2C6PA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with phosphate anion
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
694
structure length
677
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
publication title Structure of Glutamate Carboxypeptidase II, a Drug Target in Neuronal Damage and Prostate Cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 227
structure length 677
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2c6pA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2c6pA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c6pA02
3SI0A 2GU2A 4OC5A 3HLPA 4ZI6A 3JRUA 1VHEA 3CDXA 5HVFA 2HC9A 4C85A 1YLOA 2WYRA 4H2KA 4C8TA 4NJRA 4NGQA 3WC5A 4C9EA 3RBUA 1ZLHA 4NJQA 2EWBA 2RFHA 4JZ0A 1GYTA 1R43A 1QMUA 1CG2A 1YW6A 3EIFA 2V8DA 1DE4C 4YWYA 4PXBA 4OIDA 4GM5A 4G1PA 1PYTB 3DLJA 2IJZA 1VHOA 1F2PA 2ZEEA 5JGFA 4OC1A 4C8FA 3PB6X 3V38A 2PJ9A 3PBBA 3D7DA 3B3CA 3GUXA 3VTAA 5IB9A 4B6ZA 2ZOFA 1V6CA 3B3VA 3FX6A 1R3NA 1YSJA 3PFOA 2V8VA 3K2KA 2ZEOA 5F09A 5HXDA 1LAPA 1BPNA 4MCRA 4MCPA 1Z2LA 1Y7EA 3H8EA 4IHMA 3S9MA 1BAVA 3KHXA 3FECA 3SI2A 3LWUA 3KR5A 3VARA 3SJGA 3I1UA 4FUUA 3RAMA 3PB8X 3BXMA 3KR4A 4EFDA 4PPZA 4UF4A 3D7FA 4EWTA 2XEFA 3WT4A 3PEIA 4UEZA 2GLJA 2PRQA 5ELYA 4F8ZA 4Z65A 3IO1A 5CBMA 3GLJA 2V8HA 1UWYA 1FNOA 4NGSA 4FAIA 2GREA 1LAMA 3IWWA 3PRTA 2XEJA 2NSMA 2AFOA 3S9LA 3CT9A 2ZEGA 2O53A 3MRUA 4MHYA 2CF4A 3FF3A 3FJUA 2JBJA 1ZLIA 4R76A 3VATA 1Y0RA 3I74A 1YMEA 2FVGA 4P4FA 1TKHA 4OP4A 1RTQA 4BD9A 4A38A 6CPAA 2C6PA 4A39A 4F9UA 3TX8A 4P6YA 2C6CA 3B2YA 1ZG8A 5CPAA 5D8NA 2PIZA 1WVMA 3PB9X 1BLLE 2PVWA 4P4JA 3MN8A 1M4LA 5D29A 2Q43A 1LOKA 2AFWA 3D7HA 1XRYA 2AFXA 4UIBA 5I4MA 5JM6A 1XF1A 2XEIA 2IQ6A 1TKFA 4MRIA 4R7MA 2PE3A 4OIWA 2JBKA 3D66A 8CPAA 2F7VA 1PCAA 3NH4A 4C8CA 5LRJA 1LANA 1XBUA 4NGRA 1ARLA 3ISZA 2PJ8A 2CIJA 5K8OA 4MHPA 4UEEA 1XFOA 2ZEMA 2PIYA 5HVHA 3K9TA 4C86A 2PJCA 4ONWA 3WC7A 2BCOA 4CPAA 3NH5A 4KNGE 1TF9A 4ZX9A 4PQAA 4MCQA 1ELLP 1AYEA 4P4BA 2C6GA 1OBRA 5JH9A 4DJLA 3L2NA 3NH8A 4C9UA 4ZY2A 5K8PA 3IIBA 1QQ9A 3IFEA 2PJAA 1TF8A 2ZOGA 4Q7AA 2QYVA 4FBEA 2PVVA 4A37A 5LYFA 3ISXA 4YN3A 2ZEPA 2ZEFA 3GB0A 1ARMA 4TJVA 3FEDA 3D68A 3VH9A 4C8PA 4RUHA 2O4HA 3V7ZA 1CBXA 2OOTA 2PJ0A 4TJXA 2QJ8A 4OC3A 4X3RA 1KWMA 4YU9A 1F2OA 4CDKA 4DYOA 4C84A 4PXCA 1LFWA 2ABZA 3LMSA 1CPXA 1XMBA 2IMOA 4IK2A 4CDJA 2PJ2A 3B3WA 1YW4A 3NFZA 4P4IA 4NFRA 4A94A 4ZY0A 3BI1A 4PXEA 1F57A 3KHZA 4C9RA 1NSAA 4R6TA 5DS0A 4ZY1A 7CPAA 2HB6A 3QNVA 3SI1A 5THWA 4MHZA 2VL1A 3N5FA 4O23A 1LCPA 3KGQA 3RZAA 4MMOA 2J9AA 4P10A 2CTBA 2EK9A 1IY7A 4OC0A 2GLFA 1DTDA 2BOAA 5LYLA 3D67A 3CPAA 4OKOA 2AFMA 4MXUA 3FH4A 2JEWA 1CP6A 3H8FA 4WWVA 1VGYA 1Z5RA 4K3NA 4EMEA 4FWUA 3B3SA 3H8GA 4X2TA 2C1CA 3PB4X 3SJXA 3IC1A 3B35A 2AFUA 4MHNA 3DGVA 3T8WA 4LQGA 3BHXA 2RB7A 2PJ6A 2V77A 2F8HA 2DEAA 2Q4ZA 1BPMA 1TXRA 3FEEA 4TWEA 2POKA 2PJ5A 1TKJA 1IGBA 4ZX8A 4P44A 1JQGA 2G9DA 2XEGA 3SJEA 2BO9A 3KQZA 2OR4A 3HUVA 4F9VA 3IJ3A 5K8NA 3FVLA 2ZENA 5LRGA 3BI0A 2Q51A 4NGTA 1VIXA 4MCSA 3S9NA 4JYWA 3D4UA 4ZYQA 2AFSA 5LRKA 4OC4A 2I3CA 3KASA 1ZG7A 3PB7X 3FMCA 4IAVA 2PJ3A 4W9YA 4C8UA 4UIAA 2ZEDA 2PJ7A 4AXVA 5J1QA 2AFZA 2WZNA 4OMEA 3IEHA 3B7IA 1Z8LA 1CPSA 2PCUA 4C99A 1Y9ZA 4KSIA 1EE3P 1XJOA 3KQXA 4OC2A 2CTCA 3KZWA 3NA6A 3PBEA 2ZELA 4UEFA 4P45A 1H8LA 2QVPA 4PXDA 1ZG9A 2ZEHA 2PJ4A 4WJBA 2V8GA 4C8AA 1HDQA 3KI9A 3TC8A 4NGNA 4P4EA 1Y0YA 3SJFA 4C9VA 1CP7A 1FT7A 5K8MA 3I6SA 4NGPA 2EK8A 5LYDA 1HDUA 3WC6A 3WABA 2ANPA 4R8FA 4P4DA 2PJBA 4TNUA 5HVGA 4X8IA 4C9AA 3D7GA 3PFEA 1HEEA 2NYQA 1Q7LA 4DUKA 4NGMA 2PJ1A 1CX8A 1AMPA 1ELMP 3B3TA 3KL9A 3ICUA 5LYIA 3CPXA
chains in the Genus database with same CATH superfamily
3SI0A 2MP0A 3BUOB 3FBUA 1B87A 1IYLA 3JVNA 2Q44A 2WUUA 2GU2A 4OC5A 3HLPA 4BPUB 4C2ZA 1KUYA 2PQ8A 4ZI6A 3JRUA 1VHEA 1YX0A 4UFXA 2Q4VA 3CDXA 4Y49B 5HVFA 1Q2DA 2HC9A 1YLOA 3OAKA 2WYRA 4H2KA 4C8TA 4C85A 4NJRA 1S7NA 1CJWA 1GHEA 2HUZA 1XEBA 4RS2A 3BUXB 2BL1A 3QAHA 4NGQA 5EMIA 5FD8A 3WC5A 4H89A 2XPOA 3TYXA 4R3LA 4C9EA 3RBUA 2Q4YA 1ZLHA 4MJ8A 4NJQA 4MFQA 1C3OB 2OZHA 3EZBA 4ZGYB 2EWBA 2RFHA 1YREA 2DF5A 4XPKA 4JZ0A 1AUGA 2Y1MA 1GYTA 3G23A 3VGOA 3ZNIA 1R43A 3CXPA 5JQ4A 2ZW5A 1QMUA 1CG2A 4M6IA 4QC6A 2YGWA 4LQ6A 1YW6A 4UWIA 5F13A 2B4JC 5H84A 4KVME 3OP0A 4XPLA 2CY2A 3EC4A 4A33A 3EIFA 1LRZA 3LACA 4MFZA 4B11A 2GFQA 1B47A 2V8DA 3D3SA 1DE4C 3F9KC 4YWYA 4PXBA 2FXFA 4OIDA 4PK3A 2B4DB 4CAEA 4BINA 3DR8A 4GM5A 5F48A 1K4JA 4G1PA 4UBRA 4J3GA 1PYTB 3DLJA 2IJZA 1VHOA 2AJ6A 3F0AA 3K9UA 1F2PA 3RO0A 3T05A 3TLAA 2D4PA 4MBUA 2ZEEA 2JEVA 5JGFA 4OC1A 3TT2A 3CXQA 5KTAA 4C8FA 3PB6X 3V38A 1QSNA 1SQHA 2PJ9A 2Z3NA 3PBBA 2B58A 3D7DA 3B3CA 3GUXA 5F46A 2PR8A 3VTAA 5IB9A 2EO8A 4B6ZA 4EVYA 3BJ8A 2ZOFA 1YGHA 4QUSA 3TFYA 1V6CA 1I21A 2G3AA 3U1BA 3B3VA 3D2MA 3FX6A 1MK4A 1R3NA 1YSJA 2EUIA 1ZO0A 3HPHE 2ODFA 2V8VA 2ZEOA 2QIRA 5F09A 3K2KA 4XNHC 5HXDA 3IGRA 1LAPA 2OZUA 1BPNA 3TLEA 4MCRA 3R1KA 4MCPA 3PT1A 1KZFA 1Z2LA 1Z9EA 3TLGB 1QSOA 1Y7EA 3H8EA 4IHMA 1M4GA 5DWNA 3R95A 1KUVA 4KZTA 3S9MA 1BAVA 3DNSA 3KHXA 3NE8A 2VQYA 3CXSA 3FXTA 3FECA 3PFVA 1WK4A 3SI2A 1XF8A 3E0KA 4M8DA 3LWUA 2H5MA 3JUWA 3PZJA 3KR5A 1JWQA 4ORFA 4U9ZA 5BY0A 4IIXA 3T5MA 3P2HA 2CNTA 3VARA 1WJTA 3SJGA 3I1UA 4FUUA 4LX9A 3PB8X 3BXMA 4KOUA 4OLLA 3KR4A 3RAMA 4PPZA 4EFDA 2AUNA 3VRRA 4JXRA 2Z3MA 3SXOA 2YJVA 4UF4A 4CYQA 3D7FA 1L0CA 2QMLA 1XE4A 4NEXA 5CNPA 4EWTA 2XEFA 3WT4A 4UA3A 4C2XA 3PEIA 4UEZA 2GLJA 2PRQA 4CYOA 5ISVA 4KOVA 3OB1B 5ELYA 4F8ZA 4Z65A 2PRBA 2OLSA 2B4BA 4KOSA 3IO1A 5CBMA 3GLJA 4BTFA 4B5OA 4NXYA 5EC4A 3BUMB 2N3AB 1S7FA 5K99A 2V8HA 1UWYA 1FNOA 4CGMA 4NGSA 1UFHA 1Z8XA 2A4NA 2GREA 4FAIA 1BXRB 1V0CA 1LAMA 3IWWA 2ZW6A 1QSMA 3PRTA 2XEJA 1J4JA 4PV6A 3JTKA 2NSMA 2AFOA 4KOWA 3S9LA 1KUXA 3CT9A 2ZEGA 3O8ZA 3S6FA 2HI6A 2O53A 3TE4A 3MRUA 2WSAA 3H4QA 3C26A 4MHYA 4A4CA 2CF4A 4Q36A 3FF3A 3FJUA 3TCVA 5JVLA 2JBJA 1ZLIA 4R76A 3VATA 4CZ1A 1Y0RA 5AG5A 2JLMA 2KCWA 3S6HA 4AVBA 1J3LA 3I74A 3TO7A 3TLGA 4HNYB 1YMEA 2FVGA 3TOBA 5IV0A 3DDDA 4P4FA 1TKHA 2Q0YA 2O28A 4OP4A 1RTQA 3T9YA 4BD9A 4A38A 6CPAA 4F0YA 4MFKA 2C6PA 2YNEA 4E2AA 4A39A 4KORA 4J0NA 2B3VA 3VWEA 4KOTA 4I49A 3GY9A 4F9UA 4JVOA 1KC7A 5G20A 3TX8A 1M4IA 1KEEB 2ZXVA 4A30A 4P6YA 2C6CA 4E94A 3OWCA 3B2YA 1ZG8A 2C27A 5CPAA 5D8NA 2PIZA 2J8RA 1IB1E 3SHPA 2YNDA 1WVMA 3PB9X 1BLLE 4KUBA 2PVWA 4QVTA 4M6GA 2PR1A 4P4JA 3GIUA 3MN8A 3D2PA 1M4LA 4C2YA 3K4IA 2YNCA 4HPSA 4HNXB 2FIAA 5D29A 2X7BA 5AGEA 3S6GA 2CNMA 2OZGA 1IYKA 2Q43A 4C7IA 1LOKA 2VBQA 2AFWA 3D7HA 1XRYA 2AFXA 5J3XA 3I3GA 4UIBA 5I4MA 5JM6A 1XF1A 1IU8A 2XEIA 2IQ6A 2X0SA 1TKFA 4OADA 1Y7RA 4MRIA 4R7MA 3G8WA 2YNCC 2PE3A 4OIWA 1YLEA 4E0AA 2JBKA 1I12A 3D66A 5C88A 8CPAA 2F7VA 3D8PA 4BMHA 2D0OA 1EZBA 3OB2B 1PCAA 1CE8B 5F1YA 2OB0A 5BWAB 3NH4A 1GGOA 2XPPA 5EBVA 2AUMA 4MI1A 4C8CA 5LRJA 3IWEA 2Z0ZA 4LUAA 1I1DA 4CAVA 1LANA 1XBUA 1WWZA 4B5PB 4CYNA 3TO6A 4NGRA 3EZEA 4R3KA 5G21A 3FIXA 5F47A 2OU2A 4F6AA 2EZCA 3HPGG 1NE9A 2FS5A 4NCZA 1IOFA 1JDBC 1ARLA 3ISZA 2PJ8A 2CIJA 1M1DA 4FD5A 5K8OA 3VROA 4MHPA 4UEEA 5KTDA 1XFOA 2ZEMA 1Q2YA 1P0HA 2XPLA 2PIYA 3V8IA 5HVHA 3K9TA 2HWGA 4C86A 2PJCA 4BPWB 1PU9A 4ONWA 1IIDA 3WC7A 2BCOA 5KTCA 4AVAA 1MJAA 3NH5A 4CPAA 1TF9A 4ZX9A 1M6VB 1ZRSA 4KNGE 1MJ9A 4FD4A 4PQAA 4NF1A 3W91A 4MCQA 1ELLP 1AYEA 1PUAA 4P4BA 2C6GA 1OBRA 5A28A 5IX3A 4MY3A 3PLFB 4QB9A 4Y49C 5JH9A 2D0PA 2HROA 2R7HA 4DJLA 3L2NA 1YVHA 5AG7A 3NH8A 4KVXA 1VBGA 4C9UA 3IWGA 2GP4A 4RR2B 2B3UA 2AE6A 2PDOA 5G1ZA 4U9YA 4YRHA 4ONUA 2I79A 4ZY2A 5K8PA 3IIBA 1M4DA 1QQ9A 2P6FA 1TF8A 2PJAA 3IFEA 2ZOGA 4Q7AA 1YR0A 2QYVA 4C68A 4FBEA 2PVVA 4A37A 3R9GA 4XPDC 5LYFA 4UCPA 3ISXA 4CYPA 4YN3A 1N71A 2ZEPA 3VRPA 2ZEFA 3ZZIA 3GB0A 3FB3A 2B4DA 2F5IA 3CZXA 1ARMA 5HKWA 4TJVA 4IUSA 3ZJ0A 3FEDA 3D68A 2R98A 3VH9A 4A95A 4C8PA 4M3SA 2O4HA 3V7ZA 4RUHA 1M44A 4CAXA 2B0AA 1CBXA 4A31A 3IU1A 3T07A 3MGDA 4BBHA 2P6EA 3U88C 2OOTA 5AG4A 2PJ0A 4TJXA 2QJ8A 4OC3A 4B5PA 4X3RA 1KWMA 4YU9A 4CGOA 1F2OA 5AG6A 4CDKA 4DYOA 3BUNB 4C84A 4PXCA 1LFWA 4GXHA 2ABZA 4AB7A 3LMSA 4QBJA 5J8FA 1EO0A 4CO9A 1CPXA 1XMBA 2IMOA 2R1IA 4IK2A 4AG7A 4IIYA 2Q04A 4E8OA 4CDJA 1VHSA 2CNSA 2PJ2A 2Z3KA 3B3WA 4MHDA 3T90A 1VBHA 1YW4A 3NFZA 2FT0A 2WPWA 2BUEA 4P4IA 4NFRA 4A94A 4CRZB 4ZY0A 3BI1A 2E28A 4UCNA 4PXEA 1F57A 4CAWA 4CGPA 3KHZA 2VXKA 4C9RA 1NSAA 4B14A 1X10A 4MFJA 4R6TA 5DS0A 4A2ZA 4ZY1A 2DXQA 2DLAA 2GANA 2HB6A 1S5KA 3EY5A 3I9SA 3QNVA 7CPAA 2PCNA 5F5XA 3VRQA 2Z10A 4GPLB 2ARHA 5THWA 3SI1A 4MHZA 2Q7SA 2VL1A 3N5FA 2DPSA 3NFQA 4O23A 1ZL0A 2B5GB 1LCPA 3KGQA 4JLYA 3RZAA 4MMOA 4FD6A 2J9AA 2ZW7A 3FNCA 1XOVA 4L8AA 4P10A 2FM4A 1VKCA 2CTBA 2EK9A 1IY7A 4OC0A 2GLFA 3TOAA 1DTDA 4F0XA 2BEIA 4XNHB 2BOAA 5LYLA 3D67A 3TLYA 2YJTA 3N7ZA 3CPAA 1P4NA 4OKOA 2AFMA 2VEZA 2GIVA 2G3TA 2OH1A 4MXUA 1Z8TA 3FH4A 1Y9KA 4CGNA 2JEWA 5JYBA 4C7HA 1YVKA 1QSTA 4RN7A 1CP6A 3H8FA 1BO4A 4WWVA 4HKFA 4YFJA 2DIKA 3KKWA 2I00A 4AVCA 1VGYA 1Z5RA 4CGLA 4K3NA 4EMEA 3C8OA 2CXAA 3QB8A 4FWUA 1Z4EA 3B3SA 2Y0MA 2DPTA 3H8GA 4X2TA 5HKZA 1DIKA 1FY7A 5IR2A 2C1CA 4EYSA 1S7LA 3LODA 3PB4X 3SJXA 3P2FA 3S6KA 3HMJG 3IC1A 3B35A 4RI1A 2JDCA 4X5KA 1TIQA 4MI4A 2AFUA 2Z3LA 1Q5XA 4MHNA 2FIWA 4U5YA 1NMTA 3DGVA 1S60A 3SXNA 3W6SA 5IB0A 3T8WA 2Q7BA 4LQGA 3BHXA 2RB7A 2PJ6A 2Y1NA 2V77A 2CBLA 2F8HA 2VZYA 1Z4RA 3EXNA 2DEAA 3LD2A 4PSXA 4XPDB 4AG9A 5HMNA 2VKZG 4KVOE 2Q4ZA 1C30B 1TXRA 1BPMA 3FEEA 2VZZA 4TWEA 2POKA 3QAYA 2ZW4A 2PJ5A 1TKJA 3FYNA 2P0WA 1IGBA 4KOYA 4L89A 2FCKA 4ZX8A 1R57A 4P44A 1JQGA 2G9DA 2XEGA 4A4BA 3SJEA 2REEA 2Z11A 2BO9A 1QSRA 3BJ7A 5I0CA 3B8GA 5F9MA 2J8NA 3KQZA 1OZPA 1U6MA 4PK2A 2OR4A 5AXIA 3HUVA 4UFVA 1Y9WA 4F9VA 3IJ3A 5K8NA 3GKRA 4JD6A 2B5GA 3IU2A 4IF5A 4KS9A 4ZBGA 3FVLA 1NXJA 2ZENA 3A9LA 2ZPAA 4R87A 5H86A 3VRNA 2HQYA 2Z3PA 5DWMA 1NBWA 5LRGA 3BI0A 2Q51A 4H6ZA 2VI7A 3BLNA 2UV8G 4NGTA 1R61A 1VIXA 4MCSA 4DNCA 3S9NA 4CAFA 4JYWA 3D4UA 1X12A 4NSQA 4ZYQA 3R9EA 2AFSA 1S3ZA 5E96A 1Q2CA 5LRKA 4OC4A 3PFOA 3T0TA 3RYOA 2I3CA 3W6XA 3NE7A 4KSFA 3KASA 1ZG7A 3PB7X 4K30A 4OAEA 4KUAA 3FMCA 4MFPA 3VWDA 4B12A 5A27A 1MJBA 4IAVA 5C82A 2PJ3A 4INJA 3SR3A 2PSWA 1YQEA 4W9YA 2JDDA 2NMTA 2D4OA 4Q38A 4C8UA 2REFA 3G3SA 1B6BA 1VI4A 2C5QA 4UIAA 4H1HA 1YVOA 4B13A 2EBJA 4R9MA 3F8KA 5GCNA 2ZEDA 3FRMA 2PJ7A 4AXVA 3RNZA 5J1QA 3NOJA 2AFZA 2GE3A 1ON0A 2WZNA 4OMEA 2FL4A 3IEHA 3B7IA 4UCMA 1Z8LA 1NSLA 1CPSA 2PCUA 5HKYA 3KRVA 2FE7A 1RO5A 4KSIA 1Y9ZA 4C99A 3DR6A 1EE3P 1XJOA 1XMTA 1FBVA 3WR7A 3KQXA 2R8VA 3TTHA 5JPHA 1EZAA 4OC2A 2CTCA 3KZWA 3NA6A 3PBEA 2ZELA 3DSBA 4UEFA 4II9A 2EZAA 3GJZA 3EZAA 4P45A 1H8LA 4BPXB 2HV2A 3PP9A 4B10A 2QECA 2QVPA 4M6HA 3UY5A 4COGA 3F5BA 2J8MA 3GYAA 4MFLA 4PXDA 5HH1A 1ZG9A 2EVNA 2ZEHA 5F49A 4MY0A 2PJ4A 4FD7A 2BSWA 4WJBA 2V8GA 3TLBA 4E5SA 1KBLA 1IOIA 1S7KA 1HDQA 1A9XB 4C8AA 4JXQA 3KI9A 4M85A 1IICA 4R57A 4A32A 3TLZA 3TC8A 4NGNA 4PSWA 1A2ZA 3R96A 4P4EA 1Y0YA 3SJFA 4C9VA 3TO9A 1CP7A 1YK3A 5G22A 1FT7A 2PC1A 1T36B 4KOXA 5K8MA 3I6SA 4YGOA 4NGPA 4GS4A 2FSRA 2XPNA 4CRYB 4KSAA 1CS0B 1ZYMA 4UFWA 5FVJA 2EK8A 3PGPA 4MJXA 4COBA 5LYDA 1HDUA 3WC6A 1XIXA 3WABA 2ANPA 4R8FA 3H5ZA 4CS0B 1Z8WA 2WPXA 4JJXA 1RXTA 4P4DA 2IL4A 3EO4A 4UWJA 2PJBA 2EZBA 4JWPA 4TNUA 5HVGA 4X8IA 1Z9UA 4C9AA 3D7GA 2Z3OA 3PFEA 1HEEA 1CM0A 2NYQA 1Q7LA 2ATRA 5J8CA 1BOBA 4HNWB 4DUKA 2P6GA 3TLCA 4NGMA 4KLVA 2G0BA 2PJ1A 2RC4A 3BUWB 1CX8A 1AMPA 1ELMP 3EFAA 2R82A 3B3TA 4H6UA 3KL9A 3ICUA 2K5TA 3R9FA 5LYIA 3CPXA 1JDEA 4KLWA
chains in the Genus database with same CATH topology
3SI0A 2GU2A 4OC5A 3HLPA 4ZI6A 3JRUA 1VHEA 3CDXA 5HVFA 2HC9A 4C85A 1YLOA 2WYRA 4H2KA 4C8TA 4NJRA 4NGQA 3WC5A 4C9EA 3RBUA 1ZLHA 4NJQA 2EWBA 2RFHA 4JZ0A 1GYTA 1R43A 1QMUA 1CG2A 1YW6A 3EIFA 2V8DA 1DE4C 4YWYA 4PXBA 4OIDA 4GM5A 4G1PA 1PYTB 3DLJA 2IJZA 1VHOA 1F2PA 2ZEEA 5JGFA 4OC1A 4C8FA 3PB6X 3V38A 2PJ9A 3PBBA 3D7DA 3B3CA 3GUXA 3VTAA 5IB9A 4B6ZA 2ZOFA 1V6CA 3B3VA 3FX6A 1R3NA 1YSJA 3PFOA 2V8VA 3K2KA 2ZEOA 5F09A 5HXDA 1LAPA 1BPNA 4MCRA 4MCPA 1Z2LA 1Y7EA 3H8EA 4IHMA 3S9MA 1BAVA 3KHXA 3FECA 3SI2A 3LWUA 3KR5A 3VARA 3SJGA 3I1UA 4FUUA 3RAMA 3PB8X 3BXMA 3KR4A 4EFDA 4PPZA 4UF4A 3D7FA 4EWTA 2XEFA 3WT4A 3PEIA 4UEZA 2GLJA 2PRQA 5ELYA 4F8ZA 4Z65A 3IO1A 5CBMA 3GLJA 2V8HA 1UWYA 1FNOA 4NGSA 4FAIA 2GREA 1LAMA 3IWWA 3PRTA 2XEJA 2NSMA 2AFOA 3S9LA 3CT9A 2ZEGA 2O53A 3MRUA 4MHYA 2CF4A 3FF3A 3FJUA 2JBJA 1ZLIA 4R76A 3VATA 1Y0RA 3I74A 1YMEA 2FVGA 4P4FA 1TKHA 4OP4A 1RTQA 4BD9A 4A38A 6CPAA 2C6PA 4A39A 4F9UA 3TX8A 4P6YA 2C6CA 3B2YA 1ZG8A 5CPAA 5D8NA 2PIZA 1WVMA 3PB9X 1BLLE 2PVWA 4P4JA 3MN8A 1M4LA 5D29A 2Q43A 1LOKA 2AFWA 3D7HA 1XRYA 2AFXA 4UIBA 5I4MA 5JM6A 1XF1A 2XEIA 2IQ6A 1TKFA 4MRIA 4R7MA 2PE3A 4OIWA 2JBKA 3D66A 8CPAA 2F7VA 1PCAA 3NH4A 4C8CA 5LRJA 1LANA 1XBUA 4NGRA 1ARLA 3ISZA 2PJ8A 2CIJA 5K8OA 4MHPA 4UEEA 1XFOA 2ZEMA 2PIYA 5HVHA 3K9TA 4C86A 2PJCA 4ONWA 3WC7A 2BCOA 4CPAA 3NH5A 4KNGE 1TF9A 4ZX9A 4PQAA 4MCQA 1ELLP 1AYEA 4P4BA 2C6GA 1OBRA 5JH9A 4DJLA 3L2NA 3NH8A 4C9UA 2GP4A 4ZY2A 5K8PA 3IIBA 1QQ9A 3IFEA 2PJAA 1TF8A 2ZOGA 4Q7AA 2QYVA 4FBEA 2PVVA 4A37A 5LYFA 3ISXA 4YN3A 2ZEPA 2ZEFA 3GB0A 1ARMA 4TJVA 3FEDA 3D68A 3VH9A 4C8PA 4RUHA 2O4HA 3V7ZA 1CBXA 2OOTA 2PJ0A 4TJXA 2QJ8A 4OC3A 4X3RA 1KWMA 4YU9A 1F2OA 4CDKA 4DYOA 4C84A 4PXCA 1LFWA 2ABZA 3LMSA 1CPXA 1XMBA 2IMOA 4IK2A 4CDJA 2PJ2A 3B3WA 1YW4A 3NFZA 4P4IA 4NFRA 4A94A 4ZY0A 3BI1A 4PXEA 1F57A 3KHZA 4C9RA 1NSAA 4R6TA 5DS0A 4ZY1A 7CPAA 2HB6A 3QNVA 3SI1A 5THWA 4MHZA 2VL1A 3N5FA 4O23A 1LCPA 3KGQA 3RZAA 4MMOA 2J9AA 4P10A 2CTBA 2EK9A 1IY7A 4OC0A 2GLFA 1DTDA 2BOAA 5LYLA 3D67A 3CPAA 4OKOA 2AFMA 4MXUA 3FH4A 2JEWA 1CP6A 3H8FA 4WWVA 1VGYA 1Z5RA 4K3NA 4EMEA 4FWUA 3B3SA 3H8GA 4X2TA 5IR2A 2C1CA 3PB4X 3SJXA 3IC1A 3B35A 2AFUA 4MHNA 3DGVA 3T8WA 4LQGA 3BHXA 2RB7A 2PJ6A 2V77A 2F8HA 2DEAA 2Q4ZA 1BPMA 1TXRA 3FEEA 4TWEA 2POKA 2PJ5A 1TKJA 1IGBA 4ZX8A 4P44A 1JQGA 2G9DA 2XEGA 3SJEA 2BO9A 3KQZA 2OR4A 3HUVA 4F9VA 3IJ3A 5K8NA 3FVLA 2ZENA 5LRGA 3BI0A 2Q51A 4NGTA 1VIXA 4MCSA 3S9NA 4JYWA 3D4UA 4ZYQA 2AFSA 5LRKA 4OC4A 2I3CA 3KASA 1ZG7A 3PB7X 3FMCA 4IAVA 2PJ3A 4W9YA 4C8UA 2C5QA 4UIAA 2ZEDA 2PJ7A 4AXVA 5J1QA 2AFZA 2WZNA 4OMEA 3IEHA 3B7IA 1Z8LA 1CPSA 2PCUA 4C99A 1Y9ZA 4KSIA 1EE3P 1XJOA 3KQXA 4OC2A 2CTCA 3KZWA 3NA6A 3PBEA 2ZELA 4UEFA 4P45A 1H8LA 2QVPA 4PXDA 1ZG9A 2ZEHA 2PJ4A 4WJBA 2V8GA 4C8AA 1HDQA 3KI9A 3TC8A 4NGNA 4P4EA 1Y0YA 3SJFA 4C9VA 1CP7A 1FT7A 5K8MA 3I6SA 4NGPA 2EK8A 5LYDA 1HDUA 3WC6A 3WABA 2ANPA 4R8FA 4P4DA 2PJBA 4TNUA 5HVGA 4X8IA 4C9AA 3D7GA 3PFEA 1HEEA 2NYQA 1Q7LA 4DUKA 4NGMA 2PJ1A 1CX8A 1AMPA 1ELMP 3B3TA 3KL9A 3ICUA 5LYIA 3CPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SI0 A;  2GU2 A;  4OC5 A;  3HLP A;  4ZI6 A;  3JRU A;  1VHE A;  3CDX A;  5HVF A;  2HC9 A;  4C85 A;  1YLO A;  2WYR A;  4H2K A;  4C8T A;  4NJR A;  4NGQ A;  3WC5 A;  4C9E A;  3RBU A;  1ZLH A;  4NJQ A;  2EWB A;  2RFH A;  4JZ0 A;  1GYT A;  1R43 A;  1QMU A;  1CG2 A;  1YW6 A;  3EIF A;  2V8D A;  1DE4 C;  4YWY A;  4PXB A;  4OID A;  4GM5 A;  4G1P A;  1PYT B;  3DLJ A;  2IJZ A;  1VHO A;  1F2P A;  2ZEE A;  5JGF A;  4OC1 A;  4C8F A;  3PB6 X;  3V38 A;  2PJ9 A;  3PBB A;  3D7D A;  3B3C A;  3GUX A;  3VTA A;  5IB9 A;  4B6Z A;  2ZOF A;  1V6C A;  3B3V A;  3FX6 A;  1R3N A;  1YSJ A;  3PFO A;  2V8V A;  3K2K A;  2ZEO A;  5F09 A;  5HXD A;  1LAP A;  1BPN A;  4MCR A;  4MCP A;  1Z2L A;  1Y7E A;  3H8E A;  4IHM A;  3S9M A;  1BAV A;  3KHX A;  3FEC A;  3SI2 A;  3LWU A;  3KR5 A;  3VAR A;  3SJG A;  3I1U A;  4FUU A;  3RAM A;  3PB8 X;  3BXM A;  3KR4 A;  4EFD A;  4PPZ A;  4UF4 A;  3D7F A;  4EWT A;  2XEF A;  3WT4 A;  3PEI A;  4UEZ A;  2GLJ A;  2PRQ A;  5ELY A;  4F8Z A;  4Z65 A;  3IO1 A;  5CBM A;  3GLJ A;  2V8H A;  1UWY A;  1FNO A;  4NGS A;  4FAI A;  2GRE A;  1LAM A;  3IWW A;  3PRT A;  2XEJ A;  2NSM A;  2AFO A;  3S9L A;  3CT9 A;  2ZEG A;  2O53 A;  3MRU A;  4MHY A;  2CF4 A;  3FF3 A;  3FJU A;  2JBJ A;  1ZLI A;  4R76 A;  3VAT A;  1Y0R A;  3I74 A;  1YME A;  2FVG A;  4P4F A;  1TKH A;  4OP4 A;  1RTQ A;  4BD9 A;  4A38 A;  6CPA A;  2C6P A;  4A39 A;  4F9U A;  3TX8 A;  4P6Y A;  2C6C A;  3B2Y A;  1ZG8 A;  5CPA A;  5D8N A;  2PIZ A;  1WVM A;  3PB9 X;  1BLL E;  2PVW A;  4P4J A;  3MN8 A;  1M4L A;  5D29 A;  2Q43 A;  1LOK A;  2AFW A;  3D7H A;  1XRY A;  2AFX A;  4UIB A;  5I4M A;  5JM6 A;  1XF1 A;  2XEI A;  2IQ6 A;  1TKF A;  4MRI A;  4R7M A;  2PE3 A;  4OIW A;  2JBK A;  3D66 A;  8CPA A;  2F7V A;  1PCA A;  3NH4 A;  4C8C A;  5LRJ A;  1LAN A;  1XBU A;  4NGR A;  1ARL A;  3ISZ A;  2PJ8 A;  2CIJ A;  5K8O A;  4MHP A;  4UEE A;  1XFO A;  2ZEM A;  2PIY A;  5HVH A;  3K9T A;  4C86 A;  2PJC A;  4ONW A;  3WC7 A;  2BCO A;  4CPA A;  3NH5 A;  4KNG E;  1TF9 A;  4ZX9 A;  4PQA A;  4MCQ A;  1ELL P;  1AYE A;  4P4B A;  2C6G A;  1OBR A;  5JH9 A;  4DJL A;  3L2N A;  3NH8 A;  4C9U A;  4ZY2 A;  5K8P A;  3IIB A;  1QQ9 A;  3IFE A;  2PJA A;  1TF8 A;  2ZOG A;  4Q7A A;  2QYV A;  4FBE A;  2PVV A;  4A37 A;  5LYF A;  3ISX A;  4YN3 A;  2ZEP A;  2ZEF A;  3GB0 A;  1ARM A;  4TJV A;  3FED A;  3D68 A;  3VH9 A;  4C8P A;  4RUH A;  2O4H A;  3V7Z A;  1CBX A;  2OOT A;  2PJ0 A;  4TJX A;  2QJ8 A;  4OC3 A;  4X3R A;  1KWM A;  4YU9 A;  1F2O A;  4CDK A;  4DYO A;  4C84 A;  4PXC A;  1LFW A;  2ABZ A;  3LMS A;  1CPX A;  1XMB A;  2IMO A;  4IK2 A;  4CDJ A;  2PJ2 A;  3B3W A;  1YW4 A;  3NFZ A;  4P4I A;  4NFR A;  4A94 A;  4ZY0 A;  3BI1 A;  4PXE A;  1F57 A;  3KHZ A;  4C9R A;  1NSA A;  4R6T A;  5DS0 A;  4ZY1 A;  7CPA A;  2HB6 A;  3QNV A;  3SI1 A;  5THW A;  4MHZ A;  2VL1 A;  3N5F A;  4O23 A;  1LCP A;  3KGQ A;  3RZA A;  4MMO A;  2J9A A;  4P10 A;  2CTB A;  2EK9 A;  1IY7 A;  4OC0 A;  2GLF A;  1DTD A;  2BOA A;  5LYL A;  3D67 A;  3CPA A;  4OKO A;  2AFM A;  4MXU A;  3FH4 A;  2JEW A;  1CP6 A;  3H8F A;  4WWV A;  1VGY A;  1Z5R A;  4K3N A;  4EME A;  4FWU A;  3B3S A;  3H8G A;  4X2T A;  2C1C A;  3PB4 X;  3SJX A;  3IC1 A;  3B35 A;  2AFU A;  4MHN A;  3DGV A;  3T8W A;  4LQG A;  3BHX A;  2RB7 A;  2PJ6 A;  2V77 A;  2F8H A;  2DEA A;  2Q4Z A;  1BPM A;  1TXR A;  3FEE A;  4TWE A;  2POK A;  2PJ5 A;  1TKJ A;  1IGB A;  4ZX8 A;  4P44 A;  1JQG A;  2G9D A;  2XEG A;  3SJE A;  2BO9 A;  3KQZ A;  2OR4 A;  3HUV A;  4F9V A;  3IJ3 A;  5K8N A;  3FVL A;  2ZEN A;  5LRG A;  3BI0 A;  2Q51 A;  4NGT A;  1VIX A;  4MCS A;  3S9N A;  4JYW A;  3D4U A;  4ZYQ A;  2AFS A;  5LRK A;  4OC4 A;  2I3C A;  3KAS A;  1ZG7 A;  3PB7 X;  3FMC A;  4IAV A;  2PJ3 A;  4W9Y A;  4C8U A;  4UIA A;  2ZED A;  2PJ7 A;  4AXV A;  5J1Q A;  2AFZ A;  2WZN A;  4OME A;  3IEH A;  3B7I A;  1Z8L A;  1CPS A;  2PCU A;  4C99 A;  1Y9Z A;  4KSI A;  1EE3 P;  1XJO A;  3KQX A;  4OC2 A;  2CTC A;  3KZW A;  3NA6 A;  3PBE A;  2ZEL A;  4UEF A;  4P45 A;  1H8L A;  2QVP A;  4PXD A;  1ZG9 A;  2ZEH A;  2PJ4 A;  4WJB A;  2V8G A;  4C8A A;  1HDQ A;  3KI9 A;  3TC8 A;  4NGN A;  4P4E A;  1Y0Y A;  3SJF A;  4C9V A;  1CP7 A;  1FT7 A;  5K8M A;  3I6S A;  4NGP A;  2EK8 A;  5LYD A;  1HDU A;  3WC6 A;  3WAB A;  2ANP A;  4R8F A;  4P4D A;  2PJB A;  4TNU A;  5HVG A;  4X8I A;  4C9A A;  3D7G A;  3PFE A;  1HEE A;  2NYQ A;  1Q7L A;  4DUK A;  4NGM A;  2PJ1 A;  1CX8 A;  1AMP A;  1ELM P;  3B3T A;  3KL9 A;  3ICU A;  5LYI A;  3CPX A; 
#chains in the Genus database with same CATH topology
 3SI0 A;  2MP0 A;  3BUO B;  3FBU A;  1B87 A;  1IYL A;  3JVN A;  2Q44 A;  2WUU A;  2GU2 A;  4OC5 A;  3HLP A;  4BPU B;  4C2Z A;  1KUY A;  2PQ8 A;  4ZI6 A;  3JRU A;  1VHE A;  1YX0 A;  4UFX A;  2Q4V A;  3CDX A;  4Y49 B;  5HVF A;  1Q2D A;  2HC9 A;  1YLO A;  3OAK A;  2WYR A;  4H2K A;  4C8T A;  4C85 A;  4NJR A;  1S7N A;  1CJW A;  1GHE A;  2HUZ A;  1XEB A;  4RS2 A;  3BUX B;  2BL1 A;  3QAH A;  4NGQ A;  5EMI A;  5FD8 A;  3WC5 A;  4H89 A;  2XPO A;  3TYX A;  4R3L A;  4C9E A;  3RBU A;  2Q4Y A;  1ZLH A;  4MJ8 A;  4NJQ A;  4MFQ A;  1C3O B;  2OZH A;  3EZB A;  4ZGY B;  2EWB A;  2RFH A;  1YRE A;  2DF5 A;  4XPK A;  4JZ0 A;  1AUG A;  2Y1M A;  1GYT A;  3G23 A;  3VGO A;  3ZNI A;  1R43 A;  3CXP A;  5JQ4 A;  2ZW5 A;  1QMU A;  1CG2 A;  4M6I A;  4QC6 A;  2YGW A;  4LQ6 A;  1YW6 A;  4UWI A;  5F13 A;  2B4J C;  5H84 A;  4KVM E;  3OP0 A;  4XPL A;  2CY2 A;  3EC4 A;  4A33 A;  3EIF A;  1LRZ A;  3LAC A;  4MFZ A;  4B11 A;  2GFQ A;  1B47 A;  2V8D A;  3D3S A;  1DE4 C;  3F9K C;  4YWY A;  4PXB A;  2FXF A;  4OID A;  4PK3 A;  2B4D B;  4CAE A;  4BIN A;  3DR8 A;  4GM5 A;  5F48 A;  1K4J A;  4G1P A;  4UBR A;  4J3G A;  1PYT B;  3DLJ A;  2IJZ A;  1VHO A;  2AJ6 A;  3F0A A;  3K9U A;  1F2P A;  3RO0 A;  3T05 A;  3TLA A;  2D4P A;  4MBU A;  2ZEE A;  2JEV A;  5JGF A;  4OC1 A;  3TT2 A;  3CXQ A;  5KTA A;  4C8F A;  3PB6 X;  3V38 A;  1QSN A;  1SQH A;  2PJ9 A;  2Z3N A;  3PBB A;  2B58 A;  3D7D A;  3B3C A;  3GUX A;  5F46 A;  2PR8 A;  3VTA A;  5IB9 A;  2EO8 A;  4B6Z A;  4EVY A;  3BJ8 A;  2ZOF A;  1YGH A;  4QUS A;  3TFY A;  1V6C A;  1I21 A;  2G3A A;  3U1B A;  3B3V A;  3D2M A;  3FX6 A;  1MK4 A;  1R3N A;  1YSJ A;  2EUI A;  1ZO0 A;  3HPH E;  2ODF A;  2V8V A;  2ZEO A;  2QIR A;  5F09 A;  3K2K A;  4XNH C;  5HXD A;  3IGR A;  1LAP A;  2OZU A;  1BPN A;  3TLE A;  4MCR A;  3R1K A;  4MCP A;  3PT1 A;  1KZF A;  1Z2L A;  1Z9E A;  3TLG B;  1QSO A;  1Y7E A;  3H8E A;  4IHM A;  1M4G A;  5DWN A;  3R95 A;  1KUV A;  4KZT A;  3S9M A;  1BAV A;  3DNS A;  3KHX A;  3NE8 A;  2VQY A;  3CXS A;  3FXT A;  3FEC A;  3PFV A;  1WK4 A;  3SI2 A;  1XF8 A;  3E0K A;  4M8D A;  3LWU A;  2H5M A;  3JUW A;  3PZJ A;  3KR5 A;  1JWQ A;  4ORF A;  4U9Z A;  5BY0 A;  4IIX A;  3T5M A;  3P2H A;  2CNT A;  3VAR A;  1WJT A;  3SJG A;  3I1U A;  4FUU A;  4LX9 A;  3PB8 X;  3BXM A;  4KOU A;  4OLL A;  3KR4 A;  3RAM A;  4PPZ A;  4EFD A;  2AUN A;  3VRR A;  4JXR A;  2Z3M A;  3SXO A;  2YJV A;  4UF4 A;  4CYQ A;  3D7F A;  1L0C A;  2QML A;  1XE4 A;  4NEX A;  5CNP A;  4EWT A;  2XEF A;  3WT4 A;  4UA3 A;  4C2X A;  3PEI A;  4UEZ A;  2GLJ A;  2PRQ A;  4CYO A;  5ISV A;  4KOV A;  3OB1 B;  5ELY A;  4F8Z A;  4Z65 A;  2PRB A;  2OLS A;  2B4B A;  4KOS A;  3IO1 A;  5CBM A;  3GLJ A;  4BTF A;  4B5O A;  4NXY A;  5EC4 A;  3BUM B;  2N3A B;  1S7F A;  5K99 A;  2V8H A;  1UWY A;  1FNO A;  4CGM A;  4NGS A;  1UFH A;  1Z8X A;  2A4N A;  2GRE A;  4FAI A;  1BXR B;  1V0C A;  1LAM A;  3IWW A;  2ZW6 A;  1QSM A;  3PRT A;  2XEJ A;  1J4J A;  4PV6 A;  3JTK A;  2NSM A;  2AFO A;  4KOW A;  3S9L A;  1KUX A;  3CT9 A;  2ZEG A;  3O8Z A;  3S6F A;  2HI6 A;  2O53 A;  3TE4 A;  3MRU A;  2WSA A;  3H4Q A;  3C26 A;  4MHY A;  4A4C A;  2CF4 A;  4Q36 A;  3FF3 A;  3FJU A;  3TCV A;  5JVL A;  2JBJ A;  1ZLI A;  4R76 A;  3VAT A;  4CZ1 A;  1Y0R A;  5AG5 A;  2JLM A;  2KCW A;  3S6H A;  4AVB A;  1J3L A;  3I74 A;  3TO7 A;  3TLG A;  4HNY B;  1YME A;  2FVG A;  3TOB A;  5IV0 A;  3DDD A;  4P4F A;  1TKH A;  2Q0Y A;  2O28 A;  4OP4 A;  1RTQ A;  3T9Y A;  4BD9 A;  4A38 A;  6CPA A;  4F0Y A;  4MFK A;  2C6P A;  2YNE A;  4E2A A;  4A39 A;  4KOR A;  4J0N A;  2B3V A;  3VWE A;  4KOT A;  4I49 A;  3GY9 A;  4F9U A;  4JVO A;  1KC7 A;  5G20 A;  3TX8 A;  1M4I A;  1KEE B;  2ZXV A;  4A30 A;  4P6Y A;  2C6C A;  4E94 A;  3OWC A;  3B2Y A;  1ZG8 A;  2C27 A;  5CPA A;  5D8N A;  2PIZ A;  2J8R A;  1IB1 E;  3SHP A;  2YND A;  1WVM A;  3PB9 X;  1BLL E;  4KUB A;  2PVW A;  4QVT A;  4M6G A;  2PR1 A;  4P4J A;  3GIU A;  3MN8 A;  3D2P A;  1M4L A;  4C2Y A;  3K4I A;  2YNC A;  4HPS A;  4HNX B;  2FIA A;  5D29 A;  2X7B A;  5AGE A;  3S6G A;  2CNM A;  2OZG A;  1IYK A;  2Q43 A;  4C7I A;  1LOK A;  2VBQ A;  2AFW A;  3D7H A;  1XRY A;  2AFX A;  5J3X A;  3I3G A;  4UIB A;  5I4M A;  5JM6 A;  1XF1 A;  1IU8 A;  2XEI A;  2IQ6 A;  2X0S A;  1TKF A;  4OAD A;  1Y7R A;  4MRI A;  4R7M A;  3G8W A;  2YNC C;  2PE3 A;  4OIW A;  1YLE A;  4E0A A;  2JBK A;  1I12 A;  3D66 A;  5C88 A;  8CPA A;  2F7V A;  3D8P A;  4BMH A;  2D0O A;  1EZB A;  3OB2 B;  1PCA A;  1CE8 B;  5F1Y A;  2OB0 A;  5BWA B;  3NH4 A;  1GGO A;  2XPP A;  5EBV A;  2AUM A;  4MI1 A;  4C8C A;  5LRJ A;  3IWE A;  2Z0Z A;  4LUA A;  1I1D A;  4CAV A;  1LAN A;  1XBU A;  1WWZ A;  4B5P B;  4CYN A;  3TO6 A;  4NGR A;  3EZE A;  4R3K A;  5G21 A;  3FIX A;  5F47 A;  2OU2 A;  4F6A A;  2EZC A;  3HPG G;  1NE9 A;  2FS5 A;  4NCZ A;  1IOF A;  1JDB C;  1ARL A;  3ISZ A;  2PJ8 A;  2CIJ A;  1M1D A;  4FD5 A;  5K8O A;  3VRO A;  4MHP A;  4UEE A;  5KTD A;  1XFO A;  2ZEM A;  1Q2Y A;  1P0H A;  2XPL A;  2PIY A;  3V8I A;  5HVH A;  3K9T A;  2HWG A;  4C86 A;  2PJC A;  4BPW B;  1PU9 A;  4ONW A;  1IID A;  3WC7 A;  2BCO A;  5KTC A;  4AVA A;  1MJA A;  3NH5 A;  4CPA A;  1TF9 A;  4ZX9 A;  1M6V B;  1ZRS A;  4KNG E;  1MJ9 A;  4FD4 A;  4PQA A;  4NF1 A;  3W91 A;  4MCQ A;  1ELL P;  1AYE A;  1PUA A;  4P4B A;  2C6G A;  1OBR A;  5A28 A;  5IX3 A;  4MY3 A;  3PLF B;  4QB9 A;  4Y49 C;  5JH9 A;  2D0P A;  2HRO A;  2R7H A;  4DJL A;  3L2N A;  1YVH A;  5AG7 A;  3NH8 A;  4KVX A;  1VBG A;  4C9U A;  3IWG A;  2GP4 A;  4RR2 B;  2B3U A;  2AE6 A;  2PDO A;  5G1Z A;  4U9Y A;  4YRH A;  4ONU A;  2I79 A;  4ZY2 A;  5K8P A;  3IIB A;  1M4D A;  1QQ9 A;  2P6F A;  1TF8 A;  2PJA A;  3IFE A;  2ZOG A;  4Q7A A;  1YR0 A;  2QYV A;  4C68 A;  4FBE A;  2PVV A;  4A37 A;  3R9G A;  4XPD C;  5LYF A;  4UCP A;  3ISX A;  4CYP A;  4YN3 A;  1N71 A;  2ZEP A;  3VRP A;  2ZEF A;  3ZZI A;  3GB0 A;  3FB3 A;  2B4D A;  2F5I A;  3CZX A;  1ARM A;  5HKW A;  4TJV A;  4IUS A;  3ZJ0 A;  3FED A;  3D68 A;  2R98 A;  3VH9 A;  4A95 A;  4C8P A;  4M3S A;  2O4H A;  3V7Z A;  4RUH A;  1M44 A;  4CAX A;  2B0A A;  1CBX A;  4A31 A;  3IU1 A;  3T07 A;  3MGD A;  4BBH A;  2P6E A;  3U88 C;  2OOT A;  5AG4 A;  2PJ0 A;  4TJX A;  2QJ8 A;  4OC3 A;  4B5P A;  4X3R A;  1KWM A;  4YU9 A;  4CGO A;  1F2O A;  5AG6 A;  4CDK A;  4DYO A;  3BUN B;  4C84 A;  4PXC A;  1LFW A;  4GXH A;  2ABZ A;  4AB7 A;  3LMS A;  4QBJ A;  5J8F A;  1EO0 A;  4CO9 A;  1CPX A;  1XMB A;  2IMO A;  2R1I A;  4IK2 A;  4AG7 A;  4IIY A;  2Q04 A;  4E8O A;  4CDJ A;  1VHS A;  2CNS A;  2PJ2 A;  2Z3K A;  3B3W A;  4MHD A;  3T90 A;  1VBH A;  1YW4 A;  3NFZ A;  2FT0 A;  2WPW A;  2BUE A;  4P4I A;  4NFR A;  4A94 A;  4CRZ B;  4ZY0 A;  3BI1 A;  2E28 A;  4UCN A;  4PXE A;  1F57 A;  4CAW A;  4CGP A;  3KHZ A;  2VXK A;  4C9R A;  1NSA A;  4B14 A;  1X10 A;  4MFJ A;  4R6T A;  5DS0 A;  4A2Z A;  4ZY1 A;  2DXQ A;  2DLA A;  2GAN A;  2HB6 A;  1S5K A;  3EY5 A;  3I9S A;  3QNV A;  7CPA A;  2PCN A;  5F5X A;  3VRQ A;  2Z10 A;  4GPL B;  2ARH A;  5THW A;  3SI1 A;  4MHZ A;  2Q7S A;  2VL1 A;  3N5F A;  2DPS A;  3NFQ A;  4O23 A;  1ZL0 A;  2B5G B;  1LCP A;  3KGQ A;  4JLY A;  3RZA A;  4MMO A;  4FD6 A;  2J9A A;  2ZW7 A;  3FNC A;  1XOV A;  4L8A A;  4P10 A;  2FM4 A;  1VKC A;  2CTB A;  2EK9 A;  1IY7 A;  4OC0 A;  2GLF A;  3TOA A;  1DTD A;  4F0X A;  2BEI A;  4XNH B;  2BOA A;  5LYL A;  3D67 A;  3TLY A;  2YJT A;  3N7Z A;  3CPA A;  1P4N A;  4OKO A;  2AFM A;  2VEZ A;  2GIV A;  2G3T A;  2OH1 A;  4MXU A;  1Z8T A;  3FH4 A;  1Y9K A;  4CGN A;  2JEW A;  5JYB A;  4C7H A;  1YVK A;  1QST A;  4RN7 A;  1CP6 A;  3H8F A;  1BO4 A;  4WWV A;  4HKF A;  4YFJ A;  2DIK A;  3KKW A;  2I00 A;  4AVC A;  1VGY A;  1Z5R A;  4CGL A;  4K3N A;  4EME A;  3C8O A;  2CXA A;  3QB8 A;  4FWU A;  1Z4E A;  3B3S A;  2Y0M A;  2DPT A;  3H8G A;  4X2T A;  5HKZ A;  1DIK A;  1FY7 A;  5IR2 A;  2C1C A;  4EYS A;  1S7L A;  3LOD A;  3PB4 X;  3SJX A;  3P2F A;  3S6K A;  3HMJ G;  3IC1 A;  3B35 A;  4RI1 A;  2JDC A;  4X5K A;  1TIQ A;  4MI4 A;  2AFU A;  2Z3L A;  1Q5X A;  4MHN A;  2FIW A;  4U5Y A;  1NMT A;  3DGV A;  1S60 A;  3SXN A;  3W6S A;  5IB0 A;  3T8W A;  2Q7B A;  4LQG A;  3BHX A;  2RB7 A;  2PJ6 A;  2Y1N A;  2V77 A;  2CBL A;  2F8H A;  2VZY A;  1Z4R A;  3EXN A;  2DEA A;  3LD2 A;  4PSX A;  4XPD B;  4AG9 A;  5HMN A;  2VKZ G;  4KVO E;  2Q4Z A;  1C30 B;  1TXR A;  1BPM A;  3FEE A;  2VZZ A;  4TWE A;  2POK A;  3QAY A;  2ZW4 A;  2PJ5 A;  1TKJ A;  3FYN A;  2P0W A;  1IGB A;  4KOY A;  4L89 A;  2FCK A;  4ZX8 A;  1R57 A;  4P44 A;  1JQG A;  2G9D A;  2XEG A;  4A4B A;  3SJE A;  2REE A;  2Z11 A;  2BO9 A;  1QSR A;  3BJ7 A;  5I0C A;  3B8G A;  5F9M A;  2J8N A;  3KQZ A;  1OZP A;  1U6M A;  4PK2 A;  2OR4 A;  5AXI A;  3HUV A;  4UFV A;  1Y9W A;  4F9V A;  3IJ3 A;  5K8N A;  3GKR A;  4JD6 A;  2B5G A;  3IU2 A;  4IF5 A;  4KS9 A;  4ZBG A;  3FVL A;  1NXJ A;  2ZEN A;  3A9L A;  2ZPA A;  4R87 A;  5H86 A;  3VRN A;  2HQY A;  2Z3P A;  5DWM A;  1NBW A;  5LRG A;  3BI0 A;  2Q51 A;  4H6Z A;  2VI7 A;  3BLN A;  2UV8 G;  4NGT A;  1R61 A;  1VIX A;  4MCS A;  4DNC A;  3S9N A;  4CAF A;  4JYW A;  3D4U A;  1X12 A;  4NSQ A;  4ZYQ A;  3R9E A;  2AFS A;  1S3Z A;  5E96 A;  1Q2C A;  5LRK A;  4OC4 A;  3PFO A;  3T0T A;  3RYO A;  2I3C A;  3W6X A;  3NE7 A;  4KSF A;  3KAS A;  1ZG7 A;  3PB7 X;  4K30 A;  4OAE A;  4KUA A;  3FMC A;  4MFP A;  3VWD A;  4B12 A;  5A27 A;  1MJB A;  4IAV A;  5C82 A;  2PJ3 A;  4INJ A;  3SR3 A;  2PSW A;  1YQE A;  4W9Y A;  2JDD A;  2NMT A;  2D4O A;  4Q38 A;  4C8U A;  2REF A;  3G3S A;  1B6B A;  1VI4 A;  2C5Q A;  4UIA A;  4H1H A;  1YVO A;  4B13 A;  2EBJ A;  4R9M A;  3F8K A;  5GCN A;  2ZED A;  3FRM A;  2PJ7 A;  4AXV A;  3RNZ A;  5J1Q A;  3NOJ A;  2AFZ A;  2GE3 A;  1ON0 A;  2WZN A;  4OME A;  2FL4 A;  3IEH A;  3B7I A;  4UCM A;  1Z8L A;  1NSL A;  1CPS A;  2PCU A;  5HKY A;  3KRV A;  2FE7 A;  1RO5 A;  4KSI A;  1Y9Z A;  4C99 A;  3DR6 A;  1EE3 P;  1XJO A;  1XMT A;  1FBV A;  3WR7 A;  3KQX A;  2R8V A;  3TTH A;  5JPH A;  1EZA A;  4OC2 A;  2CTC A;  3KZW A;  3NA6 A;  3PBE A;  2ZEL A;  3DSB A;  4UEF A;  4II9 A;  2EZA A;  3GJZ A;  3EZA A;  4P45 A;  1H8L A;  4BPX B;  2HV2 A;  3PP9 A;  4B10 A;  2QEC A;  2QVP A;  4M6H A;  3UY5 A;  4COG A;  3F5B A;  2J8M A;  3GYA A;  4MFL A;  4PXD A;  5HH1 A;  1ZG9 A;  2EVN A;  2ZEH A;  5F49 A;  4MY0 A;  2PJ4 A;  4FD7 A;  2BSW A;  4WJB A;  2V8G A;  3TLB A;  4E5S A;  1KBL A;  1IOI A;  1S7K A;  1HDQ A;  1A9X B;  4C8A A;  4JXQ A;  3KI9 A;  4M85 A;  1IIC A;  4R57 A;  4A32 A;  3TLZ A;  3TC8 A;  4NGN A;  4PSW A;  1A2Z A;  3R96 A;  4P4E A;  1Y0Y A;  3SJF A;  4C9V A;  3TO9 A;  1CP7 A;  1YK3 A;  5G22 A;  1FT7 A;  2PC1 A;  1T36 B;  4KOX A;  5K8M A;  3I6S A;  4YGO A;  4NGP A;  4GS4 A;  2FSR A;  2XPN A;  4CRY B;  4KSA A;  1CS0 B;  1ZYM A;  4UFW A;  5FVJ A;  2EK8 A;  3PGP A;  4MJX A;  4COB A;  5LYD A;  1HDU A;  3WC6 A;  1XIX A;  3WAB A;  2ANP A;  4R8F A;  3H5Z A;  4CS0 B;  1Z8W A;  2WPX A;  4JJX A;  1RXT A;  4P4D A;  2IL4 A;  3EO4 A;  4UWJ A;  2PJB A;  2EZB A;  4JWP A;  4TNU A;  5HVG A;  4X8I A;  1Z9U A;  4C9A A;  3D7G A;  2Z3O A;  3PFE A;  1HEE A;  1CM0 A;  2NYQ A;  1Q7L A;  2ATR A;  5J8C A;  1BOB A;  4HNW B;  4DUK A;  2P6G A;  3TLC A;  4NGM A;  4KLV A;  2G0B A;  2PJ1 A;  2RC4 A;  3BUW B;  1CX8 A;  1AMP A;  1ELM P;  3EFA A;  2R82 A;  3B3T A;  4H6U A;  3KL9 A;  3ICU A;  2K5T A;  3R9F A;  5LYI A;  3CPX A;  1JDE A;  4KLW A; 
#chains in the Genus database with same CATH homology
 3SI0 A;  2GU2 A;  4OC5 A;  3HLP A;  4ZI6 A;  3JRU A;  1VHE A;  3CDX A;  5HVF A;  2HC9 A;  4C85 A;  1YLO A;  2WYR A;  4H2K A;  4C8T A;  4NJR A;  4NGQ A;  3WC5 A;  4C9E A;  3RBU A;  1ZLH A;  4NJQ A;  2EWB A;  2RFH A;  4JZ0 A;  1GYT A;  1R43 A;  1QMU A;  1CG2 A;  1YW6 A;  3EIF A;  2V8D A;  1DE4 C;  4YWY A;  4PXB A;  4OID A;  4GM5 A;  4G1P A;  1PYT B;  3DLJ A;  2IJZ A;  1VHO A;  1F2P A;  2ZEE A;  5JGF A;  4OC1 A;  4C8F A;  3PB6 X;  3V38 A;  2PJ9 A;  3PBB A;  3D7D A;  3B3C A;  3GUX A;  3VTA A;  5IB9 A;  4B6Z A;  2ZOF A;  1V6C A;  3B3V A;  3FX6 A;  1R3N A;  1YSJ A;  3PFO A;  2V8V A;  3K2K A;  2ZEO A;  5F09 A;  5HXD A;  1LAP A;  1BPN A;  4MCR A;  4MCP A;  1Z2L A;  1Y7E A;  3H8E A;  4IHM A;  3S9M A;  1BAV A;  3KHX A;  3FEC A;  3SI2 A;  3LWU A;  3KR5 A;  3VAR A;  3SJG A;  3I1U A;  4FUU A;  3RAM A;  3PB8 X;  3BXM A;  3KR4 A;  4EFD A;  4PPZ A;  4UF4 A;  3D7F A;  4EWT A;  2XEF A;  3WT4 A;  3PEI A;  4UEZ A;  2GLJ A;  2PRQ A;  5ELY A;  4F8Z A;  4Z65 A;  3IO1 A;  5CBM A;  3GLJ A;  2V8H A;  1UWY A;  1FNO A;  4NGS A;  4FAI A;  2GRE A;  1LAM A;  3IWW A;  3PRT A;  2XEJ A;  2NSM A;  2AFO A;  3S9L A;  3CT9 A;  2ZEG A;  2O53 A;  3MRU A;  4MHY A;  2CF4 A;  3FF3 A;  3FJU A;  2JBJ A;  1ZLI A;  4R76 A;  3VAT A;  1Y0R A;  3I74 A;  1YME A;  2FVG A;  4P4F A;  1TKH A;  4OP4 A;  1RTQ A;  4BD9 A;  4A38 A;  6CPA A;  2C6P A;  4A39 A;  4F9U A;  3TX8 A;  4P6Y A;  2C6C A;  3B2Y A;  1ZG8 A;  5CPA A;  5D8N A;  2PIZ A;  1WVM A;  3PB9 X;  1BLL E;  2PVW A;  4P4J A;  3MN8 A;  1M4L A;  5D29 A;  2Q43 A;  1LOK A;  2AFW A;  3D7H A;  1XRY A;  2AFX A;  4UIB A;  5I4M A;  5JM6 A;  1XF1 A;  2XEI A;  2IQ6 A;  1TKF A;  4MRI A;  4R7M A;  2PE3 A;  4OIW A;  2JBK A;  3D66 A;  8CPA A;  2F7V A;  1PCA A;  3NH4 A;  4C8C A;  5LRJ A;  1LAN A;  1XBU A;  4NGR A;  1ARL A;  3ISZ A;  2PJ8 A;  2CIJ A;  5K8O A;  4MHP A;  4UEE A;  1XFO A;  2ZEM A;  2PIY A;  5HVH A;  3K9T A;  4C86 A;  2PJC A;  4ONW A;  3WC7 A;  2BCO A;  4CPA A;  3NH5 A;  4KNG E;  1TF9 A;  4ZX9 A;  4PQA A;  4MCQ A;  1ELL P;  1AYE A;  4P4B A;  2C6G A;  1OBR A;  5JH9 A;  4DJL A;  3L2N A;  3NH8 A;  4C9U A;  2GP4 A;  4ZY2 A;  5K8P A;  3IIB A;  1QQ9 A;  3IFE A;  2PJA A;  1TF8 A;  2ZOG A;  4Q7A A;  2QYV A;  4FBE A;  2PVV A;  4A37 A;  5LYF A;  3ISX A;  4YN3 A;  2ZEP A;  2ZEF A;  3GB0 A;  1ARM A;  4TJV A;  3FED A;  3D68 A;  3VH9 A;  4C8P A;  4RUH A;  2O4H A;  3V7Z A;  1CBX A;  2OOT A;  2PJ0 A;  4TJX A;  2QJ8 A;  4OC3 A;  4X3R A;  1KWM A;  4YU9 A;  1F2O A;  4CDK A;  4DYO A;  4C84 A;  4PXC A;  1LFW A;  2ABZ A;  3LMS A;  1CPX A;  1XMB A;  2IMO A;  4IK2 A;  4CDJ A;  2PJ2 A;  3B3W A;  1YW4 A;  3NFZ A;  4P4I A;  4NFR A;  4A94 A;  4ZY0 A;  3BI1 A;  4PXE A;  1F57 A;  3KHZ A;  4C9R A;  1NSA A;  4R6T A;  5DS0 A;  4ZY1 A;  7CPA A;  2HB6 A;  3QNV A;  3SI1 A;  5THW A;  4MHZ A;  2VL1 A;  3N5F A;  4O23 A;  1LCP A;  3KGQ A;  3RZA A;  4MMO A;  2J9A A;  4P10 A;  2CTB A;  2EK9 A;  1IY7 A;  4OC0 A;  2GLF A;  1DTD A;  2BOA A;  5LYL A;  3D67 A;  3CPA A;  4OKO A;  2AFM A;  4MXU A;  3FH4 A;  2JEW A;  1CP6 A;  3H8F A;  4WWV A;  1VGY A;  1Z5R A;  4K3N A;  4EME A;  4FWU A;  3B3S A;  3H8G A;  4X2T A;  5IR2 A;  2C1C A;  3PB4 X;  3SJX A;  3IC1 A;  3B35 A;  2AFU A;  4MHN A;  3DGV A;  3T8W A;  4LQG A;  3BHX A;  2RB7 A;  2PJ6 A;  2V77 A;  2F8H A;  2DEA A;  2Q4Z A;  1BPM A;  1TXR A;  3FEE A;  4TWE A;  2POK A;  2PJ5 A;  1TKJ A;  1IGB A;  4ZX8 A;  4P44 A;  1JQG A;  2G9D A;  2XEG A;  3SJE A;  2BO9 A;  3KQZ A;  2OR4 A;  3HUV A;  4F9V A;  3IJ3 A;  5K8N A;  3FVL A;  2ZEN A;  5LRG A;  3BI0 A;  2Q51 A;  4NGT A;  1VIX A;  4MCS A;  3S9N A;  4JYW A;  3D4U A;  4ZYQ A;  2AFS A;  5LRK A;  4OC4 A;  2I3C A;  3KAS A;  1ZG7 A;  3PB7 X;  3FMC A;  4IAV A;  2PJ3 A;  4W9Y A;  4C8U A;  2C5Q A;  4UIA A;  2ZED A;  2PJ7 A;  4AXV A;  5J1Q A;  2AFZ A;  2WZN A;  4OME A;  3IEH A;  3B7I A;  1Z8L A;  1CPS A;  2PCU A;  4C99 A;  1Y9Z A;  4KSI A;  1EE3 P;  1XJO A;  3KQX A;  4OC2 A;  2CTC A;  3KZW A;  3NA6 A;  3PBE A;  2ZEL A;  4UEF A;  4P45 A;  1H8L A;  2QVP A;  4PXD A;  1ZG9 A;  2ZEH A;  2PJ4 A;  4WJB A;  2V8G A;  4C8A A;  1HDQ A;  3KI9 A;  3TC8 A;  4NGN A;  4P4E A;  1Y0Y A;  3SJF A;  4C9V A;  1CP7 A;  1FT7 A;  5K8M A;  3I6S A;  4NGP A;  2EK8 A;  5LYD A;  1HDU A;  3WC6 A;  3WAB A;  2ANP A;  4R8F A;  4P4D A;  2PJB A;  4TNU A;  5HVG A;  4X8I A;  4C9A A;  3D7G A;  3PFE A;  1HEE A;  2NYQ A;  1Q7L A;  4DUK A;  4NGM A;  2PJ1 A;  1CX8 A;  1AMP A;  1ELM P;  3B3T A;  3KL9 A;  3ICU A;  5LYI A;  3CPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...