3SJEA

X-ray structure of human glutamate carboxypeptidase ii (the e424a inactive mutant) in complex with n-acetyl-aspartyl-aminononanoic acid
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
690
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Novel Substrate-Based Inhibitors of Human Glutamate Carboxypeptidase II with Enhanced Lipophilicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3sjeA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3sjeA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3sjeA02
2EK9A 4R7MA 3IFEA 4YU9A 2FVGA 1ZLIA 3IWWA 1YW4A 4F8ZA 5D29A 2ZEPA 1ZG8A 3KASA 3VARA 2PVWA 3PFOA 1CP6A 3IIBA 1ELLP 4YWYA 3BI1A 4P45A 8CPAA 1PYTB 3EIFA 1CPSA 2PE3A 4MMOA 4DUKA 2ZOGA 2J9AA 4MCQA 5JGFA 2AFMA 4A39A 1EE3P 4MXUA 5LYIA 1GYTA 4ZYQA 4W9YA 2ZEEA 1VGYA 3IJ3A 3SI2A 1Z2LA 1F2PA 4NGRA 4FWUA 2PCUA 1LFWA 2ZEDA 5LYFA 4MCSA 2PRQA 4IK2A 3QNVA 3VATA 4MRIA 3HUVA 4P4DA 4C9RA 4ZX9A 2EK8A 3K9TA 2ZELA 4MCRA 3T8WA 3D7HA 2BO9A 3H8FA 3IC1A 4R6TA 2WZNA 2C6GA 5IB9A 4CDJA 3WABA 4TJVA 4C8CA 4NGQA 3PFEA 4PXEA 3WC6A 7CPAA 3MN8A 4FBEA 3NH5A 1R43A 1TXRA 2AFZA 4EFDA 3D67A 4LQGA 2C6CA 5K8PA 3PB8X 4PQAA 2OR4A 3D7DA 1BLLE 4JZ0A 1Y0RA 2GU2A 2ZEMA 2V8DA 1ARLA 3CPXA 3L2NA 4P4FA 4KSIA 3SJGA 4MHPA 2AFWA 2JBKA 4WJBA 2GLJA 4OC2A 1LAPA 4UEEA 4UEFA 3DGVA 4PXCA 2IMOA 4OIWA 1DTDA 4RUHA 3B3VA 3PB9X 4Z65A 2IJZA 1XMBA 2PJ9A 2PJ0A 3PB4X 4MCPA 4FAIA 4C8AA 3IO1A 4AXVA 1V6CA 4P4EA 3S9LA 3S9MA 3B35A 4ONWA 3ICUA 4MHZA 2Q51A 2F8HA 3ISXA 4C85A 2XEFA 1Z5RA 3FF3A 1ZG7A 5CBMA 5LRGA 1ZG9A 2AFOA 1ELMP 2ZEHA 1Y7EA 4P44A 1Z8LA 3SJFA 1KWMA 3LMSA 4YN3A 4WWVA 2F7VA 1XBUA 4X8IA 1AYEA 4OKOA 1YLOA 1QQ9A 2POKA 4FUUA 4PPZA 3GUXA 3D7GA 4MHNA 5K8NA 1XFOA 4NGMA 1AMPA 3FVLA 2EWBA 1VIXA 2ZEFA 2PJ2A 5J1QA 3KI9A 3CDXA 3S9NA 5ELYA 3FEDA 1XJOA 3B7IA 2BOAA 5K8MA 2AFSA 2VL1A 3D66A 2O53A 4P6YA 1QMUA 2GLFA 2GREA 4C8PA 3H8EA 5LRJA 4NJRA 3NH8A 2ABZA 3KHZA 2C1CA 4ZY0A 4ZX8A 5LRKA 3PEIA 3V7ZA 4DJLA 3VH9A 3V38A 2PJ6A 2XEIA 4TNUA 4CDKA 5D8NA 3D68A 3ISZA 4TWEA 3WC5A 3BI0A 3B3TA 4OP4A 1JQGA 4CPAA 3SI0A 1ARMA 3B3CA 1CG2A 2XEJA 4EMEA 4K3NA 2XEGA 3PB6X 5LYDA 3HLPA 5I4MA 4P4BA 2NSMA 3BXMA 3NH4A 4PXBA 3D7FA 1YSJA 4JYWA 4IHMA 4BD9A 2WYRA 4TJXA 2PJBA 1TF8A 4C9AA 2PJAA 4A94A 4ZI6A 2V8GA 3N5FA 3I6SA 2PJCA 2QYVA 3PBEA 4P10A 2CTCA 5CPAA 4NGPA 5HVHA 4MHYA 1TKHA 1M4LA 2AFXA 3PB7X 1F2OA 1F57A 2BCOA 4NGNA 5THWA 3SJXA 3FJUA 2V8VA 3JRUA 4PXDA 5DS0A 1BPNA 2PIZA 3CPAA 5HVGA 2QJ8A 3B2YA 4OC1A 5HVFA 4NJQA 2PJ3A 4R76A 1CPXA 4EWTA 1YMEA 3CT9A 1CX8A 3VTAA 3FECA 2PJ5A 4R8FA 2JBJA 5F09A 2NYQA 4C9UA 1OBRA 4A37A 5LYLA 4C99A 3FEEA 2OOTA 3KGQA 4UF4A 1NSAA 3NFZA 1CP7A 1TKFA 4C86A 3H8GA 2IQ6A 3BHXA 4NGTA 3SJEA 1R3NA 2ZOFA 3WC7A 1LCPA 1RTQA 3K2KA 1XRYA 1XF1A 4OC5A 4C9VA 2PJ8A 4GM5A 3RAMA 2C6PA 2PJ7A 3KQXA 1PCAA 2RFHA 4C9EA 3RBUA 4ZY2A 3WT4A 3D4UA 4O23A 4C8TA 4C8UA 1FT7A 4ZY1A 1TF9A 1UWYA 1TKJA 1LOKA 3KHXA 1LAMA 2CTBA 3SI1A 2O4HA 2Q4ZA 2V77A 1WVMA 2JEWA 3TC8A 1IGBA 3I74A 4B6ZA 5JH9A 2PVVA 1VHEA 4H2KA 1VHOA 1ZLHA 5JM6A 1DE4C 3FH4A 5HXDA 4P4IA 4X3RA 4C8FA 3KQZA 4KNGE 4NGSA 2Q43A 4OC0A 4DYOA 1Y9ZA 3LWUA 3RZAA 1HEEA 1HDQA 1CBXA 3KZWA 3GB0A 5K8OA 4X2TA 1BPMA 4F9VA 4A38A 2I3CA 2ANPA 4P4JA 2AFUA 2ZEGA 4OIDA 2HB6A 4OC4A 2PIYA 2CIJA 3FMCA 1HDUA 2V8HA 4NFRA 3TX8A 1YW6A 4UIBA 3KR4A 4UEZA 1FNOA 3GLJA 4G1PA 3FX6A 2DEAA 4Q7AA 2PJ4A 3B3SA 2HC9A 3DLJA 3PBBA 4IAVA 2ZEOA 2RB7A 1LANA 3KR5A 3IEHA 1IY7A 2PJ1A 3NA6A 4F9UA 6CPAA 4OC3A 3B3WA 4C84A 4UIAA 1Q7LA 4OMEA 2CF4A 2G9DA 3PRTA 1Y0YA 2QVPA 1BAVA 2ZENA 3MRUA 3I1UA 3KL9A 1H8LA
chains in the Genus database with same CATH superfamily
3VWDA 3TLCA 4UBRA 4UA3A 2EK9A 3OP0A 2Q0YA 2AUMA 2BSWA 4R7MA 3IFEA 4YU9A 2FVGA 5DWMA 4B5PA 4KVOE 5F13A 1ZLIA 1IU8A 4KS9A 3IWWA 5IV0A 2HV2A 1YW4A 3BJ8A 3FBUA 1NXJA 2WSAA 3C8OA 1IICA 5F49A 3EY5A 4F8ZA 4CS0B 1N71A 5D29A 4UFVA 3TO6A 2ZEPA 1ZG8A 3KASA 3VARA 1OZPA 5KTAA 2PVWA 3PFOA 1CP6A 4CGOA 3IIBA 1BOBA 1Q2DA 4M6GA 3D2PA 3NOJA 5KTDA 2EZAA 5BY0A 1ELLP 4YWYA 1Z8XA 3BI1A 3FNCA 4P45A 8CPAA 1PYTB 4UFXA 4KVME 4Q36A 3EIFA 1YREA 2Q04A 2QMLA 1R57A 1Z9EA 3VRNA 5EC4A 1CJWA 2OZGA 1CPSA 2PE3A 4MMOA 3S6HA 2ZOGA 4DUKA 4XNHC 2Q7BA 2YNEA 2ZXVA 2XPNA 2J9AA 4H6UA 3SXNA 1A2ZA 5HKWA 4CRZB 4MCQA 2R8VA 1JDBC 5JGFA 2HROA 4E94A 4C2YA 5JPHA 1S5KA 2AFMA 3BUWB 5I4MA 4A39A 3R9FA 1Y9KA 3F8KA 4H6ZA 1EE3P 3T5MA 4CZ1A 2I79A 4MXUA 5LYIA 3S6FA 4CGMA 4B5OA 1GYTA 1Z4EA 1ZO0A 4ZYQA 3PGPA 4CGPA 4B11A 2CNMA 3EZAA 4W9YA 2VZZA 5F48A 1R61A 2ZEEA 1VGYA 2GIVA 2CXAA 2YGWA 3H5ZA 3VRQA 1YK3A 3BUMB 3IJ3A 1J3LA 3SI2A 1Z2LA 5FVJA 1F2PA 1CM0A 1Y9WA 4NGRA 3R1KA 2GANA 2GE3A 1X10A 4FWUA 4FD4A 2Q4YA 2PCUA 1LFWA 1SQHA 2ZEDA 4OAEA 3SHPA 1YLEA 4A32A 5LYFA 2ZW5A 4MCSA 1GGOA 1FBVA 2PRQA 3MGDA 4FD6A 4IK2A 4H1HA 5IR2A 3QNVA 3VATA 1XMTA 4KSFA 4MRIA 3TT2A 4H89A 3HUVA 4UCNA 3TLAA 4P4DA 1X12A 2B4JC 4C9RA 4ZX9A 2EK8A 2Z11A 2OH1A 3K9TA 4DNCA 3OWCA 2ZELA 3JVNA 4MCRA 3V8IA 4B12A 4NEXA 3T8WA 1VI4A 2PR1A 4MBUA 3D7HA 1QSOA 4AG9A 2BO9A 4KSAA 5E96A 3H8FA 3IC1A 4CAXA 3S6GA 4PSWA 4R87A 4UCMA 1KUYA 2HWGA 3T07A 1XEBA 4R6TA 2WZNA 5DWNA 1LRZA 4KZTA 2C6GA 1UFHA 3TTHA 4XPDC 5IB9A 1EZBA 1J4JA 4CRYB 4CDJA 4NCZA 3WABA 2YJVA 4TJVA 4C8CA 4MY0A 5HH1A 4NGQA 3W6XA 3PLFB 3PFEA 2PCNA 2CNTA 4PXEA 3WC6A 7CPAA 3MN8A 4FBEA 3NH5A 2H5MA 1R43A 3TO7A 4CAEA 4MY3A 1TXRA 4A31A 4JWPA 3D67A 4EFDA 4KOVA 4LQGA 2C6CA 1JWQA 1S7LA 5K8PA 1KEEB 3PB8X 3EFAA 4PQAA 2OR4A 3D7DA 2PSWA 1BLLE 4JZ0A 5J3XA 1Y0RA 2DF5A 2OU2A 2GU2A 4CYNA 2CBLA 2JDCA 2Q44A 4R57A 2ZEMA 2GP4A 4EVYA 2V8DA 2F5IA 1M6VB 3G23A 1ARLA 3CPXA 2AUNA 3L2NA 3PP9A 3TLGA 2AE6A 5G1ZA 1NBWA 4P4FA 4KSIA 5C88A 2N3AB 3KRVA 3SJGA 5IX3A 4MHPA 2AFWA 2ZW6A 2HI6A 3SXOA 1RO5A 1ZRSA 2JBKA 2JLMA 1XIXA 2J8MA 4M8DA 4WJBA 3R9GA 4AVBA 2GLJA 3R9EA 4MFQA 4R3KA 4U9ZA 4OC2A 1LAPA 2PRBA 4E8OA 4CYOA 2P0WA 4UEEA 1FY7A 4UEFA 3EZEA 1EZAA 2DLAA 4L8AA 5H86A 3DGVA 4B13A 4CGLA 4GPLB 2K5TA 4PXCA 2IMOA 4KOYA 3CZXA 2Z3OA 4OIWA 1DTDA 4RUHA 4CYPA 1B47A 1S7FA 3B3VA 3PB9X 1NSLA 4Z65A 1M44A 2IJZA 1XMBA 2PJ9A 2PJ0A 3PB4X 4MCPA 5A28A 3OB1B 3QAHA 2E28A 5KTCA 5F9MA 5JYBA 2FXFA 3TCVA 4FAIA 2EUIA 5K99A 4ZBGA 5C82A 3IO1A 4Y49C 4AXVA 4C8AA 1V6CA 4P4EA 2AJ6A 4MHDA 3S9LA 5FD8A 3S9MA 3IWEA 3F9KC 3B35A 1VKCA 4ONWA 4MHZA 3R96A 4ZGYB 3ICUA 2Q51A 2F8HA 3D3SA 3ISXA 1T36B 1VBGA 2D4PA 4JJXA 2VQYA 3EZBA 3CXQA 2XEFA 1NMTA 1V0CA 3TLGB 4C85A 3U88C 2A4NA 5AG5A 4C68A 4CGNA 1Z5RA 3FF3A 1ZG7A 5CBMA 5LRGA 1Q2YA 1ZG9A 2EZCA 2AFOA 2Z3LA 1ELMP 2ZEHA 3FIXA 1QSMA 4GXHA 3TFYA 4BBHA 1Y7EA 4F0XA 4P44A 1Z8LA 3SJFA 1KWMA 5JQ4A 3LMSA 3E0KA 4YN3A 4WWVA 2NMTA 2G3TA 3C26A 2KCWA 2F7VA 1BO4A 1XBUA 3IU2A 1AYEA 2J8RA 4OKOA 4X8IA 5ISVA 4AVCA 1YLOA 1QQ9A 3RYOA 2POKA 1CS0B 4FUUA 4NF1A 4PPZA 4ORFA 5F5XA 1GHEA 1XE4A 2WPXA 3GUXA 3D7GA 4MHNA 4RI1A 4RS2A 2FS5A 5K8NA 5CNPA 2EVNA 2P6GA 3U1BA 2ZW4A 1ZYMA 4B5PB 1XFOA 2JDDA 4MFPA 4MFLA 4NGMA 4M6IA 4QB9A 1XOVA 1KUVA 2Z3PA 2Z0ZA 2Z3MA 1AMPA 3FVLA 2PQ8A 3JTKA 1L0CA 2EWBA 4CYQA 1WK4A 3BLNA 4JVOA 1I1DA 1VIXA 2ZEFA 2PJ2A 5J1QA 1YQEA 3KI9A 3OB2B 1NE9A 3ZNIA 1IYKA 4A4CA 4CAWA 3GJZA 1Z8WA 4IUSA 2R1IA 4CO9A 3CDXA 3S9NA 5ELYA 3FEDA 1Q2CA 2GFQA 1XJOA 3B7IA 2BOAA 5K8MA 2AFSA 2VL1A 1XF8A 3D66A 2B5GA 4KOXA 4MFKA 2O53A 4P6YA 3ZJ0A 4A33A 1QMUA 3N7ZA 3I3GA 2GLFA 4PK3A 5AG4A 3F0AA 2GREA 4C8PA 4A2ZA 3H8EA 5LRJA 5JVLA 2Z3NA 3BUOB 4YFJA 3RNZA 4BINA 4IIXA 2WUUA 4NJRA 4BMHA 3NH8A 2ABZA 4COGA 3KHZA 2C1CA 2DPSA 4HNWB 4ZY0A 3WR7A 4XNHB 4ZX8A 1S7KA 5LRKA 1CE8B 4B14A 3DDDA 1P0HA 2XPLA 3PEIA 3V7ZA 3BUXB 4DJLA 5H84A 3VH9A 4AB7A 2FL4A 2PJ6A 3V38A 3LD2A 3NFQA 2XEIA 4TNUA 4CDKA 5D8NA 3CXPA 3D68A 4XPLA 3ISZA 4TWEA 4E0AA 1A9XB 4B10A 1BXRB 4HKFA 2DIKA 3VRRA 3WC5A 5A27A 1M4IA 2IL4A 4R3LA 2B3UA 3BI0A 4RR2B 3B3TA 4KLVA 4KVXA 4OP4A 1JQGA 4CPAA 3SI0A 1ARMA 3B3CA 1MJ9A 4OLLA 4HNYB 1CG2A 2XEJA 2YNCC 4JD6A 3GIUA 3PT1A 3FXTA 4EMEA 3SR3A 4K3NA 2XEGA 3D8PA 3PB6X 5LYDA 2BEIA 1I21A 3HLPA 2G3AA 4P4BA 2B4DA 2NSMA 3BXMA 3LACA 2RC4A 4OADA 3NH4A 5G22A 4HPSA 3VWEA 3EXNA 4M6HA 2R82A 4PXBA 3D7FA 4BPUB 1YSJA 2YJTA 5F46A 4JYWA 3H4QA 2O28A 4IHMA 2C27A 3GKRA 4C7HA 2UV8G 5G20A 4A95A 4BD9A 4F6AA 2WYRA 4TJXA 4HNXB 3TE4A 2PJBA 1TF8A 4C9AA 2PJAA 3TLEA 1MJAA 4CAVA 4A94A 4ZI6A 4J0NA 4E5SA 2V8GA 3N5FA 3I6SA 2PJCA 2FT0A 2VZYA 3D2MA 2FCKA 2Z3KA 3IU1A 2QYVA 3PBEA 4P10A 2CTCA 5CPAA 2BL1A 4UWIA 4NGPA 3RO0A 2Z10A 4II9A 5HVHA 3QB8A 4A4BA 4KOUA 4MHYA 1TKHA 4IF5A 2G0BA 2P6FA 2VI7A 2ODFA 1M4LA 1WJTA 3T05A 2D0PA 2AFXA 3FYNA 4EYSA 3PB7X 1B87A 1F2OA 1F57A 2BCOA 4C2ZA 4NGNA 4MFJA 3IGRA 3I9SA 4XPDB 3SJXA 3FJUA 4Q38A 5THWA 2FIAA 2B58A 3VRPA 2V8VA 3P2FA 2ARHA 3JRUA 4U9YA 4YGOA 4KORA 5EMIA 4PXDA 1RXTA 5DS0A 3T90A 1BPNA 1P4NA 4LUAA 4MI4A 2PIZA 3CPAA 2ZW7A 5HVGA 4MJXA 4CAFA 2QJ8A 3O8ZA 3B2YA 3FRMA 1YVKA 4I49A 1ZL0A 4OC1A 5J8FA 1KUXA 5HVFA 1C3OB 4NJQA 3HPHE 2PJ3A 4R76A 2D4OA 2EO8A 2FIWA 2VKZG 3OAKA 1CPXA 1YVOA 1YGHA 4EWTA 1YMEA 3CT9A 1CX8A 5HMNA 3VTAA 3FECA 1DIKA 2PJ5A 4R8FA 4XPKA 2C5QA 2JBJA 5F09A 2NYQA 3K4IA 5F1YA 1OBRA 1IIDA 4A37A 4C9UA 5LYLA 2OZUA 4C7IA 3FEEA 2OOTA 3KGQA 3W6SA 5I0CA 4UF4A 3TYXA 4C99A 1M4GA 4INJA 1NSAA 2QIRA 1S60A 3NFZA 1CP7A 1TKFA 4C86A 2IQ6A 3H8GA 3BHXA 4NGTA 3SJEA 1R3NA 1TIQA 2ZOFA 5G21A 4E2AA 2FM4A 5HKZA 1LCPA 2B3VA 3NE7A 3QAYA 2P6EA 1RTQA 4LQ6A 3WC7A 5J8CA 4IIYA 4KOWA 4PSXA 3KKWA 4FD5A 1S7NA 3EO4A 3K2KA 2REFA 4JXRA 2HQYA 1XRYA 3NE8A 3P2HA 3VGOA 1XF1A 4OC5A 4RN7A 2PJ8A 4M3SA 4GM5A 3K9UA 1MK4A 3RAMA 2OB0A 2C6PA 2PJ7A 2WPWA 3KQXA 5AG6A 5GCNA 3CXSA 1PCAA 1VHSA 2PC1A 4KUAA 2FE7A 4UWJA 2RFHA 1WWZA 4L89A 4C9EA 3PFVA 2YNDA 1KZFA 3RBUA 3GYAA 4NXYA 4PK2A 4R9MA 4ZY2A 3WT4A 5HKYA 3D4UA 2ZPAA 2X7BA 4O23A 1FT7A 4ZY1A 4C8TA 4C8UA 4Y49B 4KOSA 1TF9A 1UWYA 3TLZA 1TKJA 4FD7A 2HUZA 2VXKA 4QUSA 2OLSA 4BPWB 1LOKA 3KHXA 1QSTA 1LAMA 2CNSA 1IB1E 2VEZA 1Z4RA 1JDEA 2CTBA 2Q4VA 3A9LA 2B4BA 4A30A 1AUGA 2O4HA 3SI1A 2Q4ZA 2REEA 2PDOA 2V77A 3IWGA 1WVMA 1IOFA 2JEWA 2VBQA 1IGBA 3TC8A 3TOAA 3TO9A 2PR8A 3PZJA 3DSBA 4B6ZA 3I74A 4UCPA 2PVVA 5JH9A 1VHEA 1Q5XA 4H2KA 2FSRA 2EZBA 3KL9A 1VHOA 1ZLHA 2R7HA 4JXQA 5JM6A 3TLBA 2Y0MA 4KLWA 2Q7SA 1DE4C 3FH4A 5HXDA 4P4IA 4X3RA 3LODA 4LX9A 1M1DA 5IB0A 2D0OA 4C8FA 3F5BA 3KQZA 4KNGE 4NGSA 1YVHA 4BPXB 2Q43A 4OC0A 4DYOA 1Y9ZA 3LWUA 4MJ8A 3DR6A 1HEEA 2OZHA 1HDQA 3RZAA 3S6KA 4M85A 1YX0A 2EBJA 2Y1MA 1QSNA 4UFWA 5AXIA 4COBA 4QVTA 1KBLA 5AG7A 1C30B 1Z9UA 1CBXA 3KZWA 2I00A 1QSRA 4MFZA 3T9YA 3B8GA 3GB0A 3W91A 4C9VA 4GS4A 5K8OA 4F0YA 4X2TA 4AG7A 1BPMA 1VBHA 1M4DA 4F9VA 4A38A 2I3CA 2ANPA 1IOIA 4P4JA 2AFUA 2B5GB 3UY5A 3TLYA 2ZEGA 4OIDA 2HB6A 3T0TA 4OC4A 3GY9A 2R98A 2PIYA 4J3GA 4YRHA 2YNCA 2CIJA 2XPOA 1PU9A 1MJBA 3FMCA 1HDUA 2XPPA 4BTFA 2V8HA 4NFRA 5AGEA 1K4JA 2MP0A 1YR0A 3TX8A 1YW6A 4QC6A 4QBJA 2X0SA 3G8WA 2DXQA 4UIBA 3VROA 1IYLA 3KR4A 4UEZA 1FNOA 5BWAB 1B6BA 1Z8TA 3GLJA 4KUBA 4G1PA 1U6MA 4MI1A 1KC7A 3BUNB 1ON0A 1PUAA 2DEAA 3FB3A 3FX6A 2ATRA 2DPTA 2PJ4A 3B3SA 4Q7AA 3R95A 4AVAA 4U5YA 4K30A 2Y1NA 1Y7RA 4C2XA 2HC9A 3DLJA 3PBBA 4IAVA 2ZEOA 4NSQA 3JUWA 2RB7A 1LANA 3G3SA 3HPGG 3KR5A 3IEHA 1IY7A 4ONUA 3HMJG 4KOTA 2CY2A 2PJ1A 2QECA 3NA6A 4F9UA 1EO0A 6CPAA 4OC3A 5EBVA 2J8NA 2BUEA 3B3WA 3DNSA 1S3ZA 2JEVA 4UIAA 4C84A 1Q7LA 3DR8A 4OMEA 3TOBA 5F47A 3BJ7A 4X5KA 2CF4A 3ZZIA 2G9DA 3PRTA 4JLYA 4PV6A 1Y0YA 2B4DB 2QVPA 1BAVA 2ZENA 1I12A 3MRUA 3I1UA 2B0AA 2AFZA 3EC4A 1H8LA
chains in the Genus database with same CATH topology
2EK9A 4R7MA 3IFEA 4YU9A 2FVGA 1ZLIA 3IWWA 1YW4A 4F8ZA 5D29A 2ZEPA 1ZG8A 3KASA 3VARA 2PVWA 3PFOA 1CP6A 3IIBA 1ELLP 4YWYA 3BI1A 4P45A 8CPAA 1PYTB 3EIFA 1CPSA 2PE3A 4MMOA 4DUKA 2ZOGA 2J9AA 4MCQA 5JGFA 2AFMA 4A39A 1EE3P 4MXUA 5LYIA 1GYTA 4ZYQA 4W9YA 2ZEEA 1VGYA 3IJ3A 3SI2A 1Z2LA 1F2PA 4NGRA 4FWUA 2PCUA 1LFWA 2ZEDA 5LYFA 4MCSA 2PRQA 4IK2A 5IR2A 3QNVA 3VATA 4MRIA 3HUVA 4P4DA 4C9RA 4ZX9A 2EK8A 3K9TA 2ZELA 4MCRA 3T8WA 3D7HA 2BO9A 3H8FA 3IC1A 4R6TA 2WZNA 2C6GA 5IB9A 4CDJA 3WABA 4TJVA 4C8CA 4NGQA 3PFEA 4PXEA 3WC6A 7CPAA 3MN8A 4FBEA 3NH5A 1R43A 1TXRA 2AFZA 4EFDA 3D67A 4LQGA 2C6CA 5K8PA 3PB8X 4PQAA 2OR4A 3D7DA 1BLLE 4JZ0A 1Y0RA 2GU2A 2ZEMA 2GP4A 2V8DA 1ARLA 3CPXA 3L2NA 4P4FA 4KSIA 3SJGA 4MHPA 2AFWA 2JBKA 4WJBA 2GLJA 4OC2A 1LAPA 4UEEA 4UEFA 3DGVA 4PXCA 2IMOA 4OIWA 1DTDA 4RUHA 3B3VA 3PB9X 4Z65A 2IJZA 1XMBA 2PJ9A 2PJ0A 3PB4X 4MCPA 4FAIA 4C8AA 3IO1A 4AXVA 1V6CA 4P4EA 3S9LA 3S9MA 3B35A 4ONWA 3ICUA 4MHZA 2Q51A 2F8HA 3ISXA 4C85A 2XEFA 1Z5RA 3FF3A 1ZG7A 5CBMA 5LRGA 1ZG9A 2AFOA 1ELMP 2ZEHA 1Y7EA 4P44A 1Z8LA 3SJFA 1KWMA 3LMSA 4YN3A 4WWVA 2F7VA 1XBUA 4X8IA 1AYEA 4OKOA 1YLOA 1QQ9A 2POKA 4FUUA 4PPZA 3GUXA 3D7GA 4MHNA 5K8NA 1XFOA 4NGMA 1AMPA 3FVLA 2EWBA 1VIXA 2ZEFA 2PJ2A 5J1QA 3KI9A 3CDXA 3S9NA 5ELYA 3FEDA 1XJOA 3B7IA 2BOAA 5K8MA 2AFSA 2VL1A 3D66A 2O53A 4P6YA 1QMUA 2GLFA 2GREA 4C8PA 3H8EA 5LRJA 4NJRA 3NH8A 2ABZA 3KHZA 2C1CA 4ZY0A 4ZX8A 5LRKA 3PEIA 3V7ZA 4DJLA 3VH9A 3V38A 2PJ6A 2XEIA 4TNUA 4CDKA 5D8NA 3D68A 3ISZA 4TWEA 3WC5A 3BI0A 3B3TA 4OP4A 1JQGA 4CPAA 3SI0A 1ARMA 3B3CA 1CG2A 2XEJA 4EMEA 4K3NA 2XEGA 3PB6X 5LYDA 3HLPA 5I4MA 4P4BA 2NSMA 3BXMA 3NH4A 4PXBA 3D7FA 1YSJA 4JYWA 4IHMA 4BD9A 2WYRA 4TJXA 2PJBA 1TF8A 4C9AA 2PJAA 4A94A 4ZI6A 2V8GA 3N5FA 3I6SA 2PJCA 2QYVA 3PBEA 4P10A 2CTCA 5CPAA 4NGPA 5HVHA 4MHYA 1TKHA 1M4LA 2AFXA 3PB7X 1F2OA 1F57A 2BCOA 4NGNA 5THWA 3SJXA 3FJUA 2V8VA 3JRUA 4PXDA 5DS0A 1BPNA 2PIZA 3CPAA 5HVGA 2QJ8A 3B2YA 4OC1A 5HVFA 4NJQA 2PJ3A 4R76A 1CPXA 4EWTA 1YMEA 3CT9A 1CX8A 3VTAA 3FECA 2PJ5A 4R8FA 2C5QA 2JBJA 5F09A 2NYQA 4C9UA 1OBRA 4A37A 5LYLA 4C99A 3FEEA 2OOTA 3KGQA 4UF4A 1NSAA 3NFZA 1CP7A 1TKFA 4C86A 3H8GA 2IQ6A 3BHXA 4NGTA 3SJEA 1R3NA 2ZOFA 3WC7A 1LCPA 1RTQA 3K2KA 1XRYA 1XF1A 4OC5A 4C9VA 2PJ8A 4GM5A 3RAMA 2C6PA 2PJ7A 3KQXA 1PCAA 2RFHA 4C9EA 3RBUA 4ZY2A 3WT4A 3D4UA 4O23A 4C8TA 4C8UA 1FT7A 4ZY1A 1TF9A 1UWYA 1TKJA 1LOKA 3KHXA 1LAMA 2CTBA 3SI1A 2O4HA 2Q4ZA 2V77A 1WVMA 2JEWA 3TC8A 1IGBA 3I74A 4B6ZA 5JH9A 2PVVA 1VHEA 4H2KA 1VHOA 1ZLHA 5JM6A 1DE4C 3FH4A 5HXDA 4P4IA 4X3RA 4C8FA 3KQZA 4KNGE 4NGSA 2Q43A 4OC0A 4DYOA 1Y9ZA 3LWUA 3RZAA 1HEEA 1HDQA 1CBXA 3KZWA 3GB0A 5K8OA 4X2TA 1BPMA 4F9VA 4A38A 2I3CA 2ANPA 4P4JA 2AFUA 2ZEGA 4OIDA 2HB6A 4OC4A 2PIYA 2CIJA 3FMCA 1HDUA 2V8HA 4NFRA 3TX8A 1YW6A 4UIBA 3KR4A 4UEZA 1FNOA 3GLJA 4G1PA 3FX6A 2DEAA 4Q7AA 2PJ4A 3B3SA 2HC9A 3DLJA 3PBBA 4IAVA 2ZEOA 2RB7A 1LANA 3KR5A 3IEHA 1IY7A 2PJ1A 3NA6A 4F9UA 6CPAA 4OC3A 3B3WA 4C84A 4UIAA 1Q7LA 4OMEA 2CF4A 2G9DA 3PRTA 1Y0YA 2QVPA 1BAVA 2ZENA 3MRUA 3I1UA 3KL9A 1H8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK9 A;  4R7M A;  3IFE A;  4YU9 A;  2FVG A;  1ZLI A;  3IWW A;  1YW4 A;  4F8Z A;  5D29 A;  2ZEP A;  1ZG8 A;  3KAS A;  3VAR A;  2PVW A;  3PFO A;  1CP6 A;  3IIB A;  1ELL P;  4YWY A;  3BI1 A;  4P45 A;  8CPA A;  1PYT B;  3EIF A;  1CPS A;  2PE3 A;  4MMO A;  4DUK A;  2ZOG A;  2J9A A;  4MCQ A;  5JGF A;  2AFM A;  4A39 A;  1EE3 P;  4MXU A;  5LYI A;  1GYT A;  4ZYQ A;  4W9Y A;  2ZEE A;  1VGY A;  3IJ3 A;  3SI2 A;  1Z2L A;  1F2P A;  4NGR A;  4FWU A;  2PCU A;  1LFW A;  2ZED A;  5LYF A;  4MCS A;  2PRQ A;  4IK2 A;  3QNV A;  3VAT A;  4MRI A;  3HUV A;  4P4D A;  4C9R A;  4ZX9 A;  2EK8 A;  3K9T A;  2ZEL A;  4MCR A;  3T8W A;  3D7H A;  2BO9 A;  3H8F A;  3IC1 A;  4R6T A;  2WZN A;  2C6G A;  5IB9 A;  4CDJ A;  3WAB A;  4TJV A;  4C8C A;  4NGQ A;  3PFE A;  4PXE A;  3WC6 A;  7CPA A;  3MN8 A;  4FBE A;  3NH5 A;  1R43 A;  1TXR A;  2AFZ A;  4EFD A;  3D67 A;  4LQG A;  2C6C A;  5K8P A;  3PB8 X;  4PQA A;  2OR4 A;  3D7D A;  1BLL E;  4JZ0 A;  1Y0R A;  2GU2 A;  2ZEM A;  2V8D A;  1ARL A;  3CPX A;  3L2N A;  4P4F A;  4KSI A;  3SJG A;  4MHP A;  2AFW A;  2JBK A;  4WJB A;  2GLJ A;  4OC2 A;  1LAP A;  4UEE A;  4UEF A;  3DGV A;  4PXC A;  2IMO A;  4OIW A;  1DTD A;  4RUH A;  3B3V A;  3PB9 X;  4Z65 A;  2IJZ A;  1XMB A;  2PJ9 A;  2PJ0 A;  3PB4 X;  4MCP A;  4FAI A;  4C8A A;  3IO1 A;  4AXV A;  1V6C A;  4P4E A;  3S9L A;  3S9M A;  3B35 A;  4ONW A;  3ICU A;  4MHZ A;  2Q51 A;  2F8H A;  3ISX A;  4C85 A;  2XEF A;  1Z5R A;  3FF3 A;  1ZG7 A;  5CBM A;  5LRG A;  1ZG9 A;  2AFO A;  1ELM P;  2ZEH A;  1Y7E A;  4P44 A;  1Z8L A;  3SJF A;  1KWM A;  3LMS A;  4YN3 A;  4WWV A;  2F7V A;  1XBU A;  4X8I A;  1AYE A;  4OKO A;  1YLO A;  1QQ9 A;  2POK A;  4FUU A;  4PPZ A;  3GUX A;  3D7G A;  4MHN A;  5K8N A;  1XFO A;  4NGM A;  1AMP A;  3FVL A;  2EWB A;  1VIX A;  2ZEF A;  2PJ2 A;  5J1Q A;  3KI9 A;  3CDX A;  3S9N A;  5ELY A;  3FED A;  1XJO A;  3B7I A;  2BOA A;  5K8M A;  2AFS A;  2VL1 A;  3D66 A;  2O53 A;  4P6Y A;  1QMU A;  2GLF A;  2GRE A;  4C8P A;  3H8E A;  5LRJ A;  4NJR A;  3NH8 A;  2ABZ A;  3KHZ A;  2C1C A;  4ZY0 A;  4ZX8 A;  5LRK A;  3PEI A;  3V7Z A;  4DJL A;  3VH9 A;  3V38 A;  2PJ6 A;  2XEI A;  4TNU A;  4CDK A;  5D8N A;  3D68 A;  3ISZ A;  4TWE A;  3WC5 A;  3BI0 A;  3B3T A;  4OP4 A;  1JQG A;  4CPA A;  3SI0 A;  1ARM A;  3B3C A;  1CG2 A;  2XEJ A;  4EME A;  4K3N A;  2XEG A;  3PB6 X;  5LYD A;  3HLP A;  5I4M A;  4P4B A;  2NSM A;  3BXM A;  3NH4 A;  4PXB A;  3D7F A;  1YSJ A;  4JYW A;  4IHM A;  4BD9 A;  2WYR A;  4TJX A;  2PJB A;  1TF8 A;  4C9A A;  2PJA A;  4A94 A;  4ZI6 A;  2V8G A;  3N5F A;  3I6S A;  2PJC A;  2QYV A;  3PBE A;  4P10 A;  2CTC A;  5CPA A;  4NGP A;  5HVH A;  4MHY A;  1TKH A;  1M4L A;  2AFX A;  3PB7 X;  1F2O A;  1F57 A;  2BCO A;  4NGN A;  5THW A;  3SJX A;  3FJU A;  2V8V A;  3JRU A;  4PXD A;  5DS0 A;  1BPN A;  2PIZ A;  3CPA A;  5HVG A;  2QJ8 A;  3B2Y A;  4OC1 A;  5HVF A;  4NJQ A;  2PJ3 A;  4R76 A;  1CPX A;  4EWT A;  1YME A;  3CT9 A;  1CX8 A;  3VTA A;  3FEC A;  2PJ5 A;  4R8F A;  2JBJ A;  5F09 A;  2NYQ A;  4C9U A;  1OBR A;  4A37 A;  5LYL A;  4C99 A;  3FEE A;  2OOT A;  3KGQ A;  4UF4 A;  1NSA A;  3NFZ A;  1CP7 A;  1TKF A;  4C86 A;  3H8G A;  2IQ6 A;  3BHX A;  4NGT A;  3SJE A;  1R3N A;  2ZOF A;  3WC7 A;  1LCP A;  1RTQ A;  3K2K A;  1XRY A;  1XF1 A;  4OC5 A;  4C9V A;  2PJ8 A;  4GM5 A;  3RAM A;  2C6P A;  2PJ7 A;  3KQX A;  1PCA A;  2RFH A;  4C9E A;  3RBU A;  4ZY2 A;  3WT4 A;  3D4U A;  4O23 A;  4C8T A;  4C8U A;  1FT7 A;  4ZY1 A;  1TF9 A;  1UWY A;  1TKJ A;  1LOK A;  3KHX A;  1LAM A;  2CTB A;  3SI1 A;  2O4H A;  2Q4Z A;  2V77 A;  1WVM A;  2JEW A;  3TC8 A;  1IGB A;  3I74 A;  4B6Z A;  5JH9 A;  2PVV A;  1VHE A;  4H2K A;  1VHO A;  1ZLH A;  5JM6 A;  1DE4 C;  3FH4 A;  5HXD A;  4P4I A;  4X3R A;  4C8F A;  3KQZ A;  4KNG E;  4NGS A;  2Q43 A;  4OC0 A;  4DYO A;  1Y9Z A;  3LWU A;  3RZA A;  1HEE A;  1HDQ A;  1CBX A;  3KZW A;  3GB0 A;  5K8O A;  4X2T A;  1BPM A;  4F9V A;  4A38 A;  2I3C A;  2ANP A;  4P4J A;  2AFU A;  2ZEG A;  4OID A;  2HB6 A;  4OC4 A;  2PIY A;  2CIJ A;  3FMC A;  1HDU A;  2V8H A;  4NFR A;  3TX8 A;  1YW6 A;  4UIB A;  3KR4 A;  4UEZ A;  1FNO A;  3GLJ A;  4G1P A;  3FX6 A;  2DEA A;  4Q7A A;  2PJ4 A;  3B3S A;  2HC9 A;  3DLJ A;  3PBB A;  4IAV A;  2ZEO A;  2RB7 A;  1LAN A;  3KR5 A;  3IEH A;  1IY7 A;  2PJ1 A;  3NA6 A;  4F9U A;  6CPA A;  4OC3 A;  3B3W A;  4C84 A;  4UIA A;  1Q7L A;  4OME A;  2CF4 A;  2G9D A;  3PRT A;  1Y0Y A;  2QVP A;  1BAV A;  2ZEN A;  3MRU A;  3I1U A;  3KL9 A;  1H8L A; 
#chains in the Genus database with same CATH topology
 3VWD A;  3TLC A;  4UBR A;  4UA3 A;  2EK9 A;  3OP0 A;  2Q0Y A;  2AUM A;  2BSW A;  4R7M A;  3IFE A;  4YU9 A;  2FVG A;  5DWM A;  4B5P A;  4KVO E;  5F13 A;  1ZLI A;  1IU8 A;  4KS9 A;  3IWW A;  5IV0 A;  2HV2 A;  1YW4 A;  3BJ8 A;  3FBU A;  1NXJ A;  2WSA A;  3C8O A;  1IIC A;  5F49 A;  3EY5 A;  4F8Z A;  4CS0 B;  1N71 A;  5D29 A;  4UFV A;  3TO6 A;  2ZEP A;  1ZG8 A;  3KAS A;  3VAR A;  1OZP A;  5KTA A;  2PVW A;  3PFO A;  1CP6 A;  4CGO A;  3IIB A;  1BOB A;  1Q2D A;  4M6G A;  3D2P A;  3NOJ A;  5KTD A;  2EZA A;  5BY0 A;  1ELL P;  4YWY A;  1Z8X A;  3BI1 A;  3FNC A;  4P45 A;  8CPA A;  1PYT B;  4UFX A;  4KVM E;  4Q36 A;  3EIF A;  1YRE A;  2Q04 A;  2QML A;  1R57 A;  1Z9E A;  3VRN A;  5EC4 A;  1CJW A;  2OZG A;  1CPS A;  2PE3 A;  4MMO A;  3S6H A;  2ZOG A;  4DUK A;  4XNH C;  2Q7B A;  2YNE A;  2ZXV A;  2XPN A;  2J9A A;  4H6U A;  3SXN A;  1A2Z A;  5HKW A;  4CRZ B;  4MCQ A;  2R8V A;  1JDB C;  5JGF A;  2HRO A;  4E94 A;  4C2Y A;  5JPH A;  1S5K A;  2AFM A;  3BUW B;  5I4M A;  4A39 A;  3R9F A;  1Y9K A;  3F8K A;  4H6Z A;  1EE3 P;  3T5M A;  4CZ1 A;  2I79 A;  4MXU A;  5LYI A;  3S6F A;  4CGM A;  4B5O A;  1GYT A;  1Z4E A;  1ZO0 A;  4ZYQ A;  3PGP A;  4CGP A;  4B11 A;  2CNM A;  3EZA A;  4W9Y A;  2VZZ A;  5F48 A;  1R61 A;  2ZEE A;  1VGY A;  2GIV A;  2CXA A;  2YGW A;  3H5Z A;  3VRQ A;  1YK3 A;  3BUM B;  3IJ3 A;  1J3L A;  3SI2 A;  1Z2L A;  5FVJ A;  1F2P A;  1CM0 A;  1Y9W A;  4NGR A;  3R1K A;  2GAN A;  2GE3 A;  1X10 A;  4FWU A;  4FD4 A;  2Q4Y A;  2PCU A;  1LFW A;  1SQH A;  2ZED A;  4OAE A;  3SHP A;  1YLE A;  4A32 A;  5LYF A;  2ZW5 A;  4MCS A;  1GGO A;  1FBV A;  2PRQ A;  3MGD A;  4FD6 A;  4IK2 A;  4H1H A;  5IR2 A;  3QNV A;  3VAT A;  1XMT A;  4KSF A;  4MRI A;  3TT2 A;  4H89 A;  3HUV A;  4UCN A;  3TLA A;  4P4D A;  1X12 A;  2B4J C;  4C9R A;  4ZX9 A;  2EK8 A;  2Z11 A;  2OH1 A;  3K9T A;  4DNC A;  3OWC A;  2ZEL A;  3JVN A;  4MCR A;  3V8I A;  4B12 A;  4NEX A;  3T8W A;  1VI4 A;  2PR1 A;  4MBU A;  3D7H A;  1QSO A;  4AG9 A;  2BO9 A;  4KSA A;  5E96 A;  3H8F A;  3IC1 A;  4CAX A;  3S6G A;  4PSW A;  4R87 A;  4UCM A;  1KUY A;  2HWG A;  3T07 A;  1XEB A;  4R6T A;  2WZN A;  5DWN A;  1LRZ A;  4KZT A;  2C6G A;  1UFH A;  3TTH A;  4XPD C;  5IB9 A;  1EZB A;  1J4J A;  4CRY B;  4CDJ A;  4NCZ A;  3WAB A;  2YJV A;  4TJV A;  4C8C A;  4MY0 A;  5HH1 A;  4NGQ A;  3W6X A;  3PLF B;  3PFE A;  2PCN A;  2CNT A;  4PXE A;  3WC6 A;  7CPA A;  3MN8 A;  4FBE A;  3NH5 A;  2H5M A;  1R43 A;  3TO7 A;  4CAE A;  4MY3 A;  1TXR A;  4A31 A;  4JWP A;  3D67 A;  4EFD A;  4KOV A;  4LQG A;  2C6C A;  1JWQ A;  1S7L A;  5K8P A;  1KEE B;  3PB8 X;  3EFA A;  4PQA A;  2OR4 A;  3D7D A;  2PSW A;  1BLL E;  4JZ0 A;  5J3X A;  1Y0R A;  2DF5 A;  2OU2 A;  2GU2 A;  4CYN A;  2CBL A;  2JDC A;  2Q44 A;  4R57 A;  2ZEM A;  2GP4 A;  4EVY A;  2V8D A;  2F5I A;  1M6V B;  3G23 A;  1ARL A;  3CPX A;  2AUN A;  3L2N A;  3PP9 A;  3TLG A;  2AE6 A;  5G1Z A;  1NBW A;  4P4F A;  4KSI A;  5C88 A;  2N3A B;  3KRV A;  3SJG A;  5IX3 A;  4MHP A;  2AFW A;  2ZW6 A;  2HI6 A;  3SXO A;  1RO5 A;  1ZRS A;  2JBK A;  2JLM A;  1XIX A;  2J8M A;  4M8D A;  4WJB A;  3R9G A;  4AVB A;  2GLJ A;  3R9E A;  4MFQ A;  4R3K A;  4U9Z A;  4OC2 A;  1LAP A;  2PRB A;  4E8O A;  4CYO A;  2P0W A;  4UEE A;  1FY7 A;  4UEF A;  3EZE A;  1EZA A;  2DLA A;  4L8A A;  5H86 A;  3DGV A;  4B13 A;  4CGL A;  4GPL B;  2K5T A;  4PXC A;  2IMO A;  4KOY A;  3CZX A;  2Z3O A;  4OIW A;  1DTD A;  4RUH A;  4CYP A;  1B47 A;  1S7F A;  3B3V A;  3PB9 X;  1NSL A;  4Z65 A;  1M44 A;  2IJZ A;  1XMB A;  2PJ9 A;  2PJ0 A;  3PB4 X;  4MCP A;  5A28 A;  3OB1 B;  3QAH A;  2E28 A;  5KTC A;  5F9M A;  5JYB A;  2FXF A;  3TCV A;  4FAI A;  2EUI A;  5K99 A;  4ZBG A;  5C82 A;  3IO1 A;  4Y49 C;  4AXV A;  4C8A A;  1V6C A;  4P4E A;  2AJ6 A;  4MHD A;  3S9L A;  5FD8 A;  3S9M A;  3IWE A;  3F9K C;  3B35 A;  1VKC A;  4ONW A;  4MHZ A;  3R96 A;  4ZGY B;  3ICU A;  2Q51 A;  2F8H A;  3D3S A;  3ISX A;  1T36 B;  1VBG A;  2D4P A;  4JJX A;  2VQY A;  3EZB A;  3CXQ A;  2XEF A;  1NMT A;  1V0C A;  3TLG B;  4C85 A;  3U88 C;  2A4N A;  5AG5 A;  4C68 A;  4CGN A;  1Z5R A;  3FF3 A;  1ZG7 A;  5CBM A;  5LRG A;  1Q2Y A;  1ZG9 A;  2EZC A;  2AFO A;  2Z3L A;  1ELM P;  2ZEH A;  3FIX A;  1QSM A;  4GXH A;  3TFY A;  4BBH A;  1Y7E A;  4F0X A;  4P44 A;  1Z8L A;  3SJF A;  1KWM A;  5JQ4 A;  3LMS A;  3E0K A;  4YN3 A;  4WWV A;  2NMT A;  2G3T A;  3C26 A;  2KCW A;  2F7V A;  1BO4 A;  1XBU A;  3IU2 A;  1AYE A;  2J8R A;  4OKO A;  4X8I A;  5ISV A;  4AVC A;  1YLO A;  1QQ9 A;  3RYO A;  2POK A;  1CS0 B;  4FUU A;  4NF1 A;  4PPZ A;  4ORF A;  5F5X A;  1GHE A;  1XE4 A;  2WPX A;  3GUX A;  3D7G A;  4MHN A;  4RI1 A;  4RS2 A;  2FS5 A;  5K8N A;  5CNP A;  2EVN A;  2P6G A;  3U1B A;  2ZW4 A;  1ZYM A;  4B5P B;  1XFO A;  2JDD A;  4MFP A;  4MFL A;  4NGM A;  4M6I A;  4QB9 A;  1XOV A;  1KUV A;  2Z3P A;  2Z0Z A;  2Z3M A;  1AMP A;  3FVL A;  2PQ8 A;  3JTK A;  1L0C A;  2EWB A;  4CYQ A;  1WK4 A;  3BLN A;  4JVO A;  1I1D A;  1VIX A;  2ZEF A;  2PJ2 A;  5J1Q A;  1YQE A;  3KI9 A;  3OB2 B;  1NE9 A;  3ZNI A;  1IYK A;  4A4C A;  4CAW A;  3GJZ A;  1Z8W A;  4IUS A;  2R1I A;  4CO9 A;  3CDX A;  3S9N A;  5ELY A;  3FED A;  1Q2C A;  2GFQ A;  1XJO A;  3B7I A;  2BOA A;  5K8M A;  2AFS A;  2VL1 A;  1XF8 A;  3D66 A;  2B5G A;  4KOX A;  4MFK A;  2O53 A;  4P6Y A;  3ZJ0 A;  4A33 A;  1QMU A;  3N7Z A;  3I3G A;  2GLF A;  4PK3 A;  5AG4 A;  3F0A A;  2GRE A;  4C8P A;  4A2Z A;  3H8E A;  5LRJ A;  5JVL A;  2Z3N A;  3BUO B;  4YFJ A;  3RNZ A;  4BIN A;  4IIX A;  2WUU A;  4NJR A;  4BMH A;  3NH8 A;  2ABZ A;  4COG A;  3KHZ A;  2C1C A;  2DPS A;  4HNW B;  4ZY0 A;  3WR7 A;  4XNH B;  4ZX8 A;  1S7K A;  5LRK A;  1CE8 B;  4B14 A;  3DDD A;  1P0H A;  2XPL A;  3PEI A;  3V7Z A;  3BUX B;  4DJL A;  5H84 A;  3VH9 A;  4AB7 A;  2FL4 A;  2PJ6 A;  3V38 A;  3LD2 A;  3NFQ A;  2XEI A;  4TNU A;  4CDK A;  5D8N A;  3CXP A;  3D68 A;  4XPL A;  3ISZ A;  4TWE A;  4E0A A;  1A9X B;  4B10 A;  1BXR B;  4HKF A;  2DIK A;  3VRR A;  3WC5 A;  5A27 A;  1M4I A;  2IL4 A;  4R3L A;  2B3U A;  3BI0 A;  4RR2 B;  3B3T A;  4KLV A;  4KVX A;  4OP4 A;  1JQG A;  4CPA A;  3SI0 A;  1ARM A;  3B3C A;  1MJ9 A;  4OLL A;  4HNY B;  1CG2 A;  2XEJ A;  2YNC C;  4JD6 A;  3GIU A;  3PT1 A;  3FXT A;  4EME A;  3SR3 A;  4K3N A;  2XEG A;  3D8P A;  3PB6 X;  5LYD A;  2BEI A;  1I21 A;  3HLP A;  2G3A A;  4P4B A;  2B4D A;  2NSM A;  3BXM A;  3LAC A;  2RC4 A;  4OAD A;  3NH4 A;  5G22 A;  4HPS A;  3VWE A;  3EXN A;  4M6H A;  2R82 A;  4PXB A;  3D7F A;  4BPU B;  1YSJ A;  2YJT A;  5F46 A;  4JYW A;  3H4Q A;  2O28 A;  4IHM A;  2C27 A;  3GKR A;  4C7H A;  2UV8 G;  5G20 A;  4A95 A;  4BD9 A;  4F6A A;  2WYR A;  4TJX A;  4HNX B;  3TE4 A;  2PJB A;  1TF8 A;  4C9A A;  2PJA A;  3TLE A;  1MJA A;  4CAV A;  4A94 A;  4ZI6 A;  4J0N A;  4E5S A;  2V8G A;  3N5F A;  3I6S A;  2PJC A;  2FT0 A;  2VZY A;  3D2M A;  2FCK A;  2Z3K A;  3IU1 A;  2QYV A;  3PBE A;  4P10 A;  2CTC A;  5CPA A;  2BL1 A;  4UWI A;  4NGP A;  3RO0 A;  2Z10 A;  4II9 A;  5HVH A;  3QB8 A;  4A4B A;  4KOU A;  4MHY A;  1TKH A;  4IF5 A;  2G0B A;  2P6F A;  2VI7 A;  2ODF A;  1M4L A;  1WJT A;  3T05 A;  2D0P A;  2AFX A;  3FYN A;  4EYS A;  3PB7 X;  1B87 A;  1F2O A;  1F57 A;  2BCO A;  4C2Z A;  4NGN A;  4MFJ A;  3IGR A;  3I9S A;  4XPD B;  3SJX A;  3FJU A;  4Q38 A;  5THW A;  2FIA A;  2B58 A;  3VRP A;  2V8V A;  3P2F A;  2ARH A;  3JRU A;  4U9Y A;  4YGO A;  4KOR A;  5EMI A;  4PXD A;  1RXT A;  5DS0 A;  3T90 A;  1BPN A;  1P4N A;  4LUA A;  4MI4 A;  2PIZ A;  3CPA A;  2ZW7 A;  5HVG A;  4MJX A;  4CAF A;  2QJ8 A;  3O8Z A;  3B2Y A;  3FRM A;  1YVK A;  4I49 A;  1ZL0 A;  4OC1 A;  5J8F A;  1KUX A;  5HVF A;  1C3O B;  4NJQ A;  3HPH E;  2PJ3 A;  4R76 A;  2D4O A;  2EO8 A;  2FIW A;  2VKZ G;  3OAK A;  1CPX A;  1YVO A;  1YGH A;  4EWT A;  1YME A;  3CT9 A;  1CX8 A;  5HMN A;  3VTA A;  3FEC A;  1DIK A;  2PJ5 A;  4R8F A;  4XPK A;  2C5Q A;  2JBJ A;  5F09 A;  2NYQ A;  3K4I A;  5F1Y A;  1OBR A;  1IID A;  4A37 A;  4C9U A;  5LYL A;  2OZU A;  4C7I A;  3FEE A;  2OOT A;  3KGQ A;  3W6S A;  5I0C A;  4UF4 A;  3TYX A;  4C99 A;  1M4G A;  4INJ A;  1NSA A;  2QIR A;  1S60 A;  3NFZ A;  1CP7 A;  1TKF A;  4C86 A;  2IQ6 A;  3H8G A;  3BHX A;  4NGT A;  3SJE A;  1R3N A;  1TIQ A;  2ZOF A;  5G21 A;  4E2A A;  2FM4 A;  5HKZ A;  1LCP A;  2B3V A;  3NE7 A;  3QAY A;  2P6E A;  1RTQ A;  4LQ6 A;  3WC7 A;  5J8C A;  4IIY A;  4KOW A;  4PSX A;  3KKW A;  4FD5 A;  1S7N A;  3EO4 A;  3K2K A;  2REF A;  4JXR A;  2HQY A;  1XRY A;  3NE8 A;  3P2H A;  3VGO A;  1XF1 A;  4OC5 A;  4RN7 A;  2PJ8 A;  4M3S A;  4GM5 A;  3K9U A;  1MK4 A;  3RAM A;  2OB0 A;  2C6P A;  2PJ7 A;  2WPW A;  3KQX A;  5AG6 A;  5GCN A;  3CXS A;  1PCA A;  1VHS A;  2PC1 A;  4KUA A;  2FE7 A;  4UWJ A;  2RFH A;  1WWZ A;  4L89 A;  4C9E A;  3PFV A;  2YND A;  1KZF A;  3RBU A;  3GYA A;  4NXY A;  4PK2 A;  4R9M A;  4ZY2 A;  3WT4 A;  5HKY A;  3D4U A;  2ZPA A;  2X7B A;  4O23 A;  1FT7 A;  4ZY1 A;  4C8T A;  4C8U A;  4Y49 B;  4KOS A;  1TF9 A;  1UWY A;  3TLZ A;  1TKJ A;  4FD7 A;  2HUZ A;  2VXK A;  4QUS A;  2OLS A;  4BPW B;  1LOK A;  3KHX A;  1QST A;  1LAM A;  2CNS A;  1IB1 E;  2VEZ A;  1Z4R A;  1JDE A;  2CTB A;  2Q4V A;  3A9L A;  2B4B A;  4A30 A;  1AUG A;  2O4H A;  3SI1 A;  2Q4Z A;  2REE A;  2PDO A;  2V77 A;  3IWG A;  1WVM A;  1IOF A;  2JEW A;  2VBQ A;  1IGB A;  3TC8 A;  3TOA A;  3TO9 A;  2PR8 A;  3PZJ A;  3DSB A;  4B6Z A;  3I74 A;  4UCP A;  2PVV A;  5JH9 A;  1VHE A;  1Q5X A;  4H2K A;  2FSR A;  2EZB A;  3KL9 A;  1VHO A;  1ZLH A;  2R7H A;  4JXQ A;  5JM6 A;  3TLB A;  2Y0M A;  4KLW A;  2Q7S A;  1DE4 C;  3FH4 A;  5HXD A;  4P4I A;  4X3R A;  3LOD A;  4LX9 A;  1M1D A;  5IB0 A;  2D0O A;  4C8F A;  3F5B A;  3KQZ A;  4KNG E;  4NGS A;  1YVH A;  4BPX B;  2Q43 A;  4OC0 A;  4DYO A;  1Y9Z A;  3LWU A;  4MJ8 A;  3DR6 A;  1HEE A;  2OZH A;  1HDQ A;  3RZA A;  3S6K A;  4M85 A;  1YX0 A;  2EBJ A;  2Y1M A;  1QSN A;  4UFW A;  5AXI A;  4COB A;  4QVT A;  1KBL A;  5AG7 A;  1C30 B;  1Z9U A;  1CBX A;  3KZW A;  2I00 A;  1QSR A;  4MFZ A;  3T9Y A;  3B8G A;  3GB0 A;  3W91 A;  4C9V A;  4GS4 A;  5K8O A;  4F0Y A;  4X2T A;  4AG7 A;  1BPM A;  1VBH A;  1M4D A;  4F9V A;  4A38 A;  2I3C A;  2ANP A;  1IOI A;  4P4J A;  2AFU A;  2B5G B;  3UY5 A;  3TLY A;  2ZEG A;  4OID A;  2HB6 A;  3T0T A;  4OC4 A;  3GY9 A;  2R98 A;  2PIY A;  4J3G A;  4YRH A;  2YNC A;  2CIJ A;  2XPO A;  1PU9 A;  1MJB A;  3FMC A;  1HDU A;  2XPP A;  4BTF A;  2V8H A;  4NFR A;  5AGE A;  1K4J A;  2MP0 A;  1YR0 A;  3TX8 A;  1YW6 A;  4QC6 A;  4QBJ A;  2X0S A;  3G8W A;  2DXQ A;  4UIB A;  3VRO A;  1IYL A;  3KR4 A;  4UEZ A;  1FNO A;  5BWA B;  1B6B A;  1Z8T A;  3GLJ A;  4KUB A;  4G1P A;  1U6M A;  4MI1 A;  1KC7 A;  3BUN B;  1ON0 A;  1PUA A;  2DEA A;  3FB3 A;  3FX6 A;  2ATR A;  2DPT A;  2PJ4 A;  3B3S A;  4Q7A A;  3R95 A;  4AVA A;  4U5Y A;  4K30 A;  2Y1N A;  1Y7R A;  4C2X A;  2HC9 A;  3DLJ A;  3PBB A;  4IAV A;  2ZEO A;  4NSQ A;  3JUW A;  2RB7 A;  1LAN A;  3G3S A;  3HPG G;  3KR5 A;  3IEH A;  1IY7 A;  4ONU A;  3HMJ G;  4KOT A;  2CY2 A;  2PJ1 A;  2QEC A;  3NA6 A;  4F9U A;  1EO0 A;  6CPA A;  4OC3 A;  5EBV A;  2J8N A;  2BUE A;  3B3W A;  3DNS A;  1S3Z A;  2JEV A;  4UIA A;  4C84 A;  1Q7L A;  3DR8 A;  4OME A;  3TOB A;  5F47 A;  3BJ7 A;  4X5K A;  2CF4 A;  3ZZI A;  2G9D A;  3PRT A;  4JLY A;  4PV6 A;  1Y0Y A;  2B4D B;  2QVP A;  1BAV A;  2ZEN A;  1I12 A;  3MRU A;  3I1U A;  2B0A A;  2AFZ A;  3EC4 A;  1H8L A; 
#chains in the Genus database with same CATH homology
 2EK9 A;  4R7M A;  3IFE A;  4YU9 A;  2FVG A;  1ZLI A;  3IWW A;  1YW4 A;  4F8Z A;  5D29 A;  2ZEP A;  1ZG8 A;  3KAS A;  3VAR A;  2PVW A;  3PFO A;  1CP6 A;  3IIB A;  1ELL P;  4YWY A;  3BI1 A;  4P45 A;  8CPA A;  1PYT B;  3EIF A;  1CPS A;  2PE3 A;  4MMO A;  4DUK A;  2ZOG A;  2J9A A;  4MCQ A;  5JGF A;  2AFM A;  4A39 A;  1EE3 P;  4MXU A;  5LYI A;  1GYT A;  4ZYQ A;  4W9Y A;  2ZEE A;  1VGY A;  3IJ3 A;  3SI2 A;  1Z2L A;  1F2P A;  4NGR A;  4FWU A;  2PCU A;  1LFW A;  2ZED A;  5LYF A;  4MCS A;  2PRQ A;  4IK2 A;  5IR2 A;  3QNV A;  3VAT A;  4MRI A;  3HUV A;  4P4D A;  4C9R A;  4ZX9 A;  2EK8 A;  3K9T A;  2ZEL A;  4MCR A;  3T8W A;  3D7H A;  2BO9 A;  3H8F A;  3IC1 A;  4R6T A;  2WZN A;  2C6G A;  5IB9 A;  4CDJ A;  3WAB A;  4TJV A;  4C8C A;  4NGQ A;  3PFE A;  4PXE A;  3WC6 A;  7CPA A;  3MN8 A;  4FBE A;  3NH5 A;  1R43 A;  1TXR A;  2AFZ A;  4EFD A;  3D67 A;  4LQG A;  2C6C A;  5K8P A;  3PB8 X;  4PQA A;  2OR4 A;  3D7D A;  1BLL E;  4JZ0 A;  1Y0R A;  2GU2 A;  2ZEM A;  2GP4 A;  2V8D A;  1ARL A;  3CPX A;  3L2N A;  4P4F A;  4KSI A;  3SJG A;  4MHP A;  2AFW A;  2JBK A;  4WJB A;  2GLJ A;  4OC2 A;  1LAP A;  4UEE A;  4UEF A;  3DGV A;  4PXC A;  2IMO A;  4OIW A;  1DTD A;  4RUH A;  3B3V A;  3PB9 X;  4Z65 A;  2IJZ A;  1XMB A;  2PJ9 A;  2PJ0 A;  3PB4 X;  4MCP A;  4FAI A;  4C8A A;  3IO1 A;  4AXV A;  1V6C A;  4P4E A;  3S9L A;  3S9M A;  3B35 A;  4ONW A;  3ICU A;  4MHZ A;  2Q51 A;  2F8H A;  3ISX A;  4C85 A;  2XEF A;  1Z5R A;  3FF3 A;  1ZG7 A;  5CBM A;  5LRG A;  1ZG9 A;  2AFO A;  1ELM P;  2ZEH A;  1Y7E A;  4P44 A;  1Z8L A;  3SJF A;  1KWM A;  3LMS A;  4YN3 A;  4WWV A;  2F7V A;  1XBU A;  4X8I A;  1AYE A;  4OKO A;  1YLO A;  1QQ9 A;  2POK A;  4FUU A;  4PPZ A;  3GUX A;  3D7G A;  4MHN A;  5K8N A;  1XFO A;  4NGM A;  1AMP A;  3FVL A;  2EWB A;  1VIX A;  2ZEF A;  2PJ2 A;  5J1Q A;  3KI9 A;  3CDX A;  3S9N A;  5ELY A;  3FED A;  1XJO A;  3B7I A;  2BOA A;  5K8M A;  2AFS A;  2VL1 A;  3D66 A;  2O53 A;  4P6Y A;  1QMU A;  2GLF A;  2GRE A;  4C8P A;  3H8E A;  5LRJ A;  4NJR A;  3NH8 A;  2ABZ A;  3KHZ A;  2C1C A;  4ZY0 A;  4ZX8 A;  5LRK A;  3PEI A;  3V7Z A;  4DJL A;  3VH9 A;  3V38 A;  2PJ6 A;  2XEI A;  4TNU A;  4CDK A;  5D8N A;  3D68 A;  3ISZ A;  4TWE A;  3WC5 A;  3BI0 A;  3B3T A;  4OP4 A;  1JQG A;  4CPA A;  3SI0 A;  1ARM A;  3B3C A;  1CG2 A;  2XEJ A;  4EME A;  4K3N A;  2XEG A;  3PB6 X;  5LYD A;  3HLP A;  5I4M A;  4P4B A;  2NSM A;  3BXM A;  3NH4 A;  4PXB A;  3D7F A;  1YSJ A;  4JYW A;  4IHM A;  4BD9 A;  2WYR A;  4TJX A;  2PJB A;  1TF8 A;  4C9A A;  2PJA A;  4A94 A;  4ZI6 A;  2V8G A;  3N5F A;  3I6S A;  2PJC A;  2QYV A;  3PBE A;  4P10 A;  2CTC A;  5CPA A;  4NGP A;  5HVH A;  4MHY A;  1TKH A;  1M4L A;  2AFX A;  3PB7 X;  1F2O A;  1F57 A;  2BCO A;  4NGN A;  5THW A;  3SJX A;  3FJU A;  2V8V A;  3JRU A;  4PXD A;  5DS0 A;  1BPN A;  2PIZ A;  3CPA A;  5HVG A;  2QJ8 A;  3B2Y A;  4OC1 A;  5HVF A;  4NJQ A;  2PJ3 A;  4R76 A;  1CPX A;  4EWT A;  1YME A;  3CT9 A;  1CX8 A;  3VTA A;  3FEC A;  2PJ5 A;  4R8F A;  2C5Q A;  2JBJ A;  5F09 A;  2NYQ A;  4C9U A;  1OBR A;  4A37 A;  5LYL A;  4C99 A;  3FEE A;  2OOT A;  3KGQ A;  4UF4 A;  1NSA A;  3NFZ A;  1CP7 A;  1TKF A;  4C86 A;  3H8G A;  2IQ6 A;  3BHX A;  4NGT A;  3SJE A;  1R3N A;  2ZOF A;  3WC7 A;  1LCP A;  1RTQ A;  3K2K A;  1XRY A;  1XF1 A;  4OC5 A;  4C9V A;  2PJ8 A;  4GM5 A;  3RAM A;  2C6P A;  2PJ7 A;  3KQX A;  1PCA A;  2RFH A;  4C9E A;  3RBU A;  4ZY2 A;  3WT4 A;  3D4U A;  4O23 A;  4C8T A;  4C8U A;  1FT7 A;  4ZY1 A;  1TF9 A;  1UWY A;  1TKJ A;  1LOK A;  3KHX A;  1LAM A;  2CTB A;  3SI1 A;  2O4H A;  2Q4Z A;  2V77 A;  1WVM A;  2JEW A;  3TC8 A;  1IGB A;  3I74 A;  4B6Z A;  5JH9 A;  2PVV A;  1VHE A;  4H2K A;  1VHO A;  1ZLH A;  5JM6 A;  1DE4 C;  3FH4 A;  5HXD A;  4P4I A;  4X3R A;  4C8F A;  3KQZ A;  4KNG E;  4NGS A;  2Q43 A;  4OC0 A;  4DYO A;  1Y9Z A;  3LWU A;  3RZA A;  1HEE A;  1HDQ A;  1CBX A;  3KZW A;  3GB0 A;  5K8O A;  4X2T A;  1BPM A;  4F9V A;  4A38 A;  2I3C A;  2ANP A;  4P4J A;  2AFU A;  2ZEG A;  4OID A;  2HB6 A;  4OC4 A;  2PIY A;  2CIJ A;  3FMC A;  1HDU A;  2V8H A;  4NFR A;  3TX8 A;  1YW6 A;  4UIB A;  3KR4 A;  4UEZ A;  1FNO A;  3GLJ A;  4G1P A;  3FX6 A;  2DEA A;  4Q7A A;  2PJ4 A;  3B3S A;  2HC9 A;  3DLJ A;  3PBB A;  4IAV A;  2ZEO A;  2RB7 A;  1LAN A;  3KR5 A;  3IEH A;  1IY7 A;  2PJ1 A;  3NA6 A;  4F9U A;  6CPA A;  4OC3 A;  3B3W A;  4C84 A;  4UIA A;  1Q7L A;  4OME A;  2CF4 A;  2G9D A;  3PRT A;  1Y0Y A;  2QVP A;  1BAV A;  2ZEN A;  3MRU A;  3I1U A;  3KL9 A;  1H8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...