3SJEA

X-ray structure of human glutamate carboxypeptidase ii (the e424a inactive mutant) in complex with n-acetyl-aspartyl-aminononanoic acid
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
690
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjeA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjeA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjeA02
3SJEA 1CPXA 4WJBA 3D7HA 1BPMA 5D8NA 2PJ8A 3T8WA 4F9UA 4P4FA 2AFWA 1Y7EA 2V8HA 3H8GA 1CX8A 4PXBA 3RZAA 4MCPA 1CPSA 4A38A 5K8NA 1YW6A 4P4BA 4OC5A 1ELMP 2BO9A 4P4JA 3SJXA 4NGRA 2G9DA 1QQ9A 4ZX8A 3TX8A 3I6SA 4KSIA 1Z5RA 1RTQA 3FX6A 3WT4A 3ISXA 4NGSA 3KR5A 2ANPA 5LRKA 4AXVA 1EE3P 2AFUA 3SJFA 4P44A 1DE4C 2PJ3A 4W9YA 4DYOA 3VARA 3N5FA 2PJCA 3H8EA 4C9VA 2PIYA 4C9UA 3SJGA 5HVFA 1F2PA 2ZEHA 3SI0A 3D7DA 2PE3A 3FF3A 2PJ7A 3PFOA 4EWTA 1ELLP 3KGQA 1DTDA 3D7GA 2ZEDA 3TC8A 2XEGA 2ZEGA 2ZEPA 3KI9A 2PIZA 3FEDA 3K2KA 3IEHA 3I1UA 2PJ2A 3LWUA 3B3VA 1HDQA 3LMSA 3MRUA 4ZY1A 1XFOA 4UIAA 3H8FA 2C6PA 1F57A 4UIBA 3IWWA 1GYTA 3FJUA 4A37A 1ZG7A 2HC9A 3PB8X 2PJ1A 2RB7A 3IJ3A 4OC1A 2IJZA 4R8FA 1BAVA 3GUXA 3KHZA 4MXUA 3VH9A 2PCUA 5JH9A 4C8FA 1ZLHA 4JYWA 2PJ4A 4F8ZA 1XMBA 1IY7A 4C8PA 1HEEA 3KQZA 4PPZA 1BPNA 3B3SA 1Z2LA 3D68A 2PJ0A 3PB9X 1ARLA 4OMEA 4MCRA 4R6TA 3B3CA 1OBRA 4TJXA 1TKHA 5HXDA 2AFXA 4K3NA 3D67A 4MCSA 4PXCA 1FNOA 3RAMA 2VL1A 2ZELA 2CTCA 3KR4A 4PXDA 2O53A 4ZI6A 2Q51A 4R7MA 5HVHA 2RFHA 3CPAA 4P10A 1ZG8A 3L2NA 3SI2A 3NH5A 3ICUA 8CPAA 4CDJA 2ZENA 7CPAA 1V6CA 4MHPA 4FAIA 5ELYA 2ZOFA 4IK2A 2BOAA 4DJLA 4P45A 1HDUA 4MHNA 3BXMA 2WYRA 1VGYA 3DLJA 3B2YA 3CT9A 3PBEA 5CPAA 3IO1A 4IHMA 3WC6A 4NGTA 1VHOA 2V8DA 4MCQA 2ZEEA 1PCAA 2C6CA 1ZLIA 4EFDA 4ZY0A 2PJBA 3VTAA 2Q4ZA 2EK9A 2OR4A 4OC3A 4NGMA 1AYEA 1VIXA 1WVMA 2V8VA 1XJOA 4YU9A 2ZEMA 3CDXA 3HUVA 2C6GA 3PB7X 3B3WA 4P4EA 2AFOA 4C9EA 1ARMA 4LQGA 4TWEA 1ZG9A 3QNVA 2GREA 3PBBA 4TJVA 4R76A 3S9LA 4OC4A 5CBMA 3V38A 3CPXA 3JRUA 4C99A 2AFMA 2GU2A 2I3CA 4NJRA 1LCPA 3FH4A 1YMEA 4A94A 2O4HA 1LANA 4OIWA 4Z65A 6CPAA 5I4MA 3NH4A 3BI0A 4C84A 2NSMA 5IB9A 5LYIA 5LYDA 1XRYA 2QVPA 4MHZA 4C9RA 2PRQA 4MMOA 2XEIA 2JEWA 1Z8LA 2CIJA 4CDKA 5THWA 1Y9ZA 4P4IA 4NJQA 2PJ9A 5HVGA 4H2KA 4X3RA 4NFRA 1Y0RA 4P6YA 4MRIA 4OIDA 4OC2A 3I74A 1TF9A 4UF4A 1LAPA 2J9AA 2FVGA 3VATA 4OP4A 2NYQA 3PFEA 3PEIA 2ZEOA 4B6ZA 4OC0A 3FEEA 1CBXA 2GLJA 4G1PA 2BCOA 1PYTB 4F9VA 2V8GA 3WC5A 1Y0YA 4NGNA 1TXRA 2POKA 2V77A 3S9MA 1AMPA 1R3NA 4FUUA 1KWMA 3IIBA 3V7ZA 1YSJA 3MN8A 4GM5A 4A39A 3SI1A 2CTBA 5DS0A 3PB4X 3WC7A 2F8HA 4PXEA 3RBUA 5LRGA 2OOTA 4UEZA 4KNGE 3K9TA 5LYLA 2IMOA 3PB6X 2EWBA 3KHXA 2PJ6A 1F2OA 3D4UA 2GLFA 4C86A 3GLJA 1BLLE 4IAVA 2XEJA 1VHEA 4X2TA 4DUKA 4JZ0A 3DGVA 5JGFA 3KASA 4ONWA 4PQAA 4EMEA 3ISZA 1H8LA 1CP7A 4NGQA 1LAMA 3NA6A 2QJ8A 4C9AA 5K8OA 1FT7A 3FVLA 4YWYA 2JBKA 1TKJA 2AFZA 1NSAA 5LRJA 1LOKA 1XBUA 1TF8A 1CG2A 5K8PA 2HB6A 4C8UA 2QYVA 4ZY2A 4C8CA 4O23A 5D29A 1TKFA 3B7IA 4UEFA 2JBJA 1R43A 3PRTA 2ZOGA 4ZYQA 3KZWA 3BI1A 2ZEFA 4ZX9A 2PJAA 4YN3A 5J1QA 3D7FA 3B3TA 4X8IA 4BD9A 3S9NA 4C8TA 2PVVA 3B35A 3HLPA 2XEFA 2PVWA 5K8MA 4FBEA 4NGPA 2WZNA 3BHXA 4C8AA 4OKOA 3NFZA 5F09A 2Q43A 3FMCA 3IFEA 1M4LA 1YW4A 3GB0A 1XF1A 5LYFA 2C1CA 1LFWA 3KL9A 2EK8A 4MHYA 4RUHA 3EIFA 2DEAA 2ABZA 2IQ6A 3NH8A 3WABA 3KQXA 3D66A 4C85A 4WWVA 2AFSA 5JM6A 2PJ5A 1JQGA 1UWYA 1YLOA 2CF4A 1CP6A 4CPAA 1Q7LA 3IC1A 4FWUA 4UEEA 4P4DA 1IGBA 1QMUA 4TNUA 3FECA 2F7VA 4Q7AA
chains in the Genus database with same CATH superfamily
3SJEA 1JWQA 1CPXA 4WJBA 1RO5A 5IB0A 2AUMA 3NE7A 4NSQA 2B0AA 5F9MA 4LX9A 3D7HA 1BPMA 2HUZA 5D8NA 2PJ8A 3T8WA 4F9UA 5J3XA 2HQYA 4P4FA 3OWCA 2AFWA 1Y7EA 2DF5A 2V8HA 4XPDB 3H8GA 4MJ8A 2FT0A 2NMTA 2J8MA 2Z3OA 1CX8A 4YRHA 1UFHA 4U9YA 3JUWA 4XNHB 5IX3A 4PXBA 3NOJA 3RZAA 1YK3A 4MCPA 4NCZA 1CPSA 5HKZA 2PRBA 4MFKA 3FB3A 4A38A 2BSWA 5C82A 1YW6A 5K8NA 4MY0A 4P4BA 2Z10A 4KOUA 4OC5A 1ELMP 2BO9A 4P4JA 4A2ZA 3GKRA 3SJXA 4MFLA 1Z8WA 3T05A 4NGRA 2G9DA 1QQ9A 2Q4VA 4NEXA 1EZBA 4ZX8A 3TX8A 3KKWA 3I6SA 4KSIA 1Z5RA 2C27A 2AJ6A 2P6EA 3DR6A 1RTQA 3FX6A 4M6HA 3WT4A 3DNSA 3N7ZA 3ISXA 2GIVA 4CAWA 2B4JC 4NGSA 3KR5A 4KLWA 4CAEA 3JVNA 2ANPA 3BLNA 3O8ZA 2HV2A 1YVHA 3FYNA 4CS0B 4CYOA 5LRKA 4AXVA 1EE3P 2AFUA 3SJFA 4KSFA 3TCVA 2QECA 1Z4RA 3EY5A 4ZGYB 4P44A 4X5KA 4CYPA 2P6FA 3RO0A 2XPNA 1AUGA 4BINA 1DE4C 2PJ3A 4W9YA 4DYOA 4MJXA 3VARA 3N5FA 2PJCA 3H8EA 1R57A 4C9VA 2PIYA 2YGWA 2Z0ZA 3D3SA 3GY9A 4II9A 3SJGA 4C9UA 3SXOA 1IYKA 3S6GA 2PQ8A 1F2PA 5HVFA 2JLMA 2ZEHA 3SI0A 4J3GA 5F48A 3D7DA 1FBVA 1YVOA 2PE3A 3FF3A 3W6XA 2PJ7A 3PFOA 4EWTA 4UCNA 1ELLP 3KGQA 1DTDA 3D7GA 4E94A 4KVXA 1QSTA 2ZEDA 1M1DA 2XEGA 2ZEGA 3TC8A 4NXYA 2EBJA 4C2ZA 3T07A 3BUNB 2ZEPA 2PIZA 3GYAA 3KI9A 3FEDA 3K2KA 3IEHA 3I1UA 2PJ2A 5JQ4A 3LWUA 3GJZA 3B3VA 1HDQA 3LMSA 3MRUA 4ZY1A 1XFOA 5KTAA 4CZ1A 4UIAA 4IUSA 3H8FA 2C6PA 2UV8G 4MBUA 1EZAA 4FD4A 4MI1A 1F57A 4UIBA 3IWWA 1GYTA 4RI1A 3FXTA 1PU9A 1VKCA 2FL4A 3FJUA 3BUXB 1ZL0A 4A37A 3R9FA 1ZG7A 5EMIA 4CGLA 2HC9A 3PB8X 4PSWA 2EZBA 2D4OA 5ISVA 3TLGA 2YNDA 2PJ1A 2R7HA 5J8CA 2RB7A 3IJ3A 1YX0A 4MFQA 4OC1A 1L0CA 1S60A 2IJZA 1BAVA 2OB0A 3EXNA 4R8FA 3QB8A 3GUXA 3TO7A 1IYLA 3KHZA 4KUBA 2KCWA 4MXUA 3NFQA 4NF1A 5F49A 2PCUA 3F8KA 3VH9A 2RC4A 2IL4A 1OZPA 2F5IA 1ZLHA 4AG7A 5JH9A 3QAHA 4C8FA 4JYWA 2PJ4A 2D0OA 4F8ZA 4QC6A 2ZW7A 4BMHA 1XMBA 1IY7A 2X7BA 3OB2B 4DNCA 1HEEA 3H5ZA 4C8PA 2YJTA 3FNCA 1XIXA 1WJTA 2Z3NA 4R87A 3KQZA 4R3KA 4PPZA 1BPNA 3B3SA 1Z2LA 3D68A 3U88C 2PJ0A 2VXKA 3PB9X 2P0WA 1Q2DA 1ARLA 4OMEA 4MCRA 3TLYA 2D0PA 5A27A 3D2MA 2PR8A 2X0SA 4R6TA 3B3CA 1OBRA 4TJXA 3JTKA 1YREA 2B4DA 3EC4A 2GP4A 1P4NA 2Y1MA 1TKHA 1WK4A 5HXDA 4RR2B 2AFXA 4B11A 2R98A 3A9LA 4K3NA 3SXNA 3D67A 2XPOA 3C26A 4MCSA 4PXCA 1Q5XA 1FNOA 3RAMA 4M6IA 4IF5A 2VL1A 3CXSA 3R96A 2ZELA 4J0NA 2CTCA 3KR4A 3CXPA 4PXDA 4COBA 2O53A 4ZI6A 5EBVA 2Q51A 2B58A 4H6ZA 4R7MA 5HVHA 2B3VA 2RFHA 5HMNA 3CPAA 3EFAA 4P10A 3PLFB 4UCPA 1ZG8A 3L2NA 4R57A 3SI2A 1BOBA 1NE9A 2H5MA 3NH5A 1YVKA 2PDOA 3TOBA 8CPAA 3ICUA 4CDJA 5BY0A 2ZENA 1Q2YA 2VI7A 3LD2A 5GCNA 2GANA 1Y9WA 3VWEA 7CPAA 2HI6A 1KC7A 4AVBA 1V6CA 4MHPA 4FAIA 3TO6A 4KSAA 5ELYA 1KUYA 4EVYA 2ZOFA 4IK2A 4BPWB 2BOAA 4DJLA 4P45A 1HDUA 4MHDA 3R9GA 5FVJA 4MHNA 2MP0A 4B10A 3DR8A 2FXFA 3BUOB 3BXMA 1KZFA 2DPSA 2WYRA 2P6GA 1VGYA 3DLJA 4JLYA 4Q38A 3TOAA 3B2YA 3CT9A 3PBEA 4MI4A 5CPAA 4EYSA 5JYBA 3IO1A 3OB1B 4KLVA 4IHMA 3WC6A 4NGTA 3PGPA 5HKYA 4OAEA 2XPPA 2Q0YA 3TFYA 1BXRB 1VHOA 4LUAA 3ZJ0A 2I79A 2V8DA 4MCQA 1IOFA 1S7FA 2CBLA 2I00A 4COGA 2ZEEA 1PCAA 4R3LA 2C6CA 1XF8A 1ZLIA 2CY2A 3G8WA 4AB7A 1RXTA 1S5KA 1ZRSA 4EFDA 3PT1A 3VRPA 4M3SA 4ZY0A 2HROA 2PJBA 3VTAA 4Y49C 1M4IA 2Q4ZA 5H86A 5KTCA 4H1HA 2EK9A 2OR4A 4OC3A 3T0TA 2B5GA 3H4QA 4NGMA 1AYEA 1IIDA 1VIXA 2PSWA 1WVMA 5F1YA 3U1BA 5H84A 1NBWA 3TLGB 2V8VA 4KOSA 1XJOA 2ZW5A 3PFVA 4YU9A 2ZEMA 3CDXA 3HUVA 2C6GA 2OZGA 4M6GA 4BTFA 5JVLA 3R95A 2WPXA 4GPLB 3PB7X 3ZZIA 4AVCA 3B3WA 4B12A 4P4EA 2AFOA 2EZAA 1ARMA 1CJWA 4LQGA 4C9EA 4CO9A 4TWEA 4KOWA 1ZG9A 1QSNA 1ZO0A 3QNVA 4F6AA 4KZTA 3C8OA 2GREA 4BPUB 3TLBA 4UFVA 3PBBA 4TJVA 1M44A 1TIQA 3S9LA 3E0KA 2D4PA 4OC4A 1Z9EA 4HNYB 4R76A 4E8OA 5CBMA 2CNTA 2PC1A 3V38A 3CPXA 3P2HA 2VQYA 3JRUA 1VBHA 4C99A 4CYQA 2AFMA 1FY7A 2GU2A 2R8VA 2I3CA 4NJRA 1XE4A 4UFWA 1LCPA 4CGNA 3FH4A 1YMEA 3ZNIA 5EC4A 5G1ZA 4A94A 1S7NA 2XPLA 3EZEA 3TLZA 1MJAA 2Q7BA 1YGHA 2O4HA 2Q4YA 2Z11A 2Z3LA 1LANA 4OIWA 5AG6A 4Z65A 6CPAA 5I4MA 2B4DB 3NH4A 4OLLA 1QSMA 4Q7AA 2AE6A 5JPHA 3BI0A 1MJBA 2NSMA 3I3GA 4C84A 1C3OB 5IB9A 5LYIA 3FIXA 4FD6A 2YJVA 5LYDA 3K4IA 3SR3A 3VRQA 1XRYA 1X10A 1Y7RA 3IU2A 2B4BA 5F5XA 2QVPA 3VROA 4MHZA 2VZZA 4C9RA 2PRQA 2JEVA 4MMOA 2XEIA 5E96A 2JEWA 3V8IA 1Z8LA 1I21A 2CXAA 2Q04A 4H6UA 5IV0A 2CIJA 4PK2A 4CDKA 5THWA 2FIWA 1Y9ZA 4P4IA 2DPTA 4KS9A 4NJQA 2PJ9A 3K9UA 5HVGA 4H2KA 2VBQA 5HH1A 4X3RA 4NFRA 1Y0RA 3UY5A 1MK4A 4P6YA 1B87A 4AVAA 4C2YA 2DXQA 2REFA 3LODA 4MRIA 1T36B 4MFPA 3IGRA 2PR1A 1K4JA 4OIDA 4C68A 3BJ7A 4OC2A 1S3ZA 1SQHA 3D8PA 4K30A 4KOYA 4U5YA 3I74A 1KUXA 1TF9A 2DIKA 4UF4A 2GE3A 1LAPA 2J9AA 2FVGA 4UCMA 3R1KA 4UWJA 1B47A 3NE8A 4OP4A 4ONUA 2VZYA 3VATA 2NYQA 5AGEA 4I49A 3TE4A 3PFEA 3PEIA 3IWEA 2ZEOA 4KOTA 3TLCA 4B6ZA 1YLEA 2FE7A 4OC0A 3B8GA 3FEEA 5A28A 1CBXA 2GLJA 2WUUA 4G1PA 5G20A 2BCOA 4KVOE 1PYTB 3EO4A 4F9VA 1Q2CA 3W91A 2V8GA 5AG7A 4MFJA 3WC5A 1Y0YA 2FCKA 4B5PA 4CGOA 4NGNA 1TXRA 2POKA 2YNCC 2E28A 1VI4A 2EZCA 1XOVA 5F13A 2V77A 1V0CA 3I9SA 3S9MA 1AMPA 1R3NA 4CAXA 4XPKA 2G3TA 2EVNA 1IU8A 4FUUA 1KWMA 1NSLA 1GGOA 1JDBC 3IIBA 3V7ZA 1YSJA 3MN8A 4GM5A 4A39A 3SI1A 2CTBA 4A31A 2YNCA 4A4CA 5DS0A 1MJ9A 1EO0A 3PB4X 1YQEA 4L8AA 3WC7A 2C5QA 2F8HA 2J8NA 4PXEA 3RBUA 5LRGA 1B6BA 4RS2A 2B5GB 4YGOA 4ORFA 2N3AB 2OOTA 2Q7SA 4UEZA 3R9EA 4KNGE 4C2XA 3K9TA 5LYLA 5F47A 2IMOA 4BBHA 4HPSA 3PB6X 5I0CA 2EWBA 3KHXA 2PJ6A 4B13A 1A9XB 1M6VB 1ZYMA 4Y49B 3S6FA 3HPGG 1R61A 1F2OA 3D4UA 5C88A 2OLSA 3IU1A 2GLFA 4C86A 4KOXA 5DWNA 3GLJA 1BLLE 4PV6A 4IAVA 2XEJA 4RN7A 1Y9KA 4E2AA 2ARHA 5IR2A 4KOVA 3KRVA 1PUAA 1VHEA 4HKFA 1J4JA 4X2TA 4XPDC 4A33A 4CRZB 1NXJA 1GHEA 1N71A 4JZ0A 4DUKA 1LRZA 2BL1A 2FM4A 3DGVA 1Z4EA 4XNHC 3RNZA 3KASA 1QSRA 2ATRA 4HNXB 4ONWA 3TO9A 5JGFA 3BUMB 3PP9A 4MFZA 4PQAA 3HMJG 2JDCA 3ISZA 4EMEA 1H8LA 1IICA 2Z3KA 1ON0A 4JWPA 1CP7A 3VRRA 4NGQA 4Q36A 3DSBA 1U6MA 4M8DA 1LAMA 4B5OA 4A32A 3PZJA 1CE8B 3NA6A 2QJ8A 4C9AA 5K8OA 1FT7A 1J3LA 4GS4A 3FRMA 3FVLA 4YWYA 2JBKA 1S7LA 1Z8XA 4PSXA 2FSRA 4R9MA 3VWDA 1TKJA 3OAKA 2AFZA 2Z3PA 1NSAA 5LRJA 1LOKA 1XBUA 1TF8A 2R1IA 3OP0A 3BJ8A 4UWIA 4QVTA 1CG2A 2Y0MA 4A4BA 1CS0B 4M85A 2GFQA 2HB6A 4UFXA 5K8PA 4C8UA 2QYVA 4B14A 4E0AA 3F9KC 1Z9UA 2PCNA 3HPHE 4H89A 1I1DA 4L89A 4ZY2A 4C8CA 3LACA 2QIRA 4O23A 5D29A 4U9ZA 4F0YA 1TKFA 3B7IA 4UEFA 4UA3A 2AUNA 1C30B 2JBJA 4F0XA 1BO4A 3MGDA 3CXQA 4HNWB 1R43A 4QUSA 2R82A 3G23A 3PRTA 2ZOGA 4AG9A 4ZYQA 4INJA 2DLAA 2EUIA 3F0AA 3BI1A 3KZWA 3VGOA 4C7HA 2ZEFA 1WWZA 1XEBA 1KBLA 4KUAA 4ZX9A 2Q44A 2PJAA 4IIYA 4YN3A 2JDDA 5J1QA 4QB9A 3D7FA 5BWAB 1CM0A 2ODFA 3B3TA 4X8IA 4A95A 4CAVA 4BD9A 3IWGA 2ZW4A 2O28A 2CNMA 2K5TA 5KTDA 4CYNA 4CGPA 3WR7A 3S9NA 2J8RA 4FD5A 3VRNA 3DDDA 5K99A 4C8TA 2OU2A 2A4NA 1M4GA 2PVVA 2VEZA 3TLAA 3TYXA 3B35A 3HLPA 3TTHA 3F5BA 3W6SA 4CAFA 2FS5A 4UBRA 2XEFA 4QBJA 4YFJA 3T90A 3CZXA 2OH1A 4B5PB 3SHPA 2Y1NA 2BUEA 2WPWA 2PVWA 5AG5A 2REEA 5AG4A 1I12A 3TT2A 3EZBA 5K8MA 5AXIA 4OADA 1XMTA 4FBEA 4NGPA 2WZNA 3BHXA 4GXHA 3RYOA 4CRYB 4C8AA 2FIAA 2VKZG 4E5SA 4OKOA 2B3UA 3NFZA 4JXRA 5F09A 5CNPA 2EO8A 2Q43A 4KVME 5HKWA 3FMCA 3IFEA 1QSOA 1YR0A 2YNEA 3EZAA 1M4LA 2QMLA 1YW4A 3GB0A 3S6HA 4LQ6A 4FD7A 3T9YA 1NMTA 1IB1E 1XF1A 5LYFA 3BUWB 4BPXB 2C1CA 4MY3A 2G0BA 1LFWA 3KL9A 5FD8A 1VBGA 3T5MA 2EK8A 4MHYA 2ZXVA 3FBUA 4RUHA 1KUVA 2ZW6A 2DEAA 2ABZA 2IQ6A 3NH8A 3WABA 1DIKA 2HWGA 3EIFA 4JVOA 3TLEA 5F46A 3KQXA 3QAYA 3D2PA 3D66A 2CNSA 4C85A 1S7KA 4WWVA 2ZPAA 2AFSA 5JM6A 2WSAA 2PJ5A 1JQGA 1UWYA 4ZBGA 5J8FA 3G3SA 1YLOA 2CF4A 1CP6A 2BEIA 1Q7LA 2OZHA 3IC1A 4CPAA 4A30A 2G3AA 4FWUA 4CGMA 1X12A 1IOIA 4PK3A 5G22A 4C7IA 2OZUA 3GIUA 4P4DA 4UEEA 1IGBA 1Z8TA 1QMUA 1VHSA 1P0HA 5G21A 4JJXA 4JD6A 1M4DA 4TNUA 4KORA 4JXQA 2Z3MA 5DWMA 4XPLA 3S6KA 4IIXA 1KEEB 3FECA 3P2FA 2F7VA 1A2ZA 1JDEA
chains in the Genus database with same CATH topology
3SJEA 1CPXA 4WJBA 3D7HA 1BPMA 5D8NA 2PJ8A 3T8WA 4F9UA 4P4FA 2AFWA 1Y7EA 2V8HA 3H8GA 1CX8A 4PXBA 3RZAA 4MCPA 1CPSA 4A38A 5K8NA 1YW6A 4P4BA 4OC5A 1ELMP 2BO9A 4P4JA 3SJXA 4NGRA 2G9DA 1QQ9A 4ZX8A 3TX8A 3I6SA 4KSIA 1Z5RA 1RTQA 3FX6A 3WT4A 3ISXA 4NGSA 3KR5A 2ANPA 5LRKA 4AXVA 1EE3P 2AFUA 3SJFA 4P44A 1DE4C 2PJ3A 4W9YA 4DYOA 3VARA 3N5FA 2PJCA 3H8EA 4C9VA 2PIYA 4C9UA 3SJGA 5HVFA 1F2PA 2ZEHA 3SI0A 3D7DA 2PE3A 3FF3A 2PJ7A 3PFOA 4EWTA 1ELLP 3KGQA 1DTDA 3D7GA 2ZEDA 3TC8A 2XEGA 2ZEGA 2ZEPA 3KI9A 2PIZA 3FEDA 3K2KA 3IEHA 3I1UA 2PJ2A 3LWUA 3B3VA 1HDQA 3LMSA 3MRUA 4ZY1A 1XFOA 4UIAA 3H8FA 2C6PA 1F57A 4UIBA 3IWWA 1GYTA 3FJUA 4A37A 1ZG7A 2HC9A 3PB8X 2PJ1A 2RB7A 3IJ3A 4OC1A 2IJZA 4R8FA 1BAVA 3GUXA 3KHZA 4MXUA 3VH9A 2PCUA 5JH9A 4C8FA 1ZLHA 4JYWA 2PJ4A 4F8ZA 1XMBA 1IY7A 4C8PA 1HEEA 3KQZA 4PPZA 1BPNA 3B3SA 1Z2LA 3D68A 2PJ0A 3PB9X 1ARLA 4OMEA 4MCRA 4R6TA 3B3CA 1OBRA 4TJXA 2GP4A 1TKHA 5HXDA 2AFXA 4K3NA 3D67A 4MCSA 4PXCA 1FNOA 3RAMA 2VL1A 2ZELA 2CTCA 3KR4A 4PXDA 2O53A 4ZI6A 2Q51A 4R7MA 5HVHA 2RFHA 3CPAA 4P10A 1ZG8A 3L2NA 3SI2A 3NH5A 3ICUA 8CPAA 4CDJA 2ZENA 7CPAA 1V6CA 4MHPA 4FAIA 5ELYA 2ZOFA 4IK2A 2BOAA 4DJLA 4P45A 1HDUA 4MHNA 3BXMA 2WYRA 1VGYA 3DLJA 3B2YA 3CT9A 3PBEA 5CPAA 3IO1A 4IHMA 3WC6A 4NGTA 1VHOA 2V8DA 4MCQA 2ZEEA 1PCAA 2C6CA 1ZLIA 4EFDA 4ZY0A 2PJBA 3VTAA 2Q4ZA 2EK9A 2OR4A 4OC3A 4NGMA 1AYEA 1VIXA 1WVMA 2V8VA 1XJOA 4YU9A 2ZEMA 3CDXA 3HUVA 2C6GA 3PB7X 3B3WA 4P4EA 2AFOA 4C9EA 1ARMA 4LQGA 4TWEA 1ZG9A 3QNVA 2GREA 3PBBA 4TJVA 4R76A 3S9LA 4OC4A 5CBMA 3V38A 3CPXA 3JRUA 4C99A 2AFMA 2GU2A 2I3CA 4NJRA 1LCPA 3FH4A 1YMEA 4A94A 2O4HA 1LANA 4OIWA 4Z65A 6CPAA 5I4MA 3NH4A 3BI0A 4C84A 2NSMA 5IB9A 5LYIA 5LYDA 1XRYA 2QVPA 4MHZA 4C9RA 2PRQA 4MMOA 2XEIA 2JEWA 1Z8LA 2CIJA 4CDKA 5THWA 1Y9ZA 4P4IA 4NJQA 2PJ9A 5HVGA 4H2KA 4X3RA 4NFRA 1Y0RA 4P6YA 4MRIA 4OIDA 4OC2A 3I74A 1TF9A 4UF4A 1LAPA 2J9AA 2FVGA 3VATA 4OP4A 2NYQA 3PFEA 3PEIA 2ZEOA 4B6ZA 4OC0A 3FEEA 1CBXA 2GLJA 4G1PA 2BCOA 1PYTB 4F9VA 2V8GA 3WC5A 1Y0YA 4NGNA 1TXRA 2POKA 2V77A 3S9MA 1AMPA 1R3NA 4FUUA 1KWMA 3IIBA 3V7ZA 1YSJA 3MN8A 4GM5A 4A39A 3SI1A 2CTBA 5DS0A 3PB4X 3WC7A 2C5QA 2F8HA 4PXEA 3RBUA 5LRGA 2OOTA 4UEZA 4KNGE 3K9TA 5LYLA 2IMOA 3PB6X 2EWBA 3KHXA 2PJ6A 1F2OA 3D4UA 2GLFA 4C86A 3GLJA 1BLLE 4IAVA 2XEJA 5IR2A 1VHEA 4X2TA 4DUKA 4JZ0A 3DGVA 5JGFA 3KASA 4ONWA 4PQAA 4EMEA 3ISZA 1H8LA 1CP7A 4NGQA 1LAMA 3NA6A 2QJ8A 4C9AA 5K8OA 1FT7A 3FVLA 4YWYA 2JBKA 1TKJA 2AFZA 1NSAA 5LRJA 1LOKA 1XBUA 1TF8A 1CG2A 5K8PA 2HB6A 4C8UA 2QYVA 4ZY2A 4C8CA 4O23A 5D29A 1TKFA 3B7IA 4UEFA 2JBJA 1R43A 3PRTA 2ZOGA 4ZYQA 3KZWA 3BI1A 2ZEFA 4ZX9A 2PJAA 4YN3A 5J1QA 3D7FA 3B3TA 4X8IA 4BD9A 3S9NA 4C8TA 2PVVA 3B35A 3HLPA 2XEFA 2PVWA 5K8MA 4FBEA 4NGPA 2WZNA 3BHXA 4C8AA 4OKOA 3NFZA 5F09A 2Q43A 3FMCA 3IFEA 1M4LA 1YW4A 3GB0A 1XF1A 5LYFA 2C1CA 1LFWA 3KL9A 2EK8A 4MHYA 4RUHA 3EIFA 2DEAA 2ABZA 2IQ6A 3NH8A 3WABA 3KQXA 3D66A 4C85A 4WWVA 2AFSA 5JM6A 2PJ5A 1JQGA 1UWYA 1YLOA 2CF4A 1CP6A 4CPAA 1Q7LA 3IC1A 4FWUA 4UEEA 4P4DA 1IGBA 1QMUA 4TNUA 3FECA 2F7VA 4Q7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJE A;  1CPX A;  4WJB A;  3D7H A;  1BPM A;  5D8N A;  2PJ8 A;  3T8W A;  4F9U A;  4P4F A;  2AFW A;  1Y7E A;  2V8H A;  3H8G A;  1CX8 A;  4PXB A;  3RZA A;  4MCP A;  1CPS A;  4A38 A;  5K8N A;  1YW6 A;  4P4B A;  4OC5 A;  1ELM P;  2BO9 A;  4P4J A;  3SJX A;  4NGR A;  2G9D A;  1QQ9 A;  4ZX8 A;  3TX8 A;  3I6S A;  4KSI A;  1Z5R A;  1RTQ A;  3FX6 A;  3WT4 A;  3ISX A;  4NGS A;  3KR5 A;  2ANP A;  5LRK A;  4AXV A;  1EE3 P;  2AFU A;  3SJF A;  4P44 A;  1DE4 C;  2PJ3 A;  4W9Y A;  4DYO A;  3VAR A;  3N5F A;  2PJC A;  3H8E A;  4C9V A;  2PIY A;  4C9U A;  3SJG A;  5HVF A;  1F2P A;  2ZEH A;  3SI0 A;  3D7D A;  2PE3 A;  3FF3 A;  2PJ7 A;  3PFO A;  4EWT A;  1ELL P;  3KGQ A;  1DTD A;  3D7G A;  2ZED A;  3TC8 A;  2XEG A;  2ZEG A;  2ZEP A;  3KI9 A;  2PIZ A;  3FED A;  3K2K A;  3IEH A;  3I1U A;  2PJ2 A;  3LWU A;  3B3V A;  1HDQ A;  3LMS A;  3MRU A;  4ZY1 A;  1XFO A;  4UIA A;  3H8F A;  2C6P A;  1F57 A;  4UIB A;  3IWW A;  1GYT A;  3FJU A;  4A37 A;  1ZG7 A;  2HC9 A;  3PB8 X;  2PJ1 A;  2RB7 A;  3IJ3 A;  4OC1 A;  2IJZ A;  4R8F A;  1BAV A;  3GUX A;  3KHZ A;  4MXU A;  3VH9 A;  2PCU A;  5JH9 A;  4C8F A;  1ZLH A;  4JYW A;  2PJ4 A;  4F8Z A;  1XMB A;  1IY7 A;  4C8P A;  1HEE A;  3KQZ A;  4PPZ A;  1BPN A;  3B3S A;  1Z2L A;  3D68 A;  2PJ0 A;  3PB9 X;  1ARL A;  4OME A;  4MCR A;  4R6T A;  3B3C A;  1OBR A;  4TJX A;  1TKH A;  5HXD A;  2AFX A;  4K3N A;  3D67 A;  4MCS A;  4PXC A;  1FNO A;  3RAM A;  2VL1 A;  2ZEL A;  2CTC A;  3KR4 A;  4PXD A;  2O53 A;  4ZI6 A;  2Q51 A;  4R7M A;  5HVH A;  2RFH A;  3CPA A;  4P10 A;  1ZG8 A;  3L2N A;  3SI2 A;  3NH5 A;  3ICU A;  8CPA A;  4CDJ A;  2ZEN A;  7CPA A;  1V6C A;  4MHP A;  4FAI A;  5ELY A;  2ZOF A;  4IK2 A;  2BOA A;  4DJL A;  4P45 A;  1HDU A;  4MHN A;  3BXM A;  2WYR A;  1VGY A;  3DLJ A;  3B2Y A;  3CT9 A;  3PBE A;  5CPA A;  3IO1 A;  4IHM A;  3WC6 A;  4NGT A;  1VHO A;  2V8D A;  4MCQ A;  2ZEE A;  1PCA A;  2C6C A;  1ZLI A;  4EFD A;  4ZY0 A;  2PJB A;  3VTA A;  2Q4Z A;  2EK9 A;  2OR4 A;  4OC3 A;  4NGM A;  1AYE A;  1VIX A;  1WVM A;  2V8V A;  1XJO A;  4YU9 A;  2ZEM A;  3CDX A;  3HUV A;  2C6G A;  3PB7 X;  3B3W A;  4P4E A;  2AFO A;  4C9E A;  1ARM A;  4LQG A;  4TWE A;  1ZG9 A;  3QNV A;  2GRE A;  3PBB A;  4TJV A;  4R76 A;  3S9L A;  4OC4 A;  5CBM A;  3V38 A;  3CPX A;  3JRU A;  4C99 A;  2AFM A;  2GU2 A;  2I3C A;  4NJR A;  1LCP A;  3FH4 A;  1YME A;  4A94 A;  2O4H A;  1LAN A;  4OIW A;  4Z65 A;  6CPA A;  5I4M A;  3NH4 A;  3BI0 A;  4C84 A;  2NSM A;  5IB9 A;  5LYI A;  5LYD A;  1XRY A;  2QVP A;  4MHZ A;  4C9R A;  2PRQ A;  4MMO A;  2XEI A;  2JEW A;  1Z8L A;  2CIJ A;  4CDK A;  5THW A;  1Y9Z A;  4P4I A;  4NJQ A;  2PJ9 A;  5HVG A;  4H2K A;  4X3R A;  4NFR A;  1Y0R A;  4P6Y A;  4MRI A;  4OID A;  4OC2 A;  3I74 A;  1TF9 A;  4UF4 A;  1LAP A;  2J9A A;  2FVG A;  3VAT A;  4OP4 A;  2NYQ A;  3PFE A;  3PEI A;  2ZEO A;  4B6Z A;  4OC0 A;  3FEE A;  1CBX A;  2GLJ A;  4G1P A;  2BCO A;  1PYT B;  4F9V A;  2V8G A;  3WC5 A;  1Y0Y A;  4NGN A;  1TXR A;  2POK A;  2V77 A;  3S9M A;  1AMP A;  1R3N A;  4FUU A;  1KWM A;  3IIB A;  3V7Z A;  1YSJ A;  3MN8 A;  4GM5 A;  4A39 A;  3SI1 A;  2CTB A;  5DS0 A;  3PB4 X;  3WC7 A;  2F8H A;  4PXE A;  3RBU A;  5LRG A;  2OOT A;  4UEZ A;  4KNG E;  3K9T A;  5LYL A;  2IMO A;  3PB6 X;  2EWB A;  3KHX A;  2PJ6 A;  1F2O A;  3D4U A;  2GLF A;  4C86 A;  3GLJ A;  1BLL E;  4IAV A;  2XEJ A;  1VHE A;  4X2T A;  4DUK A;  4JZ0 A;  3DGV A;  5JGF A;  3KAS A;  4ONW A;  4PQA A;  4EME A;  3ISZ A;  1H8L A;  1CP7 A;  4NGQ A;  1LAM A;  3NA6 A;  2QJ8 A;  4C9A A;  5K8O A;  1FT7 A;  3FVL A;  4YWY A;  2JBK A;  1TKJ A;  2AFZ A;  1NSA A;  5LRJ A;  1LOK A;  1XBU A;  1TF8 A;  1CG2 A;  5K8P A;  2HB6 A;  4C8U A;  2QYV A;  4ZY2 A;  4C8C A;  4O23 A;  5D29 A;  1TKF A;  3B7I A;  4UEF A;  2JBJ A;  1R43 A;  3PRT A;  2ZOG A;  4ZYQ A;  3KZW A;  3BI1 A;  2ZEF A;  4ZX9 A;  2PJA A;  4YN3 A;  5J1Q A;  3D7F A;  3B3T A;  4X8I A;  4BD9 A;  3S9N A;  4C8T A;  2PVV A;  3B35 A;  3HLP A;  2XEF A;  2PVW A;  5K8M A;  4FBE A;  4NGP A;  2WZN A;  3BHX A;  4C8A A;  4OKO A;  3NFZ A;  5F09 A;  2Q43 A;  3FMC A;  3IFE A;  1M4L A;  1YW4 A;  3GB0 A;  1XF1 A;  5LYF A;  2C1C A;  1LFW A;  3KL9 A;  2EK8 A;  4MHY A;  4RUH A;  3EIF A;  2DEA A;  2ABZ A;  2IQ6 A;  3NH8 A;  3WAB A;  3KQX A;  3D66 A;  4C85 A;  4WWV A;  2AFS A;  5JM6 A;  2PJ5 A;  1JQG A;  1UWY A;  1YLO A;  2CF4 A;  1CP6 A;  4CPA A;  1Q7L A;  3IC1 A;  4FWU A;  4UEE A;  4P4D A;  1IGB A;  1QMU A;  4TNU A;  3FEC A;  2F7V A;  4Q7A A; 
#chains in the Genus database with same CATH topology
 3SJE A;  1JWQ A;  1CPX A;  4WJB A;  1RO5 A;  5IB0 A;  2AUM A;  3NE7 A;  4NSQ A;  2B0A A;  5F9M A;  4LX9 A;  3D7H A;  1BPM A;  2HUZ A;  5D8N A;  2PJ8 A;  3T8W A;  4F9U A;  5J3X A;  2HQY A;  4P4F A;  3OWC A;  2AFW A;  1Y7E A;  2DF5 A;  2V8H A;  4XPD B;  3H8G A;  4MJ8 A;  2FT0 A;  2NMT A;  2J8M A;  2Z3O A;  1CX8 A;  4YRH A;  1UFH A;  4U9Y A;  3JUW A;  4XNH B;  5IX3 A;  4PXB A;  3NOJ A;  3RZA A;  1YK3 A;  4MCP A;  4NCZ A;  1CPS A;  5HKZ A;  2PRB A;  4MFK A;  3FB3 A;  4A38 A;  2BSW A;  5C82 A;  1YW6 A;  5K8N A;  4MY0 A;  4P4B A;  2Z10 A;  4KOU A;  4OC5 A;  1ELM P;  2BO9 A;  4P4J A;  4A2Z A;  3GKR A;  3SJX A;  4MFL A;  1Z8W A;  3T05 A;  4NGR A;  2G9D A;  1QQ9 A;  2Q4V A;  4NEX A;  1EZB A;  4ZX8 A;  3TX8 A;  3KKW A;  3I6S A;  4KSI A;  1Z5R A;  2C27 A;  2AJ6 A;  2P6E A;  3DR6 A;  1RTQ A;  3FX6 A;  4M6H A;  3WT4 A;  3DNS A;  3N7Z A;  3ISX A;  2GIV A;  4CAW A;  2B4J C;  4NGS A;  3KR5 A;  4KLW A;  4CAE A;  3JVN A;  2ANP A;  3BLN A;  3O8Z A;  2HV2 A;  1YVH A;  3FYN A;  4CS0 B;  4CYO A;  5LRK A;  4AXV A;  1EE3 P;  2AFU A;  3SJF A;  4KSF A;  3TCV A;  2QEC A;  1Z4R A;  3EY5 A;  4ZGY B;  4P44 A;  4X5K A;  4CYP A;  2P6F A;  3RO0 A;  2XPN A;  1AUG A;  4BIN A;  1DE4 C;  2PJ3 A;  4W9Y A;  4DYO A;  4MJX A;  3VAR A;  3N5F A;  2PJC A;  3H8E A;  1R57 A;  4C9V A;  2PIY A;  2YGW A;  2Z0Z A;  3D3S A;  3GY9 A;  4II9 A;  3SJG A;  4C9U A;  3SXO A;  1IYK A;  3S6G A;  2PQ8 A;  1F2P A;  5HVF A;  2JLM A;  2ZEH A;  3SI0 A;  4J3G A;  5F48 A;  3D7D A;  1FBV A;  1YVO A;  2PE3 A;  3FF3 A;  3W6X A;  2PJ7 A;  3PFO A;  4EWT A;  4UCN A;  1ELL P;  3KGQ A;  1DTD A;  3D7G A;  4E94 A;  4KVX A;  1QST A;  2ZED A;  1M1D A;  2XEG A;  2ZEG A;  3TC8 A;  4NXY A;  2EBJ A;  4C2Z A;  3T07 A;  3BUN B;  2ZEP A;  2PIZ A;  3GYA A;  3KI9 A;  3FED A;  3K2K A;  3IEH A;  3I1U A;  2PJ2 A;  5JQ4 A;  3LWU A;  3GJZ A;  3B3V A;  1HDQ A;  3LMS A;  3MRU A;  4ZY1 A;  1XFO A;  5KTA A;  4CZ1 A;  4UIA A;  4IUS A;  3H8F A;  2C6P A;  2UV8 G;  4MBU A;  1EZA A;  4FD4 A;  4MI1 A;  1F57 A;  4UIB A;  3IWW A;  1GYT A;  4RI1 A;  3FXT A;  1PU9 A;  1VKC A;  2FL4 A;  3FJU A;  3BUX B;  1ZL0 A;  4A37 A;  3R9F A;  1ZG7 A;  5EMI A;  4CGL A;  2HC9 A;  3PB8 X;  4PSW A;  2EZB A;  2D4O A;  5ISV A;  3TLG A;  2YND A;  2PJ1 A;  2R7H A;  5J8C A;  2RB7 A;  3IJ3 A;  1YX0 A;  4MFQ A;  4OC1 A;  1L0C A;  1S60 A;  2IJZ A;  1BAV A;  2OB0 A;  3EXN A;  4R8F A;  3QB8 A;  3GUX A;  3TO7 A;  1IYL A;  3KHZ A;  4KUB A;  2KCW A;  4MXU A;  3NFQ A;  4NF1 A;  5F49 A;  2PCU A;  3F8K A;  3VH9 A;  2RC4 A;  2IL4 A;  1OZP A;  2F5I A;  1ZLH A;  4AG7 A;  5JH9 A;  3QAH A;  4C8F A;  4JYW A;  2PJ4 A;  2D0O A;  4F8Z A;  4QC6 A;  2ZW7 A;  4BMH A;  1XMB A;  1IY7 A;  2X7B A;  3OB2 B;  4DNC A;  1HEE A;  3H5Z A;  4C8P A;  2YJT A;  3FNC A;  1XIX A;  1WJT A;  2Z3N A;  4R87 A;  3KQZ A;  4R3K A;  4PPZ A;  1BPN A;  3B3S A;  1Z2L A;  3D68 A;  3U88 C;  2PJ0 A;  2VXK A;  3PB9 X;  2P0W A;  1Q2D A;  1ARL A;  4OME A;  4MCR A;  3TLY A;  2D0P A;  5A27 A;  3D2M A;  2PR8 A;  2X0S A;  4R6T A;  3B3C A;  1OBR A;  4TJX A;  3JTK A;  1YRE A;  2B4D A;  3EC4 A;  2GP4 A;  1P4N A;  2Y1M A;  1TKH A;  1WK4 A;  5HXD A;  4RR2 B;  2AFX A;  4B11 A;  2R98 A;  3A9L A;  4K3N A;  3SXN A;  3D67 A;  2XPO A;  3C26 A;  4MCS A;  4PXC A;  1Q5X A;  1FNO A;  3RAM A;  4M6I A;  4IF5 A;  2VL1 A;  3CXS A;  3R96 A;  2ZEL A;  4J0N A;  2CTC A;  3KR4 A;  3CXP A;  4PXD A;  4COB A;  2O53 A;  4ZI6 A;  5EBV A;  2Q51 A;  2B58 A;  4H6Z A;  4R7M A;  5HVH A;  2B3V A;  2RFH A;  5HMN A;  3CPA A;  3EFA A;  4P10 A;  3PLF B;  4UCP A;  1ZG8 A;  3L2N A;  4R57 A;  3SI2 A;  1BOB A;  1NE9 A;  2H5M A;  3NH5 A;  1YVK A;  2PDO A;  3TOB A;  8CPA A;  3ICU A;  4CDJ A;  5BY0 A;  2ZEN A;  1Q2Y A;  2VI7 A;  3LD2 A;  5GCN A;  2GAN A;  1Y9W A;  3VWE A;  7CPA A;  2HI6 A;  1KC7 A;  4AVB A;  1V6C A;  4MHP A;  4FAI A;  3TO6 A;  4KSA A;  5ELY A;  1KUY A;  4EVY A;  2ZOF A;  4IK2 A;  4BPW B;  2BOA A;  4DJL A;  4P45 A;  1HDU A;  4MHD A;  3R9G A;  5FVJ A;  4MHN A;  2MP0 A;  4B10 A;  3DR8 A;  2FXF A;  3BUO B;  3BXM A;  1KZF A;  2DPS A;  2WYR A;  2P6G A;  1VGY A;  3DLJ A;  4JLY A;  4Q38 A;  3TOA A;  3B2Y A;  3CT9 A;  3PBE A;  4MI4 A;  5CPA A;  4EYS A;  5JYB A;  3IO1 A;  3OB1 B;  4KLV A;  4IHM A;  3WC6 A;  4NGT A;  3PGP A;  5HKY A;  4OAE A;  2XPP A;  2Q0Y A;  3TFY A;  1BXR B;  1VHO A;  4LUA A;  3ZJ0 A;  2I79 A;  2V8D A;  4MCQ A;  1IOF A;  1S7F A;  2CBL A;  2I00 A;  4COG A;  2ZEE A;  1PCA A;  4R3L A;  2C6C A;  1XF8 A;  1ZLI A;  2CY2 A;  3G8W A;  4AB7 A;  1RXT A;  1S5K A;  1ZRS A;  4EFD A;  3PT1 A;  3VRP A;  4M3S A;  4ZY0 A;  2HRO A;  2PJB A;  3VTA A;  4Y49 C;  1M4I A;  2Q4Z A;  5H86 A;  5KTC A;  4H1H A;  2EK9 A;  2OR4 A;  4OC3 A;  3T0T A;  2B5G A;  3H4Q A;  4NGM A;  1AYE A;  1IID A;  1VIX A;  2PSW A;  1WVM A;  5F1Y A;  3U1B A;  5H84 A;  1NBW A;  3TLG B;  2V8V A;  4KOS A;  1XJO A;  2ZW5 A;  3PFV A;  4YU9 A;  2ZEM A;  3CDX A;  3HUV A;  2C6G A;  2OZG A;  4M6G A;  4BTF A;  5JVL A;  3R95 A;  2WPX A;  4GPL B;  3PB7 X;  3ZZI A;  4AVC A;  3B3W A;  4B12 A;  4P4E A;  2AFO A;  2EZA A;  1ARM A;  1CJW A;  4LQG A;  4C9E A;  4CO9 A;  4TWE A;  4KOW A;  1ZG9 A;  1QSN A;  1ZO0 A;  3QNV A;  4F6A A;  4KZT A;  3C8O A;  2GRE A;  4BPU B;  3TLB A;  4UFV A;  3PBB A;  4TJV A;  1M44 A;  1TIQ A;  3S9L A;  3E0K A;  2D4P A;  4OC4 A;  1Z9E A;  4HNY B;  4R76 A;  4E8O A;  5CBM A;  2CNT A;  2PC1 A;  3V38 A;  3CPX A;  3P2H A;  2VQY A;  3JRU A;  1VBH A;  4C99 A;  4CYQ A;  2AFM A;  1FY7 A;  2GU2 A;  2R8V A;  2I3C A;  4NJR A;  1XE4 A;  4UFW A;  1LCP A;  4CGN A;  3FH4 A;  1YME A;  3ZNI A;  5EC4 A;  5G1Z A;  4A94 A;  1S7N A;  2XPL A;  3EZE A;  3TLZ A;  1MJA A;  2Q7B A;  1YGH A;  2O4H A;  2Q4Y A;  2Z11 A;  2Z3L A;  1LAN A;  4OIW A;  5AG6 A;  4Z65 A;  6CPA A;  5I4M A;  2B4D B;  3NH4 A;  4OLL A;  1QSM A;  4Q7A A;  2AE6 A;  5JPH A;  3BI0 A;  1MJB A;  2NSM A;  3I3G A;  4C84 A;  1C3O B;  5IB9 A;  5LYI A;  3FIX A;  4FD6 A;  2YJV A;  5LYD A;  3K4I A;  3SR3 A;  3VRQ A;  1XRY A;  1X10 A;  1Y7R A;  3IU2 A;  2B4B A;  5F5X A;  2QVP A;  3VRO A;  4MHZ A;  2VZZ A;  4C9R A;  2PRQ A;  2JEV A;  4MMO A;  2XEI A;  5E96 A;  2JEW A;  3V8I A;  1Z8L A;  1I21 A;  2CXA A;  2Q04 A;  4H6U A;  5IV0 A;  2CIJ A;  4PK2 A;  4CDK A;  5THW A;  2FIW A;  1Y9Z A;  4P4I A;  2DPT A;  4KS9 A;  4NJQ A;  2PJ9 A;  3K9U A;  5HVG A;  4H2K A;  2VBQ A;  5HH1 A;  4X3R A;  4NFR A;  1Y0R A;  3UY5 A;  1MK4 A;  4P6Y A;  1B87 A;  4AVA A;  4C2Y A;  2DXQ A;  2REF A;  3LOD A;  4MRI A;  1T36 B;  4MFP A;  3IGR A;  2PR1 A;  1K4J A;  4OID A;  4C68 A;  3BJ7 A;  4OC2 A;  1S3Z A;  1SQH A;  3D8P A;  4K30 A;  4KOY A;  4U5Y A;  3I74 A;  1KUX A;  1TF9 A;  2DIK A;  4UF4 A;  2GE3 A;  1LAP A;  2J9A A;  2FVG A;  4UCM A;  3R1K A;  4UWJ A;  1B47 A;  3NE8 A;  4OP4 A;  4ONU A;  2VZY A;  3VAT A;  2NYQ A;  5AGE A;  4I49 A;  3TE4 A;  3PFE A;  3PEI A;  3IWE A;  2ZEO A;  4KOT A;  3TLC A;  4B6Z A;  1YLE A;  2FE7 A;  4OC0 A;  3B8G A;  3FEE A;  5A28 A;  1CBX A;  2GLJ A;  2WUU A;  4G1P A;  5G20 A;  2BCO A;  4KVO E;  1PYT B;  3EO4 A;  4F9V A;  1Q2C A;  3W91 A;  2V8G A;  5AG7 A;  4MFJ A;  3WC5 A;  1Y0Y A;  2FCK A;  4B5P A;  4CGO A;  4NGN A;  1TXR A;  2POK A;  2YNC C;  2E28 A;  1VI4 A;  2EZC A;  1XOV A;  5F13 A;  2V77 A;  1V0C A;  3I9S A;  3S9M A;  1AMP A;  1R3N A;  4CAX A;  4XPK A;  2G3T A;  2EVN A;  1IU8 A;  4FUU A;  1KWM A;  1NSL A;  1GGO A;  1JDB C;  3IIB A;  3V7Z A;  1YSJ A;  3MN8 A;  4GM5 A;  4A39 A;  3SI1 A;  2CTB A;  4A31 A;  2YNC A;  4A4C A;  5DS0 A;  1MJ9 A;  1EO0 A;  3PB4 X;  1YQE A;  4L8A A;  3WC7 A;  2C5Q A;  2F8H A;  2J8N A;  4PXE A;  3RBU A;  5LRG A;  1B6B A;  4RS2 A;  2B5G B;  4YGO A;  4ORF A;  2N3A B;  2OOT A;  2Q7S A;  4UEZ A;  3R9E A;  4KNG E;  4C2X A;  3K9T A;  5LYL A;  5F47 A;  2IMO A;  4BBH A;  4HPS A;  3PB6 X;  5I0C A;  2EWB A;  3KHX A;  2PJ6 A;  4B13 A;  1A9X B;  1M6V B;  1ZYM A;  4Y49 B;  3S6F A;  3HPG G;  1R61 A;  1F2O A;  3D4U A;  5C88 A;  2OLS A;  3IU1 A;  2GLF A;  4C86 A;  4KOX A;  5DWN A;  3GLJ A;  1BLL E;  4PV6 A;  4IAV A;  2XEJ A;  4RN7 A;  1Y9K A;  4E2A A;  2ARH A;  5IR2 A;  4KOV A;  3KRV A;  1PUA A;  1VHE A;  4HKF A;  1J4J A;  4X2T A;  4XPD C;  4A33 A;  4CRZ B;  1NXJ A;  1GHE A;  1N71 A;  4JZ0 A;  4DUK A;  1LRZ A;  2BL1 A;  2FM4 A;  3DGV A;  1Z4E A;  4XNH C;  3RNZ A;  3KAS A;  1QSR A;  2ATR A;  4HNX B;  4ONW A;  3TO9 A;  5JGF A;  3BUM B;  3PP9 A;  4MFZ A;  4PQA A;  3HMJ G;  2JDC A;  3ISZ A;  4EME A;  1H8L A;  1IIC A;  2Z3K A;  1ON0 A;  4JWP A;  1CP7 A;  3VRR A;  4NGQ A;  4Q36 A;  3DSB A;  1U6M A;  4M8D A;  1LAM A;  4B5O A;  4A32 A;  3PZJ A;  1CE8 B;  3NA6 A;  2QJ8 A;  4C9A A;  5K8O A;  1FT7 A;  1J3L A;  4GS4 A;  3FRM A;  3FVL A;  4YWY A;  2JBK A;  1S7L A;  1Z8X A;  4PSX A;  2FSR A;  4R9M A;  3VWD A;  1TKJ A;  3OAK A;  2AFZ A;  2Z3P A;  1NSA A;  5LRJ A;  1LOK A;  1XBU A;  1TF8 A;  2R1I A;  3OP0 A;  3BJ8 A;  4UWI A;  4QVT A;  1CG2 A;  2Y0M A;  4A4B A;  1CS0 B;  4M85 A;  2GFQ A;  2HB6 A;  4UFX A;  5K8P A;  4C8U A;  2QYV A;  4B14 A;  4E0A A;  3F9K C;  1Z9U A;  2PCN A;  3HPH E;  4H89 A;  1I1D A;  4L89 A;  4ZY2 A;  4C8C A;  3LAC A;  2QIR A;  4O23 A;  5D29 A;  4U9Z A;  4F0Y A;  1TKF A;  3B7I A;  4UEF A;  4UA3 A;  2AUN A;  1C30 B;  2JBJ A;  4F0X A;  1BO4 A;  3MGD A;  3CXQ A;  4HNW B;  1R43 A;  4QUS A;  2R82 A;  3G23 A;  3PRT A;  2ZOG A;  4AG9 A;  4ZYQ A;  4INJ A;  2DLA A;  2EUI A;  3F0A A;  3BI1 A;  3KZW A;  3VGO A;  4C7H A;  2ZEF A;  1WWZ A;  1XEB A;  1KBL A;  4KUA A;  4ZX9 A;  2Q44 A;  2PJA A;  4IIY A;  4YN3 A;  2JDD A;  5J1Q A;  4QB9 A;  3D7F A;  5BWA B;  1CM0 A;  2ODF A;  3B3T A;  4X8I A;  4A95 A;  4CAV A;  4BD9 A;  3IWG A;  2ZW4 A;  2O28 A;  2CNM A;  2K5T A;  5KTD A;  4CYN A;  4CGP A;  3WR7 A;  3S9N A;  2J8R A;  4FD5 A;  3VRN A;  3DDD A;  5K99 A;  4C8T A;  2OU2 A;  2A4N A;  1M4G A;  2PVV A;  2VEZ A;  3TLA A;  3TYX A;  3B35 A;  3HLP A;  3TTH A;  3F5B A;  3W6S A;  4CAF A;  2FS5 A;  4UBR A;  2XEF A;  4QBJ A;  4YFJ A;  3T90 A;  3CZX A;  2OH1 A;  4B5P B;  3SHP A;  2Y1N A;  2BUE A;  2WPW A;  2PVW A;  5AG5 A;  2REE A;  5AG4 A;  1I12 A;  3TT2 A;  3EZB A;  5K8M A;  5AXI A;  4OAD A;  1XMT A;  4FBE A;  4NGP A;  2WZN A;  3BHX A;  4GXH A;  3RYO A;  4CRY B;  4C8A A;  2FIA A;  2VKZ G;  4E5S A;  4OKO A;  2B3U A;  3NFZ A;  4JXR A;  5F09 A;  5CNP A;  2EO8 A;  2Q43 A;  4KVM E;  5HKW A;  3FMC A;  3IFE A;  1QSO A;  1YR0 A;  2YNE A;  3EZA A;  1M4L A;  2QML A;  1YW4 A;  3GB0 A;  3S6H A;  4LQ6 A;  4FD7 A;  3T9Y A;  1NMT A;  1IB1 E;  1XF1 A;  5LYF A;  3BUW B;  4BPX B;  2C1C A;  4MY3 A;  2G0B A;  1LFW A;  3KL9 A;  5FD8 A;  1VBG A;  3T5M A;  2EK8 A;  4MHY A;  2ZXV A;  3FBU A;  4RUH A;  1KUV A;  2ZW6 A;  2DEA A;  2ABZ A;  2IQ6 A;  3NH8 A;  3WAB A;  1DIK A;  2HWG A;  3EIF A;  4JVO A;  3TLE A;  5F46 A;  3KQX A;  3QAY A;  3D2P A;  3D66 A;  2CNS A;  4C85 A;  1S7K A;  4WWV A;  2ZPA A;  2AFS A;  5JM6 A;  2WSA A;  2PJ5 A;  1JQG A;  1UWY A;  4ZBG A;  5J8F A;  3G3S A;  1YLO A;  2CF4 A;  1CP6 A;  2BEI A;  1Q7L A;  2OZH A;  3IC1 A;  4CPA A;  4A30 A;  2G3A A;  4FWU A;  4CGM A;  1X12 A;  1IOI A;  4PK3 A;  5G22 A;  4C7I A;  2OZU A;  3GIU A;  4P4D A;  4UEE A;  1IGB A;  1Z8T A;  1QMU A;  1VHS A;  1P0H A;  5G21 A;  4JJX A;  4JD6 A;  1M4D A;  4TNU A;  4KOR A;  4JXQ A;  2Z3M A;  5DWM A;  4XPL A;  3S6K A;  4IIX A;  1KEE B;  3FEC A;  3P2F A;  2F7V A;  1A2Z A;  1JDE A; 
#chains in the Genus database with same CATH homology
 3SJE A;  1CPX A;  4WJB A;  3D7H A;  1BPM A;  5D8N A;  2PJ8 A;  3T8W A;  4F9U A;  4P4F A;  2AFW A;  1Y7E A;  2V8H A;  3H8G A;  1CX8 A;  4PXB A;  3RZA A;  4MCP A;  1CPS A;  4A38 A;  5K8N A;  1YW6 A;  4P4B A;  4OC5 A;  1ELM P;  2BO9 A;  4P4J A;  3SJX A;  4NGR A;  2G9D A;  1QQ9 A;  4ZX8 A;  3TX8 A;  3I6S A;  4KSI A;  1Z5R A;  1RTQ A;  3FX6 A;  3WT4 A;  3ISX A;  4NGS A;  3KR5 A;  2ANP A;  5LRK A;  4AXV A;  1EE3 P;  2AFU A;  3SJF A;  4P44 A;  1DE4 C;  2PJ3 A;  4W9Y A;  4DYO A;  3VAR A;  3N5F A;  2PJC A;  3H8E A;  4C9V A;  2PIY A;  4C9U A;  3SJG A;  5HVF A;  1F2P A;  2ZEH A;  3SI0 A;  3D7D A;  2PE3 A;  3FF3 A;  2PJ7 A;  3PFO A;  4EWT A;  1ELL P;  3KGQ A;  1DTD A;  3D7G A;  2ZED A;  3TC8 A;  2XEG A;  2ZEG A;  2ZEP A;  3KI9 A;  2PIZ A;  3FED A;  3K2K A;  3IEH A;  3I1U A;  2PJ2 A;  3LWU A;  3B3V A;  1HDQ A;  3LMS A;  3MRU A;  4ZY1 A;  1XFO A;  4UIA A;  3H8F A;  2C6P A;  1F57 A;  4UIB A;  3IWW A;  1GYT A;  3FJU A;  4A37 A;  1ZG7 A;  2HC9 A;  3PB8 X;  2PJ1 A;  2RB7 A;  3IJ3 A;  4OC1 A;  2IJZ A;  4R8F A;  1BAV A;  3GUX A;  3KHZ A;  4MXU A;  3VH9 A;  2PCU A;  5JH9 A;  4C8F A;  1ZLH A;  4JYW A;  2PJ4 A;  4F8Z A;  1XMB A;  1IY7 A;  4C8P A;  1HEE A;  3KQZ A;  4PPZ A;  1BPN A;  3B3S A;  1Z2L A;  3D68 A;  2PJ0 A;  3PB9 X;  1ARL A;  4OME A;  4MCR A;  4R6T A;  3B3C A;  1OBR A;  4TJX A;  2GP4 A;  1TKH A;  5HXD A;  2AFX A;  4K3N A;  3D67 A;  4MCS A;  4PXC A;  1FNO A;  3RAM A;  2VL1 A;  2ZEL A;  2CTC A;  3KR4 A;  4PXD A;  2O53 A;  4ZI6 A;  2Q51 A;  4R7M A;  5HVH A;  2RFH A;  3CPA A;  4P10 A;  1ZG8 A;  3L2N A;  3SI2 A;  3NH5 A;  3ICU A;  8CPA A;  4CDJ A;  2ZEN A;  7CPA A;  1V6C A;  4MHP A;  4FAI A;  5ELY A;  2ZOF A;  4IK2 A;  2BOA A;  4DJL A;  4P45 A;  1HDU A;  4MHN A;  3BXM A;  2WYR A;  1VGY A;  3DLJ A;  3B2Y A;  3CT9 A;  3PBE A;  5CPA A;  3IO1 A;  4IHM A;  3WC6 A;  4NGT A;  1VHO A;  2V8D A;  4MCQ A;  2ZEE A;  1PCA A;  2C6C A;  1ZLI A;  4EFD A;  4ZY0 A;  2PJB A;  3VTA A;  2Q4Z A;  2EK9 A;  2OR4 A;  4OC3 A;  4NGM A;  1AYE A;  1VIX A;  1WVM A;  2V8V A;  1XJO A;  4YU9 A;  2ZEM A;  3CDX A;  3HUV A;  2C6G A;  3PB7 X;  3B3W A;  4P4E A;  2AFO A;  4C9E A;  1ARM A;  4LQG A;  4TWE A;  1ZG9 A;  3QNV A;  2GRE A;  3PBB A;  4TJV A;  4R76 A;  3S9L A;  4OC4 A;  5CBM A;  3V38 A;  3CPX A;  3JRU A;  4C99 A;  2AFM A;  2GU2 A;  2I3C A;  4NJR A;  1LCP A;  3FH4 A;  1YME A;  4A94 A;  2O4H A;  1LAN A;  4OIW A;  4Z65 A;  6CPA A;  5I4M A;  3NH4 A;  3BI0 A;  4C84 A;  2NSM A;  5IB9 A;  5LYI A;  5LYD A;  1XRY A;  2QVP A;  4MHZ A;  4C9R A;  2PRQ A;  4MMO A;  2XEI A;  2JEW A;  1Z8L A;  2CIJ A;  4CDK A;  5THW A;  1Y9Z A;  4P4I A;  4NJQ A;  2PJ9 A;  5HVG A;  4H2K A;  4X3R A;  4NFR A;  1Y0R A;  4P6Y A;  4MRI A;  4OID A;  4OC2 A;  3I74 A;  1TF9 A;  4UF4 A;  1LAP A;  2J9A A;  2FVG A;  3VAT A;  4OP4 A;  2NYQ A;  3PFE A;  3PEI A;  2ZEO A;  4B6Z A;  4OC0 A;  3FEE A;  1CBX A;  2GLJ A;  4G1P A;  2BCO A;  1PYT B;  4F9V A;  2V8G A;  3WC5 A;  1Y0Y A;  4NGN A;  1TXR A;  2POK A;  2V77 A;  3S9M A;  1AMP A;  1R3N A;  4FUU A;  1KWM A;  3IIB A;  3V7Z A;  1YSJ A;  3MN8 A;  4GM5 A;  4A39 A;  3SI1 A;  2CTB A;  5DS0 A;  3PB4 X;  3WC7 A;  2C5Q A;  2F8H A;  4PXE A;  3RBU A;  5LRG A;  2OOT A;  4UEZ A;  4KNG E;  3K9T A;  5LYL A;  2IMO A;  3PB6 X;  2EWB A;  3KHX A;  2PJ6 A;  1F2O A;  3D4U A;  2GLF A;  4C86 A;  3GLJ A;  1BLL E;  4IAV A;  2XEJ A;  5IR2 A;  1VHE A;  4X2T A;  4DUK A;  4JZ0 A;  3DGV A;  5JGF A;  3KAS A;  4ONW A;  4PQA A;  4EME A;  3ISZ A;  1H8L A;  1CP7 A;  4NGQ A;  1LAM A;  3NA6 A;  2QJ8 A;  4C9A A;  5K8O A;  1FT7 A;  3FVL A;  4YWY A;  2JBK A;  1TKJ A;  2AFZ A;  1NSA A;  5LRJ A;  1LOK A;  1XBU A;  1TF8 A;  1CG2 A;  5K8P A;  2HB6 A;  4C8U A;  2QYV A;  4ZY2 A;  4C8C A;  4O23 A;  5D29 A;  1TKF A;  3B7I A;  4UEF A;  2JBJ A;  1R43 A;  3PRT A;  2ZOG A;  4ZYQ A;  3KZW A;  3BI1 A;  2ZEF A;  4ZX9 A;  2PJA A;  4YN3 A;  5J1Q A;  3D7F A;  3B3T A;  4X8I A;  4BD9 A;  3S9N A;  4C8T A;  2PVV A;  3B35 A;  3HLP A;  2XEF A;  2PVW A;  5K8M A;  4FBE A;  4NGP A;  2WZN A;  3BHX A;  4C8A A;  4OKO A;  3NFZ A;  5F09 A;  2Q43 A;  3FMC A;  3IFE A;  1M4L A;  1YW4 A;  3GB0 A;  1XF1 A;  5LYF A;  2C1C A;  1LFW A;  3KL9 A;  2EK8 A;  4MHY A;  4RUH A;  3EIF A;  2DEA A;  2ABZ A;  2IQ6 A;  3NH8 A;  3WAB A;  3KQX A;  3D66 A;  4C85 A;  4WWV A;  2AFS A;  5JM6 A;  2PJ5 A;  1JQG A;  1UWY A;  1YLO A;  2CF4 A;  1CP6 A;  4CPA A;  1Q7L A;  3IC1 A;  4FWU A;  4UEE A;  4P4D A;  1IGB A;  1QMU A;  4TNU A;  3FEC A;  2F7V A;  4Q7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...