3BXMA

Structure of an inactive mutant of human glutamate carboxypeptidase ii [gcpii(e424a)] in complex with n-acetyl-asp-glu (naag)
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reaction mechanism of glutamate carboxypeptidase II revealed by mutagenesis, X-ray crystallography, and computational methods.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bxmA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bxmA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bxmA02
3KR5A 3BHXA 1VHOA 2Q4ZA 1ARMA 3PB8X 4R76A 1TKJA 2JBJA 2AFUA 2ZEDA 5DS0A 3CPXA 1Z2LA 3VATA 2CF4A 5K8PA 2ZEGA 2WZNA 4ZY1A 4ZX8A 3L2NA 3S9MA 3PFEA 1YMEA 2JBKA 2C6GA 4ZYQA 1CG2A 2IJZA 1CBXA 2O4HA 3KQZA 2CTCA 3DLJA 2XEIA 2PJ8A 1YSJA 2GLJA 3KZWA 4A37A 1R3NA 5D8NA 2I3CA 1F57A 4H2KA 1YW4A 3WABA 2PJ0A 4P6YA 4IK2A 4TJXA 1TF9A 3D66A 4C9UA 3WC7A 5LYDA 2RFHA 1AYEA 3PBBA 2PIYA 4PXBA 1WVMA 2ZOFA 4BD9A 3SI2A 3GB0A 1JQGA 4C8TA 4GM5A 2OR4A 1FNOA 2V8HA 4EWTA 2J9AA 3TC8A 4C8AA 3PB9X 2PJ7A 3DGVA 1BPNA 3KHZA 3WC6A 2V8DA 3PB4X 4JZ0A 3EIFA 3ICUA 1XBUA 4P4EA 4NGRA 2Q43A 2NYQA 4TWEA 2PJ4A 4KSIA 3SJFA 4NFRA 1Y7EA 2VL1A 7CPAA 3D7HA 4CDJA 3S9LA 3VTAA 5JGFA 4ZI6A 3WC5A 4OC1A 4ONWA 3KQXA 3LWUA 2G9DA 4OIDA 4A38A 2XEGA 4OMEA 1VIXA 4P10A 3B3WA 4W9YA 4A39A 3FF3A 4NJRA 4UIBA 2ZEOA 4FBEA 1QQ9A 3H8FA 4PXCA 4R6TA 2OOTA 3I1UA 5LYFA 3ISZA 1NSAA 3K9TA 2AFSA 4NGNA 4OC2A 4K3NA 2AFXA 3D67A 3D7GA 2F8HA 2PJ5A 5LRKA 1H8LA 1BLLE 3TX8A 5J1QA 1ZG8A 2ZEMA 4ZY2A 3FECA 2ZEPA 1ELMP 2XEFA 4P4DA 5F09A 4FWUA 2RB7A 4MCQA 2PJ2A 5THWA 1LCPA 3SI0A 2PIZA 2ZELA 3B35A 4KNGE 2WYRA 1V6CA 3IFEA 4UIAA 4FAIA 5LYLA 2POKA 1LOKA 1ARLA 3FEEA 2QJ8A 4OC3A 4R8FA 4B6ZA 2NSMA 4C9RA 4CDKA 2PJCA 3FMCA 1ZG7A 4UEEA 1Q7LA 3BI0A 2ZEFA 3FEDA 2GU2A 2PJAA 4MMOA 1VGYA 4UF4A 2Q51A 1F2OA 4OP4A 4DJLA 1IY7A 5HXDA 5D29A 3B2YA 1PYTB 5IB9A 1LAPA 3KL9A 4OC0A 4DUKA 4NJQA 5ELYA 1BPMA 2PJ1A 2PJ9A 5I4MA 2DEAA 3B3TA 2CTBA 3HLPA 2C1CA 4PQAA 1ZLIA 4JYWA 4OC4A 1ELLP 3RZAA 4C9AA 1R43A 1ZLHA 4IHMA 4Q7AA 5LRJA 4P4IA 4F9VA 1M4LA 4NGQA 3V7ZA 5K8NA 5HVFA 4C8UA 2PCUA 4MRIA 3NH8A 4FUUA 3WT4A 2EWBA 2V8VA 2PVVA 3BI1A 4C86A 4PXEA 5HVGA 4C85A 3KASA 1XMBA 4PPZA 3RAMA 2BO9A 2IMOA 5JH9A 4R7MA 4YWYA 3B3SA 3KHXA 3H8EA 6CPAA 5K8MA 4O23A 2IQ6A 3PB6X 3S9NA 1LAMA 4X8IA 3D7DA 3V38A 4X3RA 3FJUA 2O53A 3IJ3A 1HDQA 3MN8A 3GLJA 4MCRA 4A94A 4MCSA 2PRQA 1LANA 4OC5A 5LRGA 1PCAA 5K8OA 2PJ3A 3SJXA 3B7IA 3B3CA 4YU9A 3SI1A 1HEEA 4NGSA 1AMPA 3PB7X 4C9VA 2HC9A 2F7VA 2HB6A 4F8ZA 3K2KA 3FH4A 1IGBA 4P4JA 3NFZA 3IO1A 3I6SA 1TXRA 3NH4A 3T8WA 4LQGA 2AFMA 2BCOA 4OIWA 1DE4C 4ZY0A 2PE3A 3NA6A 4NGTA 1CP7A 3CDXA 2ZEHA 1BAVA 3IWWA 2FVGA 2AFZA 2V8GA 3I74A 1Y0YA 3IEHA 1CPXA 2PJBA 4UEFA 4Z65A 4C9EA 2QYVA 3KR4A 4MCPA 3N5FA 2C6CA 4C99A 3SJEA 1LFWA 4C8FA 2QVPA 3QNVA 1VHEA 3D7FA 4MHYA 3KGQA 3MRUA 3IC1A 1UWYA 4IAVA 1XRYA 4P4FA 2ANPA 2AFWA 3VARA 5CPAA 2ZEEA 1CPSA 2EK9A 4WJBA 4AXVA 2PJ6A 3B3VA 1XJOA 1Y0RA 4X2TA 4EMEA 3PEIA 1ZG9A 1GYTA 1TKFA 4MXUA 2C6PA 4PXDA 4DYOA 2GREA 5LYIA 1TKHA 2ZENA 1XF1A 1YW6A 4RUHA 3LMSA 2ABZA 3IIBA 3PRTA 4F9UA 3H8GA 2ZOGA 3CT9A 1XFOA 3JRUA 3PFOA 2XEJA 2CIJA 3HUVA 4MHZA 3CPAA 5JM6A 1RTQA 4CPAA 4C8CA 1EE3P 3NH5A 4UEZA 3FX6A 1F2PA 1CX8A 1HDUA 3FVLA 5HVHA 3PBEA 5CBMA 1CP6A 4G1PA 2BOAA 1KWMA 1DTDA 4WWVA 3D4UA 2AFOA 4P45A 4MHNA 1YLOA 3RBUA 1Y9ZA 4NGMA 2GLFA 1FT7A 1Z8LA 2EK8A 3ISXA 4TNUA 1OBRA 1Z5RA 3D68A 1QMUA 1TF8A 2JEWA 4NGPA 4P44A 4ZX9A 4MHPA 3VH9A 3KI9A 4OKOA 3SJGA 3BXMA 2V77A 3GUXA 4C84A 8CPAA 4YN3A 4EFDA 4P4BA 2PVWA 4C8PA 4TJVA
chains in the Genus database with same CATH superfamily
3KR5A 4U9YA 3BHXA 1VHOA 2Q4ZA 1M4DA 4XPDB 5HKZA 1ARMA 3PB8X 4R76A 1TKJA 4PV6A 2E28A 2XPOA 2JBJA 2AFUA 2EZCA 2ZEDA 1CJWA 5DS0A 3CPXA 1Z2LA 3BJ7A 2YNCC 3VATA 2CF4A 1A9XB 4KOVA 5K8PA 2ZEGA 2WZNA 4ZY1A 1IOIA 4ZX8A 2WPXA 3L2NA 2Y1NA 2CXAA 2JEVA 4IIXA 2EO8A 2Z3LA 3PGPA 3TLGB 3S9MA 3PFEA 1YMEA 2JBKA 2C6GA 2JLMA 3JUWA 2Q4YA 2Q4VA 5I0CA 4ZYQA 1CG2A 2IJZA 4HNXB 1EZAA 1CBXA 1T36B 3NFQA 2R7HA 2O28A 3OP0A 2O4HA 3KQZA 5A28A 2D0PA 4B14A 4PSWA 2CTCA 3DLJA 2XEIA 4XPLA 2PJ8A 1YSJA 2R1IA 4FD4A 4MY0A 2GLJA 2JDDA 2PRBA 3KZWA 1I12A 3DR8A 1R3NA 5D8NA 4A37A 3CXQA 2I3CA 4OAEA 1WJTA 1F57A 3GY9A 4K30A 4H2KA 2X0SA 1YW4A 3V8IA 4KOTA 2PJ0A 4P6YA 4IK2A 3RO0A 3WABA 1TF9A 3D66A 1DIKA 4TJXA 5CNPA 1YR0A 3T0TA 3WC7A 1YVOA 5LYDA 2FXFA 2RFHA 4ONUA 4C9UA 1AYEA 3PBBA 2PIYA 4PXBA 3S6FA 4F0YA 2ZOFA 4YGOA 1WVMA 3EY5A 4RS2A 2OZGA 1P0HA 4BD9A 3BUMB 4A4BA 3GB0A 3SI2A 1JQGA 5JH9A 4C8TA 1NXJA 4COBA 1FY7A 4GM5A 1MK4A 5IB0A 2VBQA 2OR4A 2C27A 1GGOA 2B3UA 3HMJG 1MJ9A 2OZHA 2Q0YA 5JPHA 2UV8G 1FNOA 2V8HA 4EWTA 1CS0B 2DIKA 4CGMA 2J9AA 4M6GA 4MJXA 5AXIA 3IU2A 3TC8A 4C8AA 1XEBA 2PJ7A 3DGVA 3PB9X 1BPNA 4MFJA 4C7IA 2H5MA 3KHZA 3T07A 3F0AA 2FT0A 3T05A 1U6MA 3WC6A 2YGWA 5JQ4A 2Z3NA 2VXKA 2V8DA 4CAVA 5KTCA 2GANA 3TTHA 2ODFA 4JXQA 2CNSA 4JLYA 3TLZA 3PB4X 2Q44A 3D2MA 3QAYA 4JZ0A 2YNDA 3EIFA 1PU9A 2B4DB 3ICUA 3VRQA 1XBUA 4P4EA 1BXRB 4NGRA 1EZBA 1Y9KA 2R82A 2Q43A 2Y0MA 2NYQA 3TLCA 4TWEA 2PJ4A 4KSIA 2AE6A 3SJFA 3BLNA 3QAHA 4NFRA 4NSQA 1MJBA 1Y7EA 2VL1A 2WPWA 3D7HA 2G0BA 2ZW7A 3D8PA 4B5OA 7CPAA 3PT1A 2PC1A 3KRVA 4CDJA 1YK3A 1YGHA 2ARHA 4QC6A 3S9LA 4RI1A 3VTAA 1R61A 4UCMA 4CYNA 4ZI6A 5JGFA 3WC5A 3FIXA 3FRMA 3NE8A 4OC1A 4ONWA 4CAFA 4MY3A 3LD2A 4CRYB 3KQXA 3GIUA 3LWUA 4NEXA 3F5BA 5DWMA 5E96A 5G22A 5G20A 1KUYA 1UFHA 2G9DA 3R9FA 2B5GA 2CNMA 1Q2CA 1PUAA 4KLVA 4OIDA 2XEGA 4A38A 4B12A 4OMEA 1V0CA 1VIXA 1Z8WA 2PDOA 4C2YA 4F6AA 2BL1A 4P10A 4X5KA 4PSXA 3EZAA 1IYLA 3B3WA 4W9YA 2ZW4A 4I49A 3FF3A 4JXRA 4A39A 4NJRA 5ISVA 4UIBA 1Z8XA 5IR2A 4MFKA 4RR2B 2XPPA 2ZEOA 4FBEA 1QQ9A 3H8FA 4PXCA 4R6TA 2OOTA 4FD7A 1C30B 3I1UA 3VRRA 4IUSA 5KTAA 5LYFA 3ISZA 1NSAA 3K9TA 2AFSA 4YRHA 4R3KA 4BPWB 3NOJA 4NGNA 2HQYA 4OC2A 4K3NA 3S6GA 3ZNIA 3N7ZA 4XPKA 2AFXA 3D67A 1JDEA 2B0AA 3P2FA 3D7GA 2F8HA 2PJ5A 5KTDA 3EXNA 5LRKA 1H8LA 3VGOA 3DDDA 5AG4A 2BSWA 3VWEA 4CYPA 1FBVA 5FVJA 1BLLE 3TX8A 5J1QA 1ZG8A 2OH1A 4KOXA 2ZEMA 2Z0ZA 3FECA 4JD6A 4ZY2A 4A33A 2FCKA 3EO4A 5K99A 2AJ6A 2B4DA 2VI7A 1ELMP 2ZEPA 4KZTA 3W6XA 3C8OA 4KOSA 2XEFA 2C5QA 4P4DA 5F09A 2RB7A 3A9LA 4FWUA 4MCQA 2PJ2A 5THWA 4FD6A 1LCPA 2ATRA 2PIZA 2ZELA 3B35A 3SI0A 2WYRA 1V6CA 4KNGE 3IFEA 2F5IA 4KORA 4UIAA 4MBUA 5F13A 4CYQA 4FAIA 4HKFA 5A27A 1C3OB 3TLEA 5LYLA 4UFXA 4A31A 2POKA 2D0OA 3JVNA 2PSWA 1BOBA 1I21A 1LOKA 1ARLA 2FL4A 3RYOA 2R98A 3T9YA 4CGNA 2GP4A 4UCNA 3FEEA 1NMTA 3FXTA 4L89A 4NF1A 2HI6A 2QJ8A 4OC3A 4MI4A 2Q7SA 4R8FA 5F46A 1IIDA 4B6ZA 4E2AA 2OB0A 2B4JC 4F0XA 4GXHA 1XE4A 4CO9A 2QECA 5AG6A 4A4CA 1ON0A 2DF5A 2NSMA 4C9RA 4CDKA 2PJCA 2Z11A 3BUXB 3SXOA 5C82A 3FMCA 2AUNA 4LX9A 3NE7A 1ZG7A 3ZJ0A 4UEEA 1CE8B 1Q7LA 3BI0A 2D4OA 1NE9A 4R57A 2ZEFA 3FEDA 1IICA 4CAXA 2PCNA 3IU1A 4J0NA 3VRPA 2GU2A 2PJAA 2G3AA 2BEIA 4MMOA 1VGYA 2GE3A 1VBGA 4UF4A 2DXQA 4IF5A 2FS5A 1F2OA 2Q51A 4OP4A 4INJA 4EYSA 1JDBC 2FIWA 4LUAA 4DJLA 1IY7A 4AG9A 4B5PB 4BTFA 2B4BA 5D29A 2DPTA 5HXDA 5F1YA 2D4PA 3B2YA 1PYTB 3BUOB 1LAPA 3HPHE 3TO6A 3ZZIA 3KL9A 4C2XA 4OC0A 5IB9A 3TOBA 4AVBA 4DUKA 5G1ZA 2XPLA 4NJQA 5ELYA 5GCNA 2DPSA 1BPMA 2PJ1A 4U9ZA 2PJ9A 4AB7A 5I4MA 1Q5XA 2DEAA 1M4GA 1Y7RA 3B3TA 2CTBA 2Q7BA 4UFWA 1B47A 1YVKA 3D3SA 1YLEA 3HLPA 3G23A 2C1CA 4AG7A 3TOAA 4PQAA 1ZLIA 3UY5A 4MHDA 4CS0B 4JYWA 2G3TA 4Q38A 4OC4A 1ELLP 2I00A 3RZAA 4C9AA 1R43A 1ZLHA 4IHMA 3TO9A 1P4NA 3F9KC 4H6ZA 4Q7AA 2Y1MA 4TJVA 4L8AA 1SQHA 2HV2A 5EMIA 5LRJA 5H86A 3RNZA 4B13A 2VQYA 4UWIA 4COGA 4P4IA 4KVME 5HMNA 3PP9A 3TLGA 4F9VA 3PZJA 1KEEB 1M4LA 1ZL0A 2CNTA 4C2ZA 4NGQA 1S3ZA 2FE7A 3V7ZA 4CAEA 5K8NA 3F8KA 5HVFA 4C8UA 2PCUA 4MRIA 2Q04A 2REEA 4CGLA 2QMLA 3NH8A 4FUUA 3WT4A 2EWBA 1S7LA 3EFAA 2V8VA 2VZYA 2FSRA 2I79A 5EBVA 3JTKA 2PVVA 3PFVA 3BI1A 1QSMA 2RC4A 4Q36A 2Z3MA 3DSBA 4C86A 4PXEA 5EC4A 5HVGA 3MGDA 3WR7A 3R95A 5F5XA 4C85A 3KASA 1XMBA 4OLLA 4PPZA 1AUGA 5JVLA 3RAMA 2BO9A 4UCPA 1BO4A 1KUXA 2IMOA 2WSAA 3C26A 4KUAA 1CM0A 2B5GB 1X10A 3LACA 4HNYB 4R7MA 4YWYA 3B3SA 3KHXA 4M6HA 3H8EA 4A2ZA 2YJTA 6CPAA 5K8MA 4O23A 1VHSA 2IQ6A 5HH1A 3R96A 3U1BA 3PB6X 3S9NA 1LAMA 2J8NA 4R9MA 1LRZA 3D7DA 4X8IA 2YNEA 3VWDA 4KOWA 4GS4A 3V38A 2NMTA 4X3RA 3W91A 2EZBA 4OADA 1B6BA 2KCWA 5F47A 3T90A 4KUBA 3EZEA 5BY0A 3FJUA 3BJ8A 2O53A 3IJ3A 1HDQA 3BUNB 1S7NA 3MN8A 1NSLA 1QSTA 3SHPA 3OWCA 4J3GA 4QUSA 2VEZA 1B87A 3GLJA 4MCRA 2REFA 3G8WA 4A94A 4MCSA 2PRQA 1LANA 4MFQA 4DNCA 4OC5A 3W6SA 1XIXA 1Q2YA 2K5TA 3GKRA 5LRGA 4KOUA 4CZ1A 2FIAA 3TCVA 4KLWA 1IU8A 1PCAA 1M1DA 1Z8TA 3TO7A 1RXTA 1A2ZA 5K8OA 2YNCA 2PJ3A 3SJXA 2EUIA 4YFJA 3T5MA 5F49A 3GYAA 3B7IA 4M6IA 3B3CA 3K9UA 1VKCA 4YU9A 3SI1A 1HEEA 1S5KA 4UFVA 3SR3A 4NGSA 3E0KA 3IGRA 1AMPA 1J3LA 2P6FA 1WWZA 1J4JA 3PB7X 3TLYA 4C9VA 4BPUB 2HC9A 4EVYA 1EO0A 2CBLA 3OB1B 2F7VA 2HB6A 4H89A 4F8ZA 2HUZA 3DR6A 3FYNA 4KVXA 3K2KA 4BPXB 3FH4A 1IGBA 4XNHB 4AVCA 4P4JA 3FB3A 3NFZA 3IO1A 4B11A 4BBHA 5IX3A 1Z4EA 3I6SA 1TXRA 1XOVA 4E94A 1Q2DA 3VRNA 4LQGA 3NH4A 4H6UA 3T8WA 5JYBA 2BUEA 4BINA 4CGPA 4JVOA 3TFYA 2AFMA 5AG7A 2ZW5A 1Z9EA 2BCOA 5IV0A 2GIVA 4OIWA 1DE4C 4C7HA 4ZY0A 3CXSA 3VROA 2J8MA 2PE3A 3I3GA 3NA6A 3R9EA 4NGTA 1CP7A 4JJXA 3CDXA 1N71A 3HPGG 2Z3PA 2XPNA 1WK4A 4C84A 2ZEHA 1BAVA 2EBJA 3IWWA 2FVGA 2ZXVA 2AFZA 4CRZB 2EVNA 2V8GA 3QB8A 4KSAA 2OU2A 2HWGA 1Y0YA 3I74A 3SXNA 1R57A 3IEHA 1CPXA 2PJBA 2R8VA 4UEFA 4XPDC 4Z65A 1M4IA 1QSOA 2J8RA 4C9EA 3CZXA 2HROA 3IWEA 2QYVA 4MCPA 2C6CA 2VKZG 3KR4A 1XF8A 3N5FA 3SJEA 4CAWA 1LFWA 4A32A 4C99A 4C8FA 4E5SA 2QVPA 4BMHA 3QNVA 3EZBA 1VHEA 5AGEA 4R87A 3D7FA 2MP0A 4MHYA 4B5PA 4M85A 1IYKA 1NBWA 3KGQA 3MRUA 4HNWB 3IC1A 1UWYA 3EC4A 4IAVA 1X12A 2IL4A 4UWJA 2B3VA 1XRYA 1L0CA 4P4FA 2ANPA 1M6VB 5F9MA 2DLAA 2AFWA 4KS9A 3VARA 1VI4A 5CPAA 2ZEEA 4U5YA 1CPSA 2YJVA 3DNSA 1KC7A 2EK9A 3TT2A 3LODA 4MFZA 5BWAB 4WJBA 5J3XA 3OB2B 4AXVA 2A4NA 2PJ6A 3R1KA 2PR8A 4LQ6A 4MI1A 3B3VA 2WUUA 2JDCA 4CGOA 1S7KA 2P6GA 3H5ZA 3U88C 4MFLA 1XJOA 3S6KA 5J8CA 3TE4A 2AUMA 1Y0RA 4X2TA 4EMEA 3PEIA 1ZG9A 1GYTA 2P0WA 2PR1A 4A30A 1TKFA 4NXYA 1TIQA 3PLFB 4MXUA 2C6PA 4PXDA 3I9SA 3P2HA 5G21A 1Z9UA 4DYOA 2B58A 2GREA 5LYIA 1TKHA 2ZENA 1VBHA 4M8DA 5DWNA 1XF1A 1KUVA 3GJZA 1IOFA 1YW6A 4RUHA 4H1HA 3LMSA 2ABZA 1KZFA 1OZPA 3IIBA 4C68A 3PRTA 1I1DA 4NCZA 1YREA 2Z3OA 1JWQA 4CYOA 1RO5A 3R9GA 1M44A 4F9UA 3TLBA 3H8GA 2ZOGA 3CT9A 1XFOA 3JRUA 3PFOA 4QBJA 4B10A 2XEJA 2CIJA 4KOYA 3HUVA 2FM4A 5AG5A 4MHZA 4QB9A 4IIYA 3CPAA 3KKWA 4E8OA 1K4JA 1RTQA 4Y49C 5H84A 4CPAA 5JM6A 5HKWA 4C8CA 1EE3P 3NH5A 5FD8A 4UEZA 3FX6A 1F2PA 1CX8A 1HDUA 1IB1E 3FVLA 4KVOE 1YX0A 3D2PA 5F48A 3OAKA 2PQ8A 4RN7A 3PBEA 5HVHA 5CBMA 1CP6A 2Z10A 4G1PA 2CY2A 2BOAA 5HKYA 1DTDA 1KWMA 3FBUA 4WWVA 3D4UA 2AFOA 4QVTA 4ZBGA 4II9A 4P45A 4FD5A 4MHNA 1MJAA 3B8GA 1YLOA 4UA3A 1YVHA 2P6EA 4UBRA 2QIRA 4M3SA 1XMTA 5C88A 3RBUA 1Y9ZA 4HPSA 4NGMA 1YQEA 1FT7A 2GLFA 1Z8LA 1GHEA 2EK8A 3CXPA 1QSRA 3ISXA 1Z4RA 4TNUA 1ZO0A 4E0AA 3TYXA 2EZAA 5J8FA 1ZRSA 3BUWB 4MJ8A 4XNHC 4ZGYB 1OBRA 2GFQA 2X7BA 1Z5RA 3D68A 4PK3A 1QMUA 2N3AB 1TF8A 4ORFA 3TLAA 4AVAA 2OLSA 1QSNA 3G3SA 2ZPAA 3O8ZA 3IWGA 3K4IA 2JEWA 4A95A 4NGPA 1KBLA 4P44A 3H4QA 4Y49B 4ZX9A 3S6HA 4MHPA 3VH9A 1S7FA 3KI9A 3SJGA 2OZUA 3BXMA 2Z3KA 2V77A 3GUXA 4OKOA 4R3LA 8CPAA 4GPLB 2VZZA 1ZYMA 4EFDA 4YN3A 2ZW6A 1Y9WA 4KSFA 4P4BA 4MFPA 4PK2A 2PVWA 4C8PA 3FNCA 4JWPA 1S60A
chains in the Genus database with same CATH topology
3KR5A 3BHXA 1VHOA 2Q4ZA 1ARMA 3PB8X 4R76A 1TKJA 2JBJA 2AFUA 2ZEDA 5DS0A 3CPXA 1Z2LA 3VATA 2CF4A 5K8PA 2ZEGA 2WZNA 4ZY1A 4ZX8A 3L2NA 3S9MA 3PFEA 1YMEA 2JBKA 2C6GA 4ZYQA 1CG2A 2IJZA 1CBXA 2O4HA 3KQZA 2CTCA 3DLJA 2XEIA 2PJ8A 1YSJA 2GLJA 3KZWA 4A37A 1R3NA 5D8NA 2I3CA 1F57A 4H2KA 1YW4A 3WABA 2PJ0A 4P6YA 4IK2A 4TJXA 1TF9A 3D66A 4C9UA 3WC7A 5LYDA 2RFHA 1AYEA 3PBBA 2PIYA 4PXBA 1WVMA 2ZOFA 4BD9A 3SI2A 3GB0A 1JQGA 4C8TA 4GM5A 2OR4A 1FNOA 2V8HA 4EWTA 2J9AA 3TC8A 4C8AA 3PB9X 2PJ7A 3DGVA 1BPNA 3KHZA 3WC6A 2V8DA 3PB4X 4JZ0A 3EIFA 3ICUA 1XBUA 4P4EA 4NGRA 2Q43A 2NYQA 4TWEA 2PJ4A 4KSIA 3SJFA 4NFRA 1Y7EA 2VL1A 7CPAA 3D7HA 4CDJA 3S9LA 3VTAA 5JGFA 4ZI6A 3WC5A 4OC1A 4ONWA 3KQXA 3LWUA 2G9DA 4OIDA 4A38A 2XEGA 4OMEA 1VIXA 4P10A 3B3WA 4W9YA 4A39A 3FF3A 4NJRA 4UIBA 5IR2A 2ZEOA 4FBEA 1QQ9A 3H8FA 4PXCA 4R6TA 2OOTA 3I1UA 5LYFA 3ISZA 1NSAA 3K9TA 2AFSA 4NGNA 4OC2A 4K3NA 2AFXA 3D67A 3D7GA 2F8HA 2PJ5A 5LRKA 1H8LA 1BLLE 3TX8A 5J1QA 1ZG8A 2ZEMA 4ZY2A 3FECA 2ZEPA 1ELMP 2XEFA 2C5QA 4P4DA 5F09A 4FWUA 2RB7A 4MCQA 2PJ2A 5THWA 1LCPA 3SI0A 2PIZA 2ZELA 3B35A 4KNGE 2WYRA 1V6CA 3IFEA 4UIAA 4FAIA 5LYLA 2POKA 1LOKA 1ARLA 2GP4A 3FEEA 2QJ8A 4OC3A 4R8FA 4B6ZA 2NSMA 4C9RA 4CDKA 2PJCA 3FMCA 1ZG7A 4UEEA 1Q7LA 3BI0A 2ZEFA 3FEDA 2GU2A 2PJAA 4MMOA 1VGYA 4UF4A 2Q51A 1F2OA 4OP4A 4DJLA 1IY7A 5HXDA 5D29A 3B2YA 1PYTB 5IB9A 1LAPA 3KL9A 4OC0A 4DUKA 4NJQA 5ELYA 1BPMA 2PJ1A 2PJ9A 5I4MA 2DEAA 3B3TA 2CTBA 3HLPA 2C1CA 4PQAA 1ZLIA 4JYWA 4OC4A 1ELLP 3RZAA 4C9AA 1R43A 1ZLHA 4IHMA 4Q7AA 5LRJA 4P4IA 4F9VA 1M4LA 4NGQA 3V7ZA 5K8NA 5HVFA 4C8UA 2PCUA 4MRIA 3NH8A 4FUUA 3WT4A 2EWBA 2V8VA 2PVVA 3BI1A 4C86A 4PXEA 5HVGA 4C85A 3KASA 1XMBA 4PPZA 3RAMA 2BO9A 2IMOA 5JH9A 4R7MA 4YWYA 3B3SA 3KHXA 3H8EA 6CPAA 5K8MA 4O23A 2IQ6A 3PB6X 3S9NA 1LAMA 4X8IA 3D7DA 3V38A 4X3RA 3FJUA 2O53A 3IJ3A 1HDQA 3MN8A 3GLJA 4MCRA 4A94A 4MCSA 2PRQA 1LANA 4OC5A 5LRGA 1PCAA 5K8OA 2PJ3A 3SJXA 3B7IA 3B3CA 4YU9A 3SI1A 1HEEA 4NGSA 1AMPA 3PB7X 4C9VA 2HC9A 2F7VA 2HB6A 4F8ZA 3K2KA 3FH4A 1IGBA 4P4JA 3NFZA 3IO1A 3I6SA 1TXRA 3NH4A 3T8WA 4LQGA 2AFMA 2BCOA 4OIWA 1DE4C 4ZY0A 2PE3A 3NA6A 4NGTA 1CP7A 3CDXA 2ZEHA 1BAVA 3IWWA 2FVGA 2AFZA 2V8GA 3I74A 1Y0YA 3IEHA 1CPXA 2PJBA 4UEFA 4Z65A 4C9EA 2QYVA 3KR4A 4MCPA 3N5FA 2C6CA 4C99A 3SJEA 1LFWA 4C8FA 2QVPA 3QNVA 1VHEA 3D7FA 4MHYA 3KGQA 3MRUA 3IC1A 1UWYA 4IAVA 1XRYA 4P4FA 2ANPA 2AFWA 3VARA 5CPAA 2ZEEA 1CPSA 2EK9A 4WJBA 4AXVA 2PJ6A 3B3VA 1XJOA 1Y0RA 4X2TA 4EMEA 3PEIA 1ZG9A 1GYTA 1TKFA 4MXUA 2C6PA 4PXDA 4DYOA 2GREA 5LYIA 1TKHA 2ZENA 1XF1A 1YW6A 4RUHA 3LMSA 2ABZA 3IIBA 3PRTA 4F9UA 3H8GA 2ZOGA 3CT9A 1XFOA 3JRUA 3PFOA 2XEJA 2CIJA 3HUVA 4MHZA 3CPAA 5JM6A 1RTQA 4CPAA 4C8CA 1EE3P 3NH5A 4UEZA 3FX6A 1F2PA 1CX8A 1HDUA 3FVLA 5HVHA 3PBEA 5CBMA 1CP6A 4G1PA 2BOAA 1KWMA 1DTDA 4WWVA 3D4UA 2AFOA 4P45A 4MHNA 1YLOA 3RBUA 1Y9ZA 4NGMA 2GLFA 1FT7A 1Z8LA 2EK8A 3ISXA 4TNUA 1OBRA 1Z5RA 3D68A 1QMUA 1TF8A 2JEWA 4NGPA 4P44A 4ZX9A 4MHPA 3VH9A 3KI9A 4OKOA 3SJGA 3BXMA 2V77A 3GUXA 4C84A 8CPAA 4YN3A 4EFDA 4P4BA 2PVWA 4C8PA 4TJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KR5 A;  3BHX A;  1VHO A;  2Q4Z A;  1ARM A;  3PB8 X;  4R76 A;  1TKJ A;  2JBJ A;  2AFU A;  2ZED A;  5DS0 A;  3CPX A;  1Z2L A;  3VAT A;  2CF4 A;  5K8P A;  2ZEG A;  2WZN A;  4ZY1 A;  4ZX8 A;  3L2N A;  3S9M A;  3PFE A;  1YME A;  2JBK A;  2C6G A;  4ZYQ A;  1CG2 A;  2IJZ A;  1CBX A;  2O4H A;  3KQZ A;  2CTC A;  3DLJ A;  2XEI A;  2PJ8 A;  1YSJ A;  2GLJ A;  3KZW A;  4A37 A;  1R3N A;  5D8N A;  2I3C A;  1F57 A;  4H2K A;  1YW4 A;  3WAB A;  2PJ0 A;  4P6Y A;  4IK2 A;  4TJX A;  1TF9 A;  3D66 A;  4C9U A;  3WC7 A;  5LYD A;  2RFH A;  1AYE A;  3PBB A;  2PIY A;  4PXB A;  1WVM A;  2ZOF A;  4BD9 A;  3SI2 A;  3GB0 A;  1JQG A;  4C8T A;  4GM5 A;  2OR4 A;  1FNO A;  2V8H A;  4EWT A;  2J9A A;  3TC8 A;  4C8A A;  3PB9 X;  2PJ7 A;  3DGV A;  1BPN A;  3KHZ A;  3WC6 A;  2V8D A;  3PB4 X;  4JZ0 A;  3EIF A;  3ICU A;  1XBU A;  4P4E A;  4NGR A;  2Q43 A;  2NYQ A;  4TWE A;  2PJ4 A;  4KSI A;  3SJF A;  4NFR A;  1Y7E A;  2VL1 A;  7CPA A;  3D7H A;  4CDJ A;  3S9L A;  3VTA A;  5JGF A;  4ZI6 A;  3WC5 A;  4OC1 A;  4ONW A;  3KQX A;  3LWU A;  2G9D A;  4OID A;  4A38 A;  2XEG A;  4OME A;  1VIX A;  4P10 A;  3B3W A;  4W9Y A;  4A39 A;  3FF3 A;  4NJR A;  4UIB A;  2ZEO A;  4FBE A;  1QQ9 A;  3H8F A;  4PXC A;  4R6T A;  2OOT A;  3I1U A;  5LYF A;  3ISZ A;  1NSA A;  3K9T A;  2AFS A;  4NGN A;  4OC2 A;  4K3N A;  2AFX A;  3D67 A;  3D7G A;  2F8H A;  2PJ5 A;  5LRK A;  1H8L A;  1BLL E;  3TX8 A;  5J1Q A;  1ZG8 A;  2ZEM A;  4ZY2 A;  3FEC A;  2ZEP A;  1ELM P;  2XEF A;  4P4D A;  5F09 A;  4FWU A;  2RB7 A;  4MCQ A;  2PJ2 A;  5THW A;  1LCP A;  3SI0 A;  2PIZ A;  2ZEL A;  3B35 A;  4KNG E;  2WYR A;  1V6C A;  3IFE A;  4UIA A;  4FAI A;  5LYL A;  2POK A;  1LOK A;  1ARL A;  3FEE A;  2QJ8 A;  4OC3 A;  4R8F A;  4B6Z A;  2NSM A;  4C9R A;  4CDK A;  2PJC A;  3FMC A;  1ZG7 A;  4UEE A;  1Q7L A;  3BI0 A;  2ZEF A;  3FED A;  2GU2 A;  2PJA A;  4MMO A;  1VGY A;  4UF4 A;  2Q51 A;  1F2O A;  4OP4 A;  4DJL A;  1IY7 A;  5HXD A;  5D29 A;  3B2Y A;  1PYT B;  5IB9 A;  1LAP A;  3KL9 A;  4OC0 A;  4DUK A;  4NJQ A;  5ELY A;  1BPM A;  2PJ1 A;  2PJ9 A;  5I4M A;  2DEA A;  3B3T A;  2CTB A;  3HLP A;  2C1C A;  4PQA A;  1ZLI A;  4JYW A;  4OC4 A;  1ELL P;  3RZA A;  4C9A A;  1R43 A;  1ZLH A;  4IHM A;  4Q7A A;  5LRJ A;  4P4I A;  4F9V A;  1M4L A;  4NGQ A;  3V7Z A;  5K8N A;  5HVF A;  4C8U A;  2PCU A;  4MRI A;  3NH8 A;  4FUU A;  3WT4 A;  2EWB A;  2V8V A;  2PVV A;  3BI1 A;  4C86 A;  4PXE A;  5HVG A;  4C85 A;  3KAS A;  1XMB A;  4PPZ A;  3RAM A;  2BO9 A;  2IMO A;  5JH9 A;  4R7M A;  4YWY A;  3B3S A;  3KHX A;  3H8E A;  6CPA A;  5K8M A;  4O23 A;  2IQ6 A;  3PB6 X;  3S9N A;  1LAM A;  4X8I A;  3D7D A;  3V38 A;  4X3R A;  3FJU A;  2O53 A;  3IJ3 A;  1HDQ A;  3MN8 A;  3GLJ A;  4MCR A;  4A94 A;  4MCS A;  2PRQ A;  1LAN A;  4OC5 A;  5LRG A;  1PCA A;  5K8O A;  2PJ3 A;  3SJX A;  3B7I A;  3B3C A;  4YU9 A;  3SI1 A;  1HEE A;  4NGS A;  1AMP A;  3PB7 X;  4C9V A;  2HC9 A;  2F7V A;  2HB6 A;  4F8Z A;  3K2K A;  3FH4 A;  1IGB A;  4P4J A;  3NFZ A;  3IO1 A;  3I6S A;  1TXR A;  3NH4 A;  3T8W A;  4LQG A;  2AFM A;  2BCO A;  4OIW A;  1DE4 C;  4ZY0 A;  2PE3 A;  3NA6 A;  4NGT A;  1CP7 A;  3CDX A;  2ZEH A;  1BAV A;  3IWW A;  2FVG A;  2AFZ A;  2V8G A;  3I74 A;  1Y0Y A;  3IEH A;  1CPX A;  2PJB A;  4UEF A;  4Z65 A;  4C9E A;  2QYV A;  3KR4 A;  4MCP A;  3N5F A;  2C6C A;  4C99 A;  3SJE A;  1LFW A;  4C8F A;  2QVP A;  3QNV A;  1VHE A;  3D7F A;  4MHY A;  3KGQ A;  3MRU A;  3IC1 A;  1UWY A;  4IAV A;  1XRY A;  4P4F A;  2ANP A;  2AFW A;  3VAR A;  5CPA A;  2ZEE A;  1CPS A;  2EK9 A;  4WJB A;  4AXV A;  2PJ6 A;  3B3V A;  1XJO A;  1Y0R A;  4X2T A;  4EME A;  3PEI A;  1ZG9 A;  1GYT A;  1TKF A;  4MXU A;  2C6P A;  4PXD A;  4DYO A;  2GRE A;  5LYI A;  1TKH A;  2ZEN A;  1XF1 A;  1YW6 A;  4RUH A;  3LMS A;  2ABZ A;  3IIB A;  3PRT A;  4F9U A;  3H8G A;  2ZOG A;  3CT9 A;  1XFO A;  3JRU A;  3PFO A;  2XEJ A;  2CIJ A;  3HUV A;  4MHZ A;  3CPA A;  5JM6 A;  1RTQ A;  4CPA A;  4C8C A;  1EE3 P;  3NH5 A;  4UEZ A;  3FX6 A;  1F2P A;  1CX8 A;  1HDU A;  3FVL A;  5HVH A;  3PBE A;  5CBM A;  1CP6 A;  4G1P A;  2BOA A;  1KWM A;  1DTD A;  4WWV A;  3D4U A;  2AFO A;  4P45 A;  4MHN A;  1YLO A;  3RBU A;  1Y9Z A;  4NGM A;  2GLF A;  1FT7 A;  1Z8L A;  2EK8 A;  3ISX A;  4TNU A;  1OBR A;  1Z5R A;  3D68 A;  1QMU A;  1TF8 A;  2JEW A;  4NGP A;  4P44 A;  4ZX9 A;  4MHP A;  3VH9 A;  3KI9 A;  4OKO A;  3SJG A;  3BXM A;  2V77 A;  3GUX A;  4C84 A;  8CPA A;  4YN3 A;  4EFD A;  4P4B A;  2PVW A;  4C8P A;  4TJV A; 
#chains in the Genus database with same CATH topology
 3KR5 A;  4U9Y A;  3BHX A;  1VHO A;  2Q4Z A;  1M4D A;  4XPD B;  5HKZ A;  1ARM A;  3PB8 X;  4R76 A;  1TKJ A;  4PV6 A;  2E28 A;  2XPO A;  2JBJ A;  2AFU A;  2EZC A;  2ZED A;  1CJW A;  5DS0 A;  3CPX A;  1Z2L A;  3BJ7 A;  2YNC C;  3VAT A;  2CF4 A;  1A9X B;  4KOV A;  5K8P A;  2ZEG A;  2WZN A;  4ZY1 A;  1IOI A;  4ZX8 A;  2WPX A;  3L2N A;  2Y1N A;  2CXA A;  2JEV A;  4IIX A;  2EO8 A;  2Z3L A;  3PGP A;  3TLG B;  3S9M A;  3PFE A;  1YME A;  2JBK A;  2C6G A;  2JLM A;  3JUW A;  2Q4Y A;  2Q4V A;  5I0C A;  4ZYQ A;  1CG2 A;  2IJZ A;  4HNX B;  1EZA A;  1CBX A;  1T36 B;  3NFQ A;  2R7H A;  2O28 A;  3OP0 A;  2O4H A;  3KQZ A;  5A28 A;  2D0P A;  4B14 A;  4PSW A;  2CTC A;  3DLJ A;  2XEI A;  4XPL A;  2PJ8 A;  1YSJ A;  2R1I A;  4FD4 A;  4MY0 A;  2GLJ A;  2JDD A;  2PRB A;  3KZW A;  1I12 A;  3DR8 A;  1R3N A;  5D8N A;  4A37 A;  3CXQ A;  2I3C A;  4OAE A;  1WJT A;  1F57 A;  3GY9 A;  4K30 A;  4H2K A;  2X0S A;  1YW4 A;  3V8I A;  4KOT A;  2PJ0 A;  4P6Y A;  4IK2 A;  3RO0 A;  3WAB A;  1TF9 A;  3D66 A;  1DIK A;  4TJX A;  5CNP A;  1YR0 A;  3T0T A;  3WC7 A;  1YVO A;  5LYD A;  2FXF A;  2RFH A;  4ONU A;  4C9U A;  1AYE A;  3PBB A;  2PIY A;  4PXB A;  3S6F A;  4F0Y A;  2ZOF A;  4YGO A;  1WVM A;  3EY5 A;  4RS2 A;  2OZG A;  1P0H A;  4BD9 A;  3BUM B;  4A4B A;  3GB0 A;  3SI2 A;  1JQG A;  5JH9 A;  4C8T A;  1NXJ A;  4COB A;  1FY7 A;  4GM5 A;  1MK4 A;  5IB0 A;  2VBQ A;  2OR4 A;  2C27 A;  1GGO A;  2B3U A;  3HMJ G;  1MJ9 A;  2OZH A;  2Q0Y A;  5JPH A;  2UV8 G;  1FNO A;  2V8H A;  4EWT A;  1CS0 B;  2DIK A;  4CGM A;  2J9A A;  4M6G A;  4MJX A;  5AXI A;  3IU2 A;  3TC8 A;  4C8A A;  1XEB A;  2PJ7 A;  3DGV A;  3PB9 X;  1BPN A;  4MFJ A;  4C7I A;  2H5M A;  3KHZ A;  3T07 A;  3F0A A;  2FT0 A;  3T05 A;  1U6M A;  3WC6 A;  2YGW A;  5JQ4 A;  2Z3N A;  2VXK A;  2V8D A;  4CAV A;  5KTC A;  2GAN A;  3TTH A;  2ODF A;  4JXQ A;  2CNS A;  4JLY A;  3TLZ A;  3PB4 X;  2Q44 A;  3D2M A;  3QAY A;  4JZ0 A;  2YND A;  3EIF A;  1PU9 A;  2B4D B;  3ICU A;  3VRQ A;  1XBU A;  4P4E A;  1BXR B;  4NGR A;  1EZB A;  1Y9K A;  2R82 A;  2Q43 A;  2Y0M A;  2NYQ A;  3TLC A;  4TWE A;  2PJ4 A;  4KSI A;  2AE6 A;  3SJF A;  3BLN A;  3QAH A;  4NFR A;  4NSQ A;  1MJB A;  1Y7E A;  2VL1 A;  2WPW A;  3D7H A;  2G0B A;  2ZW7 A;  3D8P A;  4B5O A;  7CPA A;  3PT1 A;  2PC1 A;  3KRV A;  4CDJ A;  1YK3 A;  1YGH A;  2ARH A;  4QC6 A;  3S9L A;  4RI1 A;  3VTA A;  1R61 A;  4UCM A;  4CYN A;  4ZI6 A;  5JGF A;  3WC5 A;  3FIX A;  3FRM A;  3NE8 A;  4OC1 A;  4ONW A;  4CAF A;  4MY3 A;  3LD2 A;  4CRY B;  3KQX A;  3GIU A;  3LWU A;  4NEX A;  3F5B A;  5DWM A;  5E96 A;  5G22 A;  5G20 A;  1KUY A;  1UFH A;  2G9D A;  3R9F A;  2B5G A;  2CNM A;  1Q2C A;  1PUA A;  4KLV A;  4OID A;  2XEG A;  4A38 A;  4B12 A;  4OME A;  1V0C A;  1VIX A;  1Z8W A;  2PDO A;  4C2Y A;  4F6A A;  2BL1 A;  4P10 A;  4X5K A;  4PSX A;  3EZA A;  1IYL A;  3B3W A;  4W9Y A;  2ZW4 A;  4I49 A;  3FF3 A;  4JXR A;  4A39 A;  4NJR A;  5ISV A;  4UIB A;  1Z8X A;  5IR2 A;  4MFK A;  4RR2 B;  2XPP A;  2ZEO A;  4FBE A;  1QQ9 A;  3H8F A;  4PXC A;  4R6T A;  2OOT A;  4FD7 A;  1C30 B;  3I1U A;  3VRR A;  4IUS A;  5KTA A;  5LYF A;  3ISZ A;  1NSA A;  3K9T A;  2AFS A;  4YRH A;  4R3K A;  4BPW B;  3NOJ A;  4NGN A;  2HQY A;  4OC2 A;  4K3N A;  3S6G A;  3ZNI A;  3N7Z A;  4XPK A;  2AFX A;  3D67 A;  1JDE A;  2B0A A;  3P2F A;  3D7G A;  2F8H A;  2PJ5 A;  5KTD A;  3EXN A;  5LRK A;  1H8L A;  3VGO A;  3DDD A;  5AG4 A;  2BSW A;  3VWE A;  4CYP A;  1FBV A;  5FVJ A;  1BLL E;  3TX8 A;  5J1Q A;  1ZG8 A;  2OH1 A;  4KOX A;  2ZEM A;  2Z0Z A;  3FEC A;  4JD6 A;  4ZY2 A;  4A33 A;  2FCK A;  3EO4 A;  5K99 A;  2AJ6 A;  2B4D A;  2VI7 A;  1ELM P;  2ZEP A;  4KZT A;  3W6X A;  3C8O A;  4KOS A;  2XEF A;  2C5Q A;  4P4D A;  5F09 A;  2RB7 A;  3A9L A;  4FWU A;  4MCQ A;  2PJ2 A;  5THW A;  4FD6 A;  1LCP A;  2ATR A;  2PIZ A;  2ZEL A;  3B35 A;  3SI0 A;  2WYR A;  1V6C A;  4KNG E;  3IFE A;  2F5I A;  4KOR A;  4UIA A;  4MBU A;  5F13 A;  4CYQ A;  4FAI A;  4HKF A;  5A27 A;  1C3O B;  3TLE A;  5LYL A;  4UFX A;  4A31 A;  2POK A;  2D0O A;  3JVN A;  2PSW A;  1BOB A;  1I21 A;  1LOK A;  1ARL A;  2FL4 A;  3RYO A;  2R98 A;  3T9Y A;  4CGN A;  2GP4 A;  4UCN A;  3FEE A;  1NMT A;  3FXT A;  4L89 A;  4NF1 A;  2HI6 A;  2QJ8 A;  4OC3 A;  4MI4 A;  2Q7S A;  4R8F A;  5F46 A;  1IID A;  4B6Z A;  4E2A A;  2OB0 A;  2B4J C;  4F0X A;  4GXH A;  1XE4 A;  4CO9 A;  2QEC A;  5AG6 A;  4A4C A;  1ON0 A;  2DF5 A;  2NSM A;  4C9R A;  4CDK A;  2PJC A;  2Z11 A;  3BUX B;  3SXO A;  5C82 A;  3FMC A;  2AUN A;  4LX9 A;  3NE7 A;  1ZG7 A;  3ZJ0 A;  4UEE A;  1CE8 B;  1Q7L A;  3BI0 A;  2D4O A;  1NE9 A;  4R57 A;  2ZEF A;  3FED A;  1IIC A;  4CAX A;  2PCN A;  3IU1 A;  4J0N A;  3VRP A;  2GU2 A;  2PJA A;  2G3A A;  2BEI A;  4MMO A;  1VGY A;  2GE3 A;  1VBG A;  4UF4 A;  2DXQ A;  4IF5 A;  2FS5 A;  1F2O A;  2Q51 A;  4OP4 A;  4INJ A;  4EYS A;  1JDB C;  2FIW A;  4LUA A;  4DJL A;  1IY7 A;  4AG9 A;  4B5P B;  4BTF A;  2B4B A;  5D29 A;  2DPT A;  5HXD A;  5F1Y A;  2D4P A;  3B2Y A;  1PYT B;  3BUO B;  1LAP A;  3HPH E;  3TO6 A;  3ZZI A;  3KL9 A;  4C2X A;  4OC0 A;  5IB9 A;  3TOB A;  4AVB A;  4DUK A;  5G1Z A;  2XPL A;  4NJQ A;  5ELY A;  5GCN A;  2DPS A;  1BPM A;  2PJ1 A;  4U9Z A;  2PJ9 A;  4AB7 A;  5I4M A;  1Q5X A;  2DEA A;  1M4G A;  1Y7R A;  3B3T A;  2CTB A;  2Q7B A;  4UFW A;  1B47 A;  1YVK A;  3D3S A;  1YLE A;  3HLP A;  3G23 A;  2C1C A;  4AG7 A;  3TOA A;  4PQA A;  1ZLI A;  3UY5 A;  4MHD A;  4CS0 B;  4JYW A;  2G3T A;  4Q38 A;  4OC4 A;  1ELL P;  2I00 A;  3RZA A;  4C9A A;  1R43 A;  1ZLH A;  4IHM A;  3TO9 A;  1P4N A;  3F9K C;  4H6Z A;  4Q7A A;  2Y1M A;  4TJV A;  4L8A A;  1SQH A;  2HV2 A;  5EMI A;  5LRJ A;  5H86 A;  3RNZ A;  4B13 A;  2VQY A;  4UWI A;  4COG A;  4P4I A;  4KVM E;  5HMN A;  3PP9 A;  3TLG A;  4F9V A;  3PZJ A;  1KEE B;  1M4L A;  1ZL0 A;  2CNT A;  4C2Z A;  4NGQ A;  1S3Z A;  2FE7 A;  3V7Z A;  4CAE A;  5K8N A;  3F8K A;  5HVF A;  4C8U A;  2PCU A;  4MRI A;  2Q04 A;  2REE A;  4CGL A;  2QML A;  3NH8 A;  4FUU A;  3WT4 A;  2EWB A;  1S7L A;  3EFA A;  2V8V A;  2VZY A;  2FSR A;  2I79 A;  5EBV A;  3JTK A;  2PVV A;  3PFV A;  3BI1 A;  1QSM A;  2RC4 A;  4Q36 A;  2Z3M A;  3DSB A;  4C86 A;  4PXE A;  5EC4 A;  5HVG A;  3MGD A;  3WR7 A;  3R95 A;  5F5X A;  4C85 A;  3KAS A;  1XMB A;  4OLL A;  4PPZ A;  1AUG A;  5JVL A;  3RAM A;  2BO9 A;  4UCP A;  1BO4 A;  1KUX A;  2IMO A;  2WSA A;  3C26 A;  4KUA A;  1CM0 A;  2B5G B;  1X10 A;  3LAC A;  4HNY B;  4R7M A;  4YWY A;  3B3S A;  3KHX A;  4M6H A;  3H8E A;  4A2Z A;  2YJT A;  6CPA A;  5K8M A;  4O23 A;  1VHS A;  2IQ6 A;  5HH1 A;  3R96 A;  3U1B A;  3PB6 X;  3S9N A;  1LAM A;  2J8N A;  4R9M A;  1LRZ A;  3D7D A;  4X8I A;  2YNE A;  3VWD A;  4KOW A;  4GS4 A;  3V38 A;  2NMT A;  4X3R A;  3W91 A;  2EZB A;  4OAD A;  1B6B A;  2KCW A;  5F47 A;  3T90 A;  4KUB A;  3EZE A;  5BY0 A;  3FJU A;  3BJ8 A;  2O53 A;  3IJ3 A;  1HDQ A;  3BUN B;  1S7N A;  3MN8 A;  1NSL A;  1QST A;  3SHP A;  3OWC A;  4J3G A;  4QUS A;  2VEZ A;  1B87 A;  3GLJ A;  4MCR A;  2REF A;  3G8W A;  4A94 A;  4MCS A;  2PRQ A;  1LAN A;  4MFQ A;  4DNC A;  4OC5 A;  3W6S A;  1XIX A;  1Q2Y A;  2K5T A;  3GKR A;  5LRG A;  4KOU A;  4CZ1 A;  2FIA A;  3TCV A;  4KLW A;  1IU8 A;  1PCA A;  1M1D A;  1Z8T A;  3TO7 A;  1RXT A;  1A2Z A;  5K8O A;  2YNC A;  2PJ3 A;  3SJX A;  2EUI A;  4YFJ A;  3T5M A;  5F49 A;  3GYA A;  3B7I A;  4M6I A;  3B3C A;  3K9U A;  1VKC A;  4YU9 A;  3SI1 A;  1HEE A;  1S5K A;  4UFV A;  3SR3 A;  4NGS A;  3E0K A;  3IGR A;  1AMP A;  1J3L A;  2P6F A;  1WWZ A;  1J4J A;  3PB7 X;  3TLY A;  4C9V A;  4BPU B;  2HC9 A;  4EVY A;  1EO0 A;  2CBL A;  3OB1 B;  2F7V A;  2HB6 A;  4H89 A;  4F8Z A;  2HUZ A;  3DR6 A;  3FYN A;  4KVX A;  3K2K A;  4BPX B;  3FH4 A;  1IGB A;  4XNH B;  4AVC A;  4P4J A;  3FB3 A;  3NFZ A;  3IO1 A;  4B11 A;  4BBH A;  5IX3 A;  1Z4E A;  3I6S A;  1TXR A;  1XOV A;  4E94 A;  1Q2D A;  3VRN A;  4LQG A;  3NH4 A;  4H6U A;  3T8W A;  5JYB A;  2BUE A;  4BIN A;  4CGP A;  4JVO A;  3TFY A;  2AFM A;  5AG7 A;  2ZW5 A;  1Z9E A;  2BCO A;  5IV0 A;  2GIV A;  4OIW A;  1DE4 C;  4C7H A;  4ZY0 A;  3CXS A;  3VRO A;  2J8M A;  2PE3 A;  3I3G A;  3NA6 A;  3R9E A;  4NGT A;  1CP7 A;  4JJX A;  3CDX A;  1N71 A;  3HPG G;  2Z3P A;  2XPN A;  1WK4 A;  4C84 A;  2ZEH A;  1BAV A;  2EBJ A;  3IWW A;  2FVG A;  2ZXV A;  2AFZ A;  4CRZ B;  2EVN A;  2V8G A;  3QB8 A;  4KSA A;  2OU2 A;  2HWG A;  1Y0Y A;  3I74 A;  3SXN A;  1R57 A;  3IEH A;  1CPX A;  2PJB A;  2R8V A;  4UEF A;  4XPD C;  4Z65 A;  1M4I A;  1QSO A;  2J8R A;  4C9E A;  3CZX A;  2HRO A;  3IWE A;  2QYV A;  4MCP A;  2C6C A;  2VKZ G;  3KR4 A;  1XF8 A;  3N5F A;  3SJE A;  4CAW A;  1LFW A;  4A32 A;  4C99 A;  4C8F A;  4E5S A;  2QVP A;  4BMH A;  3QNV A;  3EZB A;  1VHE A;  5AGE A;  4R87 A;  3D7F A;  2MP0 A;  4MHY A;  4B5P A;  4M85 A;  1IYK A;  1NBW A;  3KGQ A;  3MRU A;  4HNW B;  3IC1 A;  1UWY A;  3EC4 A;  4IAV A;  1X12 A;  2IL4 A;  4UWJ A;  2B3V A;  1XRY A;  1L0C A;  4P4F A;  2ANP A;  1M6V B;  5F9M A;  2DLA A;  2AFW A;  4KS9 A;  3VAR A;  1VI4 A;  5CPA A;  2ZEE A;  4U5Y A;  1CPS A;  2YJV A;  3DNS A;  1KC7 A;  2EK9 A;  3TT2 A;  3LOD A;  4MFZ A;  5BWA B;  4WJB A;  5J3X A;  3OB2 B;  4AXV A;  2A4N A;  2PJ6 A;  3R1K A;  2PR8 A;  4LQ6 A;  4MI1 A;  3B3V A;  2WUU A;  2JDC A;  4CGO A;  1S7K A;  2P6G A;  3H5Z A;  3U88 C;  4MFL A;  1XJO A;  3S6K A;  5J8C A;  3TE4 A;  2AUM A;  1Y0R A;  4X2T A;  4EME A;  3PEI A;  1ZG9 A;  1GYT A;  2P0W A;  2PR1 A;  4A30 A;  1TKF A;  4NXY A;  1TIQ A;  3PLF B;  4MXU A;  2C6P A;  4PXD A;  3I9S A;  3P2H A;  5G21 A;  1Z9U A;  4DYO A;  2B58 A;  2GRE A;  5LYI A;  1TKH A;  2ZEN A;  1VBH A;  4M8D A;  5DWN A;  1XF1 A;  1KUV A;  3GJZ A;  1IOF A;  1YW6 A;  4RUH A;  4H1H A;  3LMS A;  2ABZ A;  1KZF A;  1OZP A;  3IIB A;  4C68 A;  3PRT A;  1I1D A;  4NCZ A;  1YRE A;  2Z3O A;  1JWQ A;  4CYO A;  1RO5 A;  3R9G A;  1M44 A;  4F9U A;  3TLB A;  3H8G A;  2ZOG A;  3CT9 A;  1XFO A;  3JRU A;  3PFO A;  4QBJ A;  4B10 A;  2XEJ A;  2CIJ A;  4KOY A;  3HUV A;  2FM4 A;  5AG5 A;  4MHZ A;  4QB9 A;  4IIY A;  3CPA A;  3KKW A;  4E8O A;  1K4J A;  1RTQ A;  4Y49 C;  5H84 A;  4CPA A;  5JM6 A;  5HKW A;  4C8C A;  1EE3 P;  3NH5 A;  5FD8 A;  4UEZ A;  3FX6 A;  1F2P A;  1CX8 A;  1HDU A;  1IB1 E;  3FVL A;  4KVO E;  1YX0 A;  3D2P A;  5F48 A;  3OAK A;  2PQ8 A;  4RN7 A;  3PBE A;  5HVH A;  5CBM A;  1CP6 A;  2Z10 A;  4G1P A;  2CY2 A;  2BOA A;  5HKY A;  1DTD A;  1KWM A;  3FBU A;  4WWV A;  3D4U A;  2AFO A;  4QVT A;  4ZBG A;  4II9 A;  4P45 A;  4FD5 A;  4MHN A;  1MJA A;  3B8G A;  1YLO A;  4UA3 A;  1YVH A;  2P6E A;  4UBR A;  2QIR A;  4M3S A;  1XMT A;  5C88 A;  3RBU A;  1Y9Z A;  4HPS A;  4NGM A;  1YQE A;  1FT7 A;  2GLF A;  1Z8L A;  1GHE A;  2EK8 A;  3CXP A;  1QSR A;  3ISX A;  1Z4R A;  4TNU A;  1ZO0 A;  4E0A A;  3TYX A;  2EZA A;  5J8F A;  1ZRS A;  3BUW B;  4MJ8 A;  4XNH C;  4ZGY B;  1OBR A;  2GFQ A;  2X7B A;  1Z5R A;  3D68 A;  4PK3 A;  1QMU A;  2N3A B;  1TF8 A;  4ORF A;  3TLA A;  4AVA A;  2OLS A;  1QSN A;  3G3S A;  2ZPA A;  3O8Z A;  3IWG A;  3K4I A;  2JEW A;  4A95 A;  4NGP A;  1KBL A;  4P44 A;  3H4Q A;  4Y49 B;  4ZX9 A;  3S6H A;  4MHP A;  3VH9 A;  1S7F A;  3KI9 A;  3SJG A;  2OZU A;  3BXM A;  2Z3K A;  2V77 A;  3GUX A;  4OKO A;  4R3L A;  8CPA A;  4GPL B;  2VZZ A;  1ZYM A;  4EFD A;  4YN3 A;  2ZW6 A;  1Y9W A;  4KSF A;  4P4B A;  4MFP A;  4PK2 A;  2PVW A;  4C8P A;  3FNC A;  4JWP A;  1S60 A; 
#chains in the Genus database with same CATH homology
 3KR5 A;  3BHX A;  1VHO A;  2Q4Z A;  1ARM A;  3PB8 X;  4R76 A;  1TKJ A;  2JBJ A;  2AFU A;  2ZED A;  5DS0 A;  3CPX A;  1Z2L A;  3VAT A;  2CF4 A;  5K8P A;  2ZEG A;  2WZN A;  4ZY1 A;  4ZX8 A;  3L2N A;  3S9M A;  3PFE A;  1YME A;  2JBK A;  2C6G A;  4ZYQ A;  1CG2 A;  2IJZ A;  1CBX A;  2O4H A;  3KQZ A;  2CTC A;  3DLJ A;  2XEI A;  2PJ8 A;  1YSJ A;  2GLJ A;  3KZW A;  4A37 A;  1R3N A;  5D8N A;  2I3C A;  1F57 A;  4H2K A;  1YW4 A;  3WAB A;  2PJ0 A;  4P6Y A;  4IK2 A;  4TJX A;  1TF9 A;  3D66 A;  4C9U A;  3WC7 A;  5LYD A;  2RFH A;  1AYE A;  3PBB A;  2PIY A;  4PXB A;  1WVM A;  2ZOF A;  4BD9 A;  3SI2 A;  3GB0 A;  1JQG A;  4C8T A;  4GM5 A;  2OR4 A;  1FNO A;  2V8H A;  4EWT A;  2J9A A;  3TC8 A;  4C8A A;  3PB9 X;  2PJ7 A;  3DGV A;  1BPN A;  3KHZ A;  3WC6 A;  2V8D A;  3PB4 X;  4JZ0 A;  3EIF A;  3ICU A;  1XBU A;  4P4E A;  4NGR A;  2Q43 A;  2NYQ A;  4TWE A;  2PJ4 A;  4KSI A;  3SJF A;  4NFR A;  1Y7E A;  2VL1 A;  7CPA A;  3D7H A;  4CDJ A;  3S9L A;  3VTA A;  5JGF A;  4ZI6 A;  3WC5 A;  4OC1 A;  4ONW A;  3KQX A;  3LWU A;  2G9D A;  4OID A;  4A38 A;  2XEG A;  4OME A;  1VIX A;  4P10 A;  3B3W A;  4W9Y A;  4A39 A;  3FF3 A;  4NJR A;  4UIB A;  5IR2 A;  2ZEO A;  4FBE A;  1QQ9 A;  3H8F A;  4PXC A;  4R6T A;  2OOT A;  3I1U A;  5LYF A;  3ISZ A;  1NSA A;  3K9T A;  2AFS A;  4NGN A;  4OC2 A;  4K3N A;  2AFX A;  3D67 A;  3D7G A;  2F8H A;  2PJ5 A;  5LRK A;  1H8L A;  1BLL E;  3TX8 A;  5J1Q A;  1ZG8 A;  2ZEM A;  4ZY2 A;  3FEC A;  2ZEP A;  1ELM P;  2XEF A;  2C5Q A;  4P4D A;  5F09 A;  4FWU A;  2RB7 A;  4MCQ A;  2PJ2 A;  5THW A;  1LCP A;  3SI0 A;  2PIZ A;  2ZEL A;  3B35 A;  4KNG E;  2WYR A;  1V6C A;  3IFE A;  4UIA A;  4FAI A;  5LYL A;  2POK A;  1LOK A;  1ARL A;  2GP4 A;  3FEE A;  2QJ8 A;  4OC3 A;  4R8F A;  4B6Z A;  2NSM A;  4C9R A;  4CDK A;  2PJC A;  3FMC A;  1ZG7 A;  4UEE A;  1Q7L A;  3BI0 A;  2ZEF A;  3FED A;  2GU2 A;  2PJA A;  4MMO A;  1VGY A;  4UF4 A;  2Q51 A;  1F2O A;  4OP4 A;  4DJL A;  1IY7 A;  5HXD A;  5D29 A;  3B2Y A;  1PYT B;  5IB9 A;  1LAP A;  3KL9 A;  4OC0 A;  4DUK A;  4NJQ A;  5ELY A;  1BPM A;  2PJ1 A;  2PJ9 A;  5I4M A;  2DEA A;  3B3T A;  2CTB A;  3HLP A;  2C1C A;  4PQA A;  1ZLI A;  4JYW A;  4OC4 A;  1ELL P;  3RZA A;  4C9A A;  1R43 A;  1ZLH A;  4IHM A;  4Q7A A;  5LRJ A;  4P4I A;  4F9V A;  1M4L A;  4NGQ A;  3V7Z A;  5K8N A;  5HVF A;  4C8U A;  2PCU A;  4MRI A;  3NH8 A;  4FUU A;  3WT4 A;  2EWB A;  2V8V A;  2PVV A;  3BI1 A;  4C86 A;  4PXE A;  5HVG A;  4C85 A;  3KAS A;  1XMB A;  4PPZ A;  3RAM A;  2BO9 A;  2IMO A;  5JH9 A;  4R7M A;  4YWY A;  3B3S A;  3KHX A;  3H8E A;  6CPA A;  5K8M A;  4O23 A;  2IQ6 A;  3PB6 X;  3S9N A;  1LAM A;  4X8I A;  3D7D A;  3V38 A;  4X3R A;  3FJU A;  2O53 A;  3IJ3 A;  1HDQ A;  3MN8 A;  3GLJ A;  4MCR A;  4A94 A;  4MCS A;  2PRQ A;  1LAN A;  4OC5 A;  5LRG A;  1PCA A;  5K8O A;  2PJ3 A;  3SJX A;  3B7I A;  3B3C A;  4YU9 A;  3SI1 A;  1HEE A;  4NGS A;  1AMP A;  3PB7 X;  4C9V A;  2HC9 A;  2F7V A;  2HB6 A;  4F8Z A;  3K2K A;  3FH4 A;  1IGB A;  4P4J A;  3NFZ A;  3IO1 A;  3I6S A;  1TXR A;  3NH4 A;  3T8W A;  4LQG A;  2AFM A;  2BCO A;  4OIW A;  1DE4 C;  4ZY0 A;  2PE3 A;  3NA6 A;  4NGT A;  1CP7 A;  3CDX A;  2ZEH A;  1BAV A;  3IWW A;  2FVG A;  2AFZ A;  2V8G A;  3I74 A;  1Y0Y A;  3IEH A;  1CPX A;  2PJB A;  4UEF A;  4Z65 A;  4C9E A;  2QYV A;  3KR4 A;  4MCP A;  3N5F A;  2C6C A;  4C99 A;  3SJE A;  1LFW A;  4C8F A;  2QVP A;  3QNV A;  1VHE A;  3D7F A;  4MHY A;  3KGQ A;  3MRU A;  3IC1 A;  1UWY A;  4IAV A;  1XRY A;  4P4F A;  2ANP A;  2AFW A;  3VAR A;  5CPA A;  2ZEE A;  1CPS A;  2EK9 A;  4WJB A;  4AXV A;  2PJ6 A;  3B3V A;  1XJO A;  1Y0R A;  4X2T A;  4EME A;  3PEI A;  1ZG9 A;  1GYT A;  1TKF A;  4MXU A;  2C6P A;  4PXD A;  4DYO A;  2GRE A;  5LYI A;  1TKH A;  2ZEN A;  1XF1 A;  1YW6 A;  4RUH A;  3LMS A;  2ABZ A;  3IIB A;  3PRT A;  4F9U A;  3H8G A;  2ZOG A;  3CT9 A;  1XFO A;  3JRU A;  3PFO A;  2XEJ A;  2CIJ A;  3HUV A;  4MHZ A;  3CPA A;  5JM6 A;  1RTQ A;  4CPA A;  4C8C A;  1EE3 P;  3NH5 A;  4UEZ A;  3FX6 A;  1F2P A;  1CX8 A;  1HDU A;  3FVL A;  5HVH A;  3PBE A;  5CBM A;  1CP6 A;  4G1P A;  2BOA A;  1KWM A;  1DTD A;  4WWV A;  3D4U A;  2AFO A;  4P45 A;  4MHN A;  1YLO A;  3RBU A;  1Y9Z A;  4NGM A;  2GLF A;  1FT7 A;  1Z8L A;  2EK8 A;  3ISX A;  4TNU A;  1OBR A;  1Z5R A;  3D68 A;  1QMU A;  1TF8 A;  2JEW A;  4NGP A;  4P44 A;  4ZX9 A;  4MHP A;  3VH9 A;  3KI9 A;  4OKO A;  3SJG A;  3BXM A;  2V77 A;  3GUX A;  4C84 A;  8CPA A;  4YN3 A;  4EFD A;  4P4B A;  2PVW A;  4C8P A;  4TJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...