3BXMA

Structure of an inactive mutant of human glutamate carboxypeptidase ii [gcpii(e424a)] in complex with n-acetyl-asp-glu (naag)
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Reaction mechanism of glutamate carboxypeptidase II revealed by mutagenesis, X-ray crystallography, and computational methods.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bxmA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bxmA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bxmA02
2XEIA 5JM6A 2ZEMA 3NA6A 5LYDA 4P4EA 1AMPA 2POKA 3TX8A 3BI0A 2HB6A 2ZEPA 1LFWA 4MCSA 5F09A 2PCUA 2PJ1A 3PB9X 3H8GA 3KQZA 1M4LA 1LCPA 3SI2A 2JEWA 3WC5A 2GLFA 2VL1A 4ZY2A 3PBEA 4LQGA 3D4UA 3T8WA 2ZENA 1Q7LA 3SI1A 2PJAA 3B2YA 4C8UA 2PJ7A 4P4FA 1BPMA 4NJQA 3KHZA 3SI0A 1HEEA 1PYTB 2EWBA 4UIAA 5K8PA 4P44A 4NGSA 1Z5RA 5K8OA 5K8NA 4WWVA 3B3CA 1ELMP 3HUVA 3TC8A 4ZX8A 3KR5A 2NSMA 2EK8A 1Z8LA 3IFEA 4C9EA 4NGPA 4TNUA 3KGQA 2OOTA 5LRJA 2GLJA 2XEFA 1R3NA 1XF1A 4UIBA 4R8FA 4PXEA 1CX8A 3WABA 2CIJA 2ZEEA 2G9DA 3ISXA 4R7MA 3KZWA 1XBUA 3JRUA 3N5FA 3GB0A 4FUUA 3CPXA 2ZEDA 4ZY0A 3WC6A 4MCPA 3CPAA 4MHNA 2F7VA 2V77A 2AFSA 4MCQA 3D7HA 2V8DA 3PBBA 5CBMA 2ZELA 4P6YA 1F2PA 4UEZA 4RUHA 2OR4A 3WT4A 4F9VA 4UEFA 2ABZA 2HC9A 2QVPA 3GUXA 7CPAA 4C8PA 4UEEA 1ARLA 4OKOA 1VGYA 4W9YA 1FT7A 3PFEA 4A37A 1ZLHA 3MRUA 5IB9A 4OP4A 1TKFA 2ZEOA 3NH5A 4PXCA 2V8GA 2GU2A 3NH4A 4NGNA 4OC1A 1Z2LA 4Q7AA 1Y9ZA 2PIZA 3PB4X 4C8TA 4DYOA 1UWYA 1ARMA 2PIYA 3LWUA 4C8CA 1YSJA 2AFZA 2ZEFA 4P45A 1FNOA 1XRYA 3B3SA 4C9RA 2RB7A 5LYFA 3VTAA 3SJGA 5JH9A 1OBRA 3B3TA 2JBJA 3D7DA 3SJEA 5HVGA 2AFWA 2RFHA 5THWA 1IY7A 3K2KA 4NGTA 2C6CA 2BO9A 2QYVA 1Y0YA 4AXVA 4A39A 5LRGA 4UF4A 1CPXA 4NFRA 4NJRA 4MMOA 3ICUA 4TJVA 3RBUA 4R76A 4MRIA 4H2KA 3I1UA 2PJ3A 3NFZA 1LANA 2ANPA 4YU9A 4B6ZA 4PXBA 4IAVA 4MHZA 2I3CA 2PE3A 5HVHA 2PJ5A 3IEHA 1H8LA 3B3WA 3D7FA 1BLLE 1QQ9A 4YN3A 2EK9A 3KL9A 3FH4A 3FEDA 4EWTA 3EIFA 3IWWA 3D66A 1VHOA 1DE4C 2XEJA 2O4HA 4FBEA 2C1CA 1TF8A 3MN8A 1YMEA 2PJ4A 1VHEA 3FVLA 3S9LA 4P4BA 4C9VA 1RTQA 1CP7A 5DS0A 4ZY1A 3CDXA 3B35A 3IJ3A 1VIXA 5LYLA 4CDKA 4O23A 1Y0RA 1CG2A 3KASA 1EE3P 1ZG9A 3CT9A 1Y7EA 2J9AA 2ZEHA 4EMEA 3S9MA 3FF3A 5I4MA 3KR4A 4MXUA 1JQGA 3KI9A 3D7GA 4P4JA 5D29A 3KHXA 3I74A 3BI1A 4CDJA 3WC7A 3GLJA 3VATA 3DLJA 4C9UA 3B7IA 4C86A 2CTCA 4NGRA 2ZOGA 1KWMA 2PVVA 1ZLIA 2AFXA 1CPSA 2Q51A 1TXRA 1LAPA 1PCAA 2IQ6A 4A94A 3NH8A 1XMBA 3FECA 4G1PA 1NSAA 3IIBA 2PJ6A 4DJLA 5CPAA 3BXMA 4DUKA 2V8VA 2O53A 3PB6X 2XEGA 3KQXA 3FJUA 4OC2A 2PVWA 5J1QA 2FVGA 4YWYA 2PJ8A 3RZAA 1AYEA 5LRKA 4C9AA 4GM5A 4IK2A 3V7ZA 2BOAA 4K3NA 4ZYQA 4ZI6A 2ZEGA 2AFOA 2QJ8A 5HXDA 4R6TA 1QMUA 4IHMA 1ZG8A 1BAVA 1TKJA 1YW4A 2PRQA 4OMEA 2C6PA 1CBXA 2CF4A 3QNVA 4KNGE 4PPZA 5D8NA 4C99A 1ZG7A 1HDUA 2PJBA 4WJBA 4CPAA 4ZX9A 4Z65A 3IC1A 5K8MA 4KSIA 4OC3A 5ELYA 2AFUA 1TKHA 2PJ2A 2IJZA 5LYIA 3ISZA 5JGFA 2Q43A 1V6CA 1YW6A 1LAMA 3BHXA 2NYQA 1XJOA 3LMSA 1ELLP 2BCOA 3DGVA 3PB7X 4BD9A 4FAIA 1GYTA 1WVMA 2PJCA 3FEEA 1IGBA 4X8IA 4F9UA 1R43A 1TF9A 2F8HA 3K9TA 3PRTA 1XFOA 4P4IA 4C84A 1CP6A 2PJ0A 4OC0A 1YLOA 4JZ0A 3FMCA 4X2TA 2AFMA 4C85A 3PEIA 6CPAA 4OC5A 2JBKA 3B3VA 4FWUA 3VH9A 3D67A 3H8FA 3PFOA 4MHYA 4TWEA 3SJFA 1HDQA 4NGQA 1BPNA 5HVFA 3RAMA 2Q4ZA 4A38A 3SJXA 3S9NA 3V38A 1F57A 4OIWA 1LOKA 3VARA 4OIDA 1DTDA 4P10A 4TJXA 4MCRA 3L2NA 4PXDA 2C6GA 2IMOA 3FX6A 4PQAA 4OC4A 4P4DA 3HLPA 4JYWA 8CPAA 3IO1A 3PB8X 4ONWA 4MHPA 2WZNA 1F2OA 4X3RA 4NGMA 3H8EA 3D68A 2PJ9A 4EFDA 2DEAA 2CTBA 2V8HA 4F8ZA 3I6SA 2GREA 2ZOFA 2WYRA 4C8FA 4C8AA
chains in the Genus database with same CATH superfamily
2XEIA 2J8NA 5JM6A 2ZEMA 3NA6A 5LYDA 4P4EA 1YVKA 5HKZA 5J3XA 1AMPA 2POKA 3LD2A 5F49A 3TX8A 3BI0A 2HB6A 3C8OA 2ZEPA 1LFWA 4MCSA 5F09A 2B4DA 4R3LA 1EZBA 3OWCA 4CRYB 2PCUA 5AGEA 1QSMA 2PJ1A 3PB9X 4CGNA 4MY3A 3EZEA 1YLEA 2R82A 4E94A 3HPGG 3H8GA 3KQZA 1M4LA 3SHPA 4AG7A 1LCPA 5F47A 3SI2A 4C68A 3G8WA 4KSAA 2JEWA 4J0NA 2I79A 2BEIA 1IB1E 2GLFA 2VL1A 3WC5A 4ZY2A 4NSQA 3PBEA 3PT1A 1BXRB 5HMNA 1R61A 4LQGA 2EZBA 3D4UA 3T8WA 2ZENA 1Q7LA 5H86A 4R57A 4U5YA 5GCNA 3QAHA 4U9ZA 4C7IA 3SI1A 2PJAA 3B2YA 4C8UA 4RS2A 4E2AA 2ATRA 2PJ7A 2DPSA 3EC4A 1EZAA 5G20A 4INJA 4CYOA 4P4FA 1BPMA 4NJQA 5EBVA 4HNWB 3KHZA 3SI0A 1HEEA 1PYTB 2EWBA 1I21A 1P4NA 1S7FA 2HV2A 4UIAA 2VI7A 4BBHA 2J8MA 5K8PA 4P44A 4NGSA 1QSTA 1Z5RA 3OB1B 2QMLA 5K8OA 1JWQA 5K8NA 4XNHB 1R57A 3QAYA 4WWVA 3U88C 3B3CA 2IL4A 2REEA 4KVME 3NOJA 1ELMP 3HUVA 3TC8A 2ZW6A 4MBUA 3KR5A 4ZX8A 4KUBA 3R9FA 2EZCA 1T36B 1Y9KA 5F13A 1J3LA 2NSMA 2EK8A 1Z8LA 2VQYA 3EZAA 3IFEA 4BTFA 4C9EA 4NGPA 1YR0A 3N7ZA 4TNUA 2Q7SA 3KGQA 2OOTA 3ZJ0A 5LRJA 2GLJA 2XEFA 1YREA 1R3NA 4ZBGA 1PU9A 5G1ZA 1XF1A 1IU8A 4UIBA 2JDDA 4R8FA 4PXEA 1Q5XA 3K4IA 1CX8A 3WABA 2CIJA 2ZEEA 2G9DA 3ISXA 4R7MA 3RO0A 2EZAA 3BUWB 1XBUA 3JRUA 3KZWA 3N5FA 1GHEA 5K99A 4K30A 4OLLA 3BUMB 3GB0A 3I9SA 2WPWA 4XNHC 4NF1A 4FUUA 4CAFA 2D0PA 4XPKA 4A32A 2FM4A 2HUZA 2ZEDA 3CPXA 1CM0A 4UBRA 4ZY0A 4M8DA 3WC6A 3SR3A 4MCPA 3CPAA 4M3SA 4MHNA 5EC4A 2F7VA 2V77A 4GS4A 1QSRA 4KOUA 2ARHA 4M6GA 4C7HA 2Z11A 4A2ZA 1YK3A 2AFSA 4MCQA 3D7HA 2V8DA 3PBBA 1NE9A 5CBMA 4KOTA 5C88A 2PC1A 2ZELA 4P6YA 1F2PA 2EVNA 5AG5A 4B10A 4CAXA 4UEZA 4Q36A 4UWIA 2PR8A 4R87A 4RUHA 2OR4A 4MJ8A 3S6HA 3WT4A 4MJXA 4F9VA 4UEFA 2REFA 2ABZA 3T07A 1MJBA 2HC9A 2QVPA 3GUXA 2YNDA 3TO9A 3JUWA 5AG7A 3R96A 4B5PB 4ZGYB 7CPAA 3TLZA 3OB2B 4JLYA 2B5GA 3NE8A 3TLCA 4C8PA 2PDOA 1ARLA 4JWPA 4OKOA 4UEEA 1B6BA 1VGYA 1Z4RA 2HQYA 2B58A 1A2ZA 1M44A 2Q44A 4HNXB 4W9YA 1FT7A 3PFEA 4DNCA 4A37A 1ZLHA 3MRUA 5IB9A 3FIXA 4OP4A 4NXYA 3SXNA 1TKFA 2CY2A 1VBGA 4CAWA 4CYQA 1Q2DA 2DLAA 2ZEOA 3NH5A 4PXCA 1JDBC 4CAEA 2V8GA 2GU2A 3NH4A 4NGNA 3TLGB 4KLVA 3O8ZA 1IOIA 4OC1A 1Z2LA 1S60A 2FXFA 2P0WA 5LYLA 2HI6A 4Q7AA 5DWNA 3S6FA 4UCMA 1CJWA 1Y9ZA 2PIZA 3PB4X 1L0CA 2FSRA 4FD4A 4C8TA 4DYOA 2PCNA 5FVJA 1UWYA 1B87A 3R9EA 5H84A 2PRBA 1ARMA 3DDDA 2QECA 2PIYA 2Y1NA 3LWUA 2Z3OA 4C8CA 1YVOA 2XPOA 1YSJA 4F6AA 3EZBA 5FD8A 1S7LA 2AFZA 4PSXA 3D2MA 2X7BA 2ZEFA 5JQ4A 4P45A 3TYXA 3GJZA 1FNOA 3CXQA 1S5KA 1XRYA 3B3SA 1OZPA 4C9RA 2RB7A 5LYFA 3VTAA 3SJGA 3BUNB 1M4GA 5JH9A 4HPSA 2ZPAA 1ON0A 5A27A 1XEBA 1OBRA 3B3TA 2DIKA 1LRZA 4XPLA 3TT2A 1XIXA 1ZRSA 1S7KA 2JBJA 2AUNA 3D7DA 3SJEA 5HVGA 2AFWA 4M6IA 2DXQA 2RFHA 3W6XA 3PZJA 4CGMA 5THWA 1IY7A 1IOFA 1Z8TA 2Z3KA 3K2KA 4NGTA 1N71A 5HKWA 3V8IA 2G3AA 2C6CA 2BO9A 2QYVA 1Z8XA 2FIWA 2D0OA 4B13A 1Y0YA 3TO7A 3GKRA 3SXOA 4AXVA 4KOYA 4Y49B 3IWEA 4A39A 4F0XA 1WWZA 5F46A 2MP0A 4C2ZA 5LRGA 4BPUB 4UF4A 1XOVA 1CPXA 3BJ7A 4QVTA 4NFRA 4NJRA 2FS5A 4MMOA 3ICUA 1KUYA 2E28A 3QB8A 3VGOA 2H5MA 4TJVA 3RBUA 3BUOB 4R76A 4MRIA 4H2KA 4KOSA 3I1UA 5F48A 1PUAA 2D4PA 2PJ3A 4R3KA 4OADA 3NFZA 2BSWA 4UCNA 1LANA 2ANPA 4YU9A 1FBVA 1IYLA 4CS0B 2PR1A 4B6ZA 3R95A 4PXBA 4CYPA 2AE6A 1CE8B 2UV8G 4FD7A 4IAVA 4UA3A 3TCVA 1IIDA 2Z3PA 4MHZA 5F9MA 2I3CA 2PE3A 5HVHA 2PQ8A 3HPHE 4YGOA 1RO5A 1Q2YA 2PJ5A 3IEHA 3IU1A 1H8LA 3B3WA 3D7FA 1BLLE 2Z3NA 1QQ9A 4KOXA 4KS9A 4MFZA 4OAEA 1C3OB 4YN3A 1KUVA 2EK9A 3KL9A 4BPWB 3FH4A 3FEDA 2A4NA 2OU2A 4QUSA 4Y49C 4EWTA 4R9MA 4GPLB 3EIFA 5HKYA 2K5TA 3IWWA 4QBJA 2I00A 3EFAA 3D66A 5KTDA 2J8RA 1VHOA 1DE4C 2CNTA 4FD6A 4A33A 3LODA 2XEJA 2O4HA 4FBEA 3IWGA 3FYNA 2OLSA 3TFYA 2C1CA 2Q7BA 1TF8A 3D2PA 3F5BA 1UFHA 2YGWA 3MN8A 4KUAA 1YMEA 4UFVA 1EO0A 2FT0A 1VHEA 2PJ4A 3S9LA 4P4BA 3FVLA 4C2YA 2ZW7A 4C9VA 1VHSA 2YJTA 3E0KA 2N3AB 4QB9A 4UWJA 4A4CA 1RTQA 1RXTA 3PFVA 3PLFB 1CP7A 4JXRA 5DS0A 4KOVA 1VKCA 3CDXA 3B35A 3IJ3A 1VIXA 4PSWA 3A9LA 2ZW4A 3TOAA 3W91A 4L89A 4HNYB 4O23A 4CDKA 2GFQA 2EUIA 1Y0RA 1CG2A 5E96A 2WSAA 3KASA 1EE3P 1ZG9A 3CT9A 3BJ8A 2Z0ZA 2DF5A 2FL4A 2EO8A 4AVAA 1C30B 1Y7EA 2J9AA 2Q04A 2ZEHA 3D3SA 4EMEA 3S9MA 3H4QA 3FF3A 4KORA 2WUUA 3KR4A 3CXPA 5DWMA 5I4MA 4MXUA 2AUMA 4B5PA 1JQGA 4B5OA 3KI9A 3D7GA 1Y7RA 4P4JA 3DR6A 1VI4A 3F0AA 5D29A 3KHXA 4PK3A 4XPDB 3I74A 3BI1A 1KUXA 4MY0A 3TTHA 4H1HA 1X10A 3K9UA 4CDJA 5JYBA 3FXTA 3WC7A 4B12A 3GLJA 4AB7A 3TLBA 2RC4A 3P2FA 3VATA 1M4DA 3PP9A 5AXIA 2Z3LA 3EY5A 1NSLA 3DLJA 3DR8A 4C9UA 3TLGA 4KOWA 3B7IA 4C86A 4M6HA 4UFWA 1BO4A 2CTCA 4CRZB 4NGRA 2VKZG 2ZOGA 4GXHA 1KWMA 2PVVA 1ZLIA 3VWEA 1QSOA 1DIKA 2AFXA 3TE4A 2PSWA 5HH1A 2XPLA 5AG4A 4KZTA 4CZ1A 1XMTA 2DPTA 1CPSA 2Q51A 1KC7A 4KSFA 2B4JC 4BPXB 1TXRA 4E8OA 5G21A 4COBA 1BOBA 1LAPA 1PCAA 2IQ6A 4MFLA 1IYKA 3NH8A 4A94A 1XMBA 5CNPA 2O28A 3BUXB 3H5ZA 4XPDC 2C5QA 2R7HA 5A28A 1MK4A 3UY5A 1MJ9A 5BY0A 3FECA 4G1PA 2VZZA 1NSAA 3IIBA 4YFJA 2PJ6A 4MI4A 4DJLA 5CPAA 2CBLA 3BXMA 4DUKA 4E5SA 3U1BA 2V8VA 4MHDA 2O53A 3IGRA 3T90A 3PB6X 2XEGA 4ZY1A 4UFXA 3KQXA 4LQ6A 3VWDA 2G3TA 2OZUA 4OC2A 2PVWA 2OZGA 1I1DA 2ZXVA 3EO4A 3FJUA 5IX3A 5J1QA 2GP4A 2B4BA 2VEZA 2ODFA 1TIQA 2FVGA 4YWYA 4E0AA 2PJ8A 3RZAA 1ZO0A 2YNEA 4C2XA 1AYEA 5LRKA 4C9AA 4GM5A 5JVLA 3GYAA 4IK2A 4RN7A 3FB3A 2B0AA 3V7ZA 2C27A 2G0BA 1YVHA 3ZZIA 2BOAA 3T05A 4K3NA 4AVCA 4ZYQA 1YX0A 1VBHA 4ZI6A 2ZEGA 2Z10A 2AFOA 2QJ8A 2FE7A 4R6TA 5HXDA 4KLWA 2HWGA 2B3UA 2B4DB 2D4OA 1QMUA 3TOBA 4II9A 4LUAA 3IU2A 1ZG8A 4IHMA 1BAVA 4CAVA 4IF5A 1TKJA 1YW4A 4PK2A 5AG6A 4AVBA 3EXNA 3VRPA 4OMEA 2PRQA 2VZYA 4ORFA 5I0CA 1KEEB 2C6PA 1CBXA 2CF4A 2R1IA 2YNCC 4NCZA 4JVOA 3CZXA 3QNVA 4KNGE 5IR2A 4CO9A 4PPZA 5D8NA 4C99A 1ZG7A 1HDUA 2PJBA 4WJBA 4CPAA 4UCPA 2OZHA 3PGPA 4ZX9A 3IC1A 4Z65A 4HKFA 5K8MA 1J4JA 4KSIA 4OC3A 4JXQA 5ELYA 2AFUA 4H6UA 1QSNA 5G22A 1TKHA 2BUEA 4ONUA 2PJ2A 2IJZA 4L8AA 3ZNIA 2R98A 2WPXA 3ISZA 4RI1A 1M4IA 2Q43A 1YW6A 4PV6A 5JGFA 1V6CA 1LAMA 3BHXA 5KTCA 2NYQA 1GGOA 1XJOA 2Q4YA 3LMSA 1KBLA 3G3SA 1ELLP 2BCOA 3DGVA 3KKWA 3PB7X 4AG9A 4BD9A 4FAIA 5IB0A 2YJVA 1GYTA 4YRHA 1WVMA 2PJCA 1NXJA 3FEEA 1M1DA 4MFJA 1IGBA 4A31A 4X8IA 4F9UA 1R43A 1IICA 3FRMA 1K4JA 2GIVA 1TF9A 2Z3MA 3TLEA 3WR7A 4CGPA 4FD5A 2F8HA 3K9TA 3PRTA 1XFOA 4P4IA 1YGHA 3I3GA 4C84A 1CP6A 2PJ0A 4OC0A 2QIRA 4M85A 1Y9WA 1YLOA 1Z9UA 3S6GA 2AJ6A 3F9KC 4JZ0A 2NMTA 3FMCA 4A4BA 5IV0A 5ISVA 4X2TA 1M6VB 2AFMA 3MGDA 2XPNA 2B3VA 2Y0MA 4MFQA 3S6KA 3NFQA 2CXAA 4C85A 3PEIA 2JLMA 2ZW5A 4H89A 2VXKA 4IUSA 4KVXA 2VBQA 1YQEA 1V0CA 4OC5A 6CPAA 3TLAA 3OAKA 2P6FA 5J8CA 1FY7A 3TO6A 1Z9EA 1SQHA 3CXSA 4LX9A 4MFPA 2JBKA 3B3VA 4U9YA 5JPHA 4FWUA 4IIYA 2P6GA 1JDEA 2JDCA 3G23A 2BL1A 3VH9A 3T9YA 4EVYA 1S3ZA 4QC6A 3D67A 4EYSA 3B8GA 3H8FA 3PFOA 4MHYA 4TWEA 3TLYA 3SJFA 3VRRA 3BLNA 4BMHA 1HDQA 4NGQA 1BPNA 4X5KA 5HVFA 3R1KA 4F0YA 3P2HA 1X12A 3HMJG 3RAMA 4A95A 2Q4ZA 5BWAB 4H6ZA 1KZFA 3JTKA 4CGOA 3T0TA 3VRQA 4A38A 3SJXA 2FIAA 5KTAA 3S9NA 3DSBA 1MJAA 3V38A 1AUGA 2X0SA 3KRVA 4MI1A 1WJTA 1F57A 1NMTA 3FNCA 4OIWA 1LOKA 2OB0A 3JVNA 3VARA 4OIDA 4JJXA 4B14A 1DTDA 2JEVA 4P10A 4TJXA 2Q0YA 5LYIA 2R8VA 4MCRA 4Q38A 2Q4VA 4CYNA 3L2NA 1B47A 4PXDA 2C6GA 2IMOA 4BINA 2F5IA 2XPPA 3C26A 2B5GB 4MFKA 3VRNA 1Q2CA 3FX6A 3RNZA 4PQAA 2OH1A 1P0HA 1XE4A 2Y1MA 1U6MA 4OC4A 4CGLA 1ZL0A 1NBWA 4P4DA 3HLPA 4JYWA 5C82A 4RR2B 8CPAA 3IO1A 3NE7A 2CNMA 3PB8X 4KVOE 3RYOA 4ONWA 4MHPA 2WZNA 3F8KA 5EMIA 4A30A 5F5XA 4I49A 2GE3A 1F2OA 4X3RA 4J3GA 3FBUA 1CS0B 4NGMA 4COGA 1Z4EA 1I12A 1A9XB 2KCWA 2FCKA 3H8EA 3R9GA 4NEXA 2YNCA 3D68A 3OP0A 3VROA 1ZYMA 4IIXA 3T5MA 2PJ9A 4EFDA 1S7NA 3W6SA 2CNSA 2DEAA 4JD6A 2CTBA 2EBJA 1XF8A 5J8FA 2V8HA 2GANA 4F8ZA 5F1YA 1WK4A 2P6EA 3I6SA 3LACA 3D8PA 2HROA 2GREA 2ZOFA 3DNSA 3GY9A 4B11A 1Z8WA 2WYRA 4C8FA 3GIUA 4C8AA
chains in the Genus database with same CATH topology
2XEIA 5JM6A 2ZEMA 3NA6A 5LYDA 4P4EA 1AMPA 2POKA 3TX8A 3BI0A 2HB6A 2ZEPA 1LFWA 4MCSA 5F09A 2PCUA 2PJ1A 3PB9X 3H8GA 3KQZA 1M4LA 1LCPA 3SI2A 2JEWA 3WC5A 2GLFA 2VL1A 4ZY2A 3PBEA 4LQGA 3D4UA 3T8WA 2ZENA 1Q7LA 3SI1A 2PJAA 3B2YA 4C8UA 2PJ7A 4P4FA 1BPMA 4NJQA 3KHZA 3SI0A 1HEEA 1PYTB 2EWBA 4UIAA 5K8PA 4P44A 4NGSA 1Z5RA 5K8OA 5K8NA 4WWVA 3B3CA 1ELMP 3HUVA 3TC8A 4ZX8A 3KR5A 2NSMA 2EK8A 1Z8LA 3IFEA 4C9EA 4NGPA 4TNUA 3KGQA 2OOTA 5LRJA 2GLJA 2XEFA 1R3NA 1XF1A 4UIBA 4R8FA 4PXEA 1CX8A 3WABA 2CIJA 2ZEEA 2G9DA 3ISXA 4R7MA 3KZWA 1XBUA 3JRUA 3N5FA 3GB0A 4FUUA 3CPXA 2ZEDA 4ZY0A 3WC6A 4MCPA 3CPAA 4MHNA 2F7VA 2V77A 2AFSA 4MCQA 3D7HA 2V8DA 3PBBA 5CBMA 2ZELA 4P6YA 1F2PA 4UEZA 4RUHA 2OR4A 3WT4A 4F9VA 4UEFA 2ABZA 2HC9A 2QVPA 3GUXA 7CPAA 4C8PA 4UEEA 1ARLA 4OKOA 1VGYA 4W9YA 1FT7A 3PFEA 4A37A 1ZLHA 3MRUA 5IB9A 4OP4A 1TKFA 2ZEOA 3NH5A 4PXCA 2V8GA 2GU2A 3NH4A 4NGNA 4OC1A 1Z2LA 4Q7AA 1Y9ZA 2PIZA 3PB4X 4C8TA 4DYOA 1UWYA 1ARMA 2PIYA 3LWUA 4C8CA 1YSJA 2AFZA 2ZEFA 4P45A 1FNOA 1XRYA 3B3SA 4C9RA 2RB7A 5LYFA 3VTAA 3SJGA 5JH9A 1OBRA 3B3TA 2JBJA 3D7DA 3SJEA 5HVGA 2AFWA 2RFHA 5THWA 1IY7A 3K2KA 4NGTA 2C6CA 2BO9A 2QYVA 1Y0YA 4AXVA 4A39A 5LRGA 4UF4A 1CPXA 4NFRA 4NJRA 4MMOA 3ICUA 4TJVA 3RBUA 4R76A 4MRIA 4H2KA 3I1UA 2PJ3A 3NFZA 1LANA 2ANPA 4YU9A 4B6ZA 4PXBA 4IAVA 4MHZA 2I3CA 2PE3A 5HVHA 2PJ5A 3IEHA 1H8LA 3B3WA 3D7FA 1BLLE 1QQ9A 4YN3A 2EK9A 3KL9A 3FH4A 3FEDA 4EWTA 3EIFA 3IWWA 3D66A 1VHOA 1DE4C 2XEJA 2O4HA 4FBEA 2C1CA 1TF8A 3MN8A 1YMEA 2PJ4A 1VHEA 3FVLA 3S9LA 4P4BA 4C9VA 1RTQA 1CP7A 5DS0A 4ZY1A 3CDXA 3B35A 3IJ3A 1VIXA 5LYLA 4CDKA 4O23A 1Y0RA 1CG2A 3KASA 1EE3P 1ZG9A 3CT9A 1Y7EA 2J9AA 2ZEHA 4EMEA 3S9MA 3FF3A 5I4MA 3KR4A 4MXUA 1JQGA 3KI9A 3D7GA 4P4JA 5D29A 3KHXA 3I74A 3BI1A 4CDJA 3WC7A 3GLJA 3VATA 3DLJA 4C9UA 3B7IA 4C86A 2CTCA 4NGRA 2ZOGA 1KWMA 2PVVA 1ZLIA 2AFXA 1CPSA 2Q51A 1TXRA 1LAPA 1PCAA 2IQ6A 4A94A 3NH8A 1XMBA 2C5QA 3FECA 4G1PA 1NSAA 3IIBA 2PJ6A 4DJLA 5CPAA 3BXMA 4DUKA 2V8VA 2O53A 3PB6X 2XEGA 3KQXA 3FJUA 4OC2A 2PVWA 5J1QA 2GP4A 2FVGA 4YWYA 2PJ8A 3RZAA 1AYEA 5LRKA 4C9AA 4GM5A 4IK2A 3V7ZA 2BOAA 4K3NA 4ZYQA 4ZI6A 2ZEGA 2AFOA 2QJ8A 5HXDA 4R6TA 1QMUA 4IHMA 1ZG8A 1BAVA 1TKJA 1YW4A 2PRQA 4OMEA 2C6PA 1CBXA 2CF4A 3QNVA 4KNGE 5IR2A 4PPZA 5D8NA 4C99A 1ZG7A 1HDUA 2PJBA 4WJBA 4CPAA 4ZX9A 4Z65A 3IC1A 5K8MA 4KSIA 4OC3A 5ELYA 2AFUA 1TKHA 2PJ2A 2IJZA 5LYIA 3ISZA 5JGFA 2Q43A 1V6CA 1YW6A 1LAMA 3BHXA 2NYQA 1XJOA 3LMSA 1ELLP 2BCOA 3DGVA 3PB7X 4BD9A 4FAIA 1GYTA 1WVMA 2PJCA 3FEEA 1IGBA 4X8IA 4F9UA 1R43A 1TF9A 2F8HA 3K9TA 3PRTA 1XFOA 4P4IA 4C84A 1CP6A 2PJ0A 4OC0A 1YLOA 4JZ0A 3FMCA 4X2TA 2AFMA 4C85A 3PEIA 6CPAA 4OC5A 2JBKA 3B3VA 4FWUA 3VH9A 3D67A 3H8FA 3PFOA 4MHYA 4TWEA 3SJFA 1HDQA 4NGQA 1BPNA 5HVFA 3RAMA 2Q4ZA 4A38A 3SJXA 3S9NA 3V38A 1F57A 4OIWA 1LOKA 3VARA 4OIDA 1DTDA 4P10A 4TJXA 4MCRA 3L2NA 4PXDA 2C6GA 2IMOA 3FX6A 4PQAA 4OC4A 4P4DA 3HLPA 4JYWA 8CPAA 3IO1A 3PB8X 4ONWA 4MHPA 2WZNA 1F2OA 4X3RA 4NGMA 3H8EA 3D68A 2PJ9A 4EFDA 2DEAA 2CTBA 2V8HA 4F8ZA 3I6SA 2GREA 2ZOFA 2WYRA 4C8FA 4C8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEI A;  5JM6 A;  2ZEM A;  3NA6 A;  5LYD A;  4P4E A;  1AMP A;  2POK A;  3TX8 A;  3BI0 A;  2HB6 A;  2ZEP A;  1LFW A;  4MCS A;  5F09 A;  2PCU A;  2PJ1 A;  3PB9 X;  3H8G A;  3KQZ A;  1M4L A;  1LCP A;  3SI2 A;  2JEW A;  3WC5 A;  2GLF A;  2VL1 A;  4ZY2 A;  3PBE A;  4LQG A;  3D4U A;  3T8W A;  2ZEN A;  1Q7L A;  3SI1 A;  2PJA A;  3B2Y A;  4C8U A;  2PJ7 A;  4P4F A;  1BPM A;  4NJQ A;  3KHZ A;  3SI0 A;  1HEE A;  1PYT B;  2EWB A;  4UIA A;  5K8P A;  4P44 A;  4NGS A;  1Z5R A;  5K8O A;  5K8N A;  4WWV A;  3B3C A;  1ELM P;  3HUV A;  3TC8 A;  4ZX8 A;  3KR5 A;  2NSM A;  2EK8 A;  1Z8L A;  3IFE A;  4C9E A;  4NGP A;  4TNU A;  3KGQ A;  2OOT A;  5LRJ A;  2GLJ A;  2XEF A;  1R3N A;  1XF1 A;  4UIB A;  4R8F A;  4PXE A;  1CX8 A;  3WAB A;  2CIJ A;  2ZEE A;  2G9D A;  3ISX A;  4R7M A;  3KZW A;  1XBU A;  3JRU A;  3N5F A;  3GB0 A;  4FUU A;  3CPX A;  2ZED A;  4ZY0 A;  3WC6 A;  4MCP A;  3CPA A;  4MHN A;  2F7V A;  2V77 A;  2AFS A;  4MCQ A;  3D7H A;  2V8D A;  3PBB A;  5CBM A;  2ZEL A;  4P6Y A;  1F2P A;  4UEZ A;  4RUH A;  2OR4 A;  3WT4 A;  4F9V A;  4UEF A;  2ABZ A;  2HC9 A;  2QVP A;  3GUX A;  7CPA A;  4C8P A;  4UEE A;  1ARL A;  4OKO A;  1VGY A;  4W9Y A;  1FT7 A;  3PFE A;  4A37 A;  1ZLH A;  3MRU A;  5IB9 A;  4OP4 A;  1TKF A;  2ZEO A;  3NH5 A;  4PXC A;  2V8G A;  2GU2 A;  3NH4 A;  4NGN A;  4OC1 A;  1Z2L A;  4Q7A A;  1Y9Z A;  2PIZ A;  3PB4 X;  4C8T A;  4DYO A;  1UWY A;  1ARM A;  2PIY A;  3LWU A;  4C8C A;  1YSJ A;  2AFZ A;  2ZEF A;  4P45 A;  1FNO A;  1XRY A;  3B3S A;  4C9R A;  2RB7 A;  5LYF A;  3VTA A;  3SJG A;  5JH9 A;  1OBR A;  3B3T A;  2JBJ A;  3D7D A;  3SJE A;  5HVG A;  2AFW A;  2RFH A;  5THW A;  1IY7 A;  3K2K A;  4NGT A;  2C6C A;  2BO9 A;  2QYV A;  1Y0Y A;  4AXV A;  4A39 A;  5LRG A;  4UF4 A;  1CPX A;  4NFR A;  4NJR A;  4MMO A;  3ICU A;  4TJV A;  3RBU A;  4R76 A;  4MRI A;  4H2K A;  3I1U A;  2PJ3 A;  3NFZ A;  1LAN A;  2ANP A;  4YU9 A;  4B6Z A;  4PXB A;  4IAV A;  4MHZ A;  2I3C A;  2PE3 A;  5HVH A;  2PJ5 A;  3IEH A;  1H8L A;  3B3W A;  3D7F A;  1BLL E;  1QQ9 A;  4YN3 A;  2EK9 A;  3KL9 A;  3FH4 A;  3FED A;  4EWT A;  3EIF A;  3IWW A;  3D66 A;  1VHO A;  1DE4 C;  2XEJ A;  2O4H A;  4FBE A;  2C1C A;  1TF8 A;  3MN8 A;  1YME A;  2PJ4 A;  1VHE A;  3FVL A;  3S9L A;  4P4B A;  4C9V A;  1RTQ A;  1CP7 A;  5DS0 A;  4ZY1 A;  3CDX A;  3B35 A;  3IJ3 A;  1VIX A;  5LYL A;  4CDK A;  4O23 A;  1Y0R A;  1CG2 A;  3KAS A;  1EE3 P;  1ZG9 A;  3CT9 A;  1Y7E A;  2J9A A;  2ZEH A;  4EME A;  3S9M A;  3FF3 A;  5I4M A;  3KR4 A;  4MXU A;  1JQG A;  3KI9 A;  3D7G A;  4P4J A;  5D29 A;  3KHX A;  3I74 A;  3BI1 A;  4CDJ A;  3WC7 A;  3GLJ A;  3VAT A;  3DLJ A;  4C9U A;  3B7I A;  4C86 A;  2CTC A;  4NGR A;  2ZOG A;  1KWM A;  2PVV A;  1ZLI A;  2AFX A;  1CPS A;  2Q51 A;  1TXR A;  1LAP A;  1PCA A;  2IQ6 A;  4A94 A;  3NH8 A;  1XMB A;  3FEC A;  4G1P A;  1NSA A;  3IIB A;  2PJ6 A;  4DJL A;  5CPA A;  3BXM A;  4DUK A;  2V8V A;  2O53 A;  3PB6 X;  2XEG A;  3KQX A;  3FJU A;  4OC2 A;  2PVW A;  5J1Q A;  2FVG A;  4YWY A;  2PJ8 A;  3RZA A;  1AYE A;  5LRK A;  4C9A A;  4GM5 A;  4IK2 A;  3V7Z A;  2BOA A;  4K3N A;  4ZYQ A;  4ZI6 A;  2ZEG A;  2AFO A;  2QJ8 A;  5HXD A;  4R6T A;  1QMU A;  4IHM A;  1ZG8 A;  1BAV A;  1TKJ A;  1YW4 A;  2PRQ A;  4OME A;  2C6P A;  1CBX A;  2CF4 A;  3QNV A;  4KNG E;  4PPZ A;  5D8N A;  4C99 A;  1ZG7 A;  1HDU A;  2PJB A;  4WJB A;  4CPA A;  4ZX9 A;  4Z65 A;  3IC1 A;  5K8M A;  4KSI A;  4OC3 A;  5ELY A;  2AFU A;  1TKH A;  2PJ2 A;  2IJZ A;  5LYI A;  3ISZ A;  5JGF A;  2Q43 A;  1V6C A;  1YW6 A;  1LAM A;  3BHX A;  2NYQ A;  1XJO A;  3LMS A;  1ELL P;  2BCO A;  3DGV A;  3PB7 X;  4BD9 A;  4FAI A;  1GYT A;  1WVM A;  2PJC A;  3FEE A;  1IGB A;  4X8I A;  4F9U A;  1R43 A;  1TF9 A;  2F8H A;  3K9T A;  3PRT A;  1XFO A;  4P4I A;  4C84 A;  1CP6 A;  2PJ0 A;  4OC0 A;  1YLO A;  4JZ0 A;  3FMC A;  4X2T A;  2AFM A;  4C85 A;  3PEI A;  6CPA A;  4OC5 A;  2JBK A;  3B3V A;  4FWU A;  3VH9 A;  3D67 A;  3H8F A;  3PFO A;  4MHY A;  4TWE A;  3SJF A;  1HDQ A;  4NGQ A;  1BPN A;  5HVF A;  3RAM A;  2Q4Z A;  4A38 A;  3SJX A;  3S9N A;  3V38 A;  1F57 A;  4OIW A;  1LOK A;  3VAR A;  4OID A;  1DTD A;  4P10 A;  4TJX A;  4MCR A;  3L2N A;  4PXD A;  2C6G A;  2IMO A;  3FX6 A;  4PQA A;  4OC4 A;  4P4D A;  3HLP A;  4JYW A;  8CPA A;  3IO1 A;  3PB8 X;  4ONW A;  4MHP A;  2WZN A;  1F2O A;  4X3R A;  4NGM A;  3H8E A;  3D68 A;  2PJ9 A;  4EFD A;  2DEA A;  2CTB A;  2V8H A;  4F8Z A;  3I6S A;  2GRE A;  2ZOF A;  2WYR A;  4C8F A;  4C8A A; 
#chains in the Genus database with same CATH topology
 2XEI A;  2J8N A;  5JM6 A;  2ZEM A;  3NA6 A;  5LYD A;  4P4E A;  1YVK A;  5HKZ A;  5J3X A;  1AMP A;  2POK A;  3LD2 A;  5F49 A;  3TX8 A;  3BI0 A;  2HB6 A;  3C8O A;  2ZEP A;  1LFW A;  4MCS A;  5F09 A;  2B4D A;  4R3L A;  1EZB A;  3OWC A;  4CRY B;  2PCU A;  5AGE A;  1QSM A;  2PJ1 A;  3PB9 X;  4CGN A;  4MY3 A;  3EZE A;  1YLE A;  2R82 A;  4E94 A;  3HPG G;  3H8G A;  3KQZ A;  1M4L A;  3SHP A;  4AG7 A;  1LCP A;  5F47 A;  3SI2 A;  4C68 A;  3G8W A;  4KSA A;  2JEW A;  4J0N A;  2I79 A;  2BEI A;  1IB1 E;  2GLF A;  2VL1 A;  3WC5 A;  4ZY2 A;  4NSQ A;  3PBE A;  3PT1 A;  1BXR B;  5HMN A;  1R61 A;  4LQG A;  2EZB A;  3D4U A;  3T8W A;  2ZEN A;  1Q7L A;  5H86 A;  4R57 A;  4U5Y A;  5GCN A;  3QAH A;  4U9Z A;  4C7I A;  3SI1 A;  2PJA A;  3B2Y A;  4C8U A;  4RS2 A;  4E2A A;  2ATR A;  2PJ7 A;  2DPS A;  3EC4 A;  1EZA A;  5G20 A;  4INJ A;  4CYO A;  4P4F A;  1BPM A;  4NJQ A;  5EBV A;  4HNW B;  3KHZ A;  3SI0 A;  1HEE A;  1PYT B;  2EWB A;  1I21 A;  1P4N A;  1S7F A;  2HV2 A;  4UIA A;  2VI7 A;  4BBH A;  2J8M A;  5K8P A;  4P44 A;  4NGS A;  1QST A;  1Z5R A;  3OB1 B;  2QML A;  5K8O A;  1JWQ A;  5K8N A;  4XNH B;  1R57 A;  3QAY A;  4WWV A;  3U88 C;  3B3C A;  2IL4 A;  2REE A;  4KVM E;  3NOJ A;  1ELM P;  3HUV A;  3TC8 A;  2ZW6 A;  4MBU A;  3KR5 A;  4ZX8 A;  4KUB A;  3R9F A;  2EZC A;  1T36 B;  1Y9K A;  5F13 A;  1J3L A;  2NSM A;  2EK8 A;  1Z8L A;  2VQY A;  3EZA A;  3IFE A;  4BTF A;  4C9E A;  4NGP A;  1YR0 A;  3N7Z A;  4TNU A;  2Q7S A;  3KGQ A;  2OOT A;  3ZJ0 A;  5LRJ A;  2GLJ A;  2XEF A;  1YRE A;  1R3N A;  4ZBG A;  1PU9 A;  5G1Z A;  1XF1 A;  1IU8 A;  4UIB A;  2JDD A;  4R8F A;  4PXE A;  1Q5X A;  3K4I A;  1CX8 A;  3WAB A;  2CIJ A;  2ZEE A;  2G9D A;  3ISX A;  4R7M A;  3RO0 A;  2EZA A;  3BUW B;  1XBU A;  3JRU A;  3KZW A;  3N5F A;  1GHE A;  5K99 A;  4K30 A;  4OLL A;  3BUM B;  3GB0 A;  3I9S A;  2WPW A;  4XNH C;  4NF1 A;  4FUU A;  4CAF A;  2D0P A;  4XPK A;  4A32 A;  2FM4 A;  2HUZ A;  2ZED A;  3CPX A;  1CM0 A;  4UBR A;  4ZY0 A;  4M8D A;  3WC6 A;  3SR3 A;  4MCP A;  3CPA A;  4M3S A;  4MHN A;  5EC4 A;  2F7V A;  2V77 A;  4GS4 A;  1QSR A;  4KOU A;  2ARH A;  4M6G A;  4C7H A;  2Z11 A;  4A2Z A;  1YK3 A;  2AFS A;  4MCQ A;  3D7H A;  2V8D A;  3PBB A;  1NE9 A;  5CBM A;  4KOT A;  5C88 A;  2PC1 A;  2ZEL A;  4P6Y A;  1F2P A;  2EVN A;  5AG5 A;  4B10 A;  4CAX A;  4UEZ A;  4Q36 A;  4UWI A;  2PR8 A;  4R87 A;  4RUH A;  2OR4 A;  4MJ8 A;  3S6H A;  3WT4 A;  4MJX A;  4F9V A;  4UEF A;  2REF A;  2ABZ A;  3T07 A;  1MJB A;  2HC9 A;  2QVP A;  3GUX A;  2YND A;  3TO9 A;  3JUW A;  5AG7 A;  3R96 A;  4B5P B;  4ZGY B;  7CPA A;  3TLZ A;  3OB2 B;  4JLY A;  2B5G A;  3NE8 A;  3TLC A;  4C8P A;  2PDO A;  1ARL A;  4JWP A;  4OKO A;  4UEE A;  1B6B A;  1VGY A;  1Z4R A;  2HQY A;  2B58 A;  1A2Z A;  1M44 A;  2Q44 A;  4HNX B;  4W9Y A;  1FT7 A;  3PFE A;  4DNC A;  4A37 A;  1ZLH A;  3MRU A;  5IB9 A;  3FIX A;  4OP4 A;  4NXY A;  3SXN A;  1TKF A;  2CY2 A;  1VBG A;  4CAW A;  4CYQ A;  1Q2D A;  2DLA A;  2ZEO A;  3NH5 A;  4PXC A;  1JDB C;  4CAE A;  2V8G A;  2GU2 A;  3NH4 A;  4NGN A;  3TLG B;  4KLV A;  3O8Z A;  1IOI A;  4OC1 A;  1Z2L A;  1S60 A;  2FXF A;  2P0W A;  5LYL A;  2HI6 A;  4Q7A A;  5DWN A;  3S6F A;  4UCM A;  1CJW A;  1Y9Z A;  2PIZ A;  3PB4 X;  1L0C A;  2FSR A;  4FD4 A;  4C8T A;  4DYO A;  2PCN A;  5FVJ A;  1UWY A;  1B87 A;  3R9E A;  5H84 A;  2PRB A;  1ARM A;  3DDD A;  2QEC A;  2PIY A;  2Y1N A;  3LWU A;  2Z3O A;  4C8C A;  1YVO A;  2XPO A;  1YSJ A;  4F6A A;  3EZB A;  5FD8 A;  1S7L A;  2AFZ A;  4PSX A;  3D2M A;  2X7B A;  2ZEF A;  5JQ4 A;  4P45 A;  3TYX A;  3GJZ A;  1FNO A;  3CXQ A;  1S5K A;  1XRY A;  3B3S A;  1OZP A;  4C9R A;  2RB7 A;  5LYF A;  3VTA A;  3SJG A;  3BUN B;  1M4G A;  5JH9 A;  4HPS A;  2ZPA A;  1ON0 A;  5A27 A;  1XEB A;  1OBR A;  3B3T A;  2DIK A;  1LRZ A;  4XPL A;  3TT2 A;  1XIX A;  1ZRS A;  1S7K A;  2JBJ A;  2AUN A;  3D7D A;  3SJE A;  5HVG A;  2AFW A;  4M6I A;  2DXQ A;  2RFH A;  3W6X A;  3PZJ A;  4CGM A;  5THW A;  1IY7 A;  1IOF A;  1Z8T A;  2Z3K A;  3K2K A;  4NGT A;  1N71 A;  5HKW A;  3V8I A;  2G3A A;  2C6C A;  2BO9 A;  2QYV A;  1Z8X A;  2FIW A;  2D0O A;  4B13 A;  1Y0Y A;  3TO7 A;  3GKR A;  3SXO A;  4AXV A;  4KOY A;  4Y49 B;  3IWE A;  4A39 A;  4F0X A;  1WWZ A;  5F46 A;  2MP0 A;  4C2Z A;  5LRG A;  4BPU B;  4UF4 A;  1XOV A;  1CPX A;  3BJ7 A;  4QVT A;  4NFR A;  4NJR A;  2FS5 A;  4MMO A;  3ICU A;  1KUY A;  2E28 A;  3QB8 A;  3VGO A;  2H5M A;  4TJV A;  3RBU A;  3BUO B;  4R76 A;  4MRI A;  4H2K A;  4KOS A;  3I1U A;  5F48 A;  1PUA A;  2D4P A;  2PJ3 A;  4R3K A;  4OAD A;  3NFZ A;  2BSW A;  4UCN A;  1LAN A;  2ANP A;  4YU9 A;  1FBV A;  1IYL A;  4CS0 B;  2PR1 A;  4B6Z A;  3R95 A;  4PXB A;  4CYP A;  2AE6 A;  1CE8 B;  2UV8 G;  4FD7 A;  4IAV A;  4UA3 A;  3TCV A;  1IID A;  2Z3P A;  4MHZ A;  5F9M A;  2I3C A;  2PE3 A;  5HVH A;  2PQ8 A;  3HPH E;  4YGO A;  1RO5 A;  1Q2Y A;  2PJ5 A;  3IEH A;  3IU1 A;  1H8L A;  3B3W A;  3D7F A;  1BLL E;  2Z3N A;  1QQ9 A;  4KOX A;  4KS9 A;  4MFZ A;  4OAE A;  1C3O B;  4YN3 A;  1KUV A;  2EK9 A;  3KL9 A;  4BPW B;  3FH4 A;  3FED A;  2A4N A;  2OU2 A;  4QUS A;  4Y49 C;  4EWT A;  4R9M A;  4GPL B;  3EIF A;  5HKY A;  2K5T A;  3IWW A;  4QBJ A;  2I00 A;  3EFA A;  3D66 A;  5KTD A;  2J8R A;  1VHO A;  1DE4 C;  2CNT A;  4FD6 A;  4A33 A;  3LOD A;  2XEJ A;  2O4H A;  4FBE A;  3IWG A;  3FYN A;  2OLS A;  3TFY A;  2C1C A;  2Q7B A;  1TF8 A;  3D2P A;  3F5B A;  1UFH A;  2YGW A;  3MN8 A;  4KUA A;  1YME A;  4UFV A;  1EO0 A;  2FT0 A;  1VHE A;  2PJ4 A;  3S9L A;  4P4B A;  3FVL A;  4C2Y A;  2ZW7 A;  4C9V A;  1VHS A;  2YJT A;  3E0K A;  2N3A B;  4QB9 A;  4UWJ A;  4A4C A;  1RTQ A;  1RXT A;  3PFV A;  3PLF B;  1CP7 A;  4JXR A;  5DS0 A;  4KOV A;  1VKC A;  3CDX A;  3B35 A;  3IJ3 A;  1VIX A;  4PSW A;  3A9L A;  2ZW4 A;  3TOA A;  3W91 A;  4L89 A;  4HNY B;  4O23 A;  4CDK A;  2GFQ A;  2EUI A;  1Y0R A;  1CG2 A;  5E96 A;  2WSA A;  3KAS A;  1EE3 P;  1ZG9 A;  3CT9 A;  3BJ8 A;  2Z0Z A;  2DF5 A;  2FL4 A;  2EO8 A;  4AVA A;  1C30 B;  1Y7E A;  2J9A A;  2Q04 A;  2ZEH A;  3D3S A;  4EME A;  3S9M A;  3H4Q A;  3FF3 A;  4KOR A;  2WUU A;  3KR4 A;  3CXP A;  5DWM A;  5I4M A;  4MXU A;  2AUM A;  4B5P A;  1JQG A;  4B5O A;  3KI9 A;  3D7G A;  1Y7R A;  4P4J A;  3DR6 A;  1VI4 A;  3F0A A;  5D29 A;  3KHX A;  4PK3 A;  4XPD B;  3I74 A;  3BI1 A;  1KUX A;  4MY0 A;  3TTH A;  4H1H A;  1X10 A;  3K9U A;  4CDJ A;  5JYB A;  3FXT A;  3WC7 A;  4B12 A;  3GLJ A;  4AB7 A;  3TLB A;  2RC4 A;  3P2F A;  3VAT A;  1M4D A;  3PP9 A;  5AXI A;  2Z3L A;  3EY5 A;  1NSL A;  3DLJ A;  3DR8 A;  4C9U A;  3TLG A;  4KOW A;  3B7I A;  4C86 A;  4M6H A;  4UFW A;  1BO4 A;  2CTC A;  4CRZ B;  4NGR A;  2VKZ G;  2ZOG A;  4GXH A;  1KWM A;  2PVV A;  1ZLI A;  3VWE A;  1QSO A;  1DIK A;  2AFX A;  3TE4 A;  2PSW A;  5HH1 A;  2XPL A;  5AG4 A;  4KZT A;  4CZ1 A;  1XMT A;  2DPT A;  1CPS A;  2Q51 A;  1KC7 A;  4KSF A;  2B4J C;  4BPX B;  1TXR A;  4E8O A;  5G21 A;  4COB A;  1BOB A;  1LAP A;  1PCA A;  2IQ6 A;  4MFL A;  1IYK A;  3NH8 A;  4A94 A;  1XMB A;  5CNP A;  2O28 A;  3BUX B;  3H5Z A;  4XPD C;  2C5Q A;  2R7H A;  5A28 A;  1MK4 A;  3UY5 A;  1MJ9 A;  5BY0 A;  3FEC A;  4G1P A;  2VZZ A;  1NSA A;  3IIB A;  4YFJ A;  2PJ6 A;  4MI4 A;  4DJL A;  5CPA A;  2CBL A;  3BXM A;  4DUK A;  4E5S A;  3U1B A;  2V8V A;  4MHD A;  2O53 A;  3IGR A;  3T90 A;  3PB6 X;  2XEG A;  4ZY1 A;  4UFX A;  3KQX A;  4LQ6 A;  3VWD A;  2G3T A;  2OZU A;  4OC2 A;  2PVW A;  2OZG A;  1I1D A;  2ZXV A;  3EO4 A;  3FJU A;  5IX3 A;  5J1Q A;  2GP4 A;  2B4B A;  2VEZ A;  2ODF A;  1TIQ A;  2FVG A;  4YWY A;  4E0A A;  2PJ8 A;  3RZA A;  1ZO0 A;  2YNE A;  4C2X A;  1AYE A;  5LRK A;  4C9A A;  4GM5 A;  5JVL A;  3GYA A;  4IK2 A;  4RN7 A;  3FB3 A;  2B0A A;  3V7Z A;  2C27 A;  2G0B A;  1YVH A;  3ZZI A;  2BOA A;  3T05 A;  4K3N A;  4AVC A;  4ZYQ A;  1YX0 A;  1VBH A;  4ZI6 A;  2ZEG A;  2Z10 A;  2AFO A;  2QJ8 A;  2FE7 A;  4R6T A;  5HXD A;  4KLW A;  2HWG A;  2B3U A;  2B4D B;  2D4O A;  1QMU A;  3TOB A;  4II9 A;  4LUA A;  3IU2 A;  1ZG8 A;  4IHM A;  1BAV A;  4CAV A;  4IF5 A;  1TKJ A;  1YW4 A;  4PK2 A;  5AG6 A;  4AVB A;  3EXN A;  3VRP A;  4OME A;  2PRQ A;  2VZY A;  4ORF A;  5I0C A;  1KEE B;  2C6P A;  1CBX A;  2CF4 A;  2R1I A;  2YNC C;  4NCZ A;  4JVO A;  3CZX A;  3QNV A;  4KNG E;  5IR2 A;  4CO9 A;  4PPZ A;  5D8N A;  4C99 A;  1ZG7 A;  1HDU A;  2PJB A;  4WJB A;  4CPA A;  4UCP A;  2OZH A;  3PGP A;  4ZX9 A;  3IC1 A;  4Z65 A;  4HKF A;  5K8M A;  1J4J A;  4KSI A;  4OC3 A;  4JXQ A;  5ELY A;  2AFU A;  4H6U A;  1QSN A;  5G22 A;  1TKH A;  2BUE A;  4ONU A;  2PJ2 A;  2IJZ A;  4L8A A;  3ZNI A;  2R98 A;  2WPX A;  3ISZ A;  4RI1 A;  1M4I A;  2Q43 A;  1YW6 A;  4PV6 A;  5JGF A;  1V6C A;  1LAM A;  3BHX A;  5KTC A;  2NYQ A;  1GGO A;  1XJO A;  2Q4Y A;  3LMS A;  1KBL A;  3G3S A;  1ELL P;  2BCO A;  3DGV A;  3KKW A;  3PB7 X;  4AG9 A;  4BD9 A;  4FAI A;  5IB0 A;  2YJV A;  1GYT A;  4YRH A;  1WVM A;  2PJC A;  1NXJ A;  3FEE A;  1M1D A;  4MFJ A;  1IGB A;  4A31 A;  4X8I A;  4F9U A;  1R43 A;  1IIC A;  3FRM A;  1K4J A;  2GIV A;  1TF9 A;  2Z3M A;  3TLE A;  3WR7 A;  4CGP A;  4FD5 A;  2F8H A;  3K9T A;  3PRT A;  1XFO A;  4P4I A;  1YGH A;  3I3G A;  4C84 A;  1CP6 A;  2PJ0 A;  4OC0 A;  2QIR A;  4M85 A;  1Y9W A;  1YLO A;  1Z9U A;  3S6G A;  2AJ6 A;  3F9K C;  4JZ0 A;  2NMT A;  3FMC A;  4A4B A;  5IV0 A;  5ISV A;  4X2T A;  1M6V B;  2AFM A;  3MGD A;  2XPN A;  2B3V A;  2Y0M A;  4MFQ A;  3S6K A;  3NFQ A;  2CXA A;  4C85 A;  3PEI A;  2JLM A;  2ZW5 A;  4H89 A;  2VXK A;  4IUS A;  4KVX A;  2VBQ A;  1YQE A;  1V0C A;  4OC5 A;  6CPA A;  3TLA A;  3OAK A;  2P6F A;  5J8C A;  1FY7 A;  3TO6 A;  1Z9E A;  1SQH A;  3CXS A;  4LX9 A;  4MFP A;  2JBK A;  3B3V A;  4U9Y A;  5JPH A;  4FWU A;  4IIY A;  2P6G A;  1JDE A;  2JDC A;  3G23 A;  2BL1 A;  3VH9 A;  3T9Y A;  4EVY A;  1S3Z A;  4QC6 A;  3D67 A;  4EYS A;  3B8G A;  3H8F A;  3PFO A;  4MHY A;  4TWE A;  3TLY A;  3SJF A;  3VRR A;  3BLN A;  4BMH A;  1HDQ A;  4NGQ A;  1BPN A;  4X5K A;  5HVF A;  3R1K A;  4F0Y A;  3P2H A;  1X12 A;  3HMJ G;  3RAM A;  4A95 A;  2Q4Z A;  5BWA B;  4H6Z A;  1KZF A;  3JTK A;  4CGO A;  3T0T A;  3VRQ A;  4A38 A;  3SJX A;  2FIA A;  5KTA A;  3S9N A;  3DSB A;  1MJA A;  3V38 A;  1AUG A;  2X0S A;  3KRV A;  4MI1 A;  1WJT A;  1F57 A;  1NMT A;  3FNC A;  4OIW A;  1LOK A;  2OB0 A;  3JVN A;  3VAR A;  4OID A;  4JJX A;  4B14 A;  1DTD A;  2JEV A;  4P10 A;  4TJX A;  2Q0Y A;  5LYI A;  2R8V A;  4MCR A;  4Q38 A;  2Q4V A;  4CYN A;  3L2N A;  1B47 A;  4PXD A;  2C6G A;  2IMO A;  4BIN A;  2F5I A;  2XPP A;  3C26 A;  2B5G B;  4MFK A;  3VRN A;  1Q2C A;  3FX6 A;  3RNZ A;  4PQA A;  2OH1 A;  1P0H A;  1XE4 A;  2Y1M A;  1U6M A;  4OC4 A;  4CGL A;  1ZL0 A;  1NBW A;  4P4D A;  3HLP A;  4JYW A;  5C82 A;  4RR2 B;  8CPA A;  3IO1 A;  3NE7 A;  2CNM A;  3PB8 X;  4KVO E;  3RYO A;  4ONW A;  4MHP A;  2WZN A;  3F8K A;  5EMI A;  4A30 A;  5F5X A;  4I49 A;  2GE3 A;  1F2O A;  4X3R A;  4J3G A;  3FBU A;  1CS0 B;  4NGM A;  4COG A;  1Z4E A;  1I12 A;  1A9X B;  2KCW A;  2FCK A;  3H8E A;  3R9G A;  4NEX A;  2YNC A;  3D68 A;  3OP0 A;  3VRO A;  1ZYM A;  4IIX A;  3T5M A;  2PJ9 A;  4EFD A;  1S7N A;  3W6S A;  2CNS A;  2DEA A;  4JD6 A;  2CTB A;  2EBJ A;  1XF8 A;  5J8F A;  2V8H A;  2GAN A;  4F8Z A;  5F1Y A;  1WK4 A;  2P6E A;  3I6S A;  3LAC A;  3D8P A;  2HRO A;  2GRE A;  2ZOF A;  3DNS A;  3GY9 A;  4B11 A;  1Z8W A;  2WYR A;  4C8F A;  3GIU A;  4C8A A; 
#chains in the Genus database with same CATH homology
 2XEI A;  5JM6 A;  2ZEM A;  3NA6 A;  5LYD A;  4P4E A;  1AMP A;  2POK A;  3TX8 A;  3BI0 A;  2HB6 A;  2ZEP A;  1LFW A;  4MCS A;  5F09 A;  2PCU A;  2PJ1 A;  3PB9 X;  3H8G A;  3KQZ A;  1M4L A;  1LCP A;  3SI2 A;  2JEW A;  3WC5 A;  2GLF A;  2VL1 A;  4ZY2 A;  3PBE A;  4LQG A;  3D4U A;  3T8W A;  2ZEN A;  1Q7L A;  3SI1 A;  2PJA A;  3B2Y A;  4C8U A;  2PJ7 A;  4P4F A;  1BPM A;  4NJQ A;  3KHZ A;  3SI0 A;  1HEE A;  1PYT B;  2EWB A;  4UIA A;  5K8P A;  4P44 A;  4NGS A;  1Z5R A;  5K8O A;  5K8N A;  4WWV A;  3B3C A;  1ELM P;  3HUV A;  3TC8 A;  4ZX8 A;  3KR5 A;  2NSM A;  2EK8 A;  1Z8L A;  3IFE A;  4C9E A;  4NGP A;  4TNU A;  3KGQ A;  2OOT A;  5LRJ A;  2GLJ A;  2XEF A;  1R3N A;  1XF1 A;  4UIB A;  4R8F A;  4PXE A;  1CX8 A;  3WAB A;  2CIJ A;  2ZEE A;  2G9D A;  3ISX A;  4R7M A;  3KZW A;  1XBU A;  3JRU A;  3N5F A;  3GB0 A;  4FUU A;  3CPX A;  2ZED A;  4ZY0 A;  3WC6 A;  4MCP A;  3CPA A;  4MHN A;  2F7V A;  2V77 A;  2AFS A;  4MCQ A;  3D7H A;  2V8D A;  3PBB A;  5CBM A;  2ZEL A;  4P6Y A;  1F2P A;  4UEZ A;  4RUH A;  2OR4 A;  3WT4 A;  4F9V A;  4UEF A;  2ABZ A;  2HC9 A;  2QVP A;  3GUX A;  7CPA A;  4C8P A;  4UEE A;  1ARL A;  4OKO A;  1VGY A;  4W9Y A;  1FT7 A;  3PFE A;  4A37 A;  1ZLH A;  3MRU A;  5IB9 A;  4OP4 A;  1TKF A;  2ZEO A;  3NH5 A;  4PXC A;  2V8G A;  2GU2 A;  3NH4 A;  4NGN A;  4OC1 A;  1Z2L A;  4Q7A A;  1Y9Z A;  2PIZ A;  3PB4 X;  4C8T A;  4DYO A;  1UWY A;  1ARM A;  2PIY A;  3LWU A;  4C8C A;  1YSJ A;  2AFZ A;  2ZEF A;  4P45 A;  1FNO A;  1XRY A;  3B3S A;  4C9R A;  2RB7 A;  5LYF A;  3VTA A;  3SJG A;  5JH9 A;  1OBR A;  3B3T A;  2JBJ A;  3D7D A;  3SJE A;  5HVG A;  2AFW A;  2RFH A;  5THW A;  1IY7 A;  3K2K A;  4NGT A;  2C6C A;  2BO9 A;  2QYV A;  1Y0Y A;  4AXV A;  4A39 A;  5LRG A;  4UF4 A;  1CPX A;  4NFR A;  4NJR A;  4MMO A;  3ICU A;  4TJV A;  3RBU A;  4R76 A;  4MRI A;  4H2K A;  3I1U A;  2PJ3 A;  3NFZ A;  1LAN A;  2ANP A;  4YU9 A;  4B6Z A;  4PXB A;  4IAV A;  4MHZ A;  2I3C A;  2PE3 A;  5HVH A;  2PJ5 A;  3IEH A;  1H8L A;  3B3W A;  3D7F A;  1BLL E;  1QQ9 A;  4YN3 A;  2EK9 A;  3KL9 A;  3FH4 A;  3FED A;  4EWT A;  3EIF A;  3IWW A;  3D66 A;  1VHO A;  1DE4 C;  2XEJ A;  2O4H A;  4FBE A;  2C1C A;  1TF8 A;  3MN8 A;  1YME A;  2PJ4 A;  1VHE A;  3FVL A;  3S9L A;  4P4B A;  4C9V A;  1RTQ A;  1CP7 A;  5DS0 A;  4ZY1 A;  3CDX A;  3B35 A;  3IJ3 A;  1VIX A;  5LYL A;  4CDK A;  4O23 A;  1Y0R A;  1CG2 A;  3KAS A;  1EE3 P;  1ZG9 A;  3CT9 A;  1Y7E A;  2J9A A;  2ZEH A;  4EME A;  3S9M A;  3FF3 A;  5I4M A;  3KR4 A;  4MXU A;  1JQG A;  3KI9 A;  3D7G A;  4P4J A;  5D29 A;  3KHX A;  3I74 A;  3BI1 A;  4CDJ A;  3WC7 A;  3GLJ A;  3VAT A;  3DLJ A;  4C9U A;  3B7I A;  4C86 A;  2CTC A;  4NGR A;  2ZOG A;  1KWM A;  2PVV A;  1ZLI A;  2AFX A;  1CPS A;  2Q51 A;  1TXR A;  1LAP A;  1PCA A;  2IQ6 A;  4A94 A;  3NH8 A;  1XMB A;  2C5Q A;  3FEC A;  4G1P A;  1NSA A;  3IIB A;  2PJ6 A;  4DJL A;  5CPA A;  3BXM A;  4DUK A;  2V8V A;  2O53 A;  3PB6 X;  2XEG A;  3KQX A;  3FJU A;  4OC2 A;  2PVW A;  5J1Q A;  2GP4 A;  2FVG A;  4YWY A;  2PJ8 A;  3RZA A;  1AYE A;  5LRK A;  4C9A A;  4GM5 A;  4IK2 A;  3V7Z A;  2BOA A;  4K3N A;  4ZYQ A;  4ZI6 A;  2ZEG A;  2AFO A;  2QJ8 A;  5HXD A;  4R6T A;  1QMU A;  4IHM A;  1ZG8 A;  1BAV A;  1TKJ A;  1YW4 A;  2PRQ A;  4OME A;  2C6P A;  1CBX A;  2CF4 A;  3QNV A;  4KNG E;  5IR2 A;  4PPZ A;  5D8N A;  4C99 A;  1ZG7 A;  1HDU A;  2PJB A;  4WJB A;  4CPA A;  4ZX9 A;  4Z65 A;  3IC1 A;  5K8M A;  4KSI A;  4OC3 A;  5ELY A;  2AFU A;  1TKH A;  2PJ2 A;  2IJZ A;  5LYI A;  3ISZ A;  5JGF A;  2Q43 A;  1V6C A;  1YW6 A;  1LAM A;  3BHX A;  2NYQ A;  1XJO A;  3LMS A;  1ELL P;  2BCO A;  3DGV A;  3PB7 X;  4BD9 A;  4FAI A;  1GYT A;  1WVM A;  2PJC A;  3FEE A;  1IGB A;  4X8I A;  4F9U A;  1R43 A;  1TF9 A;  2F8H A;  3K9T A;  3PRT A;  1XFO A;  4P4I A;  4C84 A;  1CP6 A;  2PJ0 A;  4OC0 A;  1YLO A;  4JZ0 A;  3FMC A;  4X2T A;  2AFM A;  4C85 A;  3PEI A;  6CPA A;  4OC5 A;  2JBK A;  3B3V A;  4FWU A;  3VH9 A;  3D67 A;  3H8F A;  3PFO A;  4MHY A;  4TWE A;  3SJF A;  1HDQ A;  4NGQ A;  1BPN A;  5HVF A;  3RAM A;  2Q4Z A;  4A38 A;  3SJX A;  3S9N A;  3V38 A;  1F57 A;  4OIW A;  1LOK A;  3VAR A;  4OID A;  1DTD A;  4P10 A;  4TJX A;  4MCR A;  3L2N A;  4PXD A;  2C6G A;  2IMO A;  3FX6 A;  4PQA A;  4OC4 A;  4P4D A;  3HLP A;  4JYW A;  8CPA A;  3IO1 A;  3PB8 X;  4ONW A;  4MHP A;  2WZN A;  1F2O A;  4X3R A;  4NGM A;  3H8E A;  3D68 A;  2PJ9 A;  4EFD A;  2DEA A;  2CTB A;  2V8H A;  4F8Z A;  3I6S A;  2GRE A;  2ZOF A;  2WYR A;  4C8F A;  4C8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...