3SJEA

X-ray structure of human glutamate carboxypeptidase ii (the e424a inactive mutant) in complex with n-acetyl-aspartyl-aminononanoic acid
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
690
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 265
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjeA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjeA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjeA02
2AFXA 4NFRA 4X3RA 4UIBA 2ZEGA 5D8NA 2Q51A 8CPAA 5I4MA 4ZY1A 5LRKA 3FF3A 3NH4A 2F7VA 2EK9A 4FAIA 1Q7LA 2PJBA 2NSMA 4C8CA 1EE3P 3FH4A 3FJUA 4GM5A 2O53A 4F9VA 4YN3A 1Y9ZA 1YLOA 4C9RA 1LANA 3B35A 3GB0A 5CBMA 4TJXA 4JZ0A 2BCOA 3PFEA 4ZY2A 3BI0A 1TKHA 1FT7A 4EFDA 3KR5A 4MCPA 4PQAA 3HUVA 4NGSA 1VHOA 3DLJA 1CBXA 1TKJA 2GU2A 4Q7AA 2C6CA 2PJ7A 2WZNA 4UEZA 2PCUA 2GREA 3IIBA 3HLPA 3IC1A 2XEGA 2AFOA 3LMSA 2V77A 1UWYA 2C6PA 3K9TA 1BLLE 2I3CA 3TC8A 5LYLA 5ELYA 4BD9A 2V8VA 3VARA 3WABA 3WC6A 4C9UA 3SJFA 2C1CA 4C8FA 5D29A 3B3WA 5JM6A 3KQXA 5J1QA 4NGTA 1HDQA 2EWBA 1Y7EA 4ZY0A 1ZG8A 1M4LA 1F2OA 3K2KA 2JBKA 4TWEA 4AXVA 1LCPA 4MHNA 4P10A 3H8EA 3RZAA 1LAPA 4PXCA 5LRGA 1XJOA 3LWUA 3SJXA 2C6GA 2ZELA 1CG2A 4P4JA 4P4FA 1TF9A 1RTQA 1XFOA 3ISXA 1YW4A 1LFWA 3D7HA 2HB6A 2PE3A 4NGMA 2POKA 3VATA 4DYOA 3CPXA 4PXEA 1KWMA 5DS0A 3KHZA 4MHYA 3I1UA 3PB7X 3SJGA 4WJBA 3WT4A 3B7IA 4ZX9A 1TKFA 2PJ6A 2EK8A 4TJVA 1NSAA 1XF1A 1ELLP 2DEAA 3D67A 1CX8A 4MCQA 1ARMA 4MCSA 4W9YA 2PJAA 4OIDA 6CPAA 4C8PA 3T8WA 1PYTB 2HC9A 3SI0A 1AYEA 4C8TA 2WYRA 4X2TA 2QJ8A 3FEDA 3H8GA 1F57A 3H8FA 3MRUA 2G9DA 1OBRA 2PJCA 3B3SA 3PB6X 3BXMA 3V38A 4KSIA 2J9AA 1Y0YA 4DUKA 2XEFA 1R43A 4FUUA 4TNUA 1ZG9A 3B2YA 3D4UA 5K8NA 5CPAA 1Y0RA 2FVGA 2ZEDA 3PB4X 4DJLA 4P4BA 3RBUA 4CDKA 3PFOA 2ZEOA 2OOTA 3B3VA 4MXUA 4R76A 2BOAA 4PPZA 1VIXA 3NH5A 1V6CA 1YW6A 2ZEFA 3KHXA 1BAVA 4K3NA 2XEJA 2V8GA 1CPSA 4F9UA 4O23A 2ABZA 1XRYA 3TX8A 4G1PA 3VTAA 1Z2LA 2AFUA 4IAVA 4P6YA 3RAMA 1QMUA 5K8MA 2IJZA 4X8IA 4R8FA 1ARLA 1CP6A 4C9EA 1LOKA 4H2KA 3SI2A 2CF4A 2PJ4A 4C99A 1F2PA 3S9NA 3B3TA 3PBBA 2V8DA 4Z65A 5K8PA 4ZYQA 1ZLIA 5LYIA 2PRQA 3WC7A 1CP7A 4UIAA 2PJ5A 3GUXA 4P44A 4R7MA 3CPAA 2ZEHA 1ZG7A 3KASA 1ELMP 3KGQA 3IFEA 3JRUA 5HVFA 2PJ1A 1H8LA 4F8ZA 4P45A 1Z5RA 3IWWA 3ICUA 2PJ3A 3KL9A 4OMEA 2NYQA 1LAMA 2BO9A 2JBJA 4C8UA 3FVLA 3CDXA 4IK2A 3D7FA 1BPMA 4EMEA 4WWVA 4C86A 2GLFA 4PXDA 4LQGA 4NJRA 4A38A 5THWA 3PEIA 2Q4ZA 4IHMA 4EWTA 3CT9A 4A39A 3FEEA 4JYWA 5LYFA 2ZOGA 2CTCA 1XMBA 4OC0A 5HVGA 2Q43A 3BHXA 3MN8A 4MHZA 4PXBA 5HXDA 1TF8A 4OC4A 1HEEA 4NGRA 4ONWA 4NGQA 2JEWA 5HVHA 2AFMA 3PRTA 5K8OA 3I74A 4P4EA 4C85A 3ISZA 1AMPA 1VHEA 1HDUA 1PCAA 1YMEA 4OC1A 4OC2A 2ZEMA 4P4IA 2ZEEA 4OKOA 2PIYA 2OR4A 5F09A 3B3CA 4OP4A 4MMOA 2PJ0A 3KQZA 3SI1A 2IQ6A 1CPXA 3D7GA 3SJEA 4FBEA 4UEFA 2QYVA 4NGNA 2ANPA 3PB9X 5JH9A 4CPAA 2VL1A 3DGVA 1DE4C 3NA6A 4C84A 2RFHA 1ZLHA 4P4DA 2ZOFA 1WVMA 4FWUA 1VGYA 1R3NA 3NFZA 3BI1A 2PVWA 3L2NA 1JQGA 2O4HA 4NGPA 4A94A 3PBEA 4RUHA 1YSJA 2PJ9A 3PB8X 3KI9A 4C9VA 2PVVA 4OC3A 4NJQA 4C9AA 1GYTA 4MRIA 2RB7A 2V8HA 3D68A 4R6TA 2AFSA 2GLJA 4OIWA 3KR4A 5IB9A 3IJ3A 2CIJA 4ZI6A 2F8HA 3GLJA 3KZWA 4YWYA 2ZEPA 4ZX8A 3IO1A 4UEEA 2AFWA 1BPNA 4B6ZA 2AFZA 3D7DA 1Z8LA 3FX6A 2PJ2A 3FMCA 4UF4A 3V7ZA 2QVPA 3S9MA 1FNOA 1DTDA 4C8AA 2XEIA 2IMOA 3I6SA 5LYDA 4MCRA 2CTBA 3IEHA 3EIFA 4A37A 3S9LA 4CDJA 3QNVA 2PIZA 1XBUA 5LRJA 3VH9A 4MHPA 4OC5A 1IGBA 3D66A 3FECA 1IY7A 4YU9A 1QQ9A 3NH8A 2ZENA 3WC5A 4KNGE 1TXRA 2PJ8A 3N5FA 7CPAA 5JGFA
chains in the Genus database with same CATH superfamily
1Y7RA 2AFXA 4NFRA 4NXYA 4X3RA 4QBJA 3D2MA 2ZEGA 4UIBA 3TLCA 5D8NA 2Q51A 8CPAA 5I4MA 4ZY1A 1KUVA 1IOFA 5LRKA 1I12A 3FF3A 4MFLA 1B87A 1BO4A 4MFQA 3NH4A 4EVYA 4M6HA 2F7VA 2J8MA 2ZW5A 4Y49C 2EK9A 4FAIA 4U5YA 1Q7LA 2GANA 5C82A 1YREA 1IYLA 4KVOE 2PJBA 3C26A 2YNDA 1ZL0A 2NSMA 4C8CA 2VI7A 1RO5A 3R96A 5F9MA 4KSAA 1EE3P 3FH4A 4GPLB 2DF5A 3FJUA 3CXSA 4GM5A 4M3SA 4UCMA 4CAEA 3BJ8A 2O53A 2Z3NA 1FBVA 4CAXA 2REFA 1KEEB 4F9VA 4BBHA 4YN3A 4KSFA 1Y9ZA 5K99A 1YLOA 4KVXA 4C9RA 1LANA 1IB1E 2ZXVA 3B35A 3GB0A 4M85A 4OADA 5CBMA 1XF8A 4TJXA 4JZ0A 2BCOA 4F6AA 4J3GA 2E28A 3PFEA 4ZY2A 3RO0A 1BXRB 1CS0B 3BI0A 1TKHA 2G3AA 3RYOA 2FS5A 1FT7A 2K5TA 4EFDA 2XPPA 3KR5A 2EZBA 4MCPA 3TLZA 4PQAA 3HUVA 3VRQA 3SR3A 4JVOA 1VHOA 4NGSA 3DLJA 3O8ZA 1CBXA 1TKJA 1XOVA 2J8NA 4KLWA 4MBUA 3W6XA 2GU2A 4Q7AA 4R3KA 3R9FA 2C6CA 2R98A 2PJ7A 2R7HA 2WZNA 4UEZA 4F0XA 2PCUA 2GREA 3IIBA 3BUMB 3HLPA 3G8WA 3IC1A 2XEGA 1WK4A 2OH1A 1A2ZA 2AFOA 4UBRA 2HROA 3LMSA 2V77A 2QMLA 5H86A 1UWYA 2C6PA 2XPNA 2WUUA 1BLLE 3DDDA 2I3CA 2PRBA 3DR8A 3K9TA 3TC8A 4CGLA 5LYLA 1S3ZA 4UWJA 1M4GA 2PQ8A 3GYAA 5ELYA 4BD9A 2V8VA 3VARA 3JVNA 4C7IA 3WABA 4KUBA 2HI6A 1VBGA 1IICA 3ZNIA 1SQHA 4PSWA 3WC6A 4MJXA 2Z3MA 3SJFA 4C9UA 2NMTA 3EXNA 2C1CA 4C8FA 3JUWA 2B3UA 3F0AA 5D29A 3B3WA 3FB3A 3QAYA 4H89A 4MFJA 3EZBA 2C27A 5JM6A 2R8VA 3KQXA 5IB0A 3T90A 5J1QA 4NGTA 1HDQA 2R82A 2EWBA 1Y7EA 1IYKA 1KZFA 2VQYA 1ZG8A 1S60A 4ZY0A 3SXOA 2PR8A 4KOUA 1M4LA 2FL4A 5F13A 2P6GA 4RN7A 3WR7A 1F2OA 3K2KA 2JBKA 4C2YA 4TWEA 1Q2DA 4AXVA 1LCPA 4MHNA 4P10A 4C7HA 2YJVA 3H8EA 4FD7A 5A28A 2ZW6A 2Q4YA 2WSAA 3W6SA 3RNZA 3VRNA 3RZAA 2IL4A 4PK2A 1LAPA 2Z10A 4OAEA 1J4JA 4PXCA 5LRGA 3T07A 4JLYA 2PCNA 1XJOA 5IR2A 3LWUA 3SJXA 2C6GA 1EO0A 3VRRA 2B3VA 2BL1A 2ZELA 3D8PA 5FD8A 1CG2A 4UCNA 2JDCA 4P4JA 5EBVA 2PDOA 1TF9A 4P4FA 1RTQA 2JLMA 3BUNB 4A4CA 1XFOA 3ISXA 1YW4A 4NCZA 1LFWA 1Z8TA 3GKRA 3PZJA 2D4OA 5AG7A 2Y1NA 2FXFA 3D7HA 2HB6A 4L8AA 3DR6A 2PE3A 2CNTA 1Q5XA 1QSNA 1ZRSA 4LUAA 4E94A 4NGMA 1J3LA 2YNCA 4K30A 2POKA 3VATA 2AJ6A 2O28A 3GIUA 4DYOA 4R87A 5JVLA 3CPXA 1KUXA 2DPSA 4PXEA 1KWMA 1Z8WA 1Z4EA 1MJBA 4MHDA 3D2PA 5JYBA 4AG9A 4MI1A 5DS0A 1CJWA 2YJTA 4KUAA 3E0KA 3KHZA 4MHYA 1X12A 4ZBGA 3I1UA 4CZ1A 2HQYA 3VGOA 3PB7X 5AG5A 3W91A 2WPWA 2FIAA 1XMTA 1Y9WA 4RI1A 3SJGA 4COBA 1RXTA 4WJBA 3WT4A 3MGDA 4JWPA 3P2FA 2P0WA 1BOBA 3B7IA 4ZX9A 4YRHA 1TKFA 2OLSA 2CNSA 2PJ6A 2EK8A 4TJVA 1NSAA 1XF1A 5IX3A 1PU9A 1ELLP 2DEAA 1P0HA 3D67A 1CX8A 4MCQA 2D0PA 1OZPA 5HKWA 1ARMA 4MCSA 2Q4VA 3PGPA 3V8IA 4BPWB 4W9YA 2PJAA 4OLLA 4OIDA 2JEVA 1T36B 6CPAA 2PR1A 1ZO0A 3HPHE 3I9SA 1PYTB 2HC9A 2Q0YA 3SI0A 3T8WA 2FSRA 4C8PA 2ATRA 5DWNA 1I21A 4QB9A 4MY0A 1AYEA 4C8TA 2WYRA 4X2TA 2QJ8A 4MY3A 3FEDA 1GHEA 2EO8A 1F57A 3H8GA 3H8FA 2G9DA 3MRUA 1OBRA 3P2HA 3TOAA 2PJCA 3B3SA 3PB6X 3NE7A 2H5MA 5GCNA 2B4BA 1XIXA 3BXMA 2EVNA 3R95A 4IF5A 3V38A 2GP4A 4A31A 4KSIA 5F1YA 2J9AA 3NE8A 1S7LA 3TLGA 3ZJ0A 2HV2A 4NF1A 1Y0YA 4MFZA 3FBUA 4XPKA 4DUKA 2XEFA 5BY0A 1R43A 4KVME 3VROA 2WPXA 3NFQA 4FUUA 4JXQA 4TNUA 3BLNA 1ZG9A 3S6GA 1NBWA 3B2YA 3TLAA 1WJTA 3TO7A 3D4UA 5K8NA 2GIVA 4IUSA 2CBLA 3PLFB 3H4QA 5KTAA 5CPAA 5G1ZA 1AUGA 4E2AA 1Y0RA 3BJ7A 4XNHC 2B5GA 1YQEA 2FVGA 2A4NA 2ZEDA 3PB4X 4LQ6A 4P4BA 3RBUA 3IWEA 4DJLA 5AG4A 4CDKA 3PFOA 1YVKA 2ZEOA 3S6FA 1CM0A 2OOTA 1JWQA 4BPUB 2DPTA 3C8OA 3B3VA 3R9GA 4MXUA 4ZGYB 4R76A 3T9YA 2BOAA 4PPZA 5AXIA 1VIXA 2BEIA 3NH5A 4MFPA 4B13A 3VRPA 4CS0B 4YFJA 4A2ZA 2ZW4A 1V6CA 3OWCA 2HWGA 1YW6A 3KRVA 2ZEFA 3KHXA 1BAVA 2P6EA 2XEJA 4K3NA 4AB7A 2V8GA 1CPSA 1S7KA 4F9UA 4E8OA 1A9XB 4O23A 1P4NA 2ABZA 4UCPA 1XRYA 4COGA 1IOIA 4MI4A 3TLYA 3TX8A 1WWZA 3VWDA 5FVJA 3K9UA 2OU2A 4G1PA 1Z2LA 3VTAA 2AFUA 4IAVA 5H84A 4P6YA 3RAMA 3TOBA 3BUXB 4B12A 1QMUA 2Y0MA 4C68A 2YGWA 3N7ZA 1DIKA 5K8MA 2IJZA 4MJ8A 4X8IA 2Q7SA 3U1BA 3TLBA 1N71A 4R8FA 1MJAA 5J8CA 1ARLA 1M4DA 1CP6A 4C9EA 1B6BA 1LOKA 1YX0A 3FYNA 4CGOA 3T0TA 4H2KA 3SI2A 2CF4A 3OB2B 3TTHA 2VKZG 2PJ4A 4C99A 4KOYA 3OB1B 4FD5A 2QIRA 3IU1A 4B5OA 5CNPA 3K4IA 1F2PA 4R57A 3PFVA 3DSBA 2DIKA 4INJA 3S9NA 3SHPA 3B3TA 5DWMA 3PBBA 4X5KA 4UWIA 5C88A 1M4IA 5J8FA 2V8DA 4ORFA 2ARHA 4A4BA 1R61A 3EC4A 3IGRA 4L89A 4Z65A 3NOJA 4CGNA 4ZYQA 1ZLIA 5LYIA 5K8PA 2PRQA 3IU2A 2YNCC 3WC7A 4GXHA 4H1HA 1CP7A 4RR2B 2AE6A 4UIAA 2PJ5A 3F5BA 3GUXA 2B4JC 2ZW7A 2Z11A 4P44A 4R7MA 1YVHA 3CPAA 3OAKA 3HMJG 2ZEHA 1ZG7A 4M6IA 1L0CA 3KASA 1NXJA 2XPOA 1ELMP 3KGQA 3S6HA 5IV0A 3IFEA 1S7FA 4GS4A 1U6MA 3QB8A 3HPGG 3EZAA 3JRUA 5HVFA 4U9YA 1LRZA 1H8LA 2PJ1A 4Q36A 4AG7A 4CAWA 4A95A 5HKZA 2P6FA 4P45A 1Z5RA 4F0YA 4F8ZA 2B4DB 3IWWA 1KUYA 4AVCA 4AVBA 3ICUA 2PJ3A 3KL9A 1Z4RA 2GE3A 2CY2A 4JXRA 3T05A 1MJ9A 4FD4A 3PT1A 3TO6A 3EZEA 5J3XA 4OMEA 2NYQA 3A9LA 3FXTA 4KOTA 1LAMA 2BO9A 3GJZA 3BUOB 2PSWA 2Q04A 2R1IA 3PP9A 2Y1MA 1Z9UA 2QECA 5E96A 1YLEA 2D0OA 2JBJA 3GY9A 4C8UA 1NSLA 3FVLA 2B0AA 2Z3PA 3CDXA 1JDEA 4IK2A 3D7FA 3QAHA 1BPMA 4EMEA 4WWVA 4EYSA 3SXNA 3EO4A 4C86A 2GLFA 2CXAA 2I00A 1KBLA 2F5IA 4I49A 4PXDA 5HH1A 2ZPAA 4UFXA 4LQGA 4AVAA 3TCVA 4CRZB 4NJRA 1M6VB 4E0AA 1QSOA 5THWA 4A38A 2Q7BA 3PEIA 2Q4ZA 3LODA 4IHMA 4EWTA 3CT9A 1S7NA 4A39A 3FEEA 4JYWA 5LYFA 4KOSA 1YR0A 2ZOGA 2CTCA 3CXQA 2B58A 4B5PB 1YK3A 3IWGA 1XMBA 2G0BA 1Z8XA 2B5GB 4OC0A 4LX9A 4R3LA 5HVGA 2Q44A 4KOVA 4UFVA 5G21A 4A33A 1K4JA 2Z3OA 2Q43A 3BHXA 3MN8A 5JPHA 1VBHA 1KC7A 4KLVA 4MHZA 4PXBA 2HUZA 4XPLA 5HXDA 1TF8A 3FRMA 4QVTA 4OC4A 4CRYB 1HEEA 2X0SA 4QC6A 5F48A 4NGRA 3DNSA 4NGQA 1Q2YA 4ONWA 2JEWA 3TO9A 2X7BA 5HVHA 4XPDB 2AFMA 4M8DA 3PRTA 2Z3KA 2OZUA 3KKWA 4CYPA 5K8OA 2OB0A 5EC4A 1IIDA 2Z0ZA 3I74A 4P4EA 3B8GA 3I3GA 3ISZA 4C85A 3TLEA 4C2ZA 3TFYA 1AMPA 3EFAA 3LACA 1VHEA 2XPLA 1HDUA 1PCAA 4BPXB 1YMEA 4OC1A 4CAFA 2MP0A 4DNCA 4PSXA 5F47A 4IIXA 4OC2A 2ZEMA 3G3SA 4MFKA 5HMNA 1VI4A 4H6UA 4P4IA 3FIXA 5EMIA 4J0NA 2ZEEA 4OKOA 2FIWA 2AUMA 5BWAB 2PIYA 2OR4A 3F8KA 2DLAA 5F09A 3B3CA 4OP4A 2BUEA 4KZTA 1YVOA 4MMOA 2PJ0A 4A32A 1CE8B 3KQZA 1ZYMA 3SI1A 3CXPA 4IIYA 2IQ6A 1CPXA 2FE7A 3EY5A 3D7GA 3SJEA 4FBEA 2VZZA 4UEFA 2QYVA 2FT0A 4CAVA 4NGNA 2ANPA 3PB9X 4PV6A 4CYOA 5JH9A 5KTDA 4CPAA 2VL1A 3DGVA 1DE4C 1ON0A 4B5PA 2KCWA 1R57A 2B4DA 1Z9EA 2OZHA 5AG6A 3NA6A 2OZGA 4C84A 1QSRA 2RFHA 4UFWA 2BSWA 1ZLHA 4M6GA 5G20A 1XEBA 4QUSA 4P4DA 4BMHA 2ODFA 4KOWA 2I79A 2ZOFA 1WVMA 2UV8G 4FWUA 1FY7A 1VGYA 1VKCA 1MK4A 4CGMA 1R3NA 3H5ZA 4UA3A 1JDBC 3NFZA 5KTCA 3BI1A 2PVWA 4BINA 3L2NA 1V0CA 4HNWB 4JD6A 1JQGA 2O4HA 4NGPA 4B14A 4A94A 4BTFA 4CO9A 3PBEA 4RUHA 1I1DA 1M44A 2Z3LA 3CZXA 1YSJA 4B11A 2PJ9A 3PB8X 5F5XA 3ZZIA 3KI9A 1PUAA 1Y9KA 2PVVA 4C9VA 1QSTA 4OC3A 4NJQA 1XE4A 2YNEA 1GYTA 5AGEA 4C9AA 2FM4A 4MRIA 3F9KC 2RB7A 3TE4A 2V8HA 3D68A 4R6TA 3BUWB 2VEZA 1M1DA 1C30B 4E5SA 4KOXA 2AFSA 2GLJA 4CGPA 4OIWA 3KR4A 5IB9A 1X10A 4CYQA 2D4PA 1VHSA 3IJ3A 4H6ZA 5G22A 2CIJA 2DXQA 4ZI6A 3S6KA 2EZAA 2F8HA 3GLJA 3KZWA 2C5QA 2G3TA 4YWYA 2ZEPA 3JTKA 3OP0A 2VZYA 3IO1A 3U88C 4NEXA 3LD2A 4RS2A 4UEEA 4ZX8A 3TYXA 2AFWA 1BPNA 1Q2CA 4C2XA 2VBQA 3TT2A 4B6ZA 2AFZA 4KS9A 3D7DA 3UY5A 1Z8LA 2CNMA 2PJ2A 3FMCA 3FX6A 4KORA 4PK3A 4UF4A 4HPSA 4XNHB 4YGOA 2QVPA 3V7ZA 3S9MA 1FNOA 3FNCA 1DTDA 4B10A 4C8AA 4II9A 2XEIA 5JQ4A 1C3OB 5I0CA 2IMOA 3I6SA 1EZBA 4HNXB 4HNYB 4NSQA 3VWEA 4R9MA 4ONUA 5LYDA 2EZCA 4MCRA 2GFQA 2VXKA 4JJXA 5A27A 2PC1A 2CTBA 3IEHA 1YGHA 3EIFA 4A37A 1EZAA 3R1KA 3TLGB 3S9LA 2RC4A 4Y49B 4CDJA 3QNVA 3T5MA 2PIZA 1XBUA 2FCKA 4HKFA 4MHPA 4OC5A 1IGBA 1NMTA 2EBJA 3D66A 5LRJA 3VH9A 2J8RA 1B47A 3R9EA 4XPDC 3D3SA 2AUNA 5ISVA 1GGOA 1TIQA 3FECA 1UFHA 1IY7A 1NE9A 1QQ9A 1QSMA 2JDDA 3NH8A 2ZENA 2REEA 4FD6A 4YU9A 5HKYA 5F49A 3WC5A 4A30A 3G23A 4KNGE 1TXRA 1IU8A 2PJ8A 2N3AB 1S5KA 5F46A 4U9ZA 2EUIA 4Q38A 4CYNA 3N5FA 7CPAA 5JGFA
chains in the Genus database with same CATH topology
2AFXA 4NFRA 4X3RA 4UIBA 2ZEGA 5D8NA 2Q51A 8CPAA 5I4MA 4ZY1A 5LRKA 3FF3A 3NH4A 2F7VA 2EK9A 4FAIA 1Q7LA 2PJBA 2NSMA 4C8CA 1EE3P 3FH4A 3FJUA 4GM5A 2O53A 4F9VA 4YN3A 1Y9ZA 1YLOA 4C9RA 1LANA 3B35A 3GB0A 5CBMA 4TJXA 4JZ0A 2BCOA 3PFEA 4ZY2A 3BI0A 1TKHA 1FT7A 4EFDA 3KR5A 4MCPA 4PQAA 3HUVA 4NGSA 1VHOA 3DLJA 1CBXA 1TKJA 2GU2A 4Q7AA 2C6CA 2PJ7A 2WZNA 4UEZA 2PCUA 2GREA 3IIBA 3HLPA 3IC1A 2XEGA 2AFOA 3LMSA 2V77A 1UWYA 2C6PA 3K9TA 1BLLE 2I3CA 3TC8A 5LYLA 5ELYA 4BD9A 2V8VA 3VARA 3WABA 3WC6A 4C9UA 3SJFA 2C1CA 4C8FA 5D29A 3B3WA 5JM6A 3KQXA 5J1QA 4NGTA 1HDQA 2EWBA 1Y7EA 4ZY0A 1ZG8A 1M4LA 1F2OA 3K2KA 2JBKA 4TWEA 4AXVA 1LCPA 4MHNA 4P10A 3H8EA 3RZAA 1LAPA 4PXCA 5LRGA 1XJOA 5IR2A 3LWUA 3SJXA 2C6GA 2ZELA 1CG2A 4P4JA 4P4FA 1TF9A 1RTQA 1XFOA 3ISXA 1YW4A 1LFWA 3D7HA 2HB6A 2PE3A 4NGMA 2POKA 3VATA 4DYOA 3CPXA 4PXEA 1KWMA 5DS0A 3KHZA 4MHYA 3I1UA 3PB7X 3SJGA 4WJBA 3WT4A 3B7IA 4ZX9A 1TKFA 2PJ6A 2EK8A 4TJVA 1NSAA 1XF1A 1ELLP 2DEAA 3D67A 1CX8A 4MCQA 1ARMA 4MCSA 4W9YA 2PJAA 4OIDA 6CPAA 4C8PA 3T8WA 1PYTB 2HC9A 3SI0A 1AYEA 4C8TA 2WYRA 4X2TA 2QJ8A 3FEDA 3H8GA 1F57A 3H8FA 3MRUA 2G9DA 1OBRA 2PJCA 3B3SA 3PB6X 3BXMA 3V38A 2GP4A 4KSIA 2J9AA 1Y0YA 4DUKA 2XEFA 1R43A 4FUUA 4TNUA 1ZG9A 3B2YA 3D4UA 5K8NA 5CPAA 1Y0RA 2FVGA 2ZEDA 3PB4X 4DJLA 4P4BA 3RBUA 4CDKA 3PFOA 2ZEOA 2OOTA 3B3VA 4MXUA 4R76A 2BOAA 4PPZA 1VIXA 3NH5A 1V6CA 1YW6A 2ZEFA 3KHXA 1BAVA 4K3NA 2XEJA 2V8GA 1CPSA 4F9UA 4O23A 2ABZA 1XRYA 3TX8A 4G1PA 3VTAA 1Z2LA 2AFUA 4IAVA 4P6YA 3RAMA 1QMUA 5K8MA 2IJZA 4X8IA 4R8FA 1ARLA 1CP6A 4C9EA 1LOKA 4H2KA 3SI2A 2CF4A 2PJ4A 4C99A 1F2PA 3S9NA 3B3TA 3PBBA 2V8DA 4Z65A 5K8PA 4ZYQA 1ZLIA 5LYIA 2PRQA 3WC7A 1CP7A 4UIAA 2PJ5A 3GUXA 4P44A 4R7MA 3CPAA 2ZEHA 1ZG7A 3KASA 1ELMP 3KGQA 3IFEA 3JRUA 5HVFA 2PJ1A 1H8LA 4F8ZA 4P45A 1Z5RA 3IWWA 3ICUA 2PJ3A 3KL9A 4OMEA 2NYQA 1LAMA 2BO9A 2JBJA 4C8UA 3FVLA 3CDXA 4IK2A 3D7FA 1BPMA 4EMEA 4WWVA 4C86A 2GLFA 4PXDA 4LQGA 4NJRA 4A38A 5THWA 3PEIA 2Q4ZA 4IHMA 4EWTA 3CT9A 4A39A 3FEEA 4JYWA 5LYFA 2ZOGA 2CTCA 1XMBA 4OC0A 5HVGA 2Q43A 3BHXA 3MN8A 4MHZA 4PXBA 5HXDA 1TF8A 4OC4A 1HEEA 4NGRA 4ONWA 4NGQA 2JEWA 5HVHA 2AFMA 3PRTA 5K8OA 3I74A 4P4EA 4C85A 3ISZA 1AMPA 1VHEA 1HDUA 1PCAA 1YMEA 4OC1A 4OC2A 2ZEMA 4P4IA 2ZEEA 4OKOA 2PIYA 2OR4A 5F09A 3B3CA 4OP4A 4MMOA 2PJ0A 3KQZA 3SI1A 2IQ6A 1CPXA 3D7GA 3SJEA 4FBEA 4UEFA 2QYVA 4NGNA 2ANPA 3PB9X 5JH9A 4CPAA 2VL1A 3DGVA 1DE4C 3NA6A 4C84A 2RFHA 1ZLHA 4P4DA 2ZOFA 1WVMA 4FWUA 1VGYA 1R3NA 3NFZA 3BI1A 2PVWA 3L2NA 1JQGA 2O4HA 4NGPA 4A94A 3PBEA 4RUHA 1YSJA 2PJ9A 3PB8X 3KI9A 4C9VA 2PVVA 4OC3A 4NJQA 4C9AA 1GYTA 4MRIA 2RB7A 2V8HA 3D68A 4R6TA 2AFSA 2GLJA 4OIWA 3KR4A 5IB9A 3IJ3A 2CIJA 4ZI6A 2F8HA 3GLJA 3KZWA 2C5QA 4YWYA 2ZEPA 4ZX8A 3IO1A 4UEEA 2AFWA 1BPNA 4B6ZA 2AFZA 3D7DA 1Z8LA 3FX6A 2PJ2A 3FMCA 4UF4A 3V7ZA 2QVPA 3S9MA 1FNOA 1DTDA 4C8AA 2XEIA 2IMOA 3I6SA 5LYDA 4MCRA 2CTBA 3IEHA 3EIFA 4A37A 3S9LA 4CDJA 3QNVA 2PIZA 1XBUA 5LRJA 3VH9A 4MHPA 4OC5A 1IGBA 3D66A 3FECA 1IY7A 4YU9A 1QQ9A 3NH8A 2ZENA 3WC5A 4KNGE 1TXRA 2PJ8A 3N5FA 7CPAA 5JGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFX A;  4NFR A;  4X3R A;  4UIB A;  2ZEG A;  5D8N A;  2Q51 A;  8CPA A;  5I4M A;  4ZY1 A;  5LRK A;  3FF3 A;  3NH4 A;  2F7V A;  2EK9 A;  4FAI A;  1Q7L A;  2PJB A;  2NSM A;  4C8C A;  1EE3 P;  3FH4 A;  3FJU A;  4GM5 A;  2O53 A;  4F9V A;  4YN3 A;  1Y9Z A;  1YLO A;  4C9R A;  1LAN A;  3B35 A;  3GB0 A;  5CBM A;  4TJX A;  4JZ0 A;  2BCO A;  3PFE A;  4ZY2 A;  3BI0 A;  1TKH A;  1FT7 A;  4EFD A;  3KR5 A;  4MCP A;  4PQA A;  3HUV A;  4NGS A;  1VHO A;  3DLJ A;  1CBX A;  1TKJ A;  2GU2 A;  4Q7A A;  2C6C A;  2PJ7 A;  2WZN A;  4UEZ A;  2PCU A;  2GRE A;  3IIB A;  3HLP A;  3IC1 A;  2XEG A;  2AFO A;  3LMS A;  2V77 A;  1UWY A;  2C6P A;  3K9T A;  1BLL E;  2I3C A;  3TC8 A;  5LYL A;  5ELY A;  4BD9 A;  2V8V A;  3VAR A;  3WAB A;  3WC6 A;  4C9U A;  3SJF A;  2C1C A;  4C8F A;  5D29 A;  3B3W A;  5JM6 A;  3KQX A;  5J1Q A;  4NGT A;  1HDQ A;  2EWB A;  1Y7E A;  4ZY0 A;  1ZG8 A;  1M4L A;  1F2O A;  3K2K A;  2JBK A;  4TWE A;  4AXV A;  1LCP A;  4MHN A;  4P10 A;  3H8E A;  3RZA A;  1LAP A;  4PXC A;  5LRG A;  1XJO A;  3LWU A;  3SJX A;  2C6G A;  2ZEL A;  1CG2 A;  4P4J A;  4P4F A;  1TF9 A;  1RTQ A;  1XFO A;  3ISX A;  1YW4 A;  1LFW A;  3D7H A;  2HB6 A;  2PE3 A;  4NGM A;  2POK A;  3VAT A;  4DYO A;  3CPX A;  4PXE A;  1KWM A;  5DS0 A;  3KHZ A;  4MHY A;  3I1U A;  3PB7 X;  3SJG A;  4WJB A;  3WT4 A;  3B7I A;  4ZX9 A;  1TKF A;  2PJ6 A;  2EK8 A;  4TJV A;  1NSA A;  1XF1 A;  1ELL P;  2DEA A;  3D67 A;  1CX8 A;  4MCQ A;  1ARM A;  4MCS A;  4W9Y A;  2PJA A;  4OID A;  6CPA A;  4C8P A;  3T8W A;  1PYT B;  2HC9 A;  3SI0 A;  1AYE A;  4C8T A;  2WYR A;  4X2T A;  2QJ8 A;  3FED A;  3H8G A;  1F57 A;  3H8F A;  3MRU A;  2G9D A;  1OBR A;  2PJC A;  3B3S A;  3PB6 X;  3BXM A;  3V38 A;  4KSI A;  2J9A A;  1Y0Y A;  4DUK A;  2XEF A;  1R43 A;  4FUU A;  4TNU A;  1ZG9 A;  3B2Y A;  3D4U A;  5K8N A;  5CPA A;  1Y0R A;  2FVG A;  2ZED A;  3PB4 X;  4DJL A;  4P4B A;  3RBU A;  4CDK A;  3PFO A;  2ZEO A;  2OOT A;  3B3V A;  4MXU A;  4R76 A;  2BOA A;  4PPZ A;  1VIX A;  3NH5 A;  1V6C A;  1YW6 A;  2ZEF A;  3KHX A;  1BAV A;  4K3N A;  2XEJ A;  2V8G A;  1CPS A;  4F9U A;  4O23 A;  2ABZ A;  1XRY A;  3TX8 A;  4G1P A;  3VTA A;  1Z2L A;  2AFU A;  4IAV A;  4P6Y A;  3RAM A;  1QMU A;  5K8M A;  2IJZ A;  4X8I A;  4R8F A;  1ARL A;  1CP6 A;  4C9E A;  1LOK A;  4H2K A;  3SI2 A;  2CF4 A;  2PJ4 A;  4C99 A;  1F2P A;  3S9N A;  3B3T A;  3PBB A;  2V8D A;  4Z65 A;  5K8P A;  4ZYQ A;  1ZLI A;  5LYI A;  2PRQ A;  3WC7 A;  1CP7 A;  4UIA A;  2PJ5 A;  3GUX A;  4P44 A;  4R7M A;  3CPA A;  2ZEH A;  1ZG7 A;  3KAS A;  1ELM P;  3KGQ A;  3IFE A;  3JRU A;  5HVF A;  2PJ1 A;  1H8L A;  4F8Z A;  4P45 A;  1Z5R A;  3IWW A;  3ICU A;  2PJ3 A;  3KL9 A;  4OME A;  2NYQ A;  1LAM A;  2BO9 A;  2JBJ A;  4C8U A;  3FVL A;  3CDX A;  4IK2 A;  3D7F A;  1BPM A;  4EME A;  4WWV A;  4C86 A;  2GLF A;  4PXD A;  4LQG A;  4NJR A;  4A38 A;  5THW A;  3PEI A;  2Q4Z A;  4IHM A;  4EWT A;  3CT9 A;  4A39 A;  3FEE A;  4JYW A;  5LYF A;  2ZOG A;  2CTC A;  1XMB A;  4OC0 A;  5HVG A;  2Q43 A;  3BHX A;  3MN8 A;  4MHZ A;  4PXB A;  5HXD A;  1TF8 A;  4OC4 A;  1HEE A;  4NGR A;  4ONW A;  4NGQ A;  2JEW A;  5HVH A;  2AFM A;  3PRT A;  5K8O A;  3I74 A;  4P4E A;  4C85 A;  3ISZ A;  1AMP A;  1VHE A;  1HDU A;  1PCA A;  1YME A;  4OC1 A;  4OC2 A;  2ZEM A;  4P4I A;  2ZEE A;  4OKO A;  2PIY A;  2OR4 A;  5F09 A;  3B3C A;  4OP4 A;  4MMO A;  2PJ0 A;  3KQZ A;  3SI1 A;  2IQ6 A;  1CPX A;  3D7G A;  3SJE A;  4FBE A;  4UEF A;  2QYV A;  4NGN A;  2ANP A;  3PB9 X;  5JH9 A;  4CPA A;  2VL1 A;  3DGV A;  1DE4 C;  3NA6 A;  4C84 A;  2RFH A;  1ZLH A;  4P4D A;  2ZOF A;  1WVM A;  4FWU A;  1VGY A;  1R3N A;  3NFZ A;  3BI1 A;  2PVW A;  3L2N A;  1JQG A;  2O4H A;  4NGP A;  4A94 A;  3PBE A;  4RUH A;  1YSJ A;  2PJ9 A;  3PB8 X;  3KI9 A;  4C9V A;  2PVV A;  4OC3 A;  4NJQ A;  4C9A A;  1GYT A;  4MRI A;  2RB7 A;  2V8H A;  3D68 A;  4R6T A;  2AFS A;  2GLJ A;  4OIW A;  3KR4 A;  5IB9 A;  3IJ3 A;  2CIJ A;  4ZI6 A;  2F8H A;  3GLJ A;  3KZW A;  4YWY A;  2ZEP A;  4ZX8 A;  3IO1 A;  4UEE A;  2AFW A;  1BPN A;  4B6Z A;  2AFZ A;  3D7D A;  1Z8L A;  3FX6 A;  2PJ2 A;  3FMC A;  4UF4 A;  3V7Z A;  2QVP A;  3S9M A;  1FNO A;  1DTD A;  4C8A A;  2XEI A;  2IMO A;  3I6S A;  5LYD A;  4MCR A;  2CTB A;  3IEH A;  3EIF A;  4A37 A;  3S9L A;  4CDJ A;  3QNV A;  2PIZ A;  1XBU A;  5LRJ A;  3VH9 A;  4MHP A;  4OC5 A;  1IGB A;  3D66 A;  3FEC A;  1IY7 A;  4YU9 A;  1QQ9 A;  3NH8 A;  2ZEN A;  3WC5 A;  4KNG E;  1TXR A;  2PJ8 A;  3N5F A;  7CPA A;  5JGF A; 
#chains in the Genus database with same CATH topology
 1Y7R A;  2AFX A;  4NFR A;  4NXY A;  4X3R A;  4QBJ A;  3D2M A;  2ZEG A;  4UIB A;  3TLC A;  5D8N A;  2Q51 A;  8CPA A;  5I4M A;  4ZY1 A;  1KUV A;  1IOF A;  5LRK A;  1I12 A;  3FF3 A;  4MFL A;  1B87 A;  1BO4 A;  4MFQ A;  3NH4 A;  4EVY A;  4M6H A;  2F7V A;  2J8M A;  2ZW5 A;  4Y49 C;  2EK9 A;  4FAI A;  4U5Y A;  1Q7L A;  2GAN A;  5C82 A;  1YRE A;  1IYL A;  4KVO E;  2PJB A;  3C26 A;  2YND A;  1ZL0 A;  2NSM A;  4C8C A;  2VI7 A;  1RO5 A;  3R96 A;  5F9M A;  4KSA A;  1EE3 P;  3FH4 A;  4GPL B;  2DF5 A;  3FJU A;  3CXS A;  4GM5 A;  4M3S A;  4UCM A;  4CAE A;  3BJ8 A;  2O53 A;  2Z3N A;  1FBV A;  4CAX A;  2REF A;  1KEE B;  4F9V A;  4BBH A;  4YN3 A;  4KSF A;  1Y9Z A;  5K99 A;  1YLO A;  4KVX A;  4C9R A;  1LAN A;  1IB1 E;  2ZXV A;  3B35 A;  3GB0 A;  4M85 A;  4OAD A;  5CBM A;  1XF8 A;  4TJX A;  4JZ0 A;  2BCO A;  4F6A A;  4J3G A;  2E28 A;  3PFE A;  4ZY2 A;  3RO0 A;  1BXR B;  1CS0 B;  3BI0 A;  1TKH A;  2G3A A;  3RYO A;  2FS5 A;  1FT7 A;  2K5T A;  4EFD A;  2XPP A;  3KR5 A;  2EZB A;  4MCP A;  3TLZ A;  4PQA A;  3HUV A;  3VRQ A;  3SR3 A;  4JVO A;  1VHO A;  4NGS A;  3DLJ A;  3O8Z A;  1CBX A;  1TKJ A;  1XOV A;  2J8N A;  4KLW A;  4MBU A;  3W6X A;  2GU2 A;  4Q7A A;  4R3K A;  3R9F A;  2C6C A;  2R98 A;  2PJ7 A;  2R7H A;  2WZN A;  4UEZ A;  4F0X A;  2PCU A;  2GRE A;  3IIB A;  3BUM B;  3HLP A;  3G8W A;  3IC1 A;  2XEG A;  1WK4 A;  2OH1 A;  1A2Z A;  2AFO A;  4UBR A;  2HRO A;  3LMS A;  2V77 A;  2QML A;  5H86 A;  1UWY A;  2C6P A;  2XPN A;  2WUU A;  1BLL E;  3DDD A;  2I3C A;  2PRB A;  3DR8 A;  3K9T A;  3TC8 A;  4CGL A;  5LYL A;  1S3Z A;  4UWJ A;  1M4G A;  2PQ8 A;  3GYA A;  5ELY A;  4BD9 A;  2V8V A;  3VAR A;  3JVN A;  4C7I A;  3WAB A;  4KUB A;  2HI6 A;  1VBG A;  1IIC A;  3ZNI A;  1SQH A;  4PSW A;  3WC6 A;  4MJX A;  2Z3M A;  3SJF A;  4C9U A;  2NMT A;  3EXN A;  2C1C A;  4C8F A;  3JUW A;  2B3U A;  3F0A A;  5D29 A;  3B3W A;  3FB3 A;  3QAY A;  4H89 A;  4MFJ A;  3EZB A;  2C27 A;  5JM6 A;  2R8V A;  3KQX A;  5IB0 A;  3T90 A;  5J1Q A;  4NGT A;  1HDQ A;  2R82 A;  2EWB A;  1Y7E A;  1IYK A;  1KZF A;  2VQY A;  1ZG8 A;  1S60 A;  4ZY0 A;  3SXO A;  2PR8 A;  4KOU A;  1M4L A;  2FL4 A;  5F13 A;  2P6G A;  4RN7 A;  3WR7 A;  1F2O A;  3K2K A;  2JBK A;  4C2Y A;  4TWE A;  1Q2D A;  4AXV A;  1LCP A;  4MHN A;  4P10 A;  4C7H A;  2YJV A;  3H8E A;  4FD7 A;  5A28 A;  2ZW6 A;  2Q4Y A;  2WSA A;  3W6S A;  3RNZ A;  3VRN A;  3RZA A;  2IL4 A;  4PK2 A;  1LAP A;  2Z10 A;  4OAE A;  1J4J A;  4PXC A;  5LRG A;  3T07 A;  4JLY A;  2PCN A;  1XJO A;  5IR2 A;  3LWU A;  3SJX A;  2C6G A;  1EO0 A;  3VRR A;  2B3V A;  2BL1 A;  2ZEL A;  3D8P A;  5FD8 A;  1CG2 A;  4UCN A;  2JDC A;  4P4J A;  5EBV A;  2PDO A;  1TF9 A;  4P4F A;  1RTQ A;  2JLM A;  3BUN B;  4A4C A;  1XFO A;  3ISX A;  1YW4 A;  4NCZ A;  1LFW A;  1Z8T A;  3GKR A;  3PZJ A;  2D4O A;  5AG7 A;  2Y1N A;  2FXF A;  3D7H A;  2HB6 A;  4L8A A;  3DR6 A;  2PE3 A;  2CNT A;  1Q5X A;  1QSN A;  1ZRS A;  4LUA A;  4E94 A;  4NGM A;  1J3L A;  2YNC A;  4K30 A;  2POK A;  3VAT A;  2AJ6 A;  2O28 A;  3GIU A;  4DYO A;  4R87 A;  5JVL A;  3CPX A;  1KUX A;  2DPS A;  4PXE A;  1KWM A;  1Z8W A;  1Z4E A;  1MJB A;  4MHD A;  3D2P A;  5JYB A;  4AG9 A;  4MI1 A;  5DS0 A;  1CJW A;  2YJT A;  4KUA A;  3E0K A;  3KHZ A;  4MHY A;  1X12 A;  4ZBG A;  3I1U A;  4CZ1 A;  2HQY A;  3VGO A;  3PB7 X;  5AG5 A;  3W91 A;  2WPW A;  2FIA A;  1XMT A;  1Y9W A;  4RI1 A;  3SJG A;  4COB A;  1RXT A;  4WJB A;  3WT4 A;  3MGD A;  4JWP A;  3P2F A;  2P0W A;  1BOB A;  3B7I A;  4ZX9 A;  4YRH A;  1TKF A;  2OLS A;  2CNS A;  2PJ6 A;  2EK8 A;  4TJV A;  1NSA A;  1XF1 A;  5IX3 A;  1PU9 A;  1ELL P;  2DEA A;  1P0H A;  3D67 A;  1CX8 A;  4MCQ A;  2D0P A;  1OZP A;  5HKW A;  1ARM A;  4MCS A;  2Q4V A;  3PGP A;  3V8I A;  4BPW B;  4W9Y A;  2PJA A;  4OLL A;  4OID A;  2JEV A;  1T36 B;  6CPA A;  2PR1 A;  1ZO0 A;  3HPH E;  3I9S A;  1PYT B;  2HC9 A;  2Q0Y A;  3SI0 A;  3T8W A;  2FSR A;  4C8P A;  2ATR A;  5DWN A;  1I21 A;  4QB9 A;  4MY0 A;  1AYE A;  4C8T A;  2WYR A;  4X2T A;  2QJ8 A;  4MY3 A;  3FED A;  1GHE A;  2EO8 A;  1F57 A;  3H8G A;  3H8F A;  2G9D A;  3MRU A;  1OBR A;  3P2H A;  3TOA A;  2PJC A;  3B3S A;  3PB6 X;  3NE7 A;  2H5M A;  5GCN A;  2B4B A;  1XIX A;  3BXM A;  2EVN A;  3R95 A;  4IF5 A;  3V38 A;  2GP4 A;  4A31 A;  4KSI A;  5F1Y A;  2J9A A;  3NE8 A;  1S7L A;  3TLG A;  3ZJ0 A;  2HV2 A;  4NF1 A;  1Y0Y A;  4MFZ A;  3FBU A;  4XPK A;  4DUK A;  2XEF A;  5BY0 A;  1R43 A;  4KVM E;  3VRO A;  2WPX A;  3NFQ A;  4FUU A;  4JXQ A;  4TNU A;  3BLN A;  1ZG9 A;  3S6G A;  1NBW A;  3B2Y A;  3TLA A;  1WJT A;  3TO7 A;  3D4U A;  5K8N A;  2GIV A;  4IUS A;  2CBL A;  3PLF B;  3H4Q A;  5KTA A;  5CPA A;  5G1Z A;  1AUG A;  4E2A A;  1Y0R A;  3BJ7 A;  4XNH C;  2B5G A;  1YQE A;  2FVG A;  2A4N A;  2ZED A;  3PB4 X;  4LQ6 A;  4P4B A;  3RBU A;  3IWE A;  4DJL A;  5AG4 A;  4CDK A;  3PFO A;  1YVK A;  2ZEO A;  3S6F A;  1CM0 A;  2OOT A;  1JWQ A;  4BPU B;  2DPT A;  3C8O A;  3B3V A;  3R9G A;  4MXU A;  4ZGY B;  4R76 A;  3T9Y A;  2BOA A;  4PPZ A;  5AXI A;  1VIX A;  2BEI A;  3NH5 A;  4MFP A;  4B13 A;  3VRP A;  4CS0 B;  4YFJ A;  4A2Z A;  2ZW4 A;  1V6C A;  3OWC A;  2HWG A;  1YW6 A;  3KRV A;  2ZEF A;  3KHX A;  1BAV A;  2P6E A;  2XEJ A;  4K3N A;  4AB7 A;  2V8G A;  1CPS A;  1S7K A;  4F9U A;  4E8O A;  1A9X B;  4O23 A;  1P4N A;  2ABZ A;  4UCP A;  1XRY A;  4COG A;  1IOI A;  4MI4 A;  3TLY A;  3TX8 A;  1WWZ A;  3VWD A;  5FVJ A;  3K9U A;  2OU2 A;  4G1P A;  1Z2L A;  3VTA A;  2AFU A;  4IAV A;  5H84 A;  4P6Y A;  3RAM A;  3TOB A;  3BUX B;  4B12 A;  1QMU A;  2Y0M A;  4C68 A;  2YGW A;  3N7Z A;  1DIK A;  5K8M A;  2IJZ A;  4MJ8 A;  4X8I A;  2Q7S A;  3U1B A;  3TLB A;  1N71 A;  4R8F A;  1MJA A;  5J8C A;  1ARL A;  1M4D A;  1CP6 A;  4C9E A;  1B6B A;  1LOK A;  1YX0 A;  3FYN A;  4CGO A;  3T0T A;  4H2K A;  3SI2 A;  2CF4 A;  3OB2 B;  3TTH A;  2VKZ G;  2PJ4 A;  4C99 A;  4KOY A;  3OB1 B;  4FD5 A;  2QIR A;  3IU1 A;  4B5O A;  5CNP A;  3K4I A;  1F2P A;  4R57 A;  3PFV A;  3DSB A;  2DIK A;  4INJ A;  3S9N A;  3SHP A;  3B3T A;  5DWM A;  3PBB A;  4X5K A;  4UWI A;  5C88 A;  1M4I A;  5J8F A;  2V8D A;  4ORF A;  2ARH A;  4A4B A;  1R61 A;  3EC4 A;  3IGR A;  4L89 A;  4Z65 A;  3NOJ A;  4CGN A;  4ZYQ A;  1ZLI A;  5LYI A;  5K8P A;  2PRQ A;  3IU2 A;  2YNC C;  3WC7 A;  4GXH A;  4H1H A;  1CP7 A;  4RR2 B;  2AE6 A;  4UIA A;  2PJ5 A;  3F5B A;  3GUX A;  2B4J C;  2ZW7 A;  2Z11 A;  4P44 A;  4R7M A;  1YVH A;  3CPA A;  3OAK A;  3HMJ G;  2ZEH A;  1ZG7 A;  4M6I A;  1L0C A;  3KAS A;  1NXJ A;  2XPO A;  1ELM P;  3KGQ A;  3S6H A;  5IV0 A;  3IFE A;  1S7F A;  4GS4 A;  1U6M A;  3QB8 A;  3HPG G;  3EZA A;  3JRU A;  5HVF A;  4U9Y A;  1LRZ A;  1H8L A;  2PJ1 A;  4Q36 A;  4AG7 A;  4CAW A;  4A95 A;  5HKZ A;  2P6F A;  4P45 A;  1Z5R A;  4F0Y A;  4F8Z A;  2B4D B;  3IWW A;  1KUY A;  4AVC A;  4AVB A;  3ICU A;  2PJ3 A;  3KL9 A;  1Z4R A;  2GE3 A;  2CY2 A;  4JXR A;  3T05 A;  1MJ9 A;  4FD4 A;  3PT1 A;  3TO6 A;  3EZE A;  5J3X A;  4OME A;  2NYQ A;  3A9L A;  3FXT A;  4KOT A;  1LAM A;  2BO9 A;  3GJZ A;  3BUO B;  2PSW A;  2Q04 A;  2R1I A;  3PP9 A;  2Y1M A;  1Z9U A;  2QEC A;  5E96 A;  1YLE A;  2D0O A;  2JBJ A;  3GY9 A;  4C8U A;  1NSL A;  3FVL A;  2B0A A;  2Z3P A;  3CDX A;  1JDE A;  4IK2 A;  3D7F A;  3QAH A;  1BPM A;  4EME A;  4WWV A;  4EYS A;  3SXN A;  3EO4 A;  4C86 A;  2GLF A;  2CXA A;  2I00 A;  1KBL A;  2F5I A;  4I49 A;  4PXD A;  5HH1 A;  2ZPA A;  4UFX A;  4LQG A;  4AVA A;  3TCV A;  4CRZ B;  4NJR A;  1M6V B;  4E0A A;  1QSO A;  5THW A;  4A38 A;  2Q7B A;  3PEI A;  2Q4Z A;  3LOD A;  4IHM A;  4EWT A;  3CT9 A;  1S7N A;  4A39 A;  3FEE A;  4JYW A;  5LYF A;  4KOS A;  1YR0 A;  2ZOG A;  2CTC A;  3CXQ A;  2B58 A;  4B5P B;  1YK3 A;  3IWG A;  1XMB A;  2G0B A;  1Z8X A;  2B5G B;  4OC0 A;  4LX9 A;  4R3L A;  5HVG A;  2Q44 A;  4KOV A;  4UFV A;  5G21 A;  4A33 A;  1K4J A;  2Z3O A;  2Q43 A;  3BHX A;  3MN8 A;  5JPH A;  1VBH A;  1KC7 A;  4KLV A;  4MHZ A;  4PXB A;  2HUZ A;  4XPL A;  5HXD A;  1TF8 A;  3FRM A;  4QVT A;  4OC4 A;  4CRY B;  1HEE A;  2X0S A;  4QC6 A;  5F48 A;  4NGR A;  3DNS A;  4NGQ A;  1Q2Y A;  4ONW A;  2JEW A;  3TO9 A;  2X7B A;  5HVH A;  4XPD B;  2AFM A;  4M8D A;  3PRT A;  2Z3K A;  2OZU A;  3KKW A;  4CYP A;  5K8O A;  2OB0 A;  5EC4 A;  1IID A;  2Z0Z A;  3I74 A;  4P4E A;  3B8G A;  3I3G A;  3ISZ A;  4C85 A;  3TLE A;  4C2Z A;  3TFY A;  1AMP A;  3EFA A;  3LAC A;  1VHE A;  2XPL A;  1HDU A;  1PCA A;  4BPX B;  1YME A;  4OC1 A;  4CAF A;  2MP0 A;  4DNC A;  4PSX A;  5F47 A;  4IIX A;  4OC2 A;  2ZEM A;  3G3S A;  4MFK A;  5HMN A;  1VI4 A;  4H6U A;  4P4I A;  3FIX A;  5EMI A;  4J0N A;  2ZEE A;  4OKO A;  2FIW A;  2AUM A;  5BWA B;  2PIY A;  2OR4 A;  3F8K A;  2DLA A;  5F09 A;  3B3C A;  4OP4 A;  2BUE A;  4KZT A;  1YVO A;  4MMO A;  2PJ0 A;  4A32 A;  1CE8 B;  3KQZ A;  1ZYM A;  3SI1 A;  3CXP A;  4IIY A;  2IQ6 A;  1CPX A;  2FE7 A;  3EY5 A;  3D7G A;  3SJE A;  4FBE A;  2VZZ A;  4UEF A;  2QYV A;  2FT0 A;  4CAV A;  4NGN A;  2ANP A;  3PB9 X;  4PV6 A;  4CYO A;  5JH9 A;  5KTD A;  4CPA A;  2VL1 A;  3DGV A;  1DE4 C;  1ON0 A;  4B5P A;  2KCW A;  1R57 A;  2B4D A;  1Z9E A;  2OZH A;  5AG6 A;  3NA6 A;  2OZG A;  4C84 A;  1QSR A;  2RFH A;  4UFW A;  2BSW A;  1ZLH A;  4M6G A;  5G20 A;  1XEB A;  4QUS A;  4P4D A;  4BMH A;  2ODF A;  4KOW A;  2I79 A;  2ZOF A;  1WVM A;  2UV8 G;  4FWU A;  1FY7 A;  1VGY A;  1VKC A;  1MK4 A;  4CGM A;  1R3N A;  3H5Z A;  4UA3 A;  1JDB C;  3NFZ A;  5KTC A;  3BI1 A;  2PVW A;  4BIN A;  3L2N A;  1V0C A;  4HNW B;  4JD6 A;  1JQG A;  2O4H A;  4NGP A;  4B14 A;  4A94 A;  4BTF A;  4CO9 A;  3PBE A;  4RUH A;  1I1D A;  1M44 A;  2Z3L A;  3CZX A;  1YSJ A;  4B11 A;  2PJ9 A;  3PB8 X;  5F5X A;  3ZZI A;  3KI9 A;  1PUA A;  1Y9K A;  2PVV A;  4C9V A;  1QST A;  4OC3 A;  4NJQ A;  1XE4 A;  2YNE A;  1GYT A;  5AGE A;  4C9A A;  2FM4 A;  4MRI A;  3F9K C;  2RB7 A;  3TE4 A;  2V8H A;  3D68 A;  4R6T A;  3BUW B;  2VEZ A;  1M1D A;  1C30 B;  4E5S A;  4KOX A;  2AFS A;  2GLJ A;  4CGP A;  4OIW A;  3KR4 A;  5IB9 A;  1X10 A;  4CYQ A;  2D4P A;  1VHS A;  3IJ3 A;  4H6Z A;  5G22 A;  2CIJ A;  2DXQ A;  4ZI6 A;  3S6K A;  2EZA A;  2F8H A;  3GLJ A;  3KZW A;  2C5Q A;  2G3T A;  4YWY A;  2ZEP A;  3JTK A;  3OP0 A;  2VZY A;  3IO1 A;  3U88 C;  4NEX A;  3LD2 A;  4RS2 A;  4UEE A;  4ZX8 A;  3TYX A;  2AFW A;  1BPN A;  1Q2C A;  4C2X A;  2VBQ A;  3TT2 A;  4B6Z A;  2AFZ A;  4KS9 A;  3D7D A;  3UY5 A;  1Z8L A;  2CNM A;  2PJ2 A;  3FMC A;  3FX6 A;  4KOR A;  4PK3 A;  4UF4 A;  4HPS A;  4XNH B;  4YGO A;  2QVP A;  3V7Z A;  3S9M A;  1FNO A;  3FNC A;  1DTD A;  4B10 A;  4C8A A;  4II9 A;  2XEI A;  5JQ4 A;  1C3O B;  5I0C A;  2IMO A;  3I6S A;  1EZB A;  4HNX B;  4HNY B;  4NSQ A;  3VWE A;  4R9M A;  4ONU A;  5LYD A;  2EZC A;  4MCR A;  2GFQ A;  2VXK A;  4JJX A;  5A27 A;  2PC1 A;  2CTB A;  3IEH A;  1YGH A;  3EIF A;  4A37 A;  1EZA A;  3R1K A;  3TLG B;  3S9L A;  2RC4 A;  4Y49 B;  4CDJ A;  3QNV A;  3T5M A;  2PIZ A;  1XBU A;  2FCK A;  4HKF A;  4MHP A;  4OC5 A;  1IGB A;  1NMT A;  2EBJ A;  3D66 A;  5LRJ A;  3VH9 A;  2J8R A;  1B47 A;  3R9E A;  4XPD C;  3D3S A;  2AUN A;  5ISV A;  1GGO A;  1TIQ A;  3FEC A;  1UFH A;  1IY7 A;  1NE9 A;  1QQ9 A;  1QSM A;  2JDD A;  3NH8 A;  2ZEN A;  2REE A;  4FD6 A;  4YU9 A;  5HKY A;  5F49 A;  3WC5 A;  4A30 A;  3G23 A;  4KNG E;  1TXR A;  1IU8 A;  2PJ8 A;  2N3A B;  1S5K A;  5F46 A;  4U9Z A;  2EUI A;  4Q38 A;  4CYN A;  3N5F A;  7CPA A;  5JGF A; 
#chains in the Genus database with same CATH homology
 2AFX A;  4NFR A;  4X3R A;  4UIB A;  2ZEG A;  5D8N A;  2Q51 A;  8CPA A;  5I4M A;  4ZY1 A;  5LRK A;  3FF3 A;  3NH4 A;  2F7V A;  2EK9 A;  4FAI A;  1Q7L A;  2PJB A;  2NSM A;  4C8C A;  1EE3 P;  3FH4 A;  3FJU A;  4GM5 A;  2O53 A;  4F9V A;  4YN3 A;  1Y9Z A;  1YLO A;  4C9R A;  1LAN A;  3B35 A;  3GB0 A;  5CBM A;  4TJX A;  4JZ0 A;  2BCO A;  3PFE A;  4ZY2 A;  3BI0 A;  1TKH A;  1FT7 A;  4EFD A;  3KR5 A;  4MCP A;  4PQA A;  3HUV A;  4NGS A;  1VHO A;  3DLJ A;  1CBX A;  1TKJ A;  2GU2 A;  4Q7A A;  2C6C A;  2PJ7 A;  2WZN A;  4UEZ A;  2PCU A;  2GRE A;  3IIB A;  3HLP A;  3IC1 A;  2XEG A;  2AFO A;  3LMS A;  2V77 A;  1UWY A;  2C6P A;  3K9T A;  1BLL E;  2I3C A;  3TC8 A;  5LYL A;  5ELY A;  4BD9 A;  2V8V A;  3VAR A;  3WAB A;  3WC6 A;  4C9U A;  3SJF A;  2C1C A;  4C8F A;  5D29 A;  3B3W A;  5JM6 A;  3KQX A;  5J1Q A;  4NGT A;  1HDQ A;  2EWB A;  1Y7E A;  4ZY0 A;  1ZG8 A;  1M4L A;  1F2O A;  3K2K A;  2JBK A;  4TWE A;  4AXV A;  1LCP A;  4MHN A;  4P10 A;  3H8E A;  3RZA A;  1LAP A;  4PXC A;  5LRG A;  1XJO A;  5IR2 A;  3LWU A;  3SJX A;  2C6G A;  2ZEL A;  1CG2 A;  4P4J A;  4P4F A;  1TF9 A;  1RTQ A;  1XFO A;  3ISX A;  1YW4 A;  1LFW A;  3D7H A;  2HB6 A;  2PE3 A;  4NGM A;  2POK A;  3VAT A;  4DYO A;  3CPX A;  4PXE A;  1KWM A;  5DS0 A;  3KHZ A;  4MHY A;  3I1U A;  3PB7 X;  3SJG A;  4WJB A;  3WT4 A;  3B7I A;  4ZX9 A;  1TKF A;  2PJ6 A;  2EK8 A;  4TJV A;  1NSA A;  1XF1 A;  1ELL P;  2DEA A;  3D67 A;  1CX8 A;  4MCQ A;  1ARM A;  4MCS A;  4W9Y A;  2PJA A;  4OID A;  6CPA A;  4C8P A;  3T8W A;  1PYT B;  2HC9 A;  3SI0 A;  1AYE A;  4C8T A;  2WYR A;  4X2T A;  2QJ8 A;  3FED A;  3H8G A;  1F57 A;  3H8F A;  3MRU A;  2G9D A;  1OBR A;  2PJC A;  3B3S A;  3PB6 X;  3BXM A;  3V38 A;  2GP4 A;  4KSI A;  2J9A A;  1Y0Y A;  4DUK A;  2XEF A;  1R43 A;  4FUU A;  4TNU A;  1ZG9 A;  3B2Y A;  3D4U A;  5K8N A;  5CPA A;  1Y0R A;  2FVG A;  2ZED A;  3PB4 X;  4DJL A;  4P4B A;  3RBU A;  4CDK A;  3PFO A;  2ZEO A;  2OOT A;  3B3V A;  4MXU A;  4R76 A;  2BOA A;  4PPZ A;  1VIX A;  3NH5 A;  1V6C A;  1YW6 A;  2ZEF A;  3KHX A;  1BAV A;  4K3N A;  2XEJ A;  2V8G A;  1CPS A;  4F9U A;  4O23 A;  2ABZ A;  1XRY A;  3TX8 A;  4G1P A;  3VTA A;  1Z2L A;  2AFU A;  4IAV A;  4P6Y A;  3RAM A;  1QMU A;  5K8M A;  2IJZ A;  4X8I A;  4R8F A;  1ARL A;  1CP6 A;  4C9E A;  1LOK A;  4H2K A;  3SI2 A;  2CF4 A;  2PJ4 A;  4C99 A;  1F2P A;  3S9N A;  3B3T A;  3PBB A;  2V8D A;  4Z65 A;  5K8P A;  4ZYQ A;  1ZLI A;  5LYI A;  2PRQ A;  3WC7 A;  1CP7 A;  4UIA A;  2PJ5 A;  3GUX A;  4P44 A;  4R7M A;  3CPA A;  2ZEH A;  1ZG7 A;  3KAS A;  1ELM P;  3KGQ A;  3IFE A;  3JRU A;  5HVF A;  2PJ1 A;  1H8L A;  4F8Z A;  4P45 A;  1Z5R A;  3IWW A;  3ICU A;  2PJ3 A;  3KL9 A;  4OME A;  2NYQ A;  1LAM A;  2BO9 A;  2JBJ A;  4C8U A;  3FVL A;  3CDX A;  4IK2 A;  3D7F A;  1BPM A;  4EME A;  4WWV A;  4C86 A;  2GLF A;  4PXD A;  4LQG A;  4NJR A;  4A38 A;  5THW A;  3PEI A;  2Q4Z A;  4IHM A;  4EWT A;  3CT9 A;  4A39 A;  3FEE A;  4JYW A;  5LYF A;  2ZOG A;  2CTC A;  1XMB A;  4OC0 A;  5HVG A;  2Q43 A;  3BHX A;  3MN8 A;  4MHZ A;  4PXB A;  5HXD A;  1TF8 A;  4OC4 A;  1HEE A;  4NGR A;  4ONW A;  4NGQ A;  2JEW A;  5HVH A;  2AFM A;  3PRT A;  5K8O A;  3I74 A;  4P4E A;  4C85 A;  3ISZ A;  1AMP A;  1VHE A;  1HDU A;  1PCA A;  1YME A;  4OC1 A;  4OC2 A;  2ZEM A;  4P4I A;  2ZEE A;  4OKO A;  2PIY A;  2OR4 A;  5F09 A;  3B3C A;  4OP4 A;  4MMO A;  2PJ0 A;  3KQZ A;  3SI1 A;  2IQ6 A;  1CPX A;  3D7G A;  3SJE A;  4FBE A;  4UEF A;  2QYV A;  4NGN A;  2ANP A;  3PB9 X;  5JH9 A;  4CPA A;  2VL1 A;  3DGV A;  1DE4 C;  3NA6 A;  4C84 A;  2RFH A;  1ZLH A;  4P4D A;  2ZOF A;  1WVM A;  4FWU A;  1VGY A;  1R3N A;  3NFZ A;  3BI1 A;  2PVW A;  3L2N A;  1JQG A;  2O4H A;  4NGP A;  4A94 A;  3PBE A;  4RUH A;  1YSJ A;  2PJ9 A;  3PB8 X;  3KI9 A;  4C9V A;  2PVV A;  4OC3 A;  4NJQ A;  4C9A A;  1GYT A;  4MRI A;  2RB7 A;  2V8H A;  3D68 A;  4R6T A;  2AFS A;  2GLJ A;  4OIW A;  3KR4 A;  5IB9 A;  3IJ3 A;  2CIJ A;  4ZI6 A;  2F8H A;  3GLJ A;  3KZW A;  2C5Q A;  4YWY A;  2ZEP A;  4ZX8 A;  3IO1 A;  4UEE A;  2AFW A;  1BPN A;  4B6Z A;  2AFZ A;  3D7D A;  1Z8L A;  3FX6 A;  2PJ2 A;  3FMC A;  4UF4 A;  3V7Z A;  2QVP A;  3S9M A;  1FNO A;  1DTD A;  4C8A A;  2XEI A;  2IMO A;  3I6S A;  5LYD A;  4MCR A;  2CTB A;  3IEH A;  3EIF A;  4A37 A;  3S9L A;  4CDJ A;  3QNV A;  2PIZ A;  1XBU A;  5LRJ A;  3VH9 A;  4MHP A;  4OC5 A;  1IGB A;  3D66 A;  3FEC A;  1IY7 A;  4YU9 A;  1QQ9 A;  3NH8 A;  2ZEN A;  3WC5 A;  4KNG E;  1TXR A;  2PJ8 A;  3N5F A;  7CPA A;  5JGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...