3BXMA

Structure of an inactive mutant of human glutamate carboxypeptidase ii [gcpii(e424a)] in complex with n-acetyl-asp-glu (naag)
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Reaction mechanism of glutamate carboxypeptidase II revealed by mutagenesis, X-ray crystallography, and computational methods.
pubmed doi rcsb
source organism Homo sapiens
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bxmA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bxmA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bxmA02
1QQ9A 2PVVA 1XFOA 2PJ3A 4OC1A 2PRQA 3H8FA 1ZG7A 3NFZA 5LYFA 4OC0A 1LAPA 3FJUA 1WVMA 5LYIA 3IWWA 3VH9A 3B3VA 5ELYA 1CG2A 3H8GA 4X3RA 4C9RA 4CPAA 4FBEA 1Q7LA 5D8NA 1NSAA 3WT4A 4P44A 3WABA 4A38A 1LAMA 1Y0RA 4AXVA 1TKHA 2Q43A 3CT9A 1XJOA 2XEFA 3NH8A 2ZEOA 2EK9A 4X2TA 4YU9A 4OP4A 3K2KA 5HXDA 2PJ7A 2BCOA 2GLFA 3B3WA 1EE3P 1AYEA 4C8CA 3KHXA 3KI9A 4MCQA 2I3CA 3B2YA 4EMEA 5CBMA 1TF9A 3D67A 3SI2A 1H8LA 1Z8LA 4Z65A 1Y0YA 2PJ0A 1KWMA 2PJ2A 3KL9A 3WC5A 3KHZA 5D29A 1BPNA 2ZEGA 2PJCA 4ZX8A 1TF8A 3VTAA 8CPAA 3PB8X 4K3NA 2JEWA 3PFOA 5DS0A 5J1QA 4TNUA 4YN3A 4MHNA 5I4MA 2PIZA 2ZOGA 5LYDA 5K8MA 4MCPA 2F7VA 4PXDA 4OMEA 2V77A 2C6GA 2WYRA 4OC5A 3VARA 3KGQA 1YW6A 1Y9ZA 4GM5A 2PJAA 2CF4A 4H2KA 1UWYA 4PQAA 2QJ8A 4ZY0A 4NJRA 4UIAA 3NH5A 3ISXA 1LFWA 4KNGE 2NYQA 3S9LA 3PEIA 5K8OA 3EIFA 4NGNA 2GLJA 3H8EA 1VHOA 5LYLA 4CDJA 1IGBA 3RBUA 3PB9X 1XF1A 2JBKA 3B3TA 4OC2A 1IY7A 2V8GA 4UF4A 3DLJA 1F57A 2PJ5A 2OOTA 2ZEFA 2ZEDA 4OIDA 1ARLA 1HEEA 4MHZA 4UEZA 3TC8A 4A94A 1CPXA 1CP6A 3CPAA 3PB7X 2XEGA 4KSIA 2HC9A 5JM6A 4FWUA 2V8HA 5LRJA 1LOKA 3VATA 3NH4A 2PE3A 2Q4ZA 3SJGA 2VL1A 5IB9A 4MHYA 4C85A 4JYWA 4P4BA 4F8ZA 2RFHA 4F9VA 4WJBA 3TX8A 4C8TA 3RAMA 2BO9A 3B35A 4P4FA 1Z5RA 3MN8A 2PJ8A 2CTBA 2ZEEA 2C6CA 1LCPA 2PJ1A 3JRUA 4UEEA 4P4EA 1CBXA 1ZG9A 2G9DA 2IJZA 3IC1A 4G1PA 2AFUA 2GREA 2PVWA 3QNVA 4MMOA 2V8VA 4NJQA 1BAVA 1TXRA 1ARMA 2C6PA 1QMUA 2EWBA 2POKA 1HDQA 1XBUA 4C9EA 3CDXA 4C8FA 3PBBA 4ZY1A 3PFEA 1F2PA 3KR5A 3FEEA 3BI1A 4OC3A 2AFXA 2V8DA 4MHPA 3T8WA 4Q7AA 1M4LA 3LWUA 3SI1A 4OKOA 3DGVA 4TWEA 2WZNA 3HLPA 4YWYA 1TKFA 3FH4A 3D7FA 1OBRA 1ZLHA 3CPXA 4C9UA 4UIBA 4R7MA 1YLOA 3BXMA 3NA6A 1DE4C 3D7DA 4ONWA 4RUHA 3FEDA 2ZELA 1F2OA 2PIYA 5HVHA 2QYVA 2J9AA 1GYTA 1VHEA 4C8UA 2O53A 3IEHA 4PXCA 5LRKA 4EWTA 4CDKA 3I74A 3SJXA 5THWA 4C8PA 1AMPA 3IFEA 1YSJA 2PJ9A 4DJLA 4JZ0A 1HDUA 4P4IA 4PXEA 2RB7A 2IMOA 4A39A 4X8IA 4NGPA 4P4JA 2O4HA 4NFRA 4NGRA 3B7IA 1PCAA 3GB0A 2QVPA 4C8AA 1V6CA 1TKJA 2ANPA 2ZENA 1ELLP 4FAIA 2DEAA 4P4DA 2PCUA 4PPZA 1ZG8A 3WC6A 3V7ZA 2PJ4A 2XEJA 3S9NA 1FT7A 1RTQA 4NGTA 3FMCA 3FF3A 2HB6A 4TJVA 2GU2A 4UEFA 4A37A 3SJEA 2XEIA 3PBEA 4MXUA 5K8NA 2AFMA 3D4UA 4NGSA 4P10A 2ZEPA 1VIXA 3L2NA 2ZEMA 4C9VA 3GLJA 1CX8A 2AFWA 4LQGA 3IIBA 1YMEA 4R76A 2AFOA 2F8HA 3IJ3A 4ZYQA 6CPAA 4EFDA 5K8PA 3I6SA 3FVLA 3I1UA 5LRGA 4P45A 2NSMA 2CIJA 4F9UA 1LANA 7CPAA 1Y7EA 4DYOA 3BHXA 3KQXA 2IQ6A 2AFSA 1R3NA 4ZX9A 3D7HA 3SI0A 4IK2A 4FUUA 5F09A 4DUKA 2BOAA 4TJXA 1CPSA 2EK8A 1BPMA 3D7GA 5JGFA 2PJ6A 3FECA 2AFZA 4R8FA 5CPAA 3LMSA 1R43A 4ZY2A 4C99A 2ABZA 3KR4A 3N5FA 2ZOFA 4C84A 4R6TA 1PYTB 1DTDA 1JQGA 1BLLE 5HVFA 3V38A 1YW4A 2Q51A 4BD9A 2ZEHA 4W9YA 4P6YA 4C9AA 3ICUA 4B6ZA 3PRTA 3ISZA 4OIWA 4IHMA 3B3SA 3KQZA 1CP7A 3B3CA 3BI0A 4IAVA 3MRUA 2JBJA 3SJFA 4OC4A 3S9MA 2C1CA 1XRYA 4O23A 3D66A 3PB4X 4MRIA 4NGMA 4NGQA 1VGYA 1Z2LA 1XMBA 2FVGA 2CTCA 1ELMP 3D68A 1FNOA 2OR4A 5HVGA 3HUVA 4MCSA 4ZI6A 3KZWA 1ZLIA 3FX6A 3PB6X 4MCRA 3KASA 2PJBA 3RZAA 4PXBA 3WC7A 3K9TA 5JH9A 3GUXA 4C86A 3IO1A 4WWVA
chains in the Genus database with same CATH superfamily
1QQ9A 2PVVA 1XFOA 4B10A 2PJ3A 4OC1A 2PRQA 1S5KA 2D0PA 2OH1A 1WWZA 3R1KA 4CAEA 1KEEB 3H8FA 2ZW5A 1ZL0A 1ZG7A 2GFQA 3NFZA 1Z4RA 2GIVA 1IU8A 3EZBA 4C2YA 5EMIA 5LYFA 4CYOA 3FRMA 3BJ7A 4OC0A 5IV0A 3R9FA 3W6XA 1LAPA 4I49A 4MI4A 1ZYMA 3FJUA 4M6GA 5A28A 1WVMA 5LYIA 2R82A 4MY0A 3IWWA 3VH9A 3B3VA 5ELYA 1CG2A 3H8GA 4X3RA 2QMLA 4C9RA 4CPAA 1R57A 4FBEA 5F13A 1Q7LA 4PSXA 5D8NA 1NSAA 3SXNA 3WT4A 4P44A 2J8MA 1S3ZA 3WABA 2RC4A 4A38A 1M6VB 2B5GA 1LAMA 1Y0RA 2Q7BA 4AXVA 5G21A 4NCZA 5G1ZA 1TKHA 2B4DA 2Q43A 3CT9A 4JJXA 3TFYA 5DWMA 3PZJA 3T07A 4A4BA 5F5XA 1IB1E 1YR0A 1RXTA 1V0CA 4BPUB 4CGLA 1XJOA 2XEFA 3NH8A 2AJ6A 2ZEOA 4FD6A 4BTFA 2EK9A 4LUAA 2Z10A 4X2TA 4OP4A 3JUWA 4YU9A 5C88A 3K2KA 1XF8A 5HXDA 5HKWA 2PJ7A 1I21A 4PK2A 2BCOA 2GLFA 1IOFA 1KUVA 3B3WA 2CY2A 1EE3P 3BLNA 4HPSA 1AUGA 4QC6A 3CXQA 3CZXA 1OZPA 1AYEA 1BXRB 4C8CA 4ZGYB 4CGNA 5J8CA 3KHXA 4KSAA 5F46A 2I00A 1NSLA 3KI9A 4E2AA 1WK4A 1Z4EA 4HNYB 4MCQA 2I3CA 3OB2B 5E96A 3B2YA 4A95A 4EMEA 5K99A 2BL1A 2EBJA 1XIXA 5CBMA 1TF9A 3D67A 1T36B 1YLEA 3SI2A 3G23A 1H8LA 2QIRA 1Z8LA 2WSAA 4Z65A 1Y0YA 2AUNA 4M8DA 5F47A 1NE9A 2VKZG 4XPDB 3FB3A 2PJ0A 1KWMA 4MY3A 1C3OB 2PJ2A 3F0AA 2IL4A 3KL9A 2HV2A 3TO6A 3WC5A 5F9MA 3KHZA 5D29A 1BPNA 1YVHA 2DLAA 3V8IA 4RR2B 2OZGA 4A31A 2ZEGA 5AG5A 2PJCA 3VRPA 1S60A 4PK3A 4YRHA 4ZX8A 2P6GA 5FD8A 1K4JA 3TOBA 1TF8A 3VTAA 8CPAA 3PB8X 4K3NA 2JEWA 3PFOA 3TLAA 4UCPA 2B3UA 4KOYA 5DS0A 5J1QA 4TNUA 4YN3A 4MHNA 2C27A 3LODA 2P0WA 3FIXA 2PIZA 5I4MA 2FM4A 3GJZA 2R98A 2ZOGA 5LYDA 2Y0MA 1GHEA 5K8MA 4MCPA 2F7VA 3U1BA 4PXDA 2JDCA 1XOVA 4KOTA 4OMEA 2V77A 2C6GA 2WYRA 4OC5A 1I1DA 1Q2CA 2OZUA 4GS4A 3S6HA 3KGQA 3VARA 4AB7A 1QSTA 1YW6A 2Z11A 4H89A 1Y9ZA 3PFVA 2B0AA 1M4DA 4CGOA 1I12A 2BSWA 2PJAA 4GM5A 1XE4A 2CF4A 1X12A 4H2KA 1UWYA 1IYLA 4PQAA 4NSQA 2QJ8A 4ZY0A 4CGMA 4MFPA 4NJRA 1DIKA 4UIAA 3NH5A 1FBVA 1LFWA 3ISXA 4KNGE 1MJAA 2GP4A 3S6KA 1ZO0A 4CGPA 2WPXA 2HUZA 4MI1A 3JTKA 4B11A 1JDEA 2NYQA 3S9LA 2Q0YA 4AVCA 3B8GA 3PEIA 5K8OA 3EIFA 3TYXA 2FL4A 3G3SA 1YQEA 1Z8XA 1B87A 4NGNA 1L0CA 2GLJA 1VHOA 3H8EA 3D2MA 2PC1A 4A2ZA 5LYLA 4CDJA 1IGBA 2FS5A 3QAHA 3RBUA 3PB9X 1Y9WA 3PLFB 2B4BA 3VWDA 2JBKA 1XEBA 2H5MA 3LACA 1NXJA 1VBHA 4INJA 2F5IA 3B3TA 2HWGA 3BJ8A 2B4JC 1J4JA 3R95A 2JDDA 4OC2A 1IY7A 2V8GA 1EZBA 4MFZA 1YX0A 2VQYA 2G3AA 2ODFA 4UF4A 3W6SA 3DLJA 1F57A 4JWPA 2Z3OA 4Y49B 2JLMA 2PJ5A 3PT1A 2OOTA 2ZEFA 2ZEDA 2PR8A 2VBQA 4KZTA 4OIDA 2DIKA 2XPOA 1ARLA 1HEEA 2YJTA 4MHZA 4UEZA 2CXAA 5ISVA 3TC8A 4BBHA 4A94A 1CPXA 1JDBC 1CP6A 3TO7A 3D8PA 2ZPAA 4YFJA 3ZNIA 2FSRA 2KCWA 2YNEA 2G0BA 3CPAA 3GKRA 3PB7X 1QSNA 5I0CA 2BEIA 2XEGA 4KSIA 4E0AA 2HC9A 5JM6A 4FWUA 5G22A 4IIYA 5IR2A 2Z3KA 3N7ZA 2V8HA 4Q36A 5LRJA 4EVYA 4BINA 1LOKA 3VATA 5AG4A 4GPLB 4DNCA 3NH4A 4XPDC 2VZYA 4F6AA 3TLEA 1LRZA 5G20A 4C68A 2PE3A 3T0TA 2Q4ZA 3SJGA 2VL1A 2YNCA 5IB9A 1P4NA 4MHYA 4C85A 4JYWA 4P4BA 2ZW7A 4F8ZA 4M85A 3SXOA 3PP9A 3T90A 2RFHA 4F9VA 3T9YA 4HKFA 3OAKA 2JEVA 4WJBA 3TX8A 2Q7SA 4C8TA 3RAMA 2BO9A 3NE8A 1Y7RA 4KVXA 3B35A 4P4FA 1Z5RA 4CAWA 3NOJA 1P0HA 3MN8A 3C26A 3EZEA 5AGEA 3ZZIA 1ZRSA 4IF5A 2Z3PA 2PJ8A 2CTBA 2HQYA 3FXTA 2ZEEA 3C8OA 2C6CA 1X10A 4KSFA 1LCPA 3W91A 2EZAA 1EO0A 4R9MA 2X7BA 2YJVA 2PJ1A 3JRUA 4UEEA 4P4EA 4A4CA 1CBXA 4NXYA 2EZBA 2HI6A 2YNCC 1ZG9A 2G9DA 3BUXB 5BWAB 2IJZA 3F8KA 2OB0A 3IC1A 4LX9A 4G1PA 2FE7A 1YVKA 2CNTA 4RI1A 5F49A 3T5MA 2AFUA 2GREA 1CS0B 3T05A 2PVWA 2VI7A 3QNVA 4MMOA 2V8VA 4YGOA 2XPLA 1Z8WA 5DWNA 1WJTA 1YK3A 4TJVA 4COGA 2OLSA 3U88C 3TLBA 4IIXA 1BOBA 4NJQA 1BAVA 3IWEA 3OB1B 1PU9A 4UCMA 1TXRA 5JQ4A 1ARMA 2C6PA 2OU2A 3GY9A 2E28A 1QMUA 4QB9A 3TCVA 3BUOB 1KBLA 4RS2A 3TLZA 2EWBA 2POKA 1HDQA 1XBUA 3VRNA 3D2PA 3G8WA 3VWEA 5HMNA 1VI4A 1IYKA 4C9EA 3DSBA 1JWQA 3CDXA 4IUSA 3TT2A 1PUAA 1N71A 3PBBA 2R1IA 3PFEA 4ZY1A 4C8FA 1F2PA 4J3GA 3KR5A 1GGOA 3FEEA 3HMJG 3BI1A 4OC3A 2AFXA 2DXQA 2V8DA 4MHPA 3T8WA 4AG9A 3TLYA 4Q7AA 1M4LA 2Q4VA 3LWUA 3SI1A 2X0SA 4OKOA 5IB0A 5KTDA 3DNSA 4FD5A 3DGVA 4R57A 4X5KA 4E8OA 4HNWB 4TWEA 4Y49C 3FBUA 4BPXB 1KUXA 2WZNA 2EUIA 1TKFA 3HLPA 4YWYA 3VGOA 3FH4A 4ONUA 3D7FA 4KVME 1OBRA 1SQHA 1ZLHA 3CPXA 3TE4A 4UIBA 4C9UA 5FVJA 4R7MA 4U9ZA 2FIAA 1RO5A 3QB8A 4AVBA 4R3KA 1XF1A 3SR3A 2ARHA 4H1HA 4UA3A 1YLOA 4COBA 3RO0A 2B3VA 2J8NA 3BUWB 3BXMA 3FNCA 3EZAA 4KUBA 4MFJA 3NA6A 2DF5A 1DE4C 5J3XA 1Z9UA 2PDOA 4KS9A 4CYNA 1M4IA 3D7DA 4ONWA 4RUHA 4E5SA 4CAXA 1YGHA 2AE6A 4K30A 2FT0A 3FEDA 2ZELA 1F2OA 2PIYA 4C7IA 2C5QA 3HPHE 5HVHA 2AUMA 2QYVA 4CAVA 2J9AA 1GYTA 1VHEA 2O28A 4M6HA 4C8UA 1IICA 2CNMA 3F5BA 4QVTA 2D0OA 4J0NA 2O53A 3IEHA 5JVLA 2ZW4A 4PXCA 3D3SA 5LRKA 4EWTA 1BO4A 1CM0A 4CDKA 3I74A 1Z8TA 3SJXA 1YREA 5THWA 5IX3A 1AMPA 1M44A 3IFEA 4XNHB 1YSJA 4JD6A 3LD2A 3E0KA 4C8PA 4HNXB 4AG7A 2PJ9A 1CE8B 4DJLA 4JZ0A 2XPPA 1HDUA 3K4IA 4P4IA 4PXEA 2BUEA 2RB7A 2IMOA 3WR7A 4U9YA 4KOSA 4A39A 4B12A 1NBWA 3ZJ0A 4OAEA 4X8IA 4NGPA 4A33A 3IU2A 4P4JA 1Q2YA 2O4HA 4NFRA 3F9KC 3PGPA 2PCNA 4UWJA 3A9LA 4NGRA 3B7IA 1PCAA 1S7NA 1KZFA 3GB0A 4C7HA 1M1DA 3BUNB 2QVPA 2N3AB 1TKJA 2Z0ZA 1V6CA 4NEXA 4UFVA 2ANPA 4C8AA 2ZENA 4LQ6A 1Z9EA 2REFA 1S7FA 1ELLP 5KTCA 4FAIA 2I79A 3VRRA 2DEAA 5J8FA 3MGDA 4JXQA 1ON0A 4P4DA 2PCUA 1QSRA 4PPZA 4B5OA 3TLGB 1ZG8A 4KORA 5F1YA 3WC6A 1MJBA 3V7ZA 2DPTA 2R7HA 2Y1MA 4KUAA 2PJ4A 3R9GA 1YVOA 2UV8G 2XEJA 4CRYB 1VBGA 3S9NA 1FT7A 5HKYA 3FYNA 1RTQA 4QBJA 2D4OA 3P2HA 4NGTA 4GXHA 4KOUA 4BPWB 5EBVA 1QSMA 3FMCA 4MBUA 5HH1A 2GE3A 3FF3A 3EY5A 1S7KA 2D4PA 4MFQA 2VXKA 4ORFA 3DR6A 4KLWA 2Z3NA 3TTHA 4C2XA 5HKZA 1J3LA 2HB6A 4ZBGA 3DR8A 1R61A 4L8AA 4OADA 1Y9KA 2GU2A 4Q38A 4UEFA 5H84A 5AXIA 1A2ZA 4UCNA 4A37A 3SJEA 3IWGA 2XEIA 3PBEA 2REEA 4FD7A 4MHDA 2PRBA 4MXUA 4MJXA 5K8NA 2CBLA 4CRZB 1QSOA 2AFMA 1Q5XA 3D4UA 4PV6A 4NGSA 4P10A 2ZEPA 1VIXA 3L2NA 2ZEMA 5AG7A 3GLJA 1CX8A 4C9VA 5BY0A 2AFWA 4LQGA 1KC7A 3IIBA 1YMEA 4R76A 4EYSA 3H5ZA 5F48A 4U5YA 2AFOA 2F8HA 3IJ3A 4ZYQA 3EO4A 6CPAA 3TLCA 1KUYA 2DPSA 4EFDA 5K8PA 3I6SA 3VROA 3FVLA 3I1UA 5LRGA 4P45A 2ZW6A 4UBRA 2NSMA 3KKWA 2CIJA 2WUUA 2P6FA 4F9UA 4FD4A 4F0YA 1LANA 7CPAA 2XPNA 4KOVA 1Y7EA 4XPKA 2Z3LA 3S6GA 4DYOA 3BHXA 1TIQA 4UFWA 2MP0A 2PQ8A 3KQXA 2FXFA 2AFSA 2IQ6A 5AG6A 1R3NA 4ZX9A 3D7HA 3EFAA 3GIUA 4IK2A 3SI0A 2QECA 2B58A 1M4GA 4FUUA 2FCKA 5F09A 5JYBA 3I3GA 4UWIA 3IGRA 4NF1A 4DUKA 3OWCA 2BOAA 4TJXA 4B5PB 4A32A 1CPSA 2EK8A 1MK4A 3TLGA 3K9UA 1BPMA 2EVNA 3QAYA 4XNHC 2ZXVA 3UY5A 3D7GA 2Q44A 2Q04A 4CYQA 5JGFA 2PJ6A 3RNZA 1VHSA 3NE7A 3FECA 1NMTA 2WPWA 2AFZA 4L89A 4R87A 4R8FA 5CNPA 3LMSA 1R43A 5CPAA 4ZY2A 1Q2DA 5C82A 4C99A 4M3SA 3TO9A 3RYOA 2HROA 4MFLA 2ABZA 1IOIA 3KR4A 3N5FA 1EZAA 4JVOA 3OP0A 2ZOFA 4C84A 4R6TA 1PYTB 4KOWA 1DTDA 1JQGA 2ATRA 5A27A 4CO9A 3KRVA 3EC4A 1BLLE 4RN7A 5HVFA 1YW4A 3V38A 4B14A 2OZHA 1B6BA 2YGWA 1C30B 2Q51A 4KLVA 4BD9A 3HPGG 3O8ZA 2Z3MA 1VKCA 3IU1A 3H4QA 4AVAA 2ZEHA 4XPLA 4E94A 4KVOE 4W9YA 4P6YA 4C9AA 3ICUA 2R8VA 2VZZA 4B6ZA 4CS0B 3PRTA 3ISZA 3SHPA 4OIWA 4IHMA 1A9XB 2NMTA 3R9EA 4F0XA 4MJ8A 1MJ9A 3B3SA 3CXSA 1UFHA 3KQZA 5GCNA 4KOXA 4BMHA 1U6MA 1CP7A 3B3CA 2A4NA 2B5GB 4A30A 5JPHA 3BI0A 4PSWA 4IAVA 3MRUA 2JBJA 3SJFA 4OLLA 4OC4A 3S9MA 2B4DB 2C1CA 1XRYA 2CNSA 3D66A 4H6ZA 4O23A 4B13A 4II9A 1XMTA 3DDDA 3PB4X 4MRIA 4NGMA 3S6FA 4CZ1A 2K5TA 4NGQA 1VGYA 1Z2LA 4M6IA 4R3LA 3I9SA 1FY7A 5KTAA 3P2FA 2PSWA 1XMBA 2FVGA 2CTCA 2Y1NA 1ELMP 3D68A 1FNOA 3JVNA 2P6EA 4JXRA 2OR4A 2VEZA 3TOAA 1B47A 4C2ZA 5HVGA 3R96A 2G3TA 4MCSA 3HUVA 5H86A 4ZI6A 5EC4A 3KZWA 1ZLIA 3FX6A 3PB6X 4MCRA 3KASA 2PJBA 4UFXA 3RZAA 1IIDA 4PXBA 3WC7A 4CYPA 3NFQA 1CJWA 3K9TA 4B5PA 3VRQA 2PR1A 2FIWA 3BUMB 3CXPA 4MFKA 5JH9A 2EO8A 4QUSA 3GYAA 4H6UA 2EZCA 3GUXA 4CAFA 4C86A 3EXNA 4JLYA 2YNDA 3IO1A 4WWVA 1S7LA 2GANA 2Q4YA 2J8RA
chains in the Genus database with same CATH topology
1QQ9A 2PVVA 1XFOA 2PJ3A 4OC1A 2PRQA 3H8FA 1ZG7A 3NFZA 5LYFA 4OC0A 1LAPA 3FJUA 1WVMA 5LYIA 3IWWA 3VH9A 3B3VA 5ELYA 1CG2A 3H8GA 4X3RA 4C9RA 4CPAA 4FBEA 1Q7LA 5D8NA 1NSAA 3WT4A 4P44A 3WABA 4A38A 1LAMA 1Y0RA 4AXVA 1TKHA 2Q43A 3CT9A 1XJOA 2XEFA 3NH8A 2ZEOA 2EK9A 4X2TA 4YU9A 4OP4A 3K2KA 5HXDA 2PJ7A 2BCOA 2GLFA 3B3WA 1EE3P 1AYEA 4C8CA 3KHXA 3KI9A 4MCQA 2I3CA 3B2YA 4EMEA 5CBMA 1TF9A 3D67A 3SI2A 1H8LA 1Z8LA 4Z65A 1Y0YA 2PJ0A 1KWMA 2PJ2A 3KL9A 3WC5A 3KHZA 5D29A 1BPNA 2ZEGA 2PJCA 4ZX8A 1TF8A 3VTAA 8CPAA 3PB8X 4K3NA 2JEWA 3PFOA 5DS0A 5J1QA 4TNUA 4YN3A 4MHNA 5I4MA 2PIZA 2ZOGA 5LYDA 5K8MA 4MCPA 2F7VA 4PXDA 4OMEA 2V77A 2C6GA 2WYRA 4OC5A 3VARA 3KGQA 1YW6A 1Y9ZA 4GM5A 2PJAA 2CF4A 4H2KA 1UWYA 4PQAA 2QJ8A 4ZY0A 4NJRA 4UIAA 3NH5A 3ISXA 1LFWA 4KNGE 2GP4A 2NYQA 3S9LA 3PEIA 5K8OA 3EIFA 4NGNA 2GLJA 3H8EA 1VHOA 5LYLA 4CDJA 1IGBA 3RBUA 3PB9X 1XF1A 2JBKA 3B3TA 4OC2A 1IY7A 2V8GA 4UF4A 3DLJA 1F57A 2PJ5A 2OOTA 2ZEFA 2ZEDA 4OIDA 1ARLA 1HEEA 4MHZA 4UEZA 3TC8A 4A94A 1CPXA 1CP6A 3CPAA 3PB7X 5IR2A 2XEGA 4KSIA 2HC9A 5JM6A 4FWUA 2V8HA 5LRJA 1LOKA 3VATA 3NH4A 2PE3A 2Q4ZA 3SJGA 2VL1A 5IB9A 4MHYA 4C85A 4JYWA 4P4BA 4F8ZA 2RFHA 4F9VA 4WJBA 3TX8A 4C8TA 3RAMA 2BO9A 3B35A 4P4FA 1Z5RA 3MN8A 2PJ8A 2CTBA 2ZEEA 2C6CA 1LCPA 2PJ1A 3JRUA 4UEEA 4P4EA 1CBXA 1ZG9A 2G9DA 2IJZA 3IC1A 4G1PA 2AFUA 2GREA 2PVWA 3QNVA 4MMOA 2V8VA 4NJQA 1BAVA 1TXRA 1ARMA 2C6PA 1QMUA 2EWBA 2POKA 1HDQA 1XBUA 4C9EA 3CDXA 4C8FA 3PBBA 4ZY1A 3PFEA 1F2PA 3KR5A 3FEEA 3BI1A 4OC3A 2AFXA 2V8DA 4MHPA 3T8WA 4Q7AA 1M4LA 3LWUA 3SI1A 4OKOA 3DGVA 4TWEA 2WZNA 3HLPA 4YWYA 1TKFA 3FH4A 3D7FA 1OBRA 1ZLHA 3CPXA 4C9UA 4UIBA 4R7MA 1YLOA 3BXMA 3NA6A 1DE4C 3D7DA 4ONWA 4RUHA 3FEDA 2ZELA 1F2OA 2PIYA 2C5QA 5HVHA 2QYVA 2J9AA 1GYTA 1VHEA 4C8UA 2O53A 3IEHA 4PXCA 5LRKA 4EWTA 4CDKA 3I74A 3SJXA 5THWA 4C8PA 1AMPA 3IFEA 1YSJA 2PJ9A 4DJLA 4JZ0A 1HDUA 4P4IA 4PXEA 2RB7A 2IMOA 4A39A 4X8IA 4NGPA 4P4JA 2O4HA 4NFRA 4NGRA 3B7IA 1PCAA 3GB0A 2QVPA 4C8AA 1V6CA 1TKJA 2ANPA 2ZENA 1ELLP 4FAIA 2DEAA 4P4DA 2PCUA 4PPZA 1ZG8A 3WC6A 3V7ZA 2PJ4A 2XEJA 3S9NA 1FT7A 1RTQA 4NGTA 3FMCA 3FF3A 2HB6A 4TJVA 2GU2A 4UEFA 4A37A 3SJEA 2XEIA 3PBEA 4MXUA 5K8NA 2AFMA 3D4UA 4NGSA 4P10A 2ZEPA 1VIXA 3L2NA 2ZEMA 4C9VA 3GLJA 1CX8A 2AFWA 4LQGA 3IIBA 1YMEA 4R76A 2AFOA 2F8HA 3IJ3A 4ZYQA 6CPAA 4EFDA 5K8PA 3I6SA 3FVLA 3I1UA 5LRGA 4P45A 2NSMA 2CIJA 4F9UA 1LANA 7CPAA 1Y7EA 4DYOA 3BHXA 3KQXA 2IQ6A 2AFSA 1R3NA 4ZX9A 3D7HA 3SI0A 4IK2A 4FUUA 5F09A 4DUKA 2BOAA 4TJXA 1CPSA 2EK8A 1BPMA 3D7GA 5JGFA 2PJ6A 3FECA 2AFZA 4R8FA 5CPAA 3LMSA 1R43A 4ZY2A 4C99A 2ABZA 3KR4A 3N5FA 2ZOFA 4C84A 4R6TA 1PYTB 1DTDA 1JQGA 1BLLE 5HVFA 3V38A 1YW4A 2Q51A 4BD9A 2ZEHA 4W9YA 4P6YA 4C9AA 3ICUA 4B6ZA 3PRTA 3ISZA 4OIWA 4IHMA 3B3SA 3KQZA 1CP7A 3B3CA 3BI0A 4IAVA 3MRUA 2JBJA 3SJFA 4OC4A 3S9MA 2C1CA 1XRYA 4O23A 3D66A 3PB4X 4MRIA 4NGMA 4NGQA 1VGYA 1Z2LA 1XMBA 2FVGA 2CTCA 1ELMP 3D68A 1FNOA 2OR4A 5HVGA 3HUVA 4MCSA 4ZI6A 3KZWA 1ZLIA 3FX6A 3PB6X 4MCRA 3KASA 2PJBA 3RZAA 4PXBA 3WC7A 3K9TA 5JH9A 3GUXA 4C86A 3IO1A 4WWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQ9 A;  2PVV A;  1XFO A;  2PJ3 A;  4OC1 A;  2PRQ A;  3H8F A;  1ZG7 A;  3NFZ A;  5LYF A;  4OC0 A;  1LAP A;  3FJU A;  1WVM A;  5LYI A;  3IWW A;  3VH9 A;  3B3V A;  5ELY A;  1CG2 A;  3H8G A;  4X3R A;  4C9R A;  4CPA A;  4FBE A;  1Q7L A;  5D8N A;  1NSA A;  3WT4 A;  4P44 A;  3WAB A;  4A38 A;  1LAM A;  1Y0R A;  4AXV A;  1TKH A;  2Q43 A;  3CT9 A;  1XJO A;  2XEF A;  3NH8 A;  2ZEO A;  2EK9 A;  4X2T A;  4YU9 A;  4OP4 A;  3K2K A;  5HXD A;  2PJ7 A;  2BCO A;  2GLF A;  3B3W A;  1EE3 P;  1AYE A;  4C8C A;  3KHX A;  3KI9 A;  4MCQ A;  2I3C A;  3B2Y A;  4EME A;  5CBM A;  1TF9 A;  3D67 A;  3SI2 A;  1H8L A;  1Z8L A;  4Z65 A;  1Y0Y A;  2PJ0 A;  1KWM A;  2PJ2 A;  3KL9 A;  3WC5 A;  3KHZ A;  5D29 A;  1BPN A;  2ZEG A;  2PJC A;  4ZX8 A;  1TF8 A;  3VTA A;  8CPA A;  3PB8 X;  4K3N A;  2JEW A;  3PFO A;  5DS0 A;  5J1Q A;  4TNU A;  4YN3 A;  4MHN A;  5I4M A;  2PIZ A;  2ZOG A;  5LYD A;  5K8M A;  4MCP A;  2F7V A;  4PXD A;  4OME A;  2V77 A;  2C6G A;  2WYR A;  4OC5 A;  3VAR A;  3KGQ A;  1YW6 A;  1Y9Z A;  4GM5 A;  2PJA A;  2CF4 A;  4H2K A;  1UWY A;  4PQA A;  2QJ8 A;  4ZY0 A;  4NJR A;  4UIA A;  3NH5 A;  3ISX A;  1LFW A;  4KNG E;  2NYQ A;  3S9L A;  3PEI A;  5K8O A;  3EIF A;  4NGN A;  2GLJ A;  3H8E A;  1VHO A;  5LYL A;  4CDJ A;  1IGB A;  3RBU A;  3PB9 X;  1XF1 A;  2JBK A;  3B3T A;  4OC2 A;  1IY7 A;  2V8G A;  4UF4 A;  3DLJ A;  1F57 A;  2PJ5 A;  2OOT A;  2ZEF A;  2ZED A;  4OID A;  1ARL A;  1HEE A;  4MHZ A;  4UEZ A;  3TC8 A;  4A94 A;  1CPX A;  1CP6 A;  3CPA A;  3PB7 X;  2XEG A;  4KSI A;  2HC9 A;  5JM6 A;  4FWU A;  2V8H A;  5LRJ A;  1LOK A;  3VAT A;  3NH4 A;  2PE3 A;  2Q4Z A;  3SJG A;  2VL1 A;  5IB9 A;  4MHY A;  4C85 A;  4JYW A;  4P4B A;  4F8Z A;  2RFH A;  4F9V A;  4WJB A;  3TX8 A;  4C8T A;  3RAM A;  2BO9 A;  3B35 A;  4P4F A;  1Z5R A;  3MN8 A;  2PJ8 A;  2CTB A;  2ZEE A;  2C6C A;  1LCP A;  2PJ1 A;  3JRU A;  4UEE A;  4P4E A;  1CBX A;  1ZG9 A;  2G9D A;  2IJZ A;  3IC1 A;  4G1P A;  2AFU A;  2GRE A;  2PVW A;  3QNV A;  4MMO A;  2V8V A;  4NJQ A;  1BAV A;  1TXR A;  1ARM A;  2C6P A;  1QMU A;  2EWB A;  2POK A;  1HDQ A;  1XBU A;  4C9E A;  3CDX A;  4C8F A;  3PBB A;  4ZY1 A;  3PFE A;  1F2P A;  3KR5 A;  3FEE A;  3BI1 A;  4OC3 A;  2AFX A;  2V8D A;  4MHP A;  3T8W A;  4Q7A A;  1M4L A;  3LWU A;  3SI1 A;  4OKO A;  3DGV A;  4TWE A;  2WZN A;  3HLP A;  4YWY A;  1TKF A;  3FH4 A;  3D7F A;  1OBR A;  1ZLH A;  3CPX A;  4C9U A;  4UIB A;  4R7M A;  1YLO A;  3BXM A;  3NA6 A;  1DE4 C;  3D7D A;  4ONW A;  4RUH A;  3FED A;  2ZEL A;  1F2O A;  2PIY A;  5HVH A;  2QYV A;  2J9A A;  1GYT A;  1VHE A;  4C8U A;  2O53 A;  3IEH A;  4PXC A;  5LRK A;  4EWT A;  4CDK A;  3I74 A;  3SJX A;  5THW A;  4C8P A;  1AMP A;  3IFE A;  1YSJ A;  2PJ9 A;  4DJL A;  4JZ0 A;  1HDU A;  4P4I A;  4PXE A;  2RB7 A;  2IMO A;  4A39 A;  4X8I A;  4NGP A;  4P4J A;  2O4H A;  4NFR A;  4NGR A;  3B7I A;  1PCA A;  3GB0 A;  2QVP A;  4C8A A;  1V6C A;  1TKJ A;  2ANP A;  2ZEN A;  1ELL P;  4FAI A;  2DEA A;  4P4D A;  2PCU A;  4PPZ A;  1ZG8 A;  3WC6 A;  3V7Z A;  2PJ4 A;  2XEJ A;  3S9N A;  1FT7 A;  1RTQ A;  4NGT A;  3FMC A;  3FF3 A;  2HB6 A;  4TJV A;  2GU2 A;  4UEF A;  4A37 A;  3SJE A;  2XEI A;  3PBE A;  4MXU A;  5K8N A;  2AFM A;  3D4U A;  4NGS A;  4P10 A;  2ZEP A;  1VIX A;  3L2N A;  2ZEM A;  4C9V A;  3GLJ A;  1CX8 A;  2AFW A;  4LQG A;  3IIB A;  1YME A;  4R76 A;  2AFO A;  2F8H A;  3IJ3 A;  4ZYQ A;  6CPA A;  4EFD A;  5K8P A;  3I6S A;  3FVL A;  3I1U A;  5LRG A;  4P45 A;  2NSM A;  2CIJ A;  4F9U A;  1LAN A;  7CPA A;  1Y7E A;  4DYO A;  3BHX A;  3KQX A;  2IQ6 A;  2AFS A;  1R3N A;  4ZX9 A;  3D7H A;  3SI0 A;  4IK2 A;  4FUU A;  5F09 A;  4DUK A;  2BOA A;  4TJX A;  1CPS A;  2EK8 A;  1BPM A;  3D7G A;  5JGF A;  2PJ6 A;  3FEC A;  2AFZ A;  4R8F A;  5CPA A;  3LMS A;  1R43 A;  4ZY2 A;  4C99 A;  2ABZ A;  3KR4 A;  3N5F A;  2ZOF A;  4C84 A;  4R6T A;  1PYT B;  1DTD A;  1JQG A;  1BLL E;  5HVF A;  3V38 A;  1YW4 A;  2Q51 A;  4BD9 A;  2ZEH A;  4W9Y A;  4P6Y A;  4C9A A;  3ICU A;  4B6Z A;  3PRT A;  3ISZ A;  4OIW A;  4IHM A;  3B3S A;  3KQZ A;  1CP7 A;  3B3C A;  3BI0 A;  4IAV A;  3MRU A;  2JBJ A;  3SJF A;  4OC4 A;  3S9M A;  2C1C A;  1XRY A;  4O23 A;  3D66 A;  3PB4 X;  4MRI A;  4NGM A;  4NGQ A;  1VGY A;  1Z2L A;  1XMB A;  2FVG A;  2CTC A;  1ELM P;  3D68 A;  1FNO A;  2OR4 A;  5HVG A;  3HUV A;  4MCS A;  4ZI6 A;  3KZW A;  1ZLI A;  3FX6 A;  3PB6 X;  4MCR A;  3KAS A;  2PJB A;  3RZA A;  4PXB A;  3WC7 A;  3K9T A;  5JH9 A;  3GUX A;  4C86 A;  3IO1 A;  4WWV A; 
#chains in the Genus database with same CATH topology
 1QQ9 A;  2PVV A;  1XFO A;  4B10 A;  2PJ3 A;  4OC1 A;  2PRQ A;  1S5K A;  2D0P A;  2OH1 A;  1WWZ A;  3R1K A;  4CAE A;  1KEE B;  3H8F A;  2ZW5 A;  1ZL0 A;  1ZG7 A;  2GFQ A;  3NFZ A;  1Z4R A;  2GIV A;  1IU8 A;  3EZB A;  4C2Y A;  5EMI A;  5LYF A;  4CYO A;  3FRM A;  3BJ7 A;  4OC0 A;  5IV0 A;  3R9F A;  3W6X A;  1LAP A;  4I49 A;  4MI4 A;  1ZYM A;  3FJU A;  4M6G A;  5A28 A;  1WVM A;  5LYI A;  2R82 A;  4MY0 A;  3IWW A;  3VH9 A;  3B3V A;  5ELY A;  1CG2 A;  3H8G A;  4X3R A;  2QML A;  4C9R A;  4CPA A;  1R57 A;  4FBE A;  5F13 A;  1Q7L A;  4PSX A;  5D8N A;  1NSA A;  3SXN A;  3WT4 A;  4P44 A;  2J8M A;  1S3Z A;  3WAB A;  2RC4 A;  4A38 A;  1M6V B;  2B5G A;  1LAM A;  1Y0R A;  2Q7B A;  4AXV A;  5G21 A;  4NCZ A;  5G1Z A;  1TKH A;  2B4D A;  2Q43 A;  3CT9 A;  4JJX A;  3TFY A;  5DWM A;  3PZJ A;  3T07 A;  4A4B A;  5F5X A;  1IB1 E;  1YR0 A;  1RXT A;  1V0C A;  4BPU B;  4CGL A;  1XJO A;  2XEF A;  3NH8 A;  2AJ6 A;  2ZEO A;  4FD6 A;  4BTF A;  2EK9 A;  4LUA A;  2Z10 A;  4X2T A;  4OP4 A;  3JUW A;  4YU9 A;  5C88 A;  3K2K A;  1XF8 A;  5HXD A;  5HKW A;  2PJ7 A;  1I21 A;  4PK2 A;  2BCO A;  2GLF A;  1IOF A;  1KUV A;  3B3W A;  2CY2 A;  1EE3 P;  3BLN A;  4HPS A;  1AUG A;  4QC6 A;  3CXQ A;  3CZX A;  1OZP A;  1AYE A;  1BXR B;  4C8C A;  4ZGY B;  4CGN A;  5J8C A;  3KHX A;  4KSA A;  5F46 A;  2I00 A;  1NSL A;  3KI9 A;  4E2A A;  1WK4 A;  1Z4E A;  4HNY B;  4MCQ A;  2I3C A;  3OB2 B;  5E96 A;  3B2Y A;  4A95 A;  4EME A;  5K99 A;  2BL1 A;  2EBJ A;  1XIX A;  5CBM A;  1TF9 A;  3D67 A;  1T36 B;  1YLE A;  3SI2 A;  3G23 A;  1H8L A;  2QIR A;  1Z8L A;  2WSA A;  4Z65 A;  1Y0Y A;  2AUN A;  4M8D A;  5F47 A;  1NE9 A;  2VKZ G;  4XPD B;  3FB3 A;  2PJ0 A;  1KWM A;  4MY3 A;  1C3O B;  2PJ2 A;  3F0A A;  2IL4 A;  3KL9 A;  2HV2 A;  3TO6 A;  3WC5 A;  5F9M A;  3KHZ A;  5D29 A;  1BPN A;  1YVH A;  2DLA A;  3V8I A;  4RR2 B;  2OZG A;  4A31 A;  2ZEG A;  5AG5 A;  2PJC A;  3VRP A;  1S60 A;  4PK3 A;  4YRH A;  4ZX8 A;  2P6G A;  5FD8 A;  1K4J A;  3TOB A;  1TF8 A;  3VTA A;  8CPA A;  3PB8 X;  4K3N A;  2JEW A;  3PFO A;  3TLA A;  4UCP A;  2B3U A;  4KOY A;  5DS0 A;  5J1Q A;  4TNU A;  4YN3 A;  4MHN A;  2C27 A;  3LOD A;  2P0W A;  3FIX A;  2PIZ A;  5I4M A;  2FM4 A;  3GJZ A;  2R98 A;  2ZOG A;  5LYD A;  2Y0M A;  1GHE A;  5K8M A;  4MCP A;  2F7V A;  3U1B A;  4PXD A;  2JDC A;  1XOV A;  4KOT A;  4OME A;  2V77 A;  2C6G A;  2WYR A;  4OC5 A;  1I1D A;  1Q2C A;  2OZU A;  4GS4 A;  3S6H A;  3KGQ A;  3VAR A;  4AB7 A;  1QST A;  1YW6 A;  2Z11 A;  4H89 A;  1Y9Z A;  3PFV A;  2B0A A;  1M4D A;  4CGO A;  1I12 A;  2BSW A;  2PJA A;  4GM5 A;  1XE4 A;  2CF4 A;  1X12 A;  4H2K A;  1UWY A;  1IYL A;  4PQA A;  4NSQ A;  2QJ8 A;  4ZY0 A;  4CGM A;  4MFP A;  4NJR A;  1DIK A;  4UIA A;  3NH5 A;  1FBV A;  1LFW A;  3ISX A;  4KNG E;  1MJA A;  2GP4 A;  3S6K A;  1ZO0 A;  4CGP A;  2WPX A;  2HUZ A;  4MI1 A;  3JTK A;  4B11 A;  1JDE A;  2NYQ A;  3S9L A;  2Q0Y A;  4AVC A;  3B8G A;  3PEI A;  5K8O A;  3EIF A;  3TYX A;  2FL4 A;  3G3S A;  1YQE A;  1Z8X A;  1B87 A;  4NGN A;  1L0C A;  2GLJ A;  1VHO A;  3H8E A;  3D2M A;  2PC1 A;  4A2Z A;  5LYL A;  4CDJ A;  1IGB A;  2FS5 A;  3QAH A;  3RBU A;  3PB9 X;  1Y9W A;  3PLF B;  2B4B A;  3VWD A;  2JBK A;  1XEB A;  2H5M A;  3LAC A;  1NXJ A;  1VBH A;  4INJ A;  2F5I A;  3B3T A;  2HWG A;  3BJ8 A;  2B4J C;  1J4J A;  3R95 A;  2JDD A;  4OC2 A;  1IY7 A;  2V8G A;  1EZB A;  4MFZ A;  1YX0 A;  2VQY A;  2G3A A;  2ODF A;  4UF4 A;  3W6S A;  3DLJ A;  1F57 A;  4JWP A;  2Z3O A;  4Y49 B;  2JLM A;  2PJ5 A;  3PT1 A;  2OOT A;  2ZEF A;  2ZED A;  2PR8 A;  2VBQ A;  4KZT A;  4OID A;  2DIK A;  2XPO A;  1ARL A;  1HEE A;  2YJT A;  4MHZ A;  4UEZ A;  2CXA A;  5ISV A;  3TC8 A;  4BBH A;  4A94 A;  1CPX A;  1JDB C;  1CP6 A;  3TO7 A;  3D8P A;  2ZPA A;  4YFJ A;  3ZNI A;  2FSR A;  2KCW A;  2YNE A;  2G0B A;  3CPA A;  3GKR A;  3PB7 X;  1QSN A;  5I0C A;  2BEI A;  2XEG A;  4KSI A;  4E0A A;  2HC9 A;  5JM6 A;  4FWU A;  5G22 A;  4IIY A;  5IR2 A;  2Z3K A;  3N7Z A;  2V8H A;  4Q36 A;  5LRJ A;  4EVY A;  4BIN A;  1LOK A;  3VAT A;  5AG4 A;  4GPL B;  4DNC A;  3NH4 A;  4XPD C;  2VZY A;  4F6A A;  3TLE A;  1LRZ A;  5G20 A;  4C68 A;  2PE3 A;  3T0T A;  2Q4Z A;  3SJG A;  2VL1 A;  2YNC A;  5IB9 A;  1P4N A;  4MHY A;  4C85 A;  4JYW A;  4P4B A;  2ZW7 A;  4F8Z A;  4M85 A;  3SXO A;  3PP9 A;  3T90 A;  2RFH A;  4F9V A;  3T9Y A;  4HKF A;  3OAK A;  2JEV A;  4WJB A;  3TX8 A;  2Q7S A;  4C8T A;  3RAM A;  2BO9 A;  3NE8 A;  1Y7R A;  4KVX A;  3B35 A;  4P4F A;  1Z5R A;  4CAW A;  3NOJ A;  1P0H A;  3MN8 A;  3C26 A;  3EZE A;  5AGE A;  3ZZI A;  1ZRS A;  4IF5 A;  2Z3P A;  2PJ8 A;  2CTB A;  2HQY A;  3FXT A;  2ZEE A;  3C8O A;  2C6C A;  1X10 A;  4KSF A;  1LCP A;  3W91 A;  2EZA A;  1EO0 A;  4R9M A;  2X7B A;  2YJV A;  2PJ1 A;  3JRU A;  4UEE A;  4P4E A;  4A4C A;  1CBX A;  4NXY A;  2EZB A;  2HI6 A;  2YNC C;  1ZG9 A;  2G9D A;  3BUX B;  5BWA B;  2IJZ A;  3F8K A;  2OB0 A;  3IC1 A;  4LX9 A;  4G1P A;  2FE7 A;  1YVK A;  2CNT A;  4RI1 A;  5F49 A;  3T5M A;  2AFU A;  2GRE A;  1CS0 B;  3T05 A;  2PVW A;  2VI7 A;  3QNV A;  4MMO A;  2V8V A;  4YGO A;  2XPL A;  1Z8W A;  5DWN A;  1WJT A;  1YK3 A;  4TJV A;  4COG A;  2OLS A;  3U88 C;  3TLB A;  4IIX A;  1BOB A;  4NJQ A;  1BAV A;  3IWE A;  3OB1 B;  1PU9 A;  4UCM A;  1TXR A;  5JQ4 A;  1ARM A;  2C6P A;  2OU2 A;  3GY9 A;  2E28 A;  1QMU A;  4QB9 A;  3TCV A;  3BUO B;  1KBL A;  4RS2 A;  3TLZ A;  2EWB A;  2POK A;  1HDQ A;  1XBU A;  3VRN A;  3D2P A;  3G8W A;  3VWE A;  5HMN A;  1VI4 A;  1IYK A;  4C9E A;  3DSB A;  1JWQ A;  3CDX A;  4IUS A;  3TT2 A;  1PUA A;  1N71 A;  3PBB A;  2R1I A;  3PFE A;  4ZY1 A;  4C8F A;  1F2P A;  4J3G A;  3KR5 A;  1GGO A;  3FEE A;  3HMJ G;  3BI1 A;  4OC3 A;  2AFX A;  2DXQ A;  2V8D A;  4MHP A;  3T8W A;  4AG9 A;  3TLY A;  4Q7A A;  1M4L A;  2Q4V A;  3LWU A;  3SI1 A;  2X0S A;  4OKO A;  5IB0 A;  5KTD A;  3DNS A;  4FD5 A;  3DGV A;  4R57 A;  4X5K A;  4E8O A;  4HNW B;  4TWE A;  4Y49 C;  3FBU A;  4BPX B;  1KUX A;  2WZN A;  2EUI A;  1TKF A;  3HLP A;  4YWY A;  3VGO A;  3FH4 A;  4ONU A;  3D7F A;  4KVM E;  1OBR A;  1SQH A;  1ZLH A;  3CPX A;  3TE4 A;  4UIB A;  4C9U A;  5FVJ A;  4R7M A;  4U9Z A;  2FIA A;  1RO5 A;  3QB8 A;  4AVB A;  4R3K A;  1XF1 A;  3SR3 A;  2ARH A;  4H1H A;  4UA3 A;  1YLO A;  4COB A;  3RO0 A;  2B3V A;  2J8N A;  3BUW B;  3BXM A;  3FNC A;  3EZA A;  4KUB A;  4MFJ A;  3NA6 A;  2DF5 A;  1DE4 C;  5J3X A;  1Z9U A;  2PDO A;  4KS9 A;  4CYN A;  1M4I A;  3D7D A;  4ONW A;  4RUH A;  4E5S A;  4CAX A;  1YGH A;  2AE6 A;  4K30 A;  2FT0 A;  3FED A;  2ZEL A;  1F2O A;  2PIY A;  4C7I A;  2C5Q A;  3HPH E;  5HVH A;  2AUM A;  2QYV A;  4CAV A;  2J9A A;  1GYT A;  1VHE A;  2O28 A;  4M6H A;  4C8U A;  1IIC A;  2CNM A;  3F5B A;  4QVT A;  2D0O A;  4J0N A;  2O53 A;  3IEH A;  5JVL A;  2ZW4 A;  4PXC A;  3D3S A;  5LRK A;  4EWT A;  1BO4 A;  1CM0 A;  4CDK A;  3I74 A;  1Z8T A;  3SJX A;  1YRE A;  5THW A;  5IX3 A;  1AMP A;  1M44 A;  3IFE A;  4XNH B;  1YSJ A;  4JD6 A;  3LD2 A;  3E0K A;  4C8P A;  4HNX B;  4AG7 A;  2PJ9 A;  1CE8 B;  4DJL A;  4JZ0 A;  2XPP A;  1HDU A;  3K4I A;  4P4I A;  4PXE A;  2BUE A;  2RB7 A;  2IMO A;  3WR7 A;  4U9Y A;  4KOS A;  4A39 A;  4B12 A;  1NBW A;  3ZJ0 A;  4OAE A;  4X8I A;  4NGP A;  4A33 A;  3IU2 A;  4P4J A;  1Q2Y A;  2O4H A;  4NFR A;  3F9K C;  3PGP A;  2PCN A;  4UWJ A;  3A9L A;  4NGR A;  3B7I A;  1PCA A;  1S7N A;  1KZF A;  3GB0 A;  4C7H A;  1M1D A;  3BUN B;  2QVP A;  2N3A B;  1TKJ A;  2Z0Z A;  1V6C A;  4NEX A;  4UFV A;  2ANP A;  4C8A A;  2ZEN A;  4LQ6 A;  1Z9E A;  2REF A;  1S7F A;  1ELL P;  5KTC A;  4FAI A;  2I79 A;  3VRR A;  2DEA A;  5J8F A;  3MGD A;  4JXQ A;  1ON0 A;  4P4D A;  2PCU A;  1QSR A;  4PPZ A;  4B5O A;  3TLG B;  1ZG8 A;  4KOR A;  5F1Y A;  3WC6 A;  1MJB A;  3V7Z A;  2DPT A;  2R7H A;  2Y1M A;  4KUA A;  2PJ4 A;  3R9G A;  1YVO A;  2UV8 G;  2XEJ A;  4CRY B;  1VBG A;  3S9N A;  1FT7 A;  5HKY A;  3FYN A;  1RTQ A;  4QBJ A;  2D4O A;  3P2H A;  4NGT A;  4GXH A;  4KOU A;  4BPW B;  5EBV A;  1QSM A;  3FMC A;  4MBU A;  5HH1 A;  2GE3 A;  3FF3 A;  3EY5 A;  1S7K A;  2D4P A;  4MFQ A;  2VXK A;  4ORF A;  3DR6 A;  4KLW A;  2Z3N A;  3TTH A;  4C2X A;  5HKZ A;  1J3L A;  2HB6 A;  4ZBG A;  3DR8 A;  1R61 A;  4L8A A;  4OAD A;  1Y9K A;  2GU2 A;  4Q38 A;  4UEF A;  5H84 A;  5AXI A;  1A2Z A;  4UCN A;  4A37 A;  3SJE A;  3IWG A;  2XEI A;  3PBE A;  2REE A;  4FD7 A;  4MHD A;  2PRB A;  4MXU A;  4MJX A;  5K8N A;  2CBL A;  4CRZ B;  1QSO A;  2AFM A;  1Q5X A;  3D4U A;  4PV6 A;  4NGS A;  4P10 A;  2ZEP A;  1VIX A;  3L2N A;  2ZEM A;  5AG7 A;  3GLJ A;  1CX8 A;  4C9V A;  5BY0 A;  2AFW A;  4LQG A;  1KC7 A;  3IIB A;  1YME A;  4R76 A;  4EYS A;  3H5Z A;  5F48 A;  4U5Y A;  2AFO A;  2F8H A;  3IJ3 A;  4ZYQ A;  3EO4 A;  6CPA A;  3TLC A;  1KUY A;  2DPS A;  4EFD A;  5K8P A;  3I6S A;  3VRO A;  3FVL A;  3I1U A;  5LRG A;  4P45 A;  2ZW6 A;  4UBR A;  2NSM A;  3KKW A;  2CIJ A;  2WUU A;  2P6F A;  4F9U A;  4FD4 A;  4F0Y A;  1LAN A;  7CPA A;  2XPN A;  4KOV A;  1Y7E A;  4XPK A;  2Z3L A;  3S6G A;  4DYO A;  3BHX A;  1TIQ A;  4UFW A;  2MP0 A;  2PQ8 A;  3KQX A;  2FXF A;  2AFS A;  2IQ6 A;  5AG6 A;  1R3N A;  4ZX9 A;  3D7H A;  3EFA A;  3GIU A;  4IK2 A;  3SI0 A;  2QEC A;  2B58 A;  1M4G A;  4FUU A;  2FCK A;  5F09 A;  5JYB A;  3I3G A;  4UWI A;  3IGR A;  4NF1 A;  4DUK A;  3OWC A;  2BOA A;  4TJX A;  4B5P B;  4A32 A;  1CPS A;  2EK8 A;  1MK4 A;  3TLG A;  3K9U A;  1BPM A;  2EVN A;  3QAY A;  4XNH C;  2ZXV A;  3UY5 A;  3D7G A;  2Q44 A;  2Q04 A;  4CYQ A;  5JGF A;  2PJ6 A;  3RNZ A;  1VHS A;  3NE7 A;  3FEC A;  1NMT A;  2WPW A;  2AFZ A;  4L89 A;  4R87 A;  4R8F A;  5CNP A;  3LMS A;  1R43 A;  5CPA A;  4ZY2 A;  1Q2D A;  5C82 A;  4C99 A;  4M3S A;  3TO9 A;  3RYO A;  2HRO A;  4MFL A;  2ABZ A;  1IOI A;  3KR4 A;  3N5F A;  1EZA A;  4JVO A;  3OP0 A;  2ZOF A;  4C84 A;  4R6T A;  1PYT B;  4KOW A;  1DTD A;  1JQG A;  2ATR A;  5A27 A;  4CO9 A;  3KRV A;  3EC4 A;  1BLL E;  4RN7 A;  5HVF A;  1YW4 A;  3V38 A;  4B14 A;  2OZH A;  1B6B A;  2YGW A;  1C30 B;  2Q51 A;  4KLV A;  4BD9 A;  3HPG G;  3O8Z A;  2Z3M A;  1VKC A;  3IU1 A;  3H4Q A;  4AVA A;  2ZEH A;  4XPL A;  4E94 A;  4KVO E;  4W9Y A;  4P6Y A;  4C9A A;  3ICU A;  2R8V A;  2VZZ A;  4B6Z A;  4CS0 B;  3PRT A;  3ISZ A;  3SHP A;  4OIW A;  4IHM A;  1A9X B;  2NMT A;  3R9E A;  4F0X A;  4MJ8 A;  1MJ9 A;  3B3S A;  3CXS A;  1UFH A;  3KQZ A;  5GCN A;  4KOX A;  4BMH A;  1U6M A;  1CP7 A;  3B3C A;  2A4N A;  2B5G B;  4A30 A;  5JPH A;  3BI0 A;  4PSW A;  4IAV A;  3MRU A;  2JBJ A;  3SJF A;  4OLL A;  4OC4 A;  3S9M A;  2B4D B;  2C1C A;  1XRY A;  2CNS A;  3D66 A;  4H6Z A;  4O23 A;  4B13 A;  4II9 A;  1XMT A;  3DDD A;  3PB4 X;  4MRI A;  4NGM A;  3S6F A;  4CZ1 A;  2K5T A;  4NGQ A;  1VGY A;  1Z2L A;  4M6I A;  4R3L A;  3I9S A;  1FY7 A;  5KTA A;  3P2F A;  2PSW A;  1XMB A;  2FVG A;  2CTC A;  2Y1N A;  1ELM P;  3D68 A;  1FNO A;  3JVN A;  2P6E A;  4JXR A;  2OR4 A;  2VEZ A;  3TOA A;  1B47 A;  4C2Z A;  5HVG A;  3R96 A;  2G3T A;  4MCS A;  3HUV A;  5H86 A;  4ZI6 A;  5EC4 A;  3KZW A;  1ZLI A;  3FX6 A;  3PB6 X;  4MCR A;  3KAS A;  2PJB A;  4UFX A;  3RZA A;  1IID A;  4PXB A;  3WC7 A;  4CYP A;  3NFQ A;  1CJW A;  3K9T A;  4B5P A;  3VRQ A;  2PR1 A;  2FIW A;  3BUM B;  3CXP A;  4MFK A;  5JH9 A;  2EO8 A;  4QUS A;  3GYA A;  4H6U A;  2EZC A;  3GUX A;  4CAF A;  4C86 A;  3EXN A;  4JLY A;  2YND A;  3IO1 A;  4WWV A;  1S7L A;  2GAN A;  2Q4Y A;  2J8R A; 
#chains in the Genus database with same CATH homology
 1QQ9 A;  2PVV A;  1XFO A;  2PJ3 A;  4OC1 A;  2PRQ A;  3H8F A;  1ZG7 A;  3NFZ A;  5LYF A;  4OC0 A;  1LAP A;  3FJU A;  1WVM A;  5LYI A;  3IWW A;  3VH9 A;  3B3V A;  5ELY A;  1CG2 A;  3H8G A;  4X3R A;  4C9R A;  4CPA A;  4FBE A;  1Q7L A;  5D8N A;  1NSA A;  3WT4 A;  4P44 A;  3WAB A;  4A38 A;  1LAM A;  1Y0R A;  4AXV A;  1TKH A;  2Q43 A;  3CT9 A;  1XJO A;  2XEF A;  3NH8 A;  2ZEO A;  2EK9 A;  4X2T A;  4YU9 A;  4OP4 A;  3K2K A;  5HXD A;  2PJ7 A;  2BCO A;  2GLF A;  3B3W A;  1EE3 P;  1AYE A;  4C8C A;  3KHX A;  3KI9 A;  4MCQ A;  2I3C A;  3B2Y A;  4EME A;  5CBM A;  1TF9 A;  3D67 A;  3SI2 A;  1H8L A;  1Z8L A;  4Z65 A;  1Y0Y A;  2PJ0 A;  1KWM A;  2PJ2 A;  3KL9 A;  3WC5 A;  3KHZ A;  5D29 A;  1BPN A;  2ZEG A;  2PJC A;  4ZX8 A;  1TF8 A;  3VTA A;  8CPA A;  3PB8 X;  4K3N A;  2JEW A;  3PFO A;  5DS0 A;  5J1Q A;  4TNU A;  4YN3 A;  4MHN A;  5I4M A;  2PIZ A;  2ZOG A;  5LYD A;  5K8M A;  4MCP A;  2F7V A;  4PXD A;  4OME A;  2V77 A;  2C6G A;  2WYR A;  4OC5 A;  3VAR A;  3KGQ A;  1YW6 A;  1Y9Z A;  4GM5 A;  2PJA A;  2CF4 A;  4H2K A;  1UWY A;  4PQA A;  2QJ8 A;  4ZY0 A;  4NJR A;  4UIA A;  3NH5 A;  3ISX A;  1LFW A;  4KNG E;  2GP4 A;  2NYQ A;  3S9L A;  3PEI A;  5K8O A;  3EIF A;  4NGN A;  2GLJ A;  3H8E A;  1VHO A;  5LYL A;  4CDJ A;  1IGB A;  3RBU A;  3PB9 X;  1XF1 A;  2JBK A;  3B3T A;  4OC2 A;  1IY7 A;  2V8G A;  4UF4 A;  3DLJ A;  1F57 A;  2PJ5 A;  2OOT A;  2ZEF A;  2ZED A;  4OID A;  1ARL A;  1HEE A;  4MHZ A;  4UEZ A;  3TC8 A;  4A94 A;  1CPX A;  1CP6 A;  3CPA A;  3PB7 X;  5IR2 A;  2XEG A;  4KSI A;  2HC9 A;  5JM6 A;  4FWU A;  2V8H A;  5LRJ A;  1LOK A;  3VAT A;  3NH4 A;  2PE3 A;  2Q4Z A;  3SJG A;  2VL1 A;  5IB9 A;  4MHY A;  4C85 A;  4JYW A;  4P4B A;  4F8Z A;  2RFH A;  4F9V A;  4WJB A;  3TX8 A;  4C8T A;  3RAM A;  2BO9 A;  3B35 A;  4P4F A;  1Z5R A;  3MN8 A;  2PJ8 A;  2CTB A;  2ZEE A;  2C6C A;  1LCP A;  2PJ1 A;  3JRU A;  4UEE A;  4P4E A;  1CBX A;  1ZG9 A;  2G9D A;  2IJZ A;  3IC1 A;  4G1P A;  2AFU A;  2GRE A;  2PVW A;  3QNV A;  4MMO A;  2V8V A;  4NJQ A;  1BAV A;  1TXR A;  1ARM A;  2C6P A;  1QMU A;  2EWB A;  2POK A;  1HDQ A;  1XBU A;  4C9E A;  3CDX A;  4C8F A;  3PBB A;  4ZY1 A;  3PFE A;  1F2P A;  3KR5 A;  3FEE A;  3BI1 A;  4OC3 A;  2AFX A;  2V8D A;  4MHP A;  3T8W A;  4Q7A A;  1M4L A;  3LWU A;  3SI1 A;  4OKO A;  3DGV A;  4TWE A;  2WZN A;  3HLP A;  4YWY A;  1TKF A;  3FH4 A;  3D7F A;  1OBR A;  1ZLH A;  3CPX A;  4C9U A;  4UIB A;  4R7M A;  1YLO A;  3BXM A;  3NA6 A;  1DE4 C;  3D7D A;  4ONW A;  4RUH A;  3FED A;  2ZEL A;  1F2O A;  2PIY A;  2C5Q A;  5HVH A;  2QYV A;  2J9A A;  1GYT A;  1VHE A;  4C8U A;  2O53 A;  3IEH A;  4PXC A;  5LRK A;  4EWT A;  4CDK A;  3I74 A;  3SJX A;  5THW A;  4C8P A;  1AMP A;  3IFE A;  1YSJ A;  2PJ9 A;  4DJL A;  4JZ0 A;  1HDU A;  4P4I A;  4PXE A;  2RB7 A;  2IMO A;  4A39 A;  4X8I A;  4NGP A;  4P4J A;  2O4H A;  4NFR A;  4NGR A;  3B7I A;  1PCA A;  3GB0 A;  2QVP A;  4C8A A;  1V6C A;  1TKJ A;  2ANP A;  2ZEN A;  1ELL P;  4FAI A;  2DEA A;  4P4D A;  2PCU A;  4PPZ A;  1ZG8 A;  3WC6 A;  3V7Z A;  2PJ4 A;  2XEJ A;  3S9N A;  1FT7 A;  1RTQ A;  4NGT A;  3FMC A;  3FF3 A;  2HB6 A;  4TJV A;  2GU2 A;  4UEF A;  4A37 A;  3SJE A;  2XEI A;  3PBE A;  4MXU A;  5K8N A;  2AFM A;  3D4U A;  4NGS A;  4P10 A;  2ZEP A;  1VIX A;  3L2N A;  2ZEM A;  4C9V A;  3GLJ A;  1CX8 A;  2AFW A;  4LQG A;  3IIB A;  1YME A;  4R76 A;  2AFO A;  2F8H A;  3IJ3 A;  4ZYQ A;  6CPA A;  4EFD A;  5K8P A;  3I6S A;  3FVL A;  3I1U A;  5LRG A;  4P45 A;  2NSM A;  2CIJ A;  4F9U A;  1LAN A;  7CPA A;  1Y7E A;  4DYO A;  3BHX A;  3KQX A;  2IQ6 A;  2AFS A;  1R3N A;  4ZX9 A;  3D7H A;  3SI0 A;  4IK2 A;  4FUU A;  5F09 A;  4DUK A;  2BOA A;  4TJX A;  1CPS A;  2EK8 A;  1BPM A;  3D7G A;  5JGF A;  2PJ6 A;  3FEC A;  2AFZ A;  4R8F A;  5CPA A;  3LMS A;  1R43 A;  4ZY2 A;  4C99 A;  2ABZ A;  3KR4 A;  3N5F A;  2ZOF A;  4C84 A;  4R6T A;  1PYT B;  1DTD A;  1JQG A;  1BLL E;  5HVF A;  3V38 A;  1YW4 A;  2Q51 A;  4BD9 A;  2ZEH A;  4W9Y A;  4P6Y A;  4C9A A;  3ICU A;  4B6Z A;  3PRT A;  3ISZ A;  4OIW A;  4IHM A;  3B3S A;  3KQZ A;  1CP7 A;  3B3C A;  3BI0 A;  4IAV A;  3MRU A;  2JBJ A;  3SJF A;  4OC4 A;  3S9M A;  2C1C A;  1XRY A;  4O23 A;  3D66 A;  3PB4 X;  4MRI A;  4NGM A;  4NGQ A;  1VGY A;  1Z2L A;  1XMB A;  2FVG A;  2CTC A;  1ELM P;  3D68 A;  1FNO A;  2OR4 A;  5HVG A;  3HUV A;  4MCS A;  4ZI6 A;  3KZW A;  1ZLI A;  3FX6 A;  3PB6 X;  4MCR A;  3KAS A;  2PJB A;  3RZA A;  4PXB A;  3WC7 A;  3K9T A;  5JH9 A;  3GUX A;  4C86 A;  3IO1 A;  4WWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...