2PVWA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with 2-(phosphonomethyl)pentanedioic acid (2-pmpa)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
695
structure length
690
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 268
structure length 690
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2pvwA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pvwA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2pvwA02
1HDUA 2AFMA 4NGQA 4JYWA 4ZYQA 2ZOFA 4C84A 4ONWA 1CX8A 3T8WA 5D8NA 3I74A 4OIDA 1CPSA 5CPAA 1FT7A 2C6CA 2PJ0A 1VGYA 4RUHA 5JGFA 4ZX8A 4DYOA 2ZOGA 4PXEA 1CP7A 3QNVA 2HB6A 5DS0A 5LYIA 4P10A 2QYVA 1Y0RA 3GUXA 3KR5A 3PBBA 4OC2A 3WT4A 2C6PA 3RAMA 2C1CA 3KI9A 4C9VA 3B7IA 3MN8A 1CPXA 2AFZA 3K2KA 2PIYA 3KZWA 4MCPA 4OC1A 5J1QA 4C9RA 3RBUA 1TKHA 1BAVA 4OMEA 2AFXA 5HVHA 2ABZA 2CF4A 2ZEMA 4MHZA 4YU9A 3IJ3A 4MHPA 3PB6X 2IMOA 4ZI6A 3IO1A 4FBEA 4PXDA 2AFOA 2PRQA 1Q7LA 6CPAA 3SJFA 1JQGA 4P6YA 3CPXA 4NGTA 1R3NA 4AXVA 3RZAA 2WYRA 3CPAA 5LRGA 1XBUA 4TJVA 3NH5A 3D7GA 4OC0A 4UEEA 1BLLE 2PJCA 4P44A 2ZEEA 2OOTA 2F7VA 4YN3A 4FWUA 3NH8A 2ZEDA 4NJRA 5IB9A 4MHNA 3CDXA 4H2KA 4F8ZA 2PVWA 3ISZA 4R76A 4C8PA 5HXDA 1TKFA 2PJ1A 4C9UA 4CDJA 3JRUA 4C86A 3SJXA 4JZ0A 1BPNA 1YMEA 3FMCA 4IK2A 2AFSA 4NGNA 4C8FA 1LAPA 5LRJA 3TX8A 1ZG7A 2PJ2A 5CBMA 2Q43A 4EWTA 4KNGE 3WC5A 4NGPA 1VHEA 4P4EA 4C8AA 3LWUA 5HVGA 2GLJA 1YW4A 3FVLA 3D7DA 4UF4A 1YW6A 1R43A 2I3CA 5LRKA 4TNUA 5F09A 2PJ6A 2PJBA 1TXRA 1BPMA 2EK8A 4MCRA 1XJOA 4GM5A 3PFOA 2ZEFA 3N5FA 3B3WA 4A38A 1LCPA 1PCAA 3ICUA 2RFHA 4EFDA 2VL1A 3BI1A 1H8LA 4NGSA 1KWMA 3HUVA 4P4DA 4WJBA 3H8GA 2OR4A 5HVFA 5JM6A 2PJ9A 2IQ6A 2J9AA 2O4HA 5K8OA 5K8MA 8CPAA 2O53A 3VATA 2G9DA 1F57A 2V8VA 4OP4A 1DTDA 3VARA 2IJZA 3H8FA 3MRUA 4X2TA 3D7HA 1Y0YA 3B3TA 4MXUA 3D4UA 2ZENA 1LAMA 2FVGA 1WVMA 4NFRA 1Z2LA 2PJ5A 2NYQA 4F9UA 4P45A 2ZEHA 3B3SA 3PBEA 1M4LA 4A39A 3WC6A 1OBRA 2ZEOA 3SI2A 3DGVA 4P4BA 2ZEGA 4R7MA 4ZY2A 3KQZA 4DUKA 3PRTA 2GU2A 4C9AA 1F2OA 2Q4ZA 4F9VA 1TF9A 3V7ZA 1HDQA 2ZEPA 4CPAA 3BI0A 3FH4A 1LANA 4NGMA 2HC9A 2CIJA 4UIBA 2V8GA 3SJGA 2NSMA 1XRYA 1NSAA 2ZELA 3PB7X 1TKJA 2XEJA 4ZX9A 3IIBA 2JBJA 2PJAA 4UEFA 4C85A 3BXMA 4B6ZA 3FECA 4C9EA 4BD9A 5I4MA 1YSJA 4P4IA 2V77A 4ZY1A 3BHXA 2V8DA 4G1PA 1Z5RA 3GB0A 4MHYA 1IGBA 4CDKA 3IWWA 5THWA 3CT9A 4Z65A 2CTCA 4R8FA 3TC8A 4MMOA 2JBKA 3FX6A 2XEGA 3PB4X 4X8IA 3I6SA 1F2PA 3VTAA 1IY7A 3WC7A 1TF8A 7CPAA 4PXBA 3B3VA 3DLJA 4MCQA 3D66A 3D68A 4C8UA 4UEZA 3KR4A 2PJ4A 3H8EA 4OIWA 1CBXA 1CP6A 3IC1A 3FEDA 5JH9A 2EK9A 4KSIA 3D7FA 2PJ7A 3SJEA 1XFOA 3KHZA 4TWEA 1UWYA 2POKA 3WABA 4FAIA 3PB8X 4NJQA 1ZG9A 4MRIA 1ZG8A 3B2YA 1LOKA 5LYLA 3FEEA 1ZLIA 1AYEA 2WZNA 2PCUA 4C8CA 4A37A 3GLJA 3I1UA 1LFWA 4P4FA 5D29A 3FJUA 3PEIA 4OC4A 3L2NA 2AFWA 2BOAA 1HEEA 1Z8LA 3KGQA 4K3NA 2QJ8A 2PIZA 1ELMP 1XF1A 4W9YA 3K9TA 1VHOA 3SI1A 2RB7A 2JEWA 5K8NA 2PVVA 3NFZA 3V38A 1ZLHA 4A94A 4DJLA 3LMSA 4O23A 2Q51A 4IAVA 4FUUA 3KHXA 3IFEA 3B3CA 2PJ3A 3PB9X 2C6GA 3D67A 3PFEA 2EWBA 1XMBA 1VIXA 5LYFA 2V8HA 4EMEA 4PQAA 3FF3A 4PXCA 4YWYA 3S9MA 2XEIA 4IHMA 3KQXA 3IEHA 5LYDA 4MCSA 4R6TA 1Y7EA 2BCOA 1PYTB 1EE3P 3NA6A 2CTBA 2DEAA 4LQGA 3SI0A 4TJXA 3EIFA 2AFUA 3VH9A 4OC3A 3HLPA 1ARLA 2PJ8A 3ISXA 1AMPA 4PPZA 3NH4A 4UIAA 2ANPA 1DE4C 2F8HA 3KASA 2PE3A 2QVPA 3KL9A 4OC5A 4NGRA 5ELYA 1RTQA 4C99A 2GREA 1ARMA 1CG2A 4WWVA 4ZY0A 3S9LA 4C8TA 1ELLP 1GYTA 3S9NA 1QQ9A 1FNOA 4X3RA 4OKOA 3B35A 2GLFA 4Q7AA 1Y9ZA 1QMUA 1V6CA 1YLOA 2XEFA 5K8PA 4P4JA 2BO9A
chains in the Genus database with same CATH superfamily
1HDUA 2AFMA 2Q7SA 4RN7A 4NGQA 1QSTA 4JYWA 3VWDA 2ZOFA 3VRPA 4ZYQA 4C84A 1RO5A 5HH1A 5KTAA 3LD2A 2Q0YA 1KUVA 1S7FA 4ONWA 1CX8A 3TT2A 3ZZIA 2DXQA 2AE6A 5EBVA 3T8WA 1PUAA 4COGA 3T5MA 2DPTA 3FXTA 5K99A 1KZFA 5J8FA 5D8NA 3R96A 3I74A 4KS9A 5AG5A 5HVHA 4HNWB 2OZHA 3CZXA 4OIDA 3SXOA 4BPXB 1CPSA 1K4JA 5CPAA 3VROA 5HKYA 1FT7A 4KOWA 4C2XA 2FCKA 3BUXB 2B0AA 3BUWB 2C6CA 2C27A 1VGYA 2PJ0A 4IF5A 2Z3NA 4XPDC 4RUHA 4ZX8A 5JGFA 1C3OB 4M8DA 4DYOA 2ZOGA 4PXEA 3FB3A 2XPOA 1CP7A 3QNVA 3O8ZA 2Y0MA 4M6GA 2HB6A 5DS0A 5LYIA 4KLWA 2QYVA 4P10A 1SQHA 1Y0RA 3GUXA 4FD5A 2OLSA 3KR5A 4FD4A 3PBBA 3B8GA 2R98A 1LRZA 4OC2A 3MGDA 3WT4A 4BINA 1Z4EA 2Z11A 1IIDA 2C6PA 1JWQA 1RXTA 3RAMA 5AG7A 3TFYA 3S6GA 2C1CA 3KI9A 4C9VA 3B7IA 3MN8A 1CPXA 2AFZA 4YRHA 1EZAA 1S7NA 4MI1A 1GHEA 2GANA 4R87A 4QVTA 3K2KA 1MJ9A 1XF8A 3TLEA 1CM0A 5F47A 3PT1A 4F0YA 2QMLA 3VGOA 5AG6A 2PIYA 2YGWA 2ZPAA 2FE7A 3KZWA 4MCPA 4OC1A 3NOJA 1B87A 5J1QA 1B6BA 4C9RA 4COBA 4MFQA 1KBLA 3RBUA 1TKHA 4MY3A 4H6UA 1QSOA 3OWCA 3RO0A 1BAVA 1KUXA 2FS5A 4OMEA 1M1DA 2AFXA 2B58A 4M3SA 4U9ZA 2ABZA 4U5YA 4UFWA 1Q2DA 2CF4A 2ZEMA 2DPSA 3GKRA 4MHZA 4YU9A 4MFKA 3T9YA 4C68A 4CGPA 3IJ3A 2XPLA 1IYKA 2RC4A 4F6AA 3FIXA 4Q36A 3U88C 4MHPA 3PB6X 1Y7RA 5JPHA 2IMOA 2FXFA 1A2ZA 4KVOE 3TLYA 4KOXA 4CAEA 2GIVA 4ZI6A 1CE8B 1NBWA 3IO1A 4FBEA 1M4GA 2Z3LA 4PXDA 2AFOA 2PRQA 1NE9A 1P0HA 4CAFA 4CZ1A 4AVAA 1Q7LA 3K4IA 3EFAA 6CPAA 3SJFA 1JQGA 4QB9A 4P6YA 4MFJA 1TIQA 2EO8A 1NXJA 3CPXA 3S6KA 4NGTA 3W6XA 4MBUA 3TTHA 2B3UA 4MHDA 5C88A 5DWMA 1R3NA 4CRZB 4AXVA 4UCPA 1S3ZA 2PQ8A 3RZAA 2WYRA 4B12A 3CPAA 5LRGA 5BWAB 4CGMA 5JYBA 1XBUA 4IIYA 4NSQA 2D4OA 4TJVA 4C7IA 1A9XB 3NH5A 4C2ZA 3D7GA 4OC0A 4UEEA 1BLLE 3IU1A 2PJCA 2VQYA 4Q38A 1J3LA 4P44A 2ZEEA 4H1HA 5A28A 2OOTA 2G3AA 2ZW4A 2F7VA 2ZW7A 4E0AA 1X12A 1Z4RA 5F9MA 1Z8TA 2FIAA 4J3GA 2D4PA 4JVOA 4YN3A 4FWUA 3BUOB 1AUGA 3NH8A 4R3LA 2ZEDA 2EBJA 4RR2B 4NJRA 1CJWA 5IB9A 4MHNA 3CDXA 1EO0A 4H2KA 2EUIA 3R1KA 4F8ZA 5J8CA 2VBQA 2PVWA 3ISZA 2VEZA 4MFLA 4M85A 4R76A 4CYOA 4C8PA 2JEVA 1TKFA 1YVHA 3N7ZA 5HXDA 1X10A 2PJ1A 3ZJ0A 4C9UA 4CDJA 3JRUA 4C86A 2R1IA 1XEBA 4A30A 2AUMA 2Z3KA 3SJXA 4JZ0A 1BPNA 1YMEA 3FMCA 3I3GA 4IK2A 4KVME 1IOIA 5A27A 4MFZA 4XPKA 2AFSA 4NGNA 1EZBA 2EVNA 1UFHA 4KLVA 4YGOA 3EO4A 4C8FA 2Z3MA 1LAPA 5LRJA 3TX8A 4E8OA 5J3XA 4UBRA 1ZG7A 4UCMA 1QSRA 2PJ2A 5CBMA 4E5SA 2Q43A 4L89A 4EWTA 4KNGE 5F46A 3WC5A 2B3VA 3A9LA 4NGPA 1FBVA 2VI7A 1IYLA 2PC1A 4R57A 1S60A 4A32A 2CNMA 4BPWB 1VHEA 2OB0A 2OZUA 4C2YA 2D0OA 1S7LA 4P4EA 4ONUA 4C8AA 1ZYMA 3LWUA 4KOYA 4LUAA 4KSFA 5HVGA 1P4NA 2GLJA 1YW4A 3FVLA 3D7DA 3QAHA 2B4BA 4UFVA 4UF4A 3D2MA 4JJXA 2JDCA 1YW6A 1R43A 2A4NA 2I3CA 5LRKA 1NSLA 1M44A 2CXAA 3PP9A 4M6IA 4TNUA 4UWJA 3TLCA 4BPUB 5F09A 4CS0B 2PJ6A 2PJBA 1L0CA 4H6ZA 1TXRA 1BPMA 2EK8A 4HNYB 5I0CA 5F1YA 2Z0ZA 4MCRA 4CAWA 1VKCA 2PSWA 2UV8G 1XJOA 4UCNA 3W6SA 3K9UA 4AG7A 2J8RA 3PFOA 4GM5A 1ZL0A 3T07A 2ZEFA 3N5FA 1Q5XA 3B3WA 4A38A 1LCPA 3KKWA 1PCAA 3ICUA 2XPPA 2RFHA 4EFDA 3R9FA 1JDEA 2JLMA 4PSXA 4Y49B 2VL1A 3GIUA 4EVYA 3BI1A 1H8LA 2Q44A 2YNCC 3JUWA 1QSNA 4HPSA 4F0XA 4NGSA 1KWMA 3HUVA 4P4DA 4KSAA 4WJBA 3H8GA 2OR4A 1J4JA 3IWEA 2YNDA 2PDOA 4LQ6A 5HVFA 3TYXA 1Z9UA 5JM6A 2PJ9A 2IQ6A 2J9AA 2O4HA 4OADA 4XPLA 3U1BA 4A4CA 2AJ6A 2EZBA 5K8OA 4KVXA 3S6HA 5K8MA 8CPAA 2O53A 5EMIA 3VATA 2G9DA 1F57A 4QBJA 4E2AA 2V8VA 4OP4A 5GCNA 4B5PB 1DTDA 3VARA 2G0BA 2YJVA 2IJZA 5IV0A 3H8FA 3MRUA 4KZTA 1M4IA 4X2TA 5ISVA 3D7HA 1Y0YA 3B3TA 3JTKA 4ZGYB 5EC4A 2WPXA 4MXUA 3D4UA 3DSBA 4KUAA 2FM4A 2ZENA 1LAMA 2Z10A 1V0CA 3QAYA 2FL4A 4B14A 2GE3A 2FVGA 1R61A 1WVMA 2OU2A 4NFRA 4PK2A 1Z2LA 5C82A 3TLGB 2PJ5A 2NYQA 3TOBA 4P45A 2ZEHA 3B3SA 4RI1A 3PBEA 3FBUA 4F9UA 1M4LA 4AG9A 4A39A 3G23A 5IR2A 3WC6A 1OBRA 4OLLA 2ZEOA 3SI2A 3DGVA 4P4BA 3OB2B 1YX0A 2ZEGA 3EXNA 3KQZA 4R7MA 5H84A 4ZY2A 4B5OA 4DUKA 2HI6A 3T05A 4CAVA 2ATRA 4AB7A 2FT0A 4IIXA 3LACA 3PRTA 2HROA 2GU2A 4C9AA 1F2OA 2VXKA 4UWIA 2Q4ZA 4F9VA 1TF9A 3V7ZA 1HDQA 5IX3A 2ZEPA 4L8AA 4CPAA 3BI0A 3FH4A 4B5PA 2DLAA 1LANA 4NGMA 2REFA 2B4JC 1M6VB 2HC9A 2CIJA 4UIBA 2BL1A 5FVJA 2Y1NA 2V8GA 3SJGA 2JDDA 5BY0A 1NMTA 2NSMA 1IOFA 1XRYA 4X5KA 1NSAA 4II9A 4JXQA 3F9KC 2X0SA 3EC4A 3DNSA 5JQ4A 2ZELA 2Z3PA 2VZYA 1XE4A 1TKJA 2CY2A 2XEJA 3PB7X 5F48A 4ZX9A 3IIBA 4CAXA 3EZBA 4NEXA 4JD6A 2JBJA 1VHSA 2PJAA 4EYSA 3TLGA 4CRYB 2YNEA 4UEFA 4C85A 5KTDA 3BXMA 4B6ZA 1YR0A 3IU2A 3FECA 2PRBA 5G20A 4GS4A 2QECA 4XNHC 1XMTA 1WJTA 4FD6A 4H89A 4BD9A 4C9EA 5I4MA 1YSJA 3PLFB 4P4IA 2V77A 2MP0A 3PFVA 2EZAA 4Y49C 5JVLA 3FNCA 4ZY1A 2P0WA 1Z9EA 3BHXA 2V8DA 3JVNA 1YREA 4G1PA 4R3KA 4CO9A 2KCWA 1VI4A 1Z5RA 3TLZA 3BJ7A 3E0KA 3UY5A 3GB0A 4NF1A 2CBLA 4MHYA 4KOSA 1IGBA 4JLYA 5H86A 3IWWA 5THWA 3CT9A 3RYOA 2Y1MA 2CTCA 4KOVA 4R8FA 3TC8A 4MMOA 4Z65A 2JBKA 4AVBA 5IB0A 3FX6A 3D8PA 1DIKA 2XEGA 4KOTA 4OAEA 1GGOA 4NCZA 3IGRA 3PB4X 3EZAA 4RS2A 5AG4A 3P2FA 4X8IA 4CGOA 2N3AB 4CYQA 2WPWA 2YNCA 4PK3A 1Q2YA 3I6SA 2PR1A 4B13A 1ZRSA 1F2PA 4M6HA 3VTAA 4NXYA 1IY7A 1U6MA 3WC7A 5E96A 1TF8A 2R7HA 1KEEB 5AGEA 5DWNA 3TO7A 4PXBA 7CPAA 3B3VA 3DLJA 4MCQA 1JDBC 1PU9A 3SR3A 4UFXA 4C7HA 4K30A 2Z3OA 3BJ8A 1BOBA 4KUBA 3D66A 3D68A 4A31A 4CYNA 4YFJA 3T0TA 4C8UA 4I49A 3KR4A 4UEZA 2PJ4A 3GYAA 4KOUA 3H8EA 3DDDA 2P6FA 2HQYA 4OIWA 3V8IA 1CBXA 1CP6A 3VWEA 3IC1A 3FEDA 5JH9A 2EK9A 4B11A 4CYPA 1QSMA 4KSIA 3D7FA 2VZZA 2PJ7A 4GPLB 3SJEA 2EZCA 1XFOA 4A4BA 3KHZA 1UWYA 1S5KA 2POKA 4QUSA 4TWEA 4IUSA 3WABA 3PB8X 1MJAA 3EY5A 4FAIA 3FYNA 4NJQA 3IWGA 1ZG9A 3DR8A 2ZW5A 1ZG8A 3D2PA 4MRIA 1MJBA 2OH1A 3C26A 1YLEA 2HUZA 2WUUA 3TOAA 3B2YA 3TLAA 1CS0B 4XNHB 1IB1E 1LOKA 3OP0A 3HPGG 3R95A 5LYLA 3GJZA 3FEEA 4BMHA 1ZLIA 1AYEA 2WZNA 3NE8A 2PCUA 1XOVA 4C8CA 2FSRA 2XPNA 3VRRA 4HNXB 4A37A 4CGNA 4JWPA 3CXSA 3ZNIA 3GLJA 3I1UA 1LFWA 4P4FA 1YGHA 2IL4A 5D29A 2K5TA 3FJUA 3PEIA 3R9GA 4OC4A 1YK3A 3WR7A 1FY7A 5HMNA 3OB1B 4HKFA 2GP4A 5F5XA 3L2NA 3DR6A 4E94A 2AFWA 2BSWA 2QIRA 2BOAA 1HEEA 2J8NA 1Z8LA 3KRVA 1IU8A 3KGQA 3G8WA 3TCVA 2B5GB 1Y9WA 5FD8A 4B10A 4FD7A 2QJ8A 4K3NA 2PIZA 1ELMP 1XF1A 1BO4A 2G3TA 4W9YA 3K9TA 1VHOA 3SI1A 3SXNA 2RB7A 5HKZA 4JXRA 4INJA 2ODFA 2JEWA 5K8NA 4MY0A 2O28A 2PVVA 2WSAA 2ZW6A 3NFZA 3V38A 1OZPA 2REEA 1ZLHA 3D3SA 2I79A 4MFPA 4A94A 3LMSA 1Q2CA 4DJLA 3CXQA 4J0NA 4O23A 5G22A 2AUNA 2Q51A 2OZGA 4IAVA 4FUUA 4AVCA 1C30B 3W91A 3KHXA 3IFEA 2DIKA 3B3CA 3H4QA 2I00A 2PJ3A 2PR8A 2CNTA 3PB9X 2C6GA 3SHPA 5KTCA 3TLBA 1M4DA 3D67A 3NE7A 2F5IA 1I12A 3PFEA 3BLNA 2EWBA 3NFQA 3G3SA 1XMBA 4DNCA 2YJTA 5F13A 1VIXA 3T90A 2H5MA 4A2ZA 3QB8A 4U9YA 5LYFA 5AXIA 1KUYA 4BBHA 4MJ8A 2C5QA 2V8HA 1WWZA 2ARHA 3CXPA 1R57A 3PZJA 1WK4A 3R9EA 4EMEA 3H5ZA 3HPHE 4PQAA 3FF3A 4PXCA 4A33A 2B5GA 2R8VA 4ZBGA 4YWYA 3S9MA 2XEIA 3TO6A 4IHMA 2Q04A 3KQXA 3C8OA 1ON0A 2HV2A 2B4DB 3IEHA 4CGLA 4XPDB 5LYDA 1S7KA 4MCSA 3F0AA 4LX9A 3S6FA 1VBHA 2D0PA 4R6TA 1Y7EA 2BCOA 3BUNB 3RNZA 1PYTB 1EE3P 3NA6A 2CTBA 3I9SA 4GXHA 4ORFA 4MJXA 4QC6A 1B47A 2DEAA 3EZEA 2ZXVA 2HWGA 4LQGA 3TE4A 2Q7BA 3SI0A 4TJXA 4PV6A 3EIFA 2P6GA 5F49A 2AFUA 3VRNA 2FIWA 2GFQA 5HKWA 3VH9A 4A95A 4OC3A 3GY9A 3HLPA 1YQEA 3BUMB 1ARLA 2PJ8A 3ISXA 3VRQA 1AMPA 1I1DA 1YVOA 4PPZA 1N71A 4UA3A 5CNPA 3NH4A 4UIAA 3PGPA 4MI4A 3TO9A 2ANPA 1DE4C 4KORA 2F8HA 3KASA 2BEIA 2PE3A 3F5BA 2QVPA 2NMTA 2PCNA 2J8MA 5G1ZA 2DF5A 2B4DA 4R9MA 1BXRB 3KL9A 2CNSA 4OC5A 4NGRA 5ELYA 2BUEA 1RTQA 3OAKA 2Q4YA 5G21A 1T36B 4BTFA 2P6EA 2R82A 4C99A 2VKZG 1Z8XA 2GREA 1MK4A 2X7BA 3HMJG 1ARMA 1CG2A 4WWVA 4ZY0A 1VBGA 1YVKA 1ZO0A 3FRMA 3S9LA 4C8TA 1ELLP 1GYTA 1Y9KA 2Q4VA 3S9NA 1QQ9A 1FNOA 4CDKA 4X3RA 1IICA 4OKOA 3B35A 2GLFA 1KC7A 4Q7AA 1Y9ZA 1Z8WA 2E28A 3P2HA 1XIXA 1QMUA 3F8KA 1V6CA 1YLOA 1I21A 2XEFA 3LODA 5K8PA 4P4JA 2BO9A 4PSWA
chains in the Genus database with same CATH topology
1HDUA 2AFMA 4NGQA 4JYWA 4ZYQA 2ZOFA 4C84A 4ONWA 1CX8A 3T8WA 5D8NA 3I74A 4OIDA 1CPSA 5CPAA 1FT7A 2C6CA 2PJ0A 1VGYA 4RUHA 5JGFA 4ZX8A 4DYOA 2ZOGA 4PXEA 1CP7A 3QNVA 2HB6A 5DS0A 5LYIA 4P10A 2QYVA 1Y0RA 3GUXA 3KR5A 3PBBA 4OC2A 3WT4A 2C6PA 3RAMA 2C1CA 3KI9A 4C9VA 3B7IA 3MN8A 1CPXA 2AFZA 3K2KA 2PIYA 3KZWA 4MCPA 4OC1A 5J1QA 4C9RA 3RBUA 1TKHA 1BAVA 4OMEA 2AFXA 5HVHA 2ABZA 2CF4A 2ZEMA 4MHZA 4YU9A 3IJ3A 4MHPA 3PB6X 2IMOA 4ZI6A 3IO1A 4FBEA 4PXDA 2AFOA 2PRQA 1Q7LA 6CPAA 3SJFA 1JQGA 4P6YA 3CPXA 4NGTA 1R3NA 4AXVA 3RZAA 2WYRA 3CPAA 5LRGA 1XBUA 4TJVA 3NH5A 3D7GA 4OC0A 4UEEA 1BLLE 2PJCA 4P44A 2ZEEA 2OOTA 2F7VA 4YN3A 4FWUA 3NH8A 2ZEDA 4NJRA 5IB9A 4MHNA 3CDXA 4H2KA 4F8ZA 2PVWA 3ISZA 4R76A 4C8PA 5HXDA 1TKFA 2PJ1A 4C9UA 4CDJA 3JRUA 4C86A 3SJXA 4JZ0A 1BPNA 1YMEA 3FMCA 4IK2A 2AFSA 4NGNA 4C8FA 1LAPA 5LRJA 3TX8A 1ZG7A 2PJ2A 5CBMA 2Q43A 4EWTA 4KNGE 3WC5A 4NGPA 1VHEA 4P4EA 4C8AA 3LWUA 5HVGA 2GLJA 1YW4A 3FVLA 3D7DA 4UF4A 1YW6A 1R43A 2I3CA 5LRKA 4TNUA 5F09A 2PJ6A 2PJBA 1TXRA 1BPMA 2EK8A 4MCRA 1XJOA 4GM5A 3PFOA 2ZEFA 3N5FA 3B3WA 4A38A 1LCPA 1PCAA 3ICUA 2RFHA 4EFDA 2VL1A 3BI1A 1H8LA 4NGSA 1KWMA 3HUVA 4P4DA 4WJBA 3H8GA 2OR4A 5HVFA 5JM6A 2PJ9A 2IQ6A 2J9AA 2O4HA 5K8OA 5K8MA 8CPAA 2O53A 3VATA 2G9DA 1F57A 2V8VA 4OP4A 1DTDA 3VARA 2IJZA 3H8FA 3MRUA 4X2TA 3D7HA 1Y0YA 3B3TA 4MXUA 3D4UA 2ZENA 1LAMA 2FVGA 1WVMA 4NFRA 1Z2LA 2PJ5A 2NYQA 4F9UA 4P45A 2ZEHA 3B3SA 3PBEA 1M4LA 5IR2A 4A39A 3WC6A 1OBRA 2ZEOA 3SI2A 3DGVA 4P4BA 2ZEGA 4R7MA 4ZY2A 3KQZA 4DUKA 3PRTA 2GU2A 4C9AA 1F2OA 2Q4ZA 4F9VA 1TF9A 3V7ZA 1HDQA 2ZEPA 4CPAA 3BI0A 3FH4A 1LANA 4NGMA 2HC9A 2CIJA 4UIBA 2V8GA 3SJGA 2NSMA 1XRYA 1NSAA 2ZELA 3PB7X 1TKJA 2XEJA 4ZX9A 3IIBA 2JBJA 2PJAA 4UEFA 4C85A 3BXMA 4B6ZA 3FECA 4C9EA 4BD9A 5I4MA 1YSJA 4P4IA 2V77A 4ZY1A 3BHXA 2V8DA 4G1PA 1Z5RA 3GB0A 4MHYA 1IGBA 4CDKA 3IWWA 5THWA 3CT9A 4Z65A 2CTCA 4R8FA 3TC8A 4MMOA 2JBKA 3FX6A 2XEGA 3PB4X 4X8IA 3I6SA 1F2PA 3VTAA 1IY7A 3WC7A 1TF8A 7CPAA 4PXBA 3B3VA 3DLJA 4MCQA 3D66A 3D68A 4C8UA 4UEZA 3KR4A 2PJ4A 3H8EA 4OIWA 1CBXA 1CP6A 3IC1A 3FEDA 5JH9A 2EK9A 4KSIA 3D7FA 2PJ7A 3SJEA 1XFOA 3KHZA 4TWEA 1UWYA 2POKA 3WABA 4FAIA 3PB8X 4NJQA 1ZG9A 4MRIA 1ZG8A 3B2YA 1LOKA 5LYLA 3FEEA 1ZLIA 1AYEA 2WZNA 2PCUA 4C8CA 4A37A 3GLJA 3I1UA 1LFWA 4P4FA 5D29A 3FJUA 3PEIA 4OC4A 2GP4A 3L2NA 2AFWA 2BOAA 1HEEA 1Z8LA 3KGQA 4K3NA 2QJ8A 2PIZA 1ELMP 1XF1A 4W9YA 3K9TA 1VHOA 3SI1A 2RB7A 2JEWA 5K8NA 2PVVA 3NFZA 3V38A 1ZLHA 4A94A 4DJLA 3LMSA 4O23A 2Q51A 4IAVA 4FUUA 3KHXA 3IFEA 3B3CA 2PJ3A 3PB9X 2C6GA 3D67A 3PFEA 2EWBA 1XMBA 1VIXA 5LYFA 2C5QA 2V8HA 4EMEA 4PQAA 3FF3A 4PXCA 4YWYA 3S9MA 2XEIA 4IHMA 3KQXA 3IEHA 5LYDA 4MCSA 4R6TA 1Y7EA 2BCOA 1PYTB 1EE3P 3NA6A 2CTBA 2DEAA 4LQGA 3SI0A 4TJXA 3EIFA 2AFUA 3VH9A 4OC3A 3HLPA 1ARLA 2PJ8A 3ISXA 1AMPA 4PPZA 3NH4A 4UIAA 2ANPA 1DE4C 2F8HA 3KASA 2PE3A 2QVPA 3KL9A 4OC5A 4NGRA 5ELYA 1RTQA 4C99A 2GREA 1ARMA 1CG2A 4WWVA 4ZY0A 3S9LA 4C8TA 1ELLP 1GYTA 3S9NA 1QQ9A 1FNOA 4X3RA 4OKOA 3B35A 2GLFA 4Q7AA 1Y9ZA 1QMUA 1V6CA 1YLOA 2XEFA 5K8PA 4P4JA 2BO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDU A;  2AFM A;  4NGQ A;  4JYW A;  4ZYQ A;  2ZOF A;  4C84 A;  4ONW A;  1CX8 A;  3T8W A;  5D8N A;  3I74 A;  4OID A;  1CPS A;  5CPA A;  1FT7 A;  2C6C A;  2PJ0 A;  1VGY A;  4RUH A;  5JGF A;  4ZX8 A;  4DYO A;  2ZOG A;  4PXE A;  1CP7 A;  3QNV A;  2HB6 A;  5DS0 A;  5LYI A;  4P10 A;  2QYV A;  1Y0R A;  3GUX A;  3KR5 A;  3PBB A;  4OC2 A;  3WT4 A;  2C6P A;  3RAM A;  2C1C A;  3KI9 A;  4C9V A;  3B7I A;  3MN8 A;  1CPX A;  2AFZ A;  3K2K A;  2PIY A;  3KZW A;  4MCP A;  4OC1 A;  5J1Q A;  4C9R A;  3RBU A;  1TKH A;  1BAV A;  4OME A;  2AFX A;  5HVH A;  2ABZ A;  2CF4 A;  2ZEM A;  4MHZ A;  4YU9 A;  3IJ3 A;  4MHP A;  3PB6 X;  2IMO A;  4ZI6 A;  3IO1 A;  4FBE A;  4PXD A;  2AFO A;  2PRQ A;  1Q7L A;  6CPA A;  3SJF A;  1JQG A;  4P6Y A;  3CPX A;  4NGT A;  1R3N A;  4AXV A;  3RZA A;  2WYR A;  3CPA A;  5LRG A;  1XBU A;  4TJV A;  3NH5 A;  3D7G A;  4OC0 A;  4UEE A;  1BLL E;  2PJC A;  4P44 A;  2ZEE A;  2OOT A;  2F7V A;  4YN3 A;  4FWU A;  3NH8 A;  2ZED A;  4NJR A;  5IB9 A;  4MHN A;  3CDX A;  4H2K A;  4F8Z A;  2PVW A;  3ISZ A;  4R76 A;  4C8P A;  5HXD A;  1TKF A;  2PJ1 A;  4C9U A;  4CDJ A;  3JRU A;  4C86 A;  3SJX A;  4JZ0 A;  1BPN A;  1YME A;  3FMC A;  4IK2 A;  2AFS A;  4NGN A;  4C8F A;  1LAP A;  5LRJ A;  3TX8 A;  1ZG7 A;  2PJ2 A;  5CBM A;  2Q43 A;  4EWT A;  4KNG E;  3WC5 A;  4NGP A;  1VHE A;  4P4E A;  4C8A A;  3LWU A;  5HVG A;  2GLJ A;  1YW4 A;  3FVL A;  3D7D A;  4UF4 A;  1YW6 A;  1R43 A;  2I3C A;  5LRK A;  4TNU A;  5F09 A;  2PJ6 A;  2PJB A;  1TXR A;  1BPM A;  2EK8 A;  4MCR A;  1XJO A;  4GM5 A;  3PFO A;  2ZEF A;  3N5F A;  3B3W A;  4A38 A;  1LCP A;  1PCA A;  3ICU A;  2RFH A;  4EFD A;  2VL1 A;  3BI1 A;  1H8L A;  4NGS A;  1KWM A;  3HUV A;  4P4D A;  4WJB A;  3H8G A;  2OR4 A;  5HVF A;  5JM6 A;  2PJ9 A;  2IQ6 A;  2J9A A;  2O4H A;  5K8O A;  5K8M A;  8CPA A;  2O53 A;  3VAT A;  2G9D A;  1F57 A;  2V8V A;  4OP4 A;  1DTD A;  3VAR A;  2IJZ A;  3H8F A;  3MRU A;  4X2T A;  3D7H A;  1Y0Y A;  3B3T A;  4MXU A;  3D4U A;  2ZEN A;  1LAM A;  2FVG A;  1WVM A;  4NFR A;  1Z2L A;  2PJ5 A;  2NYQ A;  4F9U A;  4P45 A;  2ZEH A;  3B3S A;  3PBE A;  1M4L A;  4A39 A;  3WC6 A;  1OBR A;  2ZEO A;  3SI2 A;  3DGV A;  4P4B A;  2ZEG A;  4R7M A;  4ZY2 A;  3KQZ A;  4DUK A;  3PRT A;  2GU2 A;  4C9A A;  1F2O A;  2Q4Z A;  4F9V A;  1TF9 A;  3V7Z A;  1HDQ A;  2ZEP A;  4CPA A;  3BI0 A;  3FH4 A;  1LAN A;  4NGM A;  2HC9 A;  2CIJ A;  4UIB A;  2V8G A;  3SJG A;  2NSM A;  1XRY A;  1NSA A;  2ZEL A;  3PB7 X;  1TKJ A;  2XEJ A;  4ZX9 A;  3IIB A;  2JBJ A;  2PJA A;  4UEF A;  4C85 A;  3BXM A;  4B6Z A;  3FEC A;  4C9E A;  4BD9 A;  5I4M A;  1YSJ A;  4P4I A;  2V77 A;  4ZY1 A;  3BHX A;  2V8D A;  4G1P A;  1Z5R A;  3GB0 A;  4MHY A;  1IGB A;  4CDK A;  3IWW A;  5THW A;  3CT9 A;  4Z65 A;  2CTC A;  4R8F A;  3TC8 A;  4MMO A;  2JBK A;  3FX6 A;  2XEG A;  3PB4 X;  4X8I A;  3I6S A;  1F2P A;  3VTA A;  1IY7 A;  3WC7 A;  1TF8 A;  7CPA A;  4PXB A;  3B3V A;  3DLJ A;  4MCQ A;  3D66 A;  3D68 A;  4C8U A;  4UEZ A;  3KR4 A;  2PJ4 A;  3H8E A;  4OIW A;  1CBX A;  1CP6 A;  3IC1 A;  3FED A;  5JH9 A;  2EK9 A;  4KSI A;  3D7F A;  2PJ7 A;  3SJE A;  1XFO A;  3KHZ A;  4TWE A;  1UWY A;  2POK A;  3WAB A;  4FAI A;  3PB8 X;  4NJQ A;  1ZG9 A;  4MRI A;  1ZG8 A;  3B2Y A;  1LOK A;  5LYL A;  3FEE A;  1ZLI A;  1AYE A;  2WZN A;  2PCU A;  4C8C A;  4A37 A;  3GLJ A;  3I1U A;  1LFW A;  4P4F A;  5D29 A;  3FJU A;  3PEI A;  4OC4 A;  3L2N A;  2AFW A;  2BOA A;  1HEE A;  1Z8L A;  3KGQ A;  4K3N A;  2QJ8 A;  2PIZ A;  1ELM P;  1XF1 A;  4W9Y A;  3K9T A;  1VHO A;  3SI1 A;  2RB7 A;  2JEW A;  5K8N A;  2PVV A;  3NFZ A;  3V38 A;  1ZLH A;  4A94 A;  4DJL A;  3LMS A;  4O23 A;  2Q51 A;  4IAV A;  4FUU A;  3KHX A;  3IFE A;  3B3C A;  2PJ3 A;  3PB9 X;  2C6G A;  3D67 A;  3PFE A;  2EWB A;  1XMB A;  1VIX A;  5LYF A;  2V8H A;  4EME A;  4PQA A;  3FF3 A;  4PXC A;  4YWY A;  3S9M A;  2XEI A;  4IHM A;  3KQX A;  3IEH A;  5LYD A;  4MCS A;  4R6T A;  1Y7E A;  2BCO A;  1PYT B;  1EE3 P;  3NA6 A;  2CTB A;  2DEA A;  4LQG A;  3SI0 A;  4TJX A;  3EIF A;  2AFU A;  3VH9 A;  4OC3 A;  3HLP A;  1ARL A;  2PJ8 A;  3ISX A;  1AMP A;  4PPZ A;  3NH4 A;  4UIA A;  2ANP A;  1DE4 C;  2F8H A;  3KAS A;  2PE3 A;  2QVP A;  3KL9 A;  4OC5 A;  4NGR A;  5ELY A;  1RTQ A;  4C99 A;  2GRE A;  1ARM A;  1CG2 A;  4WWV A;  4ZY0 A;  3S9L A;  4C8T A;  1ELL P;  1GYT A;  3S9N A;  1QQ9 A;  1FNO A;  4X3R A;  4OKO A;  3B35 A;  2GLF A;  4Q7A A;  1Y9Z A;  1QMU A;  1V6C A;  1YLO A;  2XEF A;  5K8P A;  4P4J A;  2BO9 A; 
#chains in the Genus database with same CATH topology
 1HDU A;  2AFM A;  2Q7S A;  4RN7 A;  4NGQ A;  1QST A;  4JYW A;  3VWD A;  2ZOF A;  3VRP A;  4ZYQ A;  4C84 A;  1RO5 A;  5HH1 A;  5KTA A;  3LD2 A;  2Q0Y A;  1KUV A;  1S7F A;  4ONW A;  1CX8 A;  3TT2 A;  3ZZI A;  2DXQ A;  2AE6 A;  5EBV A;  3T8W A;  1PUA A;  4COG A;  3T5M A;  2DPT A;  3FXT A;  5K99 A;  1KZF A;  5J8F A;  5D8N A;  3R96 A;  3I74 A;  4KS9 A;  5AG5 A;  5HVH A;  4HNW B;  2OZH A;  3CZX A;  4OID A;  3SXO A;  4BPX B;  1CPS A;  1K4J A;  5CPA A;  3VRO A;  5HKY A;  1FT7 A;  4KOW A;  4C2X A;  2FCK A;  3BUX B;  2B0A A;  3BUW B;  2C6C A;  2C27 A;  1VGY A;  2PJ0 A;  4IF5 A;  2Z3N A;  4XPD C;  4RUH A;  4ZX8 A;  5JGF A;  1C3O B;  4M8D A;  4DYO A;  2ZOG A;  4PXE A;  3FB3 A;  2XPO A;  1CP7 A;  3QNV A;  3O8Z A;  2Y0M A;  4M6G A;  2HB6 A;  5DS0 A;  5LYI A;  4KLW A;  2QYV A;  4P10 A;  1SQH A;  1Y0R A;  3GUX A;  4FD5 A;  2OLS A;  3KR5 A;  4FD4 A;  3PBB A;  3B8G A;  2R98 A;  1LRZ A;  4OC2 A;  3MGD A;  3WT4 A;  4BIN A;  1Z4E A;  2Z11 A;  1IID A;  2C6P A;  1JWQ A;  1RXT A;  3RAM A;  5AG7 A;  3TFY A;  3S6G A;  2C1C A;  3KI9 A;  4C9V A;  3B7I A;  3MN8 A;  1CPX A;  2AFZ A;  4YRH A;  1EZA A;  1S7N A;  4MI1 A;  1GHE A;  2GAN A;  4R87 A;  4QVT A;  3K2K A;  1MJ9 A;  1XF8 A;  3TLE A;  1CM0 A;  5F47 A;  3PT1 A;  4F0Y A;  2QML A;  3VGO A;  5AG6 A;  2PIY A;  2YGW A;  2ZPA A;  2FE7 A;  3KZW A;  4MCP A;  4OC1 A;  3NOJ A;  1B87 A;  5J1Q A;  1B6B A;  4C9R A;  4COB A;  4MFQ A;  1KBL A;  3RBU A;  1TKH A;  4MY3 A;  4H6U A;  1QSO A;  3OWC A;  3RO0 A;  1BAV A;  1KUX A;  2FS5 A;  4OME A;  1M1D A;  2AFX A;  2B58 A;  4M3S A;  4U9Z A;  2ABZ A;  4U5Y A;  4UFW A;  1Q2D A;  2CF4 A;  2ZEM A;  2DPS A;  3GKR A;  4MHZ A;  4YU9 A;  4MFK A;  3T9Y A;  4C68 A;  4CGP A;  3IJ3 A;  2XPL A;  1IYK A;  2RC4 A;  4F6A A;  3FIX A;  4Q36 A;  3U88 C;  4MHP A;  3PB6 X;  1Y7R A;  5JPH A;  2IMO A;  2FXF A;  1A2Z A;  4KVO E;  3TLY A;  4KOX A;  4CAE A;  2GIV A;  4ZI6 A;  1CE8 B;  1NBW A;  3IO1 A;  4FBE A;  1M4G A;  2Z3L A;  4PXD A;  2AFO A;  2PRQ A;  1NE9 A;  1P0H A;  4CAF A;  4CZ1 A;  4AVA A;  1Q7L A;  3K4I A;  3EFA A;  6CPA A;  3SJF A;  1JQG A;  4QB9 A;  4P6Y A;  4MFJ A;  1TIQ A;  2EO8 A;  1NXJ A;  3CPX A;  3S6K A;  4NGT A;  3W6X A;  4MBU A;  3TTH A;  2B3U A;  4MHD A;  5C88 A;  5DWM A;  1R3N A;  4CRZ B;  4AXV A;  4UCP A;  1S3Z A;  2PQ8 A;  3RZA A;  2WYR A;  4B12 A;  3CPA A;  5LRG A;  5BWA B;  4CGM A;  5JYB A;  1XBU A;  4IIY A;  4NSQ A;  2D4O A;  4TJV A;  4C7I A;  1A9X B;  3NH5 A;  4C2Z A;  3D7G A;  4OC0 A;  4UEE A;  1BLL E;  3IU1 A;  2PJC A;  2VQY A;  4Q38 A;  1J3L A;  4P44 A;  2ZEE A;  4H1H A;  5A28 A;  2OOT A;  2G3A A;  2ZW4 A;  2F7V A;  2ZW7 A;  4E0A A;  1X12 A;  1Z4R A;  5F9M A;  1Z8T A;  2FIA A;  4J3G A;  2D4P A;  4JVO A;  4YN3 A;  4FWU A;  3BUO B;  1AUG A;  3NH8 A;  4R3L A;  2ZED A;  2EBJ A;  4RR2 B;  4NJR A;  1CJW A;  5IB9 A;  4MHN A;  3CDX A;  1EO0 A;  4H2K A;  2EUI A;  3R1K A;  4F8Z A;  5J8C A;  2VBQ A;  2PVW A;  3ISZ A;  2VEZ A;  4MFL A;  4M85 A;  4R76 A;  4CYO A;  4C8P A;  2JEV A;  1TKF A;  1YVH A;  3N7Z A;  5HXD A;  1X10 A;  2PJ1 A;  3ZJ0 A;  4C9U A;  4CDJ A;  3JRU A;  4C86 A;  2R1I A;  1XEB A;  4A30 A;  2AUM A;  2Z3K A;  3SJX A;  4JZ0 A;  1BPN A;  1YME A;  3FMC A;  3I3G A;  4IK2 A;  4KVM E;  1IOI A;  5A27 A;  4MFZ A;  4XPK A;  2AFS A;  4NGN A;  1EZB A;  2EVN A;  1UFH A;  4KLV A;  4YGO A;  3EO4 A;  4C8F A;  2Z3M A;  1LAP A;  5LRJ A;  3TX8 A;  4E8O A;  5J3X A;  4UBR A;  1ZG7 A;  4UCM A;  1QSR A;  2PJ2 A;  5CBM A;  4E5S A;  2Q43 A;  4L89 A;  4EWT A;  4KNG E;  5F46 A;  3WC5 A;  2B3V A;  3A9L A;  4NGP A;  1FBV A;  2VI7 A;  1IYL A;  2PC1 A;  4R57 A;  1S60 A;  4A32 A;  2CNM A;  4BPW B;  1VHE A;  2OB0 A;  2OZU A;  4C2Y A;  2D0O A;  1S7L A;  4P4E A;  4ONU A;  4C8A A;  1ZYM A;  3LWU A;  4KOY A;  4LUA A;  4KSF A;  5HVG A;  1P4N A;  2GLJ A;  1YW4 A;  3FVL A;  3D7D A;  3QAH A;  2B4B A;  4UFV A;  4UF4 A;  3D2M A;  4JJX A;  2JDC A;  1YW6 A;  1R43 A;  2A4N A;  2I3C A;  5LRK A;  1NSL A;  1M44 A;  2CXA A;  3PP9 A;  4M6I A;  4TNU A;  4UWJ A;  3TLC A;  4BPU B;  5F09 A;  4CS0 B;  2PJ6 A;  2PJB A;  1L0C A;  4H6Z A;  1TXR A;  1BPM A;  2EK8 A;  4HNY B;  5I0C A;  5F1Y A;  2Z0Z A;  4MCR A;  4CAW A;  1VKC A;  2PSW A;  2UV8 G;  1XJO A;  4UCN A;  3W6S A;  3K9U A;  4AG7 A;  2J8R A;  3PFO A;  4GM5 A;  1ZL0 A;  3T07 A;  2ZEF A;  3N5F A;  1Q5X A;  3B3W A;  4A38 A;  1LCP A;  3KKW A;  1PCA A;  3ICU A;  2XPP A;  2RFH A;  4EFD A;  3R9F A;  1JDE A;  2JLM A;  4PSX A;  4Y49 B;  2VL1 A;  3GIU A;  4EVY A;  3BI1 A;  1H8L A;  2Q44 A;  2YNC C;  3JUW A;  1QSN A;  4HPS A;  4F0X A;  4NGS A;  1KWM A;  3HUV A;  4P4D A;  4KSA A;  4WJB A;  3H8G A;  2OR4 A;  1J4J A;  3IWE A;  2YND A;  2PDO A;  4LQ6 A;  5HVF A;  3TYX A;  1Z9U A;  5JM6 A;  2PJ9 A;  2IQ6 A;  2J9A A;  2O4H A;  4OAD A;  4XPL A;  3U1B A;  4A4C A;  2AJ6 A;  2EZB A;  5K8O A;  4KVX A;  3S6H A;  5K8M A;  8CPA A;  2O53 A;  5EMI A;  3VAT A;  2G9D A;  1F57 A;  4QBJ A;  4E2A A;  2V8V A;  4OP4 A;  5GCN A;  4B5P B;  1DTD A;  3VAR A;  2G0B A;  2YJV A;  2IJZ A;  5IV0 A;  3H8F A;  3MRU A;  4KZT A;  1M4I A;  4X2T A;  5ISV A;  3D7H A;  1Y0Y A;  3B3T A;  3JTK A;  4ZGY B;  5EC4 A;  2WPX A;  4MXU A;  3D4U A;  3DSB A;  4KUA A;  2FM4 A;  2ZEN A;  1LAM A;  2Z10 A;  1V0C A;  3QAY A;  2FL4 A;  4B14 A;  2GE3 A;  2FVG A;  1R61 A;  1WVM A;  2OU2 A;  4NFR A;  4PK2 A;  1Z2L A;  5C82 A;  3TLG B;  2PJ5 A;  2NYQ A;  3TOB A;  4P45 A;  2ZEH A;  3B3S A;  4RI1 A;  3PBE A;  3FBU A;  4F9U A;  1M4L A;  4AG9 A;  4A39 A;  3G23 A;  5IR2 A;  3WC6 A;  1OBR A;  4OLL A;  2ZEO A;  3SI2 A;  3DGV A;  4P4B A;  3OB2 B;  1YX0 A;  2ZEG A;  3EXN A;  3KQZ A;  4R7M A;  5H84 A;  4ZY2 A;  4B5O A;  4DUK A;  2HI6 A;  3T05 A;  4CAV A;  2ATR A;  4AB7 A;  2FT0 A;  4IIX A;  3LAC A;  3PRT A;  2HRO A;  2GU2 A;  4C9A A;  1F2O A;  2VXK A;  4UWI A;  2Q4Z A;  4F9V A;  1TF9 A;  3V7Z A;  1HDQ A;  5IX3 A;  2ZEP A;  4L8A A;  4CPA A;  3BI0 A;  3FH4 A;  4B5P A;  2DLA A;  1LAN A;  4NGM A;  2REF A;  2B4J C;  1M6V B;  2HC9 A;  2CIJ A;  4UIB A;  2BL1 A;  5FVJ A;  2Y1N A;  2V8G A;  3SJG A;  2JDD A;  5BY0 A;  1NMT A;  2NSM A;  1IOF A;  1XRY A;  4X5K A;  1NSA A;  4II9 A;  4JXQ A;  3F9K C;  2X0S A;  3EC4 A;  3DNS A;  5JQ4 A;  2ZEL A;  2Z3P A;  2VZY A;  1XE4 A;  1TKJ A;  2CY2 A;  2XEJ A;  3PB7 X;  5F48 A;  4ZX9 A;  3IIB A;  4CAX A;  3EZB A;  4NEX A;  4JD6 A;  2JBJ A;  1VHS A;  2PJA A;  4EYS A;  3TLG A;  4CRY B;  2YNE A;  4UEF A;  4C85 A;  5KTD A;  3BXM A;  4B6Z A;  1YR0 A;  3IU2 A;  3FEC A;  2PRB A;  5G20 A;  4GS4 A;  2QEC A;  4XNH C;  1XMT A;  1WJT A;  4FD6 A;  4H89 A;  4BD9 A;  4C9E A;  5I4M A;  1YSJ A;  3PLF B;  4P4I A;  2V77 A;  2MP0 A;  3PFV A;  2EZA A;  4Y49 C;  5JVL A;  3FNC A;  4ZY1 A;  2P0W A;  1Z9E A;  3BHX A;  2V8D A;  3JVN A;  1YRE A;  4G1P A;  4R3K A;  4CO9 A;  2KCW A;  1VI4 A;  1Z5R A;  3TLZ A;  3BJ7 A;  3E0K A;  3UY5 A;  3GB0 A;  4NF1 A;  2CBL A;  4MHY A;  4KOS A;  1IGB A;  4JLY A;  5H86 A;  3IWW A;  5THW A;  3CT9 A;  3RYO A;  2Y1M A;  2CTC A;  4KOV A;  4R8F A;  3TC8 A;  4MMO A;  4Z65 A;  2JBK A;  4AVB A;  5IB0 A;  3FX6 A;  3D8P A;  1DIK A;  2XEG A;  4KOT A;  4OAE A;  1GGO A;  4NCZ A;  3IGR A;  3PB4 X;  3EZA A;  4RS2 A;  5AG4 A;  3P2F A;  4X8I A;  4CGO A;  2N3A B;  4CYQ A;  2WPW A;  2YNC A;  4PK3 A;  1Q2Y A;  3I6S A;  2PR1 A;  4B13 A;  1ZRS A;  1F2P A;  4M6H A;  3VTA A;  4NXY A;  1IY7 A;  1U6M A;  3WC7 A;  5E96 A;  1TF8 A;  2R7H A;  1KEE B;  5AGE A;  5DWN A;  3TO7 A;  4PXB A;  7CPA A;  3B3V A;  3DLJ A;  4MCQ A;  1JDB C;  1PU9 A;  3SR3 A;  4UFX A;  4C7H A;  4K30 A;  2Z3O A;  3BJ8 A;  1BOB A;  4KUB A;  3D66 A;  3D68 A;  4A31 A;  4CYN A;  4YFJ A;  3T0T A;  4C8U A;  4I49 A;  3KR4 A;  4UEZ A;  2PJ4 A;  3GYA A;  4KOU A;  3H8E A;  3DDD A;  2P6F A;  2HQY A;  4OIW A;  3V8I A;  1CBX A;  1CP6 A;  3VWE A;  3IC1 A;  3FED A;  5JH9 A;  2EK9 A;  4B11 A;  4CYP A;  1QSM A;  4KSI A;  3D7F A;  2VZZ A;  2PJ7 A;  4GPL B;  3SJE A;  2EZC A;  1XFO A;  4A4B A;  3KHZ A;  1UWY A;  1S5K A;  2POK A;  4QUS A;  4TWE A;  4IUS A;  3WAB A;  3PB8 X;  1MJA A;  3EY5 A;  4FAI A;  3FYN A;  4NJQ A;  3IWG A;  1ZG9 A;  3DR8 A;  2ZW5 A;  1ZG8 A;  3D2P A;  4MRI A;  1MJB A;  2OH1 A;  3C26 A;  1YLE A;  2HUZ A;  2WUU A;  3TOA A;  3B2Y A;  3TLA A;  1CS0 B;  4XNH B;  1IB1 E;  1LOK A;  3OP0 A;  3HPG G;  3R95 A;  5LYL A;  3GJZ A;  3FEE A;  4BMH A;  1ZLI A;  1AYE A;  2WZN A;  3NE8 A;  2PCU A;  1XOV A;  4C8C A;  2FSR A;  2XPN A;  3VRR A;  4HNX B;  4A37 A;  4CGN A;  4JWP A;  3CXS A;  3ZNI A;  3GLJ A;  3I1U A;  1LFW A;  4P4F A;  1YGH A;  2IL4 A;  5D29 A;  2K5T A;  3FJU A;  3PEI A;  3R9G A;  4OC4 A;  1YK3 A;  3WR7 A;  1FY7 A;  5HMN A;  3OB1 B;  4HKF A;  2GP4 A;  5F5X A;  3L2N A;  3DR6 A;  4E94 A;  2AFW A;  2BSW A;  2QIR A;  2BOA A;  1HEE A;  2J8N A;  1Z8L A;  3KRV A;  1IU8 A;  3KGQ A;  3G8W A;  3TCV A;  2B5G B;  1Y9W A;  5FD8 A;  4B10 A;  4FD7 A;  2QJ8 A;  4K3N A;  2PIZ A;  1ELM P;  1XF1 A;  1BO4 A;  2G3T A;  4W9Y A;  3K9T A;  1VHO A;  3SI1 A;  3SXN A;  2RB7 A;  5HKZ A;  4JXR A;  4INJ A;  2ODF A;  2JEW A;  5K8N A;  4MY0 A;  2O28 A;  2PVV A;  2WSA A;  2ZW6 A;  3NFZ A;  3V38 A;  1OZP A;  2REE A;  1ZLH A;  3D3S A;  2I79 A;  4MFP A;  4A94 A;  3LMS A;  1Q2C A;  4DJL A;  3CXQ A;  4J0N A;  4O23 A;  5G22 A;  2AUN A;  2Q51 A;  2OZG A;  4IAV A;  4FUU A;  4AVC A;  1C30 B;  3W91 A;  3KHX A;  3IFE A;  2DIK A;  3B3C A;  3H4Q A;  2I00 A;  2PJ3 A;  2PR8 A;  2CNT A;  3PB9 X;  2C6G A;  3SHP A;  5KTC A;  3TLB A;  1M4D A;  3D67 A;  3NE7 A;  2F5I A;  1I12 A;  3PFE A;  3BLN A;  2EWB A;  3NFQ A;  3G3S A;  1XMB A;  4DNC A;  2YJT A;  5F13 A;  1VIX A;  3T90 A;  2H5M A;  4A2Z A;  3QB8 A;  4U9Y A;  5LYF A;  5AXI A;  1KUY A;  4BBH A;  4MJ8 A;  2C5Q A;  2V8H A;  1WWZ A;  2ARH A;  3CXP A;  1R57 A;  3PZJ A;  1WK4 A;  3R9E A;  4EME A;  3H5Z A;  3HPH E;  4PQA A;  3FF3 A;  4PXC A;  4A33 A;  2B5G A;  2R8V A;  4ZBG A;  4YWY A;  3S9M A;  2XEI A;  3TO6 A;  4IHM A;  2Q04 A;  3KQX A;  3C8O A;  1ON0 A;  2HV2 A;  2B4D B;  3IEH A;  4CGL A;  4XPD B;  5LYD A;  1S7K A;  4MCS A;  3F0A A;  4LX9 A;  3S6F A;  1VBH A;  2D0P A;  4R6T A;  1Y7E A;  2BCO A;  3BUN B;  3RNZ A;  1PYT B;  1EE3 P;  3NA6 A;  2CTB A;  3I9S A;  4GXH A;  4ORF A;  4MJX A;  4QC6 A;  1B47 A;  2DEA A;  3EZE A;  2ZXV A;  2HWG A;  4LQG A;  3TE4 A;  2Q7B A;  3SI0 A;  4TJX A;  4PV6 A;  3EIF A;  2P6G A;  5F49 A;  2AFU A;  3VRN A;  2FIW A;  2GFQ A;  5HKW A;  3VH9 A;  4A95 A;  4OC3 A;  3GY9 A;  3HLP A;  1YQE A;  3BUM B;  1ARL A;  2PJ8 A;  3ISX A;  3VRQ A;  1AMP A;  1I1D A;  1YVO A;  4PPZ A;  1N71 A;  4UA3 A;  5CNP A;  3NH4 A;  4UIA A;  3PGP A;  4MI4 A;  3TO9 A;  2ANP A;  1DE4 C;  4KOR A;  2F8H A;  3KAS A;  2BEI A;  2PE3 A;  3F5B A;  2QVP A;  2NMT A;  2PCN A;  2J8M A;  5G1Z A;  2DF5 A;  2B4D A;  4R9M A;  1BXR B;  3KL9 A;  2CNS A;  4OC5 A;  4NGR A;  5ELY A;  2BUE A;  1RTQ A;  3OAK A;  2Q4Y A;  5G21 A;  1T36 B;  4BTF A;  2P6E A;  2R82 A;  4C99 A;  2VKZ G;  1Z8X A;  2GRE A;  1MK4 A;  2X7B A;  3HMJ G;  1ARM A;  1CG2 A;  4WWV A;  4ZY0 A;  1VBG A;  1YVK A;  1ZO0 A;  3FRM A;  3S9L A;  4C8T A;  1ELL P;  1GYT A;  1Y9K A;  2Q4V A;  3S9N A;  1QQ9 A;  1FNO A;  4CDK A;  4X3R A;  1IIC A;  4OKO A;  3B35 A;  2GLF A;  1KC7 A;  4Q7A A;  1Y9Z A;  1Z8W A;  2E28 A;  3P2H A;  1XIX A;  1QMU A;  3F8K A;  1V6C A;  1YLO A;  1I21 A;  2XEF A;  3LOD A;  5K8P A;  4P4J A;  2BO9 A;  4PSW A; 
#chains in the Genus database with same CATH homology
 1HDU A;  2AFM A;  4NGQ A;  4JYW A;  4ZYQ A;  2ZOF A;  4C84 A;  4ONW A;  1CX8 A;  3T8W A;  5D8N A;  3I74 A;  4OID A;  1CPS A;  5CPA A;  1FT7 A;  2C6C A;  2PJ0 A;  1VGY A;  4RUH A;  5JGF A;  4ZX8 A;  4DYO A;  2ZOG A;  4PXE A;  1CP7 A;  3QNV A;  2HB6 A;  5DS0 A;  5LYI A;  4P10 A;  2QYV A;  1Y0R A;  3GUX A;  3KR5 A;  3PBB A;  4OC2 A;  3WT4 A;  2C6P A;  3RAM A;  2C1C A;  3KI9 A;  4C9V A;  3B7I A;  3MN8 A;  1CPX A;  2AFZ A;  3K2K A;  2PIY A;  3KZW A;  4MCP A;  4OC1 A;  5J1Q A;  4C9R A;  3RBU A;  1TKH A;  1BAV A;  4OME A;  2AFX A;  5HVH A;  2ABZ A;  2CF4 A;  2ZEM A;  4MHZ A;  4YU9 A;  3IJ3 A;  4MHP A;  3PB6 X;  2IMO A;  4ZI6 A;  3IO1 A;  4FBE A;  4PXD A;  2AFO A;  2PRQ A;  1Q7L A;  6CPA A;  3SJF A;  1JQG A;  4P6Y A;  3CPX A;  4NGT A;  1R3N A;  4AXV A;  3RZA A;  2WYR A;  3CPA A;  5LRG A;  1XBU A;  4TJV A;  3NH5 A;  3D7G A;  4OC0 A;  4UEE A;  1BLL E;  2PJC A;  4P44 A;  2ZEE A;  2OOT A;  2F7V A;  4YN3 A;  4FWU A;  3NH8 A;  2ZED A;  4NJR A;  5IB9 A;  4MHN A;  3CDX A;  4H2K A;  4F8Z A;  2PVW A;  3ISZ A;  4R76 A;  4C8P A;  5HXD A;  1TKF A;  2PJ1 A;  4C9U A;  4CDJ A;  3JRU A;  4C86 A;  3SJX A;  4JZ0 A;  1BPN A;  1YME A;  3FMC A;  4IK2 A;  2AFS A;  4NGN A;  4C8F A;  1LAP A;  5LRJ A;  3TX8 A;  1ZG7 A;  2PJ2 A;  5CBM A;  2Q43 A;  4EWT A;  4KNG E;  3WC5 A;  4NGP A;  1VHE A;  4P4E A;  4C8A A;  3LWU A;  5HVG A;  2GLJ A;  1YW4 A;  3FVL A;  3D7D A;  4UF4 A;  1YW6 A;  1R43 A;  2I3C A;  5LRK A;  4TNU A;  5F09 A;  2PJ6 A;  2PJB A;  1TXR A;  1BPM A;  2EK8 A;  4MCR A;  1XJO A;  4GM5 A;  3PFO A;  2ZEF A;  3N5F A;  3B3W A;  4A38 A;  1LCP A;  1PCA A;  3ICU A;  2RFH A;  4EFD A;  2VL1 A;  3BI1 A;  1H8L A;  4NGS A;  1KWM A;  3HUV A;  4P4D A;  4WJB A;  3H8G A;  2OR4 A;  5HVF A;  5JM6 A;  2PJ9 A;  2IQ6 A;  2J9A A;  2O4H A;  5K8O A;  5K8M A;  8CPA A;  2O53 A;  3VAT A;  2G9D A;  1F57 A;  2V8V A;  4OP4 A;  1DTD A;  3VAR A;  2IJZ A;  3H8F A;  3MRU A;  4X2T A;  3D7H A;  1Y0Y A;  3B3T A;  4MXU A;  3D4U A;  2ZEN A;  1LAM A;  2FVG A;  1WVM A;  4NFR A;  1Z2L A;  2PJ5 A;  2NYQ A;  4F9U A;  4P45 A;  2ZEH A;  3B3S A;  3PBE A;  1M4L A;  5IR2 A;  4A39 A;  3WC6 A;  1OBR A;  2ZEO A;  3SI2 A;  3DGV A;  4P4B A;  2ZEG A;  4R7M A;  4ZY2 A;  3KQZ A;  4DUK A;  3PRT A;  2GU2 A;  4C9A A;  1F2O A;  2Q4Z A;  4F9V A;  1TF9 A;  3V7Z A;  1HDQ A;  2ZEP A;  4CPA A;  3BI0 A;  3FH4 A;  1LAN A;  4NGM A;  2HC9 A;  2CIJ A;  4UIB A;  2V8G A;  3SJG A;  2NSM A;  1XRY A;  1NSA A;  2ZEL A;  3PB7 X;  1TKJ A;  2XEJ A;  4ZX9 A;  3IIB A;  2JBJ A;  2PJA A;  4UEF A;  4C85 A;  3BXM A;  4B6Z A;  3FEC A;  4C9E A;  4BD9 A;  5I4M A;  1YSJ A;  4P4I A;  2V77 A;  4ZY1 A;  3BHX A;  2V8D A;  4G1P A;  1Z5R A;  3GB0 A;  4MHY A;  1IGB A;  4CDK A;  3IWW A;  5THW A;  3CT9 A;  4Z65 A;  2CTC A;  4R8F A;  3TC8 A;  4MMO A;  2JBK A;  3FX6 A;  2XEG A;  3PB4 X;  4X8I A;  3I6S A;  1F2P A;  3VTA A;  1IY7 A;  3WC7 A;  1TF8 A;  7CPA A;  4PXB A;  3B3V A;  3DLJ A;  4MCQ A;  3D66 A;  3D68 A;  4C8U A;  4UEZ A;  3KR4 A;  2PJ4 A;  3H8E A;  4OIW A;  1CBX A;  1CP6 A;  3IC1 A;  3FED A;  5JH9 A;  2EK9 A;  4KSI A;  3D7F A;  2PJ7 A;  3SJE A;  1XFO A;  3KHZ A;  4TWE A;  1UWY A;  2POK A;  3WAB A;  4FAI A;  3PB8 X;  4NJQ A;  1ZG9 A;  4MRI A;  1ZG8 A;  3B2Y A;  1LOK A;  5LYL A;  3FEE A;  1ZLI A;  1AYE A;  2WZN A;  2PCU A;  4C8C A;  4A37 A;  3GLJ A;  3I1U A;  1LFW A;  4P4F A;  5D29 A;  3FJU A;  3PEI A;  4OC4 A;  2GP4 A;  3L2N A;  2AFW A;  2BOA A;  1HEE A;  1Z8L A;  3KGQ A;  4K3N A;  2QJ8 A;  2PIZ A;  1ELM P;  1XF1 A;  4W9Y A;  3K9T A;  1VHO A;  3SI1 A;  2RB7 A;  2JEW A;  5K8N A;  2PVV A;  3NFZ A;  3V38 A;  1ZLH A;  4A94 A;  4DJL A;  3LMS A;  4O23 A;  2Q51 A;  4IAV A;  4FUU A;  3KHX A;  3IFE A;  3B3C A;  2PJ3 A;  3PB9 X;  2C6G A;  3D67 A;  3PFE A;  2EWB A;  1XMB A;  1VIX A;  5LYF A;  2C5Q A;  2V8H A;  4EME A;  4PQA A;  3FF3 A;  4PXC A;  4YWY A;  3S9M A;  2XEI A;  4IHM A;  3KQX A;  3IEH A;  5LYD A;  4MCS A;  4R6T A;  1Y7E A;  2BCO A;  1PYT B;  1EE3 P;  3NA6 A;  2CTB A;  2DEA A;  4LQG A;  3SI0 A;  4TJX A;  3EIF A;  2AFU A;  3VH9 A;  4OC3 A;  3HLP A;  1ARL A;  2PJ8 A;  3ISX A;  1AMP A;  4PPZ A;  3NH4 A;  4UIA A;  2ANP A;  1DE4 C;  2F8H A;  3KAS A;  2PE3 A;  2QVP A;  3KL9 A;  4OC5 A;  4NGR A;  5ELY A;  1RTQ A;  4C99 A;  2GRE A;  1ARM A;  1CG2 A;  4WWV A;  4ZY0 A;  3S9L A;  4C8T A;  1ELL P;  1GYT A;  3S9N A;  1QQ9 A;  1FNO A;  4X3R A;  4OKO A;  3B35 A;  2GLF A;  4Q7A A;  1Y9Z A;  1QMU A;  1V6C A;  1YLO A;  2XEF A;  5K8P A;  4P4J A;  2BO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...