 3FEDA 1CPXA 4X2TA 4H2KA 4O23A 1ELLP 1Z8LA 4NGNA 3EIFA 2ZEDA 4R8FA 5ELYA 1DE4C 1PCAA 4OIDA 1HDQA 2V8GA 3PB9X 2EK8A 2AFOA 4CDJA 2XEIA 1CX8A 2PJ2A 4UIAA 3PBEA 5D8NA 2ZOFA 1V6CA 4OC0A 1Q7LA 4C9VA 3RBUA 4P45A 1CP6A 2PIZA 4OMEA 4C8AA 4P4JA 5HVHA 2OR4A 5K8NA 4ZY1A 3D66A 2O53A 2CIJA 5JGFA 4P4IA 2EK9A 2AFSA 4R6TA 4NGMA 1YW4A 3S9LA 2OOTA 3IEHA 3TC8A 2GREA 3CPAA 3L2NA 3BHXA 4C9UA 1BPNA 2BOAA 4AXVA 3LWUA 1ZLIA 5THWA 1CG2A 1YW6A 3FECA 4C86A 2AFZA 2XEJA 3FJUA 3PB4X 1QQ9A
chains in the Genus database with same CATH superfamily
4P10A 5IX3A 4TJVA 4A4CA 2Y1MA 4NFRA 1YGHA 1Z8XA 2F7VA 3DDDA 4K3NA 4F0YA 2ZEEA 4ZX8A 2FS5A 2MP0A 3VRNA 3IFEA 4OLLA 1OBRA 2PR8A 3C8OA 4QVTA 3TLGA 3VRQA 2QVPA 4OADA 3SJFA 4UBRA 1GYTA 4C9RA 3O8ZA 2PCNA 2OB0A 2PJAA 1LANA 3VARA 1MJ9A 2BCOA 1Y0YA 4C8UA 3NOJA 4G1PA 3VROA 1UWYA 3DSBA 3KRVA 3MRUA 5HKZA 2WZNA 3SR3A 3IWWA 4MFPA 4JD6A 3T07A 2OZUA 3HLPA 1UFHA 4IUSA 3EZEA 1B87A 2CY2A 3TYXA 3DGVA 1EE3P 2VQYA 2NSMA 1NXJA 4QUSA 2JBJA 1YREA 1BAVA 3K2KA 4JXRA 1XEBA 4MFJA 3BUNB 4P44A 2PRQA 2Q4ZA 4KLVA 2R7HA 4QBJA 1KC7A 7CPAA 2XEFA 4FWUA 4KSIA 1TKJA 4R87A 4B5PB 5LYDA 3I3GA 4OKOA 5BWAB 2FIWA 2JEVA 1YLOA 1XMBA 2ZENA 4ORFA 2XPNA 4KS9A 5F1YA 4XNHB 5E96A 1R57A 2FVGA 4ZY0A 4KOYA 3FEEA 1CJWA 1S60A 2Q51A 2Q7BA 3SJGA 1AMPA 2ZW4A 1VI4A 2WUUA 4ZBGA 3NH4A 5AG7A 4A31A 2ZEFA 3BI1A 4W9YA 4P4BA 4K30A 4MY3A 3T8WA 1ELMP 5K8PA 3G23A 4ZX9A 3NFZA 3D7DA 2ANPA 3HPGG 1S7LA 3HPHE 1Z9UA 4UEZA 4UEEA 2RFHA 2UV8G 2DF5A 4F6AA 3KHZA 4BPXB 4JYWA 2B4BA 2REEA 4C9EA 3PT1A 4MJXA 2AFMA 4LQGA 1KBLA 2PJBA 3DLJA 2BO9A 3N7ZA 4MRIA 1A9XB 1DTDA 3FX6A 1P0HA 3S9MA 2KCWA 1AYEA 2IL4A 4PXEA 4NGRA 1LFWA 4MI1A 5JQ4A 3D3SA 2Q04A 2EUIA 3CPXA 5CPAA 1TKFA 3V8IA 3GKRA 2A4NA 1ZG9A 2D4OA 2OZGA 2V8VA 3BJ8A 3IU2A 3JUWA 3R96A 2AJ6A 3TLYA 3CZXA 1Z8WA 2J8RA 4FD7A 2PJ8A 5C88A 2DLAA 2ZEGA 3D7GA 3D7FA 5D29A 1XJOA 3D67A 4KVOE 4PXCA 5I0CA 5JH9A 1ZL0A 3PLFB 1IYKA 2F5IA 3D2MA 1Y9KA 3TLGB 5EMIA 1Z4RA 2AUMA 3RNZA 3GB0A 2JLMA 4DYOA 4YFJA 4MHDA 2Y1NA 1Y0RA 4MFQA 2PCUA 4A33A 1CP7A 4MCPA 2C6PA 1NMTA 4B14A 4CYPA 1BXRB 2D4PA 3SI2A 4BTFA 1Y7RA 1J4JA 2CTBA 3ISXA 1I21A 5IB9A 1Q5XA 3CXQA 1PUAA 2BL1A 4M3SA 4E0AA 2C27A 2P0WA 3LODA 4QB9A 8CPAA 1VGYA 2OLSA 2Q44A 2ZXVA 3QAHA 4MXUA 4CAEA 2ZEOA 1ARMA 4MFZA 2H5MA 4CYNA 1A2ZA 3GUXA 2ZW5A 1RXTA 4GS4A 4E8OA 3BLNA 3ZNIA 5LRGA 4JLYA 3FF3A 2BEIA 1F57A 1LCPA 2B5GA 1X12A 4MHZA 1T36B 5DWNA 2YNCA 3JRUA 4JZ0A 2HUZA 1KUYA 1L0CA 2Z10A 3PRTA 3FRMA 5H84A 1J3LA 3SI0A 4CDKA 3T0TA 4WJBA 3I1UA 3S6GA 1YVOA 2HROA 3IIBA 1XOVA 4HNXB 2CNTA 1Z2LA 4KUBA 4P4DA 3B3TA 4F9VA 2D0OA 4PSWA 5J8CA 4CYOA 4M6HA 1KEEB 2B4DA 3DR6A 5J1QA 3S6FA 2Q7SA 3GLJA 4E2AA 3TLZA 3ISZA 4F0XA 2O4HA 3S6KA 3WC5A 2CBLA 1Z9EA 1FY7A 4IAVA 3VWEA 1K4JA 5AG5A 1KUXA 5LYIA 2FM4A 4E94A 1M4GA 2K5TA 2Y0MA 4PXDA 1Y9ZA 1XMTA 3SJXA 5G21A 2BSWA 4C9AA 2BUEA 4B11A 4C2YA 2REFA 1KZFA 3P2FA 4CGPA 3EZAA 1IOFA 2FCKA 5JVLA 4TJXA 5I4MA 5LYFA 2AFXA 3QB8A 1RTQA 3DR8A 3MN8A 4C2XA 3U1BA 4KUAA 4BINA 3NE8A 4MI4A 3PP9A 3K4IA 3B3VA 2QJ8A 4IIXA 3FB3A 4NJRA 3TT2A 4LX9A 3NA6A 4C68A 1Z8TA 4KOVA 1ZRSA 2GU2A 4P4FA 1Z4EA 3B2YA 4FD4A 1ZG7A 5F5XA 2AFWA 1Q2YA 4C8PA 1YVHA 5AG6A 1S3ZA 3FYNA 2JBKA 1Q2CA 2POKA 3B3CA 1YR0A 4PV6A 5KTAA 3IC1A 4HNWB 4OAEA 4PPZA 5F48A 5A28A 1VKCA 3S6HA 4OC4A 4OC1A 4NXYA 3PFVA 1ZLHA 2I00A 4UA3A 2DIKA 2EO8A 3KZWA 2PJ1A 4ONWA 2E28A 4FD5A 4R7MA 4UIBA 2GANA 3FIXA 1FNOA 4PQAA 3T9YA 2Z3LA 4CAFA 3TLBA 3SHPA 4NGQA 3A9LA 4TNUA 1RO5A 1X10A 2PQ8A 2ZEPA 2R82A 5DWMA 1H8LA 2ZEMA 1Y9WA 2RC4A 1Y7EA 2B5GB 4KLWA 3VRRA 1F2PA 4UCMA 5G22A 5LRKA 1WVMA 1BPMA 4KZTA 4C85A 3WT4A 3FMCA 2ODFA 2PC1A 2QYVA 4MHYA 3S9NA 3W6SA 1VHOA 2VKZG 3PEIA 1GGOA 2ZELA 3I74A 1LAPA 3IWGA 2P6EA 4BPWB 1U6MA 3R9EA 1R43A 1IIDA 3H8EA 4H6UA 3TTHA 3OB1B 4J3GA 3PBBA 4Y49B 4DJLA 3UY5A 3I6SA 2G3TA 3TO7A 2PVWA 1NE9A 2B4DB 4CRYB 2C5QA 4KNGE 3VTAA 2FL4A 4Q7AA 1WWZA 3PB6X 4FBEA 4UFWA 2PJ4A 1F2OA 5BY0A 3D7HA 1TKHA 3IJ3A 4U9ZA 4A32A 1QSTA 2GFQA 1M4LA 3C26A 2OU2A 3KQXA 3VRPA 4C7IA 4KOXA 1QSNA 2YNEA 4YN3A 4EVYA 2Z3KA 3TLEA 1HDUA 3PB7X 3WABA 2PR1A 4XPDB 4NGTA 2B58A 4R3KA 3P2HA 2D0PA 2ATRA 4NGPA 2RB7A 2C1CA 3EFAA 2Q0YA 1MK4A 3EZBA 2PJ0A 3TLAA 4FAIA 3F0AA 2CNMA 2PDOA 3OAKA 3I9SA 3PFEA 4GM5A 3B3WA 3TOAA 1LOKA 1KWMA 1QSOA 2Q43A 3R9FA 3NE7A 3GYAA 3G8WA 4CGMA 4JWPA 4IHMA 3VWDA 3D2PA 3IGRA 1LAMA 3H8GA 5EC4A 3W91A 3PB8X 3ICUA 1IYLA 4OIWA 1XRYA 1FT7A 3BUMB 1S7FA 2AUNA 4C99A 4EFDA 4P4EA 4NCZA 4MBUA 2YNCC 1ZO0A 3MGDA 4EWTA 4CGNA 6CPAA 3TLCA 2HV2A 2PE3A 4B6ZA 4MCSA 3FXTA 1CBXA 3D68A 3PFOA 4YU9A 5JYBA 1CM0A 3H4QA 3KR4A 2EWBA 1JDBC 4Y49C 1TF9A 2PJ3A 2HQYA 1B6BA 1M1DA 1TF8A 2R98A 4UEFA 3SI1A 2B4JC 2WPXA 4PXBA 1CS0B 3R9GA 4MJ8A 5LRJA 1P4NA 3HMJG 4OC3A 3SJEA 1M4IA 2WYRA 3F9KC 1M4DA 2EZCA 4E5SA 4KOWA 2ZW6A 1ARLA 4P6YA 1I1DA 2QIRA 4MCQA 4ZY2A 4A94A 2GE3A 3KGQA 2PJ5A 5F09A 2PIYA 5HH1A 1IY7A 1QSRA 1NSAA 3GIUA 4A30A 1Z5RA 5JM6A 1C3OB 1JQGA 1R61A 4KOSA 4XPDC 3VATA 3EC4A 4B12A 2X0SA 3T90A 1YQEA 4XPLA 4NSQA 1XE4A 1QMUA 1OZPA 4C2ZA 4C7HA 4MHPA 3TO9A 4AVCA 2Z3NA 1YLEA 2XEGA 1IGBA 2P6GA 3B35A 1XF1A 3WC7A 2GLFA 2V8HA 2YJTA 4H1HA 4UFXA 1CPSA 3R95A 1B47A 3TOBA 4BMHA 3RAMA 4J0NA 2ABZA 4B5PA 3T5MA 2ZEHA 3V7ZA 5HMNA 3FVLA 4IF5A 5HVFA 4B5OA 3NH8A 5EBVA 3VH9A 4INJA 3QNVA 4AG7A 4M6GA 3W6XA 4A2ZA 4CAWA 4PK2A 2HB6A 2V8DA 3B3SA 1PYTB 3EO4A 1TXRA 5G1ZA 1ZG8A 2PJ7A 3BJ7A 4A37A 3NH5A 4TWEA 4ZI6A 5K8OA 1EZAA 5K8MA 4KORA 3WC6A 2JDDA 4A39A 1M44A 4IK2A 4BD9A 3HUVA 5AG4A 4NGSA 3OB2B 1BLLE 2VZYA 4LUAA 3TE4A 2B0AA 2FSRA 3B7IA 2VEZA 4R57A 4NF1A 2GIVA 4DUKA 4Z65A 4AG9A 2GP4A 1QSMA 4FUUA 1NBWA 3FBUA 2NYQA 1CE8B 2V77A 2B3UA 2YNDA 4CS0B 4C8TA 4UWJA 1VHEA 4A38A 4AVAA 2AFUA 5K99A 1XF8A 3N5FA 2DEAA 2JEWA 3KASA 4R76A 3WR7A 5C82A 3NFQA 2R1IA 5F47A 2OH1A 2QECA 3GJZA 2G0BA 4F9UA 1XFOA 4UWIA 3T05A 4BPUB 1MJBA 1GHEA 4F8ZA 2FIAA 4HKFA 1IU8A 4HNYB 4CPAA 3V38A 4I49A 2DXQA 4KOTA 2O28A 2ZW7A 5LYLA 4C9UA 4C8FA 2P6FA 3CT9A 5HVGA 1YSJA 1YX0A 4BBHA 5J8FA 3KQZA 4C84A 5F9MA 4C8CA 4OP4A 5KTDA 4OC5A 3E0KA 2IMOA 3PGPA 2Z3PA 1PU9A 2ZOGA 3KI9A 4MMOA 4MY0A 1M6VB 4CZ1A 2FXFA 2EVNA 4H6ZA 3BXMA 4OC2A 2EZAA 4JVOA 4UCPA 1XBUA 4UF4A 1VIXA 3ZJ0A 2B3VA 4B10A 2PVVA 2VXKA 3F5BA 3KL9A 4MFKA 5J3XA 2XPPA 3TO6A 3EY5A 5F46A 2PRBA 4RI1A 2R8VA 4KOUA 4WWVA 1R3NA 2GLJA 2IJZA 1ZYMA 4H89A 1IB1E 3EXNA 2VBQA 1NSLA 4ZYQA 2I79A 3U88C 2G9DA 2HC9A 4KVXA 3H8FA 2I3CA 2XPLA 2HWGA 2CXAA 2EZBA 5CBMA 3CXSA 4EYSA 3RZAA 2CF4A 2C6CA 3KR5A 1VBHA 3H5ZA 5CNPA 4ONUA 2OZHA 1YMEA 4NJQA 4CAVA 5IR2A 2IQ6A 1FBVA 4X8IA 3D4UA 2VL1A 4CO9A 1N71A 1WJTA 1YK3A 3K9TA 4RS2A 2G3AA 2J8MA 1IOIA 4KVME 1S5KA 5JPHA 4M85A 4CAXA 5HXDA 2CTCA 4JJXA 4RR2B 3SXNA 4RUHA 4A4BA 4LQ6A 4MHNA 3SXOA 5KTCA 4M8DA 1EZBA 5ISVA 2Q4VA 1HEEA 4X3RA 2PJ9A 2Z3MA 3IO1A 4PSXA 5DS0A 2HI6A 2Z3OA 2NMTA 3CDXA 4L89A 3BI0A 4XPKA 2AE6A 4CDJA 4HPSA 3K9UA 4YRHA 4NEXA 2F8HA 4EMEA 2J9AA 4KSAA 5HKWA 2PJ6A 3QAYA 2PJCA 3FNCA 3KHXA 2C6GA 3LMSA 4YWYA 2X7BA 3R1KA 3TX8A 4CYQA 5A27A 3FH4A 4MCRA 4CRZB 3FEDA 4JXQA 3TFYA 1AUGA 1V6CA 4M6IA 4CGLA 4RN7A 4COBA 2FE7A 3PZJA 1CPXA 1S7KA 4GXHA 4X2TA 1DIKA 5HKYA 4IIYA 3B8GA 2VZZA 2YGWA 4H2KA 4O23A 1VBGA 1ELLP 2J8NA 1JDEA 1Z8LA 4NGNA 3EIFA 3JVNA 2DPSA 4AVBA 2ZEDA 3IU1A 4R8FA 3BUXB 5FD8A 5ELYA 1DE4C 1PCAA 4OIDA 1HDQA 2V8GA 3PB9X 2YJVA 2EK8A 2AFOA 2CNSA 4X5KA 2XEIA 1KUVA 4XNHC 4L8AA 5AGEA 1CX8A 3OP0A 2PJ2A 4UIAA 3PBEA 1ON0A 1YVKA 2ZOFA 4OC0A 1Q7LA 2ZPAA 4R9MA 5D8NA 3RO0A 3IWEA 3RYOA 3RBUA 1C30B 4P45A 3VGOA 4C9VA 1CP6A 5FVJA 2PIZA 4OMEA 2Q4YA 4YGOA 4C8AA 4P4JA 5HVHA 1XIXA 3G3SA 4UCNA 1BO4A 1JWQA 1SQHA 2OR4A 4CGOA 4MFLA 3LACA 5K8NA 4FD6A 4U5YA 4ZY1A 3D8PA 3CXPA 3GY9A 1IICA 3D66A 5H86A 3BUOB 1I12A 2O53A 2CIJA 5JGFA 4P4IA 2EK9A 1LRZA 2AFSA 4R6TA 5GCNA 4NGMA 2N3AB 1YW4A 4QC6A 1EO0A 3S9LA 2OOTA 3IEHA 3TC8A 1MJAA 2GREA 3CPAA 3L2NA 3BHXA 1Q2DA 1V0CA 4Q38A 5AXIA 4B13A 4ZGYB 1BOBA 2PSWA 1BPNA 2ARHA 3DNSA 3LD2A 2BOAA 3BUWB 2FT0A 2WSAA 4R3LA 4AXVA 3TCVA 2DPTA 3LWUA 2JDCA 5F49A 4COGA 3JTKA 1ZLIA 1WK4A 2XPOA 4UFVA 5F13A 5G20A 5THWA 3ZZIA 5IB0A 1CG2A 5IV0A 3OWCA 3F8KA 4II9A 1S7NA 1VHSA 2VI7A 4U9YA 1YW6A 3FECA 4PK3A 4A95A 4AB7A 4DNCA 2QMLA 2AFZA 2EBJA 4C86A 4KSFA 2XEJA 2Z11A 3FJUA 2WPWA 1TIQA 2Z0ZA 4GPLB 3KKWA 3PB4X 4Q36A 1QQ9A
chains in the Genus database with same CATH topology
4P10A 4TJVA 4NFRA 2F7VA 4K3NA 2ZEEA 4ZX8A 3IFEA 1OBRA 2QVPA 3SJFA 1GYTA 4C9RA 2PJAA 3VARA 1LANA 2BCOA 1Y0YA 4C8UA 4G1PA 1UWYA 3MRUA 2WZNA 3IWWA 3HLPA 3DGVA 1EE3P 2NSMA 2JBJA 1BAVA 3K2KA 2PRQA 4P44A 2Q4ZA 2XEFA 4FWUA 4KSIA 1TKJA 5LYDA 4OKOA 1YLOA 1XMBA 2ZENA 2FVGA 4ZY0A 3FEEA 2Q51A 3SJGA 1AMPA 3NH4A 2ZEFA 3BI1A 4W9YA 4P4BA 3T8WA 1ELMP 5K8PA 4ZX9A 3NFZA 3D7DA 2ANPA 4UEZA 4UEEA 2RFHA 3KHZA 4JYWA 4C9EA 2AFMA 4LQGA 2PJBA 3DLJA 2BO9A 4MRIA 1DTDA 3FX6A 3S9MA 1AYEA 4PXEA 4NGRA 1LFWA 3CPXA 5CPAA 1TKFA 2V8VA 1ZG9A 2PJ8A 2ZEGA 3D7GA 3D7FA 5D29A 1XJOA 3D67A 4PXCA 5JH9A 3GB0A 4DYOA 1Y0RA 2PCUA 1CP7A 4MCPA 2C6PA 3SI2A 2CTBA 3ISXA 5IB9A 8CPAA 1VGYA 4MXUA 2ZEOA 1ARMA 3GUXA 5LRGA 3FF3A 1F57A 1LCPA 4MHZA 3JRUA 4JZ0A 3PRTA 3SI0A 4CDKA 4WJBA 3I1UA 3IIBA 1Z2LA 4P4DA 3B3TA 4F9VA 5J1QA 3GLJA 3ISZA 2O4HA 3WC5A 4IAVA 5LYIA 4PXDA 1Y9ZA 3SJXA 4C9AA 4TJXA 5I4MA 5LYFA 2AFXA 1RTQA 3MN8A 3B3VA 2QJ8A 4NJRA 3NA6A 2GU2A 4P4FA 3B2YA 1ZG7A 2AFWA 4C8PA 2JBKA 2POKA 3B3CA 3IC1A 4PPZA 4OC4A 4OC1A 1ZLHA 3KZWA 2PJ1A 4ONWA 4R7MA 4UIBA 4PQAA 1FNOA 4NGQA 4TNUA 2ZEPA 1H8LA 2ZEMA 1Y7EA 1F2PA 5LRKA 1WVMA 1BPMA 4C85A 3WT4A 3FMCA 2QYVA 4MHYA 3I74A 3S9NA 1VHOA 3PEIA 2ZELA 1LAPA 1R43A 3H8EA 3PBBA 4DJLA 3I6SA 2PVWA 2C5QA 4KNGE 3VTAA 4Q7AA 4FBEA 3PB6X 2PJ4A 1F2OA 1TKHA 3D7HA 3IJ3A 1M4LA 3KQXA 4YN3A 1HDUA 3PB7X 3WABA 4NGTA 4NGPA 2RB7A 2C1CA 2PJ0A 4FAIA 3PFEA 4GM5A 3B3WA 1LOKA 1KWMA 2Q43A 4IHMA 1LAMA 3H8GA 3ICUA 3PB8X 4OIWA 1XRYA 1FT7A 4C99A 4EFDA 4P4EA 4EWTA 6CPAA 2PE3A 4B6ZA 4MCSA 3PFOA 1CBXA 3D68A 4YU9A 3KR4A 2EWBA 1TF9A 2PJ3A 4UEFA 3SI1A 1TF8A 4PXBA 5LRJA 4OC3A 3SJEA 2WYRA 4P6YA 1ARLA 4MCQA 4ZY2A 4A94A 3KGQA 2PJ5A 5F09A 2PIYA 1IY7A 1NSAA 1Z5RA 5JM6A 1JQGA 3VATA 1QMUA 4MHPA 3B35A 2XEGA 1IGBA 1XF1A 3WC7A 2GLFA 2V8HA 1CPSA 3RAMA 2ABZA 2ZEHA 3V7ZA 3FVLA 5HVFA 3NH8A 3VH9A 3QNVA 2HB6A 2V8DA 3B3SA 1PYTB 1TXRA 1ZG8A 2PJ7A 4A37A 4ZI6A 3NH5A 4TWEA 5K8OA 5K8MA 3WC6A 4A39A 4IK2A 4BD9A 3HUVA 4NGSA 1BLLE 3B7IA 4DUKA 4Z65A 2GP4A 4FUUA 2NYQA 2V77A 4C8TA 4A38A 1VHEA 2AFUA 3N5FA 2DEAA 2JEWA 3KASA 4R76A 4F9UA 1XFOA 4F8ZA 4CPAA 3V38A 5LYLA 4C8FA 3CT9A 5HVGA 1YSJA 4C84A 3KQZA 4C8CA 4OP4A 4OC5A 2IMOA 3KI9A 2ZOGA 4MMOA 3BXMA 4OC2A 1XBUA 4UF4A 1VIXA 2PVVA 3KL9A 4WWVA 1R3NA 2GLJA 2IJZA 4ZYQA 2G9DA 2HC9A 3H8FA 2I3CA 5CBMA 3RZAA 2CF4A 2C6CA 3KR5A 1YMEA 4NJQA 5IR2A 2IQ6A 4X8IA 3D4UA 2VL1A 3K9TA 5HXDA 2CTCA 4RUHA 4MHNA 1HEEA 4X3RA 2PJ9A 3IO1A 5DS0A 3CDXA 3BI0A 2F8HA 4EMEA 2J9AA 2PJ6A 2PJCA 3TX8A 3KHXA 2C6GA 3LMSA 4YWYA 7CPAA 3FH4A 4MCRA 3FEDA 1CPXA 4X2TA 4H2KA 4O23A 1ELLP 1Z8LA 4NGNA 3EIFA 2ZEDA 4R8FA 5ELYA 1DE4C 1PCAA 4OIDA 1HDQA 2V8GA 3PB9X 2EK8A 2AFOA 4CDJA 2XEIA 1CX8A 2PJ2A 4UIAA 3PBEA 5D8NA 2ZOFA 1V6CA 4OC0A 1Q7LA 4C9VA 3RBUA 4P45A 1CP6A 2PIZA 4OMEA 4C8AA 4P4JA 5HVHA 2OR4A 5K8NA 4ZY1A 3D66A 2O53A 2CIJA 5JGFA 4P4IA 2EK9A 2AFSA 4R6TA 4NGMA 1YW4A 3S9LA 2OOTA 3IEHA 3TC8A 2GREA 3CPAA 3L2NA 3BHXA 4C9UA 1BPNA 2BOAA 4AXVA 3LWUA 1ZLIA 5THWA 1CG2A 1YW6A 3FECA 4C86A 2AFZA 2XEJA 3FJUA 3PB4X 1QQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P10 A;  4TJV A;  4NFR A;  2F7V A;  4K3N A;  2ZEE A;  4ZX8 A;  3IFE A;  1OBR A;  2QVP A;  3SJF A;  1GYT A;  4C9R A;  2PJA A;  3VAR A;  1LAN A;  2BCO A;  1Y0Y A;  4C8U A;  4G1P A;  1UWY A;  3MRU A;  2WZN A;  3IWW A;  3HLP A;  3DGV A;  1EE3 P;  2NSM A;  2JBJ A;  1BAV A;  3K2K A;  2PRQ A;  4P44 A;  2Q4Z A;  2XEF A;  4FWU A;  4KSI A;  1TKJ A;  5LYD A;  4OKO A;  1YLO A;  1XMB A;  2ZEN A;  2FVG A;  4ZY0 A;  3FEE A;  2Q51 A;  3SJG A;  1AMP A;  3NH4 A;  2ZEF A;  3BI1 A;  4W9Y A;  4P4B A;  3T8W A;  1ELM P;  5K8P A;  4ZX9 A;  3NFZ A;  3D7D A;  2ANP A;  4UEZ A;  4UEE A;  2RFH A;  3KHZ A;  4JYW A;  4C9E A;  2AFM A;  4LQG A;  2PJB A;  3DLJ A;  2BO9 A;  4MRI A;  1DTD A;  3FX6 A;  3S9M A;  1AYE A;  4PXE A;  4NGR A;  1LFW A;  3CPX A;  5CPA A;  1TKF A;  2V8V A;  1ZG9 A;  2PJ8 A;  2ZEG A;  3D7G A;  3D7F A;  5D29 A;  1XJO A;  3D67 A;  4PXC A;  5JH9 A;  3GB0 A;  4DYO A;  1Y0R A;  2PCU A;  1CP7 A;  4MCP A;  2C6P A;  3SI2 A;  2CTB A;  3ISX A;  5IB9 A;  8CPA A;  1VGY A;  4MXU A;  2ZEO A;  1ARM A;  3GUX A;  5LRG A;  3FF3 A;  1F57 A;  1LCP A;  4MHZ A;  3JRU A;  4JZ0 A;  3PRT A;  3SI0 A;  4CDK A;  4WJB A;  3I1U A;  3IIB A;  1Z2L A;  4P4D A;  3B3T A;  4F9V A;  5J1Q A;  3GLJ A;  3ISZ A;  2O4H A;  3WC5 A;  4IAV A;  5LYI A;  4PXD A;  1Y9Z A;  3SJX A;  4C9A A;  4TJX A;  5I4M A;  5LYF A;  2AFX A;  1RTQ A;  3MN8 A;  3B3V A;  2QJ8 A;  4NJR A;  3NA6 A;  2GU2 A;  4P4F A;  3B2Y A;  1ZG7 A;  2AFW A;  4C8P A;  2JBK A;  2POK A;  3B3C A;  3IC1 A;  4PPZ A;  4OC4 A;  4OC1 A;  1ZLH A;  3KZW A;  2PJ1 A;  4ONW A;  4R7M A;  4UIB A;  4PQA A;  1FNO A;  4NGQ A;  4TNU A;  2ZEP A;  1H8L A;  2ZEM A;  1Y7E A;  1F2P A;  5LRK A;  1WVM A;  1BPM A;  4C85 A;  3WT4 A;  3FMC A;  2QYV A;  4MHY A;  3I74 A;  3S9N A;  1VHO A;  3PEI A;  2ZEL A;  1LAP A;  1R43 A;  3H8E A;  3PBB A;  4DJL A;  3I6S A;  2PVW A;  4KNG E;  3VTA A;  4Q7A A;  4FBE A;  3PB6 X;  2PJ4 A;  1F2O A;  1TKH A;  3D7H A;  3IJ3 A;  1M4L A;  3KQX A;  4YN3 A;  1HDU A;  3PB7 X;  3WAB A;  4NGT A;  4NGP A;  2RB7 A;  2C1C A;  2PJ0 A;  4FAI A;  3PFE A;  4GM5 A;  3B3W A;  1LOK A;  1KWM A;  2Q43 A;  4IHM A;  1LAM A;  3H8G A;  3ICU A;  3PB8 X;  4OIW A;  1XRY A;  1FT7 A;  4C99 A;  4EFD A;  4P4E A;  4EWT A;  6CPA A;  2PE3 A;  4B6Z A;  4MCS A;  3PFO A;  1CBX A;  3D68 A;  4YU9 A;  3KR4 A;  2EWB A;  1TF9 A;  2PJ3 A;  4UEF A;  3SI1 A;  1TF8 A;  4PXB A;  5LRJ A;  4OC3 A;  3SJE A;  2WYR A;  4P6Y A;  1ARL A;  4MCQ A;  4ZY2 A;  4A94 A;  3KGQ A;  2PJ5 A;  5F09 A;  2PIY A;  1IY7 A;  1NSA A;  1Z5R A;  5JM6 A;  1JQG A;  3VAT A;  1QMU A;  4MHP A;  3B35 A;  2XEG A;  1IGB A;  1XF1 A;  3WC7 A;  2GLF A;  2V8H A;  1CPS A;  3RAM A;  2ABZ A;  2ZEH A;  3V7Z A;  3FVL A;  5HVF A;  3NH8 A;  3VH9 A;  3QNV A;  2HB6 A;  2V8D A;  3B3S A;  1PYT B;  1TXR A;  1ZG8 A;  2PJ7 A;  4A37 A;  4ZI6 A;  3NH5 A;  4TWE A;  5K8O A;  5K8M A;  3WC6 A;  4A39 A;  4IK2 A;  4BD9 A;  3HUV A;  4NGS A;  1BLL E;  3B7I A;  4DUK A;  4Z65 A;  4FUU A;  2NYQ A;  2V77 A;  4C8T A;  4A38 A;  1VHE A;  2AFU A;  3N5F A;  2DEA A;  2JEW A;  3KAS A;  4R76 A;  4F9U A;  1XFO A;  4F8Z A;  4CPA A;  3V38 A;  5LYL A;  4C8F A;  3CT9 A;  5HVG A;  1YSJ A;  4C84 A;  3KQZ A;  4C8C A;  4OP4 A;  4OC5 A;  2IMO A;  3KI9 A;  2ZOG A;  4MMO A;  3BXM A;  4OC2 A;  1XBU A;  4UF4 A;  1VIX A;  2PVV A;  3KL9 A;  4WWV A;  1R3N A;  2GLJ A;  2IJZ A;  4ZYQ A;  2G9D A;  2HC9 A;  3H8F A;  2I3C A;  5CBM A;  3RZA A;  2CF4 A;  2C6C A;  3KR5 A;  1YME A;  4NJQ A;  2IQ6 A;  4X8I A;  3D4U A;  2VL1 A;  3K9T A;  5HXD A;  2CTC A;  4RUH A;  4MHN A;  1HEE A;  4X3R A;  2PJ9 A;  3IO1 A;  5DS0 A;  3CDX A;  3BI0 A;  2F8H A;  4EME A;  2J9A A;  2PJ6 A;  2PJC A;  3TX8 A;  3KHX A;  2C6G A;  3LMS A;  4YWY A;  7CPA A;  3FH4 A;  4MCR A;  3FED A;  1CPX A;  4X2T A;  4H2K A;  4O23 A;  1ELL P;  1Z8L A;  4NGN A;  3EIF A;  2ZED A;  4R8F A;  5ELY A;  1DE4 C;  1PCA A;  4OID A;  1HDQ A;  2V8G A;  3PB9 X;  2EK8 A;  2AFO A;  4CDJ A;  2XEI A;  1CX8 A;  2PJ2 A;  4UIA A;  3PBE A;  5D8N A;  2ZOF A;  1V6C A;  4OC0 A;  1Q7L A;  4C9V A;  3RBU A;  4P45 A;  1CP6 A;  2PIZ A;  4OME A;  4C8A A;  4P4J A;  5HVH A;  2OR4 A;  5K8N A;  4ZY1 A;  3D66 A;  2O53 A;  2CIJ A;  5JGF A;  4P4I A;  2EK9 A;  2AFS A;  4R6T A;  4NGM A;  1YW4 A;  3S9L A;  2OOT A;  3IEH A;  3TC8 A;  2GRE A;  3CPA A;  3L2N A;  3BHX A;  4C9U A;  1BPN A;  2BOA A;  4AXV A;  3LWU A;  1ZLI A;  5THW A;  1CG2 A;  1YW6 A;  3FEC A;  4C86 A;  2AFZ A;  2XEJ A;  3FJU A;  3PB4 X;  1QQ9 A; 
#chains in the Genus database with same CATH topology
 4P10 A;  5IX3 A;  4TJV A;  4A4C A;  2Y1M A;  4NFR A;  1YGH A;  1Z8X A;  2F7V A;  3DDD A;  4K3N A;  4F0Y A;  2ZEE A;  4ZX8 A;  2FS5 A;  2MP0 A;  3VRN A;  3IFE A;  4OLL A;  1OBR A;  2PR8 A;  3C8O A;  4QVT A;  3TLG A;  3VRQ A;  2QVP A;  4OAD A;  3SJF A;  4UBR A;  1GYT A;  4C9R A;  3O8Z A;  2PCN A;  2OB0 A;  2PJA A;  1LAN A;  3VAR A;  1MJ9 A;  2BCO A;  1Y0Y A;  4C8U A;  3NOJ A;  4G1P A;  3VRO A;  1UWY A;  3DSB A;  3KRV A;  3MRU A;  5HKZ A;  2WZN A;  3SR3 A;  3IWW A;  4MFP A;  4JD6 A;  3T07 A;  2OZU A;  3HLP A;  1UFH A;  4IUS A;  3EZE A;  1B87 A;  2CY2 A;  3TYX A;  3DGV A;  1EE3 P;  2VQY A;  2NSM A;  1NXJ A;  4QUS A;  2JBJ A;  1YRE A;  1BAV A;  3K2K A;  4JXR A;  1XEB A;  4MFJ A;  3BUN B;  4P44 A;  2PRQ A;  2Q4Z A;  4KLV A;  2R7H A;  4QBJ A;  1KC7 A;  7CPA A;  2XEF A;  4FWU A;  4KSI A;  1TKJ A;  4R87 A;  4B5P B;  5LYD A;  3I3G A;  4OKO A;  5BWA B;  2FIW A;  2JEV A;  1YLO A;  1XMB A;  2ZEN A;  4ORF A;  2XPN A;  4KS9 A;  5F1Y A;  4XNH B;  5E96 A;  1R57 A;  2FVG A;  4ZY0 A;  4KOY A;  3FEE A;  1CJW A;  1S60 A;  2Q51 A;  2Q7B A;  3SJG A;  1AMP A;  2ZW4 A;  1VI4 A;  2WUU A;  4ZBG A;  3NH4 A;  5AG7 A;  4A31 A;  2ZEF A;  3BI1 A;  4W9Y A;  4P4B A;  4K30 A;  4MY3 A;  3T8W A;  1ELM P;  5K8P A;  3G23 A;  4ZX9 A;  3NFZ A;  3D7D A;  2ANP A;  3HPG G;  1S7L A;  3HPH E;  1Z9U A;  4UEZ A;  4UEE A;  2RFH A;  2UV8 G;  2DF5 A;  4F6A A;  3KHZ A;  4BPX B;  4JYW A;  2B4B A;  2REE A;  4C9E A;  3PT1 A;  4MJX A;  2AFM A;  4LQG A;  1KBL A;  2PJB A;  3DLJ A;  2BO9 A;  3N7Z A;  4MRI A;  1A9X B;  1DTD A;  3FX6 A;  1P0H A;  3S9M A;  2KCW A;  1AYE A;  2IL4 A;  4PXE A;  4NGR A;  1LFW A;  4MI1 A;  5JQ4 A;  3D3S A;  2Q04 A;  2EUI A;  3CPX A;  5CPA A;  1TKF A;  3V8I A;  3GKR A;  2A4N A;  1ZG9 A;  2D4O A;  2OZG A;  2V8V A;  3BJ8 A;  3IU2 A;  3JUW A;  3R96 A;  2AJ6 A;  3TLY A;  3CZX A;  1Z8W A;  2J8R A;  4FD7 A;  2PJ8 A;  5C88 A;  2DLA A;  2ZEG A;  3D7G A;  3D7F A;  5D29 A;  1XJO A;  3D67 A;  4KVO E;  4PXC A;  5I0C A;  5JH9 A;  1ZL0 A;  3PLF B;  1IYK A;  2F5I A;  3D2M A;  1Y9K A;  3TLG B;  5EMI A;  1Z4R A;  2AUM A;  3RNZ A;  3GB0 A;  2JLM A;  4DYO A;  4YFJ A;  4MHD A;  2Y1N A;  1Y0R A;  4MFQ A;  2PCU A;  4A33 A;  1CP7 A;  4MCP A;  2C6P A;  1NMT A;  4B14 A;  4CYP A;  1BXR B;  2D4P A;  3SI2 A;  4BTF A;  1Y7R A;  1J4J A;  2CTB A;  3ISX A;  1I21 A;  5IB9 A;  1Q5X A;  3CXQ A;  1PUA A;  2BL1 A;  4M3S A;  4E0A A;  2C27 A;  2P0W A;  3LOD A;  4QB9 A;  8CPA A;  1VGY A;  2OLS A;  2Q44 A;  2ZXV A;  3QAH A;  4MXU A;  4CAE A;  2ZEO A;  1ARM A;  4MFZ A;  2H5M A;  4CYN A;  1A2Z A;  3GUX A;  2ZW5 A;  1RXT A;  4GS4 A;  4E8O A;  3BLN A;  3ZNI A;  5LRG A;  4JLY A;  3FF3 A;  2BEI A;  1F57 A;  1LCP A;  2B5G A;  1X12 A;  4MHZ A;  1T36 B;  5DWN A;  2YNC A;  3JRU A;  4JZ0 A;  2HUZ A;  1KUY A;  1L0C A;  2Z10 A;  3PRT A;  3FRM A;  5H84 A;  1J3L A;  3SI0 A;  4CDK A;  3T0T A;  4WJB A;  3I1U A;  3S6G A;  1YVO A;  2HRO A;  3IIB A;  1XOV A;  4HNX B;  2CNT A;  1Z2L A;  4KUB A;  4P4D A;  3B3T A;  4F9V A;  2D0O A;  4PSW A;  5J8C A;  4CYO A;  4M6H A;  1KEE B;  2B4D A;  3DR6 A;  5J1Q A;  3S6F A;  2Q7S A;  3GLJ A;  4E2A A;  3TLZ A;  3ISZ A;  4F0X A;  2O4H A;  3S6K A;  3WC5 A;  2CBL A;  1Z9E A;  1FY7 A;  4IAV A;  3VWE A;  1K4J A;  5AG5 A;  1KUX A;  5LYI A;  2FM4 A;  4E94 A;  1M4G A;  2K5T A;  2Y0M A;  4PXD A;  1Y9Z A;  1XMT A;  3SJX A;  5G21 A;  2BSW A;  4C9A A;  2BUE A;  4B11 A;  4C2Y A;  2REF A;  1KZF A;  3P2F A;  4CGP A;  3EZA A;  1IOF A;  2FCK A;  5JVL A;  4TJX A;  5I4M A;  5LYF A;  2AFX A;  3QB8 A;  1RTQ A;  3DR8 A;  3MN8 A;  4C2X A;  3U1B A;  4KUA A;  4BIN A;  3NE8 A;  4MI4 A;  3PP9 A;  3K4I A;  3B3V A;  2QJ8 A;  4IIX A;  3FB3 A;  4NJR A;  3TT2 A;  4LX9 A;  3NA6 A;  4C68 A;  1Z8T A;  4KOV A;  1ZRS A;  2GU2 A;  4P4F A;  1Z4E A;  3B2Y A;  4FD4 A;  1ZG7 A;  5F5X A;  2AFW A;  1Q2Y A;  4C8P A;  1YVH A;  5AG6 A;  1S3Z A;  3FYN A;  2JBK A;  1Q2C A;  2POK A;  3B3C A;  1YR0 A;  4PV6 A;  5KTA A;  3IC1 A;  4HNW B;  4OAE A;  4PPZ A;  5F48 A;  5A28 A;  1VKC A;  3S6H A;  4OC4 A;  4OC1 A;  4NXY A;  3PFV A;  1ZLH A;  2I00 A;  4UA3 A;  2DIK A;  2EO8 A;  3KZW A;  2PJ1 A;  4ONW A;  2E28 A;  4FD5 A;  4R7M A;  4UIB A;  2GAN A;  3FIX A;  1FNO A;  4PQA A;  3T9Y A;  2Z3L A;  4CAF A;  3TLB A;  3SHP A;  4NGQ A;  3A9L A;  4TNU A;  1RO5 A;  1X10 A;  2PQ8 A;  2ZEP A;  2R82 A;  5DWM A;  1H8L A;  2ZEM A;  1Y9W A;  2RC4 A;  1Y7E A;  2B5G B;  4KLW A;  3VRR A;  1F2P A;  4UCM A;  5G22 A;  5LRK A;  1WVM A;  1BPM A;  4KZT A;  4C85 A;  3WT4 A;  3FMC A;  2ODF A;  2PC1 A;  2QYV A;  4MHY A;  3S9N A;  3W6S A;  1VHO A;  2VKZ G;  3PEI A;  1GGO A;  2ZEL A;  3I74 A;  1LAP A;  3IWG A;  2P6E A;  4BPW B;  1U6M A;  3R9E A;  1R43 A;  1IID A;  3H8E A;  4H6U A;  3TTH A;  3OB1 B;  4J3G A;  3PBB A;  4Y49 B;  4DJL A;  3UY5 A;  3I6S A;  2G3T A;  3TO7 A;  2PVW A;  1NE9 A;  2B4D B;  4CRY B;  2C5Q A;  4KNG E;  3VTA A;  2FL4 A;  4Q7A A;  1WWZ A;  3PB6 X;  4FBE A;  4UFW A;  2PJ4 A;  1F2O A;  5BY0 A;  3D7H A;  1TKH A;  3IJ3 A;  4U9Z A;  4A32 A;  1QST A;  2GFQ A;  1M4L A;  3C26 A;  2OU2 A;  3KQX A;  3VRP A;  4C7I A;  4KOX A;  1QSN A;  2YNE A;  4YN3 A;  4EVY A;  2Z3K A;  3TLE A;  1HDU A;  3PB7 X;  3WAB A;  2PR1 A;  4XPD B;  4NGT A;  2B58 A;  4R3K A;  3P2H A;  2D0P A;  2ATR A;  4NGP A;  2RB7 A;  2C1C A;  3EFA A;  2Q0Y A;  1MK4 A;  3EZB A;  2PJ0 A;  3TLA A;  4FAI A;  3F0A A;  2CNM A;  2PDO A;  3OAK A;  3I9S A;  3PFE A;  4GM5 A;  3B3W A;  3TOA A;  1LOK A;  1KWM A;  1QSO A;  2Q43 A;  3R9F A;  3NE7 A;  3GYA A;  3G8W A;  4CGM A;  4JWP A;  4IHM A;  3VWD A;  3D2P A;  3IGR A;  1LAM A;  3H8G A;  5EC4 A;  3W91 A;  3PB8 X;  3ICU A;  1IYL A;  4OIW A;  1XRY A;  1FT7 A;  3BUM B;  1S7F A;  2AUN A;  4C99 A;  4EFD A;  4P4E A;  4NCZ A;  4MBU A;  2YNC C;  1ZO0 A;  3MGD A;  4EWT A;  4CGN A;  6CPA A;  3TLC A;  2HV2 A;  2PE3 A;  4B6Z A;  4MCS A;  3FXT A;  1CBX A;  3D68 A;  3PFO A;  4YU9 A;  5JYB A;  1CM0 A;  3H4Q A;  3KR4 A;  2EWB A;  1JDB C;  4Y49 C;  1TF9 A;  2PJ3 A;  2HQY A;  1B6B A;  1M1D A;  1TF8 A;  2R98 A;  4UEF A;  3SI1 A;  2B4J C;  2WPX A;  4PXB A;  1CS0 B;  3R9G A;  4MJ8 A;  5LRJ A;  1P4N A;  3HMJ G;  4OC3 A;  3SJE A;  1M4I A;  2WYR A;  3F9K C;  1M4D A;  2EZC A;  4E5S A;  4KOW A;  2ZW6 A;  1ARL A;  4P6Y A;  1I1D A;  2QIR A;  4MCQ A;  4ZY2 A;  4A94 A;  2GE3 A;  3KGQ A;  2PJ5 A;  5F09 A;  2PIY A;  5HH1 A;  1IY7 A;  1QSR A;  1NSA A;  3GIU A;  4A30 A;  1Z5R A;  5JM6 A;  1C3O B;  1JQG A;  1R61 A;  4KOS A;  4XPD C;  3VAT A;  3EC4 A;  4B12 A;  2X0S A;  3T90 A;  1YQE A;  4XPL A;  4NSQ A;  1XE4 A;  1QMU A;  1OZP A;  4C2Z A;  4C7H A;  4MHP A;  3TO9 A;  4AVC A;  2Z3N A;  1YLE A;  2XEG A;  1IGB A;  2P6G A;  3B35 A;  1XF1 A;  3WC7 A;  2GLF A;  2V8H A;  2YJT A;  4H1H A;  4UFX A;  1CPS A;  3R95 A;  1B47 A;  3TOB A;  4BMH A;  3RAM A;  4J0N A;  2ABZ A;  4B5P A;  3T5M A;  2ZEH A;  3V7Z A;  5HMN A;  3FVL A;  4IF5 A;  5HVF A;  4B5O A;  3NH8 A;  5EBV A;  3VH9 A;  4INJ A;  3QNV A;  4AG7 A;  4M6G A;  3W6X A;  4A2Z A;  4CAW A;  4PK2 A;  2HB6 A;  2V8D A;  3B3S A;  1PYT B;  3EO4 A;  1TXR A;  5G1Z A;  1ZG8 A;  2PJ7 A;  3BJ7 A;  4A37 A;  3NH5 A;  4TWE A;  4ZI6 A;  5K8O A;  1EZA A;  5K8M A;  4KOR A;  3WC6 A;  2JDD A;  4A39 A;  1M44 A;  4IK2 A;  4BD9 A;  3HUV A;  5AG4 A;  4NGS A;  3OB2 B;  1BLL E;  2VZY A;  4LUA A;  3TE4 A;  2B0A A;  2FSR A;  3B7I A;  2VEZ A;  4R57 A;  4NF1 A;  2GIV A;  4DUK A;  4Z65 A;  4AG9 A;  2GP4 A;  1QSM A;  4FUU A;  1NBW A;  3FBU A;  2NYQ A;  1CE8 B;  2V77 A;  2B3U A;  2YND A;  4CS0 B;  4C8T A;  4UWJ A;  1VHE A;  4A38 A;  4AVA A;  2AFU A;  5K99 A;  1XF8 A;  3N5F A;  2DEA A;  2JEW A;  3KAS A;  4R76 A;  3WR7 A;  5C82 A;  3NFQ A;  2R1I A;  5F47 A;  2OH1 A;  2QEC A;  3GJZ A;  2G0B A;  4F9U A;  1XFO A;  4UWI A;  3T05 A;  4BPU B;  1MJB A;  1GHE A;  4F8Z A;  2FIA A;  4HKF A;  1IU8 A;  4HNY B;  4CPA A;  3V38 A;  4I49 A;  2DXQ A;  4KOT A;  2O28 A;  2ZW7 A;  5LYL A;  4C9U A;  4C8F A;  2P6F A;  3CT9 A;  5HVG A;  1YSJ A;  1YX0 A;  4BBH A;  5J8F A;  3KQZ A;  4C84 A;  5F9M A;  4C8C A;  4OP4 A;  5KTD A;  4OC5 A;  3E0K A;  2IMO A;  3PGP A;  2Z3P A;  1PU9 A;  2ZOG A;  3KI9 A;  4MMO A;  4MY0 A;  1M6V B;  4CZ1 A;  2FXF A;  2EVN A;  4H6Z A;  3BXM A;  4OC2 A;  2EZA A;  4JVO A;  4UCP A;  1XBU A;  4UF4 A;  1VIX A;  3ZJ0 A;  2B3V A;  4B10 A;  2PVV A;  2VXK A;  3F5B A;  3KL9 A;  4MFK A;  5J3X A;  2XPP A;  3TO6 A;  3EY5 A;  5F46 A;  2PRB A;  4RI1 A;  2R8V A;  4KOU A;  4WWV A;  1R3N A;  2GLJ A;  2IJZ A;  1ZYM A;  4H89 A;  1IB1 E;  3EXN A;  2VBQ A;  1NSL A;  4ZYQ A;  2I79 A;  3U88 C;  2G9D A;  2HC9 A;  4KVX A;  3H8F A;  2I3C A;  2XPL A;  2HWG A;  2CXA A;  2EZB A;  5CBM A;  3CXS A;  4EYS A;  3RZA A;  2CF4 A;  2C6C A;  3KR5 A;  1VBH A;  3H5Z A;  5CNP A;  4ONU A;  2OZH A;  1YME A;  4NJQ A;  4CAV A;  5IR2 A;  2IQ6 A;  1FBV A;  4X8I A;  3D4U A;  2VL1 A;  4CO9 A;  1N71 A;  1WJT A;  1YK3 A;  3K9T A;  4RS2 A;  2G3A A;  2J8M A;  1IOI A;  4KVM E;  1S5K A;  5JPH A;  4M85 A;  4CAX A;  5HXD A;  2CTC A;  4JJX A;  4RR2 B;  3SXN A;  4RUH A;  4A4B A;  4LQ6 A;  4MHN A;  3SXO A;  5KTC A;  4M8D A;  1EZB A;  5ISV A;  2Q4V A;  1HEE A;  4X3R A;  2PJ9 A;  2Z3M A;  3IO1 A;  4PSX A;  5DS0 A;  2HI6 A;  2Z3O A;  2NMT A;  3CDX A;  4L89 A;  3BI0 A;  4XPK A;  2AE6 A;  4CDJ A;  4HPS A;  3K9U A;  4YRH A;  4NEX A;  2F8H A;  4EME A;  2J9A A;  4KSA A;  5HKW A;  2PJ6 A;  3QAY A;  2PJC A;  3FNC A;  3KHX A;  2C6G A;  3LMS A;  4YWY A;  2X7B A;  3R1K A;  3TX8 A;  4CYQ A;  5A27 A;  3FH4 A;  4MCR A;  4CRZ B;  3FED A;  4JXQ A;  3TFY A;  1AUG A;  1V6C A;  4M6I A;  4CGL A;  4RN7 A;  4COB A;  2FE7 A;  3PZJ A;  1CPX A;  1S7K A;  4GXH A;  4X2T A;  1DIK A;  5HKY A;  4IIY A;  3B8G A;  2VZZ A;  2YGW A;  4H2K A;  4O23 A;  1VBG A;  1ELL P;  2J8N A;  1JDE A;  1Z8L A;  4NGN A;  3EIF A;  3JVN A;  2DPS A;  4AVB A;  2ZED A;  3IU1 A;  4R8F A;  3BUX B;  5FD8 A;  5ELY A;  1DE4 C;  1PCA A;  4OID A;  1HDQ A;  2V8G A;  3PB9 X;  2YJV A;  2EK8 A;  2AFO A;  2CNS A;  4X5K A;  2XEI A;  1KUV A;  4XNH C;  4L8A A;  5AGE A;  1CX8 A;  3OP0 A;  2PJ2 A;  4UIA A;  3PBE A;  1ON0 A;  1YVK A;  2ZOF A;  4OC0 A;  1Q7L A;  2ZPA A;  4R9M A;  5D8N A;  3RO0 A;  3IWE A;  3RYO A;  3RBU A;  1C30 B;  4P45 A;  3VGO A;  4C9V A;  1CP6 A;  5FVJ A;  2PIZ A;  4OME A;  2Q4Y A;  4YGO A;  4C8A A;  4P4J A;  5HVH A;  1XIX A;  3G3S A;  4UCN A;  1BO4 A;  1JWQ A;  1SQH A;  2OR4 A;  4CGO A;  4MFL A;  3LAC A;  5K8N A;  4FD6 A;  4U5Y A;  4ZY1 A;  3D8P A;  3CXP A;  3GY9 A;  1IIC A;  3D66 A;  5H86 A;  3BUO B;  1I12 A;  2O53 A;  2CIJ A;  5JGF A;  4P4I A;  2EK9 A;  1LRZ A;  2AFS A;  4R6T A;  5GCN A;  4NGM A;  2N3A B;  1YW4 A;  4QC6 A;  1EO0 A;  3S9L A;  2OOT A;  3IEH A;  3TC8 A;  1MJA A;  2GRE A;  3CPA A;  3L2N A;  3BHX A;  1Q2D A;  1V0C A;  4Q38 A;  5AXI A;  4B13 A;  4ZGY B;  1BOB A;  2PSW A;  1BPN A;  2ARH A;  3DNS A;  3LD2 A;  2BOA A;  3BUW B;  2FT0 A;  2WSA A;  4R3L A;  4AXV A;  3TCV A;  2DPT A;  3LWU A;  2JDC A;  5F49 A;  4COG A;  3JTK A;  1ZLI A;  1WK4 A;  2XPO A;  4UFV A;  5F13 A;  5G20 A;  5THW A;  3ZZI A;  5IB0 A;  1CG2 A;  5IV0 A;  3OWC A;  3F8K A;  4II9 A;  1S7N A;  1VHS A;  2VI7 A;  4U9Y A;  1YW6 A;  3FEC A;  4PK3 A;  4A95 A;  4AB7 A;  4DNC A;  2QML A;  2AFZ A;  2EBJ A;  4C86 A;  4KSF A;  2XEJ A;  2Z11 A;  3FJU A;  2WPW A;  1TIQ A;  2Z0Z A;  4GPL B;  3KKW A;  3PB4 X;  4Q36 A;  1QQ9 A; 
#chains in the Genus database with same CATH homology
 4P10 A;  4TJV A;  4NFR A;  2F7V A;  4K3N A;  2ZEE A;  4ZX8 A;  3IFE A;  1OBR A;  2QVP A;  3SJF A;  1GYT A;  4C9R A;  2PJA A;  3VAR A;  1LAN A;  2BCO A;  1Y0Y A;  4C8U A;  4G1P A;  1UWY A;  3MRU A;  2WZN A;  3IWW A;  3HLP A;  3DGV A;  1EE3 P;  2NSM A;  2JBJ A;  1BAV A;  3K2K A;  2PRQ A;  4P44 A;  2Q4Z A;  2XEF A;  4FWU A;  4KSI A;  1TKJ A;  5LYD A;  4OKO A;  1YLO A;  1XMB A;  2ZEN A;  2FVG A;  4ZY0 A;  3FEE A;  2Q51 A;  3SJG A;  1AMP A;  3NH4 A;  2ZEF A;  3BI1 A;  4W9Y A;  4P4B A;  3T8W A;  1ELM P;  5K8P A;  4ZX9 A;  3NFZ A;  3D7D A;  2ANP A;  4UEZ A;  4UEE A;  2RFH A;  3KHZ A;  4JYW A;  4C9E A;  2AFM A;  4LQG A;  2PJB A;  3DLJ A;  2BO9 A;  4MRI A;  1DTD A;  3FX6 A;  3S9M A;  1AYE A;  4PXE A;  4NGR A;  1LFW A;  3CPX A;  5CPA A;  1TKF A;  2V8V A;  1ZG9 A;  2PJ8 A;  2ZEG A;  3D7G A;  3D7F A;  5D29 A;  1XJO A;  3D67 A;  4PXC A;  5JH9 A;  3GB0 A;  4DYO A;  1Y0R A;  2PCU A;  1CP7 A;  4MCP A;  2C6P A;  3SI2 A;  2CTB A;  3ISX A;  5IB9 A;  8CPA A;  1VGY A;  4MXU A;  2ZEO A;  1ARM A;  3GUX A;  5LRG A;  3FF3 A;  1F57 A;  1LCP A;  4MHZ A;  3JRU A;  4JZ0 A;  3PRT A;  3SI0 A;  4CDK A;  4WJB A;  3I1U A;  3IIB A;  1Z2L A;  4P4D A;  3B3T A;  4F9V A;  5J1Q A;  3GLJ A;  3ISZ A;  2O4H A;  3WC5 A;  4IAV A;  5LYI A;  4PXD A;  1Y9Z A;  3SJX A;  4C9A A;  4TJX A;  5I4M A;  5LYF A;  2AFX A;  1RTQ A;  3MN8 A;  3B3V A;  2QJ8 A;  4NJR A;  3NA6 A;  2GU2 A;  4P4F A;  3B2Y A;  1ZG7 A;  2AFW A;  4C8P A;  2JBK A;  2POK A;  3B3C A;  3IC1 A;  4PPZ A;  4OC4 A;  4OC1 A;  1ZLH A;  3KZW A;  2PJ1 A;  4ONW A;  4R7M A;  4UIB A;  4PQA A;  1FNO A;  4NGQ A;  4TNU A;  2ZEP A;  1H8L A;  2ZEM A;  1Y7E A;  1F2P A;  5LRK A;  1WVM A;  1BPM A;  4C85 A;  3WT4 A;  3FMC A;  2QYV A;  4MHY A;  3I74 A;  3S9N A;  1VHO A;  3PEI A;  2ZEL A;  1LAP A;  1R43 A;  3H8E A;  3PBB A;  4DJL A;  3I6S A;  2PVW A;  2C5Q A;  4KNG E;  3VTA A;  4Q7A A;  4FBE A;  3PB6 X;  2PJ4 A;  1F2O A;  1TKH A;  3D7H A;  3IJ3 A;  1M4L A;  3KQX A;  4YN3 A;  1HDU A;  3PB7 X;  3WAB A;  4NGT A;  4NGP A;  2RB7 A;  2C1C A;  2PJ0 A;  4FAI A;  3PFE A;  4GM5 A;  3B3W A;  1LOK A;  1KWM A;  2Q43 A;  4IHM A;  1LAM A;  3H8G A;  3ICU A;  3PB8 X;  4OIW A;  1XRY A;  1FT7 A;  4C99 A;  4EFD A;  4P4E A;  4EWT A;  6CPA A;  2PE3 A;  4B6Z A;  4MCS A;  3PFO A;  1CBX A;  3D68 A;  4YU9 A;  3KR4 A;  2EWB A;  1TF9 A;  2PJ3 A;  4UEF A;  3SI1 A;  1TF8 A;  4PXB A;  5LRJ A;  4OC3 A;  3SJE A;  2WYR A;  4P6Y A;  1ARL A;  4MCQ A;  4ZY2 A;  4A94 A;  3KGQ A;  2PJ5 A;  5F09 A;  2PIY A;  1IY7 A;  1NSA A;  1Z5R A;  5JM6 A;  1JQG A;  3VAT A;  1QMU A;  4MHP A;  3B35 A;  2XEG A;  1IGB A;  1XF1 A;  3WC7 A;  2GLF A;  2V8H A;  1CPS A;  3RAM A;  2ABZ A;  2ZEH A;  3V7Z A;  3FVL A;  5HVF A;  3NH8 A;  3VH9 A;  3QNV A;  2HB6 A;  2V8D A;  3B3S A;  1PYT B;  1TXR A;  1ZG8 A;  2PJ7 A;  4A37 A;  4ZI6 A;  3NH5 A;  4TWE A;  5K8O A;  5K8M A;  3WC6 A;  4A39 A;  4IK2 A;  4BD9 A;  3HUV A;  4NGS A;  1BLL E;  3B7I A;  4DUK A;  4Z65 A;  2GP4 A;  4FUU A;  2NYQ A;  2V77 A;  4C8T A;  4A38 A;  1VHE A;  2AFU A;  3N5F A;  2DEA A;  2JEW A;  3KAS A;  4R76 A;  4F9U A;  1XFO A;  4F8Z A;  4CPA A;  3V38 A;  5LYL A;  4C8F A;  3CT9 A;  5HVG A;  1YSJ A;  4C84 A;  3KQZ A;  4C8C A;  4OP4 A;  4OC5 A;  2IMO A;  3KI9 A;  2ZOG A;  4MMO A;  3BXM A;  4OC2 A;  1XBU A;  4UF4 A;  1VIX A;  2PVV A;  3KL9 A;  4WWV A;  1R3N A;  2GLJ A;  2IJZ A;  4ZYQ A;  2G9D A;  2HC9 A;  3H8F A;  2I3C A;  5CBM A;  3RZA A;  2CF4 A;  2C6C A;  3KR5 A;  1YME A;  4NJQ A;  5IR2 A;  2IQ6 A;  4X8I A;  3D4U A;  2VL1 A;  3K9T A;  5HXD A;  2CTC A;  4RUH A;  4MHN A;  1HEE A;  4X3R A;  2PJ9 A;  3IO1 A;  5DS0 A;  3CDX A;  3BI0 A;  2F8H A;  4EME A;  2J9A A;  2PJ6 A;  2PJC A;  3TX8 A;  3KHX A;  2C6G A;  3LMS A;  4YWY A;  7CPA A;  3FH4 A;  4MCR A;  3FED A;  1CPX A;  4X2T A;  4H2K A;  4O23 A;  1ELL P;  1Z8L A;  4NGN A;  3EIF A;  2ZED A;  4R8F A;  5ELY A;  1DE4 C;  1PCA A;  4OID A;  1HDQ A;  2V8G A;  3PB9 X;  2EK8 A;  2AFO A;  4CDJ A;  2XEI A;  1CX8 A;  2PJ2 A;  4UIA A;  3PBE A;  5D8N A;  2ZOF A;  1V6C A;  4OC0 A;  1Q7L A;  4C9V A;  3RBU A;  4P45 A;  1CP6 A;  2PIZ A;  4OME A;  4C8A A;  4P4J A;  5HVH A;  2OR4 A;  5K8N A;  4ZY1 A;  3D66 A;  2O53 A;  2CIJ A;  5JGF A;  4P4I A;  2EK9 A;  2AFS A;  4R6T A;  4NGM A;  1YW4 A;  3S9L A;  2OOT A;  3IEH A;  3TC8 A;  2GRE A;  3CPA A;  3L2N A;  3BHX A;  4C9U A;  1BPN A;  2BOA A;  4AXV A;  3LWU A;  1ZLI A;  5THW A;  1CG2 A;  1YW6 A;  3FEC A;  4C86 A;  2AFZ A;  2XEJ A;  3FJU A;  3PB4 X;  1QQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...