2PVWA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with 2-(phosphonomethyl)pentanedioic acid (2-pmpa)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
695
structure length
690
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 268
structure length 690
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2pvwA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pvwA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2pvwA02
2QJ8A 8CPAA 4MRIA 5K8MA 2PJCA 1LAPA 1CX8A 5K8NA 2FVGA 4C8CA 1Z8LA 5LYIA 4TJXA 4MHNA 2XEGA 2IJZA 3PB7X 3WABA 2QYVA 3ISZA 4O23A 4ZX8A 1CBXA 4FUUA 4IAVA 3BI0A 2ZENA 3NA6A 4C8AA 4EMEA 2AFWA 1IY7A 4R76A 3D7HA 1CPSA 1QMUA 2PE3A 4GM5A 4JZ0A 2ABZA 3KR4A 2PIYA 2ZEDA 3KASA 4DJLA 2NYQA 1Y0YA 5HVGA 5HXDA 5LYDA 1LFWA 4B6ZA 4ZY1A 1Q7LA 1DTDA 1OBRA 4MHPA 3WT4A 4ZY0A 4IK2A 3KZWA 2NSMA 3VATA 5I4MA 1Y0RA 3S9NA 4C9AA 2PIZA 3RAMA 3GLJA 3IO1A 3CPXA 5CBMA 3CT9A 5LRJA 4NGRA 3EIFA 2O4HA 4UEZA 4A38A 4P4BA 2RB7A 5CPAA 1PCAA 3KQXA 3BXMA 2V8DA 3D7DA 4UEEA 3H8GA 4A94A 2OOTA 3ISXA 4DYOA 4OC5A 6CPAA 2G9DA 2QVPA 4H2KA 5DS0A 4G1PA 4X8IA 2GLJA 5D29A 4R6TA 2PJ4A 1FNOA 1VHOA 2ZOFA 1TF9A 3LWUA 4UF4A 2ZEHA 4C9UA 4F9VA 2WYRA 2C6CA 2BCOA 1F2OA 2I3CA 1F2PA 2RFHA 3PFEA 3VARA 3GB0A 1AYEA 4PXEA 4IHMA 3RZAA 5JGFA 1WVMA 1TXRA 1ZG7A 1QQ9A 1ZG8A 3IFEA 4NJRA 4NGSA 4P45A 1TKJA 3IIBA 4FWUA 3PBBA 3V7ZA 2ZEFA 4OKOA 1LANA 2F7VA 7CPAA 1HDUA 4PXDA 4MXUA 3KQZA 4OC1A 3B3TA 1Y9ZA 4MCPA 3NH5A 1BAVA 4NGMA 3PEIA 1Y7EA 1LAMA 4C8FA 4BD9A 3FEDA 4F9UA 4PXCA 1XMBA 1YW4A 1V6CA 2IMOA 3PBEA 3PB9X 4ZI6A 3SJGA 4MCQA 2Q4ZA 4TJVA 3QNVA 4OMEA 3JRUA 5LYFA 4FBEA 4C9RA 2ZEOA 4ONWA 3PB8X 1M4LA 2C6PA 4CDKA 3PB4X 5HVHA 4P10A 3D4UA 2ZEMA 1XF1A 2PJ3A 3GUXA 2AFZA 3B3WA 3L2NA 1CP7A 3PB6X 2DEAA 4C99A 2PVVA 2AFUA 2EK9A 1HEEA 2ZEEA 3B3SA 4P6YA 4ZX9A 5J1QA 3PFOA 3MN8A 4OP4A 2PJ0A 4RUHA 3B2YA 2F8HA 2AFXA 4MHZA 4OC3A 4C85A 3BI1A 1TF8A 2PVWA 1VHEA 2XEJA 4NGPA 1ZLHA 4C8TA 2ZOGA 3D67A 3KI9A 1BPNA 4MMOA 4X2TA 3K9TA 4R8FA 1BLLE 4W9YA 3NFZA 3B3VA 2GLFA 4FAIA 3DLJA 4KNGE 1VGYA 3IWWA 2Q43A 4KSIA 4R7MA 1GYTA 3S9MA 4TWEA 4WWVA 2BO9A 2J9AA 2PCUA 4C9VA 3ICUA 1ELLP 1YSJA 3S9LA 2JBJA 2PJ8A 3FMCA 2Q51A 3D66A 4C9EA 3V38A 1LCPA 2AFMA 1RTQA 2ZEPA 5JH9A 3I6SA 2POKA 2XEFA 3DGVA 3FJUA 3KHXA 2V8VA 4MHYA 4PPZA 2PJ9A 2VL1A 5LRKA 1JQGA 3D7FA 4NFRA 4UEFA 4OIDA 1IGBA 1R43A 4UIAA 2JBKA 4PQAA 3TX8A 4AXVA 1PYTB 1H8LA 3FVLA 4NJQA 2JEWA 5HVFA 3WC5A 4OC2A 2ANPA 3BHXA 4OC4A 3B3CA 3FH4A 2HB6A 4MCSA 3RBUA 1YLOA 3KHZA 3N5FA 3SI1A 5THWA 2ZEGA 4WJBA 3H8FA 1ZLIA 4OIWA 3VH9A 2WZNA 4ZYQA 4ZY2A 3MRUA 2CTCA 3HUVA 4YU9A 2O53A 1CG2A 1TKHA 5LYLA 1XFOA 4P44A 4YWYA 2ZELA 1YW6A 4TNUA 4C84A 4PXBA 1BPMA 2BOAA 2AFOA 3WC7A 3CPAA 2C1CA 3B35A 3I1UA 3IEHA 2GREA 4Q7AA 4UIBA 5LRGA 1ARLA 1FT7A 1TKFA 1Z2LA 1XRYA 2PJBA 1EE3P 3D7GA 3CDXA 4Z65A 2OR4A 2V77A 4A39A 1VIXA 2CF4A 4NGQA 3PRTA 3K2KA 4P4EA 1CPXA 4EFDA 1F57A 1YMEA 2PRQA 3IJ3A 4C8UA 3KR5A 3FEEA 4P4FA 1LOKA 3SJXA 2HC9A 3B7IA 3HLPA 1XBUA 2PJ2A 3D68A 2PJ6A 3KGQA 2V8GA 5D8NA 4C86A 2IQ6A 5JM6A 1R3NA 2GU2A 3T8WA 4F8ZA 3H8EA 5K8PA 4EWTA 3NH4A 4LQGA 3TC8A 2C6GA 4DUKA 3SJEA 2PJAA 2AFSA 4CDJA 4P4DA 3FX6A 3IC1A 2XEIA 1Z5RA 2CIJA 1CP6A 3VTAA 4P4JA 4CPAA 1XJOA 3LMSA 3WC6A 4NGTA 4OC0A 4NGNA 2CTBA 3FECA 3NH8A 4P4IA 1UWYA 3SI0A 1ZG9A 5IB9A 4YN3A 4C8PA 4A37A 1NSAA 1KWMA 5K8OA 2EK8A 3SJFA 1AMPA 2PJ7A 2PJ1A 1ARMA 2PJ5A 4K3NA 2V8HA 3SI2A 5ELYA 4MCRA 1HDQA 3I74A 1ELMP 1DE4C 2EWBA 5F09A 4X3RA 3KL9A 4JYWA 3FF3A
chains in the Genus database with same CATH superfamily
3H4QA 4KUBA 2EBJA 2QJ8A 1ZL0A 4UCNA 8CPAA 4MRIA 5K8MA 4FD7A 2PJCA 1LAPA 4IF5A 2OB0A 5A28A 1KEEB 2Q0YA 5CNPA 1CX8A 5K8NA 2FVGA 4C8CA 1Z8LA 2ZXVA 4XPLA 5LYIA 1IOFA 4IIYA 4MHNA 2XEGA 3NE7A 3S6GA 3KKWA 3NFQA 1MK4A 2IJZA 4MY0A 3PB7X 1IYKA 3N7ZA 4FD4A 3WABA 2GP4A 1S60A 2AJ6A 2QYVA 1VBGA 2HQYA 1M44A 2R7HA 4HNXB 3ISZA 4O23A 4ZX8A 1A9XB 1CBXA 1YVOA 2FIWA 1EO0A 4XNHC 4CAFA 4FUUA 4IAVA 3BI0A 2ZENA 3NA6A 4J3GA 4C8AA 2QMLA 2PR1A 4EMEA 2AFWA 1S7FA 3DNSA 1IY7A 4R76A 1QSOA 3EZBA 3OB2B 2PQ8A 3D7HA 1CPSA 1J4JA 1QMUA 2J8MA 4A4BA 4BMHA 2PE3A 4B10A 2AUMA 4GM5A 1MJ9A 4JZ0A 2B5GA 4RS2A 2ABZA 5JQ4A 3KR4A 3K4IA 4INJA 2PIYA 2ZEDA 4KOYA 2WPXA 4PK2A 1V0CA 2DPSA 3KASA 2PDOA 4CGMA 3BUOB 4CGOA 4KUAA 2HI6A 1U6MA 4H1HA 1P4NA 4DJLA 2D0PA 2NYQA 1Y0YA 3PZJA 3TYXA 4PK3A 1BO4A 3VRQA 1I12A 1A2ZA 5HVGA 5HXDA 3OP0A 5LYDA 1LFWA 3K9UA 5BY0A 4C7IA 2OZHA 1VBHA 4B6ZA 4ZY1A 4JLYA 2B4JC 3O8ZA 3TO9A 1Q7LA 4CO9A 1ZO0A 2R82A 1DTDA 3DDDA 2B4DA 1OBRA 3U1BA 4MHPA 1SQHA 3D2PA 3WT4A 2GFQA 4ZY0A 3VGOA 4IK2A 3KZWA 1YVKA 4B5PA 2NSMA 4QUSA 3VATA 4KORA 4RN7A 5I4MA 1Y0RA 4JWPA 4KVME 3S9NA 4C9AA 2PIZA 2Y1MA 4XNHB 3RAMA 3GLJA 3IO1A 5EMIA 4KS9A 2DPTA 3CPXA 3TLCA 5CBMA 1IB1E 2KCWA 2MP0A 3CT9A 5LRJA 4NGRA 4YRHA 3R1KA 2O4HA 2D0OA 3EIFA 4UEZA 4B12A 3TTHA 2B3UA 4A38A 1R57A 4P4BA 2RB7A 2ZW7A 5CPAA 4CGNA 1PCAA 4COGA 1QSRA 3KQXA 4CRYB 5C82A 2D4PA 3BXMA 2V8DA 4BBHA 3D7DA 4UEEA 3UY5A 3H8GA 3TE4A 2QECA 4U9ZA 4A94A 1YLEA 4ORFA 2OOTA 3F8KA 2OU2A 5HKYA 3D8PA 3IWEA 2DLAA 3ISXA 4KZTA 4U9YA 2EZCA 2DXQA 4DYOA 4OADA 5EC4A 2OLSA 2VEZA 1XE4A 5H84A 2EZAA 4OC5A 6CPAA 3NE8A 2G9DA 2Q04A 2QVPA 2Z0ZA 3I9SA 4H2KA 4MFKA 5DS0A 4CGPA 1M6VB 4G1PA 4X8IA 2GLJA 4MHDA 5D29A 1X12A 2PJ4A 2BUEA 2F5IA 4R6TA 4OAEA 4B13A 1Q2YA 1FNOA 2XPPA 2P6GA 1VHOA 3VROA 2ZOFA 2VXKA 4A30A 1TF9A 3LWUA 4UF4A 2ZEHA 3SXNA 4C9UA 4F9VA 2WYRA 2N3AB 2FE7A 2C6CA 4MFQA 2BCOA 4QB9A 3VWDA 1F2OA 2I3CA 4M3SA 3C26A 5F48A 1C3OB 1F2PA 1IICA 4OLLA 2VZZA 4C2XA 1GGOA 3EO4A 2BSWA 2RFHA 3PFEA 3DR8A 4JJXA 1M4GA 2VKZG 2BEIA 2ZW6A 3VARA 4A95A 1CE8B 1NBWA 3GB0A 1AYEA 2Z3OA 4PXEA 4K30A 4IHMA 3RZAA 2G0BA 3S6KA 2FL4A 5JGFA 3JVNA 1WVMA 4A4CA 1TXRA 5IB0A 4KSAA 1ZG7A 1QQ9A 1ZG8A 3IFEA 3RNZA 2FXFA 4NJRA 4NGSA 2G3TA 4P45A 4E8OA 2DF5A 1TKJA 1IIDA 3IIBA 4TJXA 4FWUA 3PBBA 4A32A 4A31A 4UCPA 5AG7A 3V7ZA 2REEA 2ZEFA 4II9A 4OKOA 4UBRA 4MI1A 5DWMA 1LANA 2F7VA 5G20A 7CPAA 1HDUA 4RI1A 3SHPA 3HPGG 3W91A 2VZYA 4PXDA 1CJWA 4MXUA 4UFXA 1Y9KA 4AB7A 3KQZA 2Q7BA 4EWTA 1WK4A 1NMTA 4OC1A 3B3TA 3EXNA 1Y9ZA 4MCPA 3NH5A 1BAVA 1JDEA 3V8IA 3R9GA 4NGMA 2Z3PA 3PEIA 4EVYA 3BLNA 2J8NA 3TFYA 3TLZA 1Y7EA 1LAMA 4AVAA 4B14A 4C8FA 4BD9A 3F0AA 2QIRA 1T36B 3FEDA 4F9UA 3TLAA 4PXCA 1XMBA 1KBLA 5J8FA 1S3ZA 4GXHA 4Q36A 2Z3NA 3T90A 1XMTA 2ZW5A 4KVOE 4CAEA 5H86A 3FBUA 1YW4A 3TLBA 3GKRA 1S7KA 1V6CA 1RXTA 2IMOA 3BJ8A 3D2MA 3LODA 4M85A 4MI4A 4ZBGA 3PBEA 2JDCA 4AG7A 5K8PA 3PB9X 5KTCA 4F0XA 5AXIA 4ZI6A 4MBUA 3SJGA 4MCQA 2Q4ZA 4TJVA 5A27A 3TLGA 3QNVA 4OMEA 2I00A 3KRVA 3JRUA 3P2FA 5LYFA 3S6FA 4FBEA 2Z11A 4AG9A 2ZEOA 4ONWA 3PB8X 1M4LA 4U5YA 4C9RA 4CAVA 2C6PA 2R8VA 3H5ZA 2J8RA 5F5XA 3SR3A 3PB4X 4C68A 4CDKA 5HVHA 2NMTA 5HMNA 4P10A 1Z4RA 3D4UA 1BOBA 3GY9A 1IU8A 2ZEMA 1VHSA 1XF1A 3T0TA 2VQYA 1CS0B 2PJ3A 1S7NA 2EO8A 5I0CA 3GUXA 5AG4A 4GPLB 4HNYB 3WR7A 2AFZA 2C27A 4R3KA 4Y49C 1GHEA 5IX3A 5C88A 3B3WA 1XEBA 2JLMA 3L2NA 1NE9A 2CBLA 4B11A 5FVJA 1CP7A 2A4NA 2DIKA 4M8DA 3I3GA 3PB6X 1M1DA 2DEAA 4C99A 4DNCA 2AFUA 2EK9A 1HEEA 2ZEEA 3B3SA 4P6YA 4PSWA 4ZX9A 5J1QA 4BPXB 3PFOA 3MN8A 2YNCA 4OP4A 1K4JA 2PJ0A 4RUHA 3B2YA 2F8HA 2AFXA 1Q2CA 4MHZA 3U88C 4OC3A 3NOJA 4C85A 3BI1A 1TF8A 5F9MA 2PVWA 1VHEA 2XEJA 1VKCA 4NGPA 1ZLHA 3QAYA 3S6HA 3G23A 4IIXA 3P2HA 4C8TA 4JXRA 2ZOGA 4KOSA 1PUAA 2PC1A 3D67A 3KI9A 3DSBA 1BPNA 3T9YA 4MMOA 2Z10A 4X2TA 2ZPAA 3K9TA 4L89A 4R8FA 1BLLE 4MFJA 4W9YA 3NFZA 5JPHA 3FRMA 5K99A 4C2ZA 2CXAA 2HV2A 1NXJA 4KLVA 3VRNA 3B3VA 1P0HA 1UFHA 2BL1A 3FNCA 2PCNA 2GLFA 4FAIA 3DLJA 4KNGE 2PR8A 2VBQA 1B6BA 4KOXA 1VGYA 3IWWA 2X7BA 2Q43A 3DR6A 4KSIA 4M6GA 5JYBA 4Y49B 4E0AA 3BUXB 4R7MA 4R9MA 4CYNA 2FSRA 1GYTA 3EC4A 1YREA 3S9MA 1ZYMA 4TWEA 1AUGA 4H6ZA 4WWVA 2BO9A 3EFAA 4MFZA 2J9AA 3IGRA 4LQ6A 2PCUA 2AUNA 3ICUA 1ELLP 4C9VA 2UV8G 1L0CA 1QSNA 3C8OA 4AVCA 1YSJA 3S9LA 2JBJA 4EYSA 1S5KA 4NSQA 5DWNA 4NXYA 3BJ7A 3CXSA 4E94A 2PJ8A 3G3SA 4C7HA 3FMCA 2Q51A 5HKWA 3D66A 2C5QA 4C9EA 3V38A 1KUXA 1LCPA 1Z4EA 3MGDA 1Q2DA 2H5MA 2AFMA 1RTQA 2D4OA 2GIVA 2ZEPA 3OWCA 4CGLA 5JH9A 3T05A 3I6SA 4B5OA 3TOBA 2POKA 2XEFA 3DGVA 3FJUA 4QVTA 2XPNA 1X10A 3KHXA 2P6FA 2V8VA 3T5MA 5F49A 4MHYA 4PPZA 4YFJA 2PJ9A 2Q7SA 1M4IA 2VL1A 4UWIA 4BPUB 4KVXA 4F6AA 4J0NA 2PRBA 5LRKA 1JQGA 2Q4VA 4BPWB 3D7FA 1KUYA 3FXTA 3R95A 4KOTA 4NFRA 2YJVA 1FY7A 5G22A 2CNTA 4UEFA 4OIDA 3HPHE 1IGBA 1R43A 4UIAA 4BTFA 2B5GB 3RO0A 4CRZB 4ONUA 4R3LA 2JBKA 4UFVA 4FD5A 1XIXA 4CYPA 4PQAA 3TX8A 2OH1A 2B3VA 5G21A 1N71A 4AXVA 2B0AA 1M4DA 3IWGA 3T07A 1J3LA 2EZBA 1PYTB 1H8LA 3FVLA 4NJQA 4UA3A 1BXRB 2JEWA 5HVFA 5HKZA 4HPSA 3WC5A 2GE3A 4OC2A 2ANPA 3BHXA 5F1YA 4OC4A 2EVNA 3VRRA 2Q44A 1Z9EA 2HB6A 3B3CA 3FH4A 2B4DB 3QAHA 3TO6A 4QBJA 1Z8WA 2ZW4A 4MCSA 2YNDA 3RBUA 4MFPA 4M6IA 1YLOA 2B4BA 4C2YA 5AG6A 2OZUA 3KHZA 4B5PB 3ZNIA 4KLWA 3N5FA 2JDDA 3SI1A 2B58A 5THWA 2ZEGA 2RC4A 3OAKA 4WJBA 1XOVA 5HH1A 3H8FA 1ZLIA 4OIWA 1QSTA 1Z8TA 1PU9A 2WZNA 3VH9A 4RR2B 3TT2A 4ZYQA 5AG5A 4C8UA 4ZY2A 2FIAA 1IOIA 2EUIA 3MRUA 2CTCA 3FB3A 4LUAA 4CYQA 1DIKA 3HUVA 4YU9A 4AVBA 2O53A 1CG2A 1TKHA 2JEVA 5LYLA 1XFOA 2Y0MA 4P44A 4FD6A 2FCKA 4YWYA 2ZELA 1YW6A 4TNUA 4C84A 3LACA 1KUVA 4PXBA 4PV6A 1B87A 2ARHA 1BPMA 1Z9UA 2AFOA 2BOAA 3WC7A 3CPAA 1XF8A 4LX9A 4Q38A 4E5SA 2C1CA 2PSWA 3B35A 3I1UA 3IEHA 1WJTA 2GREA 4CAWA 4HKFA 3TLYA 4Q7AA 5JVLA 3IU2A 3TO7A 1EZAA 3EZAA 3F5BA 4UIBA 1MJBA 2K5TA 4GS4A 3D3SA 4KSFA 5LRGA 4Z65A 2R98A 1ARLA 1FT7A 1MJAA 2IL4A 5E96A 4A2ZA 5BWAB 2HROA 1CM0A 1TKFA 1Z2LA 2FT0A 1XRYA 2VI7A 2Z3MA 2PJBA 3GJZA 1EE3P 3PGPA 1EZBA 4E2AA 1JWQA 3F9KC 3D7GA 3CDXA 2AE6A 3EY5A 3W6SA 2OR4A 5F13A 2CNMA 4XPDC 2R1IA 3VRPA 1YGHA 2V77A 4L8AA 2P0WA 4CZ1A 4A39A 1VIXA 3A9LA 2I79A 1ZRSA 3FYNA 2CF4A 4R57A 4NGQA 3ZJ0A 3PRTA 3K2KA 4P4EA 1CPXA 4I49A 2GANA 1C30B 4EFDA 5F47A 1F57A 1YMEA 2O28A 2PRQA 3IJ3A 1Z8XA 3G8WA 3KR5A 2Q4YA 3R9FA 4A33A 3FEEA 4P4FA 3RYOA 1Y7RA 3PFVA 2HUZA 1LOKA 3CXQA 3SJXA 4X5KA 2HC9A 4ZGYB 4H6UA 3B7IA 3HLPA 1XBUA 2PJ2A 3D68A 5GCNA 2XPLA 2CY2A 3VWEA 2WSAA 4KOWA 2PJ6A 3GIUA 2Y1NA 3KGQA 1B47A 3LD2A 2WPWA 2V8GA 3TCVA 5D8NA 3KL9A 4NF1A 4C86A 4UCMA 2IQ6A 4PSXA 5JM6A 1JDBC 1R3NA 2GU2A 3T8WA 3PT1A 4F8ZA 3H8EA 1OZPA 1S7LA 2G3AA 4NEXA 2ATRA 4JXQA 3NH4A 4LQGA 1I21A 1YX0A 4UWJA 2C6GA 3GYAA 4YGOA 4IUSA 3TC8A 3TOAA 5F46A 5IR2A 1WWZA 3SJEA 4DUKA 4XPDB 4MJXA 5KTDA 2PJAA 2AFSA 3TLEA 3CXPA 2FS5A 4CYOA 4CDJA 2OZGA 4P4DA 2YNCC 3FX6A 4HNWB 4MJ8A 3JUWA 3IC1A 2XEIA 1KZFA 3BUMB 2CIJA 1Z5RA 3R96A 4CAXA 1CP6A 3VTAA 4P4JA 2FM4A 4JD6A 1IYLA 4CPAA 5IV0A 1XJOA 5G1ZA 3LMSA 4R87A 3WC6A 2YJTA 4NGTA 3PLFB 2XPOA 4MY3A 4OC0A 4NGNA 2CTBA 3FECA 3HMJG 3EZEA 3FIXA 1ON0A 3OB1B 3NH8A 2YNEA 3TLGB 5J8CA 4P4IA 1UWYA 3SI0A 2HWGA 4JVOA 1YR0A 4KOVA 1TIQA 1R61A 1ZG9A 1QSMA 5IB9A 3JTKA 4YN3A 4C8PA 1FBVA 2REFA 4A37A 1YK3A 4NCZA 5FD8A 3ZZIA 1NSAA 1KWMA 2Z3KA 5EBVA 4KOUA 5K8OA 2P6EA 2EK8A 1YVHA 2YGWA 3PP9A 4UFWA 4MFLA 3SJFA 1AMPA 3CZXA 4M6HA 3R9EA 2X0SA 2E28A 4F0YA 5J3XA 2Z3LA 2PJ7A 2PJ1A 3SXOA 1ARMA 2PJ5A 3BUWB 1Y9WA 3IU1A 4XPKA 2ODFA 4K3NA 4QC6A 4COBA 2CNSA 2V8HA 1I1DA 3SI2A 5ELYA 4MCRA 1HDQA 1RO5A 1ELMP 3W6XA 4CS0B 3I74A 4BINA 1DE4C 1NSLA 5KTAA 5ISVA 2EWBA 3B8GA 4H89A 3QB8A 1Q5XA 3E0KA 1KC7A 5AGEA 3BUNB 5F09A 2WUUA 4X3RA 2PVVA 1LRZA 4JYWA 1VI4A 1YQEA 3FF3A
chains in the Genus database with same CATH topology
2QJ8A 8CPAA 4MRIA 5K8MA 2PJCA 1LAPA 1CX8A 5K8NA 2FVGA 4C8CA 1Z8LA 5LYIA 4TJXA 4MHNA 2XEGA 2IJZA 3PB7X 3WABA 2GP4A 2QYVA 3ISZA 4O23A 4ZX8A 1CBXA 4FUUA 4IAVA 3BI0A 2ZENA 3NA6A 4C8AA 4EMEA 2AFWA 1IY7A 4R76A 3D7HA 1CPSA 1QMUA 2PE3A 4GM5A 4JZ0A 2ABZA 3KR4A 2PIYA 2ZEDA 3KASA 4DJLA 2NYQA 1Y0YA 5HVGA 5HXDA 5LYDA 1LFWA 4B6ZA 4ZY1A 1Q7LA 1DTDA 1OBRA 4MHPA 3WT4A 4ZY0A 4IK2A 3KZWA 2NSMA 3VATA 5I4MA 1Y0RA 3S9NA 4C9AA 2PIZA 3RAMA 3GLJA 3IO1A 3CPXA 5CBMA 3CT9A 5LRJA 4NGRA 3EIFA 2O4HA 4UEZA 4A38A 4P4BA 2RB7A 5CPAA 1PCAA 3KQXA 3BXMA 2V8DA 3D7DA 4UEEA 3H8GA 4A94A 2OOTA 3ISXA 4DYOA 4OC5A 6CPAA 2G9DA 2QVPA 4H2KA 5DS0A 4G1PA 4X8IA 2GLJA 5D29A 4R6TA 2PJ4A 1FNOA 1VHOA 2ZOFA 1TF9A 3LWUA 4UF4A 2ZEHA 4C9UA 4F9VA 2WYRA 2C6CA 2BCOA 1F2OA 2I3CA 1F2PA 2RFHA 3PFEA 3VARA 3GB0A 1AYEA 4PXEA 4IHMA 3RZAA 5JGFA 1WVMA 1TXRA 1ZG7A 1QQ9A 1ZG8A 3IFEA 4NJRA 4NGSA 4P45A 1TKJA 3IIBA 4FWUA 3PBBA 3V7ZA 2ZEFA 4OKOA 1LANA 2F7VA 7CPAA 1HDUA 4PXDA 4MXUA 3KQZA 4OC1A 3B3TA 1Y9ZA 4MCPA 3NH5A 1BAVA 4NGMA 3PEIA 1Y7EA 1LAMA 4C8FA 4BD9A 3FEDA 4F9UA 4PXCA 1XMBA 1YW4A 1V6CA 2IMOA 3PBEA 3PB9X 4ZI6A 3SJGA 4MCQA 2Q4ZA 4TJVA 3QNVA 4OMEA 3JRUA 5LYFA 4FBEA 4C9RA 2ZEOA 4ONWA 3PB8X 1M4LA 2C6PA 4CDKA 3PB4X 5HVHA 4P10A 3D4UA 2ZEMA 1XF1A 2PJ3A 3GUXA 2AFZA 3B3WA 3L2NA 1CP7A 3PB6X 2DEAA 4C99A 2PVVA 2AFUA 2EK9A 1HEEA 2ZEEA 3B3SA 4P6YA 4ZX9A 5J1QA 3PFOA 3MN8A 4OP4A 2PJ0A 4RUHA 3B2YA 2F8HA 2AFXA 4MHZA 4OC3A 4C85A 3BI1A 1TF8A 2PVWA 1VHEA 2XEJA 4NGPA 1ZLHA 4C8TA 2ZOGA 3D67A 3KI9A 1BPNA 4MMOA 4X2TA 3K9TA 4R8FA 1BLLE 4W9YA 3NFZA 3B3VA 2GLFA 4FAIA 3DLJA 4KNGE 1VGYA 3IWWA 2Q43A 4KSIA 4R7MA 1GYTA 3S9MA 4TWEA 4WWVA 2BO9A 2J9AA 2PCUA 4C9VA 3ICUA 1ELLP 1YSJA 3S9LA 2JBJA 2PJ8A 3FMCA 2Q51A 3D66A 2C5QA 4C9EA 3V38A 1LCPA 2AFMA 1RTQA 2ZEPA 5JH9A 3I6SA 2POKA 2XEFA 3DGVA 3FJUA 3KHXA 2V8VA 4MHYA 4PPZA 2PJ9A 2VL1A 5LRKA 1JQGA 3D7FA 4NFRA 4UEFA 4OIDA 1IGBA 1R43A 4UIAA 2JBKA 4PQAA 3TX8A 4AXVA 1PYTB 1H8LA 3FVLA 4NJQA 2JEWA 5HVFA 3WC5A 4OC2A 2ANPA 3BHXA 4OC4A 3B3CA 3FH4A 2HB6A 4MCSA 3RBUA 1YLOA 3KHZA 3N5FA 3SI1A 5THWA 2ZEGA 4WJBA 3H8FA 1ZLIA 4OIWA 3VH9A 2WZNA 4ZYQA 4ZY2A 3MRUA 2CTCA 3HUVA 4YU9A 2O53A 1CG2A 1TKHA 5LYLA 1XFOA 4P44A 4YWYA 2ZELA 1YW6A 4TNUA 4C84A 4PXBA 1BPMA 2BOAA 2AFOA 3WC7A 3CPAA 2C1CA 3B35A 3I1UA 3IEHA 2GREA 4Q7AA 4UIBA 5LRGA 1ARLA 1FT7A 1TKFA 1Z2LA 1XRYA 2PJBA 1EE3P 3D7GA 3CDXA 4Z65A 2OR4A 2V77A 4A39A 1VIXA 2CF4A 4NGQA 3PRTA 3K2KA 4P4EA 1CPXA 4EFDA 1F57A 1YMEA 2PRQA 3IJ3A 4C8UA 3KR5A 3FEEA 4P4FA 1LOKA 3SJXA 2HC9A 3B7IA 3HLPA 1XBUA 2PJ2A 3D68A 2PJ6A 3KGQA 2V8GA 5D8NA 4C86A 2IQ6A 5JM6A 1R3NA 2GU2A 3T8WA 4F8ZA 3H8EA 5K8PA 4EWTA 3NH4A 4LQGA 3TC8A 2C6GA 5IR2A 4DUKA 3SJEA 2PJAA 2AFSA 4CDJA 4P4DA 3FX6A 3IC1A 2XEIA 1Z5RA 2CIJA 1CP6A 3VTAA 4P4JA 4CPAA 1XJOA 3LMSA 3WC6A 4NGTA 4OC0A 4NGNA 2CTBA 3FECA 3NH8A 4P4IA 1UWYA 3SI0A 1ZG9A 5IB9A 4YN3A 4C8PA 4A37A 1NSAA 1KWMA 5K8OA 2EK8A 3SJFA 1AMPA 2PJ7A 2PJ1A 1ARMA 2PJ5A 4K3NA 2V8HA 3SI2A 5ELYA 4MCRA 1HDQA 3I74A 1ELMP 1DE4C 2EWBA 5F09A 4X3RA 3KL9A 4JYWA 3FF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ8 A;  8CPA A;  4MRI A;  5K8M A;  2PJC A;  1LAP A;  1CX8 A;  5K8N A;  2FVG A;  4C8C A;  1Z8L A;  5LYI A;  4TJX A;  4MHN A;  2XEG A;  2IJZ A;  3PB7 X;  3WAB A;  2QYV A;  3ISZ A;  4O23 A;  4ZX8 A;  1CBX A;  4FUU A;  4IAV A;  3BI0 A;  2ZEN A;  3NA6 A;  4C8A A;  4EME A;  2AFW A;  1IY7 A;  4R76 A;  3D7H A;  1CPS A;  1QMU A;  2PE3 A;  4GM5 A;  4JZ0 A;  2ABZ A;  3KR4 A;  2PIY A;  2ZED A;  3KAS A;  4DJL A;  2NYQ A;  1Y0Y A;  5HVG A;  5HXD A;  5LYD A;  1LFW A;  4B6Z A;  4ZY1 A;  1Q7L A;  1DTD A;  1OBR A;  4MHP A;  3WT4 A;  4ZY0 A;  4IK2 A;  3KZW A;  2NSM A;  3VAT A;  5I4M A;  1Y0R A;  3S9N A;  4C9A A;  2PIZ A;  3RAM A;  3GLJ A;  3IO1 A;  3CPX A;  5CBM A;  3CT9 A;  5LRJ A;  4NGR A;  3EIF A;  2O4H A;  4UEZ A;  4A38 A;  4P4B A;  2RB7 A;  5CPA A;  1PCA A;  3KQX A;  3BXM A;  2V8D A;  3D7D A;  4UEE A;  3H8G A;  4A94 A;  2OOT A;  3ISX A;  4DYO A;  4OC5 A;  6CPA A;  2G9D A;  2QVP A;  4H2K A;  5DS0 A;  4G1P A;  4X8I A;  2GLJ A;  5D29 A;  4R6T A;  2PJ4 A;  1FNO A;  1VHO A;  2ZOF A;  1TF9 A;  3LWU A;  4UF4 A;  2ZEH A;  4C9U A;  4F9V A;  2WYR A;  2C6C A;  2BCO A;  1F2O A;  2I3C A;  1F2P A;  2RFH A;  3PFE A;  3VAR A;  3GB0 A;  1AYE A;  4PXE A;  4IHM A;  3RZA A;  5JGF A;  1WVM A;  1TXR A;  1ZG7 A;  1QQ9 A;  1ZG8 A;  3IFE A;  4NJR A;  4NGS A;  4P45 A;  1TKJ A;  3IIB A;  4FWU A;  3PBB A;  3V7Z A;  2ZEF A;  4OKO A;  1LAN A;  2F7V A;  7CPA A;  1HDU A;  4PXD A;  4MXU A;  3KQZ A;  4OC1 A;  3B3T A;  1Y9Z A;  4MCP A;  3NH5 A;  1BAV A;  4NGM A;  3PEI A;  1Y7E A;  1LAM A;  4C8F A;  4BD9 A;  3FED A;  4F9U A;  4PXC A;  1XMB A;  1YW4 A;  1V6C A;  2IMO A;  3PBE A;  3PB9 X;  4ZI6 A;  3SJG A;  4MCQ A;  2Q4Z A;  4TJV A;  3QNV A;  4OME A;  3JRU A;  5LYF A;  4FBE A;  4C9R A;  2ZEO A;  4ONW A;  3PB8 X;  1M4L A;  2C6P A;  4CDK A;  3PB4 X;  5HVH A;  4P10 A;  3D4U A;  2ZEM A;  1XF1 A;  2PJ3 A;  3GUX A;  2AFZ A;  3B3W A;  3L2N A;  1CP7 A;  3PB6 X;  2DEA A;  4C99 A;  2PVV A;  2AFU A;  2EK9 A;  1HEE A;  2ZEE A;  3B3S A;  4P6Y A;  4ZX9 A;  5J1Q A;  3PFO A;  3MN8 A;  4OP4 A;  2PJ0 A;  4RUH A;  3B2Y A;  2F8H A;  2AFX A;  4MHZ A;  4OC3 A;  4C85 A;  3BI1 A;  1TF8 A;  2PVW A;  1VHE A;  2XEJ A;  4NGP A;  1ZLH A;  4C8T A;  2ZOG A;  3D67 A;  3KI9 A;  1BPN A;  4MMO A;  4X2T A;  3K9T A;  4R8F A;  1BLL E;  4W9Y A;  3NFZ A;  3B3V A;  2GLF A;  4FAI A;  3DLJ A;  4KNG E;  1VGY A;  3IWW A;  2Q43 A;  4KSI A;  4R7M A;  1GYT A;  3S9M A;  4TWE A;  4WWV A;  2BO9 A;  2J9A A;  2PCU A;  4C9V A;  3ICU A;  1ELL P;  1YSJ A;  3S9L A;  2JBJ A;  2PJ8 A;  3FMC A;  2Q51 A;  3D66 A;  4C9E A;  3V38 A;  1LCP A;  2AFM A;  1RTQ A;  2ZEP A;  5JH9 A;  3I6S A;  2POK A;  2XEF A;  3DGV A;  3FJU A;  3KHX A;  2V8V A;  4MHY A;  4PPZ A;  2PJ9 A;  2VL1 A;  5LRK A;  1JQG A;  3D7F A;  4NFR A;  4UEF A;  4OID A;  1IGB A;  1R43 A;  4UIA A;  2JBK A;  4PQA A;  3TX8 A;  4AXV A;  1PYT B;  1H8L A;  3FVL A;  4NJQ A;  2JEW A;  5HVF A;  3WC5 A;  4OC2 A;  2ANP A;  3BHX A;  4OC4 A;  3B3C A;  3FH4 A;  2HB6 A;  4MCS A;  3RBU A;  1YLO A;  3KHZ A;  3N5F A;  3SI1 A;  5THW A;  2ZEG A;  4WJB A;  3H8F A;  1ZLI A;  4OIW A;  3VH9 A;  2WZN A;  4ZYQ A;  4ZY2 A;  3MRU A;  2CTC A;  3HUV A;  4YU9 A;  2O53 A;  1CG2 A;  1TKH A;  5LYL A;  1XFO A;  4P44 A;  4YWY A;  2ZEL A;  1YW6 A;  4TNU A;  4C84 A;  4PXB A;  1BPM A;  2BOA A;  2AFO A;  3WC7 A;  3CPA A;  2C1C A;  3B35 A;  3I1U A;  3IEH A;  2GRE A;  4Q7A A;  4UIB A;  5LRG A;  1ARL A;  1FT7 A;  1TKF A;  1Z2L A;  1XRY A;  2PJB A;  1EE3 P;  3D7G A;  3CDX A;  4Z65 A;  2OR4 A;  2V77 A;  4A39 A;  1VIX A;  2CF4 A;  4NGQ A;  3PRT A;  3K2K A;  4P4E A;  1CPX A;  4EFD A;  1F57 A;  1YME A;  2PRQ A;  3IJ3 A;  4C8U A;  3KR5 A;  3FEE A;  4P4F A;  1LOK A;  3SJX A;  2HC9 A;  3B7I A;  3HLP A;  1XBU A;  2PJ2 A;  3D68 A;  2PJ6 A;  3KGQ A;  2V8G A;  5D8N A;  4C86 A;  2IQ6 A;  5JM6 A;  1R3N A;  2GU2 A;  3T8W A;  4F8Z A;  3H8E A;  5K8P A;  4EWT A;  3NH4 A;  4LQG A;  3TC8 A;  2C6G A;  4DUK A;  3SJE A;  2PJA A;  2AFS A;  4CDJ A;  4P4D A;  3FX6 A;  3IC1 A;  2XEI A;  1Z5R A;  2CIJ A;  1CP6 A;  3VTA A;  4P4J A;  4CPA A;  1XJO A;  3LMS A;  3WC6 A;  4NGT A;  4OC0 A;  4NGN A;  2CTB A;  3FEC A;  3NH8 A;  4P4I A;  1UWY A;  3SI0 A;  1ZG9 A;  5IB9 A;  4YN3 A;  4C8P A;  4A37 A;  1NSA A;  1KWM A;  5K8O A;  2EK8 A;  3SJF A;  1AMP A;  2PJ7 A;  2PJ1 A;  1ARM A;  2PJ5 A;  4K3N A;  2V8H A;  3SI2 A;  5ELY A;  4MCR A;  1HDQ A;  3I74 A;  1ELM P;  1DE4 C;  2EWB A;  5F09 A;  4X3R A;  3KL9 A;  4JYW A;  3FF3 A; 
#chains in the Genus database with same CATH topology
 3H4Q A;  4KUB A;  2EBJ A;  2QJ8 A;  1ZL0 A;  4UCN A;  8CPA A;  4MRI A;  5K8M A;  4FD7 A;  2PJC A;  1LAP A;  4IF5 A;  2OB0 A;  5A28 A;  1KEE B;  2Q0Y A;  5CNP A;  1CX8 A;  5K8N A;  2FVG A;  4C8C A;  1Z8L A;  2ZXV A;  4XPL A;  5LYI A;  1IOF A;  4IIY A;  4MHN A;  2XEG A;  3NE7 A;  3S6G A;  3KKW A;  3NFQ A;  1MK4 A;  2IJZ A;  4MY0 A;  3PB7 X;  1IYK A;  3N7Z A;  4FD4 A;  3WAB A;  2GP4 A;  1S60 A;  2AJ6 A;  2QYV A;  1VBG A;  2HQY A;  1M44 A;  2R7H A;  4HNX B;  3ISZ A;  4O23 A;  4ZX8 A;  1A9X B;  1CBX A;  1YVO A;  2FIW A;  1EO0 A;  4XNH C;  4CAF A;  4FUU A;  4IAV A;  3BI0 A;  2ZEN A;  3NA6 A;  4J3G A;  4C8A A;  2QML A;  2PR1 A;  4EME A;  2AFW A;  1S7F A;  3DNS A;  1IY7 A;  4R76 A;  1QSO A;  3EZB A;  3OB2 B;  2PQ8 A;  3D7H A;  1CPS A;  1J4J A;  1QMU A;  2J8M A;  4A4B A;  4BMH A;  2PE3 A;  4B10 A;  2AUM A;  4GM5 A;  1MJ9 A;  4JZ0 A;  2B5G A;  4RS2 A;  2ABZ A;  5JQ4 A;  3KR4 A;  3K4I A;  4INJ A;  2PIY A;  2ZED A;  4KOY A;  2WPX A;  4PK2 A;  1V0C A;  2DPS A;  3KAS A;  2PDO A;  4CGM A;  3BUO B;  4CGO A;  4KUA A;  2HI6 A;  1U6M A;  4H1H A;  1P4N A;  4DJL A;  2D0P A;  2NYQ A;  1Y0Y A;  3PZJ A;  3TYX A;  4PK3 A;  1BO4 A;  3VRQ A;  1I12 A;  1A2Z A;  5HVG A;  5HXD A;  3OP0 A;  5LYD A;  1LFW A;  3K9U A;  5BY0 A;  4C7I A;  2OZH A;  1VBH A;  4B6Z A;  4ZY1 A;  4JLY A;  2B4J C;  3O8Z A;  3TO9 A;  1Q7L A;  4CO9 A;  1ZO0 A;  2R82 A;  1DTD A;  3DDD A;  2B4D A;  1OBR A;  3U1B A;  4MHP A;  1SQH A;  3D2P A;  3WT4 A;  2GFQ A;  4ZY0 A;  3VGO A;  4IK2 A;  3KZW A;  1YVK A;  4B5P A;  2NSM A;  4QUS A;  3VAT A;  4KOR A;  4RN7 A;  5I4M A;  1Y0R A;  4JWP A;  4KVM E;  3S9N A;  4C9A A;  2PIZ A;  2Y1M A;  4XNH B;  3RAM A;  3GLJ A;  3IO1 A;  5EMI A;  4KS9 A;  2DPT A;  3CPX A;  3TLC A;  5CBM A;  1IB1 E;  2KCW A;  2MP0 A;  3CT9 A;  5LRJ A;  4NGR A;  4YRH A;  3R1K A;  2O4H A;  2D0O A;  3EIF A;  4UEZ A;  4B12 A;  3TTH A;  2B3U A;  4A38 A;  1R57 A;  4P4B A;  2RB7 A;  2ZW7 A;  5CPA A;  4CGN A;  1PCA A;  4COG A;  1QSR A;  3KQX A;  4CRY B;  5C82 A;  2D4P A;  3BXM A;  2V8D A;  4BBH A;  3D7D A;  4UEE A;  3UY5 A;  3H8G A;  3TE4 A;  2QEC A;  4U9Z A;  4A94 A;  1YLE A;  4ORF A;  2OOT A;  3F8K A;  2OU2 A;  5HKY A;  3D8P A;  3IWE A;  2DLA A;  3ISX A;  4KZT A;  4U9Y A;  2EZC A;  2DXQ A;  4DYO A;  4OAD A;  5EC4 A;  2OLS A;  2VEZ A;  1XE4 A;  5H84 A;  2EZA A;  4OC5 A;  6CPA A;  3NE8 A;  2G9D A;  2Q04 A;  2QVP A;  2Z0Z A;  3I9S A;  4H2K A;  4MFK A;  5DS0 A;  4CGP A;  1M6V B;  4G1P A;  4X8I A;  2GLJ A;  4MHD A;  5D29 A;  1X12 A;  2PJ4 A;  2BUE A;  2F5I A;  4R6T A;  4OAE A;  4B13 A;  1Q2Y A;  1FNO A;  2XPP A;  2P6G A;  1VHO A;  3VRO A;  2ZOF A;  2VXK A;  4A30 A;  1TF9 A;  3LWU A;  4UF4 A;  2ZEH A;  3SXN A;  4C9U A;  4F9V A;  2WYR A;  2N3A B;  2FE7 A;  2C6C A;  4MFQ A;  2BCO A;  4QB9 A;  3VWD A;  1F2O A;  2I3C A;  4M3S A;  3C26 A;  5F48 A;  1C3O B;  1F2P A;  1IIC A;  4OLL A;  2VZZ A;  4C2X A;  1GGO A;  3EO4 A;  2BSW A;  2RFH A;  3PFE A;  3DR8 A;  4JJX A;  1M4G A;  2VKZ G;  2BEI A;  2ZW6 A;  3VAR A;  4A95 A;  1CE8 B;  1NBW A;  3GB0 A;  1AYE A;  2Z3O A;  4PXE A;  4K30 A;  4IHM A;  3RZA A;  2G0B A;  3S6K A;  2FL4 A;  5JGF A;  3JVN A;  1WVM A;  4A4C A;  1TXR A;  5IB0 A;  4KSA A;  1ZG7 A;  1QQ9 A;  1ZG8 A;  3IFE A;  3RNZ A;  2FXF A;  4NJR A;  4NGS A;  2G3T A;  4P45 A;  4E8O A;  2DF5 A;  1TKJ A;  1IID A;  3IIB A;  4TJX A;  4FWU A;  3PBB A;  4A32 A;  4A31 A;  4UCP A;  5AG7 A;  3V7Z A;  2REE A;  2ZEF A;  4II9 A;  4OKO A;  4UBR A;  4MI1 A;  5DWM A;  1LAN A;  2F7V A;  5G20 A;  7CPA A;  1HDU A;  4RI1 A;  3SHP A;  3HPG G;  3W91 A;  2VZY A;  4PXD A;  1CJW A;  4MXU A;  4UFX A;  1Y9K A;  4AB7 A;  3KQZ A;  2Q7B A;  4EWT A;  1WK4 A;  1NMT A;  4OC1 A;  3B3T A;  3EXN A;  1Y9Z A;  4MCP A;  3NH5 A;  1BAV A;  1JDE A;  3V8I A;  3R9G A;  4NGM A;  2Z3P A;  3PEI A;  4EVY A;  3BLN A;  2J8N A;  3TFY A;  3TLZ A;  1Y7E A;  1LAM A;  4AVA A;  4B14 A;  4C8F A;  4BD9 A;  3F0A A;  2QIR A;  1T36 B;  3FED A;  4F9U A;  3TLA A;  4PXC A;  1XMB A;  1KBL A;  5J8F A;  1S3Z A;  4GXH A;  4Q36 A;  2Z3N A;  3T90 A;  1XMT A;  2ZW5 A;  4KVO E;  4CAE A;  5H86 A;  3FBU A;  1YW4 A;  3TLB A;  3GKR A;  1S7K A;  1V6C A;  1RXT A;  2IMO A;  3BJ8 A;  3D2M A;  3LOD A;  4M85 A;  4MI4 A;  4ZBG A;  3PBE A;  2JDC A;  4AG7 A;  5K8P A;  3PB9 X;  5KTC A;  4F0X A;  5AXI A;  4ZI6 A;  4MBU A;  3SJG A;  4MCQ A;  2Q4Z A;  4TJV A;  5A27 A;  3TLG A;  3QNV A;  4OME A;  2I00 A;  3KRV A;  3JRU A;  3P2F A;  5LYF A;  3S6F A;  4FBE A;  2Z11 A;  4AG9 A;  2ZEO A;  4ONW A;  3PB8 X;  1M4L A;  4U5Y A;  4C9R A;  4CAV A;  2C6P A;  2R8V A;  3H5Z A;  2J8R A;  5F5X A;  3SR3 A;  3PB4 X;  4C68 A;  4CDK A;  5HVH A;  2NMT A;  5HMN A;  4P10 A;  1Z4R A;  3D4U A;  1BOB A;  3GY9 A;  1IU8 A;  2ZEM A;  1VHS A;  1XF1 A;  3T0T A;  2VQY A;  1CS0 B;  2PJ3 A;  1S7N A;  2EO8 A;  5I0C A;  3GUX A;  5AG4 A;  4GPL B;  4HNY B;  3WR7 A;  2AFZ A;  2C27 A;  4R3K A;  4Y49 C;  1GHE A;  5IX3 A;  5C88 A;  3B3W A;  1XEB A;  2JLM A;  3L2N A;  1NE9 A;  2CBL A;  4B11 A;  5FVJ A;  1CP7 A;  2A4N A;  2DIK A;  4M8D A;  3I3G A;  3PB6 X;  1M1D A;  2DEA A;  4C99 A;  4DNC A;  2AFU A;  2EK9 A;  1HEE A;  2ZEE A;  3B3S A;  4P6Y A;  4PSW A;  4ZX9 A;  5J1Q A;  4BPX B;  3PFO A;  3MN8 A;  2YNC A;  4OP4 A;  1K4J A;  2PJ0 A;  4RUH A;  3B2Y A;  2F8H A;  2AFX A;  1Q2C A;  4MHZ A;  3U88 C;  4OC3 A;  3NOJ A;  4C85 A;  3BI1 A;  1TF8 A;  5F9M A;  2PVW A;  1VHE A;  2XEJ A;  1VKC A;  4NGP A;  1ZLH A;  3QAY A;  3S6H A;  3G23 A;  4IIX A;  3P2H A;  4C8T A;  4JXR A;  2ZOG A;  4KOS A;  1PUA A;  2PC1 A;  3D67 A;  3KI9 A;  3DSB A;  1BPN A;  3T9Y A;  4MMO A;  2Z10 A;  4X2T A;  2ZPA A;  3K9T A;  4L89 A;  4R8F A;  1BLL E;  4MFJ A;  4W9Y A;  3NFZ A;  5JPH A;  3FRM A;  5K99 A;  4C2Z A;  2CXA A;  2HV2 A;  1NXJ A;  4KLV A;  3VRN A;  3B3V A;  1P0H A;  1UFH A;  2BL1 A;  3FNC A;  2PCN A;  2GLF A;  4FAI A;  3DLJ A;  4KNG E;  2PR8 A;  2VBQ A;  1B6B A;  4KOX A;  1VGY A;  3IWW A;  2X7B A;  2Q43 A;  3DR6 A;  4KSI A;  4M6G A;  5JYB A;  4Y49 B;  4E0A A;  3BUX B;  4R7M A;  4R9M A;  4CYN A;  2FSR A;  1GYT A;  3EC4 A;  1YRE A;  3S9M A;  1ZYM A;  4TWE A;  1AUG A;  4H6Z A;  4WWV A;  2BO9 A;  3EFA A;  4MFZ A;  2J9A A;  3IGR A;  4LQ6 A;  2PCU A;  2AUN A;  3ICU A;  1ELL P;  4C9V A;  2UV8 G;  1L0C A;  1QSN A;  3C8O A;  4AVC A;  1YSJ A;  3S9L A;  2JBJ A;  4EYS A;  1S5K A;  4NSQ A;  5DWN A;  4NXY A;  3BJ7 A;  3CXS A;  4E94 A;  2PJ8 A;  3G3S A;  4C7H A;  3FMC A;  2Q51 A;  5HKW A;  3D66 A;  2C5Q A;  4C9E A;  3V38 A;  1KUX A;  1LCP A;  1Z4E A;  3MGD A;  1Q2D A;  2H5M A;  2AFM A;  1RTQ A;  2D4O A;  2GIV A;  2ZEP A;  3OWC A;  4CGL A;  5JH9 A;  3T05 A;  3I6S A;  4B5O A;  3TOB A;  2POK A;  2XEF A;  3DGV A;  3FJU A;  4QVT A;  2XPN A;  1X10 A;  3KHX A;  2P6F A;  2V8V A;  3T5M A;  5F49 A;  4MHY A;  4PPZ A;  4YFJ A;  2PJ9 A;  2Q7S A;  1M4I A;  2VL1 A;  4UWI A;  4BPU B;  4KVX A;  4F6A A;  4J0N A;  2PRB A;  5LRK A;  1JQG A;  2Q4V A;  4BPW B;  3D7F A;  1KUY A;  3FXT A;  3R95 A;  4KOT A;  4NFR A;  2YJV A;  1FY7 A;  5G22 A;  2CNT A;  4UEF A;  4OID A;  3HPH E;  1IGB A;  1R43 A;  4UIA A;  4BTF A;  2B5G B;  3RO0 A;  4CRZ B;  4ONU A;  4R3L A;  2JBK A;  4UFV A;  4FD5 A;  1XIX A;  4CYP A;  4PQA A;  3TX8 A;  2OH1 A;  2B3V A;  5G21 A;  1N71 A;  4AXV A;  2B0A A;  1M4D A;  3IWG A;  3T07 A;  1J3L A;  2EZB A;  1PYT B;  1H8L A;  3FVL A;  4NJQ A;  4UA3 A;  1BXR B;  2JEW A;  5HVF A;  5HKZ A;  4HPS A;  3WC5 A;  2GE3 A;  4OC2 A;  2ANP A;  3BHX A;  5F1Y A;  4OC4 A;  2EVN A;  3VRR A;  2Q44 A;  1Z9E A;  2HB6 A;  3B3C A;  3FH4 A;  2B4D B;  3QAH A;  3TO6 A;  4QBJ A;  1Z8W A;  2ZW4 A;  4MCS A;  2YND A;  3RBU A;  4MFP A;  4M6I A;  1YLO A;  2B4B A;  4C2Y A;  5AG6 A;  2OZU A;  3KHZ A;  4B5P B;  3ZNI A;  4KLW A;  3N5F A;  2JDD A;  3SI1 A;  2B58 A;  5THW A;  2ZEG A;  2RC4 A;  3OAK A;  4WJB A;  1XOV A;  5HH1 A;  3H8F A;  1ZLI A;  4OIW A;  1QST A;  1Z8T A;  1PU9 A;  2WZN A;  3VH9 A;  4RR2 B;  3TT2 A;  4ZYQ A;  5AG5 A;  4C8U A;  4ZY2 A;  2FIA A;  1IOI A;  2EUI A;  3MRU A;  2CTC A;  3FB3 A;  4LUA A;  4CYQ A;  1DIK A;  3HUV A;  4YU9 A;  4AVB A;  2O53 A;  1CG2 A;  1TKH A;  2JEV A;  5LYL A;  1XFO A;  2Y0M A;  4P44 A;  4FD6 A;  2FCK A;  4YWY A;  2ZEL A;  1YW6 A;  4TNU A;  4C84 A;  3LAC A;  1KUV A;  4PXB A;  4PV6 A;  1B87 A;  2ARH A;  1BPM A;  1Z9U A;  2AFO A;  2BOA A;  3WC7 A;  3CPA A;  1XF8 A;  4LX9 A;  4Q38 A;  4E5S A;  2C1C A;  2PSW A;  3B35 A;  3I1U A;  3IEH A;  1WJT A;  2GRE A;  4CAW A;  4HKF A;  3TLY A;  4Q7A A;  5JVL A;  3IU2 A;  3TO7 A;  1EZA A;  3EZA A;  3F5B A;  4UIB A;  1MJB A;  2K5T A;  4GS4 A;  3D3S A;  4KSF A;  5LRG A;  4Z65 A;  2R98 A;  1ARL A;  1FT7 A;  1MJA A;  2IL4 A;  5E96 A;  4A2Z A;  5BWA B;  2HRO A;  1CM0 A;  1TKF A;  1Z2L A;  2FT0 A;  1XRY A;  2VI7 A;  2Z3M A;  2PJB A;  3GJZ A;  1EE3 P;  3PGP A;  1EZB A;  4E2A A;  1JWQ A;  3F9K C;  3D7G A;  3CDX A;  2AE6 A;  3EY5 A;  3W6S A;  2OR4 A;  5F13 A;  2CNM A;  4XPD C;  2R1I A;  3VRP A;  1YGH A;  2V77 A;  4L8A A;  2P0W A;  4CZ1 A;  4A39 A;  1VIX A;  3A9L A;  2I79 A;  1ZRS A;  3FYN A;  2CF4 A;  4R57 A;  4NGQ A;  3ZJ0 A;  3PRT A;  3K2K A;  4P4E A;  1CPX A;  4I49 A;  2GAN A;  1C30 B;  4EFD A;  5F47 A;  1F57 A;  1YME A;  2O28 A;  2PRQ A;  3IJ3 A;  1Z8X A;  3G8W A;  3KR5 A;  2Q4Y A;  3R9F A;  4A33 A;  3FEE A;  4P4F A;  3RYO A;  1Y7R A;  3PFV A;  2HUZ A;  1LOK A;  3CXQ A;  3SJX A;  4X5K A;  2HC9 A;  4ZGY B;  4H6U A;  3B7I A;  3HLP A;  1XBU A;  2PJ2 A;  3D68 A;  5GCN A;  2XPL A;  2CY2 A;  3VWE A;  2WSA A;  4KOW A;  2PJ6 A;  3GIU A;  2Y1N A;  3KGQ A;  1B47 A;  3LD2 A;  2WPW A;  2V8G A;  3TCV A;  5D8N A;  3KL9 A;  4NF1 A;  4C86 A;  4UCM A;  2IQ6 A;  4PSX A;  5JM6 A;  1JDB C;  1R3N A;  2GU2 A;  3T8W A;  3PT1 A;  4F8Z A;  3H8E A;  1OZP A;  1S7L A;  2G3A A;  4NEX A;  2ATR A;  4JXQ A;  3NH4 A;  4LQG A;  1I21 A;  1YX0 A;  4UWJ A;  2C6G A;  3GYA A;  4YGO A;  4IUS A;  3TC8 A;  3TOA A;  5F46 A;  5IR2 A;  1WWZ A;  3SJE A;  4DUK A;  4XPD B;  4MJX A;  5KTD A;  2PJA A;  2AFS A;  3TLE A;  3CXP A;  2FS5 A;  4CYO A;  4CDJ A;  2OZG A;  4P4D A;  2YNC C;  3FX6 A;  4HNW B;  4MJ8 A;  3JUW A;  3IC1 A;  2XEI A;  1KZF A;  3BUM B;  2CIJ A;  1Z5R A;  3R96 A;  4CAX A;  1CP6 A;  3VTA A;  4P4J A;  2FM4 A;  4JD6 A;  1IYL A;  4CPA A;  5IV0 A;  1XJO A;  5G1Z A;  3LMS A;  4R87 A;  3WC6 A;  2YJT A;  4NGT A;  3PLF B;  2XPO A;  4MY3 A;  4OC0 A;  4NGN A;  2CTB A;  3FEC A;  3HMJ G;  3EZE A;  3FIX A;  1ON0 A;  3OB1 B;  3NH8 A;  2YNE A;  3TLG B;  5J8C A;  4P4I A;  1UWY A;  3SI0 A;  2HWG A;  4JVO A;  1YR0 A;  4KOV A;  1TIQ A;  1R61 A;  1ZG9 A;  1QSM A;  5IB9 A;  3JTK A;  4YN3 A;  4C8P A;  1FBV A;  2REF A;  4A37 A;  1YK3 A;  4NCZ A;  5FD8 A;  3ZZI A;  1NSA A;  1KWM A;  2Z3K A;  5EBV A;  4KOU A;  5K8O A;  2P6E A;  2EK8 A;  1YVH A;  2YGW A;  3PP9 A;  4UFW A;  4MFL A;  3SJF A;  1AMP A;  3CZX A;  4M6H A;  3R9E A;  2X0S A;  2E28 A;  4F0Y A;  5J3X A;  2Z3L A;  2PJ7 A;  2PJ1 A;  3SXO A;  1ARM A;  2PJ5 A;  3BUW B;  1Y9W A;  3IU1 A;  4XPK A;  2ODF A;  4K3N A;  4QC6 A;  4COB A;  2CNS A;  2V8H A;  1I1D A;  3SI2 A;  5ELY A;  4MCR A;  1HDQ A;  1RO5 A;  1ELM P;  3W6X A;  4CS0 B;  3I74 A;  4BIN A;  1DE4 C;  1NSL A;  5KTA A;  5ISV A;  2EWB A;  3B8G A;  4H89 A;  3QB8 A;  1Q5X A;  3E0K A;  1KC7 A;  5AGE A;  3BUN B;  5F09 A;  2WUU A;  4X3R A;  2PVV A;  1LRZ A;  4JYW A;  1VI4 A;  1YQE A;  3FF3 A; 
#chains in the Genus database with same CATH homology
 2QJ8 A;  8CPA A;  4MRI A;  5K8M A;  2PJC A;  1LAP A;  1CX8 A;  5K8N A;  2FVG A;  4C8C A;  1Z8L A;  5LYI A;  4TJX A;  4MHN A;  2XEG A;  2IJZ A;  3PB7 X;  3WAB A;  2GP4 A;  2QYV A;  3ISZ A;  4O23 A;  4ZX8 A;  1CBX A;  4FUU A;  4IAV A;  3BI0 A;  2ZEN A;  3NA6 A;  4C8A A;  4EME A;  2AFW A;  1IY7 A;  4R76 A;  3D7H A;  1CPS A;  1QMU A;  2PE3 A;  4GM5 A;  4JZ0 A;  2ABZ A;  3KR4 A;  2PIY A;  2ZED A;  3KAS A;  4DJL A;  2NYQ A;  1Y0Y A;  5HVG A;  5HXD A;  5LYD A;  1LFW A;  4B6Z A;  4ZY1 A;  1Q7L A;  1DTD A;  1OBR A;  4MHP A;  3WT4 A;  4ZY0 A;  4IK2 A;  3KZW A;  2NSM A;  3VAT A;  5I4M A;  1Y0R A;  3S9N A;  4C9A A;  2PIZ A;  3RAM A;  3GLJ A;  3IO1 A;  3CPX A;  5CBM A;  3CT9 A;  5LRJ A;  4NGR A;  3EIF A;  2O4H A;  4UEZ A;  4A38 A;  4P4B A;  2RB7 A;  5CPA A;  1PCA A;  3KQX A;  3BXM A;  2V8D A;  3D7D A;  4UEE A;  3H8G A;  4A94 A;  2OOT A;  3ISX A;  4DYO A;  4OC5 A;  6CPA A;  2G9D A;  2QVP A;  4H2K A;  5DS0 A;  4G1P A;  4X8I A;  2GLJ A;  5D29 A;  4R6T A;  2PJ4 A;  1FNO A;  1VHO A;  2ZOF A;  1TF9 A;  3LWU A;  4UF4 A;  2ZEH A;  4C9U A;  4F9V A;  2WYR A;  2C6C A;  2BCO A;  1F2O A;  2I3C A;  1F2P A;  2RFH A;  3PFE A;  3VAR A;  3GB0 A;  1AYE A;  4PXE A;  4IHM A;  3RZA A;  5JGF A;  1WVM A;  1TXR A;  1ZG7 A;  1QQ9 A;  1ZG8 A;  3IFE A;  4NJR A;  4NGS A;  4P45 A;  1TKJ A;  3IIB A;  4FWU A;  3PBB A;  3V7Z A;  2ZEF A;  4OKO A;  1LAN A;  2F7V A;  7CPA A;  1HDU A;  4PXD A;  4MXU A;  3KQZ A;  4OC1 A;  3B3T A;  1Y9Z A;  4MCP A;  3NH5 A;  1BAV A;  4NGM A;  3PEI A;  1Y7E A;  1LAM A;  4C8F A;  4BD9 A;  3FED A;  4F9U A;  4PXC A;  1XMB A;  1YW4 A;  1V6C A;  2IMO A;  3PBE A;  3PB9 X;  4ZI6 A;  3SJG A;  4MCQ A;  2Q4Z A;  4TJV A;  3QNV A;  4OME A;  3JRU A;  5LYF A;  4FBE A;  4C9R A;  2ZEO A;  4ONW A;  3PB8 X;  1M4L A;  2C6P A;  4CDK A;  3PB4 X;  5HVH A;  4P10 A;  3D4U A;  2ZEM A;  1XF1 A;  2PJ3 A;  3GUX A;  2AFZ A;  3B3W A;  3L2N A;  1CP7 A;  3PB6 X;  2DEA A;  4C99 A;  2PVV A;  2AFU A;  2EK9 A;  1HEE A;  2ZEE A;  3B3S A;  4P6Y A;  4ZX9 A;  5J1Q A;  3PFO A;  3MN8 A;  4OP4 A;  2PJ0 A;  4RUH A;  3B2Y A;  2F8H A;  2AFX A;  4MHZ A;  4OC3 A;  4C85 A;  3BI1 A;  1TF8 A;  2PVW A;  1VHE A;  2XEJ A;  4NGP A;  1ZLH A;  4C8T A;  2ZOG A;  3D67 A;  3KI9 A;  1BPN A;  4MMO A;  4X2T A;  3K9T A;  4R8F A;  1BLL E;  4W9Y A;  3NFZ A;  3B3V A;  2GLF A;  4FAI A;  3DLJ A;  4KNG E;  1VGY A;  3IWW A;  2Q43 A;  4KSI A;  4R7M A;  1GYT A;  3S9M A;  4TWE A;  4WWV A;  2BO9 A;  2J9A A;  2PCU A;  4C9V A;  3ICU A;  1ELL P;  1YSJ A;  3S9L A;  2JBJ A;  2PJ8 A;  3FMC A;  2Q51 A;  3D66 A;  2C5Q A;  4C9E A;  3V38 A;  1LCP A;  2AFM A;  1RTQ A;  2ZEP A;  5JH9 A;  3I6S A;  2POK A;  2XEF A;  3DGV A;  3FJU A;  3KHX A;  2V8V A;  4MHY A;  4PPZ A;  2PJ9 A;  2VL1 A;  5LRK A;  1JQG A;  3D7F A;  4NFR A;  4UEF A;  4OID A;  1IGB A;  1R43 A;  4UIA A;  2JBK A;  4PQA A;  3TX8 A;  4AXV A;  1PYT B;  1H8L A;  3FVL A;  4NJQ A;  2JEW A;  5HVF A;  3WC5 A;  4OC2 A;  2ANP A;  3BHX A;  4OC4 A;  3B3C A;  3FH4 A;  2HB6 A;  4MCS A;  3RBU A;  1YLO A;  3KHZ A;  3N5F A;  3SI1 A;  5THW A;  2ZEG A;  4WJB A;  3H8F A;  1ZLI A;  4OIW A;  3VH9 A;  2WZN A;  4ZYQ A;  4ZY2 A;  3MRU A;  2CTC A;  3HUV A;  4YU9 A;  2O53 A;  1CG2 A;  1TKH A;  5LYL A;  1XFO A;  4P44 A;  4YWY A;  2ZEL A;  1YW6 A;  4TNU A;  4C84 A;  4PXB A;  1BPM A;  2BOA A;  2AFO A;  3WC7 A;  3CPA A;  2C1C A;  3B35 A;  3I1U A;  3IEH A;  2GRE A;  4Q7A A;  4UIB A;  5LRG A;  1ARL A;  1FT7 A;  1TKF A;  1Z2L A;  1XRY A;  2PJB A;  1EE3 P;  3D7G A;  3CDX A;  4Z65 A;  2OR4 A;  2V77 A;  4A39 A;  1VIX A;  2CF4 A;  4NGQ A;  3PRT A;  3K2K A;  4P4E A;  1CPX A;  4EFD A;  1F57 A;  1YME A;  2PRQ A;  3IJ3 A;  4C8U A;  3KR5 A;  3FEE A;  4P4F A;  1LOK A;  3SJX A;  2HC9 A;  3B7I A;  3HLP A;  1XBU A;  2PJ2 A;  3D68 A;  2PJ6 A;  3KGQ A;  2V8G A;  5D8N A;  4C86 A;  2IQ6 A;  5JM6 A;  1R3N A;  2GU2 A;  3T8W A;  4F8Z A;  3H8E A;  5K8P A;  4EWT A;  3NH4 A;  4LQG A;  3TC8 A;  2C6G A;  5IR2 A;  4DUK A;  3SJE A;  2PJA A;  2AFS A;  4CDJ A;  4P4D A;  3FX6 A;  3IC1 A;  2XEI A;  1Z5R A;  2CIJ A;  1CP6 A;  3VTA A;  4P4J A;  4CPA A;  1XJO A;  3LMS A;  3WC6 A;  4NGT A;  4OC0 A;  4NGN A;  2CTB A;  3FEC A;  3NH8 A;  4P4I A;  1UWY A;  3SI0 A;  1ZG9 A;  5IB9 A;  4YN3 A;  4C8P A;  4A37 A;  1NSA A;  1KWM A;  5K8O A;  2EK8 A;  3SJF A;  1AMP A;  2PJ7 A;  2PJ1 A;  1ARM A;  2PJ5 A;  4K3N A;  2V8H A;  3SI2 A;  5ELY A;  4MCR A;  1HDQ A;  3I74 A;  1ELM P;  1DE4 C;  2EWB A;  5F09 A;  4X3R A;  3KL9 A;  4JYW A;  3FF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...