2PVWA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with 2-(phosphonomethyl)pentanedioic acid (2-pmpa)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
695
structure length
690
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 268
structure length 690
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2pvwA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pvwA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2pvwA02
2QYVA 2F7VA 3H8GA 4A39A 3DGVA 5I4MA 4JYWA 2V8HA 4OC1A 2GLJA 3JRUA 1LCPA 8CPAA 2CIJA 1ARMA 3FJUA 4EMEA 2AFUA 4JZ0A 2AFWA 5THWA 2WZNA 1CBXA 5DS0A 4Z65A 1LFWA 3V7ZA 2RFHA 2ZEGA 2NYQA 3KR4A 2AFXA 4P4IA 3RBUA 1Q7LA 2V77A 1Z2LA 1F57A 4Q7AA 4C9VA 3D66A 1Y0RA 2PJ1A 5K8NA 3VATA 3FVLA 5LRGA 3S9NA 4TNUA 4MCPA 5LYIA 2VL1A 1LOKA 2ABZA 4ZYQA 5JGFA 4OIWA 3I6SA 1UWYA 5HVHA 1H8LA 2JBKA 4A37A 2AFOA 1TF8A 3GLJA 3FECA 4F8ZA 4ZY1A 4X2TA 1IY7A 3PB8X 4C86A 3B7IA 3PBBA 1Y7EA 3PBEA 1DE4C 2PIYA 3IO1A 1ZLIA 5D8NA 3VTAA 2PJBA 4NJQA 2IQ6A 4DUKA 1CX8A 3KGQA 2GREA 4P4DA 1YSJA 4EFDA 1JQGA 3PFOA 3KZWA 3KR5A 3LWUA 4X3RA 4UEEA 4A38A 4ZY2A 2ZEPA 3WC5A 5LRKA 4C9RA 4UIAA 2V8VA 3BI0A 3NH8A 3GB0A 4MHYA 1FT7A 1HDQA 4TJXA 2POKA 1PYTB 3IIBA 2F8HA 2Q43A 2AFSA 2XEGA 2ZOFA 3KHZA 1Z8LA 1YLOA 6CPAA 4C85A 4OC0A 3S9MA 5F09A 1R43A 5LYFA 4MMOA 4FBEA 1XMBA 3GUXA 2OR4A 1ZG8A 4FUUA 4ZX9A 1CG2A 4C8TA 3FMCA 4IAVA 4K3NA 2PCUA 4CDKA 2C1CA 2PJ2A 5LRJA 2CTBA 1VHEA 2Q4ZA 4NGTA 2PRQA 4MCQA 4P44A 4PXEA 2XEFA 3B3VA 4P4BA 1FNOA 4ZI6A 2V8DA 1BLLE 3H8FA 4KSIA 2AFZA 1BPNA 7CPAA 3K9TA 1VIXA 2EK9A 3FEEA 1DTDA 2NSMA 1XRYA 4C9UA 2ZELA 3PB7X 2PJCA 4OC2A 3KQXA 4WJBA 4PXCA 4C8UA 3PEIA 3BXMA 2J9AA 4PPZA 5CBMA 2EWBA 2GLFA 4MHNA 1ELLP 2DEAA 2ZEEA 3MRUA 4P4EA 2C6CA 1VGYA 5D29A 2PJ6A 3CDXA 3HUVA 2PE3A 3RAMA 4NGRA 4P4JA 3PB6X 4OMEA 2PJ3A 3PB9X 4AXVA 2RB7A 4MCRA 4R7MA 3SJEA 2JEWA 2PJ0A 2HB6A 2CTCA 1F2OA 2PVWA 3IWWA 5LYLA 4DYOA 1NSAA 3D4UA 4R76A 1HEEA 4GM5A 4P6YA 2IJZA 4CPAA 1ZLHA 1ARLA 3TX8A 1AYEA 1CPSA 5LYDA 3SI0A 2PJ4A 1YMEA 4YWYA 2PJAA 1ZG9A 2ZOGA 5IB9A 5HVFA 4PQAA 2PJ8A 3MN8A 4F9UA 4LQGA 4C99A 4YN3A 1QQ9A 3B35A 3ISZA 1M4LA 4UIBA 3EIFA 2XEIA 4MCSA 3IC1A 2JBJA 3ISXA 4NGQA 3NA6A 3T8WA 4YU9A 4R6TA 2FVGA 2PIZA 3B3CA 4OIDA 1HDUA 4OC3A 2ZEHA 4NGMA 3KHXA 4UEZA 2PVVA 1EE3P 1KWMA 3HLPA 5HVGA 3DLJA 3IJ3A 3TC8A 2ZEFA 1WVMA 1CPXA 4NGSA 5ELYA 2EK8A 4OKOA 1Y0YA 3IEHA 1BAVA 3SJXA 3B3TA 4DJLA 3B2YA 3FX6A 4C8AA 1OBRA 4NFRA 1CP6A 1ELMP 3WABA 3NH4A 4WWVA 4W9YA 3K2KA 4B6ZA 1BPMA 2ANPA 5K8MA 3V38A 3NFZA 5CPAA 4EWTA 1Y9ZA 2ZENA 1IGBA 3L2NA 4MRIA 3KI9A 4PXBA 2BOAA 2PJ7A 4IHMA 4C8FA 4ZY0A 4P45A 3D7GA 5JM6A 2V8GA 1Z5RA 3IFEA 1TXRA 2IMOA 4OC5A 1VHOA 3LMSA 1XBUA 5J1QA 2OOTA 3FH4A 2GU2A 1RTQA 1TKFA 2CF4A 2G9DA 3WT4A 2HC9A 2PJ5A 4FWUA 3WC6A 3D7FA 3N5FA 3NH5A 3PFEA 4X8IA 2WYRA 3PB4X 4F9VA 3SI1A 4RUHA 2AFMA 2O4HA 4OC4A 3QNVA 1R3NA 2BCOA 3FF3A 3D68A 4FAIA 2C6PA 4O23A 1TF9A 1CP7A 3KQZA 4C9AA 4IK2A 3FEDA 3SJGA 3B3WA 4MHPA 3I1UA 1PCAA 2ZEMA 4TJVA 3H8EA 3BI1A 4UEFA 3VH9A 1TKJA 4C84A 4C8CA 3BHXA 1AMPA 5K8PA 1LAMA 4P10A 3PRTA 3D7DA 1TKHA 3D7HA 2BO9A 3B3SA 3CT9A 4C9EA 4CDJA 3KASA 1XFOA 3WC7A 5JH9A 1XF1A 3SJFA 1GYTA 1ZG7A 2PJ9A 2ZEDA 4PXDA 3D67A 3CPXA 4H2KA 1QMUA 4OP4A 4P4FA 2C6GA 1V6CA 5K8OA 2ZEOA 4C8PA 3SI2A 1YW4A 3VARA 4KNGE 2I3CA 4MHZA 1YW6A 2Q51A 1LAPA 4NJRA 3KL9A 4ONWA 3S9LA 1XJOA 5HXDA 4R8FA 3ICUA 4TWEA 2QVPA 3RZAA 2O53A 3CPAA 1LANA 4MXUA 4BD9A 4A94A 4NGNA 2QJ8A 3I74A 4ZX8A 2XEJA 4G1PA 4UF4A 4NGPA 1F2PA
chains in the Genus database with same CATH superfamily
4AVBA 2QYVA 4CAVA 4YRHA 2B0AA 2F7VA 4HPSA 3H8GA 4A39A 5JQ4A 1EZBA 3DGVA 5I4MA 4KOTA 4JYWA 3DNSA 2V8HA 4OC1A 2QECA 2GLJA 3JRUA 3W91A 1LCPA 8CPAA 4M6IA 2CIJA 1ARMA 3FJUA 5GCNA 4C2YA 2FIAA 4EMEA 5HKZA 2AFUA 4JZ0A 2AFWA 5THWA 3S6FA 4E8OA 2WZNA 1ZL0A 1CBXA 5JVLA 3EO4A 4PV6A 5DS0A 4UFVA 4Z65A 3ZZIA 1M4GA 4KVOE 1UFHA 2UV8G 3B8GA 1XMTA 1LFWA 5E96A 3V7ZA 2RFHA 2ZEGA 3VGOA 2VZYA 2X7BA 3FIXA 2E28A 3SXNA 2NYQA 1VKCA 4KLVA 5G21A 1X10A 3KR4A 4KSFA 5AG7A 3C8OA 1WJTA 2AFXA 2FSRA 3E0KA 4JLYA 4P4IA 3PLFB 3RBUA 2FXFA 3HPHE 5AXIA 1Q7LA 4KSAA 4ZGYB 3D2MA 2V77A 4A32A 1Z2LA 1A9XB 1F57A 4Q7AA 3A9LA 2J8MA 1Y0RA 2PJ1A 3D66A 4KVME 5K8NA 4C9VA 3VATA 3FVLA 2P6EA 5LRGA 3S6HA 3S9NA 2D0OA 4TNUA 1N71A 2RC4A 4AB7A 4KOYA 4MCPA 5LYIA 4A4CA 2VL1A 1LOKA 2ABZA 4ZYQA 4E0AA 5JGFA 4OIWA 1S7LA 2HUZA 1YGHA 2J8RA 3K9UA 1XE4A 1UWYA 3DSBA 5HVHA 1H8LA 2JBKA 4A37A 3I6SA 4E5SA 4NXYA 2AFOA 1TF8A 1GGOA 3GLJA 1B87A 1FY7A 3FECA 4F8ZA 4RI1A 4ZY1A 1VBHA 4X2TA 4J0NA 3G23A 1OZPA 4BPUB 1IY7A 3RO0A 4Y49B 4F0XA 1ZRSA 4UWIA 3PB8X 4C86A 1Q5XA 3B7IA 2KCWA 3PBBA 1Y7EA 3PBEA 1DE4C 1VI4A 3C26A 1ON0A 1L0CA 2PIYA 3IO1A 2K5TA 5KTAA 1ZLIA 1CS0B 1RO5A 3TT2A 5D8NA 3VTAA 2PJBA 4C7HA 2DPSA 4NJQA 2IQ6A 5J8CA 4DUKA 1CX8A 2VKZG 3QAHA 1Q2CA 2B5GB 1Z8TA 3KGQA 2WUUA 3GYAA 2GREA 3VRPA 4P4DA 2Z11A 2FCKA 1YSJA 4EFDA 1JQGA 4LUAA 3T05A 3DDDA 3JUWA 3PFOA 5IR2A 2BUEA 3KZWA 3KR5A 3G8WA 3LWUA 4X3RA 4GS4A 4UEEA 4A38A 2Z10A 1R57A 2Z3PA 4ZY2A 2ZEPA 3WC5A 2B4DB 3LODA 3V8IA 5KTDA 5LRKA 4C9RA 2NMTA 4UIAA 4QBJA 2V8VA 3DR6A 3BI0A 5AGEA 5G1ZA 3NH8A 1MJBA 4QB9A 2GP4A 3GB0A 4MHYA 1FT7A 1HDQA 4TJXA 2GIVA 2POKA 4JJXA 4B11A 1PYTB 2IL4A 2PSWA 3IIBA 2YNEA 2F8HA 2Y1MA 2AFSA 2XEGA 2Q43A 2ZOFA 2ZW4A 1B6BA 2I00A 3NE7A 3KHZA 1Z8LA 5AG6A 3WR7A 1YLOA 6CPAA 4C85A 4OC0A 1IB1E 2FM4A 2JLMA 3S9MA 2HI6A 5F09A 1R43A 3R9FA 4K30A 3EXNA 5LYFA 2GE3A 2DIKA 4MMOA 4FBEA 1QSTA 1XMBA 2OR4A 3GUXA 1ZG8A 1Z9UA 4R9MA 2MP0A 3GJZA 4FUUA 4UA3A 4ZX9A 2ODFA 2WSAA 2EZCA 4INJA 1CG2A 4CGNA 4BMHA 4C8TA 2HQYA 3FMCA 4IAVA 4K3NA 4R3LA 2JDCA 3TLCA 5C88A 2Q44A 5ISVA 4FD4A 1JWQA 1PU9A 3JVNA 4R57A 2PCUA 2AJ6A 4PSWA 4B5PB 3CXPA 2C1CA 2PJ2A 4CDKA 5JYBA 2ZPAA 5G20A 5LRJA 2CTBA 1YREA 3D8PA 1VHEA 3JTKA 3TOBA 4EYSA 2Q4ZA 4H89A 3OB1B 4NGTA 2PRQA 4MCQA 4A2ZA 1KUXA 4P44A 3SHPA 1Z4RA 1IYLA 4PXEA 2XEFA 3B3VA 4P4BA 3FRMA 1FNOA 4EVYA 3HMJG 2FIWA 4RR2B 2V8DA 1BLLE 3H8FA 4KSIA 4M6HA 4NSQA 4ZI6A 2YNCC 3BUXB 4LX9A 1KC7A 2AFZA 1BPNA 2P6FA 1IICA 4ZBGA 7CPAA 2REEA 3CXQA 1VIXA 3ZNIA 3K9TA 2AUMA 4JVOA 1IOIA 5DWMA 2EK9A 3FEEA 1DTDA 3DR8A 2NSMA 1XRYA 3U88C 4MFQA 3EZBA 4II9A 4C9UA 4C68A 2OZHA 3OWCA 3U1BA 2ZELA 1J3LA 4HNXB 3PB7X 4HNYB 3T0TA 2XPNA 2PJCA 3OB2B 1PUAA 1YX0A 1S3ZA 3IWEA 4MFZA 5F49A 4C2ZA 2D4PA 1P0HA 1BO4A 4OC2A 1M4DA 3KQXA 4WJBA 3TCVA 2ZXVA 4PXCA 2EBJA 4C8UA 3EFAA 3PEIA 2Q4YA 4XPDC 3BXMA 2J9AA 1XOVA 4PPZA 5CBMA 4B12A 5C82A 2CNMA 2EWBA 2GFQA 2GLFA 3BLNA 4HKFA 4MHNA 1ELLP 2B4BA 1YVOA 2DEAA 3BJ7A 4XNHC 3T9YA 1SQHA 5A28A 3TYXA 2ZEEA 4AG7A 1Q2YA 2YGWA 4P4EA 1XF8A 2WPWA 3EC4A 2C6CA 3MRUA 1Y7RA 2VQYA 4CGPA 4MI1A 3O8ZA 5F9MA 2VI7A 3TO6A 5AG5A 4MJXA 2B5GA 1VGYA 3LD2A 4IIYA 5D29A 2ATRA 2PJ6A 3CDXA 1Y9KA 5EC4A 1YQEA 4KOXA 3HUVA 1BXRB 2QMLA 1ZO0A 2XPLA 2PE3A 4NGRA 3RAMA 4P4JA 1M1DA 4OMEA 2PJ3A 3PB6X 3PB9X 4CYNA 4AXVA 3VRNA 2RB7A 2J8NA 2DXQA 4MCRA 2B4JC 5FVJA 5A27A 5IV0A 3PZJA 4R7MA 4A4BA 1KUVA 3S6KA 3SJEA 2JEWA 2PJ0A 2HB6A 1S5KA 1Z9EA 1M44A 1F2OA 2PVWA 1QSOA 3IWWA 2CTCA 3D2PA 2B58A 4KZTA 5DWNA 5LYLA 4DYOA 2ZW7A 4COGA 1NSAA 3D4UA 1JDBC 4QC6A 4C7IA 4R76A 2X0SA 3T07A 3F5BA 3VROA 3CZXA 3BJ8A 5H86A 1FBVA 1HEEA 3G3SA 4GM5A 2IJZA 3IWGA 1ZLHA 3OP0A 4P6YA 4CPAA 1ARLA 3TX8A 3F9KC 4L8AA 3FB3A 3I3GA 3CXSA 1Z8WA 1S7NA 4XPDB 1AYEA 1CPSA 4H6UA 5LYDA 3FNCA 2PJ4A 3SI0A 1YMEA 1Z8XA 3FXTA 4MJ8A 2QIRA 4CS0B 4YWYA 4OADA 4KLWA 4UCNA 3K4IA 2PJAA 3S6GA 1DIKA 4CRYB 1ZG9A 2G3TA 2PC1A 3GKRA 1WK4A 4MFJA 2ZOGA 3GY9A 5IB9A 5HVFA 4PQAA 4R3KA 3TTHA 4H6ZA 4H1HA 4CGOA 2PJ8A 4JWPA 3MN8A 3TFYA 3OAKA 4LQGA 4I49A 4F9UA 4C99A 2OU2A 1X12A 1T36B 5HH1A 4B5PA 4YN3A 1QQ9A 3B35A 3ISZA 3PT1A 1M4LA 5CNPA 3R1KA 4M3SA 3PP9A 4UIBA 3P2HA 3EIFA 3W6XA 2XEIA 2Q0YA 4MCSA 4F6AA 3QAYA 3TLGB 3PGPA 3H4QA 1S60A 2EVNA 2JBJA 1IU8A 1Q2DA 2FE7A 4NGQA 3EY5A 3IC1A 3ISXA 4ORFA 2BSWA 4U5YA 3R95A 3NA6A 4FD6A 3T8WA 1IOFA 4B13A 4YU9A 1YR0A 4UCMA 1NBWA 4CYPA 2VZZA 3H5ZA 1YLEA 3TLBA 4R6TA 3R9GA 2FVGA 2PIZA 1VBGA 1S7KA 2ARHA 2PRBA 3B3CA 4OIDA 5I0CA 2R7HA 1HDUA 4UCPA 2Z3KA 4OC3A 3T5MA 4XNHB 4AG9A 2FT0A 4BINA 1Y9WA 1K4JA 3KRVA 2ZEHA 4NGMA 4R87A 4KUBA 3GIUA 3KHXA 3LACA 4UEZA 2PVVA 3PFVA 1EE3P 2VXKA 1KWMA 2XPPA 3HLPA 3D3SA 5F46A 1IYKA 2VBQA 5HVGA 3DLJA 3IJ3A 1B47A 2OZUA 4ONUA 3TC8A 3VWDA 4DNCA 2AE6A 1R61A 2ZEFA 4CGMA 1WVMA 4MFPA 4LQ6A 1CPXA 4NGSA 5ELYA 2EK8A 2FL4A 4UFWA 1I1DA 4KOSA 4OKOA 4B10A 4IF5A 1KBLA 2Y0MA 1Y0YA 3IEHA 1BAVA 3SJXA 1VHSA 2R98A 3B3TA 1ZYMA 3BUOB 4DJLA 3B2YA 3FX6A 4C8AA 1OBRA 3R9EA 4KOVA 4BPWB 4XPLA 2CY2A 1M4IA 4NFRA 4MFKA 1C30B 4COBA 1CP6A 5IB0A 1ELMP 2Z3OA 3WABA 1KEEB 3NH4A 2BL1A 4OLLA 4W9YA 3K2KA 2Q4VA 4IUSA 1BPMA 2CNTA 4WWVA 4B6ZA 2ANPA 5BY0A 4UWJA 3TO9A 5G22A 5K8MA 3V38A 3NFZA 2B3VA 1U6MA 5CPAA 4EWTA 1Y9ZA 2EZAA 2JDDA 3RNZA 3EZEA 2ZENA 1IGBA 2PQ8A 2Q7BA 2AUNA 3L2NA 5F48A 4MRIA 1YK3A 3F0AA 4MHDA 3SR3A 3KI9A 4U9ZA 4JXRA 2XPOA 1S7FA 2GANA 4PXBA 2BOAA 4MY3A 1I12A 2PJ7A 3TLGA 5BWAB 4IHMA 3W6SA 4C8FA 4ZY0A 4RS2A 5F1YA 1XEBA 2HWGA 4P45A 3D7GA 2ZW6A 3QB8A 1BOBA 2V8GA 5JM6A 2Z3NA 2R8VA 1Z5RA 3HPGG 3BUMB 3IFEA 4CO9A 1TXRA 4UFXA 2IMOA 3T90A 4OC5A 1VHOA 3LMSA 1XBUA 4CYQA 5J8FA 3VWEA 1CE8B 1RXTA 5J1QA 2OOTA 4CAEA 1CM0A 1NE9A 2GU2A 3FH4A 4MI4A 1RTQA 2FS5A 4CGLA 3EZAA 1TKFA 4U9YA 2HV2A 5JPHA 2CF4A 2WPXA 2G9DA 4BPXB 1V0CA 2REFA 1YVHA 3WT4A 4KS9A 2C27A 1WWZA 3FYNA 4CYOA 2HC9A 2PJ5A 5FD8A 5EBVA 4FWUA 4NF1A 2DPTA 5IX3A 3WC6A 3D7FA 3N5FA 1EZAA 3NH5A 1KUYA 2CNSA 1IIDA 2Q04A 3PFEA 4CZ1A 2PCNA 4X8IA 4OAEA 2WYRA 3PB4X 4PK2A 4PK3A 4F9VA 2DLAA 3MGDA 3SI1A 4RUHA 2PR8A 2Z0ZA 3SXOA 1M6VB 1I21A 1EO0A 2AFMA 2O4HA 4YFJA 4OC4A 3QNVA 3NOJA 4CAXA 2G0BA 4L89A 1QSMA 2C5QA 4GPLB 1R3NA 4Y49C 4IIXA 2OLSA 1NMTA 1QSNA 2BCOA 2P0WA 2YJTA 2PR1A 4RN7A 3TE4A 1QSRA 4QUSA 3FF3A 3D68A 4JD6A 3IU2A 4PSXA 2C6PA 4FAIA 1GHEA 2DF5A 2EZBA 1A2ZA 5F5XA 4O23A 1TF9A 2O28A 4A95A 1CP7A 1NXJA 1Z4EA 3KQZA 4C9AA 4IK2A 2D4OA 3FEDA 4KUAA 3SJGA 4Q38A 3B3WA 4MHPA 2CXAA 2YNDA 3I1UA 1MJAA 4NCZA 1PCAA 2ZEMA 1TIQA 4CAWA 4B5OA 4F0YA 2OB0A 3VRRA 4TJVA 1P4NA 3H8EA 3TLYA 3BI1A 4UEFA 5K99A 4A33A 3N7ZA 3VH9A 1TKJA 4B14A 4C84A 4C8CA 1MJ9A 2HROA 3BHXA 1AMPA 1YVKA 5K8PA 3TLZA 4CAFA 1LAMA 1XIXA 4P10A 4MY0A 3R96A 3PRTA 4Q36A 3D7DA 1TKHA 2I79A 3D7HA 4KOUA 2B3UA 2BO9A 4NEXA 3B3SA 3CT9A 4C9EA 4CDJA 3KASA 2BEIA 2JEVA 2OH1A 4FD7A 2YNCA 3TLEA 1XFOA 5J3XA 3WC7A 5JH9A 1XF1A 3SJFA 1GYTA 1ZG7A 2PJ9A 2ZEDA 4PXDA 5HKWA 4M8DA 4E94A 3D67A 4FD5A 3ZJ0A 3CPXA 4H2KA 1J4JA 3TOAA 1QMUA 4OP4A 4P4FA 2C6GA 4HNWB 5HMNA 2A4NA 1V6CA 3TLAA 2Z3MA 5AG4A 2EO8A 5K8OA 2ZEOA 4C8PA 1NSLA 4J3GA 4M6GA 3FBUA 3BUWB 4XPKA 4AVAA 3KKWA 3SI2A 3VRQA 1YW4A 1CJWA 3F8KA 5H84A 4C2XA 2F5IA 3IGRA 4X5KA 5EMIA 3TO7A 2VEZA 3VARA 5KTCA 2EUIA 4JXQA 4KNGE 2I3CA 4MHZA 4GXHA 1YW6A 2Q51A 5F47A 1LAPA 4NJRA 1LRZA 3KL9A 1KZFA 2R1IA 4ONWA 3S9LA 3P2FA 1XJOA 1C3OB 2Q7SA 2D0PA 5HXDA 4R8FA 4KOWA 3I9SA 4TWEA 3ICUA 3NFQA 4BTFA 2G3AA 2QVPA 2B4DA 2Z3LA 4AVCA 2Y1NA 3BUNB 3RZAA 2O53A 4BBHA 2YJVA 4E2AA 3CPAA 1LANA 3RYOA 3NE8A 4MXUA 3UY5A 4BD9A 4MBUA 4A94A 2N3AB 4KORA 4M85A 4NGNA 2OZGA 1JDEA 2H5MA 2ZW5A 2QJ8A 4KVXA 4A30A 2CBLA 4A31A 4MFLA 4ZX8A 4CRZB 4YGOA 3I74A 4QVTA 2XEJA 5F13A 5HKYA 2PDOA 1MK4A 2P6GA 3IU1A 4G1PA 4UF4A 2R82A 4NGPA 4UBRA 1F2PA 1AUGA
chains in the Genus database with same CATH topology
2QYVA 2F7VA 3H8GA 4A39A 3DGVA 5I4MA 4JYWA 2V8HA 4OC1A 2GLJA 3JRUA 1LCPA 8CPAA 2CIJA 1ARMA 3FJUA 4EMEA 2AFUA 4JZ0A 2AFWA 5THWA 2WZNA 1CBXA 5DS0A 4Z65A 1LFWA 3V7ZA 2RFHA 2ZEGA 2NYQA 3KR4A 2AFXA 4P4IA 3RBUA 1Q7LA 2V77A 1Z2LA 1F57A 4Q7AA 4C9VA 3D66A 1Y0RA 2PJ1A 5K8NA 3VATA 3FVLA 5LRGA 3S9NA 4TNUA 4MCPA 5LYIA 2VL1A 1LOKA 2ABZA 4ZYQA 5JGFA 4OIWA 3I6SA 1UWYA 5HVHA 1H8LA 2JBKA 4A37A 2AFOA 1TF8A 3GLJA 3FECA 4F8ZA 4ZY1A 4X2TA 1IY7A 3PB8X 4C86A 3B7IA 3PBBA 1Y7EA 3PBEA 1DE4C 2PIYA 3IO1A 1ZLIA 5D8NA 3VTAA 2PJBA 4NJQA 2IQ6A 4DUKA 1CX8A 3KGQA 2GREA 4P4DA 1YSJA 4EFDA 1JQGA 3PFOA 5IR2A 3KZWA 3KR5A 3LWUA 4X3RA 4UEEA 4A38A 4ZY2A 2ZEPA 3WC5A 5LRKA 4C9RA 4UIAA 2V8VA 3BI0A 3NH8A 2GP4A 3GB0A 4MHYA 1FT7A 1HDQA 4TJXA 2POKA 1PYTB 3IIBA 2F8HA 2Q43A 2AFSA 2XEGA 2ZOFA 3KHZA 1Z8LA 1YLOA 6CPAA 4C85A 4OC0A 3S9MA 5F09A 1R43A 5LYFA 4MMOA 4FBEA 1XMBA 3GUXA 2OR4A 1ZG8A 4FUUA 4ZX9A 1CG2A 4C8TA 3FMCA 4IAVA 4K3NA 2PCUA 4CDKA 2C1CA 2PJ2A 5LRJA 2CTBA 1VHEA 2Q4ZA 4NGTA 2PRQA 4MCQA 4P44A 4PXEA 2XEFA 3B3VA 4P4BA 1FNOA 4ZI6A 2V8DA 1BLLE 3H8FA 4KSIA 2AFZA 1BPNA 7CPAA 3K9TA 1VIXA 2EK9A 3FEEA 1DTDA 2NSMA 1XRYA 4C9UA 2ZELA 3PB7X 2PJCA 4OC2A 3KQXA 4WJBA 4PXCA 4C8UA 3PEIA 3BXMA 2J9AA 4PPZA 5CBMA 2EWBA 2GLFA 4MHNA 1ELLP 2DEAA 2ZEEA 3MRUA 4P4EA 2C6CA 1VGYA 5D29A 2PJ6A 3CDXA 3HUVA 2PE3A 3RAMA 4NGRA 4P4JA 3PB6X 4OMEA 2PJ3A 3PB9X 4AXVA 2RB7A 4MCRA 4R7MA 3SJEA 2JEWA 2PJ0A 2HB6A 2CTCA 1F2OA 2PVWA 3IWWA 5LYLA 4DYOA 1NSAA 3D4UA 4R76A 1HEEA 4GM5A 4P6YA 2IJZA 4CPAA 1ZLHA 1ARLA 3TX8A 1AYEA 1CPSA 5LYDA 3SI0A 2PJ4A 1YMEA 4YWYA 2PJAA 1ZG9A 2ZOGA 5IB9A 5HVFA 4PQAA 2PJ8A 3MN8A 4F9UA 4LQGA 4C99A 4YN3A 1QQ9A 3B35A 3ISZA 1M4LA 4UIBA 3EIFA 2XEIA 4MCSA 3IC1A 2JBJA 3ISXA 4NGQA 3NA6A 3T8WA 4YU9A 4R6TA 2FVGA 2PIZA 3B3CA 4OIDA 1HDUA 4OC3A 2ZEHA 4NGMA 3KHXA 4UEZA 2PVVA 1EE3P 1KWMA 3HLPA 5HVGA 3DLJA 3IJ3A 3TC8A 2ZEFA 1WVMA 1CPXA 4NGSA 5ELYA 2EK8A 4OKOA 1Y0YA 3IEHA 1BAVA 3SJXA 3B3TA 4DJLA 3B2YA 3FX6A 4C8AA 1OBRA 4NFRA 1CP6A 1ELMP 3WABA 3NH4A 4WWVA 4W9YA 3K2KA 4B6ZA 1BPMA 2ANPA 5K8MA 3V38A 3NFZA 5CPAA 4EWTA 1Y9ZA 2ZENA 1IGBA 3L2NA 4MRIA 3KI9A 4PXBA 2BOAA 2PJ7A 4IHMA 4C8FA 4ZY0A 4P45A 3D7GA 5JM6A 2V8GA 1Z5RA 3IFEA 1TXRA 2IMOA 4OC5A 1VHOA 3LMSA 1XBUA 5J1QA 2OOTA 3FH4A 2GU2A 1RTQA 1TKFA 2CF4A 2G9DA 3WT4A 2HC9A 2PJ5A 4FWUA 3WC6A 3D7FA 3N5FA 3NH5A 3PFEA 4X8IA 2WYRA 3PB4X 4F9VA 3SI1A 4RUHA 2AFMA 2O4HA 4OC4A 3QNVA 2C5QA 1R3NA 2BCOA 3FF3A 3D68A 4FAIA 2C6PA 4O23A 1TF9A 1CP7A 3KQZA 4C9AA 4IK2A 3FEDA 3SJGA 3B3WA 4MHPA 3I1UA 1PCAA 2ZEMA 4TJVA 3H8EA 3BI1A 4UEFA 3VH9A 1TKJA 4C84A 4C8CA 3BHXA 1AMPA 5K8PA 1LAMA 4P10A 3PRTA 3D7DA 1TKHA 3D7HA 2BO9A 3B3SA 3CT9A 4C9EA 4CDJA 3KASA 1XFOA 3WC7A 5JH9A 1XF1A 3SJFA 1GYTA 1ZG7A 2PJ9A 2ZEDA 4PXDA 3D67A 3CPXA 4H2KA 1QMUA 4OP4A 4P4FA 2C6GA 1V6CA 5K8OA 2ZEOA 4C8PA 3SI2A 1YW4A 3VARA 4KNGE 2I3CA 4MHZA 1YW6A 2Q51A 1LAPA 4NJRA 3KL9A 4ONWA 3S9LA 1XJOA 5HXDA 4R8FA 3ICUA 4TWEA 2QVPA 3RZAA 2O53A 3CPAA 1LANA 4MXUA 4BD9A 4A94A 4NGNA 2QJ8A 3I74A 4ZX8A 2XEJA 4G1PA 4UF4A 4NGPA 1F2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYV A;  2F7V A;  3H8G A;  4A39 A;  3DGV A;  5I4M A;  4JYW A;  2V8H A;  4OC1 A;  2GLJ A;  3JRU A;  1LCP A;  8CPA A;  2CIJ A;  1ARM A;  3FJU A;  4EME A;  2AFU A;  4JZ0 A;  2AFW A;  5THW A;  2WZN A;  1CBX A;  5DS0 A;  4Z65 A;  1LFW A;  3V7Z A;  2RFH A;  2ZEG A;  2NYQ A;  3KR4 A;  2AFX A;  4P4I A;  3RBU A;  1Q7L A;  2V77 A;  1Z2L A;  1F57 A;  4Q7A A;  4C9V A;  3D66 A;  1Y0R A;  2PJ1 A;  5K8N A;  3VAT A;  3FVL A;  5LRG A;  3S9N A;  4TNU A;  4MCP A;  5LYI A;  2VL1 A;  1LOK A;  2ABZ A;  4ZYQ A;  5JGF A;  4OIW A;  3I6S A;  1UWY A;  5HVH A;  1H8L A;  2JBK A;  4A37 A;  2AFO A;  1TF8 A;  3GLJ A;  3FEC A;  4F8Z A;  4ZY1 A;  4X2T A;  1IY7 A;  3PB8 X;  4C86 A;  3B7I A;  3PBB A;  1Y7E A;  3PBE A;  1DE4 C;  2PIY A;  3IO1 A;  1ZLI A;  5D8N A;  3VTA A;  2PJB A;  4NJQ A;  2IQ6 A;  4DUK A;  1CX8 A;  3KGQ A;  2GRE A;  4P4D A;  1YSJ A;  4EFD A;  1JQG A;  3PFO A;  3KZW A;  3KR5 A;  3LWU A;  4X3R A;  4UEE A;  4A38 A;  4ZY2 A;  2ZEP A;  3WC5 A;  5LRK A;  4C9R A;  4UIA A;  2V8V A;  3BI0 A;  3NH8 A;  3GB0 A;  4MHY A;  1FT7 A;  1HDQ A;  4TJX A;  2POK A;  1PYT B;  3IIB A;  2F8H A;  2Q43 A;  2AFS A;  2XEG A;  2ZOF A;  3KHZ A;  1Z8L A;  1YLO A;  6CPA A;  4C85 A;  4OC0 A;  3S9M A;  5F09 A;  1R43 A;  5LYF A;  4MMO A;  4FBE A;  1XMB A;  3GUX A;  2OR4 A;  1ZG8 A;  4FUU A;  4ZX9 A;  1CG2 A;  4C8T A;  3FMC A;  4IAV A;  4K3N A;  2PCU A;  4CDK A;  2C1C A;  2PJ2 A;  5LRJ A;  2CTB A;  1VHE A;  2Q4Z A;  4NGT A;  2PRQ A;  4MCQ A;  4P44 A;  4PXE A;  2XEF A;  3B3V A;  4P4B A;  1FNO A;  4ZI6 A;  2V8D A;  1BLL E;  3H8F A;  4KSI A;  2AFZ A;  1BPN A;  7CPA A;  3K9T A;  1VIX A;  2EK9 A;  3FEE A;  1DTD A;  2NSM A;  1XRY A;  4C9U A;  2ZEL A;  3PB7 X;  2PJC A;  4OC2 A;  3KQX A;  4WJB A;  4PXC A;  4C8U A;  3PEI A;  3BXM A;  2J9A A;  4PPZ A;  5CBM A;  2EWB A;  2GLF A;  4MHN A;  1ELL P;  2DEA A;  2ZEE A;  3MRU A;  4P4E A;  2C6C A;  1VGY A;  5D29 A;  2PJ6 A;  3CDX A;  3HUV A;  2PE3 A;  3RAM A;  4NGR A;  4P4J A;  3PB6 X;  4OME A;  2PJ3 A;  3PB9 X;  4AXV A;  2RB7 A;  4MCR A;  4R7M A;  3SJE A;  2JEW A;  2PJ0 A;  2HB6 A;  2CTC A;  1F2O A;  2PVW A;  3IWW A;  5LYL A;  4DYO A;  1NSA A;  3D4U A;  4R76 A;  1HEE A;  4GM5 A;  4P6Y A;  2IJZ A;  4CPA A;  1ZLH A;  1ARL A;  3TX8 A;  1AYE A;  1CPS A;  5LYD A;  3SI0 A;  2PJ4 A;  1YME A;  4YWY A;  2PJA A;  1ZG9 A;  2ZOG A;  5IB9 A;  5HVF A;  4PQA A;  2PJ8 A;  3MN8 A;  4F9U A;  4LQG A;  4C99 A;  4YN3 A;  1QQ9 A;  3B35 A;  3ISZ A;  1M4L A;  4UIB A;  3EIF A;  2XEI A;  4MCS A;  3IC1 A;  2JBJ A;  3ISX A;  4NGQ A;  3NA6 A;  3T8W A;  4YU9 A;  4R6T A;  2FVG A;  2PIZ A;  3B3C A;  4OID A;  1HDU A;  4OC3 A;  2ZEH A;  4NGM A;  3KHX A;  4UEZ A;  2PVV A;  1EE3 P;  1KWM A;  3HLP A;  5HVG A;  3DLJ A;  3IJ3 A;  3TC8 A;  2ZEF A;  1WVM A;  1CPX A;  4NGS A;  5ELY A;  2EK8 A;  4OKO A;  1Y0Y A;  3IEH A;  1BAV A;  3SJX A;  3B3T A;  4DJL A;  3B2Y A;  3FX6 A;  4C8A A;  1OBR A;  4NFR A;  1CP6 A;  1ELM P;  3WAB A;  3NH4 A;  4WWV A;  4W9Y A;  3K2K A;  4B6Z A;  1BPM A;  2ANP A;  5K8M A;  3V38 A;  3NFZ A;  5CPA A;  4EWT A;  1Y9Z A;  2ZEN A;  1IGB A;  3L2N A;  4MRI A;  3KI9 A;  4PXB A;  2BOA A;  2PJ7 A;  4IHM A;  4C8F A;  4ZY0 A;  4P45 A;  3D7G A;  5JM6 A;  2V8G A;  1Z5R A;  3IFE A;  1TXR A;  2IMO A;  4OC5 A;  1VHO A;  3LMS A;  1XBU A;  5J1Q A;  2OOT A;  3FH4 A;  2GU2 A;  1RTQ A;  1TKF A;  2CF4 A;  2G9D A;  3WT4 A;  2HC9 A;  2PJ5 A;  4FWU A;  3WC6 A;  3D7F A;  3N5F A;  3NH5 A;  3PFE A;  4X8I A;  2WYR A;  3PB4 X;  4F9V A;  3SI1 A;  4RUH A;  2AFM A;  2O4H A;  4OC4 A;  3QNV A;  1R3N A;  2BCO A;  3FF3 A;  3D68 A;  4FAI A;  2C6P A;  4O23 A;  1TF9 A;  1CP7 A;  3KQZ A;  4C9A A;  4IK2 A;  3FED A;  3SJG A;  3B3W A;  4MHP A;  3I1U A;  1PCA A;  2ZEM A;  4TJV A;  3H8E A;  3BI1 A;  4UEF A;  3VH9 A;  1TKJ A;  4C84 A;  4C8C A;  3BHX A;  1AMP A;  5K8P A;  1LAM A;  4P10 A;  3PRT A;  3D7D A;  1TKH A;  3D7H A;  2BO9 A;  3B3S A;  3CT9 A;  4C9E A;  4CDJ A;  3KAS A;  1XFO A;  3WC7 A;  5JH9 A;  1XF1 A;  3SJF A;  1GYT A;  1ZG7 A;  2PJ9 A;  2ZED A;  4PXD A;  3D67 A;  3CPX A;  4H2K A;  1QMU A;  4OP4 A;  4P4F A;  2C6G A;  1V6C A;  5K8O A;  2ZEO A;  4C8P A;  3SI2 A;  1YW4 A;  3VAR A;  4KNG E;  2I3C A;  4MHZ A;  1YW6 A;  2Q51 A;  1LAP A;  4NJR A;  3KL9 A;  4ONW A;  3S9L A;  1XJO A;  5HXD A;  4R8F A;  3ICU A;  4TWE A;  2QVP A;  3RZA A;  2O53 A;  3CPA A;  1LAN A;  4MXU A;  4BD9 A;  4A94 A;  4NGN A;  2QJ8 A;  3I74 A;  4ZX8 A;  2XEJ A;  4G1P A;  4UF4 A;  4NGP A;  1F2P A; 
#chains in the Genus database with same CATH topology
 4AVB A;  2QYV A;  4CAV A;  4YRH A;  2B0A A;  2F7V A;  4HPS A;  3H8G A;  4A39 A;  5JQ4 A;  1EZB A;  3DGV A;  5I4M A;  4KOT A;  4JYW A;  3DNS A;  2V8H A;  4OC1 A;  2QEC A;  2GLJ A;  3JRU A;  3W91 A;  1LCP A;  8CPA A;  4M6I A;  2CIJ A;  1ARM A;  3FJU A;  5GCN A;  4C2Y A;  2FIA A;  4EME A;  5HKZ A;  2AFU A;  4JZ0 A;  2AFW A;  5THW A;  3S6F A;  4E8O A;  2WZN A;  1ZL0 A;  1CBX A;  5JVL A;  3EO4 A;  4PV6 A;  5DS0 A;  4UFV A;  4Z65 A;  3ZZI A;  1M4G A;  4KVO E;  1UFH A;  2UV8 G;  3B8G A;  1XMT A;  1LFW A;  5E96 A;  3V7Z A;  2RFH A;  2ZEG A;  3VGO A;  2VZY A;  2X7B A;  3FIX A;  2E28 A;  3SXN A;  2NYQ A;  1VKC A;  4KLV A;  5G21 A;  1X10 A;  3KR4 A;  4KSF A;  5AG7 A;  3C8O A;  1WJT A;  2AFX A;  2FSR A;  3E0K A;  4JLY A;  4P4I A;  3PLF B;  3RBU A;  2FXF A;  3HPH E;  5AXI A;  1Q7L A;  4KSA A;  4ZGY B;  3D2M A;  2V77 A;  4A32 A;  1Z2L A;  1A9X B;  1F57 A;  4Q7A A;  3A9L A;  2J8M A;  1Y0R A;  2PJ1 A;  3D66 A;  4KVM E;  5K8N A;  4C9V A;  3VAT A;  3FVL A;  2P6E A;  5LRG A;  3S6H A;  3S9N A;  2D0O A;  4TNU A;  1N71 A;  2RC4 A;  4AB7 A;  4KOY A;  4MCP A;  5LYI A;  4A4C A;  2VL1 A;  1LOK A;  2ABZ A;  4ZYQ A;  4E0A A;  5JGF A;  4OIW A;  1S7L A;  2HUZ A;  1YGH A;  2J8R A;  3K9U A;  1XE4 A;  1UWY A;  3DSB A;  5HVH A;  1H8L A;  2JBK A;  4A37 A;  3I6S A;  4E5S A;  4NXY A;  2AFO A;  1TF8 A;  1GGO A;  3GLJ A;  1B87 A;  1FY7 A;  3FEC A;  4F8Z A;  4RI1 A;  4ZY1 A;  1VBH A;  4X2T A;  4J0N A;  3G23 A;  1OZP A;  4BPU B;  1IY7 A;  3RO0 A;  4Y49 B;  4F0X A;  1ZRS A;  4UWI A;  3PB8 X;  4C86 A;  1Q5X A;  3B7I A;  2KCW A;  3PBB A;  1Y7E A;  3PBE A;  1DE4 C;  1VI4 A;  3C26 A;  1ON0 A;  1L0C A;  2PIY A;  3IO1 A;  2K5T A;  5KTA A;  1ZLI A;  1CS0 B;  1RO5 A;  3TT2 A;  5D8N A;  3VTA A;  2PJB A;  4C7H A;  2DPS A;  4NJQ A;  2IQ6 A;  5J8C A;  4DUK A;  1CX8 A;  2VKZ G;  3QAH A;  1Q2C A;  2B5G B;  1Z8T A;  3KGQ A;  2WUU A;  3GYA A;  2GRE A;  3VRP A;  4P4D A;  2Z11 A;  2FCK A;  1YSJ A;  4EFD A;  1JQG A;  4LUA A;  3T05 A;  3DDD A;  3JUW A;  3PFO A;  5IR2 A;  2BUE A;  3KZW A;  3KR5 A;  3G8W A;  3LWU A;  4X3R A;  4GS4 A;  4UEE A;  4A38 A;  2Z10 A;  1R57 A;  2Z3P A;  4ZY2 A;  2ZEP A;  3WC5 A;  2B4D B;  3LOD A;  3V8I A;  5KTD A;  5LRK A;  4C9R A;  2NMT A;  4UIA A;  4QBJ A;  2V8V A;  3DR6 A;  3BI0 A;  5AGE A;  5G1Z A;  3NH8 A;  1MJB A;  4QB9 A;  2GP4 A;  3GB0 A;  4MHY A;  1FT7 A;  1HDQ A;  4TJX A;  2GIV A;  2POK A;  4JJX A;  4B11 A;  1PYT B;  2IL4 A;  2PSW A;  3IIB A;  2YNE A;  2F8H A;  2Y1M A;  2AFS A;  2XEG A;  2Q43 A;  2ZOF A;  2ZW4 A;  1B6B A;  2I00 A;  3NE7 A;  3KHZ A;  1Z8L A;  5AG6 A;  3WR7 A;  1YLO A;  6CPA A;  4C85 A;  4OC0 A;  1IB1 E;  2FM4 A;  2JLM A;  3S9M A;  2HI6 A;  5F09 A;  1R43 A;  3R9F A;  4K30 A;  3EXN A;  5LYF A;  2GE3 A;  2DIK A;  4MMO A;  4FBE A;  1QST A;  1XMB A;  2OR4 A;  3GUX A;  1ZG8 A;  1Z9U A;  4R9M A;  2MP0 A;  3GJZ A;  4FUU A;  4UA3 A;  4ZX9 A;  2ODF A;  2WSA A;  2EZC A;  4INJ A;  1CG2 A;  4CGN A;  4BMH A;  4C8T A;  2HQY A;  3FMC A;  4IAV A;  4K3N A;  4R3L A;  2JDC A;  3TLC A;  5C88 A;  2Q44 A;  5ISV A;  4FD4 A;  1JWQ A;  1PU9 A;  3JVN A;  4R57 A;  2PCU A;  2AJ6 A;  4PSW A;  4B5P B;  3CXP A;  2C1C A;  2PJ2 A;  4CDK A;  5JYB A;  2ZPA A;  5G20 A;  5LRJ A;  2CTB A;  1YRE A;  3D8P A;  1VHE A;  3JTK A;  3TOB A;  4EYS A;  2Q4Z A;  4H89 A;  3OB1 B;  4NGT A;  2PRQ A;  4MCQ A;  4A2Z A;  1KUX A;  4P44 A;  3SHP A;  1Z4R A;  1IYL A;  4PXE A;  2XEF A;  3B3V A;  4P4B A;  3FRM A;  1FNO A;  4EVY A;  3HMJ G;  2FIW A;  4RR2 B;  2V8D A;  1BLL E;  3H8F A;  4KSI A;  4M6H A;  4NSQ A;  4ZI6 A;  2YNC C;  3BUX B;  4LX9 A;  1KC7 A;  2AFZ A;  1BPN A;  2P6F A;  1IIC A;  4ZBG A;  7CPA A;  2REE A;  3CXQ A;  1VIX A;  3ZNI A;  3K9T A;  2AUM A;  4JVO A;  1IOI A;  5DWM A;  2EK9 A;  3FEE A;  1DTD A;  3DR8 A;  2NSM A;  1XRY A;  3U88 C;  4MFQ A;  3EZB A;  4II9 A;  4C9U A;  4C68 A;  2OZH A;  3OWC A;  3U1B A;  2ZEL A;  1J3L A;  4HNX B;  3PB7 X;  4HNY B;  3T0T A;  2XPN A;  2PJC A;  3OB2 B;  1PUA A;  1YX0 A;  1S3Z A;  3IWE A;  4MFZ A;  5F49 A;  4C2Z A;  2D4P A;  1P0H A;  1BO4 A;  4OC2 A;  1M4D A;  3KQX A;  4WJB A;  3TCV A;  2ZXV A;  4PXC A;  2EBJ A;  4C8U A;  3EFA A;  3PEI A;  2Q4Y A;  4XPD C;  3BXM A;  2J9A A;  1XOV A;  4PPZ A;  5CBM A;  4B12 A;  5C82 A;  2CNM A;  2EWB A;  2GFQ A;  2GLF A;  3BLN A;  4HKF A;  4MHN A;  1ELL P;  2B4B A;  1YVO A;  2DEA A;  3BJ7 A;  4XNH C;  3T9Y A;  1SQH A;  5A28 A;  3TYX A;  2ZEE A;  4AG7 A;  1Q2Y A;  2YGW A;  4P4E A;  1XF8 A;  2WPW A;  3EC4 A;  2C6C A;  3MRU A;  1Y7R A;  2VQY A;  4CGP A;  4MI1 A;  3O8Z A;  5F9M A;  2VI7 A;  3TO6 A;  5AG5 A;  4MJX A;  2B5G A;  1VGY A;  3LD2 A;  4IIY A;  5D29 A;  2ATR A;  2PJ6 A;  3CDX A;  1Y9K A;  5EC4 A;  1YQE A;  4KOX A;  3HUV A;  1BXR B;  2QML A;  1ZO0 A;  2XPL A;  2PE3 A;  4NGR A;  3RAM A;  4P4J A;  1M1D A;  4OME A;  2PJ3 A;  3PB6 X;  3PB9 X;  4CYN A;  4AXV A;  3VRN A;  2RB7 A;  2J8N A;  2DXQ A;  4MCR A;  2B4J C;  5FVJ A;  5A27 A;  5IV0 A;  3PZJ A;  4R7M A;  4A4B A;  1KUV A;  3S6K A;  3SJE A;  2JEW A;  2PJ0 A;  2HB6 A;  1S5K A;  1Z9E A;  1M44 A;  1F2O A;  2PVW A;  1QSO A;  3IWW A;  2CTC A;  3D2P A;  2B58 A;  4KZT A;  5DWN A;  5LYL A;  4DYO A;  2ZW7 A;  4COG A;  1NSA A;  3D4U A;  1JDB C;  4QC6 A;  4C7I A;  4R76 A;  2X0S A;  3T07 A;  3F5B A;  3VRO A;  3CZX A;  3BJ8 A;  5H86 A;  1FBV A;  1HEE A;  3G3S A;  4GM5 A;  2IJZ A;  3IWG A;  1ZLH A;  3OP0 A;  4P6Y A;  4CPA A;  1ARL A;  3TX8 A;  3F9K C;  4L8A A;  3FB3 A;  3I3G A;  3CXS A;  1Z8W A;  1S7N A;  4XPD B;  1AYE A;  1CPS A;  4H6U A;  5LYD A;  3FNC A;  2PJ4 A;  3SI0 A;  1YME A;  1Z8X A;  3FXT A;  4MJ8 A;  2QIR A;  4CS0 B;  4YWY A;  4OAD A;  4KLW A;  4UCN A;  3K4I A;  2PJA A;  3S6G A;  1DIK A;  4CRY B;  1ZG9 A;  2G3T A;  2PC1 A;  3GKR A;  1WK4 A;  4MFJ A;  2ZOG A;  3GY9 A;  5IB9 A;  5HVF A;  4PQA A;  4R3K A;  3TTH A;  4H6Z A;  4H1H A;  4CGO A;  2PJ8 A;  4JWP A;  3MN8 A;  3TFY A;  3OAK A;  4LQG A;  4I49 A;  4F9U A;  4C99 A;  2OU2 A;  1X12 A;  1T36 B;  5HH1 A;  4B5P A;  4YN3 A;  1QQ9 A;  3B35 A;  3ISZ A;  3PT1 A;  1M4L A;  5CNP A;  3R1K A;  4M3S A;  3PP9 A;  4UIB A;  3P2H A;  3EIF A;  3W6X A;  2XEI A;  2Q0Y A;  4MCS A;  4F6A A;  3QAY A;  3TLG B;  3PGP A;  3H4Q A;  1S60 A;  2EVN A;  2JBJ A;  1IU8 A;  1Q2D A;  2FE7 A;  4NGQ A;  3EY5 A;  3IC1 A;  3ISX A;  4ORF A;  2BSW A;  4U5Y A;  3R95 A;  3NA6 A;  4FD6 A;  3T8W A;  1IOF A;  4B13 A;  4YU9 A;  1YR0 A;  4UCM A;  1NBW A;  4CYP A;  2VZZ A;  3H5Z A;  1YLE A;  3TLB A;  4R6T A;  3R9G A;  2FVG A;  2PIZ A;  1VBG A;  1S7K A;  2ARH A;  2PRB A;  3B3C A;  4OID A;  5I0C A;  2R7H A;  1HDU A;  4UCP A;  2Z3K A;  4OC3 A;  3T5M A;  4XNH B;  4AG9 A;  2FT0 A;  4BIN A;  1Y9W A;  1K4J A;  3KRV A;  2ZEH A;  4NGM A;  4R87 A;  4KUB A;  3GIU A;  3KHX A;  3LAC A;  4UEZ A;  2PVV A;  3PFV A;  1EE3 P;  2VXK A;  1KWM A;  2XPP A;  3HLP A;  3D3S A;  5F46 A;  1IYK A;  2VBQ A;  5HVG A;  3DLJ A;  3IJ3 A;  1B47 A;  2OZU A;  4ONU A;  3TC8 A;  3VWD A;  4DNC A;  2AE6 A;  1R61 A;  2ZEF A;  4CGM A;  1WVM A;  4MFP A;  4LQ6 A;  1CPX A;  4NGS A;  5ELY A;  2EK8 A;  2FL4 A;  4UFW A;  1I1D A;  4KOS A;  4OKO A;  4B10 A;  4IF5 A;  1KBL A;  2Y0M A;  1Y0Y A;  3IEH A;  1BAV A;  3SJX A;  1VHS A;  2R98 A;  3B3T A;  1ZYM A;  3BUO B;  4DJL A;  3B2Y A;  3FX6 A;  4C8A A;  1OBR A;  3R9E A;  4KOV A;  4BPW B;  4XPL A;  2CY2 A;  1M4I A;  4NFR A;  4MFK A;  1C30 B;  4COB A;  1CP6 A;  5IB0 A;  1ELM P;  2Z3O A;  3WAB A;  1KEE B;  3NH4 A;  2BL1 A;  4OLL A;  4W9Y A;  3K2K A;  2Q4V A;  4IUS A;  1BPM A;  2CNT A;  4WWV A;  4B6Z A;  2ANP A;  5BY0 A;  4UWJ A;  3TO9 A;  5G22 A;  5K8M A;  3V38 A;  3NFZ A;  2B3V A;  1U6M A;  5CPA A;  4EWT A;  1Y9Z A;  2EZA A;  2JDD A;  3RNZ A;  3EZE A;  2ZEN A;  1IGB A;  2PQ8 A;  2Q7B A;  2AUN A;  3L2N A;  5F48 A;  4MRI A;  1YK3 A;  3F0A A;  4MHD A;  3SR3 A;  3KI9 A;  4U9Z A;  4JXR A;  2XPO A;  1S7F A;  2GAN A;  4PXB A;  2BOA A;  4MY3 A;  1I12 A;  2PJ7 A;  3TLG A;  5BWA B;  4IHM A;  3W6S A;  4C8F A;  4ZY0 A;  4RS2 A;  5F1Y A;  1XEB A;  2HWG A;  4P45 A;  3D7G A;  2ZW6 A;  3QB8 A;  1BOB A;  2V8G A;  5JM6 A;  2Z3N A;  2R8V A;  1Z5R A;  3HPG G;  3BUM B;  3IFE A;  4CO9 A;  1TXR A;  4UFX A;  2IMO A;  3T90 A;  4OC5 A;  1VHO A;  3LMS A;  1XBU A;  4CYQ A;  5J8F A;  3VWE A;  1CE8 B;  1RXT A;  5J1Q A;  2OOT A;  4CAE A;  1CM0 A;  1NE9 A;  2GU2 A;  3FH4 A;  4MI4 A;  1RTQ A;  2FS5 A;  4CGL A;  3EZA A;  1TKF A;  4U9Y A;  2HV2 A;  5JPH A;  2CF4 A;  2WPX A;  2G9D A;  4BPX B;  1V0C A;  2REF A;  1YVH A;  3WT4 A;  4KS9 A;  2C27 A;  1WWZ A;  3FYN A;  4CYO A;  2HC9 A;  2PJ5 A;  5FD8 A;  5EBV A;  4FWU A;  4NF1 A;  2DPT A;  5IX3 A;  3WC6 A;  3D7F A;  3N5F A;  1EZA A;  3NH5 A;  1KUY A;  2CNS A;  1IID A;  2Q04 A;  3PFE A;  4CZ1 A;  2PCN A;  4X8I A;  4OAE A;  2WYR A;  3PB4 X;  4PK2 A;  4PK3 A;  4F9V A;  2DLA A;  3MGD A;  3SI1 A;  4RUH A;  2PR8 A;  2Z0Z A;  3SXO A;  1M6V B;  1I21 A;  1EO0 A;  2AFM A;  2O4H A;  4YFJ A;  4OC4 A;  3QNV A;  3NOJ A;  4CAX A;  2G0B A;  4L89 A;  1QSM A;  2C5Q A;  4GPL B;  1R3N A;  4Y49 C;  4IIX A;  2OLS A;  1NMT A;  1QSN A;  2BCO A;  2P0W A;  2YJT A;  2PR1 A;  4RN7 A;  3TE4 A;  1QSR A;  4QUS A;  3FF3 A;  3D68 A;  4JD6 A;  3IU2 A;  4PSX A;  2C6P A;  4FAI A;  1GHE A;  2DF5 A;  2EZB A;  1A2Z A;  5F5X A;  4O23 A;  1TF9 A;  2O28 A;  4A95 A;  1CP7 A;  1NXJ A;  1Z4E A;  3KQZ A;  4C9A A;  4IK2 A;  2D4O A;  3FED A;  4KUA A;  3SJG A;  4Q38 A;  3B3W A;  4MHP A;  2CXA A;  2YND A;  3I1U A;  1MJA A;  4NCZ A;  1PCA A;  2ZEM A;  1TIQ A;  4CAW A;  4B5O A;  4F0Y A;  2OB0 A;  3VRR A;  4TJV A;  1P4N A;  3H8E A;  3TLY A;  3BI1 A;  4UEF A;  5K99 A;  4A33 A;  3N7Z A;  3VH9 A;  1TKJ A;  4B14 A;  4C84 A;  4C8C A;  1MJ9 A;  2HRO A;  3BHX A;  1AMP A;  1YVK A;  5K8P A;  3TLZ A;  4CAF A;  1LAM A;  1XIX A;  4P10 A;  4MY0 A;  3R96 A;  3PRT A;  4Q36 A;  3D7D A;  1TKH A;  2I79 A;  3D7H A;  4KOU A;  2B3U A;  2BO9 A;  4NEX A;  3B3S A;  3CT9 A;  4C9E A;  4CDJ A;  3KAS A;  2BEI A;  2JEV A;  2OH1 A;  4FD7 A;  2YNC A;  3TLE A;  1XFO A;  5J3X A;  3WC7 A;  5JH9 A;  1XF1 A;  3SJF A;  1GYT A;  1ZG7 A;  2PJ9 A;  2ZED A;  4PXD A;  5HKW A;  4M8D A;  4E94 A;  3D67 A;  4FD5 A;  3ZJ0 A;  3CPX A;  4H2K A;  1J4J A;  3TOA A;  1QMU A;  4OP4 A;  4P4F A;  2C6G A;  4HNW B;  5HMN A;  2A4N A;  1V6C A;  3TLA A;  2Z3M A;  5AG4 A;  2EO8 A;  5K8O A;  2ZEO A;  4C8P A;  1NSL A;  4J3G A;  4M6G A;  3FBU A;  3BUW B;  4XPK A;  4AVA A;  3KKW A;  3SI2 A;  3VRQ A;  1YW4 A;  1CJW A;  3F8K A;  5H84 A;  4C2X A;  2F5I A;  3IGR A;  4X5K A;  5EMI A;  3TO7 A;  2VEZ A;  3VAR A;  5KTC A;  2EUI A;  4JXQ A;  4KNG E;  2I3C A;  4MHZ A;  4GXH A;  1YW6 A;  2Q51 A;  5F47 A;  1LAP A;  4NJR A;  1LRZ A;  3KL9 A;  1KZF A;  2R1I A;  4ONW A;  3S9L A;  3P2F A;  1XJO A;  1C3O B;  2Q7S A;  2D0P A;  5HXD A;  4R8F A;  4KOW A;  3I9S A;  4TWE A;  3ICU A;  3NFQ A;  4BTF A;  2G3A A;  2QVP A;  2B4D A;  2Z3L A;  4AVC A;  2Y1N A;  3BUN B;  3RZA A;  2O53 A;  4BBH A;  2YJV A;  4E2A A;  3CPA A;  1LAN A;  3RYO A;  3NE8 A;  4MXU A;  3UY5 A;  4BD9 A;  4MBU A;  4A94 A;  2N3A B;  4KOR A;  4M85 A;  4NGN A;  2OZG A;  1JDE A;  2H5M A;  2ZW5 A;  2QJ8 A;  4KVX A;  4A30 A;  2CBL A;  4A31 A;  4MFL A;  4ZX8 A;  4CRZ B;  4YGO A;  3I74 A;  4QVT A;  2XEJ A;  5F13 A;  5HKY A;  2PDO A;  1MK4 A;  2P6G A;  3IU1 A;  4G1P A;  4UF4 A;  2R82 A;  4NGP A;  4UBR A;  1F2P A;  1AUG A; 
#chains in the Genus database with same CATH homology
 2QYV A;  2F7V A;  3H8G A;  4A39 A;  3DGV A;  5I4M A;  4JYW A;  2V8H A;  4OC1 A;  2GLJ A;  3JRU A;  1LCP A;  8CPA A;  2CIJ A;  1ARM A;  3FJU A;  4EME A;  2AFU A;  4JZ0 A;  2AFW A;  5THW A;  2WZN A;  1CBX A;  5DS0 A;  4Z65 A;  1LFW A;  3V7Z A;  2RFH A;  2ZEG A;  2NYQ A;  3KR4 A;  2AFX A;  4P4I A;  3RBU A;  1Q7L A;  2V77 A;  1Z2L A;  1F57 A;  4Q7A A;  4C9V A;  3D66 A;  1Y0R A;  2PJ1 A;  5K8N A;  3VAT A;  3FVL A;  5LRG A;  3S9N A;  4TNU A;  4MCP A;  5LYI A;  2VL1 A;  1LOK A;  2ABZ A;  4ZYQ A;  5JGF A;  4OIW A;  3I6S A;  1UWY A;  5HVH A;  1H8L A;  2JBK A;  4A37 A;  2AFO A;  1TF8 A;  3GLJ A;  3FEC A;  4F8Z A;  4ZY1 A;  4X2T A;  1IY7 A;  3PB8 X;  4C86 A;  3B7I A;  3PBB A;  1Y7E A;  3PBE A;  1DE4 C;  2PIY A;  3IO1 A;  1ZLI A;  5D8N A;  3VTA A;  2PJB A;  4NJQ A;  2IQ6 A;  4DUK A;  1CX8 A;  3KGQ A;  2GRE A;  4P4D A;  1YSJ A;  4EFD A;  1JQG A;  3PFO A;  5IR2 A;  3KZW A;  3KR5 A;  3LWU A;  4X3R A;  4UEE A;  4A38 A;  4ZY2 A;  2ZEP A;  3WC5 A;  5LRK A;  4C9R A;  4UIA A;  2V8V A;  3BI0 A;  3NH8 A;  2GP4 A;  3GB0 A;  4MHY A;  1FT7 A;  1HDQ A;  4TJX A;  2POK A;  1PYT B;  3IIB A;  2F8H A;  2Q43 A;  2AFS A;  2XEG A;  2ZOF A;  3KHZ A;  1Z8L A;  1YLO A;  6CPA A;  4C85 A;  4OC0 A;  3S9M A;  5F09 A;  1R43 A;  5LYF A;  4MMO A;  4FBE A;  1XMB A;  3GUX A;  2OR4 A;  1ZG8 A;  4FUU A;  4ZX9 A;  1CG2 A;  4C8T A;  3FMC A;  4IAV A;  4K3N A;  2PCU A;  4CDK A;  2C1C A;  2PJ2 A;  5LRJ A;  2CTB A;  1VHE A;  2Q4Z A;  4NGT A;  2PRQ A;  4MCQ A;  4P44 A;  4PXE A;  2XEF A;  3B3V A;  4P4B A;  1FNO A;  4ZI6 A;  2V8D A;  1BLL E;  3H8F A;  4KSI A;  2AFZ A;  1BPN A;  7CPA A;  3K9T A;  1VIX A;  2EK9 A;  3FEE A;  1DTD A;  2NSM A;  1XRY A;  4C9U A;  2ZEL A;  3PB7 X;  2PJC A;  4OC2 A;  3KQX A;  4WJB A;  4PXC A;  4C8U A;  3PEI A;  3BXM A;  2J9A A;  4PPZ A;  5CBM A;  2EWB A;  2GLF A;  4MHN A;  1ELL P;  2DEA A;  2ZEE A;  3MRU A;  4P4E A;  2C6C A;  1VGY A;  5D29 A;  2PJ6 A;  3CDX A;  3HUV A;  2PE3 A;  3RAM A;  4NGR A;  4P4J A;  3PB6 X;  4OME A;  2PJ3 A;  3PB9 X;  4AXV A;  2RB7 A;  4MCR A;  4R7M A;  3SJE A;  2JEW A;  2PJ0 A;  2HB6 A;  2CTC A;  1F2O A;  2PVW A;  3IWW A;  5LYL A;  4DYO A;  1NSA A;  3D4U A;  4R76 A;  1HEE A;  4GM5 A;  4P6Y A;  2IJZ A;  4CPA A;  1ZLH A;  1ARL A;  3TX8 A;  1AYE A;  1CPS A;  5LYD A;  3SI0 A;  2PJ4 A;  1YME A;  4YWY A;  2PJA A;  1ZG9 A;  2ZOG A;  5IB9 A;  5HVF A;  4PQA A;  2PJ8 A;  3MN8 A;  4F9U A;  4LQG A;  4C99 A;  4YN3 A;  1QQ9 A;  3B35 A;  3ISZ A;  1M4L A;  4UIB A;  3EIF A;  2XEI A;  4MCS A;  3IC1 A;  2JBJ A;  3ISX A;  4NGQ A;  3NA6 A;  3T8W A;  4YU9 A;  4R6T A;  2FVG A;  2PIZ A;  3B3C A;  4OID A;  1HDU A;  4OC3 A;  2ZEH A;  4NGM A;  3KHX A;  4UEZ A;  2PVV A;  1EE3 P;  1KWM A;  3HLP A;  5HVG A;  3DLJ A;  3IJ3 A;  3TC8 A;  2ZEF A;  1WVM A;  1CPX A;  4NGS A;  5ELY A;  2EK8 A;  4OKO A;  1Y0Y A;  3IEH A;  1BAV A;  3SJX A;  3B3T A;  4DJL A;  3B2Y A;  3FX6 A;  4C8A A;  1OBR A;  4NFR A;  1CP6 A;  1ELM P;  3WAB A;  3NH4 A;  4WWV A;  4W9Y A;  3K2K A;  4B6Z A;  1BPM A;  2ANP A;  5K8M A;  3V38 A;  3NFZ A;  5CPA A;  4EWT A;  1Y9Z A;  2ZEN A;  1IGB A;  3L2N A;  4MRI A;  3KI9 A;  4PXB A;  2BOA A;  2PJ7 A;  4IHM A;  4C8F A;  4ZY0 A;  4P45 A;  3D7G A;  5JM6 A;  2V8G A;  1Z5R A;  3IFE A;  1TXR A;  2IMO A;  4OC5 A;  1VHO A;  3LMS A;  1XBU A;  5J1Q A;  2OOT A;  3FH4 A;  2GU2 A;  1RTQ A;  1TKF A;  2CF4 A;  2G9D A;  3WT4 A;  2HC9 A;  2PJ5 A;  4FWU A;  3WC6 A;  3D7F A;  3N5F A;  3NH5 A;  3PFE A;  4X8I A;  2WYR A;  3PB4 X;  4F9V A;  3SI1 A;  4RUH A;  2AFM A;  2O4H A;  4OC4 A;  3QNV A;  2C5Q A;  1R3N A;  2BCO A;  3FF3 A;  3D68 A;  4FAI A;  2C6P A;  4O23 A;  1TF9 A;  1CP7 A;  3KQZ A;  4C9A A;  4IK2 A;  3FED A;  3SJG A;  3B3W A;  4MHP A;  3I1U A;  1PCA A;  2ZEM A;  4TJV A;  3H8E A;  3BI1 A;  4UEF A;  3VH9 A;  1TKJ A;  4C84 A;  4C8C A;  3BHX A;  1AMP A;  5K8P A;  1LAM A;  4P10 A;  3PRT A;  3D7D A;  1TKH A;  3D7H A;  2BO9 A;  3B3S A;  3CT9 A;  4C9E A;  4CDJ A;  3KAS A;  1XFO A;  3WC7 A;  5JH9 A;  1XF1 A;  3SJF A;  1GYT A;  1ZG7 A;  2PJ9 A;  2ZED A;  4PXD A;  3D67 A;  3CPX A;  4H2K A;  1QMU A;  4OP4 A;  4P4F A;  2C6G A;  1V6C A;  5K8O A;  2ZEO A;  4C8P A;  3SI2 A;  1YW4 A;  3VAR A;  4KNG E;  2I3C A;  4MHZ A;  1YW6 A;  2Q51 A;  1LAP A;  4NJR A;  3KL9 A;  4ONW A;  3S9L A;  1XJO A;  5HXD A;  4R8F A;  3ICU A;  4TWE A;  2QVP A;  3RZA A;  2O53 A;  3CPA A;  1LAN A;  4MXU A;  4BD9 A;  4A94 A;  4NGN A;  2QJ8 A;  3I74 A;  4ZX8 A;  2XEJ A;  4G1P A;  4UF4 A;  4NGP A;  1F2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...