3BXMA

Structure of an inactive mutant of human glutamate carboxypeptidase ii [gcpii(e424a)] in complex with n-acetyl-asp-glu (naag)
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Reaction mechanism of glutamate carboxypeptidase II revealed by mutagenesis, X-ray crystallography, and computational methods.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bxmA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bxmA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bxmA02
1FT7A 3FMCA 2ZEFA 1YSJA 4A39A 4PXDA 6CPAA 4OC5A 3PEIA 4MRIA 3D68A 2BOAA 3S9LA 1AMPA 2PCUA 3B3VA 4BD9A 2PJ2A 2BO9A 4NGTA 4UEEA 4IAVA 3NH5A 4YN3A 4NFRA 4G1PA 2PJCA 3H8FA 1NSAA 4R8FA 3MRUA 2PJ7A 3D7HA 3S9NA 4C99A 4A37A 2XEFA 4DYOA 3I6SA 3N5FA 4A94A 4R6TA 4Z65A 1PYTB 5K8PA 4MMOA 4DJLA 1IGBA 4C8PA 2V8DA 4K3NA 2J9AA 1IY7A 3WC6A 3TX8A 4ZY0A 1CBXA 2ZEMA 3LWUA 1BAVA 4F9VA 3V7ZA 1Y9ZA 4P4IA 1LFWA 2CTCA 3BHXA 1HEEA 2QVPA 4C85A 3KZWA 2Q4ZA 3IWWA 3FEDA 2GU2A 4C9RA 3KASA 1TF8A 3I74A 2ZEHA 3D4UA 2F7VA 1BPMA 2RB7A 3GB0A 5LYDA 4GM5A 3WC7A 2ABZA 3IJ3A 1VIXA 4MCPA 2EWBA 3QNVA 3SJEA 1WVMA 4OC1A 4C8CA 1YMEA 4C8UA 3H8GA 4PPZA 1CPXA 2CIJA 4NGPA 1XRYA 2ZEPA 2PVVA 5K8OA 3DLJA 3IEHA 4YU9A 4P4BA 3IC1A 4OC2A 2C6GA 3BI1A 4OC0A 4UF4A 1LANA 4P44A 1ARLA 4P4DA 4MHYA 4CDKA 3KHZA 4P45A 1YW6A 1TKJA 2HB6A 3CT9A 1Z2LA 3PB9X 5CPAA 4ZI6A 5J1QA 2PJ3A 2ZEDA 3L2NA 4C84A 2NYQA 3IFEA 3I1UA 4ZY1A 4P10A 2PRQA 4MHPA 4OP4A 4R76A 4R7MA 3FEEA 2OOTA 3FX6A 2PJ5A 1F2PA 2V8GA 3PFEA 4X3RA 3VARA 3VTAA 1UWYA 2O4HA 1QQ9A 3B7IA 2JBKA 4YWYA 4WWVA 1R3NA 3SJXA 3PB8X 1LCPA 4AXVA 3KQXA 5HVHA 3D66A 3GUXA 4PXEA 4TJVA 3EIFA 5LYLA 2ZELA 2JEWA 4PXCA 1M4LA 2WYRA 8CPAA 2PE3A 1TXRA 2GLFA 2IQ6A 5K8NA 4FUUA 2BCOA 1XFOA 4P4JA 1ZG9A 4C8AA 1GYTA 2IJZA 4RUHA 2G9DA 5HVGA 2EK9A 4DUKA 3FH4A 2V8VA 2FVGA 2AFUA 3WABA 3D67A 3FJUA 3RZAA 4EMEA 5D29A 1XJOA 3FECA 2PJBA 4PXBA 4OMEA 1YLOA 3FVLA 4KSIA 4IK2A 3DGVA 4NGQA 4F8ZA 4C9VA 2XEGA 2XEJA 2HC9A 4P6YA 5THWA 3ISXA 4OIDA 4H2KA 3B35A 3KQZA 3PB6X 5I4MA 1V6CA 4FAIA 1CG2A 3SJFA 2ZOFA 2AFXA 3H8EA 4NJRA 4EWTA 2OR4A 1OBRA 4P4FA 5LRKA 4C8FA 4KNGE 2PJ9A 3PB7X 3D7FA 3JRUA 2CF4A 2ZOGA 1ZG8A 2PIZA 3KR4A 3HLPA 4ONWA 3B3CA 4ZX8A 4NGNA 4MHNA 4CDJA 1BPNA 1VGYA 4A38A 2PJ6A 4NGSA 1TF9A 3CPAA 4FBEA 1VHOA 3SI1A 4C8TA 2Q51A 5LYIA 4C9UA 2AFSA 2IMOA 4OIWA 3KI9A 1DTDA 3RBUA 1ARMA 4UIAA 5JM6A 4C86A 4C9AA 1Y0YA 4IHMA 3WT4A 1Q7LA 3NFZA 2AFZA 3WC5A 3SI0A 3FF3A 3IIBA 2PJ0A 5LRJA 4OC3A 1XBUA 4Q7AA 3LMSA 2C6CA 3D7DA 1YW4A 1ZLHA 2DEAA 1KWMA 3HUVA 4FWUA 2O53A 1ZLIA 1Y0RA 3PBEA 2NSMA 2EK8A 1FNOA 4NGRA 3D7GA 2RFHA 3VH9A 2VL1A 2PVWA 2I3CA 2V77A 2WZNA 5ELYA 1Z5RA 4MCRA 1CX8A 2C1CA 2F8HA 4UEFA 2QJ8A 3RAMA 1Z8LA 2ZEGA 1CP7A 1CPSA 4F9UA 2C6PA 4MXUA 3ICUA 2AFOA 4LQGA 4CPAA 3CDXA 1EE3P 5K8MA 5JGFA 3ISZA 4UIBA 4TWEA 2PJ1A 4JZ0A 1HDQA 5DS0A 3MN8A 2PJAA 3TC8A 2V8HA 5IB9A 1H8LA 2CTBA 1QMUA 4MCQA 4X2TA 3B3WA 3B3SA 4ZX9A 2POKA 1ELMP 3PB4X 4ZY2A 5JH9A 4OKOA 4NGMA 1RTQA 3K9TA 3PBBA 1DE4C 1R43A 3V38A 1LAMA 3KGQA 2JBJA 3KHXA 2ZEEA 2XEIA 3S9MA 3NH8A 5HVFA 3T8WA 4UEZA 4B6ZA 3NH4A 5D8NA 1TKFA 4PQAA 4WJBA 1XF1A 3KL9A 5CBMA 3PRTA 3GLJA 4P4EA 3BXMA 2PIYA 1XMBA 3B2YA 1Y7EA 1JQGA 1PCAA 3SJGA 1CP6A 2GREA 4OC4A 1F2OA 4MCSA 1F57A 4MHZA 2PJ4A 1VHEA 5F09A 4W9YA 4TNUA 4JYWA 4NJQA 3VATA 4C9EA 3BI0A 5LYFA 5LRGA 2AFWA 4X8IA 1ZG7A 3K2KA 1HDUA 3CPXA 2ZENA 2PJ8A 1AYEA 3SI2A 3PFOA 1ELLP 3IO1A 1LAPA 3B3TA 2ANPA 2GLJA 2Q43A 4ZYQA 2QYVA 1BLLE 2AFMA 3KR5A 2ZEOA 1LOKA 4O23A 5HXDA 1TKHA 4EFDA 7CPAA 4TJXA 3NA6A
chains in the Genus database with same CATH superfamily
4C68A 4MFZA 5AXIA 5BWAB 1ZYMA 1FT7A 1OZPA 3FMCA 2ZEFA 4UCPA 1YSJA 3FB3A 4A39A 4ONUA 5JVLA 1IOIA 2ATRA 4PXDA 4HKFA 3TOAA 6CPAA 4CGNA 5KTAA 4UA3A 3T9YA 1XEBA 4OC5A 3PEIA 3B8GA 4MRIA 1ZL0A 1J3LA 2WPXA 1I21A 2X7BA 3D68A 2XPOA 2BOAA 4GXHA 2CNMA 4KLWA 2OH1A 5JQ4A 2GANA 2VZYA 1M6VB 4XPDB 3S9LA 1AMPA 1MK4A 2PCUA 3BUXB 3B3VA 3EZBA 4H1HA 4BD9A 4L89A 2PJ2A 2BO9A 2Q0YA 4NGTA 2E28A 4EVYA 4UEEA 4IAVA 5F9MA 3NH5A 2DPTA 2MP0A 4YN3A 4CAWA 3TLYA 4NFRA 4EYSA 1Q2DA 2OB0A 4G1PA 2PJCA 1IU8A 1NSAA 3H8FA 1ZO0A 4JXRA 4LX9A 2HI6A 2AJ6A 4R8FA 4MJ8A 3MRUA 2PJ7A 3D7HA 3S9NA 4Q36A 4C99A 4A37A 2XEFA 4DYOA 4MFPA 2C5QA 3I6SA 3N5FA 4A94A 2UV8G 4CO9A 4R6TA 4BBHA 4Z65A 2NMTA 5G20A 1PYTB 4M85A 5K8PA 4GPLB 4RR2B 4MMOA 3R9GA 4DJLA 1BO4A 2X0SA 4RS2A 3TO9A 3TLAA 1IGBA 4KUBA 4M6GA 4C8PA 2JLMA 2V8DA 4K3NA 4HPSA 2J9AA 4B13A 4UFXA 1IY7A 2XPLA 3WC6A 3TX8A 1YVHA 1GGOA 5H86A 4ZY0A 2R82A 2R98A 4JVOA 5AG6A 3FXTA 3RNZA 1CBXA 2BEIA 2ZEMA 1Z9UA 3LWUA 4ZBGA 2BSWA 4XPDC 4ZGYB 5BY0A 4PK2A 1BAVA 4F9VA 5A28A 3V7ZA 1PU9A 1S7LA 1EZAA 3G23A 3TLGB 1YVOA 1Y9ZA 4KVXA 4P4IA 1LFWA 2EZAA 5J3XA 2G3TA 2CTCA 3BHXA 4NF1A 4UFWA 4M3SA 2VI7A 1HEEA 2QVPA 4C85A 2RC4A 4OLLA 4F0YA 4MBUA 1KEEB 2FE7A 2Q4ZA 3IWWA 3KZWA 4C2YA 4DNCA 3S6HA 3FEDA 2GU2A 3D2MA 4U5YA 3S6KA 2P0WA 4C9RA 2B4JC 4BMHA 3KASA 4Y49B 4B5OA 1TF8A 3BJ7A 5G21A 2ZEHA 3D4UA 1IYLA 5F46A 1AUGA 2PDOA 5IB0A 3I74A 2F7VA 5EMIA 1BPMA 3HPHE 3SXOA 5F1YA 4CYOA 4OADA 2RB7A 3GB0A 2REFA 1UFHA 5AGEA 4CGMA 1CM0A 1Y9WA 5LYDA 2CNSA 4GM5A 4FD6A 3WC7A 5EC4A 2ABZA 3TOBA 3BLNA 3IJ3A 1VIXA 2FXFA 3TE4A 1K4JA 4MCPA 2EWBA 3QNVA 4IF5A 3SJEA 5CNPA 1YX0A 1WK4A 2B5GB 2YNCA 4OC1A 2ZXVA 3D2PA 1DIKA 1RO5A 3S6GA 1VBGA 1YMEA 1WVMA 4C8CA 4C8UA 3H8GA 4PPZA 1IIDA 3VWDA 1CPXA 1RXTA 4C7IA 2CIJA 4NGPA 2WPWA 1XRYA 1P0HA 2B58A 5AG5A 4L8AA 2ZEPA 2PVVA 5K8OA 3DLJA 1QSOA 3IEHA 4YU9A 4P4BA 2C27A 2R8VA 3IC1A 4OC2A 4QC6A 2C6GA 3FRMA 4J0NA 1IICA 2DLAA 3BI1A 4OC0A 3HMJG 1QSTA 3LD2A 4UF4A 1LANA 4P44A 1ARLA 2EUIA 4M6HA 4P4DA 2AUNA 5A27A 1S5KA 2FCKA 2EBJA 4KOTA 2ZPAA 4CYNA 4E8OA 1KUVA 2CXAA 4MHYA 3FYNA 1YLEA 3KHZA 2I00A 4P45A 4CDKA 1YW6A 1TKJA 5J8FA 4BPWB 5F49A 2HB6A 3CT9A 4H6UA 1IB1E 5DWNA 3T0TA 1Z2LA 4B5PA 3PB9X 2WUUA 3P2HA 2PR8A 4B10A 3OB1B 5CPAA 3V8IA 4E5SA 1S3ZA 4OAEA 2GE3A 2CBLA 1M4GA 2PJ3A 2ZEDA 2ZW7A 3L2NA 4ZI6A 5J1QA 4C84A 1P4NA 3K9UA 4A30A 3LACA 2NYQA 3IFEA 3I1UA 4ZY1A 3TLCA 4P10A 2PRQA 4MHPA 2VBQA 4OP4A 2OZGA 4R76A 5F48A 4R7MA 3EZEA 5IX3A 3A9LA 1BXRB 3FEEA 3DDDA 1YK3A 3R9EA 2OOTA 3CXPA 3FX6A 2PJ5A 4KSFA 1F2PA 2V8GA 3PFEA 4X3RA 3TO6A 3VARA 3VTAA 1UWYA 2WSAA 3T05A 2O4HA 1QQ9A 3B7IA 4IUSA 4KSAA 3W6SA 4NEXA 2JBKA 4YWYA 4WWVA 1R3NA 3SJXA 3PB8X 4A95A 1LCPA 3O8ZA 3I9SA 2DXQA 2K5TA 3KQXA 3N7ZA 4AXVA 1FY7A 5HVHA 3D66A 3GUXA 4PXEA 4C2XA 4TJVA 4U9YA 1Z4RA 3EIFA 3OAKA 5LYLA 1KC7A 2ZELA 3PP9A 2JEWA 2Z0ZA 4PXCA 4C7HA 2GP4A 1IOFA 1M4LA 2WYRA 3QAHA 4GS4A 1VKCA 8CPAA 4RI1A 2FM4A 2PE3A 1TXRA 1Y7RA 4KOUA 2GLFA 3PLFB 2IQ6A 2Q44A 5K8NA 4FUUA 2BCOA 1XFOA 4P4JA 1ZG9A 2Q4VA 3IU2A 4KS9A 4R57A 1Q5XA 1GYTA 4XPKA 2IJZA 4C8AA 4NCZA 2PR1A 4RUHA 2G9DA 5HVGA 2EK9A 4DUKA 1C3OB 3FH4A 2Y0MA 1S7KA 1M4IA 2QMLA 3GKRA 4MFJA 4U9ZA 1Z8TA 2DPSA 2V8VA 4YGOA 1ZRSA 2FVGA 4COBA 1JWQA 2AFUA 3WABA 1JDEA 1WWZA 1YGHA 3D67A 3FJUA 3RZAA 4EMEA 5G22A 1A9XB 5D29A 4QUSA 1Z8WA 4KLVA 2JDDA 3T90A 1XJOA 3FECA 2PJBA 4PXBA 1NBWA 3GJZA 4RN7A 4OMEA 1YLOA 3FVLA 2D4PA 4IK2A 4KSIA 4ORFA 4QB9A 1T36B 5F5XA 3DGVA 4NGQA 4BPXB 4JLYA 5JPHA 2OZHA 5AG7A 4F8ZA 3TLGA 4UWIA 2CNTA 4C9VA 2XEGA 2R7HA 2XEJA 2HC9A 2OU2A 4P6YA 1R57A 5THWA 3ISXA 5FD8A 4M6IA 4H2KA 4OIDA 3B35A 3KQZA 2R1IA 3OB2B 1X10A 3G8WA 4BTFA 2HV2A 3GYAA 3PB6X 5HKWA 5I4MA 3VRQA 1XMTA 4KOXA 4CYQA 1V6CA 4FAIA 1CG2A 3SJFA 3P2FA 2ZOFA 4B11A 2DIKA 2AFXA 3H8EA 1SQHA 2HUZA 4NJRA 4EWTA 3QB8A 4A2ZA 2OR4A 1OBRA 4P4FA 2ZW4A 2REEA 4PSWA 5LRKA 1L0CA 4PV6A 4KORA 1PUAA 4C8FA 2J8RA 4KNGE 3FBUA 3TFYA 2DF5A 2PJ9A 1EO0A 3D7FA 3JRUA 3PB7X 4UCNA 1KUYA 2EZCA 2CF4A 2Q04A 2YNEA 1YVKA 2ZOGA 3F8KA 4I49A 3G3SA 3U88C 3WR7A 3SXNA 1ZG8A 2PIZA 3KR4A 3W91A 2OZUA 2B5GA 3HLPA 2YJTA 4A32A 2EZBA 4ONWA 4XNHB 4MFQA 5GCNA 2D0OA 4R87A 1KBLA 3JTKA 1VBHA 3B3CA 5I0CA 4ZX8A 4NGNA 4MHNA 4CDJA 2GIVA 1Z9EA 3R9FA 1BPNA 1VGYA 4C2ZA 2Q7BA 3VROA 3DR6A 2HWGA 3EFAA 3JUWA 3QAYA 4JWPA 2PJ6A 4A38A 4NGSA 1MJAA 5F47A 1TF9A 3CPAA 1C30B 2J8NA 4MJXA 2VEZA 1VHOA 3NE7A 4FBEA 4KOVA 2D0PA 3SI1A 3IWGA 2Q51A 3VWEA 4C8TA 4CZ1A 5F13A 1VI4A 4CRYB 2BUEA 5HKZA 5LYIA 2Y1MA 2AFSA 4C9UA 2IMOA 4OIWA 1EZBA 3H4QA 4E94A 3CXQA 3KI9A 2B4DB 4MFLA 4NXYA 4BPUB 1DTDA 4CGOA 3RBUA 1ARMA 2JDCA 4UIAA 5JM6A 3TLEA 3EZAA 4C86A 1B6BA 1YR0A 4B12A 4CS0B 4C9AA 1Y0YA 4IHMA 3WT4A 2Z3NA 1Q7LA 2FL4A 3T5MA 3NFZA 2Y1NA 3FNCA 1QSMA 2AFZA 2Z11A 3IGRA 5JYBA 1XF8A 3OP0A 1X12A 4XNHC 3WC5A 1YQEA 3HPGG 1TIQA 3K4IA 3SI0A 3EO4A 3FF3A 2VXKA 2PJ0A 3IIBA 2A4NA 5LRJA 4XPLA 4A4CA 2VZZA 4CAVA 5ISVA 4OC3A 1XBUA 4Q7AA 3LMSA 4AVBA 2C6CA 3D7DA 1N71A 1YW4A 1CE8B 1ZLHA 4JD6A 5C88A 4FD4A 2DEAA 1KWMA 4LQ6A 3BUMB 3JVNA 3HUVA 4KOSA 1M4DA 4FWUA 1YREA 2D4OA 2PC1A 2Z3PA 2O53A 5HMNA 1ZLIA 1Y0RA 3PBEA 1KZFA 5HH1A 3LODA 2NSMA 2EK8A 4MFKA 2HQYA 1XOVA 1FNOA 3DR8A 1QSRA 4UWJA 3UY5A 2B0AA 4NGRA 2CY2A 5H84A 2PRBA 1CS0B 3D7GA 1Y9KA 4CAEA 2RFHA 3VH9A 2VL1A 2PVWA 2I3CA 2V77A 2VQYA 2WZNA 5ELYA 1Z5RA 4KUAA 4MCRA 1CX8A 2FIAA 3EXNA 2Z3OA 3TYXA 2C1CA 2F8HA 4MI4A 3IU1A 2QJ8A 4UEFA 4YRHA 3RAMA 4CAFA 4CRZB 3C8OA 4KVOE 1Z8LA 1CJWA 1R61A 2ZEGA 1CP7A 3TLZA 1CPSA 3OWCA 1MJBA 4NSQA 4IIYA 3CXSA 4UFVA 4A33A 4F9UA 2C6PA 4MXUA 4E2AA 3PFVA 3ICUA 2AFOA 4LQGA 3VRNA 3TO7A 4CPAA 1B87A 5G1ZA 2P6GA 3CDXA 1EE3P 3H5ZA 1ON0A 3D3SA 2QECA 5K8MA 1NXJA 5JGFA 2Q7SA 3ISZA 3C26A 3GIUA 4UIBA 4TWEA 2PJ1A 1XE4A 4AB7A 5K99A 4JZ0A 1HDQA 5DS0A 2JEVA 2B3UA 3NFQA 2PJAA 3MN8A 3TC8A 4J3GA 2V8HA 3ZJ0A 2XPPA 4AVCA 5IB9A 3ZNIA 3VRRA 1H8LA 2G3AA 2YNDA 4PK3A 1A2ZA 1QMUA 2CTBA 4MCQA 2G0BA 4X2TA 4CGPA 2P6EA 1Q2CA 3B3WA 3B3SA 4ZX9A 2POKA 4AVAA 1ELMP 3PB4X 3PGPA 3SHPA 4ZY2A 3GY9A 4OKOA 5JH9A 3F9KC 1J4JA 3D8PA 1S7FA 4MHDA 1Q2YA 1JDBC 2FSRA 1M44A 4NGMA 1RTQA 3EY5A 3F5BA 1S60A 3K9TA 2XPNA 3I3GA 3PBBA 1DE4C 1R43A 2ARHA 2BL1A 3V38A 1LAMA 3KGQA 2JBJA 3KHXA 2B4BA 4IIXA 2ZEEA 2XEIA 4X5KA 5HKYA 4FD7A 2QIRA 1B47A 3S9MA 1FBVA 3NH8A 5HVFA 3VRPA 2FIWA 3T8WA 2Z10A 4UEZA 2H5MA 3R95A 2Z3LA 3R1KA 4B6ZA 3BUWB 1IYKA 5IV0A 4F0XA 4E0AA 5KTCA 3NH4A 3TTHA 4R3KA 4UBRA 3TLBA 3R96A 1LRZA 5D8NA 2O28A 5FVJA 3E0KA 5J8CA 5IR2A 1TKFA 4PQAA 4WJBA 1XF1A 1WJTA 4HNYB 1S7NA 4COGA 2PCNA 1Z4EA 3KL9A 5CBMA 3PRTA 3NOJA 3GLJA 2HROA 2F5IA 4K30A 4P4EA 2PSWA 3BXMA 2PIYA 1XMBA 3B2YA 1VHSA 2EO8A 3VGOA 1Y7EA 1JQGA 1KUXA 1PCAA 3SJGA 3CZXA 4KVME 2ZW5A 2PQ8A 2VKZG 1CP6A 1NSLA 1NMTA 4R9MA 3IWEA 4JJXA 3KRVA 2GREA 4CYPA 4BINA 4OC4A 2I79A 1F2OA 1Z8XA 4MCSA 1F57A 4MHZA 4FD5A 3U1BA 2PJ4A 2B4DA 1VHEA 5F09A 4W9YA 3RYOA 4TNUA 5KTDA 4INJA 3FIXA 4M8DA 4JYWA 4NJQA 3VATA 4C9EA 3BI0A 3BUOB 5LYFA 3BJ8A 2AFWA 1QSNA 4KOYA 4MY3A 5DWMA 4HNWB 2J8MA 5EBVA 5LRGA 3TCVA 3BUNB 4KOWA 2KCWA 2Z3KA 2AUMA 2ZW6A 4Q38A 4X8IA 1U6MA 2B3VA 1XIXA 1GHEA 4CGLA 4YFJA 3DNSA 2ODFA 4A4BA 1BOBA 1ZG7A 3MGDA 1MJ9A 3K2KA 1HDUA 3DSBA 3CPXA 2ZENA 3W6XA 2PJ8A 4JXQA 4CAXA 2GFQA 4PSXA 4AG9A 4H6ZA 2AE6A 3F0AA 4B14A 4II9A 2YJVA 1AYEA 1NE9A 2FT0A 2YGWA 3SI2A 3PFOA 1ELLP 2Z3MA 3IO1A 4Y49C 1LAPA 3ZZIA 4UCMA 3B3TA 3RO0A 5E96A 1I1DA 2ANPA 2GLJA 2Q43A 3SR3A 3NE8A 4H89A 2FS5A 4HNXB 2IL4A 1V0CA 3S6FA 4B5PB 1I12A 3EC4A 4ZYQA 2N3AB 2QYVA 1BLLE 2Q4YA 4MY0A 2AFMA 3T07A 2P6FA 3PZJA 3KR5A 4AG7A 4LUAA 2ZEOA 4R3LA 1LOKA 5C82A 4O23A 4F6AA 5HXDA 4MI1A 1TKHA 4QVTA 2EVNA 4QBJA 2OLSA 2YNCC 5AG4A 3KKWA 4A31A 3TT2A 1M1DA 4EFDA 7CPAA 4TJXA 4KZTA 3PT1A 3NA6A
chains in the Genus database with same CATH topology
1FT7A 3FMCA 2ZEFA 1YSJA 4A39A 4PXDA 6CPAA 4OC5A 3PEIA 4MRIA 3D68A 2BOAA 3S9LA 1AMPA 2PCUA 3B3VA 4BD9A 2PJ2A 2BO9A 4NGTA 4UEEA 4IAVA 3NH5A 4YN3A 4NFRA 4G1PA 2PJCA 3H8FA 1NSAA 4R8FA 3MRUA 2PJ7A 3D7HA 3S9NA 4C99A 4A37A 2XEFA 4DYOA 2C5QA 3I6SA 3N5FA 4A94A 4R6TA 4Z65A 1PYTB 5K8PA 4MMOA 4DJLA 1IGBA 4C8PA 2V8DA 4K3NA 2J9AA 1IY7A 3WC6A 3TX8A 4ZY0A 1CBXA 2ZEMA 3LWUA 1BAVA 4F9VA 3V7ZA 1Y9ZA 4P4IA 1LFWA 2CTCA 3BHXA 1HEEA 2QVPA 4C85A 3KZWA 2Q4ZA 3IWWA 3FEDA 2GU2A 4C9RA 3KASA 1TF8A 3I74A 2ZEHA 3D4UA 2F7VA 1BPMA 2RB7A 3GB0A 5LYDA 4GM5A 3WC7A 2ABZA 3IJ3A 1VIXA 4MCPA 2EWBA 3QNVA 3SJEA 1WVMA 4OC1A 4C8CA 1YMEA 4C8UA 3H8GA 4PPZA 1CPXA 2CIJA 4NGPA 1XRYA 2ZEPA 2PVVA 5K8OA 3DLJA 3IEHA 4YU9A 4P4BA 3IC1A 4OC2A 2C6GA 3BI1A 4OC0A 4UF4A 1LANA 4P44A 1ARLA 4P4DA 4MHYA 4CDKA 3KHZA 4P45A 1YW6A 1TKJA 2HB6A 3CT9A 1Z2LA 3PB9X 5CPAA 4ZI6A 5J1QA 2PJ3A 2ZEDA 3L2NA 4C84A 2NYQA 3IFEA 3I1UA 4ZY1A 4P10A 2PRQA 4MHPA 4OP4A 4R76A 4R7MA 3FEEA 2OOTA 3FX6A 2PJ5A 1F2PA 2V8GA 3PFEA 4X3RA 3VARA 3VTAA 1UWYA 2O4HA 1QQ9A 3B7IA 2JBKA 4YWYA 4WWVA 1R3NA 3SJXA 3PB8X 1LCPA 4AXVA 3KQXA 5HVHA 3D66A 3GUXA 4PXEA 4TJVA 3EIFA 5LYLA 2ZELA 2JEWA 4PXCA 2GP4A 1M4LA 2WYRA 8CPAA 2PE3A 1TXRA 2GLFA 2IQ6A 5K8NA 4FUUA 2BCOA 1XFOA 4P4JA 1ZG9A 4C8AA 1GYTA 2IJZA 4RUHA 2G9DA 5HVGA 2EK9A 4DUKA 3FH4A 2V8VA 2FVGA 2AFUA 3WABA 3D67A 3FJUA 3RZAA 4EMEA 5D29A 1XJOA 3FECA 2PJBA 4PXBA 4OMEA 1YLOA 3FVLA 4KSIA 4IK2A 3DGVA 4NGQA 4F8ZA 4C9VA 2XEGA 2XEJA 2HC9A 4P6YA 5THWA 3ISXA 4OIDA 4H2KA 3B35A 3KQZA 3PB6X 5I4MA 1V6CA 4FAIA 1CG2A 3SJFA 2ZOFA 2AFXA 3H8EA 4NJRA 4EWTA 2OR4A 1OBRA 4P4FA 5LRKA 4C8FA 4KNGE 2PJ9A 3PB7X 3D7FA 3JRUA 2CF4A 2ZOGA 1ZG8A 2PIZA 3KR4A 3HLPA 4ONWA 3B3CA 4ZX8A 4NGNA 4MHNA 4CDJA 1BPNA 1VGYA 4A38A 2PJ6A 4NGSA 1TF9A 3CPAA 4FBEA 1VHOA 3SI1A 4C8TA 2Q51A 5LYIA 4C9UA 2AFSA 2IMOA 4OIWA 3KI9A 1DTDA 3RBUA 1ARMA 4UIAA 5JM6A 4C86A 4C9AA 1Y0YA 4IHMA 3WT4A 1Q7LA 3NFZA 2AFZA 3WC5A 3SI0A 3FF3A 3IIBA 2PJ0A 5LRJA 4OC3A 1XBUA 4Q7AA 3LMSA 2C6CA 3D7DA 1YW4A 1ZLHA 2DEAA 1KWMA 3HUVA 4FWUA 2O53A 1ZLIA 1Y0RA 3PBEA 2NSMA 2EK8A 1FNOA 4NGRA 3D7GA 2RFHA 3VH9A 2VL1A 2PVWA 2I3CA 2V77A 2WZNA 5ELYA 1Z5RA 4MCRA 1CX8A 2C1CA 2F8HA 4UEFA 2QJ8A 3RAMA 1Z8LA 2ZEGA 1CP7A 1CPSA 4F9UA 2C6PA 4MXUA 3ICUA 2AFOA 4LQGA 4CPAA 3CDXA 1EE3P 5K8MA 5JGFA 3ISZA 4UIBA 4TWEA 2PJ1A 4JZ0A 1HDQA 5DS0A 3MN8A 2PJAA 3TC8A 2V8HA 5IB9A 1H8LA 2CTBA 1QMUA 4MCQA 4X2TA 3B3WA 3B3SA 4ZX9A 2POKA 1ELMP 3PB4X 4ZY2A 5JH9A 4OKOA 4NGMA 1RTQA 3K9TA 3PBBA 1DE4C 1R43A 3V38A 1LAMA 3KGQA 2JBJA 3KHXA 2ZEEA 2XEIA 3S9MA 3NH8A 5HVFA 3T8WA 4UEZA 4B6ZA 3NH4A 5D8NA 5IR2A 1TKFA 4PQAA 4WJBA 1XF1A 3KL9A 5CBMA 3PRTA 3GLJA 4P4EA 3BXMA 2PIYA 1XMBA 3B2YA 1Y7EA 1JQGA 1PCAA 3SJGA 1CP6A 2GREA 4OC4A 1F2OA 4MCSA 1F57A 4MHZA 2PJ4A 1VHEA 5F09A 4W9YA 4TNUA 4JYWA 4NJQA 3VATA 4C9EA 3BI0A 5LYFA 5LRGA 2AFWA 4X8IA 1ZG7A 3K2KA 1HDUA 3CPXA 2ZENA 2PJ8A 1AYEA 3SI2A 3PFOA 1ELLP 3IO1A 1LAPA 3B3TA 2ANPA 2GLJA 2Q43A 4ZYQA 2QYVA 1BLLE 2AFMA 3KR5A 2ZEOA 1LOKA 4O23A 5HXDA 1TKHA 4EFDA 7CPAA 4TJXA 3NA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FT7 A;  3FMC A;  2ZEF A;  1YSJ A;  4A39 A;  4PXD A;  6CPA A;  4OC5 A;  3PEI A;  4MRI A;  3D68 A;  2BOA A;  3S9L A;  1AMP A;  2PCU A;  3B3V A;  4BD9 A;  2PJ2 A;  2BO9 A;  4NGT A;  4UEE A;  4IAV A;  3NH5 A;  4YN3 A;  4NFR A;  4G1P A;  2PJC A;  3H8F A;  1NSA A;  4R8F A;  3MRU A;  2PJ7 A;  3D7H A;  3S9N A;  4C99 A;  4A37 A;  2XEF A;  4DYO A;  3I6S A;  3N5F A;  4A94 A;  4R6T A;  4Z65 A;  1PYT B;  5K8P A;  4MMO A;  4DJL A;  1IGB A;  4C8P A;  2V8D A;  4K3N A;  2J9A A;  1IY7 A;  3WC6 A;  3TX8 A;  4ZY0 A;  1CBX A;  2ZEM A;  3LWU A;  1BAV A;  4F9V A;  3V7Z A;  1Y9Z A;  4P4I A;  1LFW A;  2CTC A;  3BHX A;  1HEE A;  2QVP A;  4C85 A;  3KZW A;  2Q4Z A;  3IWW A;  3FED A;  2GU2 A;  4C9R A;  3KAS A;  1TF8 A;  3I74 A;  2ZEH A;  3D4U A;  2F7V A;  1BPM A;  2RB7 A;  3GB0 A;  5LYD A;  4GM5 A;  3WC7 A;  2ABZ A;  3IJ3 A;  1VIX A;  4MCP A;  2EWB A;  3QNV A;  3SJE A;  1WVM A;  4OC1 A;  4C8C A;  1YME A;  4C8U A;  3H8G A;  4PPZ A;  1CPX A;  2CIJ A;  4NGP A;  1XRY A;  2ZEP A;  2PVV A;  5K8O A;  3DLJ A;  3IEH A;  4YU9 A;  4P4B A;  3IC1 A;  4OC2 A;  2C6G A;  3BI1 A;  4OC0 A;  4UF4 A;  1LAN A;  4P44 A;  1ARL A;  4P4D A;  4MHY A;  4CDK A;  3KHZ A;  4P45 A;  1YW6 A;  1TKJ A;  2HB6 A;  3CT9 A;  1Z2L A;  3PB9 X;  5CPA A;  4ZI6 A;  5J1Q A;  2PJ3 A;  2ZED A;  3L2N A;  4C84 A;  2NYQ A;  3IFE A;  3I1U A;  4ZY1 A;  4P10 A;  2PRQ A;  4MHP A;  4OP4 A;  4R76 A;  4R7M A;  3FEE A;  2OOT A;  3FX6 A;  2PJ5 A;  1F2P A;  2V8G A;  3PFE A;  4X3R A;  3VAR A;  3VTA A;  1UWY A;  2O4H A;  1QQ9 A;  3B7I A;  2JBK A;  4YWY A;  4WWV A;  1R3N A;  3SJX A;  3PB8 X;  1LCP A;  4AXV A;  3KQX A;  5HVH A;  3D66 A;  3GUX A;  4PXE A;  4TJV A;  3EIF A;  5LYL A;  2ZEL A;  2JEW A;  4PXC A;  1M4L A;  2WYR A;  8CPA A;  2PE3 A;  1TXR A;  2GLF A;  2IQ6 A;  5K8N A;  4FUU A;  2BCO A;  1XFO A;  4P4J A;  1ZG9 A;  4C8A A;  1GYT A;  2IJZ A;  4RUH A;  2G9D A;  5HVG A;  2EK9 A;  4DUK A;  3FH4 A;  2V8V A;  2FVG A;  2AFU A;  3WAB A;  3D67 A;  3FJU A;  3RZA A;  4EME A;  5D29 A;  1XJO A;  3FEC A;  2PJB A;  4PXB A;  4OME A;  1YLO A;  3FVL A;  4KSI A;  4IK2 A;  3DGV A;  4NGQ A;  4F8Z A;  4C9V A;  2XEG A;  2XEJ A;  2HC9 A;  4P6Y A;  5THW A;  3ISX A;  4OID A;  4H2K A;  3B35 A;  3KQZ A;  3PB6 X;  5I4M A;  1V6C A;  4FAI A;  1CG2 A;  3SJF A;  2ZOF A;  2AFX A;  3H8E A;  4NJR A;  4EWT A;  2OR4 A;  1OBR A;  4P4F A;  5LRK A;  4C8F A;  4KNG E;  2PJ9 A;  3PB7 X;  3D7F A;  3JRU A;  2CF4 A;  2ZOG A;  1ZG8 A;  2PIZ A;  3KR4 A;  3HLP A;  4ONW A;  3B3C A;  4ZX8 A;  4NGN A;  4MHN A;  4CDJ A;  1BPN A;  1VGY A;  4A38 A;  2PJ6 A;  4NGS A;  1TF9 A;  3CPA A;  4FBE A;  1VHO A;  3SI1 A;  4C8T A;  2Q51 A;  5LYI A;  4C9U A;  2AFS A;  2IMO A;  4OIW A;  3KI9 A;  1DTD A;  3RBU A;  1ARM A;  4UIA A;  5JM6 A;  4C86 A;  4C9A A;  1Y0Y A;  4IHM A;  3WT4 A;  1Q7L A;  3NFZ A;  2AFZ A;  3WC5 A;  3SI0 A;  3FF3 A;  3IIB A;  2PJ0 A;  5LRJ A;  4OC3 A;  1XBU A;  4Q7A A;  3LMS A;  2C6C A;  3D7D A;  1YW4 A;  1ZLH A;  2DEA A;  1KWM A;  3HUV A;  4FWU A;  2O53 A;  1ZLI A;  1Y0R A;  3PBE A;  2NSM A;  2EK8 A;  1FNO A;  4NGR A;  3D7G A;  2RFH A;  3VH9 A;  2VL1 A;  2PVW A;  2I3C A;  2V77 A;  2WZN A;  5ELY A;  1Z5R A;  4MCR A;  1CX8 A;  2C1C A;  2F8H A;  4UEF A;  2QJ8 A;  3RAM A;  1Z8L A;  2ZEG A;  1CP7 A;  1CPS A;  4F9U A;  2C6P A;  4MXU A;  3ICU A;  2AFO A;  4LQG A;  4CPA A;  3CDX A;  1EE3 P;  5K8M A;  5JGF A;  3ISZ A;  4UIB A;  4TWE A;  2PJ1 A;  4JZ0 A;  1HDQ A;  5DS0 A;  3MN8 A;  2PJA A;  3TC8 A;  2V8H A;  5IB9 A;  1H8L A;  2CTB A;  1QMU A;  4MCQ A;  4X2T A;  3B3W A;  3B3S A;  4ZX9 A;  2POK A;  1ELM P;  3PB4 X;  4ZY2 A;  5JH9 A;  4OKO A;  4NGM A;  1RTQ A;  3K9T A;  3PBB A;  1DE4 C;  1R43 A;  3V38 A;  1LAM A;  3KGQ A;  2JBJ A;  3KHX A;  2ZEE A;  2XEI A;  3S9M A;  3NH8 A;  5HVF A;  3T8W A;  4UEZ A;  4B6Z A;  3NH4 A;  5D8N A;  1TKF A;  4PQA A;  4WJB A;  1XF1 A;  3KL9 A;  5CBM A;  3PRT A;  3GLJ A;  4P4E A;  3BXM A;  2PIY A;  1XMB A;  3B2Y A;  1Y7E A;  1JQG A;  1PCA A;  3SJG A;  1CP6 A;  2GRE A;  4OC4 A;  1F2O A;  4MCS A;  1F57 A;  4MHZ A;  2PJ4 A;  1VHE A;  5F09 A;  4W9Y A;  4TNU A;  4JYW A;  4NJQ A;  3VAT A;  4C9E A;  3BI0 A;  5LYF A;  5LRG A;  2AFW A;  4X8I A;  1ZG7 A;  3K2K A;  1HDU A;  3CPX A;  2ZEN A;  2PJ8 A;  1AYE A;  3SI2 A;  3PFO A;  1ELL P;  3IO1 A;  1LAP A;  3B3T A;  2ANP A;  2GLJ A;  2Q43 A;  4ZYQ A;  2QYV A;  1BLL E;  2AFM A;  3KR5 A;  2ZEO A;  1LOK A;  4O23 A;  5HXD A;  1TKH A;  4EFD A;  7CPA A;  4TJX A;  3NA6 A; 
#chains in the Genus database with same CATH topology
 4C68 A;  4MFZ A;  5AXI A;  5BWA B;  1ZYM A;  1FT7 A;  1OZP A;  3FMC A;  2ZEF A;  4UCP A;  1YSJ A;  3FB3 A;  4A39 A;  4ONU A;  5JVL A;  1IOI A;  2ATR A;  4PXD A;  4HKF A;  3TOA A;  6CPA A;  4CGN A;  5KTA A;  4UA3 A;  3T9Y A;  1XEB A;  4OC5 A;  3PEI A;  3B8G A;  4MRI A;  1ZL0 A;  1J3L A;  2WPX A;  1I21 A;  2X7B A;  3D68 A;  2XPO A;  2BOA A;  4GXH A;  2CNM A;  4KLW A;  2OH1 A;  5JQ4 A;  2GAN A;  2VZY A;  1M6V B;  4XPD B;  3S9L A;  1AMP A;  1MK4 A;  2PCU A;  3BUX B;  3B3V A;  3EZB A;  4H1H A;  4BD9 A;  4L89 A;  2PJ2 A;  2BO9 A;  2Q0Y A;  4NGT A;  2E28 A;  4EVY A;  4UEE A;  4IAV A;  5F9M A;  3NH5 A;  2DPT A;  2MP0 A;  4YN3 A;  4CAW A;  3TLY A;  4NFR A;  4EYS A;  1Q2D A;  2OB0 A;  4G1P A;  2PJC A;  1IU8 A;  1NSA A;  3H8F A;  1ZO0 A;  4JXR A;  4LX9 A;  2HI6 A;  2AJ6 A;  4R8F A;  4MJ8 A;  3MRU A;  2PJ7 A;  3D7H A;  3S9N A;  4Q36 A;  4C99 A;  4A37 A;  2XEF A;  4DYO A;  4MFP A;  2C5Q A;  3I6S A;  3N5F A;  4A94 A;  2UV8 G;  4CO9 A;  4R6T A;  4BBH A;  4Z65 A;  2NMT A;  5G20 A;  1PYT B;  4M85 A;  5K8P A;  4GPL B;  4RR2 B;  4MMO A;  3R9G A;  4DJL A;  1BO4 A;  2X0S A;  4RS2 A;  3TO9 A;  3TLA A;  1IGB A;  4KUB A;  4M6G A;  4C8P A;  2JLM A;  2V8D A;  4K3N A;  4HPS A;  2J9A A;  4B13 A;  4UFX A;  1IY7 A;  2XPL A;  3WC6 A;  3TX8 A;  1YVH A;  1GGO A;  5H86 A;  4ZY0 A;  2R82 A;  2R98 A;  4JVO A;  5AG6 A;  3FXT A;  3RNZ A;  1CBX A;  2BEI A;  2ZEM A;  1Z9U A;  3LWU A;  4ZBG A;  2BSW A;  4XPD C;  4ZGY B;  5BY0 A;  4PK2 A;  1BAV A;  4F9V A;  5A28 A;  3V7Z A;  1PU9 A;  1S7L A;  1EZA A;  3G23 A;  3TLG B;  1YVO A;  1Y9Z A;  4KVX A;  4P4I A;  1LFW A;  2EZA A;  5J3X A;  2G3T A;  2CTC A;  3BHX A;  4NF1 A;  4UFW A;  4M3S A;  2VI7 A;  1HEE A;  2QVP A;  4C85 A;  2RC4 A;  4OLL A;  4F0Y A;  4MBU A;  1KEE B;  2FE7 A;  2Q4Z A;  3IWW A;  3KZW A;  4C2Y A;  4DNC A;  3S6H A;  3FED A;  2GU2 A;  3D2M A;  4U5Y A;  3S6K A;  2P0W A;  4C9R A;  2B4J C;  4BMH A;  3KAS A;  4Y49 B;  4B5O A;  1TF8 A;  3BJ7 A;  5G21 A;  2ZEH A;  3D4U A;  1IYL A;  5F46 A;  1AUG A;  2PDO A;  5IB0 A;  3I74 A;  2F7V A;  5EMI A;  1BPM A;  3HPH E;  3SXO A;  5F1Y A;  4CYO A;  4OAD A;  2RB7 A;  3GB0 A;  2REF A;  1UFH A;  5AGE A;  4CGM A;  1CM0 A;  1Y9W A;  5LYD A;  2CNS A;  4GM5 A;  4FD6 A;  3WC7 A;  5EC4 A;  2ABZ A;  3TOB A;  3BLN A;  3IJ3 A;  1VIX A;  2FXF A;  3TE4 A;  1K4J A;  4MCP A;  2EWB A;  3QNV A;  4IF5 A;  3SJE A;  5CNP A;  1YX0 A;  1WK4 A;  2B5G B;  2YNC A;  4OC1 A;  2ZXV A;  3D2P A;  1DIK A;  1RO5 A;  3S6G A;  1VBG A;  1YME A;  1WVM A;  4C8C A;  4C8U A;  3H8G A;  4PPZ A;  1IID A;  3VWD A;  1CPX A;  1RXT A;  4C7I A;  2CIJ A;  4NGP A;  2WPW A;  1XRY A;  1P0H A;  2B58 A;  5AG5 A;  4L8A A;  2ZEP A;  2PVV A;  5K8O A;  3DLJ A;  1QSO A;  3IEH A;  4YU9 A;  4P4B A;  2C27 A;  2R8V A;  3IC1 A;  4OC2 A;  4QC6 A;  2C6G A;  3FRM A;  4J0N A;  1IIC A;  2DLA A;  3BI1 A;  4OC0 A;  3HMJ G;  1QST A;  3LD2 A;  4UF4 A;  1LAN A;  4P44 A;  1ARL A;  2EUI A;  4M6H A;  4P4D A;  2AUN A;  5A27 A;  1S5K A;  2FCK A;  2EBJ A;  4KOT A;  2ZPA A;  4CYN A;  4E8O A;  1KUV A;  2CXA A;  4MHY A;  3FYN A;  1YLE A;  3KHZ A;  2I00 A;  4P45 A;  4CDK A;  1YW6 A;  1TKJ A;  5J8F A;  4BPW B;  5F49 A;  2HB6 A;  3CT9 A;  4H6U A;  1IB1 E;  5DWN A;  3T0T A;  1Z2L A;  4B5P A;  3PB9 X;  2WUU A;  3P2H A;  2PR8 A;  4B10 A;  3OB1 B;  5CPA A;  3V8I A;  4E5S A;  1S3Z A;  4OAE A;  2GE3 A;  2CBL A;  1M4G A;  2PJ3 A;  2ZED A;  2ZW7 A;  3L2N A;  4ZI6 A;  5J1Q A;  4C84 A;  1P4N A;  3K9U A;  4A30 A;  3LAC A;  2NYQ A;  3IFE A;  3I1U A;  4ZY1 A;  3TLC A;  4P10 A;  2PRQ A;  4MHP A;  2VBQ A;  4OP4 A;  2OZG A;  4R76 A;  5F48 A;  4R7M A;  3EZE A;  5IX3 A;  3A9L A;  1BXR B;  3FEE A;  3DDD A;  1YK3 A;  3R9E A;  2OOT A;  3CXP A;  3FX6 A;  2PJ5 A;  4KSF A;  1F2P A;  2V8G A;  3PFE A;  4X3R A;  3TO6 A;  3VAR A;  3VTA A;  1UWY A;  2WSA A;  3T05 A;  2O4H A;  1QQ9 A;  3B7I A;  4IUS A;  4KSA A;  3W6S A;  4NEX A;  2JBK A;  4YWY A;  4WWV A;  1R3N A;  3SJX A;  3PB8 X;  4A95 A;  1LCP A;  3O8Z A;  3I9S A;  2DXQ A;  2K5T A;  3KQX A;  3N7Z A;  4AXV A;  1FY7 A;  5HVH A;  3D66 A;  3GUX A;  4PXE A;  4C2X A;  4TJV A;  4U9Y A;  1Z4R A;  3EIF A;  3OAK A;  5LYL A;  1KC7 A;  2ZEL A;  3PP9 A;  2JEW A;  2Z0Z A;  4PXC A;  4C7H A;  2GP4 A;  1IOF A;  1M4L A;  2WYR A;  3QAH A;  4GS4 A;  1VKC A;  8CPA A;  4RI1 A;  2FM4 A;  2PE3 A;  1TXR A;  1Y7R A;  4KOU A;  2GLF A;  3PLF B;  2IQ6 A;  2Q44 A;  5K8N A;  4FUU A;  2BCO A;  1XFO A;  4P4J A;  1ZG9 A;  2Q4V A;  3IU2 A;  4KS9 A;  4R57 A;  1Q5X A;  1GYT A;  4XPK A;  2IJZ A;  4C8A A;  4NCZ A;  2PR1 A;  4RUH A;  2G9D A;  5HVG A;  2EK9 A;  4DUK A;  1C3O B;  3FH4 A;  2Y0M A;  1S7K A;  1M4I A;  2QML A;  3GKR A;  4MFJ A;  4U9Z A;  1Z8T A;  2DPS A;  2V8V A;  4YGO A;  1ZRS A;  2FVG A;  4COB A;  1JWQ A;  2AFU A;  3WAB A;  1JDE A;  1WWZ A;  1YGH A;  3D67 A;  3FJU A;  3RZA A;  4EME A;  5G22 A;  1A9X B;  5D29 A;  4QUS A;  1Z8W A;  4KLV A;  2JDD A;  3T90 A;  1XJO A;  3FEC A;  2PJB A;  4PXB A;  1NBW A;  3GJZ A;  4RN7 A;  4OME A;  1YLO A;  3FVL A;  2D4P A;  4IK2 A;  4KSI A;  4ORF A;  4QB9 A;  1T36 B;  5F5X A;  3DGV A;  4NGQ A;  4BPX B;  4JLY A;  5JPH A;  2OZH A;  5AG7 A;  4F8Z A;  3TLG A;  4UWI A;  2CNT A;  4C9V A;  2XEG A;  2R7H A;  2XEJ A;  2HC9 A;  2OU2 A;  4P6Y A;  1R57 A;  5THW A;  3ISX A;  5FD8 A;  4M6I A;  4H2K A;  4OID A;  3B35 A;  3KQZ A;  2R1I A;  3OB2 B;  1X10 A;  3G8W A;  4BTF A;  2HV2 A;  3GYA A;  3PB6 X;  5HKW A;  5I4M A;  3VRQ A;  1XMT A;  4KOX A;  4CYQ A;  1V6C A;  4FAI A;  1CG2 A;  3SJF A;  3P2F A;  2ZOF A;  4B11 A;  2DIK A;  2AFX A;  3H8E A;  1SQH A;  2HUZ A;  4NJR A;  4EWT A;  3QB8 A;  4A2Z A;  2OR4 A;  1OBR A;  4P4F A;  2ZW4 A;  2REE A;  4PSW A;  5LRK A;  1L0C A;  4PV6 A;  4KOR A;  1PUA A;  4C8F A;  2J8R A;  4KNG E;  3FBU A;  3TFY A;  2DF5 A;  2PJ9 A;  1EO0 A;  3D7F A;  3JRU A;  3PB7 X;  4UCN A;  1KUY A;  2EZC A;  2CF4 A;  2Q04 A;  2YNE A;  1YVK A;  2ZOG A;  3F8K A;  4I49 A;  3G3S A;  3U88 C;  3WR7 A;  3SXN A;  1ZG8 A;  2PIZ A;  3KR4 A;  3W91 A;  2OZU A;  2B5G A;  3HLP A;  2YJT A;  4A32 A;  2EZB A;  4ONW A;  4XNH B;  4MFQ A;  5GCN A;  2D0O A;  4R87 A;  1KBL A;  3JTK A;  1VBH A;  3B3C A;  5I0C A;  4ZX8 A;  4NGN A;  4MHN A;  4CDJ A;  2GIV A;  1Z9E A;  3R9F A;  1BPN A;  1VGY A;  4C2Z A;  2Q7B A;  3VRO A;  3DR6 A;  2HWG A;  3EFA A;  3JUW A;  3QAY A;  4JWP A;  2PJ6 A;  4A38 A;  4NGS A;  1MJA A;  5F47 A;  1TF9 A;  3CPA A;  1C30 B;  2J8N A;  4MJX A;  2VEZ A;  1VHO A;  3NE7 A;  4FBE A;  4KOV A;  2D0P A;  3SI1 A;  3IWG A;  2Q51 A;  3VWE A;  4C8T A;  4CZ1 A;  5F13 A;  1VI4 A;  4CRY B;  2BUE A;  5HKZ A;  5LYI A;  2Y1M A;  2AFS A;  4C9U A;  2IMO A;  4OIW A;  1EZB A;  3H4Q A;  4E94 A;  3CXQ A;  3KI9 A;  2B4D B;  4MFL A;  4NXY A;  4BPU B;  1DTD A;  4CGO A;  3RBU A;  1ARM A;  2JDC A;  4UIA A;  5JM6 A;  3TLE A;  3EZA A;  4C86 A;  1B6B A;  1YR0 A;  4B12 A;  4CS0 B;  4C9A A;  1Y0Y A;  4IHM A;  3WT4 A;  2Z3N A;  1Q7L A;  2FL4 A;  3T5M A;  3NFZ A;  2Y1N A;  3FNC A;  1QSM A;  2AFZ A;  2Z11 A;  3IGR A;  5JYB A;  1XF8 A;  3OP0 A;  1X12 A;  4XNH C;  3WC5 A;  1YQE A;  3HPG G;  1TIQ A;  3K4I A;  3SI0 A;  3EO4 A;  3FF3 A;  2VXK A;  2PJ0 A;  3IIB A;  2A4N A;  5LRJ A;  4XPL A;  4A4C A;  2VZZ A;  4CAV A;  5ISV A;  4OC3 A;  1XBU A;  4Q7A A;  3LMS A;  4AVB A;  2C6C A;  3D7D A;  1N71 A;  1YW4 A;  1CE8 B;  1ZLH A;  4JD6 A;  5C88 A;  4FD4 A;  2DEA A;  1KWM A;  4LQ6 A;  3BUM B;  3JVN A;  3HUV A;  4KOS A;  1M4D A;  4FWU A;  1YRE A;  2D4O A;  2PC1 A;  2Z3P A;  2O53 A;  5HMN A;  1ZLI A;  1Y0R A;  3PBE A;  1KZF A;  5HH1 A;  3LOD A;  2NSM A;  2EK8 A;  4MFK A;  2HQY A;  1XOV A;  1FNO A;  3DR8 A;  1QSR A;  4UWJ A;  3UY5 A;  2B0A A;  4NGR A;  2CY2 A;  5H84 A;  2PRB A;  1CS0 B;  3D7G A;  1Y9K A;  4CAE A;  2RFH A;  3VH9 A;  2VL1 A;  2PVW A;  2I3C A;  2V77 A;  2VQY A;  2WZN A;  5ELY A;  1Z5R A;  4KUA A;  4MCR A;  1CX8 A;  2FIA A;  3EXN A;  2Z3O A;  3TYX A;  2C1C A;  2F8H A;  4MI4 A;  3IU1 A;  2QJ8 A;  4UEF A;  4YRH A;  3RAM A;  4CAF A;  4CRZ B;  3C8O A;  4KVO E;  1Z8L A;  1CJW A;  1R61 A;  2ZEG A;  1CP7 A;  3TLZ A;  1CPS A;  3OWC A;  1MJB A;  4NSQ A;  4IIY A;  3CXS A;  4UFV A;  4A33 A;  4F9U A;  2C6P A;  4MXU A;  4E2A A;  3PFV A;  3ICU A;  2AFO A;  4LQG A;  3VRN A;  3TO7 A;  4CPA A;  1B87 A;  5G1Z A;  2P6G A;  3CDX A;  1EE3 P;  3H5Z A;  1ON0 A;  3D3S A;  2QEC A;  5K8M A;  1NXJ A;  5JGF A;  2Q7S A;  3ISZ A;  3C26 A;  3GIU A;  4UIB A;  4TWE A;  2PJ1 A;  1XE4 A;  4AB7 A;  5K99 A;  4JZ0 A;  1HDQ A;  5DS0 A;  2JEV A;  2B3U A;  3NFQ A;  2PJA A;  3MN8 A;  3TC8 A;  4J3G A;  2V8H A;  3ZJ0 A;  2XPP A;  4AVC A;  5IB9 A;  3ZNI A;  3VRR A;  1H8L A;  2G3A A;  2YND A;  4PK3 A;  1A2Z A;  1QMU A;  2CTB A;  4MCQ A;  2G0B A;  4X2T A;  4CGP A;  2P6E A;  1Q2C A;  3B3W A;  3B3S A;  4ZX9 A;  2POK A;  4AVA A;  1ELM P;  3PB4 X;  3PGP A;  3SHP A;  4ZY2 A;  3GY9 A;  4OKO A;  5JH9 A;  3F9K C;  1J4J A;  3D8P A;  1S7F A;  4MHD A;  1Q2Y A;  1JDB C;  2FSR A;  1M44 A;  4NGM A;  1RTQ A;  3EY5 A;  3F5B A;  1S60 A;  3K9T A;  2XPN A;  3I3G A;  3PBB A;  1DE4 C;  1R43 A;  2ARH A;  2BL1 A;  3V38 A;  1LAM A;  3KGQ A;  2JBJ A;  3KHX A;  2B4B A;  4IIX A;  2ZEE A;  2XEI A;  4X5K A;  5HKY A;  4FD7 A;  2QIR A;  1B47 A;  3S9M A;  1FBV A;  3NH8 A;  5HVF A;  3VRP A;  2FIW A;  3T8W A;  2Z10 A;  4UEZ A;  2H5M A;  3R95 A;  2Z3L A;  3R1K A;  4B6Z A;  3BUW B;  1IYK A;  5IV0 A;  4F0X A;  4E0A A;  5KTC A;  3NH4 A;  3TTH A;  4R3K A;  4UBR A;  3TLB A;  3R96 A;  1LRZ A;  5D8N A;  2O28 A;  5FVJ A;  3E0K A;  5J8C A;  5IR2 A;  1TKF A;  4PQA A;  4WJB A;  1XF1 A;  1WJT A;  4HNY B;  1S7N A;  4COG A;  2PCN A;  1Z4E A;  3KL9 A;  5CBM A;  3PRT A;  3NOJ A;  3GLJ A;  2HRO A;  2F5I A;  4K30 A;  4P4E A;  2PSW A;  3BXM A;  2PIY A;  1XMB A;  3B2Y A;  1VHS A;  2EO8 A;  3VGO A;  1Y7E A;  1JQG A;  1KUX A;  1PCA A;  3SJG A;  3CZX A;  4KVM E;  2ZW5 A;  2PQ8 A;  2VKZ G;  1CP6 A;  1NSL A;  1NMT A;  4R9M A;  3IWE A;  4JJX A;  3KRV A;  2GRE A;  4CYP A;  4BIN A;  4OC4 A;  2I79 A;  1F2O A;  1Z8X A;  4MCS A;  1F57 A;  4MHZ A;  4FD5 A;  3U1B A;  2PJ4 A;  2B4D A;  1VHE A;  5F09 A;  4W9Y A;  3RYO A;  4TNU A;  5KTD A;  4INJ A;  3FIX A;  4M8D A;  4JYW A;  4NJQ A;  3VAT A;  4C9E A;  3BI0 A;  3BUO B;  5LYF A;  3BJ8 A;  2AFW A;  1QSN A;  4KOY A;  4MY3 A;  5DWM A;  4HNW B;  2J8M A;  5EBV A;  5LRG A;  3TCV A;  3BUN B;  4KOW A;  2KCW A;  2Z3K A;  2AUM A;  2ZW6 A;  4Q38 A;  4X8I A;  1U6M A;  2B3V A;  1XIX A;  1GHE A;  4CGL A;  4YFJ A;  3DNS A;  2ODF A;  4A4B A;  1BOB A;  1ZG7 A;  3MGD A;  1MJ9 A;  3K2K A;  1HDU A;  3DSB A;  3CPX A;  2ZEN A;  3W6X A;  2PJ8 A;  4JXQ A;  4CAX A;  2GFQ A;  4PSX A;  4AG9 A;  4H6Z A;  2AE6 A;  3F0A A;  4B14 A;  4II9 A;  2YJV A;  1AYE A;  1NE9 A;  2FT0 A;  2YGW A;  3SI2 A;  3PFO A;  1ELL P;  2Z3M A;  3IO1 A;  4Y49 C;  1LAP A;  3ZZI A;  4UCM A;  3B3T A;  3RO0 A;  5E96 A;  1I1D A;  2ANP A;  2GLJ A;  2Q43 A;  3SR3 A;  3NE8 A;  4H89 A;  2FS5 A;  4HNX B;  2IL4 A;  1V0C A;  3S6F A;  4B5P B;  1I12 A;  3EC4 A;  4ZYQ A;  2N3A B;  2QYV A;  1BLL E;  2Q4Y A;  4MY0 A;  2AFM A;  3T07 A;  2P6F A;  3PZJ A;  3KR5 A;  4AG7 A;  4LUA A;  2ZEO A;  4R3L A;  1LOK A;  5C82 A;  4O23 A;  4F6A A;  5HXD A;  4MI1 A;  1TKH A;  4QVT A;  2EVN A;  4QBJ A;  2OLS A;  2YNC C;  5AG4 A;  3KKW A;  4A31 A;  3TT2 A;  1M1D A;  4EFD A;  7CPA A;  4TJX A;  4KZT A;  3PT1 A;  3NA6 A; 
#chains in the Genus database with same CATH homology
 1FT7 A;  3FMC A;  2ZEF A;  1YSJ A;  4A39 A;  4PXD A;  6CPA A;  4OC5 A;  3PEI A;  4MRI A;  3D68 A;  2BOA A;  3S9L A;  1AMP A;  2PCU A;  3B3V A;  4BD9 A;  2PJ2 A;  2BO9 A;  4NGT A;  4UEE A;  4IAV A;  3NH5 A;  4YN3 A;  4NFR A;  4G1P A;  2PJC A;  3H8F A;  1NSA A;  4R8F A;  3MRU A;  2PJ7 A;  3D7H A;  3S9N A;  4C99 A;  4A37 A;  2XEF A;  4DYO A;  2C5Q A;  3I6S A;  3N5F A;  4A94 A;  4R6T A;  4Z65 A;  1PYT B;  5K8P A;  4MMO A;  4DJL A;  1IGB A;  4C8P A;  2V8D A;  4K3N A;  2J9A A;  1IY7 A;  3WC6 A;  3TX8 A;  4ZY0 A;  1CBX A;  2ZEM A;  3LWU A;  1BAV A;  4F9V A;  3V7Z A;  1Y9Z A;  4P4I A;  1LFW A;  2CTC A;  3BHX A;  1HEE A;  2QVP A;  4C85 A;  3KZW A;  2Q4Z A;  3IWW A;  3FED A;  2GU2 A;  4C9R A;  3KAS A;  1TF8 A;  3I74 A;  2ZEH A;  3D4U A;  2F7V A;  1BPM A;  2RB7 A;  3GB0 A;  5LYD A;  4GM5 A;  3WC7 A;  2ABZ A;  3IJ3 A;  1VIX A;  4MCP A;  2EWB A;  3QNV A;  3SJE A;  1WVM A;  4OC1 A;  4C8C A;  1YME A;  4C8U A;  3H8G A;  4PPZ A;  1CPX A;  2CIJ A;  4NGP A;  1XRY A;  2ZEP A;  2PVV A;  5K8O A;  3DLJ A;  3IEH A;  4YU9 A;  4P4B A;  3IC1 A;  4OC2 A;  2C6G A;  3BI1 A;  4OC0 A;  4UF4 A;  1LAN A;  4P44 A;  1ARL A;  4P4D A;  4MHY A;  4CDK A;  3KHZ A;  4P45 A;  1YW6 A;  1TKJ A;  2HB6 A;  3CT9 A;  1Z2L A;  3PB9 X;  5CPA A;  4ZI6 A;  5J1Q A;  2PJ3 A;  2ZED A;  3L2N A;  4C84 A;  2NYQ A;  3IFE A;  3I1U A;  4ZY1 A;  4P10 A;  2PRQ A;  4MHP A;  4OP4 A;  4R76 A;  4R7M A;  3FEE A;  2OOT A;  3FX6 A;  2PJ5 A;  1F2P A;  2V8G A;  3PFE A;  4X3R A;  3VAR A;  3VTA A;  1UWY A;  2O4H A;  1QQ9 A;  3B7I A;  2JBK A;  4YWY A;  4WWV A;  1R3N A;  3SJX A;  3PB8 X;  1LCP A;  4AXV A;  3KQX A;  5HVH A;  3D66 A;  3GUX A;  4PXE A;  4TJV A;  3EIF A;  5LYL A;  2ZEL A;  2JEW A;  4PXC A;  2GP4 A;  1M4L A;  2WYR A;  8CPA A;  2PE3 A;  1TXR A;  2GLF A;  2IQ6 A;  5K8N A;  4FUU A;  2BCO A;  1XFO A;  4P4J A;  1ZG9 A;  4C8A A;  1GYT A;  2IJZ A;  4RUH A;  2G9D A;  5HVG A;  2EK9 A;  4DUK A;  3FH4 A;  2V8V A;  2FVG A;  2AFU A;  3WAB A;  3D67 A;  3FJU A;  3RZA A;  4EME A;  5D29 A;  1XJO A;  3FEC A;  2PJB A;  4PXB A;  4OME A;  1YLO A;  3FVL A;  4KSI A;  4IK2 A;  3DGV A;  4NGQ A;  4F8Z A;  4C9V A;  2XEG A;  2XEJ A;  2HC9 A;  4P6Y A;  5THW A;  3ISX A;  4OID A;  4H2K A;  3B35 A;  3KQZ A;  3PB6 X;  5I4M A;  1V6C A;  4FAI A;  1CG2 A;  3SJF A;  2ZOF A;  2AFX A;  3H8E A;  4NJR A;  4EWT A;  2OR4 A;  1OBR A;  4P4F A;  5LRK A;  4C8F A;  4KNG E;  2PJ9 A;  3PB7 X;  3D7F A;  3JRU A;  2CF4 A;  2ZOG A;  1ZG8 A;  2PIZ A;  3KR4 A;  3HLP A;  4ONW A;  3B3C A;  4ZX8 A;  4NGN A;  4MHN A;  4CDJ A;  1BPN A;  1VGY A;  4A38 A;  2PJ6 A;  4NGS A;  1TF9 A;  3CPA A;  4FBE A;  1VHO A;  3SI1 A;  4C8T A;  2Q51 A;  5LYI A;  4C9U A;  2AFS A;  2IMO A;  4OIW A;  3KI9 A;  1DTD A;  3RBU A;  1ARM A;  4UIA A;  5JM6 A;  4C86 A;  4C9A A;  1Y0Y A;  4IHM A;  3WT4 A;  1Q7L A;  3NFZ A;  2AFZ A;  3WC5 A;  3SI0 A;  3FF3 A;  3IIB A;  2PJ0 A;  5LRJ A;  4OC3 A;  1XBU A;  4Q7A A;  3LMS A;  2C6C A;  3D7D A;  1YW4 A;  1ZLH A;  2DEA A;  1KWM A;  3HUV A;  4FWU A;  2O53 A;  1ZLI A;  1Y0R A;  3PBE A;  2NSM A;  2EK8 A;  1FNO A;  4NGR A;  3D7G A;  2RFH A;  3VH9 A;  2VL1 A;  2PVW A;  2I3C A;  2V77 A;  2WZN A;  5ELY A;  1Z5R A;  4MCR A;  1CX8 A;  2C1C A;  2F8H A;  4UEF A;  2QJ8 A;  3RAM A;  1Z8L A;  2ZEG A;  1CP7 A;  1CPS A;  4F9U A;  2C6P A;  4MXU A;  3ICU A;  2AFO A;  4LQG A;  4CPA A;  3CDX A;  1EE3 P;  5K8M A;  5JGF A;  3ISZ A;  4UIB A;  4TWE A;  2PJ1 A;  4JZ0 A;  1HDQ A;  5DS0 A;  3MN8 A;  2PJA A;  3TC8 A;  2V8H A;  5IB9 A;  1H8L A;  2CTB A;  1QMU A;  4MCQ A;  4X2T A;  3B3W A;  3B3S A;  4ZX9 A;  2POK A;  1ELM P;  3PB4 X;  4ZY2 A;  5JH9 A;  4OKO A;  4NGM A;  1RTQ A;  3K9T A;  3PBB A;  1DE4 C;  1R43 A;  3V38 A;  1LAM A;  3KGQ A;  2JBJ A;  3KHX A;  2ZEE A;  2XEI A;  3S9M A;  3NH8 A;  5HVF A;  3T8W A;  4UEZ A;  4B6Z A;  3NH4 A;  5D8N A;  5IR2 A;  1TKF A;  4PQA A;  4WJB A;  1XF1 A;  3KL9 A;  5CBM A;  3PRT A;  3GLJ A;  4P4E A;  3BXM A;  2PIY A;  1XMB A;  3B2Y A;  1Y7E A;  1JQG A;  1PCA A;  3SJG A;  1CP6 A;  2GRE A;  4OC4 A;  1F2O A;  4MCS A;  1F57 A;  4MHZ A;  2PJ4 A;  1VHE A;  5F09 A;  4W9Y A;  4TNU A;  4JYW A;  4NJQ A;  3VAT A;  4C9E A;  3BI0 A;  5LYF A;  5LRG A;  2AFW A;  4X8I A;  1ZG7 A;  3K2K A;  1HDU A;  3CPX A;  2ZEN A;  2PJ8 A;  1AYE A;  3SI2 A;  3PFO A;  1ELL P;  3IO1 A;  1LAP A;  3B3T A;  2ANP A;  2GLJ A;  2Q43 A;  4ZYQ A;  2QYV A;  1BLL E;  2AFM A;  3KR5 A;  2ZEO A;  1LOK A;  4O23 A;  5HXD A;  1TKH A;  4EFD A;  7CPA A;  4TJX A;  3NA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...