3BXMA

Structure of an inactive mutant of human glutamate carboxypeptidase ii [gcpii(e424a)] in complex with n-acetyl-asp-glu (naag)
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reaction mechanism of glutamate carboxypeptidase II revealed by mutagenesis, X-ray crystallography, and computational methods.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bxmA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bxmA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bxmA02
1CG2A 3S9NA 3GB0A 1LANA 3FJUA 1TXRA 4RUHA 1ZG9A 4A39A 3KZWA 4TNUA 2BO9A 1WVMA 2PJ6A 4TWEA 2PRQA 2CTBA 3LMSA 4PQAA 4EFDA 4LQGA 1TF8A 4C84A 2ZOFA 2IMOA 2XEIA 3TC8A 1JQGA 3WC5A 4C8CA 1NSAA 3K2KA 2C6PA 3WC6A 4OMEA 4C8FA 2POKA 3D7HA 5LRJA 5I4MA 3V38A 2C1CA 4YWYA 1F2PA 6CPAA 3IFEA 4OP4A 1XJOA 5F09A 1HDUA 1ZG8A 5LRKA 1DTDA 3PFOA 4FUUA 4ZX8A 2JEWA 3BXMA 5JM6A 2HB6A 3D7FA 3VARA 1F57A 4ZX9A 4MHNA 2DEAA 5ELYA 4CDKA 3NA6A 4DYOA 1PCAA 2PJAA 3NH4A 3MRUA 3FMCA 3GLJA 4TJXA 3VATA 1HEEA 2V77A 4Q7AA 3D7GA 3D68A 4MCQA 2NSMA 1BPNA 4NGTA 5K8OA 3HUVA 5DS0A 2G9DA 2QJ8A 1HDQA 2PJCA 3H8FA 4FAIA 1XRYA 5HVHA 4ZY0A 4P4EA 4OC5A 2PJ1A 4ZYQA 4WJBA 3B3CA 4C8TA 4PPZA 4P4BA 4PXEA 3PB6X 1M4LA 1VGYA 4B6ZA 2GREA 4C8UA 2PJ5A 4OC0A 4UIAA 4C8AA 4IHMA 4P10A 3IIBA 4P6YA 1YSJA 5LYDA 2V8HA 2IJZA 1AYEA 1ZLIA 2QYVA 2BCOA 3B3VA 3I1UA 5IB9A 5LYIA 2PJ9A 3WC7A 4P45A 4MHPA 4ZY1A 4K3NA 3I6SA 2PJ2A 4TJVA 1TKJA 4DJLA 2AFSA 1LCPA 3KR4A 4KNGE 4OC1A 1CP6A 1R43A 4YU9A 3SI1A 2Q43A 2O4HA 3FX6A 4W9YA 2XEFA 2PJ8A 2F8HA 2ANPA 4P44A 2WZNA 1QMUA 2ZENA 2GLJA 3B7IA 2HC9A 1ELLP 4F9VA 2O53A 5LYLA 2PCUA 4NGRA 1Y0RA 2V8DA 4FBEA 4GM5A 2EK9A 3DLJA 3FECA 3N5FA 4X3RA 2ZEDA 4UF4A 4C85A 5HXDA 4UEEA 1Z8LA 4NGQA 3KR5A 3RBUA 3SJEA 2FVGA 1DE4C 3KHZA 5JH9A 4R8FA 1UWYA 4CPAA 2ABZA 3PEIA 2OOTA 7CPAA 2F7VA 4EWTA 3D67A 1ARMA 2QVPA 1ARLA 2GU2A 3B3SA 4F8ZA 4C99A 3IWWA 2IQ6A 4X8IA 4OIDA 3B3WA 3KQZA 5LRGA 3ICUA 1ZLHA 3B35A 3CPAA 3NH8A 2AFXA 2AFOA 4C9UA 3NH5A 4C8PA 1LFWA 3B3TA 4UEZA 4A94A 4NGPA 2XEJA 2CF4A 4A38A 1XBUA 3IC1A 4FWUA 4MCRA 3IEHA 4MHYA 4UEFA 4OC4A 3SI2A 1LOKA 3HLPA 1GYTA 3D7DA 1FNOA 3CT9A 1KWMA 3KGQA 4OC3A 4MRIA 4YN3A 1LAMA 1LAPA 3PBEA 2ZEGA 4ZY2A 4NGMA 4DUKA 1XF1A 4MCPA 2XEGA 1AMPA 2PJ4A 2Q51A 3SJXA 3BI0A 4OIWA 1QQ9A 5K8MA 1Z2LA 3PB4X 3VH9A 3KHXA 5HVFA 1Y7EA 3IO1A 2AFMA 4C86A 4KSIA 1CBXA 3PB9X 1EE3P 2ZEFA 4UIBA 2PE3A 3JRUA 2EWBA 4P4DA 2JBKA 1BLLE 4A37A 2AFZA 4MHZA 4NGSA 3I74A 3CDXA 3CPXA 1V6CA 2VL1A 4Z65A 1VHOA 5JGFA 3S9MA 3KL9A 1VHEA 3B2YA 4C9AA 5K8NA 1OBRA 3BI1A 1PYTB 2NYQA 1YW4A 2PIZA 4R7MA 3PB8X 3D66A 2PJ7A 5K8PA 5THWA 2WYRA 2AFWA 2JBJA 5D29A 3VTAA 1CX8A 4MXUA 4OKOA 4PXDA 1BPMA 3KASA 4G1PA 1XMBA 4C9VA 3SI0A 3FEEA 3WT4A 1H8LA 3PBBA 2Q4ZA 2GLFA 1F2OA 1YMEA 2PJ3A 3D4UA 1ZG7A 4AXVA 3FEDA 1CPXA 3KI9A 4MMOA 4NJRA 4C9EA 5J1QA 2PIYA 4P4FA 4ZI6A 1CP7A 3H8EA 1Y0YA 4NJQA 4BD9A 2PVVA 3PFEA 2I3CA 4P4JA 3NFZA 1Z5RA 1TKHA 2CTCA 4R76A 4X2TA 4IK2A 3BHXA 1IY7A 4OC2A 3S9LA 1CPSA 2PJ0A 4JZ0A 3MN8A 5HVGA 2ZEOA 2RFHA 4C9RA 2EK8A 3DGVA 3ISZA 2ZEMA 4JYWA 3WABA 3FH4A 3ISXA 3SJFA 2ZEEA 4H2KA 3K9TA 2V8VA 4EMEA 3GUXA 1XFOA 1FT7A 3KQXA 3PRTA 3TX8A 1R3NA 3IJ3A 1YW6A 2PJBA 2BOAA 1YLOA 4NGNA 1IGBA 4IAVA 3T8WA 1BAVA 3V7ZA 2PVWA 4R6TA 3QNVA 4ONWA 2C6CA 3H8GA 3EIFA 2ZEHA 1TF9A 2ZEPA 2CIJA 2ZELA 1RTQA 8CPAA 4P4IA 4PXCA 4CDJA 4O23A 3L2NA 2C6GA 4PXBA 5LYFA 1VIXA 5CBMA 4F9UA 3FVLA 2RB7A 4NFRA 5D8NA 4MCSA 3SJGA 2J9AA 2V8GA 3RZAA 3RAMA 1TKFA 2AFUA 3PB7X 2ZOGA 1Q7LA 3LWUA 2OR4A 4WWVA 1Y9ZA 3FF3A 1ELMP 5CPAA
chains in the Genus database with same CATH superfamily
1CG2A 2EBJA 3S9NA 3GB0A 1EZBA 3VRNA 1LANA 3FJUA 2EZBA 3K4IA 1TXRA 1S3ZA 4RUHA 1YGHA 2YGWA 4IIXA 3VWDA 3CXPA 1ZG9A 4A39A 3D2MA 1KUXA 5J3XA 1BOBA 4M6HA 2F5IA 4HKFA 4DNCA 3KZWA 1IOIA 2ZW7A 4JD6A 4TNUA 1Z8TA 2BO9A 3R96A 4AB7A 1WVMA 3PT1A 2PJ6A 4A32A 4TWEA 2PRQA 2FIAA 3T07A 2CTBA 3LMSA 3FIXA 3F5BA 4BPUB 4PQAA 3NE8A 4KOXA 4XNHC 4EFDA 1N71A 4MJXA 4LQGA 1TF8A 4C84A 1WJTA 2ZOFA 2IMOA 2Q44A 5J8FA 2XEIA 2DPSA 2PR8A 3T05A 2N3AB 5F48A 3TC8A 1TIQA 1JQGA 2B3VA 3WC5A 4MJ8A 4C8CA 2DXQA 1EO0A 1OZPA 4JWPA 1NSAA 3K2KA 2NMTA 2R82A 4BMHA 3WR7A 2C6PA 3WC6A 2JDDA 2G3AA 4UFXA 4XPLA 4OMEA 2BSWA 2H5MA 1DIKA 4C8FA 2POKA 3D7HA 5IB0A 1JDBC 4FD6A 2HWGA 5LRJA 4C2ZA 3PZJA 5I4MA 3TFYA 1KZFA 4JXRA 3V38A 1IU8A 2Z11A 5I0CA 2B4JC 1AUGA 4L89A 1NBWA 4CGPA 5F1YA 1XF8A 2CNMA 2BUEA 2C1CA 2GFQA 2REFA 2Q7BA 4YWYA 3W6XA 2AUMA 5F46A 4CAFA 3OB1B 1F2PA 2P6GA 4AVAA 6CPAA 3TOBA 3G8WA 4A95A 1P0HA 2CY2A 3IFEA 4OP4A 1XJOA 3BUXB 5F09A 1HDUA 2FL4A 3DDDA 5A27A 4OLLA 4C8UA 1YVKA 2ZW5A 4A33A 1ZG8A 4XPDB 5LRKA 1DTDA 3PFOA 4FUUA 5G20A 4FD4A 5F13A 3GJZA 2GIVA 3LD2A 4CGLA 4ZX8A 2JEWA 3BXMA 4QB9A 5JM6A 2HB6A 3I9SA 3D7FA 4H89A 3VARA 2X7BA 1F57A 4ZX9A 1M6VB 4IUSA 2FM4A 1WK4A 4MHNA 2QIRA 2OZGA 1Y9KA 2B5GB 2DEAA 4NEXA 5ELYA 4QUSA 4U9YA 3NA6A 2C5QA 4KUBA 4CDKA 4DYOA 4E2AA 1PCAA 1Z8WA 2PJAA 3NE7A 1X10A 3NH4A 2PCNA 2JDCA 2WPXA 3D3SA 3FMCA 3MRUA 3GLJA 4TJXA 3VATA 1HEEA 4JLYA 4A2ZA 1U6MA 2V77A 4Q7AA 3D7GA 4MCQA 3D68A 2NSMA 1BPNA 4NGTA 4FD7A 4M8DA 4CO9A 1S7NA 5K8OA 1Q5XA 1R61A 3HUVA 5DS0A 2G9DA 2QJ8A 4KLWA 1HDQA 3EFAA 2P6EA 2O28A 2PJCA 3H8FA 4KVME 1R57A 1XRYA 4FAIA 2Q4YA 5HVHA 4ZY0A 2Z10A 4P4EA 4H1HA 4OC5A 2PJ1A 3KRVA 4ZYQA 4MFKA 4WJBA 3B3CA 4R3KA 4C8TA 4PPZA 4P4BA 4UWIA 4PXEA 2R1IA 3N7ZA 2D0PA 5JVLA 3PB6X 2AUNA 2MP0A 3TLZA 3A9LA 1M4LA 3MGDA 4R57A 4YRHA 3VWEA 5LYLA 4CAEA 4GPLB 1VGYA 4B6ZA 3VRPA 1QSTA 2GREA 3FRMA 3GY9A 4LUAA 2EZCA 5H86A 4PSXA 2PJ5A 2GP4A 2Z3MA 4UFVA 2XPLA 4AG9A 4OC0A 1C30B 3PP9A 3ZNIA 3EZBA 4M3SA 2VEZA 4KORA 4UIAA 3RNZA 5F9MA 4C8AA 3DSBA 4IHMA 4MY3A 3IIBA 4P10A 4P6YA 1YSJA 5EMIA 5LYDA 2V8HA 2IJZA 1AYEA 1IOFA 3EXNA 3FYNA 2WUUA 2D0OA 5KTCA 2UV8G 1ZLIA 2QYVA 4RS2A 2P0WA 2BCOA 3B3VA 3I1UA 4E8OA 1UFHA 5IB9A 4LX9A 1VBGA 2OLSA 2A4NA 2Q04A 5LYIA 1ZO0A 2BEIA 2PJ9A 1K4JA 3QAYA 3WC7A 4P45A 1V0CA 4MHPA 2FCKA 4ZY1A 3TT2A 4XPKA 2ZXVA 1Z4RA 4K3NA 3I6SA 2PJ2A 4TJVA 4B12A 1TKJA 4LQ6A 2B4DA 4DJLA 2E28A 3U88C 4MHDA 2AFSA 4Y49C 4IIYA 1LCPA 5F5XA 1KBLA 4MFLA 4UA3A 3BUWB 3KR4A 4KNGE 5HKWA 4OC1A 1CP6A 3TLYA 1R43A 2Z3KA 1Q2DA 4XNHB 4YU9A 4A31A 3SI1A 1SQHA 2Q43A 2O4HA 1KUYA 3CXSA 3FX6A 4W9YA 4QC6A 2XEFA 2PJ8A 5BWAB 2F8HA 4KOYA 2ANPA 4P44A 5HKYA 2WZNA 1QMUA 2ZENA 2IL4A 1NSLA 2GLJA 2G0BA 3B7IA 2HC9A 3TE4A 1ELLP 3F0AA 2B5GA 4F9VA 1P4NA 1B47A 4UWJA 3QB8A 2O53A 2AE6A 1FY7A 3GKRA 2PCUA 4NGRA 4MY0A 4U5YA 1Y0RA 5GCNA 2V8DA 4FBEA 3BUMB 4GM5A 5K99A 2EK9A 2HV2A 3FECA 2Y0MA 3OAKA 3DLJA 3N5FA 3BUOB 3VGOA 1QSMA 5F47A 5IR2A 2HI6A 4X3RA 4HNXB 1PUAA 4KOVA 2Q7SA 3TO7A 4CAXA 5CNPA 5H84A 5AGEA 3IWGA 2ZEDA 3T0TA 2WSAA 3I3GA 4UF4A 1PU9A 4NCZA 4B13A 5AG4A 4C85A 1Q2YA 5HXDA 2DF5A 4UEEA 3F9KC 4MFQA 1A9XB 4ORFA 2D4PA 1Z8LA 4NGQA 3KR5A 2I79A 3RBUA 2OU2A 4QBJA 3SJEA 2FVGA 4EVYA 4UCNA 1DE4C 3KHZA 2KCWA 2Y1NA 1Z8XA 5JH9A 4R8FA 2ARHA 4BPWB 2K5TA 1UWYA 4CYOA 4MFPA 4CPAA 4A4CA 2ABZA 3PEIA 2OOTA 4M6GA 7CPAA 2F7VA 4EWTA 4CRZB 3D67A 3SR3A 2EVNA 1ARMA 1CM0A 2QVPA 1ARLA 1IICA 2GU2A 3B3SA 4F8ZA 4C99A 2YNCC 4B5PB 3IWWA 2PRBA 4B5OA 2CXAA 2VZZA 2Z3PA 3W6SA 1VI4A 4C2YA 2IQ6A 4X8IA 3HPHE 1RO5A 3HPGG 5IV0A 1J4JA 2VXKA 4OIDA 3H5ZA 3B3WA 3KQZA 1JDEA 5LRGA 3ICUA 3O8ZA 2JLMA 1ZLHA 4PV6A 1Y7RA 2VBQA 2Q0YA 2Z0ZA 3B35A 3CPAA 3NH8A 2AFXA 4COGA 2RC4A 3W91A 1S7FA 2Y1MA 1M4GA 2AFOA 2B4BA 4UFWA 4E94A 5A28A 4C9UA 3NH5A 1Z9EA 4C8PA 1B6BA 4BPXB 1QSOA 1S60A 3FB3A 4KZTA 1LFWA 4J0NA 3B3TA 3RYOA 4UEZA 2FXFA 4J3GA 1EZAA 4A94A 4NGPA 2XEJA 2CF4A 1M44A 1VBHA 3EZEA 4A38A 3HMJG 1QSNA 1XBUA 3IC1A 4FWUA 4MCRA 1Y9WA 3IEHA 2Z3LA 1B87A 4MHYA 4PK2A 4UEFA 2QMLA 3LACA 5EBVA 4OC4A 3SI2A 1LOKA 1BXRB 4AVCA 3HLPA 4CYQA 1GYTA 4GXHA 3D7DA 2Z3OA 1FNOA 2YNEA 3CT9A 2EUIA 2ZW4A 3SXNA 1KWMA 3KGQA 4OC3A 1M4IA 2VI7A 4MRIA 2XPPA 4YN3A 3EO4A 1LAMA 1ZL0A 4NF1A 3IGRA 4GS4A 5EC4A 1LAPA 3LODA 4JJXA 4JVOA 5AG5A 4F0XA 3IU2A 3PBEA 1M1DA 3S6HA 2ZEGA 5E96A 4BTFA 4ZY2A 4NGMA 5HMNA 4DUKA 1ZYMA 2BL1A 2PQ8A 4CS0B 1XF1A 4MCPA 4RR2B 4B5PA 2XEGA 4R3LA 4B11A 1AMPA 1T36B 2PJ4A 2Q51A 3SJXA 3BI0A 3D8PA 4OIWA 1QQ9A 5K8MA 1Z2LA 3PB4X 4JXQA 1C3OB 1J3LA 3VH9A 3KHXA 5HVFA 2J8MA 4COBA 1Y7EA 2YJVA 3V8IA 4C7IA 2YJTA 3IO1A 2AFMA 3S6FA 4BINA 3DR8A 2YNCA 4C86A 4KSIA 3SHPA 1IIDA 2Q4VA 1YQEA 2R7HA 4PK3A 4II9A 2DLAA 2PDOA 3R9FA 1CBXA 3PB9X 1YLEA 1EE3P 2ZEFA 1FBVA 4CGMA 4UIBA 2PE3A 3JRUA 2EWBA 4KVOE 3FNCA 4P4DA 2JBKA 1BLLE 2FT0A 3TOAA 4A37A 2AFZA 3K9UA 4HPSA 1MK4A 4M85A 4NGSA 4MHZA 1VKCA 2I00A 4KOSA 3R9GA 1I12A 3CDXA 2VQYA 3CPXA 4CYNA 2XPOA 2PSWA 3KKWA 4C2XA 1V6CA 3BLNA 2VL1A 3IU1A 3FBUA 4C68A 3BUNB 1X12A 3PGPA 1LRZA 4B10A 4MI4A 1S7KA 4RN7A 4Q38A 4Z65A 1CS0B 1GGOA 2B0AA 1VHOA 2AJ6A 4A4BA 3TLAA 5JGFA 3S9MA 2HUZA 4KSFA 3KL9A 4E0AA 4KOTA 5G22A 1VHEA 3B2YA 4CYPA 5JQ4A 4C9AA 3DR6A 2ODFA 4AG7A 5K8NA 1OBRA 3BI1A 2B3UA 1PYTB 4KSAA 1L0CA 2NYQA 1YW4A 2PIZA 3BJ8A 3IWEA 1NXJA 5J8CA 5IX3A 4HNWB 4R7MA 5C82A 3PB8X 1MJAA 4UBRA 3ZZIA 4NSQA 3D66A 2PJ7A 3S6KA 5K8PA 5AG7A 5THWA 3P2FA 2WYRA 2OZUA 3EY5A 1IYLA 4CRYB 2AFWA 2JBJA 5D29A 2REEA 2GE3A 1NE9A 5C88A 3VTAA 2B4DB 1CX8A 4MXUA 1ZRSA 4CGOA 1VHSA 5KTAA 4OKOA 2FE7A 1BPMA 4PXDA 3ZJ0A 3T5MA 4L8AA 3KASA 4G1PA 1XE4A 1XMBA 1MJBA 4X5KA 4C9VA 4UCPA 3FEEA 3SI0A 4KOUA 3WT4A 1H8LA 3PBBA 4HNYB 3T90A 1Q2CA 2Q4ZA 2QECA 4YFJA 2D4OA 3TLGB 3NFQA 5F49A 1RXTA 1IB1E 2YNDA 1YMEA 1F2OA 1CJWA 2GLFA 2PJ3A 3D4UA 3FXTA 4UCMA 4F0YA 1KC7A 1S5KA 2VKZG 1ZG7A 4AXVA 3FEDA 4C7HA 1CPXA 2C27A 4ZBGA 3GYAA 3KI9A 4MMOA 5DWNA 3TCVA 3B8GA 4OADA 3TLGA 3SXOA 1KUVA 4E5SA 3JTKA 3OP0A 1YR0A 4Q36A 2Z3NA 4KS9A 3VRQA 3VRRA 5KTDA 2R98A 3UY5A 4NJRA 3I74A 4C9EA 5J1QA 1KEEB 3C8OA 2PIYA 4P4FA 4ZI6A 1S7LA 1ON0A 1I1DA 3R1KA 4B14A 1MJ9A 5JYBA 1CP7A 1BO4A 1CE8B 2CNTA 3U1BA 4PSWA 5FD8A 3H8EA 1Y0YA 2EZAA 1YREA 4H6UA 4MFZA 4NJQA 4BD9A 2PVVA 1XIXA 2B58A 3PFEA 4I49A 1YX0A 2CBLA 5AG6A 2I3CA 4P4JA 2DIKA 3PLFB 1Z9UA 3CXQA 3NFZA 3JVNA 1Z5RA 1TKHA 4K30A 2R8VA 1JWQA 2JEVA 3C26A 2CTCA 5FVJA 5JPHA 3P2HA 4INJA 4EYSA 4R76A 4X2TA 3D2PA 5DWMA 4CGNA 3E0KA 4IK2A 3BHXA 1IY7A 3EZAA 1YVHA 4OC2A 3S9LA 4KLVA 1CPSA 2EO8A 2PJ0A 4XPDC 2X0SA 3GIUA 4JZ0A 3T9YA 3MN8A 5HVGA 1GHEA 2ZEOA 2XPNA 2RFHA 4C9RA 2EK8A 1M4DA 2OB0A 2ZEMA 4JYWA 2PR1A 3DGVA 3ISZA 4H6ZA 4Y49B 3WABA 1IYKA 5BY0A 4CZ1A 1XOVA 3FH4A 3ISXA 3SJFA 2OH1A 4MFJA 3PFVA 2ZEEA 4H2KA 4R9MA 3K9TA 2V8VA 3VROA 4EMEA 3GUXA 1XFOA 1FT7A 2G3TA 2J8NA 3KQXA 1R3NA 3PRTA 3R95A 3TX8A 3G3SA 3IJ3A 1YVOA 3TLCA 3TLBA 1YW6A 5HKZA 1YK3A 2PJBA 1A2ZA 2P6FA 5AXIA 2BOAA 3JUWA 4FD5A 1YLOA 4A30A 4NGNA 1QSRA 2HROA 3F8KA 3EC4A 1IGBA 4IAVA 5ISVA 3CZXA 3QAHA 3NOJA 3T8WA 2VZYA 1BAVA 3V7ZA 3TTHA 1XEBA 3TYXA 2PVWA 4NXYA 3QNVA 4R6TA 5G1ZA 3H4QA 4ONWA 2C6CA 2ZW6A 3RO0A 3H8GA 4AVBA 3EIFA 2ZEHA 1TF9A 2ZEPA 3BJ7A 3OWCA 3G23A 2CIJA 4MI1A 4KUAA 2ZELA 1RTQA 8CPAA 4P4IA 4ZGYB 4MBUA 4PXCA 3S6GA 4KVXA 4CDJA 1Z4EA 4O23A 2CNSA 2C6GA 3DNSA 3L2NA 4PXBA 4U9ZA 4F6AA 2FIWA 5HH1A 5LYFA 1NMTA 1VIXA 2HQYA 2ZPAA 4F9UA 3FVLA 5CBMA 2RB7A 3R9EA 1I21A 4NFRA 5D8NA 4CAWA 4IF5A 4MCSA 2ATRA 3TO9A 4BBHA 3SJGA 2FSRA 3TO6A 2J8RA 4QVTA 4YGOA 2DPTA 3OB2B 2J9AA 2GANA 2V8GA 4CAVA 1XMTA 4R87A 3RZAA 2WPWA 5G21A 4RI1A 3RAMA 1WWZA 4KOWA 3TLEA 2AFUA 1TKFA 3PB7X 2ZOGA 4OAEA 1Q7LA 4M6IA 2FS5A 4ONUA 3LWUA 2OR4A 2PC1A 4WWVA 2OZHA 3FF3A 1Y9ZA 1ELMP 5CPAA
chains in the Genus database with same CATH topology
1CG2A 3S9NA 3GB0A 1LANA 3FJUA 1TXRA 4RUHA 1ZG9A 4A39A 3KZWA 4TNUA 2BO9A 1WVMA 2PJ6A 4TWEA 2PRQA 2CTBA 3LMSA 4PQAA 4EFDA 4LQGA 1TF8A 4C84A 2ZOFA 2IMOA 2XEIA 3TC8A 1JQGA 3WC5A 4C8CA 1NSAA 3K2KA 2C6PA 3WC6A 4OMEA 4C8FA 2POKA 3D7HA 5LRJA 5I4MA 3V38A 2C1CA 4YWYA 1F2PA 6CPAA 3IFEA 4OP4A 1XJOA 5F09A 1HDUA 1ZG8A 5LRKA 1DTDA 3PFOA 4FUUA 4ZX8A 2JEWA 3BXMA 5JM6A 2HB6A 3D7FA 3VARA 1F57A 4ZX9A 4MHNA 2DEAA 5ELYA 2C5QA 4CDKA 3NA6A 4DYOA 1PCAA 2PJAA 3NH4A 3MRUA 3FMCA 3GLJA 4TJXA 3VATA 1HEEA 2V77A 4Q7AA 3D7GA 3D68A 4MCQA 2NSMA 1BPNA 4NGTA 5K8OA 3HUVA 5DS0A 2G9DA 2QJ8A 1HDQA 2PJCA 3H8FA 4FAIA 1XRYA 5HVHA 4ZY0A 4P4EA 4OC5A 2PJ1A 4ZYQA 4WJBA 3B3CA 4C8TA 4PPZA 4P4BA 4PXEA 3PB6X 1M4LA 1VGYA 4B6ZA 2GREA 4C8UA 2PJ5A 2GP4A 4OC0A 4UIAA 4C8AA 4IHMA 4P10A 3IIBA 4P6YA 1YSJA 5LYDA 2V8HA 2IJZA 1AYEA 1ZLIA 2QYVA 2BCOA 3B3VA 3I1UA 5IB9A 5LYIA 2PJ9A 3WC7A 4P45A 4MHPA 4ZY1A 4K3NA 3I6SA 2PJ2A 4TJVA 1TKJA 4DJLA 2AFSA 1LCPA 3KR4A 4KNGE 4OC1A 1CP6A 1R43A 4YU9A 3SI1A 2Q43A 2O4HA 3FX6A 4W9YA 2XEFA 2PJ8A 2F8HA 2ANPA 4P44A 2WZNA 1QMUA 2ZENA 2GLJA 3B7IA 2HC9A 1ELLP 4F9VA 2O53A 5LYLA 2PCUA 4NGRA 1Y0RA 2V8DA 4FBEA 4GM5A 2EK9A 3DLJA 3FECA 3N5FA 5IR2A 4X3RA 2ZEDA 4UF4A 4C85A 5HXDA 4UEEA 1Z8LA 4NGQA 3KR5A 3RBUA 3SJEA 2FVGA 1DE4C 3KHZA 5JH9A 4R8FA 1UWYA 4CPAA 2ABZA 3PEIA 2OOTA 7CPAA 2F7VA 4EWTA 3D67A 1ARMA 2QVPA 1ARLA 2GU2A 3B3SA 4F8ZA 4C99A 3IWWA 2IQ6A 4X8IA 4OIDA 3B3WA 3KQZA 5LRGA 3ICUA 1ZLHA 3B35A 3CPAA 3NH8A 2AFXA 2AFOA 4C9UA 3NH5A 4C8PA 1LFWA 3B3TA 4UEZA 4A94A 4NGPA 2XEJA 2CF4A 4A38A 1XBUA 3IC1A 4FWUA 4MCRA 3IEHA 4MHYA 4UEFA 4OC4A 3SI2A 1LOKA 3HLPA 1GYTA 3D7DA 1FNOA 3CT9A 1KWMA 3KGQA 4OC3A 4MRIA 4YN3A 1LAMA 1LAPA 3PBEA 2ZEGA 4ZY2A 4NGMA 4DUKA 1XF1A 4MCPA 2XEGA 1AMPA 2PJ4A 2Q51A 3SJXA 3BI0A 4OIWA 1QQ9A 5K8MA 1Z2LA 3PB4X 3VH9A 3KHXA 5HVFA 1Y7EA 3IO1A 2AFMA 4C86A 4KSIA 1CBXA 3PB9X 1EE3P 2ZEFA 4UIBA 2PE3A 3JRUA 2EWBA 4P4DA 2JBKA 1BLLE 4A37A 2AFZA 4MHZA 4NGSA 3I74A 3CDXA 3CPXA 1V6CA 2VL1A 4Z65A 1VHOA 5JGFA 3S9MA 3KL9A 1VHEA 3B2YA 4C9AA 5K8NA 1OBRA 3BI1A 1PYTB 2NYQA 1YW4A 2PIZA 4R7MA 3PB8X 3D66A 2PJ7A 5K8PA 5THWA 2WYRA 2AFWA 2JBJA 5D29A 3VTAA 1CX8A 4MXUA 4OKOA 4PXDA 1BPMA 3KASA 4G1PA 1XMBA 4C9VA 3SI0A 3FEEA 3WT4A 1H8LA 3PBBA 2Q4ZA 2GLFA 1F2OA 1YMEA 2PJ3A 3D4UA 1ZG7A 4AXVA 3FEDA 1CPXA 3KI9A 4MMOA 4NJRA 4C9EA 5J1QA 2PIYA 4P4FA 4ZI6A 1CP7A 3H8EA 1Y0YA 4NJQA 4BD9A 2PVVA 3PFEA 2I3CA 4P4JA 3NFZA 1Z5RA 1TKHA 2CTCA 4R76A 4X2TA 4IK2A 3BHXA 1IY7A 4OC2A 3S9LA 1CPSA 2PJ0A 4JZ0A 3MN8A 5HVGA 2ZEOA 2RFHA 4C9RA 2EK8A 3DGVA 3ISZA 2ZEMA 4JYWA 3WABA 3FH4A 3ISXA 3SJFA 2ZEEA 4H2KA 3K9TA 2V8VA 4EMEA 3GUXA 1XFOA 1FT7A 3KQXA 3PRTA 3TX8A 1R3NA 3IJ3A 1YW6A 2PJBA 2BOAA 1YLOA 4NGNA 1IGBA 4IAVA 3T8WA 1BAVA 3V7ZA 2PVWA 4R6TA 3QNVA 4ONWA 2C6CA 3H8GA 3EIFA 2ZEHA 1TF9A 2ZEPA 2CIJA 2ZELA 1RTQA 8CPAA 4P4IA 4PXCA 4CDJA 4O23A 3L2NA 2C6GA 4PXBA 5LYFA 1VIXA 5CBMA 4F9UA 3FVLA 2RB7A 4NFRA 5D8NA 4MCSA 3SJGA 2J9AA 2V8GA 3RZAA 3RAMA 1TKFA 2AFUA 3PB7X 2ZOGA 1Q7LA 3LWUA 2OR4A 4WWVA 1Y9ZA 3FF3A 1ELMP 5CPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CG2 A;  3S9N A;  3GB0 A;  1LAN A;  3FJU A;  1TXR A;  4RUH A;  1ZG9 A;  4A39 A;  3KZW A;  4TNU A;  2BO9 A;  1WVM A;  2PJ6 A;  4TWE A;  2PRQ A;  2CTB A;  3LMS A;  4PQA A;  4EFD A;  4LQG A;  1TF8 A;  4C84 A;  2ZOF A;  2IMO A;  2XEI A;  3TC8 A;  1JQG A;  3WC5 A;  4C8C A;  1NSA A;  3K2K A;  2C6P A;  3WC6 A;  4OME A;  4C8F A;  2POK A;  3D7H A;  5LRJ A;  5I4M A;  3V38 A;  2C1C A;  4YWY A;  1F2P A;  6CPA A;  3IFE A;  4OP4 A;  1XJO A;  5F09 A;  1HDU A;  1ZG8 A;  5LRK A;  1DTD A;  3PFO A;  4FUU A;  4ZX8 A;  2JEW A;  3BXM A;  5JM6 A;  2HB6 A;  3D7F A;  3VAR A;  1F57 A;  4ZX9 A;  4MHN A;  2DEA A;  5ELY A;  4CDK A;  3NA6 A;  4DYO A;  1PCA A;  2PJA A;  3NH4 A;  3MRU A;  3FMC A;  3GLJ A;  4TJX A;  3VAT A;  1HEE A;  2V77 A;  4Q7A A;  3D7G A;  3D68 A;  4MCQ A;  2NSM A;  1BPN A;  4NGT A;  5K8O A;  3HUV A;  5DS0 A;  2G9D A;  2QJ8 A;  1HDQ A;  2PJC A;  3H8F A;  4FAI A;  1XRY A;  5HVH A;  4ZY0 A;  4P4E A;  4OC5 A;  2PJ1 A;  4ZYQ A;  4WJB A;  3B3C A;  4C8T A;  4PPZ A;  4P4B A;  4PXE A;  3PB6 X;  1M4L A;  1VGY A;  4B6Z A;  2GRE A;  4C8U A;  2PJ5 A;  4OC0 A;  4UIA A;  4C8A A;  4IHM A;  4P10 A;  3IIB A;  4P6Y A;  1YSJ A;  5LYD A;  2V8H A;  2IJZ A;  1AYE A;  1ZLI A;  2QYV A;  2BCO A;  3B3V A;  3I1U A;  5IB9 A;  5LYI A;  2PJ9 A;  3WC7 A;  4P45 A;  4MHP A;  4ZY1 A;  4K3N A;  3I6S A;  2PJ2 A;  4TJV A;  1TKJ A;  4DJL A;  2AFS A;  1LCP A;  3KR4 A;  4KNG E;  4OC1 A;  1CP6 A;  1R43 A;  4YU9 A;  3SI1 A;  2Q43 A;  2O4H A;  3FX6 A;  4W9Y A;  2XEF A;  2PJ8 A;  2F8H A;  2ANP A;  4P44 A;  2WZN A;  1QMU A;  2ZEN A;  2GLJ A;  3B7I A;  2HC9 A;  1ELL P;  4F9V A;  2O53 A;  5LYL A;  2PCU A;  4NGR A;  1Y0R A;  2V8D A;  4FBE A;  4GM5 A;  2EK9 A;  3DLJ A;  3FEC A;  3N5F A;  4X3R A;  2ZED A;  4UF4 A;  4C85 A;  5HXD A;  4UEE A;  1Z8L A;  4NGQ A;  3KR5 A;  3RBU A;  3SJE A;  2FVG A;  1DE4 C;  3KHZ A;  5JH9 A;  4R8F A;  1UWY A;  4CPA A;  2ABZ A;  3PEI A;  2OOT A;  7CPA A;  2F7V A;  4EWT A;  3D67 A;  1ARM A;  2QVP A;  1ARL A;  2GU2 A;  3B3S A;  4F8Z A;  4C99 A;  3IWW A;  2IQ6 A;  4X8I A;  4OID A;  3B3W A;  3KQZ A;  5LRG A;  3ICU A;  1ZLH A;  3B35 A;  3CPA A;  3NH8 A;  2AFX A;  2AFO A;  4C9U A;  3NH5 A;  4C8P A;  1LFW A;  3B3T A;  4UEZ A;  4A94 A;  4NGP A;  2XEJ A;  2CF4 A;  4A38 A;  1XBU A;  3IC1 A;  4FWU A;  4MCR A;  3IEH A;  4MHY A;  4UEF A;  4OC4 A;  3SI2 A;  1LOK A;  3HLP A;  1GYT A;  3D7D A;  1FNO A;  3CT9 A;  1KWM A;  3KGQ A;  4OC3 A;  4MRI A;  4YN3 A;  1LAM A;  1LAP A;  3PBE A;  2ZEG A;  4ZY2 A;  4NGM A;  4DUK A;  1XF1 A;  4MCP A;  2XEG A;  1AMP A;  2PJ4 A;  2Q51 A;  3SJX A;  3BI0 A;  4OIW A;  1QQ9 A;  5K8M A;  1Z2L A;  3PB4 X;  3VH9 A;  3KHX A;  5HVF A;  1Y7E A;  3IO1 A;  2AFM A;  4C86 A;  4KSI A;  1CBX A;  3PB9 X;  1EE3 P;  2ZEF A;  4UIB A;  2PE3 A;  3JRU A;  2EWB A;  4P4D A;  2JBK A;  1BLL E;  4A37 A;  2AFZ A;  4MHZ A;  4NGS A;  3I74 A;  3CDX A;  3CPX A;  1V6C A;  2VL1 A;  4Z65 A;  1VHO A;  5JGF A;  3S9M A;  3KL9 A;  1VHE A;  3B2Y A;  4C9A A;  5K8N A;  1OBR A;  3BI1 A;  1PYT B;  2NYQ A;  1YW4 A;  2PIZ A;  4R7M A;  3PB8 X;  3D66 A;  2PJ7 A;  5K8P A;  5THW A;  2WYR A;  2AFW A;  2JBJ A;  5D29 A;  3VTA A;  1CX8 A;  4MXU A;  4OKO A;  4PXD A;  1BPM A;  3KAS A;  4G1P A;  1XMB A;  4C9V A;  3SI0 A;  3FEE A;  3WT4 A;  1H8L A;  3PBB A;  2Q4Z A;  2GLF A;  1F2O A;  1YME A;  2PJ3 A;  3D4U A;  1ZG7 A;  4AXV A;  3FED A;  1CPX A;  3KI9 A;  4MMO A;  4NJR A;  4C9E A;  5J1Q A;  2PIY A;  4P4F A;  4ZI6 A;  1CP7 A;  3H8E A;  1Y0Y A;  4NJQ A;  4BD9 A;  2PVV A;  3PFE A;  2I3C A;  4P4J A;  3NFZ A;  1Z5R A;  1TKH A;  2CTC A;  4R76 A;  4X2T A;  4IK2 A;  3BHX A;  1IY7 A;  4OC2 A;  3S9L A;  1CPS A;  2PJ0 A;  4JZ0 A;  3MN8 A;  5HVG A;  2ZEO A;  2RFH A;  4C9R A;  2EK8 A;  3DGV A;  3ISZ A;  2ZEM A;  4JYW A;  3WAB A;  3FH4 A;  3ISX A;  3SJF A;  2ZEE A;  4H2K A;  3K9T A;  2V8V A;  4EME A;  3GUX A;  1XFO A;  1FT7 A;  3KQX A;  3PRT A;  3TX8 A;  1R3N A;  3IJ3 A;  1YW6 A;  2PJB A;  2BOA A;  1YLO A;  4NGN A;  1IGB A;  4IAV A;  3T8W A;  1BAV A;  3V7Z A;  2PVW A;  4R6T A;  3QNV A;  4ONW A;  2C6C A;  3H8G A;  3EIF A;  2ZEH A;  1TF9 A;  2ZEP A;  2CIJ A;  2ZEL A;  1RTQ A;  8CPA A;  4P4I A;  4PXC A;  4CDJ A;  4O23 A;  3L2N A;  2C6G A;  4PXB A;  5LYF A;  1VIX A;  5CBM A;  4F9U A;  3FVL A;  2RB7 A;  4NFR A;  5D8N A;  4MCS A;  3SJG A;  2J9A A;  2V8G A;  3RZA A;  3RAM A;  1TKF A;  2AFU A;  3PB7 X;  2ZOG A;  1Q7L A;  3LWU A;  2OR4 A;  4WWV A;  1Y9Z A;  3FF3 A;  1ELM P;  5CPA A; 
#chains in the Genus database with same CATH topology
 1CG2 A;  2EBJ A;  3S9N A;  3GB0 A;  1EZB A;  3VRN A;  1LAN A;  3FJU A;  2EZB A;  3K4I A;  1TXR A;  1S3Z A;  4RUH A;  1YGH A;  2YGW A;  4IIX A;  3VWD A;  3CXP A;  1ZG9 A;  4A39 A;  3D2M A;  1KUX A;  5J3X A;  1BOB A;  4M6H A;  2F5I A;  4HKF A;  4DNC A;  3KZW A;  1IOI A;  2ZW7 A;  4JD6 A;  4TNU A;  1Z8T A;  2BO9 A;  3R96 A;  4AB7 A;  1WVM A;  3PT1 A;  2PJ6 A;  4A32 A;  4TWE A;  2PRQ A;  2FIA A;  3T07 A;  2CTB A;  3LMS A;  3FIX A;  3F5B A;  4BPU B;  4PQA A;  3NE8 A;  4KOX A;  4XNH C;  4EFD A;  1N71 A;  4MJX A;  4LQG A;  1TF8 A;  4C84 A;  1WJT A;  2ZOF A;  2IMO A;  2Q44 A;  5J8F A;  2XEI A;  2DPS A;  2PR8 A;  3T05 A;  2N3A B;  5F48 A;  3TC8 A;  1TIQ A;  1JQG A;  2B3V A;  3WC5 A;  4MJ8 A;  4C8C A;  2DXQ A;  1EO0 A;  1OZP A;  4JWP A;  1NSA A;  3K2K A;  2NMT A;  2R82 A;  4BMH A;  3WR7 A;  2C6P A;  3WC6 A;  2JDD A;  2G3A A;  4UFX A;  4XPL A;  4OME A;  2BSW A;  2H5M A;  1DIK A;  4C8F A;  2POK A;  3D7H A;  5IB0 A;  1JDB C;  4FD6 A;  2HWG A;  5LRJ A;  4C2Z A;  3PZJ A;  5I4M A;  3TFY A;  1KZF A;  4JXR A;  3V38 A;  1IU8 A;  2Z11 A;  5I0C A;  2B4J C;  1AUG A;  4L89 A;  1NBW A;  4CGP A;  5F1Y A;  1XF8 A;  2CNM A;  2BUE A;  2C1C A;  2GFQ A;  2REF A;  2Q7B A;  4YWY A;  3W6X A;  2AUM A;  5F46 A;  4CAF A;  3OB1 B;  1F2P A;  2P6G A;  4AVA A;  6CPA A;  3TOB A;  3G8W A;  4A95 A;  1P0H A;  2CY2 A;  3IFE A;  4OP4 A;  1XJO A;  3BUX B;  5F09 A;  1HDU A;  2FL4 A;  3DDD A;  5A27 A;  4OLL A;  4C8U A;  1YVK A;  2ZW5 A;  4A33 A;  1ZG8 A;  4XPD B;  5LRK A;  1DTD A;  3PFO A;  4FUU A;  5G20 A;  4FD4 A;  5F13 A;  3GJZ A;  2GIV A;  3LD2 A;  4CGL A;  4ZX8 A;  2JEW A;  3BXM A;  4QB9 A;  5JM6 A;  2HB6 A;  3I9S A;  3D7F A;  4H89 A;  3VAR A;  2X7B A;  1F57 A;  4ZX9 A;  1M6V B;  4IUS A;  2FM4 A;  1WK4 A;  4MHN A;  2QIR A;  2OZG A;  1Y9K A;  2B5G B;  2DEA A;  4NEX A;  5ELY A;  4QUS A;  4U9Y A;  3NA6 A;  2C5Q A;  4KUB A;  4CDK A;  4DYO A;  4E2A A;  1PCA A;  1Z8W A;  2PJA A;  3NE7 A;  1X10 A;  3NH4 A;  2PCN A;  2JDC A;  2WPX A;  3D3S A;  3FMC A;  3MRU A;  3GLJ A;  4TJX A;  3VAT A;  1HEE A;  4JLY A;  4A2Z A;  1U6M A;  2V77 A;  4Q7A A;  3D7G A;  4MCQ A;  3D68 A;  2NSM A;  1BPN A;  4NGT A;  4FD7 A;  4M8D A;  4CO9 A;  1S7N A;  5K8O A;  1Q5X A;  1R61 A;  3HUV A;  5DS0 A;  2G9D A;  2QJ8 A;  4KLW A;  1HDQ A;  3EFA A;  2P6E A;  2O28 A;  2PJC A;  3H8F A;  4KVM E;  1R57 A;  1XRY A;  4FAI A;  2Q4Y A;  5HVH A;  4ZY0 A;  2Z10 A;  4P4E A;  4H1H A;  4OC5 A;  2PJ1 A;  3KRV A;  4ZYQ A;  4MFK A;  4WJB A;  3B3C A;  4R3K A;  4C8T A;  4PPZ A;  4P4B A;  4UWI A;  4PXE A;  2R1I A;  3N7Z A;  2D0P A;  5JVL A;  3PB6 X;  2AUN A;  2MP0 A;  3TLZ A;  3A9L A;  1M4L A;  3MGD A;  4R57 A;  4YRH A;  3VWE A;  5LYL A;  4CAE A;  4GPL B;  1VGY A;  4B6Z A;  3VRP A;  1QST A;  2GRE A;  3FRM A;  3GY9 A;  4LUA A;  2EZC A;  5H86 A;  4PSX A;  2PJ5 A;  2GP4 A;  2Z3M A;  4UFV A;  2XPL A;  4AG9 A;  4OC0 A;  1C30 B;  3PP9 A;  3ZNI A;  3EZB A;  4M3S A;  2VEZ A;  4KOR A;  4UIA A;  3RNZ A;  5F9M A;  4C8A A;  3DSB A;  4IHM A;  4MY3 A;  3IIB A;  4P10 A;  4P6Y A;  1YSJ A;  5EMI A;  5LYD A;  2V8H A;  2IJZ A;  1AYE A;  1IOF A;  3EXN A;  3FYN A;  2WUU A;  2D0O A;  5KTC A;  2UV8 G;  1ZLI A;  2QYV A;  4RS2 A;  2P0W A;  2BCO A;  3B3V A;  3I1U A;  4E8O A;  1UFH A;  5IB9 A;  4LX9 A;  1VBG A;  2OLS A;  2A4N A;  2Q04 A;  5LYI A;  1ZO0 A;  2BEI A;  2PJ9 A;  1K4J A;  3QAY A;  3WC7 A;  4P45 A;  1V0C A;  4MHP A;  2FCK A;  4ZY1 A;  3TT2 A;  4XPK A;  2ZXV A;  1Z4R A;  4K3N A;  3I6S A;  2PJ2 A;  4TJV A;  4B12 A;  1TKJ A;  4LQ6 A;  2B4D A;  4DJL A;  2E28 A;  3U88 C;  4MHD A;  2AFS A;  4Y49 C;  4IIY A;  1LCP A;  5F5X A;  1KBL A;  4MFL A;  4UA3 A;  3BUW B;  3KR4 A;  4KNG E;  5HKW A;  4OC1 A;  1CP6 A;  3TLY A;  1R43 A;  2Z3K A;  1Q2D A;  4XNH B;  4YU9 A;  4A31 A;  3SI1 A;  1SQH A;  2Q43 A;  2O4H A;  1KUY A;  3CXS A;  3FX6 A;  4W9Y A;  4QC6 A;  2XEF A;  2PJ8 A;  5BWA B;  2F8H A;  4KOY A;  2ANP A;  4P44 A;  5HKY A;  2WZN A;  1QMU A;  2ZEN A;  2IL4 A;  1NSL A;  2GLJ A;  2G0B A;  3B7I A;  2HC9 A;  3TE4 A;  1ELL P;  3F0A A;  2B5G A;  4F9V A;  1P4N A;  1B47 A;  4UWJ A;  3QB8 A;  2O53 A;  2AE6 A;  1FY7 A;  3GKR A;  2PCU A;  4NGR A;  4MY0 A;  4U5Y A;  1Y0R A;  5GCN A;  2V8D A;  4FBE A;  3BUM B;  4GM5 A;  5K99 A;  2EK9 A;  2HV2 A;  3FEC A;  2Y0M A;  3OAK A;  3DLJ A;  3N5F A;  3BUO B;  3VGO A;  1QSM A;  5F47 A;  5IR2 A;  2HI6 A;  4X3R A;  4HNX B;  1PUA A;  4KOV A;  2Q7S A;  3TO7 A;  4CAX A;  5CNP A;  5H84 A;  5AGE A;  3IWG A;  2ZED A;  3T0T A;  2WSA A;  3I3G A;  4UF4 A;  1PU9 A;  4NCZ A;  4B13 A;  5AG4 A;  4C85 A;  1Q2Y A;  5HXD A;  2DF5 A;  4UEE A;  3F9K C;  4MFQ A;  1A9X B;  4ORF A;  2D4P A;  1Z8L A;  4NGQ A;  3KR5 A;  2I79 A;  3RBU A;  2OU2 A;  4QBJ A;  3SJE A;  2FVG A;  4EVY A;  4UCN A;  1DE4 C;  3KHZ A;  2KCW A;  2Y1N A;  1Z8X A;  5JH9 A;  4R8F A;  2ARH A;  4BPW B;  2K5T A;  1UWY A;  4CYO A;  4MFP A;  4CPA A;  4A4C A;  2ABZ A;  3PEI A;  2OOT A;  4M6G A;  7CPA A;  2F7V A;  4EWT A;  4CRZ B;  3D67 A;  3SR3 A;  2EVN A;  1ARM A;  1CM0 A;  2QVP A;  1ARL A;  1IIC A;  2GU2 A;  3B3S A;  4F8Z A;  4C99 A;  2YNC C;  4B5P B;  3IWW A;  2PRB A;  4B5O A;  2CXA A;  2VZZ A;  2Z3P A;  3W6S A;  1VI4 A;  4C2Y A;  2IQ6 A;  4X8I A;  3HPH E;  1RO5 A;  3HPG G;  5IV0 A;  1J4J A;  2VXK A;  4OID A;  3H5Z A;  3B3W A;  3KQZ A;  1JDE A;  5LRG A;  3ICU A;  3O8Z A;  2JLM A;  1ZLH A;  4PV6 A;  1Y7R A;  2VBQ A;  2Q0Y A;  2Z0Z A;  3B35 A;  3CPA A;  3NH8 A;  2AFX A;  4COG A;  2RC4 A;  3W91 A;  1S7F A;  2Y1M A;  1M4G A;  2AFO A;  2B4B A;  4UFW A;  4E94 A;  5A28 A;  4C9U A;  3NH5 A;  1Z9E A;  4C8P A;  1B6B A;  4BPX B;  1QSO A;  1S60 A;  3FB3 A;  4KZT A;  1LFW A;  4J0N A;  3B3T A;  3RYO A;  4UEZ A;  2FXF A;  4J3G A;  1EZA A;  4A94 A;  4NGP A;  2XEJ A;  2CF4 A;  1M44 A;  1VBH A;  3EZE A;  4A38 A;  3HMJ G;  1QSN A;  1XBU A;  3IC1 A;  4FWU A;  4MCR A;  1Y9W A;  3IEH A;  2Z3L A;  1B87 A;  4MHY A;  4PK2 A;  4UEF A;  2QML A;  3LAC A;  5EBV A;  4OC4 A;  3SI2 A;  1LOK A;  1BXR B;  4AVC A;  3HLP A;  4CYQ A;  1GYT A;  4GXH A;  3D7D A;  2Z3O A;  1FNO A;  2YNE A;  3CT9 A;  2EUI A;  2ZW4 A;  3SXN A;  1KWM A;  3KGQ A;  4OC3 A;  1M4I A;  2VI7 A;  4MRI A;  2XPP A;  4YN3 A;  3EO4 A;  1LAM A;  1ZL0 A;  4NF1 A;  3IGR A;  4GS4 A;  5EC4 A;  1LAP A;  3LOD A;  4JJX A;  4JVO A;  5AG5 A;  4F0X A;  3IU2 A;  3PBE A;  1M1D A;  3S6H A;  2ZEG A;  5E96 A;  4BTF A;  4ZY2 A;  4NGM A;  5HMN A;  4DUK A;  1ZYM A;  2BL1 A;  2PQ8 A;  4CS0 B;  1XF1 A;  4MCP A;  4RR2 B;  4B5P A;  2XEG A;  4R3L A;  4B11 A;  1AMP A;  1T36 B;  2PJ4 A;  2Q51 A;  3SJX A;  3BI0 A;  3D8P A;  4OIW A;  1QQ9 A;  5K8M A;  1Z2L A;  3PB4 X;  4JXQ A;  1C3O B;  1J3L A;  3VH9 A;  3KHX A;  5HVF A;  2J8M A;  4COB A;  1Y7E A;  2YJV A;  3V8I A;  4C7I A;  2YJT A;  3IO1 A;  2AFM A;  3S6F A;  4BIN A;  3DR8 A;  2YNC A;  4C86 A;  4KSI A;  3SHP A;  1IID A;  2Q4V A;  1YQE A;  2R7H A;  4PK3 A;  4II9 A;  2DLA A;  2PDO A;  3R9F A;  1CBX A;  3PB9 X;  1YLE A;  1EE3 P;  2ZEF A;  1FBV A;  4CGM A;  4UIB A;  2PE3 A;  3JRU A;  2EWB A;  4KVO E;  3FNC A;  4P4D A;  2JBK A;  1BLL E;  2FT0 A;  3TOA A;  4A37 A;  2AFZ A;  3K9U A;  4HPS A;  1MK4 A;  4M85 A;  4NGS A;  4MHZ A;  1VKC A;  2I00 A;  4KOS A;  3R9G A;  1I12 A;  3CDX A;  2VQY A;  3CPX A;  4CYN A;  2XPO A;  2PSW A;  3KKW A;  4C2X A;  1V6C A;  3BLN A;  2VL1 A;  3IU1 A;  3FBU A;  4C68 A;  3BUN B;  1X12 A;  3PGP A;  1LRZ A;  4B10 A;  4MI4 A;  1S7K A;  4RN7 A;  4Q38 A;  4Z65 A;  1CS0 B;  1GGO A;  2B0A A;  1VHO A;  2AJ6 A;  4A4B A;  3TLA A;  5JGF A;  3S9M A;  2HUZ A;  4KSF A;  3KL9 A;  4E0A A;  4KOT A;  5G22 A;  1VHE A;  3B2Y A;  4CYP A;  5JQ4 A;  4C9A A;  3DR6 A;  2ODF A;  4AG7 A;  5K8N A;  1OBR A;  3BI1 A;  2B3U A;  1PYT B;  4KSA A;  1L0C A;  2NYQ A;  1YW4 A;  2PIZ A;  3BJ8 A;  3IWE A;  1NXJ A;  5J8C A;  5IX3 A;  4HNW B;  4R7M A;  5C82 A;  3PB8 X;  1MJA A;  4UBR A;  3ZZI A;  4NSQ A;  3D66 A;  2PJ7 A;  3S6K A;  5K8P A;  5AG7 A;  5THW A;  3P2F A;  2WYR A;  2OZU A;  3EY5 A;  1IYL A;  4CRY B;  2AFW A;  2JBJ A;  5D29 A;  2REE A;  2GE3 A;  1NE9 A;  5C88 A;  3VTA A;  2B4D B;  1CX8 A;  4MXU A;  1ZRS A;  4CGO A;  1VHS A;  5KTA A;  4OKO A;  2FE7 A;  1BPM A;  4PXD A;  3ZJ0 A;  3T5M A;  4L8A A;  3KAS A;  4G1P A;  1XE4 A;  1XMB A;  1MJB A;  4X5K A;  4C9V A;  4UCP A;  3FEE A;  3SI0 A;  4KOU A;  3WT4 A;  1H8L A;  3PBB A;  4HNY B;  3T90 A;  1Q2C A;  2Q4Z A;  2QEC A;  4YFJ A;  2D4O A;  3TLG B;  3NFQ A;  5F49 A;  1RXT A;  1IB1 E;  2YND A;  1YME A;  1F2O A;  1CJW A;  2GLF A;  2PJ3 A;  3D4U A;  3FXT A;  4UCM A;  4F0Y A;  1KC7 A;  1S5K A;  2VKZ G;  1ZG7 A;  4AXV A;  3FED A;  4C7H A;  1CPX A;  2C27 A;  4ZBG A;  3GYA A;  3KI9 A;  4MMO A;  5DWN A;  3TCV A;  3B8G A;  4OAD A;  3TLG A;  3SXO A;  1KUV A;  4E5S A;  3JTK A;  3OP0 A;  1YR0 A;  4Q36 A;  2Z3N A;  4KS9 A;  3VRQ A;  3VRR A;  5KTD A;  2R98 A;  3UY5 A;  4NJR A;  3I74 A;  4C9E A;  5J1Q A;  1KEE B;  3C8O A;  2PIY A;  4P4F A;  4ZI6 A;  1S7L A;  1ON0 A;  1I1D A;  3R1K A;  4B14 A;  1MJ9 A;  5JYB A;  1CP7 A;  1BO4 A;  1CE8 B;  2CNT A;  3U1B A;  4PSW A;  5FD8 A;  3H8E A;  1Y0Y A;  2EZA A;  1YRE A;  4H6U A;  4MFZ A;  4NJQ A;  4BD9 A;  2PVV A;  1XIX A;  2B58 A;  3PFE A;  4I49 A;  1YX0 A;  2CBL A;  5AG6 A;  2I3C A;  4P4J A;  2DIK A;  3PLF B;  1Z9U A;  3CXQ A;  3NFZ A;  3JVN A;  1Z5R A;  1TKH A;  4K30 A;  2R8V A;  1JWQ A;  2JEV A;  3C26 A;  2CTC A;  5FVJ A;  5JPH A;  3P2H A;  4INJ A;  4EYS A;  4R76 A;  4X2T A;  3D2P A;  5DWM A;  4CGN A;  3E0K A;  4IK2 A;  3BHX A;  1IY7 A;  3EZA A;  1YVH A;  4OC2 A;  3S9L A;  4KLV A;  1CPS A;  2EO8 A;  2PJ0 A;  4XPD C;  2X0S A;  3GIU A;  4JZ0 A;  3T9Y A;  3MN8 A;  5HVG A;  1GHE A;  2ZEO A;  2XPN A;  2RFH A;  4C9R A;  2EK8 A;  1M4D A;  2OB0 A;  2ZEM A;  4JYW A;  2PR1 A;  3DGV A;  3ISZ A;  4H6Z A;  4Y49 B;  3WAB A;  1IYK A;  5BY0 A;  4CZ1 A;  1XOV A;  3FH4 A;  3ISX A;  3SJF A;  2OH1 A;  4MFJ A;  3PFV A;  2ZEE A;  4H2K A;  4R9M A;  3K9T A;  2V8V A;  3VRO A;  4EME A;  3GUX A;  1XFO A;  1FT7 A;  2G3T A;  2J8N A;  3KQX A;  1R3N A;  3PRT A;  3R95 A;  3TX8 A;  3G3S A;  3IJ3 A;  1YVO A;  3TLC A;  3TLB A;  1YW6 A;  5HKZ A;  1YK3 A;  2PJB A;  1A2Z A;  2P6F A;  5AXI A;  2BOA A;  3JUW A;  4FD5 A;  1YLO A;  4A30 A;  4NGN A;  1QSR A;  2HRO A;  3F8K A;  3EC4 A;  1IGB A;  4IAV A;  5ISV A;  3CZX A;  3QAH A;  3NOJ A;  3T8W A;  2VZY A;  1BAV A;  3V7Z A;  3TTH A;  1XEB A;  3TYX A;  2PVW A;  4NXY A;  3QNV A;  4R6T A;  5G1Z A;  3H4Q A;  4ONW A;  2C6C A;  2ZW6 A;  3RO0 A;  3H8G A;  4AVB A;  3EIF A;  2ZEH A;  1TF9 A;  2ZEP A;  3BJ7 A;  3OWC A;  3G23 A;  2CIJ A;  4MI1 A;  4KUA A;  2ZEL A;  1RTQ A;  8CPA A;  4P4I A;  4ZGY B;  4MBU A;  4PXC A;  3S6G A;  4KVX A;  4CDJ A;  1Z4E A;  4O23 A;  2CNS A;  2C6G A;  3DNS A;  3L2N A;  4PXB A;  4U9Z A;  4F6A A;  2FIW A;  5HH1 A;  5LYF A;  1NMT A;  1VIX A;  2HQY A;  2ZPA A;  4F9U A;  3FVL A;  5CBM A;  2RB7 A;  3R9E A;  1I21 A;  4NFR A;  5D8N A;  4CAW A;  4IF5 A;  4MCS A;  2ATR A;  3TO9 A;  4BBH A;  3SJG A;  2FSR A;  3TO6 A;  2J8R A;  4QVT A;  4YGO A;  2DPT A;  3OB2 B;  2J9A A;  2GAN A;  2V8G A;  4CAV A;  1XMT A;  4R87 A;  3RZA A;  2WPW A;  5G21 A;  4RI1 A;  3RAM A;  1WWZ A;  4KOW A;  3TLE A;  2AFU A;  1TKF A;  3PB7 X;  2ZOG A;  4OAE A;  1Q7L A;  4M6I A;  2FS5 A;  4ONU A;  3LWU A;  2OR4 A;  2PC1 A;  4WWV A;  2OZH A;  3FF3 A;  1Y9Z A;  1ELM P;  5CPA A; 
#chains in the Genus database with same CATH homology
 1CG2 A;  3S9N A;  3GB0 A;  1LAN A;  3FJU A;  1TXR A;  4RUH A;  1ZG9 A;  4A39 A;  3KZW A;  4TNU A;  2BO9 A;  1WVM A;  2PJ6 A;  4TWE A;  2PRQ A;  2CTB A;  3LMS A;  4PQA A;  4EFD A;  4LQG A;  1TF8 A;  4C84 A;  2ZOF A;  2IMO A;  2XEI A;  3TC8 A;  1JQG A;  3WC5 A;  4C8C A;  1NSA A;  3K2K A;  2C6P A;  3WC6 A;  4OME A;  4C8F A;  2POK A;  3D7H A;  5LRJ A;  5I4M A;  3V38 A;  2C1C A;  4YWY A;  1F2P A;  6CPA A;  3IFE A;  4OP4 A;  1XJO A;  5F09 A;  1HDU A;  1ZG8 A;  5LRK A;  1DTD A;  3PFO A;  4FUU A;  4ZX8 A;  2JEW A;  3BXM A;  5JM6 A;  2HB6 A;  3D7F A;  3VAR A;  1F57 A;  4ZX9 A;  4MHN A;  2DEA A;  5ELY A;  2C5Q A;  4CDK A;  3NA6 A;  4DYO A;  1PCA A;  2PJA A;  3NH4 A;  3MRU A;  3FMC A;  3GLJ A;  4TJX A;  3VAT A;  1HEE A;  2V77 A;  4Q7A A;  3D7G A;  3D68 A;  4MCQ A;  2NSM A;  1BPN A;  4NGT A;  5K8O A;  3HUV A;  5DS0 A;  2G9D A;  2QJ8 A;  1HDQ A;  2PJC A;  3H8F A;  4FAI A;  1XRY A;  5HVH A;  4ZY0 A;  4P4E A;  4OC5 A;  2PJ1 A;  4ZYQ A;  4WJB A;  3B3C A;  4C8T A;  4PPZ A;  4P4B A;  4PXE A;  3PB6 X;  1M4L A;  1VGY A;  4B6Z A;  2GRE A;  4C8U A;  2PJ5 A;  2GP4 A;  4OC0 A;  4UIA A;  4C8A A;  4IHM A;  4P10 A;  3IIB A;  4P6Y A;  1YSJ A;  5LYD A;  2V8H A;  2IJZ A;  1AYE A;  1ZLI A;  2QYV A;  2BCO A;  3B3V A;  3I1U A;  5IB9 A;  5LYI A;  2PJ9 A;  3WC7 A;  4P45 A;  4MHP A;  4ZY1 A;  4K3N A;  3I6S A;  2PJ2 A;  4TJV A;  1TKJ A;  4DJL A;  2AFS A;  1LCP A;  3KR4 A;  4KNG E;  4OC1 A;  1CP6 A;  1R43 A;  4YU9 A;  3SI1 A;  2Q43 A;  2O4H A;  3FX6 A;  4W9Y A;  2XEF A;  2PJ8 A;  2F8H A;  2ANP A;  4P44 A;  2WZN A;  1QMU A;  2ZEN A;  2GLJ A;  3B7I A;  2HC9 A;  1ELL P;  4F9V A;  2O53 A;  5LYL A;  2PCU A;  4NGR A;  1Y0R A;  2V8D A;  4FBE A;  4GM5 A;  2EK9 A;  3DLJ A;  3FEC A;  3N5F A;  5IR2 A;  4X3R A;  2ZED A;  4UF4 A;  4C85 A;  5HXD A;  4UEE A;  1Z8L A;  4NGQ A;  3KR5 A;  3RBU A;  3SJE A;  2FVG A;  1DE4 C;  3KHZ A;  5JH9 A;  4R8F A;  1UWY A;  4CPA A;  2ABZ A;  3PEI A;  2OOT A;  7CPA A;  2F7V A;  4EWT A;  3D67 A;  1ARM A;  2QVP A;  1ARL A;  2GU2 A;  3B3S A;  4F8Z A;  4C99 A;  3IWW A;  2IQ6 A;  4X8I A;  4OID A;  3B3W A;  3KQZ A;  5LRG A;  3ICU A;  1ZLH A;  3B35 A;  3CPA A;  3NH8 A;  2AFX A;  2AFO A;  4C9U A;  3NH5 A;  4C8P A;  1LFW A;  3B3T A;  4UEZ A;  4A94 A;  4NGP A;  2XEJ A;  2CF4 A;  4A38 A;  1XBU A;  3IC1 A;  4FWU A;  4MCR A;  3IEH A;  4MHY A;  4UEF A;  4OC4 A;  3SI2 A;  1LOK A;  3HLP A;  1GYT A;  3D7D A;  1FNO A;  3CT9 A;  1KWM A;  3KGQ A;  4OC3 A;  4MRI A;  4YN3 A;  1LAM A;  1LAP A;  3PBE A;  2ZEG A;  4ZY2 A;  4NGM A;  4DUK A;  1XF1 A;  4MCP A;  2XEG A;  1AMP A;  2PJ4 A;  2Q51 A;  3SJX A;  3BI0 A;  4OIW A;  1QQ9 A;  5K8M A;  1Z2L A;  3PB4 X;  3VH9 A;  3KHX A;  5HVF A;  1Y7E A;  3IO1 A;  2AFM A;  4C86 A;  4KSI A;  1CBX A;  3PB9 X;  1EE3 P;  2ZEF A;  4UIB A;  2PE3 A;  3JRU A;  2EWB A;  4P4D A;  2JBK A;  1BLL E;  4A37 A;  2AFZ A;  4MHZ A;  4NGS A;  3I74 A;  3CDX A;  3CPX A;  1V6C A;  2VL1 A;  4Z65 A;  1VHO A;  5JGF A;  3S9M A;  3KL9 A;  1VHE A;  3B2Y A;  4C9A A;  5K8N A;  1OBR A;  3BI1 A;  1PYT B;  2NYQ A;  1YW4 A;  2PIZ A;  4R7M A;  3PB8 X;  3D66 A;  2PJ7 A;  5K8P A;  5THW A;  2WYR A;  2AFW A;  2JBJ A;  5D29 A;  3VTA A;  1CX8 A;  4MXU A;  4OKO A;  4PXD A;  1BPM A;  3KAS A;  4G1P A;  1XMB A;  4C9V A;  3SI0 A;  3FEE A;  3WT4 A;  1H8L A;  3PBB A;  2Q4Z A;  2GLF A;  1F2O A;  1YME A;  2PJ3 A;  3D4U A;  1ZG7 A;  4AXV A;  3FED A;  1CPX A;  3KI9 A;  4MMO A;  4NJR A;  4C9E A;  5J1Q A;  2PIY A;  4P4F A;  4ZI6 A;  1CP7 A;  3H8E A;  1Y0Y A;  4NJQ A;  4BD9 A;  2PVV A;  3PFE A;  2I3C A;  4P4J A;  3NFZ A;  1Z5R A;  1TKH A;  2CTC A;  4R76 A;  4X2T A;  4IK2 A;  3BHX A;  1IY7 A;  4OC2 A;  3S9L A;  1CPS A;  2PJ0 A;  4JZ0 A;  3MN8 A;  5HVG A;  2ZEO A;  2RFH A;  4C9R A;  2EK8 A;  3DGV A;  3ISZ A;  2ZEM A;  4JYW A;  3WAB A;  3FH4 A;  3ISX A;  3SJF A;  2ZEE A;  4H2K A;  3K9T A;  2V8V A;  4EME A;  3GUX A;  1XFO A;  1FT7 A;  3KQX A;  3PRT A;  3TX8 A;  1R3N A;  3IJ3 A;  1YW6 A;  2PJB A;  2BOA A;  1YLO A;  4NGN A;  1IGB A;  4IAV A;  3T8W A;  1BAV A;  3V7Z A;  2PVW A;  4R6T A;  3QNV A;  4ONW A;  2C6C A;  3H8G A;  3EIF A;  2ZEH A;  1TF9 A;  2ZEP A;  2CIJ A;  2ZEL A;  1RTQ A;  8CPA A;  4P4I A;  4PXC A;  4CDJ A;  4O23 A;  3L2N A;  2C6G A;  4PXB A;  5LYF A;  1VIX A;  5CBM A;  4F9U A;  3FVL A;  2RB7 A;  4NFR A;  5D8N A;  4MCS A;  3SJG A;  2J9A A;  2V8G A;  3RZA A;  3RAM A;  1TKF A;  2AFU A;  3PB7 X;  2ZOG A;  1Q7L A;  3LWU A;  2OR4 A;  4WWV A;  1Y9Z A;  3FF3 A;  1ELM P;  5CPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...