3BXMA

Structure of an inactive mutant of human glutamate carboxypeptidase ii [gcpii(e424a)] in complex with n-acetyl-asp-glu (naag)
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Reaction mechanism of glutamate carboxypeptidase II revealed by mutagenesis, X-ray crystallography, and computational methods.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bxmA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bxmA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bxmA02
2ZENA 4A94A 3D66A 3CPAA 4G1PA 4MCSA 2AFZA 3GB0A 3S9NA 4OP4A 4RUHA 4FBEA 3QNVA 4R8FA 3CDXA 4MXUA 5JH9A 4MHZA 4R76A 1ELLP 1BPMA 5D29A 5JGFA 4MCPA 2F7VA 4X8IA 4C9RA 3PFOA 2PVVA 2AFMA 3LMSA 4P4FA 1QMUA 2Q4ZA 1F57A 2EK9A 4C84A 4PXCA 3PBEA 3B7IA 1BAVA 4P44A 1TKHA 3PB7X 3FEDA 2ANPA 5THWA 2VL1A 2ZEMA 1Y7EA 3SJEA 7CPAA 2V8GA 1F2PA 3FJUA 2ZEHA 2PJ9A 3WC5A 1Q7LA 3WT4A 5K8NA 2C6CA 3KGQA 1YLOA 4C99A 2JEWA 5K8OA 4OC1A 4GM5A 4P4DA 1Y0YA 3K2KA 4EFDA 1EE3P 4OC5A 4A39A 4YN3A 1IY7A 1YW4A 3FECA 2IMOA 3B35A 3KR4A 1DE4C 2ZOFA 3WC6A 3PFEA 2V8HA 2HC9A 1VHOA 2I3CA 4UIAA 3RAMA 1TF9A 4ONWA 1ZG8A 2O4HA 4UEEA 4W9YA 3KHXA 4ZY1A 3PB9X 1YSJA 4PPZA 1TF8A 2AFSA 4TWEA 3EIFA 3FMCA 3L2NA 4P4IA 2PIYA 4DUKA 4OC0A 1TXRA 3S9MA 2G9DA 3H8FA 2J9AA 2GLJA 3VTAA 2CTBA 3H8EA 2IQ6A 2GU2A 4YU9A 2AFOA 1QQ9A 1VHEA 1XFOA 3N5FA 1R3NA 2CIJA 1Z2LA 1BPNA 4EMEA 2NYQA 3BI1A 2CTCA 2PVWA 2PJ2A 5LYIA 2FVGA 3PB4X 4ZX9A 4C9EA 1M4LA 4A37A 1CPXA 1RTQA 3FX6A 3NH4A 1HEEA 2C6PA 2PE3A 4EWTA 4UF4A 1OBRA 3D68A 5CBMA 3BHXA 4UEZA 3MRUA 2EK8A 2QVPA 2PJ8A 4H2KA 5LRKA 4C8PA 2PRQA 4JYWA 4UEFA 3LWUA 2BOAA 2AFXA 3TC8A 5ELYA 3B3TA 3D7DA 2WZNA 2ZEGA 2ZEOA 4PXBA 1UWYA 2HB6A 2XEGA 3HUVA 3T8WA 1YW6A 5CPAA 1AYEA 2Q43A 3VATA 3NH8A 4B6ZA 1WVMA 3PRTA 3KHZA 5HVFA 4YWYA 3RZAA 2PCUA 4MMOA 4O23A 4C8FA 2OR4A 2ZEFA 5K8PA 4NGSA 3NH5A 1TKJA 4C8CA 1LFWA 2AFWA 4X2TA 1LANA 3D4UA 3IFEA 4P4BA 3D7FA 2Q51A 2RFHA 3PB8X 4ZI6A 4MHNA 2POKA 1H8LA 2PJAA 2XEIA 1HDUA 3SJGA 4WJBA 3JRUA 5LYFA 3BI0A 5HVGA 4C9AA 3DGVA 2PJ6A 1ZG7A 4MRIA 4ZYQA 3CT9A 4UIBA 3BXMA 1TKFA 3IWWA 4OC4A 2PJ4A 4PXDA 3I1UA 3ISXA 4NGNA 3SI0A 4F9VA 3B3VA 3V7ZA 3PEIA 1XRYA 3WC7A 4WWVA 4DYOA 1KWMA 2PJ3A 3SJXA 3RBUA 3KZWA 1GYTA 3KQZA 4PXEA 5DS0A 4DJLA 2V8VA 1ZG9A 2EWBA 1Y9ZA 1LOKA 4TJXA 4CDJA 4C8TA 4C9UA 2JBJA 1NSAA 4IAVA 3D67A 3IC1A 1Z8LA 3IO1A 4BD9A 4MHPA 4NGTA 1YMEA 4C8AA 5IB9A 1AMPA 4A38A 4NJRA 3IJ3A 2PJCA 2RB7A 4AXVA 4ZX8A 4P6YA 1XF1A 3ICUA 2JBKA 1VIXA 3SJFA 2PJBA 1HDQA 5LYLA 4NGMA 3B3SA 3DLJA 2ZEPA 2OOTA 1PYTB 1FT7A 2QJ8A 8CPAA 4C85A 4P4JA 3D7HA 3PB6X 4F9UA 4PQAA 3FEEA 3B2YA 2BCOA 5LYDA 4P4EA 1ELMP 1XJOA 4C86A 2IJZA 1VGYA 2QYVA 2ABZA 4R6TA 4ZY0A 4C8UA 4NGPA 1LAMA 2DEAA 2PJ1A 2ZOGA 3SI2A 4OMEA 4OIWA 2AFUA 2ZEDA 3I6SA 1FNOA 5HVHA 3V38A 4OKOA 4JZ0A 1CBXA 3D7GA 2NSMA 2PJ5A 3VARA 3S9LA 3KQXA 1R43A 3NA6A 4F8ZA 1XMBA 4TJVA 5JM6A 1IGBA 3VH9A 4CDKA 4P10A 3ISZA 3FH4A 3I74A 4NGRA 1F2OA 2BO9A 4OC3A 1ARLA 4MCQA 5F09A 3B3CA 1CP6A 2WYRA 3WABA 3MN8A 2PIZA 4NGQA 3PBBA 1CPSA 5J1QA 1DTDA 4FWUA 4CPAA 4KSIA 1ZLHA 2XEFA 2XEJA 1PCAA 4P45A 4Z65A 4FAIA 3GUXA 4OC2A 3IIBA 1Z5RA 2PJ7A 5HXDA 3H8GA 4IHMA 1LAPA 1XBUA 3TX8A 5LRGA 2ZEEA 2GREA 3GLJA 5I4MA 1LCPA 3B3WA 1V6CA 1JQGA 2V77A 5LRJA 1CP7A 3K9TA 1BLLE 4IK2A 3NFZA 3KI9A 4Q7AA 4MCRA 2V8DA 1ARMA 4NFRA 2C1CA 1Y0RA 5K8MA 4LQGA 1CG2A 4NJQA 4R7MA 3CPXA 2ZELA 2PJ0A 3HLPA 3SI1A 3IEHA 2O53A 1CX8A 4KNGE 3KASA 4FUUA 4OIDA 2CF4A 2F8HA 1ZLIA 5D8NA 4ZY2A 4C9VA 4TNUA 2C6GA 3KR5A 4K3NA 3FF3A 3KL9A 4X3RA 4MHYA 2GLFA 3FVLA 6CPAA
chains in the Genus database with same CATH superfamily
1ZRSA 2ZENA 3D8PA 4A94A 3D66A 5HKWA 3CPAA 2DIKA 4UCPA 1X12A 4U5YA 4CGMA 1I21A 1KZFA 4G1PA 4MCSA 2FL4A 3FXTA 4INJA 2AFZA 3GB0A 5A27A 3FBUA 3S9NA 4OP4A 4RUHA 4MFZA 1K4JA 1KUYA 3NE7A 3QNVA 4R8FA 3CDXA 4MXUA 4FBEA 2AUMA 2D0OA 2AE6A 5JH9A 4PSWA 4MHZA 3FYNA 4R76A 2OZHA 1ELLP 3UY5A 1BPMA 2ODFA 3EO4A 3EFAA 5D29A 3R1KA 2OH1A 5JGFA 1JDEA 4MCPA 1Y9KA 1Z8WA 2F7VA 1IOFA 1M4GA 2WSAA 4FD7A 4KOXA 4K30A 4MFKA 4X8IA 3A9LA 2YNEA 3PFOA 3QB8A 4C9RA 2PVVA 3OB1B 2AFMA 1MJAA 2FXFA 3LMSA 4P4FA 1QMUA 1AUGA 4JXQA 2Q4ZA 1F57A 2EK9A 4R87A 4C2YA 2EZBA 3TOBA 3OWCA 4MY3A 4UA3A 2I79A 5F49A 3WR7A 4C84A 3OP0A 1YLEA 4PXCA 3PBEA 1YREA 2OZGA 1CE8B 2Z10A 1IYKA 1BOBA 1Z4EA 2Z3LA 3B7IA 3RO0A 1BAVA 4QB9A 4P44A 4UFXA 5G20A 1TKHA 3PB7X 3F9KC 2FSRA 3FEDA 2ANPA 2DPSA 2Z3MA 4Y49B 2VL1A 5THWA 4E2AA 2JDDA 4NXYA 3TLEA 4KVXA 3VROA 2ZEMA 1Y7EA 3SJEA 1Z4RA 3DDDA 3S6KA 3NE8A 7CPAA 3FRMA 2B58A 2P0WA 3R96A 3TO7A 3PFVA 2C27A 1F2PA 2V8GA 1N71A 4M3SA 3FJUA 2ZEHA 4NF1A 2C5QA 4A4CA 4JJXA 3G8WA 4RN7A 2PJ9A 3P2FA 4RS2A 3S6GA 4ZBGA 2CXAA 1NE9A 1MK4A 2CY2A 3ZZIA 2G3AA 4Q38A 3WC5A 4B5OA 1YVKA 3SHPA 1Q7LA 5AG7A 4YFJA 4KUAA 3H5ZA 3VWEA 3WT4A 5K8NA 2C6CA 3DR8A 3KGQA 1YQEA 1YLOA 1VBHA 4C99A 4XPDC 3QAHA 2HWGA 4KOYA 2JEWA 4PK3A 4XPLA 1P0HA 5K8OA 2XPNA 4HPSA 4OC1A 2KCWA 1VBGA 3R95A 1S7KA 4GM5A 4P4DA 1Y0YA 2FIWA 3K2KA 2EBJA 4EFDA 2XPPA 1EE3P 2J8MA 4OC5A 4UFWA 1Q2CA 1SQHA 2ZW7A 1IY7A 1YW4A 4A39A 1VI4A 4YN3A 3FECA 4C2ZA 5LRJA 3CXSA 2F5IA 5G21A 2N3AB 2IMOA 4H1HA 3B35A 2PSWA 3KR4A 3IU1A 5F47A 1DE4C 3SXNA 4BBHA 1KC7A 5JQ4A 1PUAA 2ZOFA 1YVHA 3F5BA 3WC6A 4IIXA 1KUVA 3PFEA 5EBVA 2EUIA 4CO9A 3TLGA 2V8HA 4XNHC 2HC9A 2Y1NA 1VHOA 5C88A 1Y7RA 4RR2B 1QSNA 2I3CA 4UIAA 2GIVA 3RAMA 3S6HA 3TO9A 1J4JA 1TF9A 4OAEA 4ONWA 1ZG8A 3K9UA 3F0AA 4FD5A 3ZJ0A 4QC6A 2QMLA 5JVLA 5KTDA 3TYXA 1FY7A 4CAEA 2O4HA 3TT2A 4UEEA 3RNZA 2E28A 2OZUA 5C82A 3GKRA 1VHSA 4W9YA 4MFJA 4KOUA 1ON0A 3KHXA 1KEEB 4ZY1A 3PB9X 3W6SA 1YSJA 4PPZA 1TF8A 1XF8A 1IYLA 5DWMA 2AFSA 4R3KA 1IB1E 4TWEA 3FMCA 3L2NA 4P4IA 3EIFA 3VRPA 4JD6A 2PIYA 3I3GA 4DUKA 4OC0A 1TXRA 2WUUA 5HH1A 2PRBA 4A4BA 3LD2A 2YJVA 3PT1A 3S9MA 4CS0B 1S7FA 3N7ZA 5J3XA 2HUZA 2G9DA 3H8FA 3IGRA 2XPOA 4QUSA 3DNSA 2J9AA 4A31A 3CXQA 4GPLB 1M1DA 2GLJA 3VTAA 2CTBA 5CNPA 3SXOA 3H8EA 2IQ6A 3IWEA 2GU2A 4XPDB 4YU9A 2AFOA 1QQ9A 1VHEA 2PC1A 1XFOA 2B5GB 1BXRB 1XEBA 3N5FA 4KVOE 3T90A 2EZCA 5AGEA 1QSRA 1IOIA 4KZTA 1ZYMA 5F46A 1R3NA 2CIJA 1V0CA 3TLAA 2OU2A 4B10A 1Z2LA 5IV0A 1BPNA 4EMEA 1CJWA 3NFQA 2NYQA 3BI1A 2CTCA 2PVWA 4F6AA 2GE3A 2PJ2A 4UWJA 4CYNA 4E0AA 2Z3KA 5LYIA 1C3OB 1GGOA 3T5MA 4KLVA 1M6VB 2Q7BA 3RYOA 2FVGA 2QECA 3PB4X 4E94A 4ZX9A 4XNHB 2B4JC 4C9EA 1M4LA 4A37A 4MI4A 4JWPA 5F13A 2B3VA 2VQYA 4PK2A 5FD8A 4HNYB 4KOSA 3HMJG 2REFA 4M6GA 4H89A 5F5XA 4IUSA 2FCKA 4A2ZA 1CPXA 1RTQA 3R9FA 2R8VA 1UFHA 3FX6A 3TE4A 4A95A 4NCZA 3NH4A 3EZBA 2AJ6A 1HEEA 3ZNIA 2C6PA 2PE3A 1S5KA 4EWTA 3TFYA 3TCVA 3JUWA 1OZPA 4MFLA 2Q0YA 4MJXA 1Z9EA 4IF5A 4UF4A 1QSTA 4JVOA 1OBRA 4EYSA 1JWQA 1KUXA 3D68A 3BHXA 2CNSA 3MRUA 4KORA 4UEZA 3TTHA 2EK8A 2QVPA 4BPXB 2PJ8A 4H2KA 4BTFA 3F8KA 4CAFA 5LRKA 1NBWA 4C8PA 2PRQA 2P6FA 1C30B 1ZO0A 1Y9WA 4EVYA 3HPHE 2YNDA 4JYWA 4ONUA 4UEFA 3LWUA 4CZ1A 2FIAA 4KSFA 2BOAA 4NEXA 5I0CA 2AFXA 3GJZA 3PP9A 2VBQA 3KRVA 3TC8A 3TLYA 2B5GA 5ELYA 3B3TA 2J8RA 3D7DA 2WZNA 2MP0A 1YK3A 4CGPA 2ZEGA 2ZEOA 3EC4A 4PXBA 4YGOA 4Q36A 1UWYA 2EO8A 2VZYA 1YVOA 2XEGA 2HB6A 3HUVA 4HNWB 3T8WA 2GANA 4BINA 1YW6A 5CPAA 1AYEA 2Q4VA 2XPLA 3TLCA 2Q43A 1MJ9A 4BPUB 2B4BA 4R9MA 3NH8A 3VATA 4B6ZA 2B4DB 4CRZB 1J3LA 3PRTA 4CAVA 3KHZA 5F48A 5H86A 4YWYA 5HVFA 1TIQA 2ZXVA 2B0AA 3RZAA 2PCUA 4MMOA 4MFQA 4O23A 4C8FA 2OR4A 4BPWB 2ZEFA 5K8PA 4NGSA 3NH5A 2PCNA 2Q7SA 1TKJA 1QSOA 4C8CA 1LFWA 2AFWA 1Z9UA 1LANA 4R57A 4X2TA 2CNMA 3D4UA 2YJTA 2D4OA 1LRZA 4P4BA 3VRRA 3IFEA 4YRHA 4B13A 5HKZA 2H5MA 3D7FA 2Q51A 1JDBC 5AG6A 2RFHA 3PB8X 4ZI6A 4C2XA 5F9MA 4MHNA 3NOJA 1XOVA 2POKA 4KOWA 2YNCC 4F0YA 1H8LA 2PJAA 2JDCA 3PGPA 2XEIA 3R9GA 1HDUA 3U1BA 3SJGA 4WJBA 5GCNA 1ZL0A 5FVJA 1WWZA 4J3GA 2RC4A 3JRUA 4HNXB 4KLWA 5LYFA 2EZAA 3VRNA 1IICA 3BI0A 2X7BA 5HVGA 2FT0A 1IU8A 1BO4A 2Y0MA 4KOTA 4C9AA 3DGVA 2PJ6A 4KOVA 3VWDA 4C7HA 5IB0A 5J8FA 1ZG7A 4MRIA 4LQ6A 2WPXA 4CGOA 4ZYQA 1S7NA 3CT9A 2R82A 4UIBA 1EZAA 3BXMA 1TKFA 2O28A 4X5KA 1U6MA 4MI1A 3IWWA 4OC4A 2PJ4A 4MY0A 2HROA 4PXDA 3SR3A 3I1UA 2P6GA 2Q44A 3ISXA 3BLNA 4NGNA 3SI0A 4F9VA 3B3VA 4M6HA 3V7ZA 1RXTA 3QAYA 5IX3A 3PEIA 5HMNA 4COGA 1XRYA 4QVTA 3WC7A 4M6IA 5A28A 2B4DA 2EVNA 2PQ8A 4WWVA 5JPHA 2DLAA 4CYQA 1CM0A 4XPKA 4DYOA 1KWMA 1MJBA 1NMTA 2PJ3A 2ZW4A 3SJXA 3RBUA 3KZWA 1GYTA 3KQZA 4PXEA 5DS0A 1S3ZA 3BUOB 1ZG9A 2EWBA 2V8VA 1LOKA 2PDOA 4MHDA 4TJXA 3BUWB 3P2HA 4CDJA 3KKWA 4NSQA 4C8TA 4C9UA 1WVMA 4MBUA 3FIXA 4GS4A 2JBJA 2Y1MA 5CBMA 4CAWA 1A2ZA 2PR8A 1NSAA 4IAVA 3D67A 3IC1A 5AG5A 1Z8LA 2ARHA 3O8ZA 2PR1A 3IO1A 2G0BA 5E96A 4BD9A 4MHPA 4DNCA 4NGTA 3G3SA 1YMEA 3G23A 4C8AA 2YGWA 1Q2DA 4HKFA 3TO6A 5IB9A 1AMPA 3OB2B 1YX0A 1Z8XA 4A38A 2OB0A 3LODA 2Q4YA 4LUAA 5JYBA 4NJRA 1YGHA 4A33A 3IJ3A 2PJCA 5BY0A 5G1ZA 4AG7A 4C7IA 2RB7A 4AVCA 1X10A 4AXVA 4ZX8A 4P6YA 4CYPA 1XF1A 2B3UA 3ICUA 2JBKA 1VIXA 3SJFA 2PJBA 3FNCA 4UCMA 1HDQA 5H84A 3T05A 3HPGG 4NGMA 3B3SA 4CRYB 5LYLA 2HV2A 4UBRA 2FS5A 4COBA 3DLJA 2ZEPA 2OOTA 1PYTB 2P6EA 1FT7A 2QJ8A 4C68A 8CPAA 4IIYA 4P4JA 3D7HA 3TLZA 4C85A 2I00A 4JLYA 3PB6X 2VI7A 5HKYA 1Z8TA 4F9UA 3LACA 3FB3A 4B5PB 1VKCA 2CNTA 3D2PA 4PQAA 3GY9A 1NXJA 2VEZA 3FEEA 2VXKA 3B2YA 2FE7A 2J8NA 4GXHA 2JLMA 2K5TA 2BCOA 4H6UA 4M8DA 4FD6A 5LYDA 3PZJA 3D3SA 3CXPA 4KUBA 4KS9A 1Y9ZA 1M4IA 4CAXA 4B12A 4P4EA 2Z3OA 3C8OA 3T9YA 1ELMP 1XJOA 4C86A 1XE4A 4OADA 3I9SA 3DSBA 2IJZA 1S60A 1VGYA 2QYVA 4MJ8A 2R1IA 2ABZA 3BUNB 4R6TA 4ZY0A 1P4NA 1XMTA 3CZXA 4NGPA 1LAMA 2DEAA 2PJ1A 4UWIA 3W91A 4CYOA 4C8UA 2ZOGA 4PV6A 4OMEA 4OIWA 2AFUA 3SI2A 1M4DA 2ZEDA 2Z0ZA 3C26A 2WPWA 2ATRA 2DPTA 3DR6A 4M85A 5KTAA 1FNOA 1DIKA 3I6SA 3S6FA 2BUEA 5HVHA 3V38A 4OKOA 2GP4A 3VRQA 4U9ZA 5AG4A 4JZ0A 1CBXA 3U88C 3D7GA 2BEIA 3JVNA 2NSMA 2PJ5A 1S7LA 2REEA 3S9LA 3VARA 5IR2A 3KQXA 3OAKA 1R43A 3NA6A 1FBVA 4AVBA 2G3TA 3D2MA 2CBLA 1XMBA 4F8ZA 3BUXB 5KTCA 2DXQA 4A30A 4TJVA 5F1YA 5JM6A 1IGBA 4KSAA 1CS0B 3VH9A 3PLFB 4AVAA 4CDKA 4P10A 2UV8G 1GHEA 3TOAA 4U9YA 2D4PA 3ISZA 2ZPAA 3FH4A 4AG9A 2R98A 3EY5A 4E8OA 4NGRA 3I74A 1F2OA 2BO9A 4OC3A 1ARLA 2Z3PA 4MCQA 5F09A 2YNCA 3K4IA 3B3CA 4AB7A 1CP6A 2WYRA 3WABA 3MN8A 2PIZA 3EZEA 4NGQA 3JTKA 4F0XA 3PBBA 1RO5A 4J0NA 3T0TA 3BJ7A 3EXNA 2X0SA 1CPSA 2Z3NA 5J1QA 5K99A 1DTDA 2HQYA 2ZW6A 3H4QA 5G22A 1R57A 5DWNA 1EZBA 4LX9A 4BMHA 3GYAA 4FWUA 4CPAA 1KBLA 4KSIA 3V8IA 4B5PA 1ZLHA 2OLSA 2XEFA 2XEJA 2R7HA 1PCAA 4P45A 4FD4A 4Z65A 4FAIA 3GUXA 4OC2A 2AUNA 4R3LA 3IIBA 1Z5RA 1A9XB 2VZZA 2PJ7A 5HXDA 3H8GA 4IHMA 4II9A 5ISVA 1LAPA 1XBUA 4OLLA 3VGOA 3TX8A 5LRGA 4PSXA 5AXIA 2ZEEA 3EZAA 4JXRA 4RI1A 1Q2YA 2GREA 3GLJA 4DJLA 2JEVA 5I4MA 1LCPA 2GFQA 1Q5XA 3MGDA 4E5SA 3B3WA 1V6CA 1JQGA 1QSMA 2A4NA 1PU9A 2V77A 2NMTA 1B47A 1CP7A 1BLLE 3K9TA 3IWGA 2QIRA 4IK2A 2ZW5A 4UFVA 2FM4A 2HI6A 3NFZA 3KI9A 4Q7AA 1M44A 3B8GA 4MCRA 2V8DA 1ARMA 2Z11A 4NFRA 2C1CA 3R9EA 1Y0RA 3W6XA 1B87A 4KVME 5K8MA 4B11A 3BUMB 4MFPA 5BWAB 5J8CA 3IU2A 2VKZG 4Y49C 4LQGA 2Q04A 1CG2A 4NJQA 1WJTA 1WK4A 4R7MA 3CPXA 2ZELA 2PJ0A 3HLPA 4H6ZA 3SI1A 4ORFA 4I49A 5EMIA 3IEHA 5EC4A 1NSLA 3TLGB 2O53A 1CX8A 4L8AA 4UCNA 4A32A 4B14A 4KNGE 3KASA 2IL4A 4FUUA 4OIDA 2CF4A 3T07A 4CGNA 2F8HA 1ZLIA 5D8NA 1XIXA 4ZY2A 1R61A 1B6BA 4L89A 4C9VA 4TNUA 4CGLA 2BL1A 2DF5A 2C6GA 3KR5A 4K3NA 4QBJA 3FF3A 1YR0A 1IIDA 3KL9A 2BSWA 3E0KA 3BJ8A 3GIUA 4X3RA 4ZGYB 1I12A 2D0PA 1L0CA 4MHYA 1T36B 2GLFA 1I1DA 3FVLA 1EO0A 3TLBA 6CPAA
chains in the Genus database with same CATH topology
2ZENA 4A94A 3D66A 3CPAA 4G1PA 4MCSA 2AFZA 3GB0A 3S9NA 4OP4A 4RUHA 4FBEA 3QNVA 4R8FA 3CDXA 4MXUA 5JH9A 4MHZA 4R76A 1ELLP 1BPMA 5D29A 5JGFA 4MCPA 2F7VA 4X8IA 4C9RA 3PFOA 2PVVA 2AFMA 3LMSA 4P4FA 1QMUA 2Q4ZA 1F57A 2EK9A 4C84A 4PXCA 3PBEA 3B7IA 1BAVA 4P44A 1TKHA 3PB7X 3FEDA 2ANPA 5THWA 2VL1A 2ZEMA 1Y7EA 3SJEA 7CPAA 2V8GA 1F2PA 2C5QA 3FJUA 2ZEHA 2PJ9A 3WC5A 1Q7LA 3WT4A 5K8NA 2C6CA 3KGQA 1YLOA 4C99A 2JEWA 5K8OA 4OC1A 4GM5A 4P4DA 1Y0YA 3K2KA 4EFDA 1EE3P 4OC5A 4A39A 4YN3A 1IY7A 1YW4A 3FECA 2IMOA 3B35A 3KR4A 1DE4C 2ZOFA 3WC6A 3PFEA 2V8HA 2HC9A 1VHOA 2I3CA 4UIAA 3RAMA 1TF9A 4ONWA 1ZG8A 2O4HA 4UEEA 4W9YA 3KHXA 4ZY1A 3PB9X 1YSJA 4PPZA 1TF8A 2AFSA 4TWEA 3EIFA 3FMCA 3L2NA 4P4IA 2PIYA 4DUKA 4OC0A 1TXRA 3S9MA 2G9DA 3H8FA 2J9AA 2GLJA 3VTAA 2CTBA 3H8EA 2IQ6A 2GU2A 4YU9A 2AFOA 1QQ9A 1VHEA 1XFOA 3N5FA 1R3NA 2CIJA 1Z2LA 1BPNA 4EMEA 2NYQA 3BI1A 2CTCA 2PVWA 2PJ2A 5LYIA 2FVGA 3PB4X 4ZX9A 4C9EA 1M4LA 4A37A 1CPXA 1RTQA 3FX6A 3NH4A 1HEEA 2C6PA 2PE3A 4EWTA 4UF4A 1OBRA 3D68A 5CBMA 3BHXA 4UEZA 3MRUA 2EK8A 2QVPA 2PJ8A 4H2KA 5LRKA 4C8PA 2PRQA 4JYWA 4UEFA 3LWUA 2BOAA 2AFXA 3TC8A 5ELYA 3B3TA 3D7DA 2WZNA 2ZEGA 2ZEOA 4PXBA 1UWYA 2HB6A 2XEGA 3HUVA 3T8WA 1YW6A 5CPAA 1AYEA 2Q43A 3VATA 3NH8A 4B6ZA 1WVMA 3PRTA 3KHZA 5HVFA 4YWYA 3RZAA 2PCUA 4MMOA 4O23A 4C8FA 2OR4A 2ZEFA 5K8PA 4NGSA 3NH5A 1TKJA 4C8CA 1LFWA 2AFWA 4X2TA 1LANA 3D4UA 3IFEA 4P4BA 3D7FA 2Q51A 2RFHA 3PB8X 4ZI6A 4MHNA 2POKA 1H8LA 2PJAA 2XEIA 1HDUA 3SJGA 4WJBA 3JRUA 5LYFA 3BI0A 5HVGA 4C9AA 3DGVA 2PJ6A 1ZG7A 4MRIA 4ZYQA 3CT9A 4UIBA 3BXMA 1TKFA 3IWWA 4OC4A 2PJ4A 4PXDA 3I1UA 3ISXA 4NGNA 3SI0A 4F9VA 3B3VA 3V7ZA 3PEIA 1XRYA 3WC7A 4WWVA 4DYOA 1KWMA 2PJ3A 3SJXA 3RBUA 3KZWA 1GYTA 3KQZA 4PXEA 5DS0A 4DJLA 2V8VA 1ZG9A 2EWBA 1Y9ZA 1LOKA 4TJXA 4CDJA 4C8TA 4C9UA 2JBJA 1NSAA 4IAVA 3D67A 3IC1A 1Z8LA 3IO1A 4BD9A 4MHPA 4NGTA 1YMEA 4C8AA 5IB9A 1AMPA 4A38A 4NJRA 3IJ3A 2PJCA 2RB7A 4AXVA 4ZX8A 4P6YA 1XF1A 3ICUA 2JBKA 1VIXA 3SJFA 2PJBA 1HDQA 5LYLA 4NGMA 3B3SA 3DLJA 2ZEPA 2OOTA 1PYTB 1FT7A 2QJ8A 8CPAA 4C85A 4P4JA 3D7HA 3PB6X 4F9UA 4PQAA 3FEEA 3B2YA 2BCOA 5LYDA 4P4EA 1ELMP 1XJOA 4C86A 2IJZA 1VGYA 2QYVA 2ABZA 4R6TA 4ZY0A 4C8UA 4NGPA 1LAMA 2DEAA 2PJ1A 2ZOGA 3SI2A 4OMEA 4OIWA 2AFUA 2ZEDA 3I6SA 1FNOA 5HVHA 3V38A 4OKOA 2GP4A 4JZ0A 1CBXA 3D7GA 2NSMA 2PJ5A 3VARA 3S9LA 5IR2A 3KQXA 1R43A 3NA6A 4F8ZA 1XMBA 4TJVA 5JM6A 1IGBA 3VH9A 4CDKA 4P10A 3ISZA 3FH4A 3I74A 4NGRA 1F2OA 2BO9A 4OC3A 1ARLA 4MCQA 5F09A 3B3CA 1CP6A 2WYRA 3WABA 3MN8A 2PIZA 4NGQA 3PBBA 1CPSA 5J1QA 1DTDA 4FWUA 4CPAA 4KSIA 1ZLHA 2XEFA 2XEJA 1PCAA 4P45A 4Z65A 4FAIA 3GUXA 4OC2A 3IIBA 1Z5RA 2PJ7A 5HXDA 3H8GA 4IHMA 1LAPA 1XBUA 3TX8A 5LRGA 2ZEEA 2GREA 3GLJA 5I4MA 1LCPA 3B3WA 1V6CA 1JQGA 2V77A 5LRJA 1CP7A 3K9TA 1BLLE 4IK2A 3NFZA 3KI9A 4Q7AA 4MCRA 2V8DA 1ARMA 4NFRA 2C1CA 1Y0RA 5K8MA 4LQGA 1CG2A 4NJQA 4R7MA 3CPXA 2ZELA 2PJ0A 3HLPA 3SI1A 3IEHA 2O53A 1CX8A 4KNGE 3KASA 4FUUA 4OIDA 2CF4A 2F8HA 1ZLIA 5D8NA 4ZY2A 4C9VA 4TNUA 2C6GA 3KR5A 4K3NA 3FF3A 3KL9A 4X3RA 4MHYA 2GLFA 3FVLA 6CPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEN A;  4A94 A;  3D66 A;  3CPA A;  4G1P A;  4MCS A;  2AFZ A;  3GB0 A;  3S9N A;  4OP4 A;  4RUH A;  4FBE A;  3QNV A;  4R8F A;  3CDX A;  4MXU A;  5JH9 A;  4MHZ A;  4R76 A;  1ELL P;  1BPM A;  5D29 A;  5JGF A;  4MCP A;  2F7V A;  4X8I A;  4C9R A;  3PFO A;  2PVV A;  2AFM A;  3LMS A;  4P4F A;  1QMU A;  2Q4Z A;  1F57 A;  2EK9 A;  4C84 A;  4PXC A;  3PBE A;  3B7I A;  1BAV A;  4P44 A;  1TKH A;  3PB7 X;  3FED A;  2ANP A;  5THW A;  2VL1 A;  2ZEM A;  1Y7E A;  3SJE A;  7CPA A;  2V8G A;  1F2P A;  3FJU A;  2ZEH A;  2PJ9 A;  3WC5 A;  1Q7L A;  3WT4 A;  5K8N A;  2C6C A;  3KGQ A;  1YLO A;  4C99 A;  2JEW A;  5K8O A;  4OC1 A;  4GM5 A;  4P4D A;  1Y0Y A;  3K2K A;  4EFD A;  1EE3 P;  4OC5 A;  4A39 A;  4YN3 A;  1IY7 A;  1YW4 A;  3FEC A;  2IMO A;  3B35 A;  3KR4 A;  1DE4 C;  2ZOF A;  3WC6 A;  3PFE A;  2V8H A;  2HC9 A;  1VHO A;  2I3C A;  4UIA A;  3RAM A;  1TF9 A;  4ONW A;  1ZG8 A;  2O4H A;  4UEE A;  4W9Y A;  3KHX A;  4ZY1 A;  3PB9 X;  1YSJ A;  4PPZ A;  1TF8 A;  2AFS A;  4TWE A;  3EIF A;  3FMC A;  3L2N A;  4P4I A;  2PIY A;  4DUK A;  4OC0 A;  1TXR A;  3S9M A;  2G9D A;  3H8F A;  2J9A A;  2GLJ A;  3VTA A;  2CTB A;  3H8E A;  2IQ6 A;  2GU2 A;  4YU9 A;  2AFO A;  1QQ9 A;  1VHE A;  1XFO A;  3N5F A;  1R3N A;  2CIJ A;  1Z2L A;  1BPN A;  4EME A;  2NYQ A;  3BI1 A;  2CTC A;  2PVW A;  2PJ2 A;  5LYI A;  2FVG A;  3PB4 X;  4ZX9 A;  4C9E A;  1M4L A;  4A37 A;  1CPX A;  1RTQ A;  3FX6 A;  3NH4 A;  1HEE A;  2C6P A;  2PE3 A;  4EWT A;  4UF4 A;  1OBR A;  3D68 A;  5CBM A;  3BHX A;  4UEZ A;  3MRU A;  2EK8 A;  2QVP A;  2PJ8 A;  4H2K A;  5LRK A;  4C8P A;  2PRQ A;  4JYW A;  4UEF A;  3LWU A;  2BOA A;  2AFX A;  3TC8 A;  5ELY A;  3B3T A;  3D7D A;  2WZN A;  2ZEG A;  2ZEO A;  4PXB A;  1UWY A;  2HB6 A;  2XEG A;  3HUV A;  3T8W A;  1YW6 A;  5CPA A;  1AYE A;  2Q43 A;  3VAT A;  3NH8 A;  4B6Z A;  1WVM A;  3PRT A;  3KHZ A;  5HVF A;  4YWY A;  3RZA A;  2PCU A;  4MMO A;  4O23 A;  4C8F A;  2OR4 A;  2ZEF A;  5K8P A;  4NGS A;  3NH5 A;  1TKJ A;  4C8C A;  1LFW A;  2AFW A;  4X2T A;  1LAN A;  3D4U A;  3IFE A;  4P4B A;  3D7F A;  2Q51 A;  2RFH A;  3PB8 X;  4ZI6 A;  4MHN A;  2POK A;  1H8L A;  2PJA A;  2XEI A;  1HDU A;  3SJG A;  4WJB A;  3JRU A;  5LYF A;  3BI0 A;  5HVG A;  4C9A A;  3DGV A;  2PJ6 A;  1ZG7 A;  4MRI A;  4ZYQ A;  3CT9 A;  4UIB A;  3BXM A;  1TKF A;  3IWW A;  4OC4 A;  2PJ4 A;  4PXD A;  3I1U A;  3ISX A;  4NGN A;  3SI0 A;  4F9V A;  3B3V A;  3V7Z A;  3PEI A;  1XRY A;  3WC7 A;  4WWV A;  4DYO A;  1KWM A;  2PJ3 A;  3SJX A;  3RBU A;  3KZW A;  1GYT A;  3KQZ A;  4PXE A;  5DS0 A;  4DJL A;  2V8V A;  1ZG9 A;  2EWB A;  1Y9Z A;  1LOK A;  4TJX A;  4CDJ A;  4C8T A;  4C9U A;  2JBJ A;  1NSA A;  4IAV A;  3D67 A;  3IC1 A;  1Z8L A;  3IO1 A;  4BD9 A;  4MHP A;  4NGT A;  1YME A;  4C8A A;  5IB9 A;  1AMP A;  4A38 A;  4NJR A;  3IJ3 A;  2PJC A;  2RB7 A;  4AXV A;  4ZX8 A;  4P6Y A;  1XF1 A;  3ICU A;  2JBK A;  1VIX A;  3SJF A;  2PJB A;  1HDQ A;  5LYL A;  4NGM A;  3B3S A;  3DLJ A;  2ZEP A;  2OOT A;  1PYT B;  1FT7 A;  2QJ8 A;  8CPA A;  4C85 A;  4P4J A;  3D7H A;  3PB6 X;  4F9U A;  4PQA A;  3FEE A;  3B2Y A;  2BCO A;  5LYD A;  4P4E A;  1ELM P;  1XJO A;  4C86 A;  2IJZ A;  1VGY A;  2QYV A;  2ABZ A;  4R6T A;  4ZY0 A;  4C8U A;  4NGP A;  1LAM A;  2DEA A;  2PJ1 A;  2ZOG A;  3SI2 A;  4OME A;  4OIW A;  2AFU A;  2ZED A;  3I6S A;  1FNO A;  5HVH A;  3V38 A;  4OKO A;  4JZ0 A;  1CBX A;  3D7G A;  2NSM A;  2PJ5 A;  3VAR A;  3S9L A;  3KQX A;  1R43 A;  3NA6 A;  4F8Z A;  1XMB A;  4TJV A;  5JM6 A;  1IGB A;  3VH9 A;  4CDK A;  4P10 A;  3ISZ A;  3FH4 A;  3I74 A;  4NGR A;  1F2O A;  2BO9 A;  4OC3 A;  1ARL A;  4MCQ A;  5F09 A;  3B3C A;  1CP6 A;  2WYR A;  3WAB A;  3MN8 A;  2PIZ A;  4NGQ A;  3PBB A;  1CPS A;  5J1Q A;  1DTD A;  4FWU A;  4CPA A;  4KSI A;  1ZLH A;  2XEF A;  2XEJ A;  1PCA A;  4P45 A;  4Z65 A;  4FAI A;  3GUX A;  4OC2 A;  3IIB A;  1Z5R A;  2PJ7 A;  5HXD A;  3H8G A;  4IHM A;  1LAP A;  1XBU A;  3TX8 A;  5LRG A;  2ZEE A;  2GRE A;  3GLJ A;  5I4M A;  1LCP A;  3B3W A;  1V6C A;  1JQG A;  2V77 A;  5LRJ A;  1CP7 A;  3K9T A;  1BLL E;  4IK2 A;  3NFZ A;  3KI9 A;  4Q7A A;  4MCR A;  2V8D A;  1ARM A;  4NFR A;  2C1C A;  1Y0R A;  5K8M A;  4LQG A;  1CG2 A;  4NJQ A;  4R7M A;  3CPX A;  2ZEL A;  2PJ0 A;  3HLP A;  3SI1 A;  3IEH A;  2O53 A;  1CX8 A;  4KNG E;  3KAS A;  4FUU A;  4OID A;  2CF4 A;  2F8H A;  1ZLI A;  5D8N A;  4ZY2 A;  4C9V A;  4TNU A;  2C6G A;  3KR5 A;  4K3N A;  3FF3 A;  3KL9 A;  4X3R A;  4MHY A;  2GLF A;  3FVL A;  6CPA A; 
#chains in the Genus database with same CATH topology
 1ZRS A;  2ZEN A;  3D8P A;  4A94 A;  3D66 A;  5HKW A;  3CPA A;  2DIK A;  4UCP A;  1X12 A;  4U5Y A;  4CGM A;  1I21 A;  1KZF A;  4G1P A;  4MCS A;  2FL4 A;  3FXT A;  4INJ A;  2AFZ A;  3GB0 A;  5A27 A;  3FBU A;  3S9N A;  4OP4 A;  4RUH A;  4MFZ A;  1K4J A;  1KUY A;  3NE7 A;  3QNV A;  4R8F A;  3CDX A;  4MXU A;  4FBE A;  2AUM A;  2D0O A;  2AE6 A;  5JH9 A;  4PSW A;  4MHZ A;  3FYN A;  4R76 A;  2OZH A;  1ELL P;  3UY5 A;  1BPM A;  2ODF A;  3EO4 A;  3EFA A;  5D29 A;  3R1K A;  2OH1 A;  5JGF A;  1JDE A;  4MCP A;  1Y9K A;  1Z8W A;  2F7V A;  1IOF A;  1M4G A;  2WSA A;  4FD7 A;  4KOX A;  4K30 A;  4MFK A;  4X8I A;  3A9L A;  2YNE A;  3PFO A;  3QB8 A;  4C9R A;  2PVV A;  3OB1 B;  2AFM A;  1MJA A;  2FXF A;  3LMS A;  4P4F A;  1QMU A;  1AUG A;  4JXQ A;  2Q4Z A;  1F57 A;  2EK9 A;  4R87 A;  4C2Y A;  2EZB A;  3TOB A;  3OWC A;  4MY3 A;  4UA3 A;  2I79 A;  5F49 A;  3WR7 A;  4C84 A;  3OP0 A;  1YLE A;  4PXC A;  3PBE A;  1YRE A;  2OZG A;  1CE8 B;  2Z10 A;  1IYK A;  1BOB A;  1Z4E A;  2Z3L A;  3B7I A;  3RO0 A;  1BAV A;  4QB9 A;  4P44 A;  4UFX A;  5G20 A;  1TKH A;  3PB7 X;  3F9K C;  2FSR A;  3FED A;  2ANP A;  2DPS A;  2Z3M A;  4Y49 B;  2VL1 A;  5THW A;  4E2A A;  2JDD A;  4NXY A;  3TLE A;  4KVX A;  3VRO A;  2ZEM A;  1Y7E A;  3SJE A;  1Z4R A;  3DDD A;  3S6K A;  3NE8 A;  7CPA A;  3FRM A;  2B58 A;  2P0W A;  3R96 A;  3TO7 A;  3PFV A;  2C27 A;  1F2P A;  2V8G A;  1N71 A;  4M3S A;  3FJU A;  2ZEH A;  4NF1 A;  2C5Q A;  4A4C A;  4JJX A;  3G8W A;  4RN7 A;  2PJ9 A;  3P2F A;  4RS2 A;  3S6G A;  4ZBG A;  2CXA A;  1NE9 A;  1MK4 A;  2CY2 A;  3ZZI A;  2G3A A;  4Q38 A;  3WC5 A;  4B5O A;  1YVK A;  3SHP A;  1Q7L A;  5AG7 A;  4YFJ A;  4KUA A;  3H5Z A;  3VWE A;  3WT4 A;  5K8N A;  2C6C A;  3DR8 A;  3KGQ A;  1YQE A;  1YLO A;  1VBH A;  4C99 A;  4XPD C;  3QAH A;  2HWG A;  4KOY A;  2JEW A;  4PK3 A;  4XPL A;  1P0H A;  5K8O A;  2XPN A;  4HPS A;  4OC1 A;  2KCW A;  1VBG A;  3R95 A;  1S7K A;  4GM5 A;  4P4D A;  1Y0Y A;  2FIW A;  3K2K A;  2EBJ A;  4EFD A;  2XPP A;  1EE3 P;  2J8M A;  4OC5 A;  4UFW A;  1Q2C A;  1SQH A;  2ZW7 A;  1IY7 A;  1YW4 A;  4A39 A;  1VI4 A;  4YN3 A;  3FEC A;  4C2Z A;  5LRJ A;  3CXS A;  2F5I A;  5G21 A;  2N3A B;  2IMO A;  4H1H A;  3B35 A;  2PSW A;  3KR4 A;  3IU1 A;  5F47 A;  1DE4 C;  3SXN A;  4BBH A;  1KC7 A;  5JQ4 A;  1PUA A;  2ZOF A;  1YVH A;  3F5B A;  3WC6 A;  4IIX A;  1KUV A;  3PFE A;  5EBV A;  2EUI A;  4CO9 A;  3TLG A;  2V8H A;  4XNH C;  2HC9 A;  2Y1N A;  1VHO A;  5C88 A;  1Y7R A;  4RR2 B;  1QSN A;  2I3C A;  4UIA A;  2GIV A;  3RAM A;  3S6H A;  3TO9 A;  1J4J A;  1TF9 A;  4OAE A;  4ONW A;  1ZG8 A;  3K9U A;  3F0A A;  4FD5 A;  3ZJ0 A;  4QC6 A;  2QML A;  5JVL A;  5KTD A;  3TYX A;  1FY7 A;  4CAE A;  2O4H A;  3TT2 A;  4UEE A;  3RNZ A;  2E28 A;  2OZU A;  5C82 A;  3GKR A;  1VHS A;  4W9Y A;  4MFJ A;  4KOU A;  1ON0 A;  3KHX A;  1KEE B;  4ZY1 A;  3PB9 X;  3W6S A;  1YSJ A;  4PPZ A;  1TF8 A;  1XF8 A;  1IYL A;  5DWM A;  2AFS A;  4R3K A;  1IB1 E;  4TWE A;  3FMC A;  3L2N A;  4P4I A;  3EIF A;  3VRP A;  4JD6 A;  2PIY A;  3I3G A;  4DUK A;  4OC0 A;  1TXR A;  2WUU A;  5HH1 A;  2PRB A;  4A4B A;  3LD2 A;  2YJV A;  3PT1 A;  3S9M A;  4CS0 B;  1S7F A;  3N7Z A;  5J3X A;  2HUZ A;  2G9D A;  3H8F A;  3IGR A;  2XPO A;  4QUS A;  3DNS A;  2J9A A;  4A31 A;  3CXQ A;  4GPL B;  1M1D A;  2GLJ A;  3VTA A;  2CTB A;  5CNP A;  3SXO A;  3H8E A;  2IQ6 A;  3IWE A;  2GU2 A;  4XPD B;  4YU9 A;  2AFO A;  1QQ9 A;  1VHE A;  2PC1 A;  1XFO A;  2B5G B;  1BXR B;  1XEB A;  3N5F A;  4KVO E;  3T90 A;  2EZC A;  5AGE A;  1QSR A;  1IOI A;  4KZT A;  1ZYM A;  5F46 A;  1R3N A;  2CIJ A;  1V0C A;  3TLA A;  2OU2 A;  4B10 A;  1Z2L A;  5IV0 A;  1BPN A;  4EME A;  1CJW A;  3NFQ A;  2NYQ A;  3BI1 A;  2CTC A;  2PVW A;  4F6A A;  2GE3 A;  2PJ2 A;  4UWJ A;  4CYN A;  4E0A A;  2Z3K A;  5LYI A;  1C3O B;  1GGO A;  3T5M A;  4KLV A;  1M6V B;  2Q7B A;  3RYO A;  2FVG A;  2QEC A;  3PB4 X;  4E94 A;  4ZX9 A;  4XNH B;  2B4J C;  4C9E A;  1M4L A;  4A37 A;  4MI4 A;  4JWP A;  5F13 A;  2B3V A;  2VQY A;  4PK2 A;  5FD8 A;  4HNY B;  4KOS A;  3HMJ G;  2REF A;  4M6G A;  4H89 A;  5F5X A;  4IUS A;  2FCK A;  4A2Z A;  1CPX A;  1RTQ A;  3R9F A;  2R8V A;  1UFH A;  3FX6 A;  3TE4 A;  4A95 A;  4NCZ A;  3NH4 A;  3EZB A;  2AJ6 A;  1HEE A;  3ZNI A;  2C6P A;  2PE3 A;  1S5K A;  4EWT A;  3TFY A;  3TCV A;  3JUW A;  1OZP A;  4MFL A;  2Q0Y A;  4MJX A;  1Z9E A;  4IF5 A;  4UF4 A;  1QST A;  4JVO A;  1OBR A;  4EYS A;  1JWQ A;  1KUX A;  3D68 A;  3BHX A;  2CNS A;  3MRU A;  4KOR A;  4UEZ A;  3TTH A;  2EK8 A;  2QVP A;  4BPX B;  2PJ8 A;  4H2K A;  4BTF A;  3F8K A;  4CAF A;  5LRK A;  1NBW A;  4C8P A;  2PRQ A;  2P6F A;  1C30 B;  1ZO0 A;  1Y9W A;  4EVY A;  3HPH E;  2YND A;  4JYW A;  4ONU A;  4UEF A;  3LWU A;  4CZ1 A;  2FIA A;  4KSF A;  2BOA A;  4NEX A;  5I0C A;  2AFX A;  3GJZ A;  3PP9 A;  2VBQ A;  3KRV A;  3TC8 A;  3TLY A;  2B5G A;  5ELY A;  3B3T A;  2J8R A;  3D7D A;  2WZN A;  2MP0 A;  1YK3 A;  4CGP A;  2ZEG A;  2ZEO A;  3EC4 A;  4PXB A;  4YGO A;  4Q36 A;  1UWY A;  2EO8 A;  2VZY A;  1YVO A;  2XEG A;  2HB6 A;  3HUV A;  4HNW B;  3T8W A;  2GAN A;  4BIN A;  1YW6 A;  5CPA A;  1AYE A;  2Q4V A;  2XPL A;  3TLC A;  2Q43 A;  1MJ9 A;  4BPU B;  2B4B A;  4R9M A;  3NH8 A;  3VAT A;  4B6Z A;  2B4D B;  4CRZ B;  1J3L A;  3PRT A;  4CAV A;  3KHZ A;  5F48 A;  5H86 A;  4YWY A;  5HVF A;  1TIQ A;  2ZXV A;  2B0A A;  3RZA A;  2PCU A;  4MMO A;  4MFQ A;  4O23 A;  4C8F A;  2OR4 A;  4BPW B;  2ZEF A;  5K8P A;  4NGS A;  3NH5 A;  2PCN A;  2Q7S A;  1TKJ A;  1QSO A;  4C8C A;  1LFW A;  2AFW A;  1Z9U A;  1LAN A;  4R57 A;  4X2T A;  2CNM A;  3D4U A;  2YJT A;  2D4O A;  1LRZ A;  4P4B A;  3VRR A;  3IFE A;  4YRH A;  4B13 A;  5HKZ A;  2H5M A;  3D7F A;  2Q51 A;  1JDB C;  5AG6 A;  2RFH A;  3PB8 X;  4ZI6 A;  4C2X A;  5F9M A;  4MHN A;  3NOJ A;  1XOV A;  2POK A;  4KOW A;  2YNC C;  4F0Y A;  1H8L A;  2PJA A;  2JDC A;  3PGP A;  2XEI A;  3R9G A;  1HDU A;  3U1B A;  3SJG A;  4WJB A;  5GCN A;  1ZL0 A;  5FVJ A;  1WWZ A;  4J3G A;  2RC4 A;  3JRU A;  4HNX B;  4KLW A;  5LYF A;  2EZA A;  3VRN A;  1IIC A;  3BI0 A;  2X7B A;  5HVG A;  2FT0 A;  1IU8 A;  1BO4 A;  2Y0M A;  4KOT A;  4C9A A;  3DGV A;  2PJ6 A;  4KOV A;  3VWD A;  4C7H A;  5IB0 A;  5J8F A;  1ZG7 A;  4MRI A;  4LQ6 A;  2WPX A;  4CGO A;  4ZYQ A;  1S7N A;  3CT9 A;  2R82 A;  4UIB A;  1EZA A;  3BXM A;  1TKF A;  2O28 A;  4X5K A;  1U6M A;  4MI1 A;  3IWW A;  4OC4 A;  2PJ4 A;  4MY0 A;  2HRO A;  4PXD A;  3SR3 A;  3I1U A;  2P6G A;  2Q44 A;  3ISX A;  3BLN A;  4NGN A;  3SI0 A;  4F9V A;  3B3V A;  4M6H A;  3V7Z A;  1RXT A;  3QAY A;  5IX3 A;  3PEI A;  5HMN A;  4COG A;  1XRY A;  4QVT A;  3WC7 A;  4M6I A;  5A28 A;  2B4D A;  2EVN A;  2PQ8 A;  4WWV A;  5JPH A;  2DLA A;  4CYQ A;  1CM0 A;  4XPK A;  4DYO A;  1KWM A;  1MJB A;  1NMT A;  2PJ3 A;  2ZW4 A;  3SJX A;  3RBU A;  3KZW A;  1GYT A;  3KQZ A;  4PXE A;  5DS0 A;  1S3Z A;  3BUO B;  1ZG9 A;  2EWB A;  2V8V A;  1LOK A;  2PDO A;  4MHD A;  4TJX A;  3BUW B;  3P2H A;  4CDJ A;  3KKW A;  4NSQ A;  4C8T A;  4C9U A;  1WVM A;  4MBU A;  3FIX A;  4GS4 A;  2JBJ A;  2Y1M A;  5CBM A;  4CAW A;  1A2Z A;  2PR8 A;  1NSA A;  4IAV A;  3D67 A;  3IC1 A;  5AG5 A;  1Z8L A;  2ARH A;  3O8Z A;  2PR1 A;  3IO1 A;  2G0B A;  5E96 A;  4BD9 A;  4MHP A;  4DNC A;  4NGT A;  3G3S A;  1YME A;  3G23 A;  4C8A A;  2YGW A;  1Q2D A;  4HKF A;  3TO6 A;  5IB9 A;  1AMP A;  3OB2 B;  1YX0 A;  1Z8X A;  4A38 A;  2OB0 A;  3LOD A;  2Q4Y A;  4LUA A;  5JYB A;  4NJR A;  1YGH A;  4A33 A;  3IJ3 A;  2PJC A;  5BY0 A;  5G1Z A;  4AG7 A;  4C7I A;  2RB7 A;  4AVC A;  1X10 A;  4AXV A;  4ZX8 A;  4P6Y A;  4CYP A;  1XF1 A;  2B3U A;  3ICU A;  2JBK A;  1VIX A;  3SJF A;  2PJB A;  3FNC A;  4UCM A;  1HDQ A;  5H84 A;  3T05 A;  3HPG G;  4NGM A;  3B3S A;  4CRY B;  5LYL A;  2HV2 A;  4UBR A;  2FS5 A;  4COB A;  3DLJ A;  2ZEP A;  2OOT A;  1PYT B;  2P6E A;  1FT7 A;  2QJ8 A;  4C68 A;  8CPA A;  4IIY A;  4P4J A;  3D7H A;  3TLZ A;  4C85 A;  2I00 A;  4JLY A;  3PB6 X;  2VI7 A;  5HKY A;  1Z8T A;  4F9U A;  3LAC A;  3FB3 A;  4B5P B;  1VKC A;  2CNT A;  3D2P A;  4PQA A;  3GY9 A;  1NXJ A;  2VEZ A;  3FEE A;  2VXK A;  3B2Y A;  2FE7 A;  2J8N A;  4GXH A;  2JLM A;  2K5T A;  2BCO A;  4H6U A;  4M8D A;  4FD6 A;  5LYD A;  3PZJ A;  3D3S A;  3CXP A;  4KUB A;  4KS9 A;  1Y9Z A;  1M4I A;  4CAX A;  4B12 A;  4P4E A;  2Z3O A;  3C8O A;  3T9Y A;  1ELM P;  1XJO A;  4C86 A;  1XE4 A;  4OAD A;  3I9S A;  3DSB A;  2IJZ A;  1S60 A;  1VGY A;  2QYV A;  4MJ8 A;  2R1I A;  2ABZ A;  3BUN B;  4R6T A;  4ZY0 A;  1P4N A;  1XMT A;  3CZX A;  4NGP A;  1LAM A;  2DEA A;  2PJ1 A;  4UWI A;  3W91 A;  4CYO A;  4C8U A;  2ZOG A;  4PV6 A;  4OME A;  4OIW A;  2AFU A;  3SI2 A;  1M4D A;  2ZED A;  2Z0Z A;  3C26 A;  2WPW A;  2ATR A;  2DPT A;  3DR6 A;  4M85 A;  5KTA A;  1FNO A;  1DIK A;  3I6S A;  3S6F A;  2BUE A;  5HVH A;  3V38 A;  4OKO A;  2GP4 A;  3VRQ A;  4U9Z A;  5AG4 A;  4JZ0 A;  1CBX A;  3U88 C;  3D7G A;  2BEI A;  3JVN A;  2NSM A;  2PJ5 A;  1S7L A;  2REE A;  3S9L A;  3VAR A;  5IR2 A;  3KQX A;  3OAK A;  1R43 A;  3NA6 A;  1FBV A;  4AVB A;  2G3T A;  3D2M A;  2CBL A;  1XMB A;  4F8Z A;  3BUX B;  5KTC A;  2DXQ A;  4A30 A;  4TJV A;  5F1Y A;  5JM6 A;  1IGB A;  4KSA A;  1CS0 B;  3VH9 A;  3PLF B;  4AVA A;  4CDK A;  4P10 A;  2UV8 G;  1GHE A;  3TOA A;  4U9Y A;  2D4P A;  3ISZ A;  2ZPA A;  3FH4 A;  4AG9 A;  2R98 A;  3EY5 A;  4E8O A;  4NGR A;  3I74 A;  1F2O A;  2BO9 A;  4OC3 A;  1ARL A;  2Z3P A;  4MCQ A;  5F09 A;  2YNC A;  3K4I A;  3B3C A;  4AB7 A;  1CP6 A;  2WYR A;  3WAB A;  3MN8 A;  2PIZ A;  3EZE A;  4NGQ A;  3JTK A;  4F0X A;  3PBB A;  1RO5 A;  4J0N A;  3T0T A;  3BJ7 A;  3EXN A;  2X0S A;  1CPS A;  2Z3N A;  5J1Q A;  5K99 A;  1DTD A;  2HQY A;  2ZW6 A;  3H4Q A;  5G22 A;  1R57 A;  5DWN A;  1EZB A;  4LX9 A;  4BMH A;  3GYA A;  4FWU A;  4CPA A;  1KBL A;  4KSI A;  3V8I A;  4B5P A;  1ZLH A;  2OLS A;  2XEF A;  2XEJ A;  2R7H A;  1PCA A;  4P45 A;  4FD4 A;  4Z65 A;  4FAI A;  3GUX A;  4OC2 A;  2AUN A;  4R3L A;  3IIB A;  1Z5R A;  1A9X B;  2VZZ A;  2PJ7 A;  5HXD A;  3H8G A;  4IHM A;  4II9 A;  5ISV A;  1LAP A;  1XBU A;  4OLL A;  3VGO A;  3TX8 A;  5LRG A;  4PSX A;  5AXI A;  2ZEE A;  3EZA A;  4JXR A;  4RI1 A;  1Q2Y A;  2GRE A;  3GLJ A;  4DJL A;  2JEV A;  5I4M A;  1LCP A;  2GFQ A;  1Q5X A;  3MGD A;  4E5S A;  3B3W A;  1V6C A;  1JQG A;  1QSM A;  2A4N A;  1PU9 A;  2V77 A;  2NMT A;  1B47 A;  1CP7 A;  1BLL E;  3K9T A;  3IWG A;  2QIR A;  4IK2 A;  2ZW5 A;  4UFV A;  2FM4 A;  2HI6 A;  3NFZ A;  3KI9 A;  4Q7A A;  1M44 A;  3B8G A;  4MCR A;  2V8D A;  1ARM A;  2Z11 A;  4NFR A;  2C1C A;  3R9E A;  1Y0R A;  3W6X A;  1B87 A;  4KVM E;  5K8M A;  4B11 A;  3BUM B;  4MFP A;  5BWA B;  5J8C A;  3IU2 A;  2VKZ G;  4Y49 C;  4LQG A;  2Q04 A;  1CG2 A;  4NJQ A;  1WJT A;  1WK4 A;  4R7M A;  3CPX A;  2ZEL A;  2PJ0 A;  3HLP A;  4H6Z A;  3SI1 A;  4ORF A;  4I49 A;  5EMI A;  3IEH A;  5EC4 A;  1NSL A;  3TLG B;  2O53 A;  1CX8 A;  4L8A A;  4UCN A;  4A32 A;  4B14 A;  4KNG E;  3KAS A;  2IL4 A;  4FUU A;  4OID A;  2CF4 A;  3T07 A;  4CGN A;  2F8H A;  1ZLI A;  5D8N A;  1XIX A;  4ZY2 A;  1R61 A;  1B6B A;  4L89 A;  4C9V A;  4TNU A;  4CGL A;  2BL1 A;  2DF5 A;  2C6G A;  3KR5 A;  4K3N A;  4QBJ A;  3FF3 A;  1YR0 A;  1IID A;  3KL9 A;  2BSW A;  3E0K A;  3BJ8 A;  3GIU A;  4X3R A;  4ZGY B;  1I12 A;  2D0P A;  1L0C A;  4MHY A;  1T36 B;  2GLF A;  1I1D A;  3FVL A;  1EO0 A;  3TLB A;  6CPA A; 
#chains in the Genus database with same CATH homology
 2ZEN A;  4A94 A;  3D66 A;  3CPA A;  4G1P A;  4MCS A;  2AFZ A;  3GB0 A;  3S9N A;  4OP4 A;  4RUH A;  4FBE A;  3QNV A;  4R8F A;  3CDX A;  4MXU A;  5JH9 A;  4MHZ A;  4R76 A;  1ELL P;  1BPM A;  5D29 A;  5JGF A;  4MCP A;  2F7V A;  4X8I A;  4C9R A;  3PFO A;  2PVV A;  2AFM A;  3LMS A;  4P4F A;  1QMU A;  2Q4Z A;  1F57 A;  2EK9 A;  4C84 A;  4PXC A;  3PBE A;  3B7I A;  1BAV A;  4P44 A;  1TKH A;  3PB7 X;  3FED A;  2ANP A;  5THW A;  2VL1 A;  2ZEM A;  1Y7E A;  3SJE A;  7CPA A;  2V8G A;  1F2P A;  2C5Q A;  3FJU A;  2ZEH A;  2PJ9 A;  3WC5 A;  1Q7L A;  3WT4 A;  5K8N A;  2C6C A;  3KGQ A;  1YLO A;  4C99 A;  2JEW A;  5K8O A;  4OC1 A;  4GM5 A;  4P4D A;  1Y0Y A;  3K2K A;  4EFD A;  1EE3 P;  4OC5 A;  4A39 A;  4YN3 A;  1IY7 A;  1YW4 A;  3FEC A;  2IMO A;  3B35 A;  3KR4 A;  1DE4 C;  2ZOF A;  3WC6 A;  3PFE A;  2V8H A;  2HC9 A;  1VHO A;  2I3C A;  4UIA A;  3RAM A;  1TF9 A;  4ONW A;  1ZG8 A;  2O4H A;  4UEE A;  4W9Y A;  3KHX A;  4ZY1 A;  3PB9 X;  1YSJ A;  4PPZ A;  1TF8 A;  2AFS A;  4TWE A;  3EIF A;  3FMC A;  3L2N A;  4P4I A;  2PIY A;  4DUK A;  4OC0 A;  1TXR A;  3S9M A;  2G9D A;  3H8F A;  2J9A A;  2GLJ A;  3VTA A;  2CTB A;  3H8E A;  2IQ6 A;  2GU2 A;  4YU9 A;  2AFO A;  1QQ9 A;  1VHE A;  1XFO A;  3N5F A;  1R3N A;  2CIJ A;  1Z2L A;  1BPN A;  4EME A;  2NYQ A;  3BI1 A;  2CTC A;  2PVW A;  2PJ2 A;  5LYI A;  2FVG A;  3PB4 X;  4ZX9 A;  4C9E A;  1M4L A;  4A37 A;  1CPX A;  1RTQ A;  3FX6 A;  3NH4 A;  1HEE A;  2C6P A;  2PE3 A;  4EWT A;  4UF4 A;  1OBR A;  3D68 A;  5CBM A;  3BHX A;  4UEZ A;  3MRU A;  2EK8 A;  2QVP A;  2PJ8 A;  4H2K A;  5LRK A;  4C8P A;  2PRQ A;  4JYW A;  4UEF A;  3LWU A;  2BOA A;  2AFX A;  3TC8 A;  5ELY A;  3B3T A;  3D7D A;  2WZN A;  2ZEG A;  2ZEO A;  4PXB A;  1UWY A;  2HB6 A;  2XEG A;  3HUV A;  3T8W A;  1YW6 A;  5CPA A;  1AYE A;  2Q43 A;  3VAT A;  3NH8 A;  4B6Z A;  1WVM A;  3PRT A;  3KHZ A;  5HVF A;  4YWY A;  3RZA A;  2PCU A;  4MMO A;  4O23 A;  4C8F A;  2OR4 A;  2ZEF A;  5K8P A;  4NGS A;  3NH5 A;  1TKJ A;  4C8C A;  1LFW A;  2AFW A;  4X2T A;  1LAN A;  3D4U A;  3IFE A;  4P4B A;  3D7F A;  2Q51 A;  2RFH A;  3PB8 X;  4ZI6 A;  4MHN A;  2POK A;  1H8L A;  2PJA A;  2XEI A;  1HDU A;  3SJG A;  4WJB A;  3JRU A;  5LYF A;  3BI0 A;  5HVG A;  4C9A A;  3DGV A;  2PJ6 A;  1ZG7 A;  4MRI A;  4ZYQ A;  3CT9 A;  4UIB A;  3BXM A;  1TKF A;  3IWW A;  4OC4 A;  2PJ4 A;  4PXD A;  3I1U A;  3ISX A;  4NGN A;  3SI0 A;  4F9V A;  3B3V A;  3V7Z A;  3PEI A;  1XRY A;  3WC7 A;  4WWV A;  4DYO A;  1KWM A;  2PJ3 A;  3SJX A;  3RBU A;  3KZW A;  1GYT A;  3KQZ A;  4PXE A;  5DS0 A;  4DJL A;  2V8V A;  1ZG9 A;  2EWB A;  1Y9Z A;  1LOK A;  4TJX A;  4CDJ A;  4C8T A;  4C9U A;  2JBJ A;  1NSA A;  4IAV A;  3D67 A;  3IC1 A;  1Z8L A;  3IO1 A;  4BD9 A;  4MHP A;  4NGT A;  1YME A;  4C8A A;  5IB9 A;  1AMP A;  4A38 A;  4NJR A;  3IJ3 A;  2PJC A;  2RB7 A;  4AXV A;  4ZX8 A;  4P6Y A;  1XF1 A;  3ICU A;  2JBK A;  1VIX A;  3SJF A;  2PJB A;  1HDQ A;  5LYL A;  4NGM A;  3B3S A;  3DLJ A;  2ZEP A;  2OOT A;  1PYT B;  1FT7 A;  2QJ8 A;  8CPA A;  4C85 A;  4P4J A;  3D7H A;  3PB6 X;  4F9U A;  4PQA A;  3FEE A;  3B2Y A;  2BCO A;  5LYD A;  4P4E A;  1ELM P;  1XJO A;  4C86 A;  2IJZ A;  1VGY A;  2QYV A;  2ABZ A;  4R6T A;  4ZY0 A;  4C8U A;  4NGP A;  1LAM A;  2DEA A;  2PJ1 A;  2ZOG A;  3SI2 A;  4OME A;  4OIW A;  2AFU A;  2ZED A;  3I6S A;  1FNO A;  5HVH A;  3V38 A;  4OKO A;  2GP4 A;  4JZ0 A;  1CBX A;  3D7G A;  2NSM A;  2PJ5 A;  3VAR A;  3S9L A;  5IR2 A;  3KQX A;  1R43 A;  3NA6 A;  4F8Z A;  1XMB A;  4TJV A;  5JM6 A;  1IGB A;  3VH9 A;  4CDK A;  4P10 A;  3ISZ A;  3FH4 A;  3I74 A;  4NGR A;  1F2O A;  2BO9 A;  4OC3 A;  1ARL A;  4MCQ A;  5F09 A;  3B3C A;  1CP6 A;  2WYR A;  3WAB A;  3MN8 A;  2PIZ A;  4NGQ A;  3PBB A;  1CPS A;  5J1Q A;  1DTD A;  4FWU A;  4CPA A;  4KSI A;  1ZLH A;  2XEF A;  2XEJ A;  1PCA A;  4P45 A;  4Z65 A;  4FAI A;  3GUX A;  4OC2 A;  3IIB A;  1Z5R A;  2PJ7 A;  5HXD A;  3H8G A;  4IHM A;  1LAP A;  1XBU A;  3TX8 A;  5LRG A;  2ZEE A;  2GRE A;  3GLJ A;  5I4M A;  1LCP A;  3B3W A;  1V6C A;  1JQG A;  2V77 A;  5LRJ A;  1CP7 A;  3K9T A;  1BLL E;  4IK2 A;  3NFZ A;  3KI9 A;  4Q7A A;  4MCR A;  2V8D A;  1ARM A;  4NFR A;  2C1C A;  1Y0R A;  5K8M A;  4LQG A;  1CG2 A;  4NJQ A;  4R7M A;  3CPX A;  2ZEL A;  2PJ0 A;  3HLP A;  3SI1 A;  3IEH A;  2O53 A;  1CX8 A;  4KNG E;  3KAS A;  4FUU A;  4OID A;  2CF4 A;  2F8H A;  1ZLI A;  5D8N A;  4ZY2 A;  4C9V A;  4TNU A;  2C6G A;  3KR5 A;  4K3N A;  3FF3 A;  3KL9 A;  4X3R A;  4MHY A;  2GLF A;  3FVL A;  6CPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...