2PVWA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with 2-(phosphonomethyl)pentanedioic acid (2-pmpa)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
695
structure length
690
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 268
structure length 690
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2pvwA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pvwA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2pvwA02
2PVVA 3WABA 3S9MA 2PJ0A 3SJGA 4UIAA 3KHZA 2PJ9A 3BXMA 3DLJA 2C6GA 4BD9A 8CPAA 3EIFA 1F57A 5JGFA 4ZX8A 1YW4A 4DUKA 1XRYA 4P4FA 4NGQA 3ISZA 1CPXA 1ELLP 2ZEGA 4A38A 2OOTA 4F8ZA 3VATA 1TKFA 2AFWA 5JH9A 5J1QA 5K8OA 1ZG7A 2PJ6A 3IEHA 2I3CA 2PJ8A 2EWBA 7CPAA 1ARMA 4DYOA 2V8DA 4NGPA 1QQ9A 1CP7A 5F09A 3V7ZA 4P4JA 2V8HA 2O4HA 1F2PA 2AFXA 3B3SA 5HXDA 3D7GA 3ISXA 4ONWA 1PCAA 2QJ8A 1F2OA 3B3CA 2PVWA 2PJAA 3DGVA 2IMOA 2GLJA 4FAIA 5HVGA 5LYLA 4C9AA 2IQ6A 4IAVA 5IB9A 5LYDA 1NSAA 4JYWA 4P44A 4X8IA 3B3VA 3B3WA 2DEAA 2V8GA 3HLPA 3NA6A 4P45A 2EK9A 2ZOFA 2ZOGA 4G1PA 4WWVA 1XBUA 3SI1A 3KR5A 1ZLHA 3FMCA 3WT4A 1HEEA 3LWUA 4OC3A 1HDUA 3FVLA 3FH4A 3IWWA 2JBJA 1CPSA 3GUXA 3GLJA 1TKHA 5THWA 4P6YA 3PB4X 4C8PA 4PQAA 1LCPA 4NGSA 3JRUA 2OR4A 2ZELA 5LYFA 4C8UA 1VHOA 1CG2A 1Z5RA 2PJBA 3KHXA 3SJEA 3KGQA 2PJ3A 4ZI6A 3B7IA 3PB7X 3VH9A 2EK8A 4PPZA 4OIDA 2Q4ZA 4PXDA 3VTAA 2RB7A 2AFSA 2O53A 4X2TA 5LYIA 2F7VA 3H8GA 2PIYA 5JM6A 2C6CA 3RBUA 4OC5A 4KNGE 4R7MA 2QYVA 5LRGA 3L2NA 3PEIA 2Q43A 4EMEA 1R3NA 2POKA 4NGRA 3BI0A 4FBEA 3PFOA 3FJUA 4F9VA 4ZYQA 2CF4A 4CDKA 1WVMA 3H8EA 4P4BA 4OC2A 5ELYA 4JZ0A 1BLLE 3B2YA 1LFWA 2GREA 2JEWA 3I6SA 1Q7LA 4TJVA 1ZG8A 2ZEEA 3I1UA 4C9RA 1ZLIA 2VL1A 3D68A 3PB9X 5CPAA 4UEZA 1Z8LA 3FECA 4NGMA 1YMEA 3S9NA 3QNVA 1TF8A 4C8AA 2ZEDA 1CX8A 4NGTA 4P10A 3CPXA 2AFUA 2XEIA 1XFOA 1BPNA 1EE3P 3PBEA 4CDJA 4ZY1A 1Y0YA 4OC0A 2RFHA 2GLFA 2HB6A 3T8WA 4W9YA 1CP6A 1AYEA 2CIJA 1HDQA 1BAVA 2FVGA 3N5FA 3IJ3A 4A39A 3IFEA 2C6PA 2ANPA 4IHMA 4UEEA 3SJXA 5I4MA 1TF9A 2V77A 4R6TA 1JQGA 4RUHA 2AFOA 2ZENA 1VHEA 4C86A 3BHXA 3LMSA 4C9EA 1LANA 1YSJA 3V38A 3MN8A 4MHZA 5K8MA 4TWEA 4Z65A 1UWYA 2PJ4A 4GM5A 4C8FA 1YW6A 2CTCA 2HC9A 4PXBA 3IC1A 2BOAA 2NYQA 4UIBA 1TKJA 2ZEHA 5D29A 2G9DA 1ARLA 3CDXA 1KWMA 4MHNA 4NJQA 4UEFA 3SI0A 3PB8X 2NSMA 2ZEMA 1Y9ZA 4UF4A 5HVHA 1R43A 3CPAA 3NFZA 4OMEA 4ZY0A 1Z2LA 2BO9A 3PRTA 5CBMA 3H8FA 3PFEA 3BI1A 2Q51A 3D7FA 4Q7AA 3RZAA 1M4LA 1FT7A 3FEDA 2PJCA 1IY7A 4A37A 1DE4C 1XF1A 3SI2A 4NFRA 3WC5A 4PXCA 4B6ZA 3PBBA 2PJ2A 4OIWA 3KL9A 1H8LA 3D66A 2XEJA 2PE3A 3KASA 2ZEPA 3S9LA 3TC8A 4FWUA 2WYRA 2ZEOA 3FEEA 1CBXA 4AXVA 3B35A 1LAPA 4DJLA 3NH4A 3MRUA 1XJOA 3SJFA 4MXUA 4ZX9A 4C9VA 3CT9A 4MHPA 2AFMA 1ZG9A 4H2KA 3D7DA 5K8NA 4TNUA 2CTBA 3KQZA 1VGYA 1FNOA 5K8PA 5HVFA 4K3NA 2PCUA 4YN3A 2JBKA 1V6CA 3D7HA 3KQXA 1XMBA 4YU9A 2BCOA 3K9TA 3FX6A 2QVPA 4MCQA 1RTQA 2C1CA 1Y0RA 4TJXA 2ABZA 4NJRA 3FF3A 6CPAA 4CPAA 1TXRA 4WJBA 4IK2A 4EWTA 1QMUA 3D67A 3I74A 4NGNA 2AFZA 4MCPA 3IO1A 4YWYA 4OC4A 1BPMA 2WZNA 4MCSA 3KI9A 3RAMA 4R8FA 3HUVA 4LQGA 2PJ7A 4MCRA 1YLOA 5D8NA 1AMPA 3IIBA 4MRIA 4FUUA 2GU2A 3GB0A 4P4EA 3NH5A 4X3RA 4MHYA 4C99A 4ZY2A 4OP4A 3KZWA 4C85A 4EFDA 2XEGA 3VARA 4F9UA 1LOKA 5LRKA 4R76A 4A94A 1LAMA 3B3TA 3NH8A 5LRJA 1ELMP 3TX8A 2PJ1A 3KR4A 2F8HA 1Y7EA 1IGBA 3ICUA 2J9AA 1VIXA 4OC1A 3WC7A 4P4IA 4O23A 2PJ5A 3K2KA 2PIZA 3PB6X 1GYTA 4MMOA 4C84A 2ZEFA 4C9UA 1DTDA 4PXEA 1OBRA 2PRQA 2XEFA 3D4UA 4KSIA 1PYTB 4OKOA 3WC6A 2IJZA 4C8TA 5DS0A 4C8CA 4P4DA 2V8VA
chains in the Genus database with same CATH superfamily
4KVOE 1Z9EA 2PVVA 3C8OA 3WABA 3S9MA 2B58A 2KCWA 3EZBA 2PJ0A 3SJGA 4UIAA 3KHZA 2PJ9A 3FRMA 3BXMA 2OU2A 1RXTA 2C27A 1WJTA 3G8WA 4B14A 1N71A 1PU9A 3DLJA 4R3LA 5C88A 4UCPA 2C6GA 2YGWA 2YNEA 4BD9A 1PUAA 2FIAA 1Z8WA 3S6GA 4M6IA 4BTFA 3EIFA 1F57A 3T9YA 5JGFA 4K30A 4UCMA 3W6XA 4ZX8A 3R1KA 3JTKA 4UA3A 1YW4A 2DXQA 4DUKA 1XRYA 2JDDA 1R61A 4P4FA 4NGQA 3ISZA 4BMHA 5H84A 4QBJA 1CPXA 4H89A 3MGDA 4M6GA 2B4BA 4C2ZA 1ELLP 2ZEGA 4A38A 3EZEA 2OOTA 4F8ZA 3VATA 1TKFA 2WSAA 1QSOA 2AFWA 5JH9A 5J1QA 4CGNA 2P6EA 3PFVA 4YGOA 5K8OA 5BY0A 1ZG7A 2PJ6A 3IEHA 4Q38A 2I3CA 2CY2A 2PJ8A 3IU1A 2EWBA 3VWEA 1S7NA 7CPAA 1ARMA 4DYOA 2DIKA 4RN7A 3K4IA 4UWIA 4A31A 3F0AA 2XPLA 1Z8TA 3TOBA 2V8DA 2Q44A 4NGPA 1QQ9A 3PZJA 2CNMA 3TO9A 1CP7A 5F13A 5F09A 3V7ZA 4P4JA 2V8HA 1CJWA 2O4HA 1CM0A 5G1ZA 1VBHA 1F2PA 2AFXA 3B3SA 2B4JC 3BUXB 1BOBA 3D7GA 3ISXA 3QB8A 4ONWA 1PCAA 2QJ8A 1F2OA 1YVKA 3B3CA 2PVWA 1YGHA 3EFAA 4FD5A 4ORFA 4UFVA 2PJAA 3EO4A 1U6MA 3DGVA 2H5MA 3RYOA 2IMOA 2GLJA 4FAIA 2Q04A 5HVGA 5LYLA 2YJTA 2JDCA 4C9AA 2IQ6A 3GYAA 4IAVA 1YR0A 4FD7A 5HMNA 5IB9A 3ZZIA 5LYDA 1NSAA 4JYWA 4P44A 1FBVA 5JPHA 5AXIA 4X8IA 3TO7A 4LX9A 2XPOA 3B3VA 3B3WA 2DEAA 2V8GA 3HLPA 4GPLB 5F48A 2J8NA 5AGEA 3EC4A 1ZO0A 3NA6A 3VRNA 1ZYMA 4GS4A 4P45A 2EK9A 2FM4A 4INJA 1LRZA 1P4NA 1S7FA 2ZOFA 3DDDA 1ZL0A 5HKZA 2ZOGA 1NSLA 5HKYA 4G1PA 1IYLA 4WWVA 1XBUA 3SI1A 3KR5A 1ZLHA 4C7IA 3F8KA 3FMCA 1J4JA 2E28A 4EYSA 1IICA 2Z3MA 3WT4A 1HEEA 1XIXA 3LWUA 3RO0A 5J8FA 4OC3A 1HDUA 3FVLA 4RI1A 3FH4A 4KUBA 3IWWA 2JBJA 2FSRA 3W91A 2G0BA 5C82A 4CYQA 1CPSA 3GUXA 4CRYB 3GLJA 1TKHA 3QAYA 1IU8A 5THWA 4A4BA 5F5XA 2ZW6A 4P6YA 4E0AA 3PB4X 4XPLA 2VXKA 1XOVA 4HKFA 4C8PA 2Q7SA 4PQAA 1LCPA 1XF8A 1IYKA 4NGSA 3JRUA 3S6KA 3OWCA 2OR4A 3KKWA 4JXRA 2ZELA 2QECA 2EUIA 3DSBA 4KLVA 2PQ8A 5LYFA 1VI4A 3TLAA 2B4DA 4QVTA 4NXYA 3R9GA 3V8IA 1VHOA 4B12A 1CG2A 1Z5RA 2PJBA 3KHXA 1OZPA 2BUEA 1X12A 3SJEA 1Q2YA 3KGQA 2PJ3A 5G21A 2FL4A 2GIVA 1XMTA 3T90A 4IIYA 4ZI6A 4C8UA 2Q4YA 4JXQA 2BSWA 3B7IA 3PB7X 3VH9A 1KUXA 2EK8A 4PPZA 4OIDA 2Q4ZA 5AG5A 2CNSA 2Y0MA 2EZCA 1I1DA 4PXDA 3VTAA 2RB7A 4EVYA 5H86A 2AFSA 2O53A 4X2TA 5LYIA 4GXHA 3IWEA 2RC4A 2F7VA 3H8GA 2PIYA 5JM6A 2C6CA 3RBUA 5J8CA 2Q0YA 4CGPA 4E2AA 4OC5A 1K4JA 1QSMA 4KNGE 4MY3A 4R7MA 2Z3KA 1CS0B 1S7LA 4L89A 2IL4A 4F6AA 2EZBA 4A4CA 2QYVA 2Z3OA 5LRGA 3L2NA 2I00A 3SXNA 3PEIA 2P6FA 3GKRA 4FD6A 4UFWA 4YRHA 2Q43A 2J8RA 5DWNA 4EMEA 1R3NA 2POKA 4NGRA 3BI0A 2B4DB 2YJVA 4JLYA 1ON0A 4A95A 3R96A 1I21A 3FB3A 4KOUA 4CAVA 4FBEA 3PFOA 3FJUA 3G3SA 3HPHE 2CNTA 4B10A 2CF4A 4F9VA 4ZYQA 3TFYA 4CDKA 4KORA 1WVMA 3H8EA 4B5OA 4P4BA 4MFPA 4AG9A 4OC2A 5ELYA 2YNCA 4JZ0A 4U9ZA 1BLLE 3B2YA 3TLCA 1R57A 1LFWA 2GREA 2JEWA 3I6SA 2YNCC 2VI7A 1Q7LA 4TJVA 1ZG8A 2ZEEA 1TIQA 1XE4A 4KVME 3T05A 4FD4A 4AVBA 3I1UA 2YNDA 4ZBGA 2JLMA 1M6VB 3OB1B 4C9RA 4E5SA 5IB0A 1ZLIA 2VL1A 3D68A 2Z3PA 5IV0A 3PB9X 2EO8A 5CPAA 3O8ZA 5G20A 1S7KA 4L8AA 1YQEA 3PGPA 4UEZA 3OAKA 4BPWB 1Z8LA 2I79A 3FECA 2Z10A 4NGMA 2ZW7A 4RS2A 4MY0A 2PSWA 1YMEA 2VZYA 4MFKA 3S9NA 3QNVA 1TF8A 2ZPAA 5IR2A 4C8AA 2ZEDA 2R98A 2BL1A 4KOTA 1CX8A 4JVOA 3TLYA 4NGTA 1IB1E 4P10A 3CPXA 2AFUA 4R3KA 1Y9KA 2FCKA 2PCNA 2XEIA 1XFOA 1BPNA 1EE3P 1KUVA 2A4NA 4HPSA 4H6ZA 1NBWA 1AUGA 1IOFA 1M1DA 4MFLA 1GHEA 3PBEA 4UWJA 3DNSA 4ZY1A 2VKZG 2AUNA 3NE7A 4ZGYB 2GP4A 4CDJA 1KBLA 1KUYA 3R9EA 1Y0YA 4OC0A 3BUWB 1YREA 2RFHA 3KRVA 2GLFA 3TCVA 1I12A 2HB6A 3T8WA 3OB2B 4AVAA 4W9YA 4BPUB 4E8OA 4UFXA 2CBLA 1GGOA 2R7HA 1CP6A 3TYXA 3WR7A 3DR6A 1AYEA 1BXRB 2CIJA 1HDQA 1BAVA 2FVGA 3N5FA 3IJ3A 4A39A 1QSRA 2HROA 3DR8A 3IFEA 2C6PA 1P0HA 3TTHA 2Q4VA 4I49A 4B5PA 5HXDA 4KOSA 4KOXA 2ANPA 4IHMA 2Z3NA 4UEEA 3TLGA 3SJXA 5I4MA 1DIKA 1L0CA 1TF9A 2V77A 4MFJA 2FT0A 4R6TA 4BBHA 1J3LA 1JQGA 4RUHA 4H1HA 2F5IA 4CGLA 2AFOA 4UBRA 2PR8A 3TLBA 3PT1A 4PSWA 2ZENA 1VHEA 4RR2B 4OADA 4Y49B 2WUUA 4CAEA 2Z0ZA 3F5BA 4C86A 1KZFA 1MJAA 1Q2DA 3BHXA 4E94A 2D4OA 3JVNA 3LMSA 4PV6A 3CXQA 4B11A 4C9EA 1LANA 1YSJA 3V38A 5AG7A 4XPDB 3MN8A 4MHZA 4OAEA 4TWEA 4Z65A 5K8MA 1JDEA 4X5KA 4NF1A 4COBA 1UWYA 2PJ4A 4R87A 1VHSA 2UV8G 3VGOA 1Z9UA 4GM5A 4C8FA 1YW6A 1S5KA 2CTCA 4COGA 1YVHA 2HC9A 4PXBA 2DPSA 4LQ6A 2NMTA 1Y7RA 1YX0A 1A9XB 3ZNIA 3IC1A 3OP0A 2Z3LA 2ARHA 2BOAA 2NYQA 4MFZA 5A27A 4UIBA 4M8DA 1TKJA 4A30A 2ZEHA 2FXFA 5D29A 4R9MA 3U88C 3SHPA 3HPGG 2G9DA 1ARLA 2R8VA 3T5MA 5K99A 4B5PB 5KTAA 3NFQA 3VRRA 5EBVA 3CDXA 1KWMA 4MHNA 4NJQA 4UEFA 3SI0A 4DNCA 3TLGB 3PB8X 5BWAB 2NSMA 2ZEMA 1Y9ZA 4UF4A 2GFQA 2REFA 5HVHA 1R43A 3CPAA 3VROA 4XNHB 2N3AB 5J3XA 3NFZA 4OMEA 1IOIA 2R1IA 2Y1MA 4ZY0A 5JYBA 1Z2LA 2BO9A 3EXNA 3LACA 3PRTA 5CNPA 4XPKA 3ZJ0A 5CBMA 3H8FA 2C5QA 2EZAA 4QUSA 3G23A 3PFEA 1CE8B 1XEBA 3BI1A 3D8PA 1C3OB 5DWMA 2Q51A 4F0YA 3IU2A 3BJ7A 3D7FA 2WPWA 4Q7AA 3RZAA 1M4LA 1FT7A 3FEDA 2PJCA 1IY7A 3BLNA 5EMIA 4KUAA 4A37A 1DE4C 4LUAA 3SI2A 3S6HA 5IX3A 4NFRA 1XF1A 3WC5A 4PXCA 4CO9A 4B6ZA 4KS9A 3U1BA 2WPXA 4A33A 4C7HA 3PBBA 4KLWA 2PJ2A 4F0XA 4B13A 4OIWA 3CZXA 1B6BA 3KL9A 1EO0A 4BINA 1H8LA 4J3GA 2EVNA 2OLSA 3BUOB 3D66A 4CYNA 4HNXB 4C68A 1YVOA 2CXAA 2XEJA 1S60A 5AG6A 4AG7A 2D4PA 2PE3A 4OLLA 3KASA 2ZEPA 5KTCA 3S9LA 4M85A 1RO5A 3TC8A 1VBGA 1NMTA 4IF5A 1JWQA 2DPTA 2WYRA 4FWUA 2OB0A 1FY7A 4KOWA 2ZEOA 3FEEA 2X7BA 3A9LA 1CBXA 3F9KC 4AXVA 5JVLA 3B35A 1KC7A 1C30B 4Q36A 1IIDA 1LAPA 1QSNA 2P0WA 3PP9A 2BEIA 4DJLA 3NH4A 3BUNB 3LODA 3EZAA 3MRUA 1XJOA 3FYNA 3SJFA 4MXUA 5F47A 3P2HA 4ZX9A 2OZUA 4JJXA 2VEZA 4J0NA 3CT9A 1T36B 4C9VA 3TE4A 3FNCA 4MHPA 4CYOA 3TLZA 2AFMA 1ZG9A 4H2KA 3D7DA 3TO6A 5K8NA 3LD2A 3BJ8A 4TNUA 1A2ZA 4ONUA 2CTBA 2OZGA 3CXPA 1VGYA 3KQZA 4M3SA 4YFJA 1NXJA 1FNOA 3BUMB 5K8PA 5HVFA 2QMLA 4K3NA 2FS5A 2PCUA 4UCNA 4YN3A 2JBKA 2G3AA 1V6CA 3D7HA 3KQXA 1XMBA 4CZ1A 4Y49C 4YU9A 2EBJA 2BCOA 3K9TA 3P2FA 5F1YA 3FX6A 2QVPA 4MCQA 3E0KA 1RTQA 2PC1A 3CXSA 5FVJA 4C2XA 2PR1A 2R82A 2B5GA 2C1CA 5F46A 4XPDC 2D0OA 2ODFA 3FXTA 4IUSA 2X0SA 1Z8XA 3GIUA 3TOAA 1Y0RA 3UY5A 2AUMA 4TJXA 2ABZA 3H4QA 4KZTA 4NJRA 4CAWA 3FF3A 2B3VA 6CPAA 2Q7BA 1MJBA 2P6GA 1Z4EA 4NCZA 1WWZA 4CYPA 4BPXB 4CPAA 1TXRA 4MBUA 4WJBA 4CRZB 1BO4A 2ZW4A 4KVXA 5E96A 4M6HA 3TLEA 4IK2A 3TT2A 4EWTA 1QMUA 2Z11A 4NSQA 4MFQA 3D67A 2FIWA 3I74A 3K9UA 4U9YA 4NGNA 2AFZA 1KEEB 3H5ZA 4MCPA 2OH1A 1SQHA 1MJ9A 4NEXA 4XNHC 3IO1A 2XPPA 4OC4A 1Q2CA 3FBUA 4QB9A 1BPMA 4KOVA 4YWYA 2WZNA 3R95A 3W6SA 4MCSA 3HMJG 3KI9A 3QAHA 3RAMA 4AB7A 5G22A 3T07A 4R8FA 1NE9A 5F49A 3HUVA 4LQGA 2PJ7A 4MCRA 1YLOA 5D8NA 1AMPA 3IIBA 4JD6A 4MRIA 4FUUA 2J8MA 2GU2A 2B5GB 4P4EA 3GB0A 3N7ZA 4X3RA 3NH5A 4MHYA 4CGOA 4C99A 4ZY2A 5F9MA 3PLFB 1B47A 4MHDA 1Y9WA 4KSAA 4OP4A 3S6FA 3VRQA 4A32A 8CPAA 2OZHA 3KZWA 5I0CA 2HWGA 5GCNA 4C85A 3VRPA 4CS0B 2PRBA 2HI6A 3D2PA 3GJZA 2JEVA 4HNYB 4EFDA 1M4DA 1X10A 2XEGA 3VARA 4KSFA 3JUWA 4II9A 4F9UA 1LOKA 5LRKA 1Q5XA 5A28A 4R76A 2XPNA 1S3ZA 4A94A 1LAMA 3B3TA 3FIXA 3NH8A 5LRJA 4A2ZA 3R9FA 1ELMP 3TX8A 4MI4A 2PJ1A 2REEA 3KR4A 4U5YA 4PK2A 1VKCA 2F8HA 4JWPA 1WK4A 5AG4A 1ZRSA 3B8GA 2DLAA 4MI1A 3VWDA 5KTDA 2PDOA 1Y7EA 2AJ6A 1IGBA 4HNWB 3NE8A 1M4IA 2FE7A 3ICUA 2J9AA 4R57A 1M44A 1VIXA 4OC1A 3RNZA 3NOJA 1UFHA 5FD8A 1B87A 3IWGA 4IIXA 3WC7A 5EC4A 4H6UA 2O28A 4P4IA 3EY5A 1EZAA 3SR3A 2VBQA 4O23A 1V0CA 2PJ5A 3K2KA 2HUZA 2B3UA 2PIZA 3D2MA 3PB6X 5HKWA 4CAFA 2HQYA 3I3GA 1GYTA 1YK3A 4AVCA 4PK3A 5ISVA 4MMOA 2MP0A 2ZW5A 5JQ4A 2ZEFA 4C84A 2K5TA 2Y1NA 3GY9A 4C9UA 3I9SA 1EZBA 1DTDA 2GANA 2DF5A 2B0AA 4PXEA 1OBRA 4MJ8A 4QC6A 2PRQA 1M4GA 2XEFA 2G3TA 1Z4RA 3D4UA 4KSIA 3IGRA 1PYTB 2VZZA 3SXOA 4C2YA 2VQYA 1MK4A 4OKOA 1JDBC 2HV2A 2QIRA 5HH1A 4KOYA 3WC6A 3T0TA 2IJZA 3D3SA 4C8TA 1QSTA 5DS0A 1YLEA 2ATRA 4CGMA 2ZXVA 4C8CA 4MJXA 3C26A 2AE6A 4PSXA 4P4DA 2GE3A 2V8VA 2D0PA 4CAXA
chains in the Genus database with same CATH topology
2PVVA 3WABA 3S9MA 2PJ0A 3SJGA 4UIAA 3KHZA 2PJ9A 3BXMA 3DLJA 2C6GA 4BD9A 8CPAA 3EIFA 1F57A 5JGFA 4ZX8A 1YW4A 4DUKA 1XRYA 4P4FA 4NGQA 3ISZA 1CPXA 1ELLP 2ZEGA 4A38A 2OOTA 4F8ZA 3VATA 1TKFA 2AFWA 5JH9A 5J1QA 5K8OA 1ZG7A 2PJ6A 3IEHA 2I3CA 2PJ8A 2EWBA 7CPAA 1ARMA 4DYOA 2V8DA 4NGPA 1QQ9A 1CP7A 5F09A 3V7ZA 4P4JA 2V8HA 2O4HA 1F2PA 2AFXA 3B3SA 5HXDA 2GP4A 3D7GA 3ISXA 4ONWA 1PCAA 2QJ8A 1F2OA 3B3CA 2PVWA 2PJAA 3DGVA 2IMOA 2GLJA 4FAIA 5HVGA 5LYLA 4C9AA 2IQ6A 4IAVA 5IB9A 5LYDA 1NSAA 4JYWA 4P44A 4X8IA 3B3VA 3B3WA 2DEAA 2V8GA 3HLPA 3NA6A 4P45A 2EK9A 2ZOFA 2ZOGA 4G1PA 4WWVA 1XBUA 3SI1A 3KR5A 1ZLHA 3FMCA 3WT4A 1HEEA 3LWUA 4OC3A 1HDUA 3FVLA 3FH4A 3IWWA 2JBJA 1CPSA 3GUXA 3GLJA 1TKHA 5THWA 4P6YA 3PB4X 4C8PA 4PQAA 1LCPA 4NGSA 3JRUA 2OR4A 2ZELA 5LYFA 4C8UA 1VHOA 1CG2A 1Z5RA 2PJBA 3KHXA 3SJEA 3KGQA 2PJ3A 4ZI6A 3B7IA 3PB7X 3VH9A 2EK8A 4PPZA 4OIDA 2Q4ZA 4PXDA 3VTAA 2RB7A 2AFSA 2O53A 4X2TA 5LYIA 2F7VA 3H8GA 2PIYA 5JM6A 2C6CA 3RBUA 4OC5A 4KNGE 4R7MA 2QYVA 5LRGA 3L2NA 3PEIA 2Q43A 4EMEA 1R3NA 2POKA 4NGRA 3BI0A 4FBEA 3PFOA 3FJUA 4F9VA 4ZYQA 2CF4A 4CDKA 1WVMA 3H8EA 4P4BA 4OC2A 5ELYA 4JZ0A 1BLLE 3B2YA 1LFWA 2GREA 2JEWA 3I6SA 1Q7LA 4TJVA 1ZG8A 2ZEEA 3I1UA 4C9RA 1ZLIA 2VL1A 3D68A 3PB9X 5CPAA 4UEZA 1Z8LA 3FECA 4NGMA 1YMEA 5IR2A 3S9NA 3QNVA 1TF8A 4C8AA 2ZEDA 1CX8A 4NGTA 4P10A 3CPXA 2AFUA 2XEIA 1XFOA 1BPNA 1EE3P 3PBEA 4CDJA 4ZY1A 1Y0YA 4OC0A 2RFHA 2GLFA 2HB6A 3T8WA 4W9YA 1CP6A 1AYEA 2CIJA 1HDQA 1BAVA 2FVGA 3N5FA 3IJ3A 4A39A 3IFEA 2C6PA 2ANPA 4IHMA 4UEEA 3SJXA 5I4MA 1TF9A 2V77A 4R6TA 1JQGA 4RUHA 2AFOA 2ZENA 1VHEA 4C86A 3BHXA 3LMSA 4C9EA 1LANA 1YSJA 3V38A 3MN8A 4MHZA 5K8MA 4TWEA 4Z65A 1UWYA 2PJ4A 4GM5A 4C8FA 1YW6A 2CTCA 2HC9A 4PXBA 3IC1A 2BOAA 2NYQA 4UIBA 1TKJA 2ZEHA 5D29A 2G9DA 1ARLA 3CDXA 1KWMA 4MHNA 4NJQA 4UEFA 3SI0A 3PB8X 2NSMA 2ZEMA 1Y9ZA 4UF4A 5HVHA 1R43A 3CPAA 3NFZA 4OMEA 4ZY0A 1Z2LA 2BO9A 3PRTA 5CBMA 3H8FA 2C5QA 3PFEA 3BI1A 2Q51A 3D7FA 4Q7AA 3RZAA 1M4LA 1FT7A 3FEDA 2PJCA 1IY7A 4A37A 1DE4C 1XF1A 3SI2A 4NFRA 3WC5A 4PXCA 4B6ZA 3PBBA 2PJ2A 4OIWA 3KL9A 1H8LA 3D66A 2XEJA 2PE3A 3KASA 2ZEPA 3S9LA 3TC8A 4FWUA 2WYRA 2ZEOA 3FEEA 1CBXA 4AXVA 3B35A 1LAPA 4DJLA 3NH4A 3MRUA 1XJOA 3SJFA 4MXUA 4ZX9A 4C9VA 3CT9A 4MHPA 2AFMA 1ZG9A 4H2KA 3D7DA 5K8NA 4TNUA 2CTBA 3KQZA 1VGYA 1FNOA 5K8PA 5HVFA 4K3NA 2PCUA 4YN3A 2JBKA 1V6CA 3D7HA 3KQXA 1XMBA 4YU9A 2BCOA 3K9TA 3FX6A 2QVPA 4MCQA 1RTQA 2C1CA 1Y0RA 4TJXA 2ABZA 4NJRA 3FF3A 6CPAA 4CPAA 1TXRA 4WJBA 4IK2A 4EWTA 1QMUA 3D67A 3I74A 4NGNA 2AFZA 4MCPA 3IO1A 4YWYA 4OC4A 1BPMA 2WZNA 4MCSA 3KI9A 3RAMA 4R8FA 3HUVA 4LQGA 2PJ7A 4MCRA 1YLOA 5D8NA 1AMPA 3IIBA 4MRIA 4FUUA 2GU2A 3GB0A 4P4EA 3NH5A 4X3RA 4MHYA 4C99A 4ZY2A 4OP4A 3KZWA 4C85A 4EFDA 2XEGA 3VARA 4F9UA 1LOKA 5LRKA 4R76A 4A94A 1LAMA 3B3TA 3NH8A 5LRJA 1ELMP 3TX8A 2PJ1A 3KR4A 2F8HA 1Y7EA 1IGBA 3ICUA 2J9AA 1VIXA 4OC1A 3WC7A 4P4IA 4O23A 2PJ5A 3K2KA 2PIZA 3PB6X 1GYTA 4MMOA 4C84A 2ZEFA 4C9UA 1DTDA 4PXEA 1OBRA 2PRQA 2XEFA 3D4UA 4KSIA 1PYTB 4OKOA 3WC6A 2IJZA 4C8TA 5DS0A 4C8CA 4P4DA 2V8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVV A;  3WAB A;  3S9M A;  2PJ0 A;  3SJG A;  4UIA A;  3KHZ A;  2PJ9 A;  3BXM A;  3DLJ A;  2C6G A;  4BD9 A;  8CPA A;  3EIF A;  1F57 A;  5JGF A;  4ZX8 A;  1YW4 A;  4DUK A;  1XRY A;  4P4F A;  4NGQ A;  3ISZ A;  1CPX A;  1ELL P;  2ZEG A;  4A38 A;  2OOT A;  4F8Z A;  3VAT A;  1TKF A;  2AFW A;  5JH9 A;  5J1Q A;  5K8O A;  1ZG7 A;  2PJ6 A;  3IEH A;  2I3C A;  2PJ8 A;  2EWB A;  7CPA A;  1ARM A;  4DYO A;  2V8D A;  4NGP A;  1QQ9 A;  1CP7 A;  5F09 A;  3V7Z A;  4P4J A;  2V8H A;  2O4H A;  1F2P A;  2AFX A;  3B3S A;  5HXD A;  3D7G A;  3ISX A;  4ONW A;  1PCA A;  2QJ8 A;  1F2O A;  3B3C A;  2PVW A;  2PJA A;  3DGV A;  2IMO A;  2GLJ A;  4FAI A;  5HVG A;  5LYL A;  4C9A A;  2IQ6 A;  4IAV A;  5IB9 A;  5LYD A;  1NSA A;  4JYW A;  4P44 A;  4X8I A;  3B3V A;  3B3W A;  2DEA A;  2V8G A;  3HLP A;  3NA6 A;  4P45 A;  2EK9 A;  2ZOF A;  2ZOG A;  4G1P A;  4WWV A;  1XBU A;  3SI1 A;  3KR5 A;  1ZLH A;  3FMC A;  3WT4 A;  1HEE A;  3LWU A;  4OC3 A;  1HDU A;  3FVL A;  3FH4 A;  3IWW A;  2JBJ A;  1CPS A;  3GUX A;  3GLJ A;  1TKH A;  5THW A;  4P6Y A;  3PB4 X;  4C8P A;  4PQA A;  1LCP A;  4NGS A;  3JRU A;  2OR4 A;  2ZEL A;  5LYF A;  4C8U A;  1VHO A;  1CG2 A;  1Z5R A;  2PJB A;  3KHX A;  3SJE A;  3KGQ A;  2PJ3 A;  4ZI6 A;  3B7I A;  3PB7 X;  3VH9 A;  2EK8 A;  4PPZ A;  4OID A;  2Q4Z A;  4PXD A;  3VTA A;  2RB7 A;  2AFS A;  2O53 A;  4X2T A;  5LYI A;  2F7V A;  3H8G A;  2PIY A;  5JM6 A;  2C6C A;  3RBU A;  4OC5 A;  4KNG E;  4R7M A;  2QYV A;  5LRG A;  3L2N A;  3PEI A;  2Q43 A;  4EME A;  1R3N A;  2POK A;  4NGR A;  3BI0 A;  4FBE A;  3PFO A;  3FJU A;  4F9V A;  4ZYQ A;  2CF4 A;  4CDK A;  1WVM A;  3H8E A;  4P4B A;  4OC2 A;  5ELY A;  4JZ0 A;  1BLL E;  3B2Y A;  1LFW A;  2GRE A;  2JEW A;  3I6S A;  1Q7L A;  4TJV A;  1ZG8 A;  2ZEE A;  3I1U A;  4C9R A;  1ZLI A;  2VL1 A;  3D68 A;  3PB9 X;  5CPA A;  4UEZ A;  1Z8L A;  3FEC A;  4NGM A;  1YME A;  3S9N A;  3QNV A;  1TF8 A;  4C8A A;  2ZED A;  1CX8 A;  4NGT A;  4P10 A;  3CPX A;  2AFU A;  2XEI A;  1XFO A;  1BPN A;  1EE3 P;  3PBE A;  4CDJ A;  4ZY1 A;  1Y0Y A;  4OC0 A;  2RFH A;  2GLF A;  2HB6 A;  3T8W A;  4W9Y A;  1CP6 A;  1AYE A;  2CIJ A;  1HDQ A;  1BAV A;  2FVG A;  3N5F A;  3IJ3 A;  4A39 A;  3IFE A;  2C6P A;  2ANP A;  4IHM A;  4UEE A;  3SJX A;  5I4M A;  1TF9 A;  2V77 A;  4R6T A;  1JQG A;  4RUH A;  2AFO A;  2ZEN A;  1VHE A;  4C86 A;  3BHX A;  3LMS A;  4C9E A;  1LAN A;  1YSJ A;  3V38 A;  3MN8 A;  4MHZ A;  5K8M A;  4TWE A;  4Z65 A;  1UWY A;  2PJ4 A;  4GM5 A;  4C8F A;  1YW6 A;  2CTC A;  2HC9 A;  4PXB A;  3IC1 A;  2BOA A;  2NYQ A;  4UIB A;  1TKJ A;  2ZEH A;  5D29 A;  2G9D A;  1ARL A;  3CDX A;  1KWM A;  4MHN A;  4NJQ A;  4UEF A;  3SI0 A;  3PB8 X;  2NSM A;  2ZEM A;  1Y9Z A;  4UF4 A;  5HVH A;  1R43 A;  3CPA A;  3NFZ A;  4OME A;  4ZY0 A;  1Z2L A;  2BO9 A;  3PRT A;  5CBM A;  3H8F A;  3PFE A;  3BI1 A;  2Q51 A;  3D7F A;  4Q7A A;  3RZA A;  1M4L A;  1FT7 A;  3FED A;  2PJC A;  1IY7 A;  4A37 A;  1DE4 C;  1XF1 A;  3SI2 A;  4NFR A;  3WC5 A;  4PXC A;  4B6Z A;  3PBB A;  2PJ2 A;  4OIW A;  3KL9 A;  1H8L A;  3D66 A;  2XEJ A;  2PE3 A;  3KAS A;  2ZEP A;  3S9L A;  3TC8 A;  4FWU A;  2WYR A;  2ZEO A;  3FEE A;  1CBX A;  4AXV A;  3B35 A;  1LAP A;  4DJL A;  3NH4 A;  3MRU A;  1XJO A;  3SJF A;  4MXU A;  4ZX9 A;  4C9V A;  3CT9 A;  4MHP A;  2AFM A;  1ZG9 A;  4H2K A;  3D7D A;  5K8N A;  4TNU A;  2CTB A;  3KQZ A;  1VGY A;  1FNO A;  5K8P A;  5HVF A;  4K3N A;  2PCU A;  4YN3 A;  2JBK A;  1V6C A;  3D7H A;  3KQX A;  1XMB A;  4YU9 A;  2BCO A;  3K9T A;  3FX6 A;  2QVP A;  4MCQ A;  1RTQ A;  2C1C A;  1Y0R A;  4TJX A;  2ABZ A;  4NJR A;  3FF3 A;  6CPA A;  4CPA A;  1TXR A;  4WJB A;  4IK2 A;  4EWT A;  1QMU A;  3D67 A;  3I74 A;  4NGN A;  2AFZ A;  4MCP A;  3IO1 A;  4YWY A;  4OC4 A;  1BPM A;  2WZN A;  4MCS A;  3KI9 A;  3RAM A;  4R8F A;  3HUV A;  4LQG A;  2PJ7 A;  4MCR A;  1YLO A;  5D8N A;  1AMP A;  3IIB A;  4MRI A;  4FUU A;  2GU2 A;  3GB0 A;  4P4E A;  3NH5 A;  4X3R A;  4MHY A;  4C99 A;  4ZY2 A;  4OP4 A;  3KZW A;  4C85 A;  4EFD A;  2XEG A;  3VAR A;  4F9U A;  1LOK A;  5LRK A;  4R76 A;  4A94 A;  1LAM A;  3B3T A;  3NH8 A;  5LRJ A;  1ELM P;  3TX8 A;  2PJ1 A;  3KR4 A;  2F8H A;  1Y7E A;  1IGB A;  3ICU A;  2J9A A;  1VIX A;  4OC1 A;  3WC7 A;  4P4I A;  4O23 A;  2PJ5 A;  3K2K A;  2PIZ A;  3PB6 X;  1GYT A;  4MMO A;  4C84 A;  2ZEF A;  4C9U A;  1DTD A;  4PXE A;  1OBR A;  2PRQ A;  2XEF A;  3D4U A;  4KSI A;  1PYT B;  4OKO A;  3WC6 A;  2IJZ A;  4C8T A;  5DS0 A;  4C8C A;  4P4D A;  2V8V A; 
#chains in the Genus database with same CATH topology
 4KVO E;  1Z9E A;  2PVV A;  3C8O A;  3WAB A;  3S9M A;  2B58 A;  2KCW A;  3EZB A;  2PJ0 A;  3SJG A;  4UIA A;  3KHZ A;  2PJ9 A;  3FRM A;  3BXM A;  2OU2 A;  1RXT A;  2C27 A;  1WJT A;  3G8W A;  4B14 A;  1N71 A;  1PU9 A;  3DLJ A;  4R3L A;  5C88 A;  4UCP A;  2C6G A;  2YGW A;  2YNE A;  4BD9 A;  1PUA A;  2FIA A;  1Z8W A;  3S6G A;  4M6I A;  4BTF A;  3EIF A;  1F57 A;  3T9Y A;  5JGF A;  4K30 A;  4UCM A;  3W6X A;  4ZX8 A;  3R1K A;  3JTK A;  4UA3 A;  1YW4 A;  2DXQ A;  4DUK A;  1XRY A;  2JDD A;  1R61 A;  4P4F A;  4NGQ A;  3ISZ A;  4BMH A;  5H84 A;  4QBJ A;  1CPX A;  4H89 A;  3MGD A;  4M6G A;  2B4B A;  4C2Z A;  1ELL P;  2ZEG A;  4A38 A;  3EZE A;  2OOT A;  4F8Z A;  3VAT A;  1TKF A;  2WSA A;  1QSO A;  2AFW A;  5JH9 A;  5J1Q A;  4CGN A;  2P6E A;  3PFV A;  4YGO A;  5K8O A;  5BY0 A;  1ZG7 A;  2PJ6 A;  3IEH A;  4Q38 A;  2I3C A;  2CY2 A;  2PJ8 A;  3IU1 A;  2EWB A;  3VWE A;  1S7N A;  7CPA A;  1ARM A;  4DYO A;  2DIK A;  4RN7 A;  3K4I A;  4UWI A;  4A31 A;  3F0A A;  2XPL A;  1Z8T A;  3TOB A;  2V8D A;  2Q44 A;  4NGP A;  1QQ9 A;  3PZJ A;  2CNM A;  3TO9 A;  1CP7 A;  5F13 A;  5F09 A;  3V7Z A;  4P4J A;  2V8H A;  1CJW A;  2O4H A;  1CM0 A;  5G1Z A;  1VBH A;  1F2P A;  2AFX A;  3B3S A;  2B4J C;  3BUX B;  1BOB A;  3D7G A;  3ISX A;  3QB8 A;  4ONW A;  1PCA A;  2QJ8 A;  1F2O A;  1YVK A;  3B3C A;  2PVW A;  1YGH A;  3EFA A;  4FD5 A;  4ORF A;  4UFV A;  2PJA A;  3EO4 A;  1U6M A;  3DGV A;  2H5M A;  3RYO A;  2IMO A;  2GLJ A;  4FAI A;  2Q04 A;  5HVG A;  5LYL A;  2YJT A;  2JDC A;  4C9A A;  2IQ6 A;  3GYA A;  4IAV A;  1YR0 A;  4FD7 A;  5HMN A;  5IB9 A;  3ZZI A;  5LYD A;  1NSA A;  4JYW A;  4P44 A;  1FBV A;  5JPH A;  5AXI A;  4X8I A;  3TO7 A;  4LX9 A;  2XPO A;  3B3V A;  3B3W A;  2DEA A;  2V8G A;  3HLP A;  4GPL B;  5F48 A;  2J8N A;  5AGE A;  3EC4 A;  1ZO0 A;  3NA6 A;  3VRN A;  1ZYM A;  4GS4 A;  4P45 A;  2EK9 A;  2FM4 A;  4INJ A;  1LRZ A;  1P4N A;  1S7F A;  2ZOF A;  3DDD A;  1ZL0 A;  5HKZ A;  2ZOG A;  1NSL A;  5HKY A;  4G1P A;  1IYL A;  4WWV A;  1XBU A;  3SI1 A;  3KR5 A;  1ZLH A;  4C7I A;  3F8K A;  3FMC A;  1J4J A;  2E28 A;  4EYS A;  1IIC A;  2Z3M A;  3WT4 A;  1HEE A;  1XIX A;  3LWU A;  3RO0 A;  5J8F A;  4OC3 A;  1HDU A;  3FVL A;  4RI1 A;  3FH4 A;  4KUB A;  3IWW A;  2JBJ A;  2FSR A;  3W91 A;  2G0B A;  5C82 A;  4CYQ A;  1CPS A;  3GUX A;  4CRY B;  3GLJ A;  1TKH A;  3QAY A;  1IU8 A;  5THW A;  4A4B A;  5F5X A;  2ZW6 A;  4P6Y A;  4E0A A;  3PB4 X;  4XPL A;  2VXK A;  1XOV A;  4HKF A;  4C8P A;  2Q7S A;  4PQA A;  1LCP A;  1XF8 A;  1IYK A;  4NGS A;  3JRU A;  3S6K A;  3OWC A;  2OR4 A;  3KKW A;  4JXR A;  2ZEL A;  2QEC A;  2EUI A;  3DSB A;  4KLV A;  2PQ8 A;  5LYF A;  1VI4 A;  3TLA A;  2B4D A;  4QVT A;  4NXY A;  3R9G A;  3V8I A;  1VHO A;  4B12 A;  1CG2 A;  1Z5R A;  2PJB A;  3KHX A;  1OZP A;  2BUE A;  1X12 A;  3SJE A;  1Q2Y A;  3KGQ A;  2PJ3 A;  5G21 A;  2FL4 A;  2GIV A;  1XMT A;  3T90 A;  4IIY A;  4ZI6 A;  4C8U A;  2Q4Y A;  4JXQ A;  2BSW A;  3B7I A;  3PB7 X;  3VH9 A;  1KUX A;  2EK8 A;  4PPZ A;  4OID A;  2Q4Z A;  5AG5 A;  2CNS A;  2Y0M A;  2EZC A;  1I1D A;  4PXD A;  3VTA A;  2RB7 A;  4EVY A;  5H86 A;  2AFS A;  2O53 A;  4X2T A;  5LYI A;  4GXH A;  3IWE A;  2RC4 A;  2F7V A;  3H8G A;  2PIY A;  5JM6 A;  2C6C A;  3RBU A;  5J8C A;  2Q0Y A;  4CGP A;  4E2A A;  4OC5 A;  1K4J A;  1QSM A;  4KNG E;  4MY3 A;  4R7M A;  2Z3K A;  1CS0 B;  1S7L A;  4L89 A;  2IL4 A;  4F6A A;  2EZB A;  4A4C A;  2QYV A;  2Z3O A;  5LRG A;  3L2N A;  2I00 A;  3SXN A;  3PEI A;  2P6F A;  3GKR A;  4FD6 A;  4UFW A;  4YRH A;  2Q43 A;  2J8R A;  5DWN A;  4EME A;  1R3N A;  2POK A;  4NGR A;  3BI0 A;  2B4D B;  2YJV A;  4JLY A;  1ON0 A;  4A95 A;  3R96 A;  1I21 A;  3FB3 A;  4KOU A;  4CAV A;  4FBE A;  3PFO A;  3FJU A;  3G3S A;  3HPH E;  2CNT A;  4B10 A;  2CF4 A;  4F9V A;  4ZYQ A;  3TFY A;  4CDK A;  4KOR A;  1WVM A;  3H8E A;  4B5O A;  4P4B A;  4MFP A;  4AG9 A;  4OC2 A;  5ELY A;  2YNC A;  4JZ0 A;  4U9Z A;  1BLL E;  3B2Y A;  3TLC A;  1R57 A;  1LFW A;  2GRE A;  2JEW A;  3I6S A;  2YNC C;  2VI7 A;  1Q7L A;  4TJV A;  1ZG8 A;  2ZEE A;  1TIQ A;  1XE4 A;  4KVM E;  3T05 A;  4FD4 A;  4AVB A;  3I1U A;  2YND A;  4ZBG A;  2JLM A;  1M6V B;  3OB1 B;  4C9R A;  4E5S A;  5IB0 A;  1ZLI A;  2VL1 A;  3D68 A;  2Z3P A;  5IV0 A;  3PB9 X;  2EO8 A;  5CPA A;  3O8Z A;  5G20 A;  1S7K A;  4L8A A;  1YQE A;  3PGP A;  4UEZ A;  3OAK A;  4BPW B;  1Z8L A;  2I79 A;  3FEC A;  2Z10 A;  4NGM A;  2ZW7 A;  4RS2 A;  4MY0 A;  2PSW A;  1YME A;  2VZY A;  4MFK A;  3S9N A;  3QNV A;  1TF8 A;  2ZPA A;  5IR2 A;  4C8A A;  2ZED A;  2R98 A;  2BL1 A;  4KOT A;  1CX8 A;  4JVO A;  3TLY A;  4NGT A;  1IB1 E;  4P10 A;  3CPX A;  2AFU A;  4R3K A;  1Y9K A;  2FCK A;  2PCN A;  2XEI A;  1XFO A;  1BPN A;  1EE3 P;  1KUV A;  2A4N A;  4HPS A;  4H6Z A;  1NBW A;  1AUG A;  1IOF A;  1M1D A;  4MFL A;  1GHE A;  3PBE A;  4UWJ A;  3DNS A;  4ZY1 A;  2VKZ G;  2AUN A;  3NE7 A;  4ZGY B;  2GP4 A;  4CDJ A;  1KBL A;  1KUY A;  3R9E A;  1Y0Y A;  4OC0 A;  3BUW B;  1YRE A;  2RFH A;  3KRV A;  2GLF A;  3TCV A;  1I12 A;  2HB6 A;  3T8W A;  3OB2 B;  4AVA A;  4W9Y A;  4BPU B;  4E8O A;  4UFX A;  2CBL A;  1GGO A;  2R7H A;  1CP6 A;  3TYX A;  3WR7 A;  3DR6 A;  1AYE A;  1BXR B;  2CIJ A;  1HDQ A;  1BAV A;  2FVG A;  3N5F A;  3IJ3 A;  4A39 A;  1QSR A;  2HRO A;  3DR8 A;  3IFE A;  2C6P A;  1P0H A;  3TTH A;  2Q4V A;  4I49 A;  4B5P A;  5HXD A;  4KOS A;  4KOX A;  2ANP A;  4IHM A;  2Z3N A;  4UEE A;  3TLG A;  3SJX A;  5I4M A;  1DIK A;  1L0C A;  1TF9 A;  2V77 A;  4MFJ A;  2FT0 A;  4R6T A;  4BBH A;  1J3L A;  1JQG A;  4RUH A;  4H1H A;  2F5I A;  4CGL A;  2AFO A;  4UBR A;  2PR8 A;  3TLB A;  3PT1 A;  4PSW A;  2ZEN A;  1VHE A;  4RR2 B;  4OAD A;  4Y49 B;  2WUU A;  4CAE A;  2Z0Z A;  3F5B A;  4C86 A;  1KZF A;  1MJA A;  1Q2D A;  3BHX A;  4E94 A;  2D4O A;  3JVN A;  3LMS A;  4PV6 A;  3CXQ A;  4B11 A;  4C9E A;  1LAN A;  1YSJ A;  3V38 A;  5AG7 A;  4XPD B;  3MN8 A;  4MHZ A;  4OAE A;  4TWE A;  4Z65 A;  5K8M A;  1JDE A;  4X5K A;  4NF1 A;  4COB A;  1UWY A;  2PJ4 A;  4R87 A;  1VHS A;  2UV8 G;  3VGO A;  1Z9U A;  4GM5 A;  4C8F A;  1YW6 A;  1S5K A;  2CTC A;  4COG A;  1YVH A;  2HC9 A;  4PXB A;  2DPS A;  4LQ6 A;  2NMT A;  1Y7R A;  1YX0 A;  1A9X B;  3ZNI A;  3IC1 A;  3OP0 A;  2Z3L A;  2ARH A;  2BOA A;  2NYQ A;  4MFZ A;  5A27 A;  4UIB A;  4M8D A;  1TKJ A;  4A30 A;  2ZEH A;  2FXF A;  5D29 A;  4R9M A;  3U88 C;  3SHP A;  3HPG G;  2G9D A;  1ARL A;  2R8V A;  3T5M A;  5K99 A;  4B5P B;  5KTA A;  3NFQ A;  3VRR A;  5EBV A;  3CDX A;  1KWM A;  4MHN A;  4NJQ A;  4UEF A;  3SI0 A;  4DNC A;  3TLG B;  3PB8 X;  5BWA B;  2NSM A;  2ZEM A;  1Y9Z A;  4UF4 A;  2GFQ A;  2REF A;  5HVH A;  1R43 A;  3CPA A;  3VRO A;  4XNH B;  2N3A B;  5J3X A;  3NFZ A;  4OME A;  1IOI A;  2R1I A;  2Y1M A;  4ZY0 A;  5JYB A;  1Z2L A;  2BO9 A;  3EXN A;  3LAC A;  3PRT A;  5CNP A;  4XPK A;  3ZJ0 A;  5CBM A;  3H8F A;  2C5Q A;  2EZA A;  4QUS A;  3G23 A;  3PFE A;  1CE8 B;  1XEB A;  3BI1 A;  3D8P A;  1C3O B;  5DWM A;  2Q51 A;  4F0Y A;  3IU2 A;  3BJ7 A;  3D7F A;  2WPW A;  4Q7A A;  3RZA A;  1M4L A;  1FT7 A;  3FED A;  2PJC A;  1IY7 A;  3BLN A;  5EMI A;  4KUA A;  4A37 A;  1DE4 C;  4LUA A;  3SI2 A;  3S6H A;  5IX3 A;  4NFR A;  1XF1 A;  3WC5 A;  4PXC A;  4CO9 A;  4B6Z A;  4KS9 A;  3U1B A;  2WPX A;  4A33 A;  4C7H A;  3PBB A;  4KLW A;  2PJ2 A;  4F0X A;  4B13 A;  4OIW A;  3CZX A;  1B6B A;  3KL9 A;  1EO0 A;  4BIN A;  1H8L A;  4J3G A;  2EVN A;  2OLS A;  3BUO B;  3D66 A;  4CYN A;  4HNX B;  4C68 A;  1YVO A;  2CXA A;  2XEJ A;  1S60 A;  5AG6 A;  4AG7 A;  2D4P A;  2PE3 A;  4OLL A;  3KAS A;  2ZEP A;  5KTC A;  3S9L A;  4M85 A;  1RO5 A;  3TC8 A;  1VBG A;  1NMT A;  4IF5 A;  1JWQ A;  2DPT A;  2WYR A;  4FWU A;  2OB0 A;  1FY7 A;  4KOW A;  2ZEO A;  3FEE A;  2X7B A;  3A9L A;  1CBX A;  3F9K C;  4AXV A;  5JVL A;  3B35 A;  1KC7 A;  1C30 B;  4Q36 A;  1IID A;  1LAP A;  1QSN A;  2P0W A;  3PP9 A;  2BEI A;  4DJL A;  3NH4 A;  3BUN B;  3LOD A;  3EZA A;  3MRU A;  1XJO A;  3FYN A;  3SJF A;  4MXU A;  5F47 A;  3P2H A;  4ZX9 A;  2OZU A;  4JJX A;  2VEZ A;  4J0N A;  3CT9 A;  1T36 B;  4C9V A;  3TE4 A;  3FNC A;  4MHP A;  4CYO A;  3TLZ A;  2AFM A;  1ZG9 A;  4H2K A;  3D7D A;  3TO6 A;  5K8N A;  3LD2 A;  3BJ8 A;  4TNU A;  1A2Z A;  4ONU A;  2CTB A;  2OZG A;  3CXP A;  1VGY A;  3KQZ A;  4M3S A;  4YFJ A;  1NXJ A;  1FNO A;  3BUM B;  5K8P A;  5HVF A;  2QML A;  4K3N A;  2FS5 A;  2PCU A;  4UCN A;  4YN3 A;  2JBK A;  2G3A A;  1V6C A;  3D7H A;  3KQX A;  1XMB A;  4CZ1 A;  4Y49 C;  4YU9 A;  2EBJ A;  2BCO A;  3K9T A;  3P2F A;  5F1Y A;  3FX6 A;  2QVP A;  4MCQ A;  3E0K A;  1RTQ A;  2PC1 A;  3CXS A;  5FVJ A;  4C2X A;  2PR1 A;  2R82 A;  2B5G A;  2C1C A;  5F46 A;  4XPD C;  2D0O A;  2ODF A;  3FXT A;  4IUS A;  2X0S A;  1Z8X A;  3GIU A;  3TOA A;  1Y0R A;  3UY5 A;  2AUM A;  4TJX A;  2ABZ A;  3H4Q A;  4KZT A;  4NJR A;  4CAW A;  3FF3 A;  2B3V A;  6CPA A;  2Q7B A;  1MJB A;  2P6G A;  1Z4E A;  4NCZ A;  1WWZ A;  4CYP A;  4BPX B;  4CPA A;  1TXR A;  4MBU A;  4WJB A;  4CRZ B;  1BO4 A;  2ZW4 A;  4KVX A;  5E96 A;  4M6H A;  3TLE A;  4IK2 A;  3TT2 A;  4EWT A;  1QMU A;  2Z11 A;  4NSQ A;  4MFQ A;  3D67 A;  2FIW A;  3I74 A;  3K9U A;  4U9Y A;  4NGN A;  2AFZ A;  1KEE B;  3H5Z A;  4MCP A;  2OH1 A;  1SQH A;  1MJ9 A;  4NEX A;  4XNH C;  3IO1 A;  2XPP A;  4OC4 A;  1Q2C A;  3FBU A;  4QB9 A;  1BPM A;  4KOV A;  4YWY A;  2WZN A;  3R95 A;  3W6S A;  4MCS A;  3HMJ G;  3KI9 A;  3QAH A;  3RAM A;  4AB7 A;  5G22 A;  3T07 A;  4R8F A;  1NE9 A;  5F49 A;  3HUV A;  4LQG A;  2PJ7 A;  4MCR A;  1YLO A;  5D8N A;  1AMP A;  3IIB A;  4JD6 A;  4MRI A;  4FUU A;  2J8M A;  2GU2 A;  2B5G B;  4P4E A;  3GB0 A;  3N7Z A;  4X3R A;  3NH5 A;  4MHY A;  4CGO A;  4C99 A;  4ZY2 A;  5F9M A;  3PLF B;  1B47 A;  4MHD A;  1Y9W A;  4KSA A;  4OP4 A;  3S6F A;  3VRQ A;  4A32 A;  8CPA A;  2OZH A;  3KZW A;  5I0C A;  2HWG A;  5GCN A;  4C85 A;  3VRP A;  4CS0 B;  2PRB A;  2HI6 A;  3D2P A;  3GJZ A;  2JEV A;  4HNY B;  4EFD A;  1M4D A;  1X10 A;  2XEG A;  3VAR A;  4KSF A;  3JUW A;  4II9 A;  4F9U A;  1LOK A;  5LRK A;  1Q5X A;  5A28 A;  4R76 A;  2XPN A;  1S3Z A;  4A94 A;  1LAM A;  3B3T A;  3FIX A;  3NH8 A;  5LRJ A;  4A2Z A;  3R9F A;  1ELM P;  3TX8 A;  4MI4 A;  2PJ1 A;  2REE A;  3KR4 A;  4U5Y A;  4PK2 A;  1VKC A;  2F8H A;  4JWP A;  1WK4 A;  5AG4 A;  1ZRS A;  3B8G A;  2DLA A;  4MI1 A;  3VWD A;  5KTD A;  2PDO A;  1Y7E A;  2AJ6 A;  1IGB A;  4HNW B;  3NE8 A;  1M4I A;  2FE7 A;  3ICU A;  2J9A A;  4R57 A;  1M44 A;  1VIX A;  4OC1 A;  3RNZ A;  3NOJ A;  1UFH A;  5FD8 A;  1B87 A;  3IWG A;  4IIX A;  3WC7 A;  5EC4 A;  4H6U A;  2O28 A;  4P4I A;  3EY5 A;  1EZA A;  3SR3 A;  2VBQ A;  4O23 A;  1V0C A;  2PJ5 A;  3K2K A;  2HUZ A;  2B3U A;  2PIZ A;  3D2M A;  3PB6 X;  5HKW A;  4CAF A;  2HQY A;  3I3G A;  1GYT A;  1YK3 A;  4AVC A;  4PK3 A;  5ISV A;  4MMO A;  2MP0 A;  2ZW5 A;  5JQ4 A;  2ZEF A;  4C84 A;  2K5T A;  2Y1N A;  3GY9 A;  4C9U A;  3I9S A;  1EZB A;  1DTD A;  2GAN A;  2DF5 A;  2B0A A;  4PXE A;  1OBR A;  4MJ8 A;  4QC6 A;  2PRQ A;  1M4G A;  2XEF A;  2G3T A;  1Z4R A;  3D4U A;  4KSI A;  3IGR A;  1PYT B;  2VZZ A;  3SXO A;  4C2Y A;  2VQY A;  1MK4 A;  4OKO A;  1JDB C;  2HV2 A;  2QIR A;  5HH1 A;  4KOY A;  3WC6 A;  3T0T A;  2IJZ A;  3D3S A;  4C8T A;  1QST A;  5DS0 A;  1YLE A;  2ATR A;  4CGM A;  2ZXV A;  4C8C A;  4MJX A;  3C26 A;  2AE6 A;  4PSX A;  4P4D A;  2GE3 A;  2V8V A;  2D0P A;  4CAX A; 
#chains in the Genus database with same CATH homology
 2PVV A;  3WAB A;  3S9M A;  2PJ0 A;  3SJG A;  4UIA A;  3KHZ A;  2PJ9 A;  3BXM A;  3DLJ A;  2C6G A;  4BD9 A;  8CPA A;  3EIF A;  1F57 A;  5JGF A;  4ZX8 A;  1YW4 A;  4DUK A;  1XRY A;  4P4F A;  4NGQ A;  3ISZ A;  1CPX A;  1ELL P;  2ZEG A;  4A38 A;  2OOT A;  4F8Z A;  3VAT A;  1TKF A;  2AFW A;  5JH9 A;  5J1Q A;  5K8O A;  1ZG7 A;  2PJ6 A;  3IEH A;  2I3C A;  2PJ8 A;  2EWB A;  7CPA A;  1ARM A;  4DYO A;  2V8D A;  4NGP A;  1QQ9 A;  1CP7 A;  5F09 A;  3V7Z A;  4P4J A;  2V8H A;  2O4H A;  1F2P A;  2AFX A;  3B3S A;  5HXD A;  2GP4 A;  3D7G A;  3ISX A;  4ONW A;  1PCA A;  2QJ8 A;  1F2O A;  3B3C A;  2PVW A;  2PJA A;  3DGV A;  2IMO A;  2GLJ A;  4FAI A;  5HVG A;  5LYL A;  4C9A A;  2IQ6 A;  4IAV A;  5IB9 A;  5LYD A;  1NSA A;  4JYW A;  4P44 A;  4X8I A;  3B3V A;  3B3W A;  2DEA A;  2V8G A;  3HLP A;  3NA6 A;  4P45 A;  2EK9 A;  2ZOF A;  2ZOG A;  4G1P A;  4WWV A;  1XBU A;  3SI1 A;  3KR5 A;  1ZLH A;  3FMC A;  3WT4 A;  1HEE A;  3LWU A;  4OC3 A;  1HDU A;  3FVL A;  3FH4 A;  3IWW A;  2JBJ A;  1CPS A;  3GUX A;  3GLJ A;  1TKH A;  5THW A;  4P6Y A;  3PB4 X;  4C8P A;  4PQA A;  1LCP A;  4NGS A;  3JRU A;  2OR4 A;  2ZEL A;  5LYF A;  4C8U A;  1VHO A;  1CG2 A;  1Z5R A;  2PJB A;  3KHX A;  3SJE A;  3KGQ A;  2PJ3 A;  4ZI6 A;  3B7I A;  3PB7 X;  3VH9 A;  2EK8 A;  4PPZ A;  4OID A;  2Q4Z A;  4PXD A;  3VTA A;  2RB7 A;  2AFS A;  2O53 A;  4X2T A;  5LYI A;  2F7V A;  3H8G A;  2PIY A;  5JM6 A;  2C6C A;  3RBU A;  4OC5 A;  4KNG E;  4R7M A;  2QYV A;  5LRG A;  3L2N A;  3PEI A;  2Q43 A;  4EME A;  1R3N A;  2POK A;  4NGR A;  3BI0 A;  4FBE A;  3PFO A;  3FJU A;  4F9V A;  4ZYQ A;  2CF4 A;  4CDK A;  1WVM A;  3H8E A;  4P4B A;  4OC2 A;  5ELY A;  4JZ0 A;  1BLL E;  3B2Y A;  1LFW A;  2GRE A;  2JEW A;  3I6S A;  1Q7L A;  4TJV A;  1ZG8 A;  2ZEE A;  3I1U A;  4C9R A;  1ZLI A;  2VL1 A;  3D68 A;  3PB9 X;  5CPA A;  4UEZ A;  1Z8L A;  3FEC A;  4NGM A;  1YME A;  5IR2 A;  3S9N A;  3QNV A;  1TF8 A;  4C8A A;  2ZED A;  1CX8 A;  4NGT A;  4P10 A;  3CPX A;  2AFU A;  2XEI A;  1XFO A;  1BPN A;  1EE3 P;  3PBE A;  4CDJ A;  4ZY1 A;  1Y0Y A;  4OC0 A;  2RFH A;  2GLF A;  2HB6 A;  3T8W A;  4W9Y A;  1CP6 A;  1AYE A;  2CIJ A;  1HDQ A;  1BAV A;  2FVG A;  3N5F A;  3IJ3 A;  4A39 A;  3IFE A;  2C6P A;  2ANP A;  4IHM A;  4UEE A;  3SJX A;  5I4M A;  1TF9 A;  2V77 A;  4R6T A;  1JQG A;  4RUH A;  2AFO A;  2ZEN A;  1VHE A;  4C86 A;  3BHX A;  3LMS A;  4C9E A;  1LAN A;  1YSJ A;  3V38 A;  3MN8 A;  4MHZ A;  5K8M A;  4TWE A;  4Z65 A;  1UWY A;  2PJ4 A;  4GM5 A;  4C8F A;  1YW6 A;  2CTC A;  2HC9 A;  4PXB A;  3IC1 A;  2BOA A;  2NYQ A;  4UIB A;  1TKJ A;  2ZEH A;  5D29 A;  2G9D A;  1ARL A;  3CDX A;  1KWM A;  4MHN A;  4NJQ A;  4UEF A;  3SI0 A;  3PB8 X;  2NSM A;  2ZEM A;  1Y9Z A;  4UF4 A;  5HVH A;  1R43 A;  3CPA A;  3NFZ A;  4OME A;  4ZY0 A;  1Z2L A;  2BO9 A;  3PRT A;  5CBM A;  3H8F A;  2C5Q A;  3PFE A;  3BI1 A;  2Q51 A;  3D7F A;  4Q7A A;  3RZA A;  1M4L A;  1FT7 A;  3FED A;  2PJC A;  1IY7 A;  4A37 A;  1DE4 C;  1XF1 A;  3SI2 A;  4NFR A;  3WC5 A;  4PXC A;  4B6Z A;  3PBB A;  2PJ2 A;  4OIW A;  3KL9 A;  1H8L A;  3D66 A;  2XEJ A;  2PE3 A;  3KAS A;  2ZEP A;  3S9L A;  3TC8 A;  4FWU A;  2WYR A;  2ZEO A;  3FEE A;  1CBX A;  4AXV A;  3B35 A;  1LAP A;  4DJL A;  3NH4 A;  3MRU A;  1XJO A;  3SJF A;  4MXU A;  4ZX9 A;  4C9V A;  3CT9 A;  4MHP A;  2AFM A;  1ZG9 A;  4H2K A;  3D7D A;  5K8N A;  4TNU A;  2CTB A;  3KQZ A;  1VGY A;  1FNO A;  5K8P A;  5HVF A;  4K3N A;  2PCU A;  4YN3 A;  2JBK A;  1V6C A;  3D7H A;  3KQX A;  1XMB A;  4YU9 A;  2BCO A;  3K9T A;  3FX6 A;  2QVP A;  4MCQ A;  1RTQ A;  2C1C A;  1Y0R A;  4TJX A;  2ABZ A;  4NJR A;  3FF3 A;  6CPA A;  4CPA A;  1TXR A;  4WJB A;  4IK2 A;  4EWT A;  1QMU A;  3D67 A;  3I74 A;  4NGN A;  2AFZ A;  4MCP A;  3IO1 A;  4YWY A;  4OC4 A;  1BPM A;  2WZN A;  4MCS A;  3KI9 A;  3RAM A;  4R8F A;  3HUV A;  4LQG A;  2PJ7 A;  4MCR A;  1YLO A;  5D8N A;  1AMP A;  3IIB A;  4MRI A;  4FUU A;  2GU2 A;  3GB0 A;  4P4E A;  3NH5 A;  4X3R A;  4MHY A;  4C99 A;  4ZY2 A;  4OP4 A;  3KZW A;  4C85 A;  4EFD A;  2XEG A;  3VAR A;  4F9U A;  1LOK A;  5LRK A;  4R76 A;  4A94 A;  1LAM A;  3B3T A;  3NH8 A;  5LRJ A;  1ELM P;  3TX8 A;  2PJ1 A;  3KR4 A;  2F8H A;  1Y7E A;  1IGB A;  3ICU A;  2J9A A;  1VIX A;  4OC1 A;  3WC7 A;  4P4I A;  4O23 A;  2PJ5 A;  3K2K A;  2PIZ A;  3PB6 X;  1GYT A;  4MMO A;  4C84 A;  2ZEF A;  4C9U A;  1DTD A;  4PXE A;  1OBR A;  2PRQ A;  2XEF A;  3D4U A;  4KSI A;  1PYT B;  4OKO A;  3WC6 A;  2IJZ A;  4C8T A;  5DS0 A;  4C8C A;  4P4D A;  2V8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...