2C6PA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with phosphate anion
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
694
structure length
677
Chain Sequence
b'NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Glutamate Carboxypeptidase II, a Drug Target in Neuronal Damage and Prostate Cancer.
pubmed doi rcsb
molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
source organism Homo sapiens
molecule tags Hydrolase
total genus 227
structure length 677
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2c6pA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2c6pA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c6pA02
4C8CA 3NA6A 5LRKA 5F09A 4NGRA 5CBMA 3B3CA 3GB0A 2CF4A 3MRUA 5ELYA 4ZI6A 3PBBA 2PIZA 1LOKA 4MRIA 1Z8LA 3FECA 4DJLA 3LWUA 1YSJA 4P4JA 4UF4A 4IHMA 4MCQA 3H8GA 2XEGA 4A38A 4F9UA 2C6GA 2ZENA 1Z5RA 3N5FA 3VTAA 1R43A 2ANPA 1XF1A 1EE3P 3V38A 4CPAA 4X8IA 1BAVA 2EWBA 3RZAA 4C99A 2ABZA 4ZX8A 1CP6A 2V77A 1IGBA 1QMUA 4C86A 4MCRA 5JGFA 4C9UA 3H8FA 1YMEA 1XJOA 2G9DA 4EWTA 2RB7A 4CDKA 3CPXA 1TKHA 4C9VA 2PJ3A 3IO1A 1NSAA 3PRTA 5JM6A 3FMCA 4P4EA 3RAMA 4KSIA 1TXRA 4LQGA 1GYTA 2ZEEA 3GUXA 3VH9A 1LAPA 3KR4A 4ONWA 4PXCA 4TJXA 2OOTA 3KGQA 4C8UA 5LYFA 2JEWA 5D8NA 3NH5A 3ISXA 3S9LA 3HUVA 2XEFA 3FF3A 2QYVA 1PCAA 2ZEFA 3KI9A 3CPAA 4R7MA 3TC8A 3B7IA 3I6SA 5K8MA 3B3WA 4P4IA 1F2PA 2ZOGA 5J1QA 3ICUA 2NSMA 2RFHA 1TF8A 1BPNA 4C9AA 4MCSA 3DGVA 2OR4A 4TWEA 1YW6A 1VHEA 1CPSA 1LCPA 4FAIA 5JH9A 2PJ1A 4A94A 2NYQA 3PBEA 3SJEA 3WABA 3FEDA 4C8PA 1Y7EA 2ZEPA 4ZY0A 3PB7X 2Q43A 4MHPA 1HEEA 1YW4A 4MXUA 3B2YA 3IC1A 2PJCA 4PPZA 3VARA 4NGPA 3PB6X 2BOAA 5LYIA 4P4FA 1UWYA 2BCOA 2WZNA 5HVFA 3IEHA 5HVHA 2ZEHA 2PJ6A 3SJXA 3H8EA 3S9MA 4RUHA 4JYWA 3IIBA 1RTQA 1YLOA 2PJ9A 2O4HA 5LYDA 4EMEA 3KQXA 4C9RA 3LMSA 4C85A 2O53A 3KHZA 4R76A 1TF9A 4NGTA 2POKA 4OKOA 4FWUA 4X2TA 1BPMA 4ZYQA 4NGSA 3I1UA 2FVGA 4IAVA 2AFUA 3TX8A 5I4MA 3I74A 4MHNA 1VIXA 1CP7A 1QQ9A 4UEEA 2HB6A 1FT7A 2PJ7A 4UIBA 4P4BA 3B3SA 5DS0A 3SJFA 3CDXA 4Q7AA 2AFXA 1Q7LA 2BO9A 1FNOA 3BI0A 2ZELA 4PXDA 5IB9A 4NGNA 4OC4A 4DUKA 1ARMA 2Q51A 3D7GA 1LANA 2PJAA 3BXMA 4TNUA 3KASA 1Z2LA 2JBJA 2CTCA 5THWA 5D29A 3WC7A 4KNGE 4P10A 4C84A 4YU9A 4C8TA 2C6PA 3NH4A 4Z65A 3FX6A 4PXBA 1BLLE 2GLJA 3D68A 3B3TA 2AFZA 2Q4ZA 5LRGA 4C9EA 2PVVA 1ZLHA 3FEEA 4BD9A 1Y9ZA 1CG2A 3B3VA 2PJ4A 1VGYA 2AFMA 4X3RA 3MN8A 2ZEOA 2PVWA 4EFDA 3CT9A 3IFEA 3WT4A 2V8GA 2JBKA 4UEFA 2F8HA 4MMOA 4P4DA 4NFRA 1R3NA 2ZEGA 1LFWA 4OC0A 8CPAA 3KQZA 2ZEDA 1AMPA 4O23A 1CX8A 1VHOA 4NGMA 2GLFA 1AYEA 2CIJA 1F57A 1ZLIA 1LAMA 4GM5A 1XBUA 4ZY2A 2WYRA 1ZG8A 1Y0YA 1ZG9A 1F2OA 2PIYA 2ZOFA 3BHXA 4OIWA 3QNVA 3S9NA 2C6CA 3KHXA 4CDJA 4ZY1A 3PFOA 2XEJA 3JRUA 3D7FA 3V7ZA 2C1CA 4FUUA 4PXEA 3D7HA 4R6TA 4WWVA 1TKFA 2PJ5A 2PRQA 3VATA 3B35A 2PCUA 1ZG7A 4A39A 4B6ZA 3K2KA 4WJBA 3PB4X 5HXDA 2PJ2A 3FVLA 3KZWA 2CTBA 4MHYA 4ZX9A 2I3CA 5LYLA 3PFEA 4R8FA 5CPAA 4TJVA 2IQ6A 2QVPA 3DLJA 1PYTB 4F8ZA 2VL1A 3FJUA 5HVGA 4JZ0A 4OIDA 2AFOA 4UEZA 4AXVA 2IJZA 4YN3A 4OP4A 2EK9A 4W9YA 1CBXA 3NH8A 3RBUA 3PEIA 1V6CA 2F7VA 3D67A 2DEAA 1H8LA 2AFWA 1JQGA 1XRYA 3BI1A 3IJ3A 3ISZA 3SI0A 1OBRA 4OC1A 4A37A 1CPXA 1ARLA 5K8OA 3KL9A 3WC5A 4NGQA 2EK8A 4MCPA 3IWWA 4IK2A 4G1PA 5LRJA 3GLJA 4FBEA 4K3NA 1M4LA 3SI1A 2V8DA 3WC6A 1KWMA 4C8FA 4OMEA 4NJQA 4F9VA 2GREA 1HDUA 2GU2A 2PJ0A 3D7DA 1Y0RA 3NFZA 3EIFA 1XFOA 1ELMP 4OC5A 1HDQA 1ELLP 4PQAA 3K9TA 3PB8X 1DE4C 3L2NA 2IMOA 2AFSA 2PE3A 3PB9X 3SJGA 2HC9A 6CPAA 2J9AA 4C8AA 4P44A 4MHZA 4P6YA 4OC2A 1DTDA 4OC3A 4UIAA 1XMBA 2V8VA 3D4UA 1IY7A 2QJ8A 5K8NA 4DYOA 2ZEMA 4H2KA 4NJRA 1TKJA 2XEIA 3KR5A 4P45A 2V8HA 2PJ8A 3T8WA 3FH4A 5K8PA 1WVMA 4YWYA 3D66A 2PJBA 7CPAA 3SI2A 3HLPA
chains in the Genus database with same CATH superfamily
3I9SA 4C8CA 3TO7A 3NA6A 2EO8A 1NE9A 5LRKA 2YJVA 3BUNB 4NGRA 5F09A 2A4NA 5CBMA 5A27A 4MJ8A 5C82A 4A30A 3B3CA 3GB0A 3NE8A 4J3GA 1S7NA 4AVCA 2CF4A 3MRUA 5ELYA 4ZI6A 1KEEB 2PCNA 3PBBA 2PIZA 3VRPA 1LOKA 2VQYA 3FNCA 5F9MA 4CO9A 2Q0YA 4MRIA 1Z8LA 2HV2A 3EFAA 1Z9EA 3FECA 2R8VA 4C2YA 4DJLA 4ZGYB 5G1ZA 3LWUA 3R95A 4E8OA 3ZNIA 1YSJA 4P4JA 4UF4A 1QSNA 4IHMA 2B0AA 4C2ZA 4MCQA 3H8GA 2XEGA 4A95A 4A32A 2Y1MA 4A38A 4F9UA 2C6GA 1L0CA 1IIDA 2ZENA 2AJ6A 3OB1B 1X10A 3BUXB 2DF5A 1I21A 1Z5RA 2EZCA 3N5FA 3VTAA 3CZXA 3TE4A 1RXTA 5F5XA 1R43A 2ANPA 1Y7RA 3U88C 1XF1A 3TLGA 2K5TA 5IV0A 2HQYA 1WJTA 1EE3P 3PZJA 3V38A 4CPAA 4X8IA 1BAVA 2EWBA 3RZAA 2O28A 2ABZA 2R7HA 4C99A 2PJBA 3T9YA 4ZX8A 1CP6A 2PSWA 1KUXA 2B3VA 3EC4A 2V77A 1IGBA 2OU2A 5C88A 4U5YA 1XE4A 4DNCA 4JWPA 1QMUA 3PT1A 3PGPA 4KOSA 5F13A 4MCRA 4FD4A 5F46A 4C86A 4H6UA 5JGFA 4C9UA 1QSRA 3H8FA 1U6MA 1YMEA 1XJOA 3EXNA 1C3OB 3PFVA 2G9DA 4EWTA 2RB7A 1Q2YA 4CDKA 3CPXA 1TKHA 4C9VA 1CE8B 4A31A 2JDDA 3PP9A 2PJ3A 2ZW5A 3IO1A 1YQEA 1NSAA 3PRTA 4CYNA 5JM6A 3FMCA 1VI4A 4P4EA 1Z4EA 4B5OA 3RAMA 4KSIA 1T36B 5F1YA 1J3LA 1TXRA 2YJTA 1XOVA 1YLEA 4LQGA 3VRNA 1UFHA 3TFYA 2ZEEA 1KC7A 3GUXA 3PLFB 3N7ZA 4HNYB 4KUAA 3VH9A 4A2ZA 4RR2B 4KOTA 2C5QA 1LAPA 1YREA 2UV8G 3KR4A 4ONWA 4AG9A 2D0PA 4PXCA 2OZGA 4TJXA 4E0AA 5DWMA 2OOTA 3U1BA 3D8PA 4RS2A 2YNDA 3KGQA 4C8UA 1IYLA 4CRYB 5LYFA 3TLZA 1N71A 2JEWA 1WWZA 2OB0A 4UFWA 2N3AB 5D8NA 3NH5A 1Q5XA 1YR0A 3ISXA 3S6KA 2HROA 3S9LA 3HUVA 2XEFA 4K30A 3HPHE 2DIKA 3IU2A 3FF3A 2BEIA 4Y49B 1A9XB 2QYVA 1PCAA 2YNCC 4UBRA 4J0NA 1CS0B 2ZEFA 3KI9A 3CPAA 2B4JC 4R7MA 1B87A 2HUZA 3RO0A 3TC8A 3B7IA 3I6SA 5K8MA 3NFQA 3B3WA 4FD6A 2NMTA 4KOVA 2PC1A 4P4IA 2G0BA 1F2PA 1PUAA 2Z10A 2ZOGA 3E0KA 4H89A 4KVME 4F6AA 5J1QA 3ICUA 2NSMA 2RFHA 4OLLA 2BL1A 2B4DB 4R3KA 1TF8A 1BPNA 2FT0A 2VBQA 5F49A 3SHPA 4E94A 4C9AA 1S7KA 4MCSA 4IIYA 1K4JA 3DGVA 1IICA 4KOXA 5F48A 2OR4A 3RNZA 4M6IA 4TWEA 1YW6A 5J8CA 1RO5A 2I00A 2FSRA 4RI1A 3K4IA 2ZW6A 4PSWA 3RYOA 1Z8XA 4CAFA 4R9MA 1VHEA 2R98A 1CPSA 1LCPA 4FAIA 3BLNA 2PJ1A 2QIRA 4B13A 2F5IA 4A94A 4R87A 2NYQA 3PBEA 3SJEA 3WABA 3FEDA 4MFJA 4F0XA 3NOJA 2C27A 4C8PA 2B5GB 1Y7EA 2PQ8A 1A2ZA 2ZEPA 4KLVA 2XPOA 4ZY0A 2AE6A 3PB7X 4ZBGA 3TLYA 2Q43A 1KUYA 3P2FA 4MHPA 1HEEA 3QB8A 4MY0A 3TO6A 1YW4A 3GYAA 4QB9A 2WSAA 4MXUA 3B2YA 3IC1A 2Z11A 1JDEA 2PJCA 4PPZA 3VARA 5J8FA 5I0CA 2WPXA 4NGPA 1CJWA 3PB6X 4JJXA 2BOAA 4HKFA 4XPLA 5LYIA 3O8ZA 3TCVA 2MP0A 4YGOA 2GP4A 4P4FA 1UWYA 2BCOA 3GIUA 3ZJ0A 3G8WA 1QSMA 1Q2CA 2WZNA 4Q36A 3IEHA 5HVFA 3IWEA 5HVHA 4KVXA 4A4CA 2PJ6A 3SJXA 2ZEHA 3H8EA 3S9MA 4RUHA 3TT2A 2VI7A 4AB7A 4NSQA 4JYWA 2ODFA 3BJ8A 2PR1A 3MGDA 3IIBA 5HKZA 1RTQA 1IB1E 2CY2A 1YLOA 1MJ9A 2PJ9A 4BPUB 2O4HA 5LYDA 3LODA 1M4IA 3TOBA 3KQXA 3DNSA 4EMEA 4HPSA 3F0AA 5KTDA 4C9RA 2B5GA 3LMSA 1GHEA 2O53A 3KHZA 4FD5A 4C85A 4R76A 4KSFA 1TF9A 4KOYA 4NGTA 2POKA 2Z3KA 4OKOA 4FWUA 4XPKA 4X2TA 1AUGA 1BPMA 4NGSA 4XNHC 2FCKA 4ZYQA 3I1UA 2GE3A 4R3LA 4JVOA 3TYXA 1Z9UA 4COBA 2D4PA 2FVGA 4IAVA 1XEBA 2AFUA 3TX8A 1NXJA 5IR2A 5I4MA 3I74A 4MHNA 1VIXA 2QECA 1SQHA 4LQ6A 4Q38A 3OP0A 1CP7A 1Z8TA 1QQ9A 3D2PA 4U9YA 5JQ4A 4UEEA 1FBVA 2HB6A 4B10A 1C30B 1FT7A 2PJ7A 4UIBA 3TOAA 1BOBA 1ON0A 4A4BA 5HKYA 4P4BA 2Z3PA 3B3SA 5DS0A 4CAVA 4XPDC 1WK4A 3S6GA 3SJFA 4YFJA 3IU1A 1VBGA 3CDXA 4Q7AA 3BUMB 4BMHA 3LD2A 2AFXA 5BWAB 2I79A 1Q7LA 2BO9A 2ZW7A 5HH1A 4BPWB 1FNOA 2WPWA 4BTFA 5JYBA 3WR7A 5CNPA 3BI0A 3VRQA 2ZELA 4PXDA 4CYPA 4NGNA 4OC4A 5IB9A 2REEA 4DUKA 1ARMA 1XMTA 1I12A 4UWIA 5IB0A 2Q51A 3D7GA 1LANA 2PJAA 3BXMA 3JUWA 4TNUA 3KASA 2EZAA 4MI1A 3S6FA 4C7HA 2XPPA 1Z2LA 5KTCA 2JBJA 1XIXA 2OLSA 1KBLA 3T07A 2CTCA 4MFQA 5AG6A 1MJBA 4MBUA 5THWA 5D29A 4B14A 4CAEA 4FBEA 4UCNA 3TO9A 2HI6A 3DDDA 2Y0MA 3QAYA 4HNWB 5E96A 2BUEA 3WC7A 4F0YA 4PK2A 2Z3OA 3T05A 4KOWA 2ATRA 4RN7A 2VZZA 1Y9KA 4KNGE 3B8GA 4P10A 3EZEA 4C84A 4YU9A 4C8TA 2C6PA 3NH4A 4Z65A 2REFA 3FX6A 4CGPA 4EYSA 4PXBA 3EZBA 2Q7SA 3FXTA 3JVNA 1BLLE 2GLJA 5JPHA 3SXNA 4C7IA 3HMJG 1S60A 5DWNA 3D68A 4B12A 3B3TA 4UCPA 2AFZA 3CXQA 2Q4ZA 1Z4RA 5LRGA 4CRZB 4E2AA 1S3ZA 2GIVA 3W6SA 5F47A 3DSBA 4C9EA 2PVVA 1ZLHA 3FEEA 1LRZA 3K9UA 4BD9A 2ZXVA 1Y9ZA 2PRBA 3VGOA 1CG2A 1M44A 2PDOA 3QAHA 3G23A 2OZUA 3B3VA 2PJ4A 3V8IA 1VGYA 1S5KA 1CM0A 3VROA 2AFMA 4X3RA 2P0WA 2PR8A 2Q44A 2CNMA 2PVWA 2ZEOA 3MN8A 4YRHA 2Q7BA 4CGOA 5ISVA 4IIXA 3GY9A 2VEZA 1Q2DA 4EFDA 5AXIA 2Y1NA 3R96A 3CT9A 3IFEA 3P2HA 1EZAA 1ZYMA 3C8OA 3WT4A 2V8GA 1YX0A 1P4NA 2JBKA 4C68A 4UEFA 2F8HA 2KCWA 4MMOA 4P4DA 1FY7A 4NFRA 1R3NA 5G21A 2ARHA 1YVHA 2ZEGA 3CXSA 1LFWA 1NSLA 4OC0A 4BPXB 2CNTA 1Z8WA 8CPAA 3KQZA 2ZEDA 1AMPA 2GFQA 1CX8A 3D2MA 2CBLA 4O23A 4X5KA 1VHOA 2Z3NA 4NGMA 2GLFA 1AYEA 4MFKA 2CIJA 4KUBA 1F57A 1ZLIA 1LAMA 4GM5A 4C2XA 1XBUA 2EBJA 2B3UA 4ZY2A 2WYRA 1B47A 1ZG8A 3F8KA 1Y0YA 2Z3MA 4KSAA 4IF5A 1ZG9A 4UFXA 2FIAA 1F2OA 2PIYA 4CGNA 2ZOFA 1IOFA 3BHXA 2B4DA 4NF1A 4R57A 4OIWA 2WUUA 3QNVA 3S9NA 2C6CA 2VXKA 3KHXA 4M6HA 2IL4A 3NE7A 2XEJA 3PFOA 4KORA 4UCMA 4ZY1A 1NBWA 5K99A 3JRUA 4OADA 4INJA 3SXOA 2JDCA 3D7FA 2Q04A 3V7ZA 4KZTA 5AGEA 2C1CA 4FUUA 4PXEA 3BUWB 4QVTA 4LX9A 3D7HA 4R6TA 4WWVA 3H4QA 3R9GA 5JH9A 1TIQA 1S7LA 1TKFA 4IUSA 3EO4A 3DR6A 1M1DA 3H5ZA 2EVNA 3GKRA 4CZ1A 3S6HA 2Q4VA 2PJ5A 3EY5A 4JXQA 2RC4A 2PRQA 3OB2B 5G20A 3OWCA 3VATA 1MJAA 1YVOA 3B35A 2PCUA 4PV6A 1ZG7A 4A39A 4MHDA 4B6ZA 4UFVA 5AG4A 3HPGG 3K2KA 1VHSA 2JEVA 4WJBA 4MY3A 3IGRA 3T90A 4CAXA 5KTAA 3PB4X 5HXDA 3EZAA 2YNEA 2G3TA 4B5PB 4H1HA 2PJ2A 4BBHA 3FVLA 3KZWA 4XNHB 2CTBA 4MHYA 1XF8A 2I3CA 2FS5A 4ZX9A 3PFEA 4R8FA 4AVAA 5CPAA 5LYLA 1S7FA 4M6GA 5FVJA 4EVYA 2JLMA 1JDBC 1X12A 4TJVA 2IQ6A 2QVPA 3DLJA 3T5MA 4CAWA 1PYTB 5BY0A 2EUIA 1QSOA 4NEXA 4F8ZA 2VL1A 2J8NA 2QMLA 3FJUA 4JZ0A 1YK3A 4OIDA 5HVGA 1GGOA 2AFOA 4UEZA 4AXVA 4CYOA 3TLAA 4E5SA 2P6FA 5G22A 2D0OA 3TTHA 1EZBA 2IJZA 3DR8A 3I3GA 4OAEA 2R1IA 4QC6A 2FL4A 4YN3A 3BJ7A 2ZW4A 4JD6A 4OP4A 2EK9A 4XPDB 2EZBA 4W9YA 1CBXA 1DIKA 3NH8A 1M4DA 3BUOB 1MK4A 1VKCA 2FIWA 1EO0A 3RBUA 4A33A 3PEIA 2R82A 4UA3A 5EC4A 2ZPAA 2H5MA 4JLYA 4AVBA 1V6CA 1VBHA 4QUSA 1QSTA 4MFPA 3FRMA 2F7VA 1ZO0A 3ZZIA 3D67A 5GCNA 5HMNA 4I49A 4U9ZA 2HWGA 2DEAA 4B5PA 5IX3A 4GS4A 2B58A 1OZPA 1H8LA 2AFWA 1JQGA 1XRYA 4B11A 2BSWA 3BI1A 1PU9A 2J8MA 4AG7A 3IJ3A 1NMTA 3D3SA 4PK3A 3F5BA 3TLBA 2XPLA 3ISZA 3TLEA 3FB3A 2FM4A 1YVKA 3SI0A 3VWDA 4M3SA 1OBRA 4CDJA 3JTKA 5FD8A 2AUNA 5H84A 4OC1A 4A37A 1CPXA 3T0TA 1ARLA 1ZL0A 2OZHA 4CGLA 1Y9WA 5K8OA 1M4GA 3KL9A 4HNXB 4H6ZA 3WC5A 4NGQA 1BXRB 3HLPA 2EK8A 2Z0ZA 4JXRA 4MCPA 2B4BA 2CNSA 1P0HA 3IWWA 1YGHA 2D4OA 4G1PA 4IK2A 3GLJA 5LRJA 2X7BA 1B6BA 4K3NA 1M4LA 3R1KA 4LUAA 3SI1A 2V8DA 4CS0B 1M6VB 5HKWA 4FD7A 5A28A 3WC6A 1KWMA 3FYNA 4C8FA 4Y49C 4OMEA 4NJQA 4F9VA 2GREA 1HDUA 2GU2A 2CXAA 2PJ0A 3D7DA 1Y0RA 3NFZA 4UWJA 3EIFA 1XFOA 1ELMP 4KS9A 4OC5A 1HDQA 1ELLP 4PQAA 3K9TA 2Z3LA 3PB8X 2DXQA 1R57A 5AG7A 1DE4C 1BO4A 3L2NA 1R61A 3GJZA 1KUVA 4NCZA 4CYQA 2IMOA 2AFSA 3SR3A 1I1DA 1KZFA 4GXHA 3KKWA 3LACA 2PE3A 4M85A 3PB9X 2DLAA 2Q4YA 4L89A 3SJGA 2HC9A 3CXPA 4M8DA 1J4JA 3W91A 4PSXA 2J9AA 6CPAA 2E28A 3VWEA 2X0SA 3VRRA 1IOIA 4P44A 4MFLA 2AUMA 3TLCA 4MFZA 5J3XA 4MHZA 4MJXA 4C8AA 2P6GA 3IWGA 4P6YA 3OAKA 4OC2A 1DTDA 1ZRSA 4L8AA 4OC3A 4UIAA 1IYKA 2YNCA 1XMBA 2V8VA 3R9FA 3W6XA 1JWQA 3D4UA 1IY7A 2QJ8A 3F9KC 5JVLA 5EMIA 5K8NA 4KVOE 4DYOA 2ZEMA 4MI4A 3KRVA 4H2KA 4NJRA 5H86A 1TKJA 5EBVA 4BINA 4CGMA 2XPNA 2VKZG 2YGWA 3G3SA 2P6EA 2XEIA 2DPSA 2GANA 3R9EA 4ONUA 4ORFA 4KOUA 2OH1A 3FBUA 4II9A 2VZYA 1V0CA 1IU8A 4GPLB 2FE7A 3KR5A 5AG5A 4P45A 4QBJA 3FIXA 2V8HA 2DPTA 4NXYA 3TLGB 2FXFA 2PJ8A 3T8WA 4KLWA 3FH4A 5K8PA 2G3AA 4COGA 1WVMA 3A9LA 3C26A 4YWYA 3D66A 3UY5A 2J8RA 7CPAA 3SI2A 1GYTA
chains in the Genus database with same CATH topology
4C8CA 3NA6A 5LRKA 5F09A 4NGRA 5CBMA 3B3CA 3GB0A 2CF4A 3MRUA 5ELYA 4ZI6A 3PBBA 2PIZA 1LOKA 4MRIA 1Z8LA 3FECA 4DJLA 3LWUA 1YSJA 4P4JA 4UF4A 4IHMA 4MCQA 3H8GA 2XEGA 4A38A 4F9UA 2C6GA 2ZENA 1Z5RA 3N5FA 3VTAA 1R43A 2ANPA 1XF1A 1EE3P 3V38A 4CPAA 4X8IA 1BAVA 2EWBA 3RZAA 4C99A 2ABZA 4ZX8A 1CP6A 2V77A 1IGBA 1QMUA 4C86A 4MCRA 5JGFA 4C9UA 3H8FA 1YMEA 1XJOA 2G9DA 4EWTA 2RB7A 4CDKA 3CPXA 1TKHA 4C9VA 2PJ3A 3IO1A 1NSAA 3PRTA 5JM6A 3FMCA 4P4EA 3RAMA 4KSIA 1TXRA 4LQGA 1GYTA 2ZEEA 3GUXA 3VH9A 1LAPA 3KR4A 4ONWA 4PXCA 4TJXA 2OOTA 3KGQA 4C8UA 5LYFA 2JEWA 2C5QA 5D8NA 3NH5A 3ISXA 3S9LA 3HUVA 2XEFA 3FF3A 2QYVA 1PCAA 2ZEFA 3KI9A 3CPAA 4R7MA 3TC8A 3B7IA 3I6SA 5K8MA 3B3WA 4P4IA 1F2PA 2ZOGA 5J1QA 3ICUA 2NSMA 2RFHA 1TF8A 1BPNA 4C9AA 4MCSA 3DGVA 2OR4A 4TWEA 1YW6A 1VHEA 1CPSA 1LCPA 4FAIA 5JH9A 2PJ1A 4A94A 2NYQA 3PBEA 3SJEA 3WABA 3FEDA 4C8PA 1Y7EA 2ZEPA 4ZY0A 3PB7X 2Q43A 4MHPA 1HEEA 1YW4A 4MXUA 3B2YA 3IC1A 2PJCA 4PPZA 3VARA 4NGPA 3PB6X 2BOAA 5LYIA 2GP4A 4P4FA 1UWYA 2BCOA 2WZNA 5HVFA 3IEHA 5HVHA 2ZEHA 2PJ6A 3SJXA 3H8EA 3S9MA 4RUHA 4JYWA 3IIBA 1RTQA 1YLOA 2PJ9A 2O4HA 5LYDA 4EMEA 3KQXA 4C9RA 3LMSA 4C85A 2O53A 3KHZA 4R76A 1TF9A 4NGTA 2POKA 4OKOA 4FWUA 4X2TA 1BPMA 4ZYQA 4NGSA 3I1UA 2FVGA 4IAVA 2AFUA 3TX8A 5IR2A 5I4MA 3I74A 4MHNA 1VIXA 1CP7A 1QQ9A 4UEEA 2HB6A 1FT7A 2PJ7A 4UIBA 4P4BA 3B3SA 5DS0A 3SJFA 3CDXA 4Q7AA 2AFXA 1Q7LA 2BO9A 1FNOA 3BI0A 2ZELA 4PXDA 5IB9A 4NGNA 4OC4A 4DUKA 1ARMA 2Q51A 3D7GA 1LANA 2PJAA 3BXMA 4TNUA 3KASA 1Z2LA 2JBJA 2CTCA 5THWA 5D29A 3WC7A 4KNGE 4P10A 4C84A 4YU9A 4C8TA 2C6PA 3NH4A 4Z65A 3FX6A 4PXBA 1BLLE 2GLJA 3D68A 3B3TA 2AFZA 2Q4ZA 5LRGA 4C9EA 2PVVA 1ZLHA 3FEEA 4BD9A 1Y9ZA 1CG2A 3B3VA 2PJ4A 1VGYA 2AFMA 4X3RA 3MN8A 2ZEOA 2PVWA 4EFDA 3CT9A 3IFEA 3WT4A 2V8GA 2JBKA 4UEFA 2F8HA 4MMOA 4P4DA 4NFRA 1R3NA 2ZEGA 1LFWA 4OC0A 8CPAA 3KQZA 2ZEDA 1AMPA 4O23A 1CX8A 1VHOA 4NGMA 2GLFA 1AYEA 2CIJA 1F57A 1ZLIA 1LAMA 4GM5A 1XBUA 4ZY2A 2WYRA 1ZG8A 1Y0YA 1ZG9A 1F2OA 2PIYA 2ZOFA 3BHXA 4OIWA 3QNVA 3S9NA 2C6CA 3KHXA 4CDJA 4ZY1A 3PFOA 2XEJA 3JRUA 3D7FA 3V7ZA 2C1CA 4FUUA 4PXEA 3D7HA 4R6TA 4WWVA 1TKFA 2PJ5A 2PRQA 3VATA 3B35A 2PCUA 1ZG7A 4A39A 4B6ZA 3K2KA 4WJBA 3PB4X 5HXDA 2PJ2A 3FVLA 3KZWA 2CTBA 4MHYA 4ZX9A 2I3CA 5LYLA 3PFEA 4R8FA 5CPAA 4TJVA 2IQ6A 2QVPA 3DLJA 1PYTB 4F8ZA 2VL1A 3FJUA 5HVGA 4JZ0A 4OIDA 2AFOA 4UEZA 4AXVA 2IJZA 4YN3A 4OP4A 2EK9A 4W9YA 1CBXA 3NH8A 3RBUA 3PEIA 1V6CA 2F7VA 3D67A 2DEAA 1H8LA 2AFWA 1JQGA 1XRYA 3BI1A 3IJ3A 3ISZA 3SI0A 1OBRA 4OC1A 4A37A 1CPXA 1ARLA 5K8OA 3KL9A 3WC5A 4NGQA 2EK8A 4MCPA 3IWWA 4IK2A 4G1PA 5LRJA 3GLJA 4FBEA 4K3NA 1M4LA 3SI1A 2V8DA 3WC6A 1KWMA 4C8FA 4OMEA 4NJQA 4F9VA 2GREA 1HDUA 2GU2A 2PJ0A 3D7DA 1Y0RA 3NFZA 3EIFA 1XFOA 1ELMP 4OC5A 1HDQA 1ELLP 4PQAA 3K9TA 3PB8X 1DE4C 3L2NA 2IMOA 2AFSA 2PE3A 3PB9X 3SJGA 2HC9A 6CPAA 2J9AA 4C8AA 4P44A 4MHZA 4P6YA 4OC2A 1DTDA 4OC3A 4UIAA 1XMBA 2V8VA 3D4UA 1IY7A 2QJ8A 5K8NA 4DYOA 2ZEMA 4H2KA 4NJRA 1TKJA 2XEIA 3KR5A 4P45A 2V8HA 2PJ8A 3T8WA 3FH4A 5K8PA 1WVMA 4YWYA 3D66A 2PJBA 7CPAA 3SI2A 3HLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8C A;  3NA6 A;  5LRK A;  5F09 A;  4NGR A;  5CBM A;  3B3C A;  3GB0 A;  2CF4 A;  3MRU A;  5ELY A;  4ZI6 A;  3PBB A;  2PIZ A;  1LOK A;  4MRI A;  1Z8L A;  3FEC A;  4DJL A;  3LWU A;  1YSJ A;  4P4J A;  4UF4 A;  4IHM A;  4MCQ A;  3H8G A;  2XEG A;  4A38 A;  4F9U A;  2C6G A;  2ZEN A;  1Z5R A;  3N5F A;  3VTA A;  1R43 A;  2ANP A;  1XF1 A;  1EE3 P;  3V38 A;  4CPA A;  4X8I A;  1BAV A;  2EWB A;  3RZA A;  4C99 A;  2ABZ A;  4ZX8 A;  1CP6 A;  2V77 A;  1IGB A;  1QMU A;  4C86 A;  4MCR A;  5JGF A;  4C9U A;  3H8F A;  1YME A;  1XJO A;  2G9D A;  4EWT A;  2RB7 A;  4CDK A;  3CPX A;  1TKH A;  4C9V A;  2PJ3 A;  3IO1 A;  1NSA A;  3PRT A;  5JM6 A;  3FMC A;  4P4E A;  3RAM A;  4KSI A;  1TXR A;  4LQG A;  1GYT A;  2ZEE A;  3GUX A;  3VH9 A;  1LAP A;  3KR4 A;  4ONW A;  4PXC A;  4TJX A;  2OOT A;  3KGQ A;  4C8U A;  5LYF A;  2JEW A;  5D8N A;  3NH5 A;  3ISX A;  3S9L A;  3HUV A;  2XEF A;  3FF3 A;  2QYV A;  1PCA A;  2ZEF A;  3KI9 A;  3CPA A;  4R7M A;  3TC8 A;  3B7I A;  3I6S A;  5K8M A;  3B3W A;  4P4I A;  1F2P A;  2ZOG A;  5J1Q A;  3ICU A;  2NSM A;  2RFH A;  1TF8 A;  1BPN A;  4C9A A;  4MCS A;  3DGV A;  2OR4 A;  4TWE A;  1YW6 A;  1VHE A;  1CPS A;  1LCP A;  4FAI A;  5JH9 A;  2PJ1 A;  4A94 A;  2NYQ A;  3PBE A;  3SJE A;  3WAB A;  3FED A;  4C8P A;  1Y7E A;  2ZEP A;  4ZY0 A;  3PB7 X;  2Q43 A;  4MHP A;  1HEE A;  1YW4 A;  4MXU A;  3B2Y A;  3IC1 A;  2PJC A;  4PPZ A;  3VAR A;  4NGP A;  3PB6 X;  2BOA A;  5LYI A;  4P4F A;  1UWY A;  2BCO A;  2WZN A;  5HVF A;  3IEH A;  5HVH A;  2ZEH A;  2PJ6 A;  3SJX A;  3H8E A;  3S9M A;  4RUH A;  4JYW A;  3IIB A;  1RTQ A;  1YLO A;  2PJ9 A;  2O4H A;  5LYD A;  4EME A;  3KQX A;  4C9R A;  3LMS A;  4C85 A;  2O53 A;  3KHZ A;  4R76 A;  1TF9 A;  4NGT A;  2POK A;  4OKO A;  4FWU A;  4X2T A;  1BPM A;  4ZYQ A;  4NGS A;  3I1U A;  2FVG A;  4IAV A;  2AFU A;  3TX8 A;  5I4M A;  3I74 A;  4MHN A;  1VIX A;  1CP7 A;  1QQ9 A;  4UEE A;  2HB6 A;  1FT7 A;  2PJ7 A;  4UIB A;  4P4B A;  3B3S A;  5DS0 A;  3SJF A;  3CDX A;  4Q7A A;  2AFX A;  1Q7L A;  2BO9 A;  1FNO A;  3BI0 A;  2ZEL A;  4PXD A;  5IB9 A;  4NGN A;  4OC4 A;  4DUK A;  1ARM A;  2Q51 A;  3D7G A;  1LAN A;  2PJA A;  3BXM A;  4TNU A;  3KAS A;  1Z2L A;  2JBJ A;  2CTC A;  5THW A;  5D29 A;  3WC7 A;  4KNG E;  4P10 A;  4C84 A;  4YU9 A;  4C8T A;  2C6P A;  3NH4 A;  4Z65 A;  3FX6 A;  4PXB A;  1BLL E;  2GLJ A;  3D68 A;  3B3T A;  2AFZ A;  2Q4Z A;  5LRG A;  4C9E A;  2PVV A;  1ZLH A;  3FEE A;  4BD9 A;  1Y9Z A;  1CG2 A;  3B3V A;  2PJ4 A;  1VGY A;  2AFM A;  4X3R A;  3MN8 A;  2ZEO A;  2PVW A;  4EFD A;  3CT9 A;  3IFE A;  3WT4 A;  2V8G A;  2JBK A;  4UEF A;  2F8H A;  4MMO A;  4P4D A;  4NFR A;  1R3N A;  2ZEG A;  1LFW A;  4OC0 A;  8CPA A;  3KQZ A;  2ZED A;  1AMP A;  4O23 A;  1CX8 A;  1VHO A;  4NGM A;  2GLF A;  1AYE A;  2CIJ A;  1F57 A;  1ZLI A;  1LAM A;  4GM5 A;  1XBU A;  4ZY2 A;  2WYR A;  1ZG8 A;  1Y0Y A;  1ZG9 A;  1F2O A;  2PIY A;  2ZOF A;  3BHX A;  4OIW A;  3QNV A;  3S9N A;  2C6C A;  3KHX A;  4CDJ A;  4ZY1 A;  3PFO A;  2XEJ A;  3JRU A;  3D7F A;  3V7Z A;  2C1C A;  4FUU A;  4PXE A;  3D7H A;  4R6T A;  4WWV A;  1TKF A;  2PJ5 A;  2PRQ A;  3VAT A;  3B35 A;  2PCU A;  1ZG7 A;  4A39 A;  4B6Z A;  3K2K A;  4WJB A;  3PB4 X;  5HXD A;  2PJ2 A;  3FVL A;  3KZW A;  2CTB A;  4MHY A;  4ZX9 A;  2I3C A;  5LYL A;  3PFE A;  4R8F A;  5CPA A;  4TJV A;  2IQ6 A;  2QVP A;  3DLJ A;  1PYT B;  4F8Z A;  2VL1 A;  3FJU A;  5HVG A;  4JZ0 A;  4OID A;  2AFO A;  4UEZ A;  4AXV A;  2IJZ A;  4YN3 A;  4OP4 A;  2EK9 A;  4W9Y A;  1CBX A;  3NH8 A;  3RBU A;  3PEI A;  1V6C A;  2F7V A;  3D67 A;  2DEA A;  1H8L A;  2AFW A;  1JQG A;  1XRY A;  3BI1 A;  3IJ3 A;  3ISZ A;  3SI0 A;  1OBR A;  4OC1 A;  4A37 A;  1CPX A;  1ARL A;  5K8O A;  3KL9 A;  3WC5 A;  4NGQ A;  2EK8 A;  4MCP A;  3IWW A;  4IK2 A;  4G1P A;  5LRJ A;  3GLJ A;  4FBE A;  4K3N A;  1M4L A;  3SI1 A;  2V8D A;  3WC6 A;  1KWM A;  4C8F A;  4OME A;  4NJQ A;  4F9V A;  2GRE A;  1HDU A;  2GU2 A;  2PJ0 A;  3D7D A;  1Y0R A;  3NFZ A;  3EIF A;  1XFO A;  1ELM P;  4OC5 A;  1HDQ A;  1ELL P;  4PQA A;  3K9T A;  3PB8 X;  1DE4 C;  3L2N A;  2IMO A;  2AFS A;  2PE3 A;  3PB9 X;  3SJG A;  2HC9 A;  6CPA A;  2J9A A;  4C8A A;  4P44 A;  4MHZ A;  4P6Y A;  4OC2 A;  1DTD A;  4OC3 A;  4UIA A;  1XMB A;  2V8V A;  3D4U A;  1IY7 A;  2QJ8 A;  5K8N A;  4DYO A;  2ZEM A;  4H2K A;  4NJR A;  1TKJ A;  2XEI A;  3KR5 A;  4P45 A;  2V8H A;  2PJ8 A;  3T8W A;  3FH4 A;  5K8P A;  1WVM A;  4YWY A;  3D66 A;  2PJB A;  7CPA A;  3SI2 A;  3HLP A; 
#chains in the Genus database with same CATH topology
 3I9S A;  4C8C A;  3TO7 A;  3NA6 A;  2EO8 A;  1NE9 A;  5LRK A;  2YJV A;  3BUN B;  4NGR A;  5F09 A;  2A4N A;  5CBM A;  5A27 A;  4MJ8 A;  5C82 A;  4A30 A;  3B3C A;  3GB0 A;  3NE8 A;  4J3G A;  1S7N A;  4AVC A;  2CF4 A;  3MRU A;  5ELY A;  4ZI6 A;  1KEE B;  2PCN A;  3PBB A;  2PIZ A;  3VRP A;  1LOK A;  2VQY A;  3FNC A;  5F9M A;  4CO9 A;  2Q0Y A;  4MRI A;  1Z8L A;  2HV2 A;  3EFA A;  1Z9E A;  3FEC A;  2R8V A;  4C2Y A;  4DJL A;  4ZGY B;  5G1Z A;  3LWU A;  3R95 A;  4E8O A;  3ZNI A;  1YSJ A;  4P4J A;  4UF4 A;  1QSN A;  4IHM A;  2B0A A;  4C2Z A;  4MCQ A;  3H8G A;  2XEG A;  4A95 A;  4A32 A;  2Y1M A;  4A38 A;  4F9U A;  2C6G A;  1L0C A;  1IID A;  2ZEN A;  2AJ6 A;  3OB1 B;  1X10 A;  3BUX B;  2DF5 A;  1I21 A;  1Z5R A;  2EZC A;  3N5F A;  3VTA A;  3CZX A;  3TE4 A;  1RXT A;  5F5X A;  1R43 A;  2ANP A;  1Y7R A;  3U88 C;  1XF1 A;  3TLG A;  2K5T A;  5IV0 A;  2HQY A;  1WJT A;  1EE3 P;  3PZJ A;  3V38 A;  4CPA A;  4X8I A;  1BAV A;  2EWB A;  3RZA A;  2O28 A;  2ABZ A;  2R7H A;  4C99 A;  2PJB A;  3T9Y A;  4ZX8 A;  1CP6 A;  2PSW A;  1KUX A;  2B3V A;  3EC4 A;  2V77 A;  1IGB A;  2OU2 A;  5C88 A;  4U5Y A;  1XE4 A;  4DNC A;  4JWP A;  1QMU A;  3PT1 A;  3PGP A;  4KOS A;  5F13 A;  4MCR A;  4FD4 A;  5F46 A;  4C86 A;  4H6U A;  5JGF A;  4C9U A;  1QSR A;  3H8F A;  1U6M A;  1YME A;  1XJO A;  3EXN A;  1C3O B;  3PFV A;  2G9D A;  4EWT A;  2RB7 A;  1Q2Y A;  4CDK A;  3CPX A;  1TKH A;  4C9V A;  1CE8 B;  4A31 A;  2JDD A;  3PP9 A;  2PJ3 A;  2ZW5 A;  3IO1 A;  1YQE A;  1NSA A;  3PRT A;  4CYN A;  5JM6 A;  3FMC A;  1VI4 A;  4P4E A;  1Z4E A;  4B5O A;  3RAM A;  4KSI A;  1T36 B;  5F1Y A;  1J3L A;  1TXR A;  2YJT A;  1XOV A;  1YLE A;  4LQG A;  3VRN A;  1UFH A;  3TFY A;  2ZEE A;  1KC7 A;  3GUX A;  3PLF B;  3N7Z A;  4HNY B;  4KUA A;  3VH9 A;  4A2Z A;  4RR2 B;  4KOT A;  2C5Q A;  1LAP A;  1YRE A;  2UV8 G;  3KR4 A;  4ONW A;  4AG9 A;  2D0P A;  4PXC A;  2OZG A;  4TJX A;  4E0A A;  5DWM A;  2OOT A;  3U1B A;  3D8P A;  4RS2 A;  2YND A;  3KGQ A;  4C8U A;  1IYL A;  4CRY B;  5LYF A;  3TLZ A;  1N71 A;  2JEW A;  1WWZ A;  2OB0 A;  4UFW A;  2N3A B;  5D8N A;  3NH5 A;  1Q5X A;  1YR0 A;  3ISX A;  3S6K A;  2HRO A;  3S9L A;  3HUV A;  2XEF A;  4K30 A;  3HPH E;  2DIK A;  3IU2 A;  3FF3 A;  2BEI A;  4Y49 B;  1A9X B;  2QYV A;  1PCA A;  2YNC C;  4UBR A;  4J0N A;  1CS0 B;  2ZEF A;  3KI9 A;  3CPA A;  2B4J C;  4R7M A;  1B87 A;  2HUZ A;  3RO0 A;  3TC8 A;  3B7I A;  3I6S A;  5K8M A;  3NFQ A;  3B3W A;  4FD6 A;  2NMT A;  4KOV A;  2PC1 A;  4P4I A;  2G0B A;  1F2P A;  1PUA A;  2Z10 A;  2ZOG A;  3E0K A;  4H89 A;  4KVM E;  4F6A A;  5J1Q A;  3ICU A;  2NSM A;  2RFH A;  4OLL A;  2BL1 A;  2B4D B;  4R3K A;  1TF8 A;  1BPN A;  2FT0 A;  2VBQ A;  5F49 A;  3SHP A;  4E94 A;  4C9A A;  1S7K A;  4MCS A;  4IIY A;  1K4J A;  3DGV A;  1IIC A;  4KOX A;  5F48 A;  2OR4 A;  3RNZ A;  4M6I A;  4TWE A;  1YW6 A;  5J8C A;  1RO5 A;  2I00 A;  2FSR A;  4RI1 A;  3K4I A;  2ZW6 A;  4PSW A;  3RYO A;  1Z8X A;  4CAF A;  4R9M A;  1VHE A;  2R98 A;  1CPS A;  1LCP A;  4FAI A;  3BLN A;  2PJ1 A;  2QIR A;  4B13 A;  2F5I A;  4A94 A;  4R87 A;  2NYQ A;  3PBE A;  3SJE A;  3WAB A;  3FED A;  4MFJ A;  4F0X A;  3NOJ A;  2C27 A;  4C8P A;  2B5G B;  1Y7E A;  2PQ8 A;  1A2Z A;  2ZEP A;  4KLV A;  2XPO A;  4ZY0 A;  2AE6 A;  3PB7 X;  4ZBG A;  3TLY A;  2Q43 A;  1KUY A;  3P2F A;  4MHP A;  1HEE A;  3QB8 A;  4MY0 A;  3TO6 A;  1YW4 A;  3GYA A;  4QB9 A;  2WSA A;  4MXU A;  3B2Y A;  3IC1 A;  2Z11 A;  1JDE A;  2PJC A;  4PPZ A;  3VAR A;  5J8F A;  5I0C A;  2WPX A;  4NGP A;  1CJW A;  3PB6 X;  4JJX A;  2BOA A;  4HKF A;  4XPL A;  5LYI A;  3O8Z A;  3TCV A;  2MP0 A;  4YGO A;  2GP4 A;  4P4F A;  1UWY A;  2BCO A;  3GIU A;  3ZJ0 A;  3G8W A;  1QSM A;  1Q2C A;  2WZN A;  4Q36 A;  3IEH A;  5HVF A;  3IWE A;  5HVH A;  4KVX A;  4A4C A;  2PJ6 A;  3SJX A;  2ZEH A;  3H8E A;  3S9M A;  4RUH A;  3TT2 A;  2VI7 A;  4AB7 A;  4NSQ A;  4JYW A;  2ODF A;  3BJ8 A;  2PR1 A;  3MGD A;  3IIB A;  5HKZ A;  1RTQ A;  1IB1 E;  2CY2 A;  1YLO A;  1MJ9 A;  2PJ9 A;  4BPU B;  2O4H A;  5LYD A;  3LOD A;  1M4I A;  3TOB A;  3KQX A;  3DNS A;  4EME A;  4HPS A;  3F0A A;  5KTD A;  4C9R A;  2B5G A;  3LMS A;  1GHE A;  2O53 A;  3KHZ A;  4FD5 A;  4C85 A;  4R76 A;  4KSF A;  1TF9 A;  4KOY A;  4NGT A;  2POK A;  2Z3K A;  4OKO A;  4FWU A;  4XPK A;  4X2T A;  1AUG A;  1BPM A;  4NGS A;  4XNH C;  2FCK A;  4ZYQ A;  3I1U A;  2GE3 A;  4R3L A;  4JVO A;  3TYX A;  1Z9U A;  4COB A;  2D4P A;  2FVG A;  4IAV A;  1XEB A;  2AFU A;  3TX8 A;  1NXJ A;  5IR2 A;  5I4M A;  3I74 A;  4MHN A;  1VIX A;  2QEC A;  1SQH A;  4LQ6 A;  4Q38 A;  3OP0 A;  1CP7 A;  1Z8T A;  1QQ9 A;  3D2P A;  4U9Y A;  5JQ4 A;  4UEE A;  1FBV A;  2HB6 A;  4B10 A;  1C30 B;  1FT7 A;  2PJ7 A;  4UIB A;  3TOA A;  1BOB A;  1ON0 A;  4A4B A;  5HKY A;  4P4B A;  2Z3P A;  3B3S A;  5DS0 A;  4CAV A;  4XPD C;  1WK4 A;  3S6G A;  3SJF A;  4YFJ A;  3IU1 A;  1VBG A;  3CDX A;  4Q7A A;  3BUM B;  4BMH A;  3LD2 A;  2AFX A;  5BWA B;  2I79 A;  1Q7L A;  2BO9 A;  2ZW7 A;  5HH1 A;  4BPW B;  1FNO A;  2WPW A;  4BTF A;  5JYB A;  3WR7 A;  5CNP A;  3BI0 A;  3VRQ A;  2ZEL A;  4PXD A;  4CYP A;  4NGN A;  4OC4 A;  5IB9 A;  2REE A;  4DUK A;  1ARM A;  1XMT A;  1I12 A;  4UWI A;  5IB0 A;  2Q51 A;  3D7G A;  1LAN A;  2PJA A;  3BXM A;  3JUW A;  4TNU A;  3KAS A;  2EZA A;  4MI1 A;  3S6F A;  4C7H A;  2XPP A;  1Z2L A;  5KTC A;  2JBJ A;  1XIX A;  2OLS A;  1KBL A;  3T07 A;  2CTC A;  4MFQ A;  5AG6 A;  1MJB A;  4MBU A;  5THW A;  5D29 A;  4B14 A;  4CAE A;  4FBE A;  4UCN A;  3TO9 A;  2HI6 A;  3DDD A;  2Y0M A;  3QAY A;  4HNW B;  5E96 A;  2BUE A;  3WC7 A;  4F0Y A;  4PK2 A;  2Z3O A;  3T05 A;  4KOW A;  2ATR A;  4RN7 A;  2VZZ A;  1Y9K A;  4KNG E;  3B8G A;  4P10 A;  3EZE A;  4C84 A;  4YU9 A;  4C8T A;  2C6P A;  3NH4 A;  4Z65 A;  2REF A;  3FX6 A;  4CGP A;  4EYS A;  4PXB A;  3EZB A;  2Q7S A;  3FXT A;  3JVN A;  1BLL E;  2GLJ A;  5JPH A;  3SXN A;  4C7I A;  3HMJ G;  1S60 A;  5DWN A;  3D68 A;  4B12 A;  3B3T A;  4UCP A;  2AFZ A;  3CXQ A;  2Q4Z A;  1Z4R A;  5LRG A;  4CRZ B;  4E2A A;  1S3Z A;  2GIV A;  3W6S A;  5F47 A;  3DSB A;  4C9E A;  2PVV A;  1ZLH A;  3FEE A;  1LRZ A;  3K9U A;  4BD9 A;  2ZXV A;  1Y9Z A;  2PRB A;  3VGO A;  1CG2 A;  1M44 A;  2PDO A;  3QAH A;  3G23 A;  2OZU A;  3B3V A;  2PJ4 A;  3V8I A;  1VGY A;  1S5K A;  1CM0 A;  3VRO A;  2AFM A;  4X3R A;  2P0W A;  2PR8 A;  2Q44 A;  2CNM A;  2PVW A;  2ZEO A;  3MN8 A;  4YRH A;  2Q7B A;  4CGO A;  5ISV A;  4IIX A;  3GY9 A;  2VEZ A;  1Q2D A;  4EFD A;  5AXI A;  2Y1N A;  3R96 A;  3CT9 A;  3IFE A;  3P2H A;  1EZA A;  1ZYM A;  3C8O A;  3WT4 A;  2V8G A;  1YX0 A;  1P4N A;  2JBK A;  4C68 A;  4UEF A;  2F8H A;  2KCW A;  4MMO A;  4P4D A;  1FY7 A;  4NFR A;  1R3N A;  5G21 A;  2ARH A;  1YVH A;  2ZEG A;  3CXS A;  1LFW A;  1NSL A;  4OC0 A;  4BPX B;  2CNT A;  1Z8W A;  8CPA A;  3KQZ A;  2ZED A;  1AMP A;  2GFQ A;  1CX8 A;  3D2M A;  2CBL A;  4O23 A;  4X5K A;  1VHO A;  2Z3N A;  4NGM A;  2GLF A;  1AYE A;  4MFK A;  2CIJ A;  4KUB A;  1F57 A;  1ZLI A;  1LAM A;  4GM5 A;  4C2X A;  1XBU A;  2EBJ A;  2B3U A;  4ZY2 A;  2WYR A;  1B47 A;  1ZG8 A;  3F8K A;  1Y0Y A;  2Z3M A;  4KSA A;  4IF5 A;  1ZG9 A;  4UFX A;  2FIA A;  1F2O A;  2PIY A;  4CGN A;  2ZOF A;  1IOF A;  3BHX A;  2B4D A;  4NF1 A;  4R57 A;  4OIW A;  2WUU A;  3QNV A;  3S9N A;  2C6C A;  2VXK A;  3KHX A;  4M6H A;  2IL4 A;  3NE7 A;  2XEJ A;  3PFO A;  4KOR A;  4UCM A;  4ZY1 A;  1NBW A;  5K99 A;  3JRU A;  4OAD A;  4INJ A;  3SXO A;  2JDC A;  3D7F A;  2Q04 A;  3V7Z A;  4KZT A;  5AGE A;  2C1C A;  4FUU A;  4PXE A;  3BUW B;  4QVT A;  4LX9 A;  3D7H A;  4R6T A;  4WWV A;  3H4Q A;  3R9G A;  5JH9 A;  1TIQ A;  1S7L A;  1TKF A;  4IUS A;  3EO4 A;  3DR6 A;  1M1D A;  3H5Z A;  2EVN A;  3GKR A;  4CZ1 A;  3S6H A;  2Q4V A;  2PJ5 A;  3EY5 A;  4JXQ A;  2RC4 A;  2PRQ A;  3OB2 B;  5G20 A;  3OWC A;  3VAT A;  1MJA A;  1YVO A;  3B35 A;  2PCU A;  4PV6 A;  1ZG7 A;  4A39 A;  4MHD A;  4B6Z A;  4UFV A;  5AG4 A;  3HPG G;  3K2K A;  1VHS A;  2JEV A;  4WJB A;  4MY3 A;  3IGR A;  3T90 A;  4CAX A;  5KTA A;  3PB4 X;  5HXD A;  3EZA A;  2YNE A;  2G3T A;  4B5P B;  4H1H A;  2PJ2 A;  4BBH A;  3FVL A;  3KZW A;  4XNH B;  2CTB A;  4MHY A;  1XF8 A;  2I3C A;  2FS5 A;  4ZX9 A;  3PFE A;  4R8F A;  4AVA A;  5CPA A;  5LYL A;  1S7F A;  4M6G A;  5FVJ A;  4EVY A;  2JLM A;  1JDB C;  1X12 A;  4TJV A;  2IQ6 A;  2QVP A;  3DLJ A;  3T5M A;  4CAW A;  1PYT B;  5BY0 A;  2EUI A;  1QSO A;  4NEX A;  4F8Z A;  2VL1 A;  2J8N A;  2QML A;  3FJU A;  4JZ0 A;  1YK3 A;  4OID A;  5HVG A;  1GGO A;  2AFO A;  4UEZ A;  4AXV A;  4CYO A;  3TLA A;  4E5S A;  2P6F A;  5G22 A;  2D0O A;  3TTH A;  1EZB A;  2IJZ A;  3DR8 A;  3I3G A;  4OAE A;  2R1I A;  4QC6 A;  2FL4 A;  4YN3 A;  3BJ7 A;  2ZW4 A;  4JD6 A;  4OP4 A;  2EK9 A;  4XPD B;  2EZB A;  4W9Y A;  1CBX A;  1DIK A;  3NH8 A;  1M4D A;  3BUO B;  1MK4 A;  1VKC A;  2FIW A;  1EO0 A;  3RBU A;  4A33 A;  3PEI A;  2R82 A;  4UA3 A;  5EC4 A;  2ZPA A;  2H5M A;  4JLY A;  4AVB A;  1V6C A;  1VBH A;  4QUS A;  1QST A;  4MFP A;  3FRM A;  2F7V A;  1ZO0 A;  3ZZI A;  3D67 A;  5GCN A;  5HMN A;  4I49 A;  4U9Z A;  2HWG A;  2DEA A;  4B5P A;  5IX3 A;  4GS4 A;  2B58 A;  1OZP A;  1H8L A;  2AFW A;  1JQG A;  1XRY A;  4B11 A;  2BSW A;  3BI1 A;  1PU9 A;  2J8M A;  4AG7 A;  3IJ3 A;  1NMT A;  3D3S A;  4PK3 A;  3F5B A;  3TLB A;  2XPL A;  3ISZ A;  3TLE A;  3FB3 A;  2FM4 A;  1YVK A;  3SI0 A;  3VWD A;  4M3S A;  1OBR A;  4CDJ A;  3JTK A;  5FD8 A;  2AUN A;  5H84 A;  4OC1 A;  4A37 A;  1CPX A;  3T0T A;  1ARL A;  1ZL0 A;  2OZH A;  4CGL A;  1Y9W A;  5K8O A;  1M4G A;  3KL9 A;  4HNX B;  4H6Z A;  3WC5 A;  4NGQ A;  1BXR B;  3HLP A;  2EK8 A;  2Z0Z A;  4JXR A;  4MCP A;  2B4B A;  2CNS A;  1P0H A;  3IWW A;  1YGH A;  2D4O A;  4G1P A;  4IK2 A;  3GLJ A;  5LRJ A;  2X7B A;  1B6B A;  4K3N A;  1M4L A;  3R1K A;  4LUA A;  3SI1 A;  2V8D A;  4CS0 B;  1M6V B;  5HKW A;  4FD7 A;  5A28 A;  3WC6 A;  1KWM A;  3FYN A;  4C8F A;  4Y49 C;  4OME A;  4NJQ A;  4F9V A;  2GRE A;  1HDU A;  2GU2 A;  2CXA A;  2PJ0 A;  3D7D A;  1Y0R A;  3NFZ A;  4UWJ A;  3EIF A;  1XFO A;  1ELM P;  4KS9 A;  4OC5 A;  1HDQ A;  1ELL P;  4PQA A;  3K9T A;  2Z3L A;  3PB8 X;  2DXQ A;  1R57 A;  5AG7 A;  1DE4 C;  1BO4 A;  3L2N A;  1R61 A;  3GJZ A;  1KUV A;  4NCZ A;  4CYQ A;  2IMO A;  2AFS A;  3SR3 A;  1I1D A;  1KZF A;  4GXH A;  3KKW A;  3LAC A;  2PE3 A;  4M85 A;  3PB9 X;  2DLA A;  2Q4Y A;  4L89 A;  3SJG A;  2HC9 A;  3CXP A;  4M8D A;  1J4J A;  3W91 A;  4PSX A;  2J9A A;  6CPA A;  2E28 A;  3VWE A;  2X0S A;  3VRR A;  1IOI A;  4P44 A;  4MFL A;  2AUM A;  3TLC A;  4MFZ A;  5J3X A;  4MHZ A;  4MJX A;  4C8A A;  2P6G A;  3IWG A;  4P6Y A;  3OAK A;  4OC2 A;  1DTD A;  1ZRS A;  4L8A A;  4OC3 A;  4UIA A;  1IYK A;  2YNC A;  1XMB A;  2V8V A;  3R9F A;  3W6X A;  1JWQ A;  3D4U A;  1IY7 A;  2QJ8 A;  3F9K C;  5JVL A;  5EMI A;  5K8N A;  4KVO E;  4DYO A;  2ZEM A;  4MI4 A;  3KRV A;  4H2K A;  4NJR A;  5H86 A;  1TKJ A;  5EBV A;  4BIN A;  4CGM A;  2XPN A;  2VKZ G;  2YGW A;  3G3S A;  2P6E A;  2XEI A;  2DPS A;  2GAN A;  3R9E A;  4ONU A;  4ORF A;  4KOU A;  2OH1 A;  3FBU A;  4II9 A;  2VZY A;  1V0C A;  1IU8 A;  4GPL B;  2FE7 A;  3KR5 A;  5AG5 A;  4P45 A;  4QBJ A;  3FIX A;  2V8H A;  2DPT A;  4NXY A;  3TLG B;  2FXF A;  2PJ8 A;  3T8W A;  4KLW A;  3FH4 A;  5K8P A;  2G3A A;  4COG A;  1WVM A;  3A9L A;  3C26 A;  4YWY A;  3D66 A;  3UY5 A;  2J8R A;  7CPA A;  3SI2 A;  1GYT A; 
#chains in the Genus database with same CATH homology
 4C8C A;  3NA6 A;  5LRK A;  5F09 A;  4NGR A;  5CBM A;  3B3C A;  3GB0 A;  2CF4 A;  3MRU A;  5ELY A;  4ZI6 A;  3PBB A;  2PIZ A;  1LOK A;  4MRI A;  1Z8L A;  3FEC A;  4DJL A;  3LWU A;  1YSJ A;  4P4J A;  4UF4 A;  4IHM A;  4MCQ A;  3H8G A;  2XEG A;  4A38 A;  4F9U A;  2C6G A;  2ZEN A;  1Z5R A;  3N5F A;  3VTA A;  1R43 A;  2ANP A;  1XF1 A;  1EE3 P;  3V38 A;  4CPA A;  4X8I A;  1BAV A;  2EWB A;  3RZA A;  4C99 A;  2ABZ A;  4ZX8 A;  1CP6 A;  2V77 A;  1IGB A;  1QMU A;  4C86 A;  4MCR A;  5JGF A;  4C9U A;  3H8F A;  1YME A;  1XJO A;  2G9D A;  4EWT A;  2RB7 A;  4CDK A;  3CPX A;  1TKH A;  4C9V A;  2PJ3 A;  3IO1 A;  1NSA A;  3PRT A;  5JM6 A;  3FMC A;  4P4E A;  3RAM A;  4KSI A;  1TXR A;  4LQG A;  1GYT A;  2ZEE A;  3GUX A;  3VH9 A;  1LAP A;  3KR4 A;  4ONW A;  4PXC A;  4TJX A;  2OOT A;  3KGQ A;  4C8U A;  5LYF A;  2JEW A;  2C5Q A;  5D8N A;  3NH5 A;  3ISX A;  3S9L A;  3HUV A;  2XEF A;  3FF3 A;  2QYV A;  1PCA A;  2ZEF A;  3KI9 A;  3CPA A;  4R7M A;  3TC8 A;  3B7I A;  3I6S A;  5K8M A;  3B3W A;  4P4I A;  1F2P A;  2ZOG A;  5J1Q A;  3ICU A;  2NSM A;  2RFH A;  1TF8 A;  1BPN A;  4C9A A;  4MCS A;  3DGV A;  2OR4 A;  4TWE A;  1YW6 A;  1VHE A;  1CPS A;  1LCP A;  4FAI A;  5JH9 A;  2PJ1 A;  4A94 A;  2NYQ A;  3PBE A;  3SJE A;  3WAB A;  3FED A;  4C8P A;  1Y7E A;  2ZEP A;  4ZY0 A;  3PB7 X;  2Q43 A;  4MHP A;  1HEE A;  1YW4 A;  4MXU A;  3B2Y A;  3IC1 A;  2PJC A;  4PPZ A;  3VAR A;  4NGP A;  3PB6 X;  2BOA A;  5LYI A;  2GP4 A;  4P4F A;  1UWY A;  2BCO A;  2WZN A;  5HVF A;  3IEH A;  5HVH A;  2ZEH A;  2PJ6 A;  3SJX A;  3H8E A;  3S9M A;  4RUH A;  4JYW A;  3IIB A;  1RTQ A;  1YLO A;  2PJ9 A;  2O4H A;  5LYD A;  4EME A;  3KQX A;  4C9R A;  3LMS A;  4C85 A;  2O53 A;  3KHZ A;  4R76 A;  1TF9 A;  4NGT A;  2POK A;  4OKO A;  4FWU A;  4X2T A;  1BPM A;  4ZYQ A;  4NGS A;  3I1U A;  2FVG A;  4IAV A;  2AFU A;  3TX8 A;  5IR2 A;  5I4M A;  3I74 A;  4MHN A;  1VIX A;  1CP7 A;  1QQ9 A;  4UEE A;  2HB6 A;  1FT7 A;  2PJ7 A;  4UIB A;  4P4B A;  3B3S A;  5DS0 A;  3SJF A;  3CDX A;  4Q7A A;  2AFX A;  1Q7L A;  2BO9 A;  1FNO A;  3BI0 A;  2ZEL A;  4PXD A;  5IB9 A;  4NGN A;  4OC4 A;  4DUK A;  1ARM A;  2Q51 A;  3D7G A;  1LAN A;  2PJA A;  3BXM A;  4TNU A;  3KAS A;  1Z2L A;  2JBJ A;  2CTC A;  5THW A;  5D29 A;  3WC7 A;  4KNG E;  4P10 A;  4C84 A;  4YU9 A;  4C8T A;  2C6P A;  3NH4 A;  4Z65 A;  3FX6 A;  4PXB A;  1BLL E;  2GLJ A;  3D68 A;  3B3T A;  2AFZ A;  2Q4Z A;  5LRG A;  4C9E A;  2PVV A;  1ZLH A;  3FEE A;  4BD9 A;  1Y9Z A;  1CG2 A;  3B3V A;  2PJ4 A;  1VGY A;  2AFM A;  4X3R A;  3MN8 A;  2ZEO A;  2PVW A;  4EFD A;  3CT9 A;  3IFE A;  3WT4 A;  2V8G A;  2JBK A;  4UEF A;  2F8H A;  4MMO A;  4P4D A;  4NFR A;  1R3N A;  2ZEG A;  1LFW A;  4OC0 A;  8CPA A;  3KQZ A;  2ZED A;  1AMP A;  4O23 A;  1CX8 A;  1VHO A;  4NGM A;  2GLF A;  1AYE A;  2CIJ A;  1F57 A;  1ZLI A;  1LAM A;  4GM5 A;  1XBU A;  4ZY2 A;  2WYR A;  1ZG8 A;  1Y0Y A;  1ZG9 A;  1F2O A;  2PIY A;  2ZOF A;  3BHX A;  4OIW A;  3QNV A;  3S9N A;  2C6C A;  3KHX A;  4CDJ A;  4ZY1 A;  3PFO A;  2XEJ A;  3JRU A;  3D7F A;  3V7Z A;  2C1C A;  4FUU A;  4PXE A;  3D7H A;  4R6T A;  4WWV A;  1TKF A;  2PJ5 A;  2PRQ A;  3VAT A;  3B35 A;  2PCU A;  1ZG7 A;  4A39 A;  4B6Z A;  3K2K A;  4WJB A;  3PB4 X;  5HXD A;  2PJ2 A;  3FVL A;  3KZW A;  2CTB A;  4MHY A;  4ZX9 A;  2I3C A;  5LYL A;  3PFE A;  4R8F A;  5CPA A;  4TJV A;  2IQ6 A;  2QVP A;  3DLJ A;  1PYT B;  4F8Z A;  2VL1 A;  3FJU A;  5HVG A;  4JZ0 A;  4OID A;  2AFO A;  4UEZ A;  4AXV A;  2IJZ A;  4YN3 A;  4OP4 A;  2EK9 A;  4W9Y A;  1CBX A;  3NH8 A;  3RBU A;  3PEI A;  1V6C A;  2F7V A;  3D67 A;  2DEA A;  1H8L A;  2AFW A;  1JQG A;  1XRY A;  3BI1 A;  3IJ3 A;  3ISZ A;  3SI0 A;  1OBR A;  4OC1 A;  4A37 A;  1CPX A;  1ARL A;  5K8O A;  3KL9 A;  3WC5 A;  4NGQ A;  2EK8 A;  4MCP A;  3IWW A;  4IK2 A;  4G1P A;  5LRJ A;  3GLJ A;  4FBE A;  4K3N A;  1M4L A;  3SI1 A;  2V8D A;  3WC6 A;  1KWM A;  4C8F A;  4OME A;  4NJQ A;  4F9V A;  2GRE A;  1HDU A;  2GU2 A;  2PJ0 A;  3D7D A;  1Y0R A;  3NFZ A;  3EIF A;  1XFO A;  1ELM P;  4OC5 A;  1HDQ A;  1ELL P;  4PQA A;  3K9T A;  3PB8 X;  1DE4 C;  3L2N A;  2IMO A;  2AFS A;  2PE3 A;  3PB9 X;  3SJG A;  2HC9 A;  6CPA A;  2J9A A;  4C8A A;  4P44 A;  4MHZ A;  4P6Y A;  4OC2 A;  1DTD A;  4OC3 A;  4UIA A;  1XMB A;  2V8V A;  3D4U A;  1IY7 A;  2QJ8 A;  5K8N A;  4DYO A;  2ZEM A;  4H2K A;  4NJR A;  1TKJ A;  2XEI A;  3KR5 A;  4P45 A;  2V8H A;  2PJ8 A;  3T8W A;  3FH4 A;  5K8P A;  1WVM A;  4YWY A;  3D66 A;  2PJB A;  7CPA A;  3SI2 A;  3HLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...