2C6PA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with phosphate anion
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
694
structure length
677
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
publication title Structure of Glutamate Carboxypeptidase II, a Drug Target in Neuronal Damage and Prostate Cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 227
structure length 677
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2c6pA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2c6pA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c6pA02
3IC1A 2J9AA 2BOAA 4C8CA 5F09A 4PQAA 3B3TA 1IY7A 3KHZA 2PJ6A 4ZY2A 3NFZA 4YN3A 1ZLHA 5K8NA 2OR4A 2PVWA 3I74A 1ARLA 2ZEHA 3KQXA 4NGMA 4OC1A 1HEEA 2IMOA 4UEEA 2Q4ZA 2PJ7A 2AFZA 5LYLA 3WT4A 4ZY1A 4MXUA 2Q51A 3CT9A 4ZI6A 4AXVA 1EE3P 3GB0A 8CPAA 1YLOA 3PRTA 4OIDA 1BPNA 2WYRA 1QQ9A 3I1UA 3PB6X 2CTBA 2PJBA 5LRJA 2IJZA 1H8LA 3L2NA 3DGVA 1NSAA 4PXDA 1LFWA 3PFEA 3B3CA 3PB4X 3DLJA 4UIBA 4NGNA 2C1CA 1FT7A 1TF9A 4UEZA 2PJ8A 3TC8A 2BO9A 4C8TA 4RUHA 2POKA 1QMUA 4C9AA 4C99A 4FWUA 4X3RA 2XEGA 2ANPA 2ZEDA 4UIAA 3D67A 3NH4A 5JGFA 2ZEPA 3PEIA 1HDQA 3D7FA 1LAPA 5K8PA 3KL9A 3PB8X 2ZEGA 3FECA 1ZG8A 5HVGA 4PXCA 4P4IA 2GLFA 1PCAA 4YWYA 2V8HA 4CPAA 3IWWA 5CPAA 1Y7EA 3SI2A 4OC2A 4GM5A 2ZOFA 5CBMA 2V8DA 2PJ1A 3D7DA 4C8PA 3NH8A 4BD9A 3KQZA 2C6GA 2PJ4A 1CBXA 1VIXA 5K8OA 1CP6A 1ELMP 4R76A 3H8FA 1PYTB 2PIZA 3QNVA 4PPZA 3KZWA 4R8FA 2XEIA 3VTAA 3MN8A 3IFEA 3I6SA 1F2OA 1F57A 2HC9A 2G9DA 3B2YA 4OC3A 3D68A 4PXEA 2GLJA 1ELLP 3ISZA 3KGQA 2PIYA 3LWUA 6CPAA 4IK2A 1GYTA 3B3VA 2PJ5A 4TJXA 1Y0RA 2DEAA 3KR5A 5D8NA 5ELYA 1FNOA 2ZEOA 2JBJA 3S9LA 3SJGA 1WVMA 2ZENA 3KHXA 2QJ8A 2CF4A 4O23A 4P6YA 4FUUA 1HDUA 3B3SA 4ZX9A 5JM6A 3RZAA 1LAMA 5LYFA 4X8IA 4TNUA 1F2PA 2XEFA 4C9EA 2ZOGA 4IAVA 3VATA 1LOKA 4Q7AA 2O4HA 3D7HA 2V8VA 2PJ3A 4H2KA 4NGTA 4LQGA 2EWBA 3GLJA 3MRUA 1LANA 4C9VA 3D66A 3S9NA 4F9UA 4A38A 3IJ3A 3SJEA 3PBBA 4OIWA 1M4LA 3SI1A 4OKOA 1CG2A 3BHXA 3H8GA 2FVGA 1BAVA 2VL1A 3FH4A 4C86A 4OP4A 3V38A 4OMEA 2PJCA 4NGSA 4WWVA 2AFUA 1CPSA 1ZG7A 1OBRA 4DUKA 4MCSA 3NA6A 2F8HA 1Z5RA 1YW6A 2GREA 4X2TA 2PE3A 2C6CA 4OC0A 1RTQA 3D7GA 3WABA 4CDKA 3B7IA 2CTCA 4P4DA 2JEWA 4C8UA 4MHYA 1XFOA 1Q7LA 3WC5A 4JZ0A 5LRKA 2AFXA 1DE4C 2AFSA 1ZG9A 3VARA 5K8MA 4G1PA 4ZYQA 5HVFA 4P4BA 5D29A 3KASA 3SJXA 2C6PA 3IEHA 1Y9ZA 1CPXA 3FEDA 4KNGE 4MRIA 4F9VA 4P44A 4A37A 2PRQA 1ARMA 2ZEEA 1YMEA 3RAMA 1DTDA 4FAIA 2EK9A 4P4EA 1XJOA 2BCOA 1XF1A 3PBEA 4JYWA 4W9YA 3T8WA 5JH9A 3FMCA 2Q43A 4K3NA 3K2KA 5J1QA 2AFOA 2RB7A 2CIJA 3D4UA 4MHZA 3RBUA 4PXBA 2PJAA 1AYEA 5LYDA 7CPAA 1YW4A 4NGRA 1ZLIA 4ZX8A 4B6ZA 3HUVA 2F7VA 4UEFA 4MHNA 4NGPA 4A39A 1Z2LA 2OOTA 4IHMA 5HVHA 3VH9A 3K9TA 4R6TA 2QVPA 2NSMA 1Y0YA 3WC7A 3FF3A 1TXRA 4C8AA 2ABZA 4EFDA 5I4MA 4EWTA 3FX6A 2PJ0A 2V77A 4C84A 2PVVA 2IQ6A 4C9UA 3FJUA 4NFRA 3ICUA 4C9RA 2XEJA 3N5FA 1JQGA 5HXDA 3PFOA 1XMBA 5THWA 3KR4A 4YU9A 1CP7A 4P4JA 4NGQA 3S9MA 4MCQA 4DJLA 3CPXA 2ZEFA 1TKHA 1IGBA 3FVLA 1VHEA 3IO1A 4CDJA 4ZY0A 1BPMA 2I3CA 3H8EA 3IIBA 5DS0A 2NYQA 1VGYA 3NH5A 1XBUA 3B3WA 1R3NA 4ONWA 3LMSA 3BI1A 1UWYA 1TKJA 2HB6A 3FEEA 4MMOA 3KI9A 2PCUA 2ZEMA 1VHOA 3PB9X 1V6CA 4UF4A 2O53A 4FBEA 1TF8A 3WC6A 3CPAA 2ZELA 3B35A 3HLPA 4Z65A 3ISXA 3JRUA 2AFMA 4KSIA 4NJRA 3SJFA 2AFWA 4A94A 4OC5A 3SI0A 2PJ9A 1TKFA 2PJ2A 4OC4A 4TJVA 4R7MA 4F8ZA 3V7ZA 5IB9A 4C85A 1Z8LA 1R43A 2WZNA 4MCPA 1YSJA 4TWEA 4EMEA 2RFHA 1CX8A 2GU2A 4WJBA 2EK8A 3PB7X 1AMPA 3CDXA 4MHPA 3GUXA 4DYOA 1BLLE 1LCPA 2V8GA 4P45A 3TX8A 3EIFA 4C8FA 3BI0A 4P10A 5LYIA 4P4FA 4NJQA 2QYVA 2JBKA 1KWMA 1XRYA 4MCRA 5LRGA 3BXMA
chains in the Genus database with same CATH superfamily
3IC1A 2J9AA 3DDDA 2BOAA 4A2ZA 4C7HA 1JDBC 4C8CA 5F09A 1RO5A 4PQAA 3B3TA 3D2MA 3S6KA 3SHPA 3GYAA 1IY7A 3KHZA 1IICA 4KOTA 2PJ6A 4ZY2A 4AVCA 3T05A 3NFZA 4YN3A 2AUMA 4NEXA 1KZFA 2CNMA 1ZLHA 3F0AA 2FXFA 5K8NA 2OR4A 2PVWA 1YX0A 3I74A 3EZBA 1ARLA 1XOVA 2EZAA 2ZEHA 3BLNA 3GKRA 2UV8G 3KQXA 3HPHE 2Q44A 4B11A 1NE9A 4J3GA 1Z8WA 4NGMA 4E5SA 4OC1A 1HEEA 2IMOA 4UEEA 2Q4ZA 3TCVA 4CS0B 4B14A 2PJ7A 3I9SA 2AFZA 5LYLA 2PRBA 2MP0A 2B3VA 3WT4A 2G0BA 4ZY1A 4MXUA 2Q51A 1A9XB 2VQYA 2ZW4A 3TO9A 3CT9A 4CGOA 3PT1A 3RO0A 1VBHA 4ZI6A 3TLEA 4AXVA 4F6AA 1EE3P 1I12A 4CAEA 5J3XA 3OWCA 4CYQA 4NF1A 4FD4A 4B12A 3GB0A 5G20A 2Y0MA 8CPAA 1YLOA 1S7NA 3PRTA 1Y9WA 4OIDA 3VRPA 4XPKA 4OAEA 4XNHB 1B6BA 1BO4A 1BPNA 2WYRA 4I49A 1QQ9A 3I1UA 3PB6X 1WK4A 3VRQA 3DR8A 2CTBA 2PJBA 5EBVA 2IJZA 5LRJA 5IV0A 1H8LA 2CXAA 1A2ZA 3L2NA 3DGVA 1NSAA 2FL4A 4PXDA 1LFWA 3T07A 4LQ6A 3R9EA 4A31A 3PFEA 2C5QA 2ZW6A 3B3CA 3PB4X 3EC4A 3DLJA 3BUNB 4NGNA 2C1CA 1FT7A 3EY5A 4UIBA 4C9EA 1TF9A 4UEZA 2PJ8A 4UFXA 2AJ6A 1MJBA 4HPSA 3V8IA 5I0CA 3BUXB 3R96A 2VKZG 3BJ8A 3TC8A 1JWQA 2BO9A 1IB1E 2REFA 5FD8A 4UFVA 3ZZIA 4RUHA 4C8TA 2POKA 2Z0ZA 1QMUA 3B8GA 4C9AA 4COBA 5HKWA 2BEIA 4F0YA 4C99A 2Z10A 4FWUA 4ONUA 2QIRA 3R9GA 4X3RA 5G21A 2XEGA 1NXJA 4COGA 2ANPA 4CGNA 2ZEDA 3RYOA 4FD7A 4MY0A 4UIAA 1YREA 2XPPA 4R87A 2R98A 2FCKA 3D67A 3NH4A 5JGFA 2ZEPA 3PEIA 4FD6A 1HDQA 2GANA 1CS0B 4CGPA 3D7FA 1LAPA 4C68A 4B10A 4QVTA 2JDCA 2OZHA 3E0KA 3FXTA 3KL9A 3PB8X 4UBRA 5K8PA 2ZEGA 1CE8B 3FECA 1ZG8A 2Y1MA 5HVGA 4UWIA 4PXCA 4M8DA 4P4IA 3C8OA 5H84A 3TO6A 4HKFA 2GLFA 3D8PA 1MJ9A 1PCAA 4H89A 1X10A 4YWYA 1QSTA 2PSWA 2V8HA 2Y1NA 4CPAA 3IWWA 5CPAA 1Y7EA 3SI2A 4OC2A 2ZPAA 4GM5A 2ZOFA 5G22A 2YNEA 5CBMA 1KBLA 3EZEA 4CRYB 2V8DA 3TLZA 2PJ1A 5AGEA 3D7DA 2HV2A 4UCMA 3BUMB 4OLLA 4C8PA 5JQ4A 4KOXA 3RNZA 4X5KA 3U88C 4FD5A 4PV6A 2ATRA 2P0WA 4UCNA 4YRHA 5GCNA 2PR8A 3QAYA 5A28A 4HNYB 4RR2B 3NH8A 5ISVA 4CO9A 3TTHA 2QECA 3IU1A 4BD9A 3KQZA 2J8NA 2C6GA 2PJ4A 5HKYA 2ZXVA 1CBXA 1VIXA 3CZXA 1IYKA 4KOWA 5K8OA 1CP6A 1ELMP 2WUUA 3JVNA 3H8FA 4R76A 1PYTB 4II9A 3W6XA 2PIZA 4JLYA 3QNVA 4PPZA 4CGLA 1S3ZA 1UFHA 4AVBA 3PZJA 1EO0A 2H5MA 3T9YA 2Z3OA 1VKCA 2GFQA 3KZWA 4R8FA 2XEIA 2CBLA 1DIKA 3G23A 3VTAA 3MN8A 2QMLA 3IFEA 3NE8A 3ZJ0A 3I6SA 2P6FA 1F2OA 3TO7A 3LODA 5LRGA 4KVXA 2ODFA 1C30B 1F57A 2HC9A 2G9DA 3B2YA 4KVOE 3KKWA 4Y49B 3T90A 1GHEA 1CJWA 4OC3A 2VXKA 4KOSA 3TOAA 3D68A 4PXEA 4JD6A 4KVME 2GLJA 1ELLP 4C2ZA 2J8MA 3ISZA 4KOUA 3HPGG 2Q7SA 3S6FA 4CGMA 2Q0YA 1Z8XA 3TOBA 3UY5A 4BINA 1VI4A 3KGQA 2D0PA 2PIYA 3LWUA 4YGOA 6CPAA 1XEBA 4PSXA 4IUSA 4JXRA 4IK2A 3JUWA 1ZRSA 2BSWA 3S6HA 2CNTA 1B47A 2Q04A 1GYTA 4AVAA 3B3VA 4K30A 2Q7BA 5J8CA 1PUAA 4KSFA 3D2PA 3TFYA 3OP0A 4JJXA 1S7LA 2PJ5A 2WSAA 4R57A 1Y0RA 4TJXA 2EO8A 2B5GA 2DEAA 4KUBA 3KR5A 2HQYA 3EFAA 5D8NA 5ELYA 1FNOA 2PR1A 2ZEOA 4HNXB 4RI1A 4C2XA 2JBJA 3S9LA 3SJGA 1WVMA 2Z3PA 2FT0A 2ZENA 2X7BA 3KHXA 4UFWA 2QJ8A 3C26A 5AG5A 4CZ1A 2CF4A 5A27A 2HROA 3GJZA 4O23A 3ZNIA 1XF8A 3K9UA 1ZYMA 4P6YA 4FUUA 1KUYA 4JWPA 1ZO0A 3N7ZA 1HDUA 4MI4A 3B3SA 5C88A 1EZBA 4ZX9A 5JM6A 5KTAA 2YNCC 3RZAA 1LAMA 2GP4A 5LYFA 5JYBA 2FS5A 4TNUA 4X8IA 1F2PA 2XEFA 2DXQA 1C3OB 2B5GB 4L89A 2D0OA 1I1DA 1Z4RA 2ZOGA 1N71A 3QB8A 1LOKA 2EUIA 4IAVA 3VATA 4H1HA 2OH1A 4Q7AA 5J8FA 2O4HA 3D7HA 3TE4A 2V8VA 2G3AA 2PJ3A 3K4IA 3KRVA 4CYOA 4H2KA 4NGTA 1M4IA 2ZW5A 1NMTA 3WR7A 3EZAA 4LQGA 4U9ZA 5DWNA 3U1BA 1Y9KA 4PK2A 5HVHA 1SQHA 2EWBA 3GLJA 2FIWA 2OB0A 3MRUA 1LANA 4UA3A 4C9VA 4MBUA 4M3SA 3D66A 3S9NA 4B5OA 4F9UA 4NXYA 3LD2A 4OADA 4RS2A 4A38A 3IJ3A 2HI6A 3SJEA 2XPNA 3PBBA 4OIWA 4NCZA 3R9FA 1M4LA 2P6EA 4E8OA 3SI1A 2BL1A 4OKOA 1CG2A 3BHXA 3CXPA 3TLAA 5BY0A 3H8GA 2WPWA 3G8WA 1I21A 2ZW7A 2FVGA 4KORA 3VWEA 5F47A 1BAVA 2VL1A 3FH4A 4KOVA 3SR3A 4C86A 3PGPA 5HKZA 1VHSA 4LUAA 4OP4A 4BBHA 2ARHA 2NMTA 2OZUA 4R3KA 4KSAA 2B4BA 3V38A 4OMEA 3BJ7A 4GS4A 5JPHA 2PJCA 4NGSA 3NE7A 5HMNA 1BOBA 3TLCA 4WWVA 4R9MA 2VZYA 2AFUA 3IGRA 1CPSA 4KLWA 1ZG7A 2B3UA 1OBRA 2K5TA 5J1QA 4DUKA 4INJA 4QUSA 1J3LA 4MCSA 5KTDA 2DIKA 3NA6A 2F8HA 3VRRA 1Z5RA 2N3AB 4M6GA 4XPDC 1YW6A 2E28A 3FNCA 2YJTA 4E0AA 5IX3A 2GREA 4X2TA 3TLBA 2PE3A 2C6CA 4OC0A 1RTQA 3D7GA 3FIXA 5EMIA 3W6SA 3WABA 4CDKA 4PSWA 3B7IA 1K4JA 2CTCA 5DWMA 4M6IA 4BPUB 4P4DA 1Z4EA 1M6VB 1XIXA 2JEWA 4C8UA 4MHYA 1KUVA 4MI1A 1XFOA 1Q7LA 2DPTA 4U9YA 3LACA 1Z9UA 3GIUA 5IR2A 3WC5A 3D3SA 4JZ0A 5LRKA 2AFXA 1DE4C 4CAFA 2EZBA 1KUXA 2AFSA 1TIQA 2DPSA 2JDDA 1ZG9A 3P2FA 2CNSA 2Z3KA 3VARA 4YFJA 5K8MA 2R82A 2OLSA 4G1PA 4ZYQA 1ZL0A 1MJAA 4M6HA 5HVFA 4P4BA 5D29A 3KASA 3SJXA 3TLGA 2C6PA 3PFVA 3DR6A 2WPXA 3IEHA 4GPLB 2PDOA 3IWGA 5G1ZA 1Y9ZA 3G3SA 1CPXA 3FEDA 1M1DA 1B87A 4H6ZA 1RXTA 4KNGE 2F5IA 4M85A 4MRIA 4F9VA 1JDEA 4P44A 4KOYA 1FBVA 5EC4A 2B0AA 4A37A 3OB2B 2PRQA 3VWDA 1ARMA 2YJVA 4E2AA 2HUZA 2ZEEA 3DSBA 3NOJA 1YMEA 3RAMA 1KC7A 1YVKA 1DTDA 3FB3A 3DNSA 4AB7A 4FAIA 2EK9A 1M44A 1T36B 4P4EA 2FIAA 1XJOA 2BCOA 1NBWA 1XF1A 4A4CA 5F9MA 1L0CA 4MFLA 1OZPA 3PBEA 3NFQA 4JYWA 4A30A 4AG9A 3TLGB 4XPDB 2B4DA 4W9YA 1YLEA 2KCWA 2B4JC 4XPLA 3T8WA 4GXHA 5FVJA 5JH9A 3VROA 3TLYA 4A95A 4B5PB 3FMCA 2Q43A 3P2HA 3TT2A 1YVHA 2Z3NA 5JVLA 4LX9A 4K3NA 1IOIA 3FYNA 3K2KA 4MFKA 2AFOA 3BUWB 2RB7A 3A9LA 2CIJA 1ON0A 2Q4YA 3D4UA 1LRZA 1M4DA 1V0CA 2VEZA 4MHZA 3PLFB 3EO4A 3R1KA 1WWZA 4MY3A 2VI7A 4C7IA 3RBUA 4H6UA 4F0XA 5AXIA 1IOFA 3IU2A 4J0NA 4PXBA 3EXNA 2PJAA 4CAVA 3TYXA 1AYEA 2X0SA 5LYDA 4MFPA 7CPAA 3CXQA 2B4DB 1IU8A 1YW4A 1M4GA 4RN7A 2EZCA 4NGRA 1ZLIA 4ZX8A 2DLAA 3I3GA 4IIXA 4B6ZA 1YR0A 1Q2DA 2F7VA 3HUVA 4UEFA 5F49A 1QSOA 4MHNA 4E94A 4NGPA 4A39A 4QBJA 4HNWB 3VRNA 2OOTA 1Z2LA 4IHMA 4NSQA 5F48A 3K9TA 2DF5A 1R57A 3VH9A 2JEVA 1X12A 4R6TA 2P6GA 2QVPA 5K99A 2NSMA 1Y0YA 3WC7A 3FF3A 4A4BA 3MGDA 1TXRA 1MK4A 2ABZA 2I00A 2HWGA 4C8AA 1Z9EA 3PP9A 5CNPA 4A32A 4EFDA 5I4MA 5KTCA 2J8RA 4EWTA 4BPXB 3FBUA 3OB1B 2PJ0A 2V77A 3FX6A 5HH1A 2PVVA 2IQ6A 1QSMA 4L8AA 4C84A 4C9UA 3FJUA 4IIYA 4NFRA 3ICUA 2O28A 2PCNA 1GGOA 1YQEA 2R8VA 4C9RA 5F1YA 4EYSA 3QAHA 2XEJA 3N5FA 1JQGA 2YNCA 4MFQA 4CAXA 3PFOA 4ZBGA 1XMBA 5HXDA 5THWA 3KR4A 5E96A 4A33A 4YU9A 1Z8TA 1EZAA 3O8ZA 2XPOA 1CP7A 1BXRB 5F5XA 4P4JA 4QC6A 2EVNA 4NGQA 4MCQA 3S9MA 4BPWB 2VZZA 4CYPA 1R61A 2FM4A 2AE6A 4DJLA 2XPLA 3CPXA 2ZEFA 4MJXA 1TKHA 1IGBA 1AUGA 1IIDA 1XE4A 2EBJA 3FVLA 1VHEA 3IO1A 3W91A 4KLVA 3F5BA 4KZTA 4CDJA 4MJ8A 1Q5XA 4BTFA 1YK3A 4ZY0A 3T5MA 3SXOA 1BPMA 1S60A 2D4PA 2I3CA 3H8EA 3IIBA 2NYQA 4MFJA 4Q38A 1VGYA 3CXSA 3NH5A 5DS0A 1XBUA 3B3WA 1R3NA 2BUEA 2Q4VA 4ONWA 3LMSA 2OU2A 3BI1A 1UWYA 5F46A 1TKJA 2HB6A 2YNDA 3FEEA 4MMOA 5AG7A 4KS9A 1VBGA 3BUOB 2PCUA 2ZEMA 3KI9A 5H86A 4B13A 1Y7RA 1QSRA 1VHOA 2B58A 3H4QA 2FSRA 5C82A 1S7KA 2CY2A 3PB9X 4R3LA 3OAKA 2I79A 4UF4A 2O53A 4Y49C 4FBEA 1V6CA 1TF8A 1U6MA 1P0HA 4U5YA 3WC6A 3CPAA 2Z3MA 2ZELA 3B35A 1CM0A 3HLPA 4ORFA 4Z65A 3ISXA 4JVOA 3JRUA 2AFMA 4KSIA 1IYLA 4NJRA 3SJFA 2AFWA 2YGWA 2Z3LA 1S5KA 4A94A 3IWEA 4OC5A 3SI0A 2A4NA 2IL4A 2PJ9A 1WJTA 1TKFA 2PJ2A 4OC4A 4TJVA 1S7FA 3F9KC 4R7MA 2GE3A 3T0TA 2C27A 2R1IA 3V7ZA 4F8ZA 5IB9A 5AG6A 4C85A 2PQ8A 4C2YA 1Z8LA 1R43A 3GY9A 2RC4A 2WZNA 4MCPA 5F13A 1YSJA 4TWEA 1YVOA 2D4OA 4JXQA 4CYNA 4EMEA 2RFHA 3SXNA 4DNCA 2REEA 1CX8A 4UWJA 2GU2A 4B5PA 4WJBA 1Q2CA 1Q2YA 4CAWA 4UCPA 2EK8A 2G3TA 3PB7X 4MHDA 4MFZA 1AMPA 1PU9A 4BMHA 3VGOA 3CDXA 5IB0A 2GIVA 3FRMA 4MHPA 4PK3A 4Q36A 3HMJG 3GUXA 5AG4A 2OZGA 3R95A 4ZGYB 2Z11A 4DYOA 4CRZB 1BLLE 2R7HA 2VBQA 3F8KA 3JTKA 4XNHC 1NSLA 1LCPA 2V8GA 4QB9A 4P45A 1QSNA 1J4JA 3S6GA 2AUNA 3TX8A 2PC1A 3EIFA 4C8FA 1P4NA 3BI0A 4P10A 4EVYA 1FY7A 2FE7A 1XMTA 5LYIA 4P4FA 4KUAA 4NJQA 1YGHA 1KEEB 2JLMA 3H5ZA 2QYVA 4AG7A 5BWAB 2JBKA 1KWMA 1XRYA 4MCRA 4IF5A 3BXMA
chains in the Genus database with same CATH topology
3IC1A 2J9AA 2BOAA 4C8CA 5F09A 4PQAA 3B3TA 1IY7A 3KHZA 2PJ6A 4ZY2A 3NFZA 4YN3A 1ZLHA 5K8NA 2OR4A 2PVWA 3I74A 1ARLA 2ZEHA 3KQXA 4NGMA 4OC1A 1HEEA 2IMOA 4UEEA 2Q4ZA 2PJ7A 2AFZA 5LYLA 3WT4A 4ZY1A 4MXUA 2Q51A 3CT9A 4ZI6A 4AXVA 1EE3P 3GB0A 8CPAA 1YLOA 3PRTA 4OIDA 1BPNA 2WYRA 1QQ9A 3I1UA 3PB6X 2CTBA 2PJBA 5LRJA 2IJZA 1H8LA 3L2NA 3DGVA 1NSAA 4PXDA 1LFWA 2C5QA 3PFEA 3B3CA 3PB4X 3DLJA 4UIBA 4NGNA 2C1CA 1FT7A 1TF9A 4UEZA 2PJ8A 3TC8A 2BO9A 4C8TA 4RUHA 2POKA 1QMUA 4C9AA 4C99A 4FWUA 4X3RA 2XEGA 2ANPA 2ZEDA 4UIAA 3D67A 3NH4A 5JGFA 2ZEPA 3PEIA 1HDQA 3D7FA 1LAPA 5K8PA 3KL9A 3PB8X 2ZEGA 3FECA 1ZG8A 5HVGA 4PXCA 4P4IA 2GLFA 1PCAA 4YWYA 2V8HA 4CPAA 3IWWA 5CPAA 1Y7EA 3SI2A 4OC2A 4GM5A 2ZOFA 5CBMA 2V8DA 2PJ1A 3D7DA 4C8PA 3NH8A 4BD9A 3KQZA 2C6GA 2PJ4A 1CBXA 1VIXA 5K8OA 1CP6A 1ELMP 4R76A 3H8FA 1PYTB 2PIZA 3QNVA 4PPZA 3KZWA 4R8FA 2XEIA 3VTAA 3MN8A 3IFEA 3I6SA 1F2OA 1F57A 2HC9A 2G9DA 3B2YA 4OC3A 3D68A 4PXEA 2GLJA 1ELLP 3ISZA 3KGQA 2PIYA 3LWUA 6CPAA 4IK2A 1GYTA 3B3VA 2PJ5A 4TJXA 1Y0RA 2DEAA 3KR5A 5D8NA 5ELYA 1FNOA 2ZEOA 2JBJA 3S9LA 3SJGA 1WVMA 2ZENA 3KHXA 2QJ8A 2CF4A 4O23A 4P6YA 4FUUA 1HDUA 3B3SA 4ZX9A 5JM6A 3RZAA 1LAMA 2GP4A 5LYFA 4X8IA 4TNUA 1F2PA 2XEFA 4C9EA 2ZOGA 4IAVA 3VATA 1LOKA 4Q7AA 2O4HA 3D7HA 2V8VA 2PJ3A 4H2KA 4NGTA 4LQGA 2EWBA 3GLJA 3MRUA 1LANA 4C9VA 3D66A 3S9NA 4F9UA 4A38A 3IJ3A 3SJEA 3PBBA 4OIWA 1M4LA 3SI1A 4OKOA 1CG2A 3BHXA 3H8GA 2FVGA 1BAVA 2VL1A 3FH4A 4C86A 4OP4A 3V38A 4OMEA 2PJCA 4NGSA 4WWVA 2AFUA 1CPSA 1ZG7A 1OBRA 4DUKA 4MCSA 3NA6A 2F8HA 1Z5RA 1YW6A 2GREA 4X2TA 2PE3A 2C6CA 4OC0A 1RTQA 3D7GA 3WABA 4CDKA 3B7IA 2CTCA 4P4DA 2JEWA 4C8UA 4MHYA 1XFOA 1Q7LA 5IR2A 3WC5A 4JZ0A 5LRKA 2AFXA 1DE4C 2AFSA 1ZG9A 3VARA 5K8MA 4G1PA 4ZYQA 5HVFA 4P4BA 5D29A 3KASA 3SJXA 2C6PA 3IEHA 1Y9ZA 1CPXA 3FEDA 4KNGE 4MRIA 4F9VA 4P44A 4A37A 2PRQA 1ARMA 2ZEEA 1YMEA 3RAMA 1DTDA 4FAIA 2EK9A 4P4EA 1XJOA 2BCOA 1XF1A 3PBEA 4JYWA 4W9YA 3T8WA 5JH9A 3FMCA 2Q43A 4K3NA 3K2KA 5J1QA 2AFOA 2RB7A 2CIJA 3D4UA 4MHZA 3RBUA 4PXBA 2PJAA 1AYEA 5LYDA 7CPAA 1YW4A 4NGRA 1ZLIA 4ZX8A 4B6ZA 3HUVA 2F7VA 4UEFA 4MHNA 4NGPA 4A39A 1Z2LA 2OOTA 4IHMA 5HVHA 3VH9A 3K9TA 4R6TA 2QVPA 2NSMA 1Y0YA 3WC7A 3FF3A 1TXRA 4C8AA 2ABZA 4EFDA 5I4MA 4EWTA 3FX6A 2PJ0A 2V77A 4C84A 2PVVA 2IQ6A 4C9UA 3FJUA 4NFRA 3ICUA 4C9RA 2XEJA 3N5FA 1JQGA 5HXDA 3PFOA 1XMBA 5THWA 3KR4A 4YU9A 1CP7A 4P4JA 4NGQA 3S9MA 4MCQA 4DJLA 3CPXA 2ZEFA 1TKHA 1IGBA 3FVLA 1VHEA 3IO1A 4CDJA 4ZY0A 1BPMA 2I3CA 3H8EA 3IIBA 5DS0A 2NYQA 1VGYA 3NH5A 1XBUA 3B3WA 1R3NA 4ONWA 3LMSA 3BI1A 1UWYA 1TKJA 2HB6A 3FEEA 4MMOA 3KI9A 2PCUA 2ZEMA 1VHOA 3PB9X 1V6CA 4UF4A 2O53A 4FBEA 1TF8A 3WC6A 3CPAA 2ZELA 3B35A 3HLPA 4Z65A 3ISXA 3JRUA 2AFMA 4KSIA 4NJRA 3SJFA 2AFWA 4A94A 4OC5A 3SI0A 2PJ9A 1TKFA 2PJ2A 4OC4A 4TJVA 4R7MA 4F8ZA 3V7ZA 5IB9A 4C85A 1Z8LA 1R43A 2WZNA 4MCPA 1YSJA 4TWEA 4EMEA 2RFHA 1CX8A 2GU2A 4WJBA 2EK8A 3PB7X 1AMPA 3CDXA 4MHPA 3GUXA 4DYOA 1BLLE 1LCPA 2V8GA 4P45A 3TX8A 3EIFA 4C8FA 3BI0A 4P10A 5LYIA 4P4FA 4NJQA 2QYVA 2JBKA 1KWMA 1XRYA 4MCRA 5LRGA 3BXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IC1 A;  2J9A A;  2BOA A;  4C8C A;  5F09 A;  4PQA A;  3B3T A;  1IY7 A;  3KHZ A;  2PJ6 A;  4ZY2 A;  3NFZ A;  4YN3 A;  1ZLH A;  5K8N A;  2OR4 A;  2PVW A;  3I74 A;  1ARL A;  2ZEH A;  3KQX A;  4NGM A;  4OC1 A;  1HEE A;  2IMO A;  4UEE A;  2Q4Z A;  2PJ7 A;  2AFZ A;  5LYL A;  3WT4 A;  4ZY1 A;  4MXU A;  2Q51 A;  3CT9 A;  4ZI6 A;  4AXV A;  1EE3 P;  3GB0 A;  8CPA A;  1YLO A;  3PRT A;  4OID A;  1BPN A;  2WYR A;  1QQ9 A;  3I1U A;  3PB6 X;  2CTB A;  2PJB A;  5LRJ A;  2IJZ A;  1H8L A;  3L2N A;  3DGV A;  1NSA A;  4PXD A;  1LFW A;  3PFE A;  3B3C A;  3PB4 X;  3DLJ A;  4UIB A;  4NGN A;  2C1C A;  1FT7 A;  1TF9 A;  4UEZ A;  2PJ8 A;  3TC8 A;  2BO9 A;  4C8T A;  4RUH A;  2POK A;  1QMU A;  4C9A A;  4C99 A;  4FWU A;  4X3R A;  2XEG A;  2ANP A;  2ZED A;  4UIA A;  3D67 A;  3NH4 A;  5JGF A;  2ZEP A;  3PEI A;  1HDQ A;  3D7F A;  1LAP A;  5K8P A;  3KL9 A;  3PB8 X;  2ZEG A;  3FEC A;  1ZG8 A;  5HVG A;  4PXC A;  4P4I A;  2GLF A;  1PCA A;  4YWY A;  2V8H A;  4CPA A;  3IWW A;  5CPA A;  1Y7E A;  3SI2 A;  4OC2 A;  4GM5 A;  2ZOF A;  5CBM A;  2V8D A;  2PJ1 A;  3D7D A;  4C8P A;  3NH8 A;  4BD9 A;  3KQZ A;  2C6G A;  2PJ4 A;  1CBX A;  1VIX A;  5K8O A;  1CP6 A;  1ELM P;  4R76 A;  3H8F A;  1PYT B;  2PIZ A;  3QNV A;  4PPZ A;  3KZW A;  4R8F A;  2XEI A;  3VTA A;  3MN8 A;  3IFE A;  3I6S A;  1F2O A;  1F57 A;  2HC9 A;  2G9D A;  3B2Y A;  4OC3 A;  3D68 A;  4PXE A;  2GLJ A;  1ELL P;  3ISZ A;  3KGQ A;  2PIY A;  3LWU A;  6CPA A;  4IK2 A;  1GYT A;  3B3V A;  2PJ5 A;  4TJX A;  1Y0R A;  2DEA A;  3KR5 A;  5D8N A;  5ELY A;  1FNO A;  2ZEO A;  2JBJ A;  3S9L A;  3SJG A;  1WVM A;  2ZEN A;  3KHX A;  2QJ8 A;  2CF4 A;  4O23 A;  4P6Y A;  4FUU A;  1HDU A;  3B3S A;  4ZX9 A;  5JM6 A;  3RZA A;  1LAM A;  5LYF A;  4X8I A;  4TNU A;  1F2P A;  2XEF A;  4C9E A;  2ZOG A;  4IAV A;  3VAT A;  1LOK A;  4Q7A A;  2O4H A;  3D7H A;  2V8V A;  2PJ3 A;  4H2K A;  4NGT A;  4LQG A;  2EWB A;  3GLJ A;  3MRU A;  1LAN A;  4C9V A;  3D66 A;  3S9N A;  4F9U A;  4A38 A;  3IJ3 A;  3SJE A;  3PBB A;  4OIW A;  1M4L A;  3SI1 A;  4OKO A;  1CG2 A;  3BHX A;  3H8G A;  2FVG A;  1BAV A;  2VL1 A;  3FH4 A;  4C86 A;  4OP4 A;  3V38 A;  4OME A;  2PJC A;  4NGS A;  4WWV A;  2AFU A;  1CPS A;  1ZG7 A;  1OBR A;  4DUK A;  4MCS A;  3NA6 A;  2F8H A;  1Z5R A;  1YW6 A;  2GRE A;  4X2T A;  2PE3 A;  2C6C A;  4OC0 A;  1RTQ A;  3D7G A;  3WAB A;  4CDK A;  3B7I A;  2CTC A;  4P4D A;  2JEW A;  4C8U A;  4MHY A;  1XFO A;  1Q7L A;  3WC5 A;  4JZ0 A;  5LRK A;  2AFX A;  1DE4 C;  2AFS A;  1ZG9 A;  3VAR A;  5K8M A;  4G1P A;  4ZYQ A;  5HVF A;  4P4B A;  5D29 A;  3KAS A;  3SJX A;  2C6P A;  3IEH A;  1Y9Z A;  1CPX A;  3FED A;  4KNG E;  4MRI A;  4F9V A;  4P44 A;  4A37 A;  2PRQ A;  1ARM A;  2ZEE A;  1YME A;  3RAM A;  1DTD A;  4FAI A;  2EK9 A;  4P4E A;  1XJO A;  2BCO A;  1XF1 A;  3PBE A;  4JYW A;  4W9Y A;  3T8W A;  5JH9 A;  3FMC A;  2Q43 A;  4K3N A;  3K2K A;  5J1Q A;  2AFO A;  2RB7 A;  2CIJ A;  3D4U A;  4MHZ A;  3RBU A;  4PXB A;  2PJA A;  1AYE A;  5LYD A;  7CPA A;  1YW4 A;  4NGR A;  1ZLI A;  4ZX8 A;  4B6Z A;  3HUV A;  2F7V A;  4UEF A;  4MHN A;  4NGP A;  4A39 A;  1Z2L A;  2OOT A;  4IHM A;  5HVH A;  3VH9 A;  3K9T A;  4R6T A;  2QVP A;  2NSM A;  1Y0Y A;  3WC7 A;  3FF3 A;  1TXR A;  4C8A A;  2ABZ A;  4EFD A;  5I4M A;  4EWT A;  3FX6 A;  2PJ0 A;  2V77 A;  4C84 A;  2PVV A;  2IQ6 A;  4C9U A;  3FJU A;  4NFR A;  3ICU A;  4C9R A;  2XEJ A;  3N5F A;  1JQG A;  5HXD A;  3PFO A;  1XMB A;  5THW A;  3KR4 A;  4YU9 A;  1CP7 A;  4P4J A;  4NGQ A;  3S9M A;  4MCQ A;  4DJL A;  3CPX A;  2ZEF A;  1TKH A;  1IGB A;  3FVL A;  1VHE A;  3IO1 A;  4CDJ A;  4ZY0 A;  1BPM A;  2I3C A;  3H8E A;  3IIB A;  5DS0 A;  2NYQ A;  1VGY A;  3NH5 A;  1XBU A;  3B3W A;  1R3N A;  4ONW A;  3LMS A;  3BI1 A;  1UWY A;  1TKJ A;  2HB6 A;  3FEE A;  4MMO A;  3KI9 A;  2PCU A;  2ZEM A;  1VHO A;  3PB9 X;  1V6C A;  4UF4 A;  2O53 A;  4FBE A;  1TF8 A;  3WC6 A;  3CPA A;  2ZEL A;  3B35 A;  3HLP A;  4Z65 A;  3ISX A;  3JRU A;  2AFM A;  4KSI A;  4NJR A;  3SJF A;  2AFW A;  4A94 A;  4OC5 A;  3SI0 A;  2PJ9 A;  1TKF A;  2PJ2 A;  4OC4 A;  4TJV A;  4R7M A;  4F8Z A;  3V7Z A;  5IB9 A;  4C85 A;  1Z8L A;  1R43 A;  2WZN A;  4MCP A;  1YSJ A;  4TWE A;  4EME A;  2RFH A;  1CX8 A;  2GU2 A;  4WJB A;  2EK8 A;  3PB7 X;  1AMP A;  3CDX A;  4MHP A;  3GUX A;  4DYO A;  1BLL E;  1LCP A;  2V8G A;  4P45 A;  3TX8 A;  3EIF A;  4C8F A;  3BI0 A;  4P10 A;  5LYI A;  4P4F A;  4NJQ A;  2QYV A;  2JBK A;  1KWM A;  1XRY A;  4MCR A;  5LRG A;  3BXM A; 
#chains in the Genus database with same CATH topology
 3IC1 A;  2J9A A;  3DDD A;  2BOA A;  4A2Z A;  4C7H A;  1JDB C;  4C8C A;  5F09 A;  1RO5 A;  4PQA A;  3B3T A;  3D2M A;  3S6K A;  3SHP A;  3GYA A;  1IY7 A;  3KHZ A;  1IIC A;  4KOT A;  2PJ6 A;  4ZY2 A;  4AVC A;  3T05 A;  3NFZ A;  4YN3 A;  2AUM A;  4NEX A;  1KZF A;  2CNM A;  1ZLH A;  3F0A A;  2FXF A;  5K8N A;  2OR4 A;  2PVW A;  1YX0 A;  3I74 A;  3EZB A;  1ARL A;  1XOV A;  2EZA A;  2ZEH A;  3BLN A;  3GKR A;  2UV8 G;  3KQX A;  3HPH E;  2Q44 A;  4B11 A;  1NE9 A;  4J3G A;  1Z8W A;  4NGM A;  4E5S A;  4OC1 A;  1HEE A;  2IMO A;  4UEE A;  2Q4Z A;  3TCV A;  4CS0 B;  4B14 A;  2PJ7 A;  3I9S A;  2AFZ A;  5LYL A;  2PRB A;  2MP0 A;  2B3V A;  3WT4 A;  2G0B A;  4ZY1 A;  4MXU A;  2Q51 A;  1A9X B;  2VQY A;  2ZW4 A;  3TO9 A;  3CT9 A;  4CGO A;  3PT1 A;  3RO0 A;  1VBH A;  4ZI6 A;  3TLE A;  4AXV A;  4F6A A;  1EE3 P;  1I12 A;  4CAE A;  5J3X A;  3OWC A;  4CYQ A;  4NF1 A;  4FD4 A;  4B12 A;  3GB0 A;  5G20 A;  2Y0M A;  8CPA A;  1YLO A;  1S7N A;  3PRT A;  1Y9W A;  4OID A;  3VRP A;  4XPK A;  4OAE A;  4XNH B;  1B6B A;  1BO4 A;  1BPN A;  2WYR A;  4I49 A;  1QQ9 A;  3I1U A;  3PB6 X;  1WK4 A;  3VRQ A;  3DR8 A;  2CTB A;  2PJB A;  5EBV A;  2IJZ A;  5LRJ A;  5IV0 A;  1H8L A;  2CXA A;  1A2Z A;  3L2N A;  3DGV A;  1NSA A;  2FL4 A;  4PXD A;  1LFW A;  3T07 A;  4LQ6 A;  3R9E A;  4A31 A;  3PFE A;  2C5Q A;  2ZW6 A;  3B3C A;  3PB4 X;  3EC4 A;  3DLJ A;  3BUN B;  4NGN A;  2C1C A;  1FT7 A;  3EY5 A;  4UIB A;  4C9E A;  1TF9 A;  4UEZ A;  2PJ8 A;  4UFX A;  2AJ6 A;  1MJB A;  4HPS A;  3V8I A;  5I0C A;  3BUX B;  3R96 A;  2VKZ G;  3BJ8 A;  3TC8 A;  1JWQ A;  2BO9 A;  1IB1 E;  2REF A;  5FD8 A;  4UFV A;  3ZZI A;  4RUH A;  4C8T A;  2POK A;  2Z0Z A;  1QMU A;  3B8G A;  4C9A A;  4COB A;  5HKW A;  2BEI A;  4F0Y A;  4C99 A;  2Z10 A;  4FWU A;  4ONU A;  2QIR A;  3R9G A;  4X3R A;  5G21 A;  2XEG A;  1NXJ A;  4COG A;  2ANP A;  4CGN A;  2ZED A;  3RYO A;  4FD7 A;  4MY0 A;  4UIA A;  1YRE A;  2XPP A;  4R87 A;  2R98 A;  2FCK A;  3D67 A;  3NH4 A;  5JGF A;  2ZEP A;  3PEI A;  4FD6 A;  1HDQ A;  2GAN A;  1CS0 B;  4CGP A;  3D7F A;  1LAP A;  4C68 A;  4B10 A;  4QVT A;  2JDC A;  2OZH A;  3E0K A;  3FXT A;  3KL9 A;  3PB8 X;  4UBR A;  5K8P A;  2ZEG A;  1CE8 B;  3FEC A;  1ZG8 A;  2Y1M A;  5HVG A;  4UWI A;  4PXC A;  4M8D A;  4P4I A;  3C8O A;  5H84 A;  3TO6 A;  4HKF A;  2GLF A;  3D8P A;  1MJ9 A;  1PCA A;  4H89 A;  1X10 A;  4YWY A;  1QST A;  2PSW A;  2V8H A;  2Y1N A;  4CPA A;  3IWW A;  5CPA A;  1Y7E A;  3SI2 A;  4OC2 A;  2ZPA A;  4GM5 A;  2ZOF A;  5G22 A;  2YNE A;  5CBM A;  1KBL A;  3EZE A;  4CRY B;  2V8D A;  3TLZ A;  2PJ1 A;  5AGE A;  3D7D A;  2HV2 A;  4UCM A;  3BUM B;  4OLL A;  4C8P A;  5JQ4 A;  4KOX A;  3RNZ A;  4X5K A;  3U88 C;  4FD5 A;  4PV6 A;  2ATR A;  2P0W A;  4UCN A;  4YRH A;  5GCN A;  2PR8 A;  3QAY A;  5A28 A;  4HNY B;  4RR2 B;  3NH8 A;  5ISV A;  4CO9 A;  3TTH A;  2QEC A;  3IU1 A;  4BD9 A;  3KQZ A;  2J8N A;  2C6G A;  2PJ4 A;  5HKY A;  2ZXV A;  1CBX A;  1VIX A;  3CZX A;  1IYK A;  4KOW A;  5K8O A;  1CP6 A;  1ELM P;  2WUU A;  3JVN A;  3H8F A;  4R76 A;  1PYT B;  4II9 A;  3W6X A;  2PIZ A;  4JLY A;  3QNV A;  4PPZ A;  4CGL A;  1S3Z A;  1UFH A;  4AVB A;  3PZJ A;  1EO0 A;  2H5M A;  3T9Y A;  2Z3O A;  1VKC A;  2GFQ A;  3KZW A;  4R8F A;  2XEI A;  2CBL A;  1DIK A;  3G23 A;  3VTA A;  3MN8 A;  2QML A;  3IFE A;  3NE8 A;  3ZJ0 A;  3I6S A;  2P6F A;  1F2O A;  3TO7 A;  3LOD A;  5LRG A;  4KVX A;  2ODF A;  1C30 B;  1F57 A;  2HC9 A;  2G9D A;  3B2Y A;  4KVO E;  3KKW A;  4Y49 B;  3T90 A;  1GHE A;  1CJW A;  4OC3 A;  2VXK A;  4KOS A;  3TOA A;  3D68 A;  4PXE A;  4JD6 A;  4KVM E;  2GLJ A;  1ELL P;  4C2Z A;  2J8M A;  3ISZ A;  4KOU A;  3HPG G;  2Q7S A;  3S6F A;  4CGM A;  2Q0Y A;  1Z8X A;  3TOB A;  3UY5 A;  4BIN A;  1VI4 A;  3KGQ A;  2D0P A;  2PIY A;  3LWU A;  4YGO A;  6CPA A;  1XEB A;  4PSX A;  4IUS A;  4JXR A;  4IK2 A;  3JUW A;  1ZRS A;  2BSW A;  3S6H A;  2CNT A;  1B47 A;  2Q04 A;  1GYT A;  4AVA A;  3B3V A;  4K30 A;  2Q7B A;  5J8C A;  1PUA A;  4KSF A;  3D2P A;  3TFY A;  3OP0 A;  4JJX A;  1S7L A;  2PJ5 A;  2WSA A;  4R57 A;  1Y0R A;  4TJX A;  2EO8 A;  2B5G A;  2DEA A;  4KUB A;  3KR5 A;  2HQY A;  3EFA A;  5D8N A;  5ELY A;  1FNO A;  2PR1 A;  2ZEO A;  4HNX B;  4RI1 A;  4C2X A;  2JBJ A;  3S9L A;  3SJG A;  1WVM A;  2Z3P A;  2FT0 A;  2ZEN A;  2X7B A;  3KHX A;  4UFW A;  2QJ8 A;  3C26 A;  5AG5 A;  4CZ1 A;  2CF4 A;  5A27 A;  2HRO A;  3GJZ A;  4O23 A;  3ZNI A;  1XF8 A;  3K9U A;  1ZYM A;  4P6Y A;  4FUU A;  1KUY A;  4JWP A;  1ZO0 A;  3N7Z A;  1HDU A;  4MI4 A;  3B3S A;  5C88 A;  1EZB A;  4ZX9 A;  5JM6 A;  5KTA A;  2YNC C;  3RZA A;  1LAM A;  2GP4 A;  5LYF A;  5JYB A;  2FS5 A;  4TNU A;  4X8I A;  1F2P A;  2XEF A;  2DXQ A;  1C3O B;  2B5G B;  4L89 A;  2D0O A;  1I1D A;  1Z4R A;  2ZOG A;  1N71 A;  3QB8 A;  1LOK A;  2EUI A;  4IAV A;  3VAT A;  4H1H A;  2OH1 A;  4Q7A A;  5J8F A;  2O4H A;  3D7H A;  3TE4 A;  2V8V A;  2G3A A;  2PJ3 A;  3K4I A;  3KRV A;  4CYO A;  4H2K A;  4NGT A;  1M4I A;  2ZW5 A;  1NMT A;  3WR7 A;  3EZA A;  4LQG A;  4U9Z A;  5DWN A;  3U1B A;  1Y9K A;  4PK2 A;  5HVH A;  1SQH A;  2EWB A;  3GLJ A;  2FIW A;  2OB0 A;  3MRU A;  1LAN A;  4UA3 A;  4C9V A;  4MBU A;  4M3S A;  3D66 A;  3S9N A;  4B5O A;  4F9U A;  4NXY A;  3LD2 A;  4OAD A;  4RS2 A;  4A38 A;  3IJ3 A;  2HI6 A;  3SJE A;  2XPN A;  3PBB A;  4OIW A;  4NCZ A;  3R9F A;  1M4L A;  2P6E A;  4E8O A;  3SI1 A;  2BL1 A;  4OKO A;  1CG2 A;  3BHX A;  3CXP A;  3TLA A;  5BY0 A;  3H8G A;  2WPW A;  3G8W A;  1I21 A;  2ZW7 A;  2FVG A;  4KOR A;  3VWE A;  5F47 A;  1BAV A;  2VL1 A;  3FH4 A;  4KOV A;  3SR3 A;  4C86 A;  3PGP A;  5HKZ A;  1VHS A;  4LUA A;  4OP4 A;  4BBH A;  2ARH A;  2NMT A;  2OZU A;  4R3K A;  4KSA A;  2B4B A;  3V38 A;  4OME A;  3BJ7 A;  4GS4 A;  5JPH A;  2PJC A;  4NGS A;  3NE7 A;  5HMN A;  1BOB A;  3TLC A;  4WWV A;  4R9M A;  2VZY A;  2AFU A;  3IGR A;  1CPS A;  4KLW A;  1ZG7 A;  2B3U A;  1OBR A;  2K5T A;  5J1Q A;  4DUK A;  4INJ A;  4QUS A;  1J3L A;  4MCS A;  5KTD A;  2DIK A;  3NA6 A;  2F8H A;  3VRR A;  1Z5R A;  2N3A B;  4M6G A;  4XPD C;  1YW6 A;  2E28 A;  3FNC A;  2YJT A;  4E0A A;  5IX3 A;  2GRE A;  4X2T A;  3TLB A;  2PE3 A;  2C6C A;  4OC0 A;  1RTQ A;  3D7G A;  3FIX A;  5EMI A;  3W6S A;  3WAB A;  4CDK A;  4PSW A;  3B7I A;  1K4J A;  2CTC A;  5DWM A;  4M6I A;  4BPU B;  4P4D A;  1Z4E A;  1M6V B;  1XIX A;  2JEW A;  4C8U A;  4MHY A;  1KUV A;  4MI1 A;  1XFO A;  1Q7L A;  2DPT A;  4U9Y A;  3LAC A;  1Z9U A;  3GIU A;  5IR2 A;  3WC5 A;  3D3S A;  4JZ0 A;  5LRK A;  2AFX A;  1DE4 C;  4CAF A;  2EZB A;  1KUX A;  2AFS A;  1TIQ A;  2DPS A;  2JDD A;  1ZG9 A;  3P2F A;  2CNS A;  2Z3K A;  3VAR A;  4YFJ A;  5K8M A;  2R82 A;  2OLS A;  4G1P A;  4ZYQ A;  1ZL0 A;  1MJA A;  4M6H A;  5HVF A;  4P4B A;  5D29 A;  3KAS A;  3SJX A;  3TLG A;  2C6P A;  3PFV A;  3DR6 A;  2WPX A;  3IEH A;  4GPL B;  2PDO A;  3IWG A;  5G1Z A;  1Y9Z A;  3G3S A;  1CPX A;  3FED A;  1M1D A;  1B87 A;  4H6Z A;  1RXT A;  4KNG E;  2F5I A;  4M85 A;  4MRI A;  4F9V A;  1JDE A;  4P44 A;  4KOY A;  1FBV A;  5EC4 A;  2B0A A;  4A37 A;  3OB2 B;  2PRQ A;  3VWD A;  1ARM A;  2YJV A;  4E2A A;  2HUZ A;  2ZEE A;  3DSB A;  3NOJ A;  1YME A;  3RAM A;  1KC7 A;  1YVK A;  1DTD A;  3FB3 A;  3DNS A;  4AB7 A;  4FAI A;  2EK9 A;  1M44 A;  1T36 B;  4P4E A;  2FIA A;  1XJO A;  2BCO A;  1NBW A;  1XF1 A;  4A4C A;  5F9M A;  1L0C A;  4MFL A;  1OZP A;  3PBE A;  3NFQ A;  4JYW A;  4A30 A;  4AG9 A;  3TLG B;  4XPD B;  2B4D A;  4W9Y A;  1YLE A;  2KCW A;  2B4J C;  4XPL A;  3T8W A;  4GXH A;  5FVJ A;  5JH9 A;  3VRO A;  3TLY A;  4A95 A;  4B5P B;  3FMC A;  2Q43 A;  3P2H A;  3TT2 A;  1YVH A;  2Z3N A;  5JVL A;  4LX9 A;  4K3N A;  1IOI A;  3FYN A;  3K2K A;  4MFK A;  2AFO A;  3BUW B;  2RB7 A;  3A9L A;  2CIJ A;  1ON0 A;  2Q4Y A;  3D4U A;  1LRZ A;  1M4D A;  1V0C A;  2VEZ A;  4MHZ A;  3PLF B;  3EO4 A;  3R1K A;  1WWZ A;  4MY3 A;  2VI7 A;  4C7I A;  3RBU A;  4H6U A;  4F0X A;  5AXI A;  1IOF A;  3IU2 A;  4J0N A;  4PXB A;  3EXN A;  2PJA A;  4CAV A;  3TYX A;  1AYE A;  2X0S A;  5LYD A;  4MFP A;  7CPA A;  3CXQ A;  2B4D B;  1IU8 A;  1YW4 A;  1M4G A;  4RN7 A;  2EZC A;  4NGR A;  1ZLI A;  4ZX8 A;  2DLA A;  3I3G A;  4IIX A;  4B6Z A;  1YR0 A;  1Q2D A;  2F7V A;  3HUV A;  4UEF A;  5F49 A;  1QSO A;  4MHN A;  4E94 A;  4NGP A;  4A39 A;  4QBJ A;  4HNW B;  3VRN A;  2OOT A;  1Z2L A;  4IHM A;  4NSQ A;  5F48 A;  3K9T A;  2DF5 A;  1R57 A;  3VH9 A;  2JEV A;  1X12 A;  4R6T A;  2P6G A;  2QVP A;  5K99 A;  2NSM A;  1Y0Y A;  3WC7 A;  3FF3 A;  4A4B A;  3MGD A;  1TXR A;  1MK4 A;  2ABZ A;  2I00 A;  2HWG A;  4C8A A;  1Z9E A;  3PP9 A;  5CNP A;  4A32 A;  4EFD A;  5I4M A;  5KTC A;  2J8R A;  4EWT A;  4BPX B;  3FBU A;  3OB1 B;  2PJ0 A;  2V77 A;  3FX6 A;  5HH1 A;  2PVV A;  2IQ6 A;  1QSM A;  4L8A A;  4C84 A;  4C9U A;  3FJU A;  4IIY A;  4NFR A;  3ICU A;  2O28 A;  2PCN A;  1GGO A;  1YQE A;  2R8V A;  4C9R A;  5F1Y A;  4EYS A;  3QAH A;  2XEJ A;  3N5F A;  1JQG A;  2YNC A;  4MFQ A;  4CAX A;  3PFO A;  4ZBG A;  1XMB A;  5HXD A;  5THW A;  3KR4 A;  5E96 A;  4A33 A;  4YU9 A;  1Z8T A;  1EZA A;  3O8Z A;  2XPO A;  1CP7 A;  1BXR B;  5F5X A;  4P4J A;  4QC6 A;  2EVN A;  4NGQ A;  4MCQ A;  3S9M A;  4BPW B;  2VZZ A;  4CYP A;  1R61 A;  2FM4 A;  2AE6 A;  4DJL A;  2XPL A;  3CPX A;  2ZEF A;  4MJX A;  1TKH A;  1IGB A;  1AUG A;  1IID A;  1XE4 A;  2EBJ A;  3FVL A;  1VHE A;  3IO1 A;  3W91 A;  4KLV A;  3F5B A;  4KZT A;  4CDJ A;  4MJ8 A;  1Q5X A;  4BTF A;  1YK3 A;  4ZY0 A;  3T5M A;  3SXO A;  1BPM A;  1S60 A;  2D4P A;  2I3C A;  3H8E A;  3IIB A;  2NYQ A;  4MFJ A;  4Q38 A;  1VGY A;  3CXS A;  3NH5 A;  5DS0 A;  1XBU A;  3B3W A;  1R3N A;  2BUE A;  2Q4V A;  4ONW A;  3LMS A;  2OU2 A;  3BI1 A;  1UWY A;  5F46 A;  1TKJ A;  2HB6 A;  2YND A;  3FEE A;  4MMO A;  5AG7 A;  4KS9 A;  1VBG A;  3BUO B;  2PCU A;  2ZEM A;  3KI9 A;  5H86 A;  4B13 A;  1Y7R A;  1QSR A;  1VHO A;  2B58 A;  3H4Q A;  2FSR A;  5C82 A;  1S7K A;  2CY2 A;  3PB9 X;  4R3L A;  3OAK A;  2I79 A;  4UF4 A;  2O53 A;  4Y49 C;  4FBE A;  1V6C A;  1TF8 A;  1U6M A;  1P0H A;  4U5Y A;  3WC6 A;  3CPA A;  2Z3M A;  2ZEL A;  3B35 A;  1CM0 A;  3HLP A;  4ORF A;  4Z65 A;  3ISX A;  4JVO A;  3JRU A;  2AFM A;  4KSI A;  1IYL A;  4NJR A;  3SJF A;  2AFW A;  2YGW A;  2Z3L A;  1S5K A;  4A94 A;  3IWE A;  4OC5 A;  3SI0 A;  2A4N A;  2IL4 A;  2PJ9 A;  1WJT A;  1TKF A;  2PJ2 A;  4OC4 A;  4TJV A;  1S7F A;  3F9K C;  4R7M A;  2GE3 A;  3T0T A;  2C27 A;  2R1I A;  3V7Z A;  4F8Z A;  5IB9 A;  5AG6 A;  4C85 A;  2PQ8 A;  4C2Y A;  1Z8L A;  1R43 A;  3GY9 A;  2RC4 A;  2WZN A;  4MCP A;  5F13 A;  1YSJ A;  4TWE A;  1YVO A;  2D4O A;  4JXQ A;  4CYN A;  4EME A;  2RFH A;  3SXN A;  4DNC A;  2REE A;  1CX8 A;  4UWJ A;  2GU2 A;  4B5P A;  4WJB A;  1Q2C A;  1Q2Y A;  4CAW A;  4UCP A;  2EK8 A;  2G3T A;  3PB7 X;  4MHD A;  4MFZ A;  1AMP A;  1PU9 A;  4BMH A;  3VGO A;  3CDX A;  5IB0 A;  2GIV A;  3FRM A;  4MHP A;  4PK3 A;  4Q36 A;  3HMJ G;  3GUX A;  5AG4 A;  2OZG A;  3R95 A;  4ZGY B;  2Z11 A;  4DYO A;  4CRZ B;  1BLL E;  2R7H A;  2VBQ A;  3F8K A;  3JTK A;  4XNH C;  1NSL A;  1LCP A;  2V8G A;  4QB9 A;  4P45 A;  1QSN A;  1J4J A;  3S6G A;  2AUN A;  3TX8 A;  2PC1 A;  3EIF A;  4C8F A;  1P4N A;  3BI0 A;  4P10 A;  4EVY A;  1FY7 A;  2FE7 A;  1XMT A;  5LYI A;  4P4F A;  4KUA A;  4NJQ A;  1YGH A;  1KEE B;  2JLM A;  3H5Z A;  2QYV A;  4AG7 A;  5BWA B;  2JBK A;  1KWM A;  1XRY A;  4MCR A;  4IF5 A;  3BXM A; 
#chains in the Genus database with same CATH homology
 3IC1 A;  2J9A A;  2BOA A;  4C8C A;  5F09 A;  4PQA A;  3B3T A;  1IY7 A;  3KHZ A;  2PJ6 A;  4ZY2 A;  3NFZ A;  4YN3 A;  1ZLH A;  5K8N A;  2OR4 A;  2PVW A;  3I74 A;  1ARL A;  2ZEH A;  3KQX A;  4NGM A;  4OC1 A;  1HEE A;  2IMO A;  4UEE A;  2Q4Z A;  2PJ7 A;  2AFZ A;  5LYL A;  3WT4 A;  4ZY1 A;  4MXU A;  2Q51 A;  3CT9 A;  4ZI6 A;  4AXV A;  1EE3 P;  3GB0 A;  8CPA A;  1YLO A;  3PRT A;  4OID A;  1BPN A;  2WYR A;  1QQ9 A;  3I1U A;  3PB6 X;  2CTB A;  2PJB A;  5LRJ A;  2IJZ A;  1H8L A;  3L2N A;  3DGV A;  1NSA A;  4PXD A;  1LFW A;  2C5Q A;  3PFE A;  3B3C A;  3PB4 X;  3DLJ A;  4UIB A;  4NGN A;  2C1C A;  1FT7 A;  1TF9 A;  4UEZ A;  2PJ8 A;  3TC8 A;  2BO9 A;  4C8T A;  4RUH A;  2POK A;  1QMU A;  4C9A A;  4C99 A;  4FWU A;  4X3R A;  2XEG A;  2ANP A;  2ZED A;  4UIA A;  3D67 A;  3NH4 A;  5JGF A;  2ZEP A;  3PEI A;  1HDQ A;  3D7F A;  1LAP A;  5K8P A;  3KL9 A;  3PB8 X;  2ZEG A;  3FEC A;  1ZG8 A;  5HVG A;  4PXC A;  4P4I A;  2GLF A;  1PCA A;  4YWY A;  2V8H A;  4CPA A;  3IWW A;  5CPA A;  1Y7E A;  3SI2 A;  4OC2 A;  4GM5 A;  2ZOF A;  5CBM A;  2V8D A;  2PJ1 A;  3D7D A;  4C8P A;  3NH8 A;  4BD9 A;  3KQZ A;  2C6G A;  2PJ4 A;  1CBX A;  1VIX A;  5K8O A;  1CP6 A;  1ELM P;  4R76 A;  3H8F A;  1PYT B;  2PIZ A;  3QNV A;  4PPZ A;  3KZW A;  4R8F A;  2XEI A;  3VTA A;  3MN8 A;  3IFE A;  3I6S A;  1F2O A;  1F57 A;  2HC9 A;  2G9D A;  3B2Y A;  4OC3 A;  3D68 A;  4PXE A;  2GLJ A;  1ELL P;  3ISZ A;  3KGQ A;  2PIY A;  3LWU A;  6CPA A;  4IK2 A;  1GYT A;  3B3V A;  2PJ5 A;  4TJX A;  1Y0R A;  2DEA A;  3KR5 A;  5D8N A;  5ELY A;  1FNO A;  2ZEO A;  2JBJ A;  3S9L A;  3SJG A;  1WVM A;  2ZEN A;  3KHX A;  2QJ8 A;  2CF4 A;  4O23 A;  4P6Y A;  4FUU A;  1HDU A;  3B3S A;  4ZX9 A;  5JM6 A;  3RZA A;  1LAM A;  2GP4 A;  5LYF A;  4X8I A;  4TNU A;  1F2P A;  2XEF A;  4C9E A;  2ZOG A;  4IAV A;  3VAT A;  1LOK A;  4Q7A A;  2O4H A;  3D7H A;  2V8V A;  2PJ3 A;  4H2K A;  4NGT A;  4LQG A;  2EWB A;  3GLJ A;  3MRU A;  1LAN A;  4C9V A;  3D66 A;  3S9N A;  4F9U A;  4A38 A;  3IJ3 A;  3SJE A;  3PBB A;  4OIW A;  1M4L A;  3SI1 A;  4OKO A;  1CG2 A;  3BHX A;  3H8G A;  2FVG A;  1BAV A;  2VL1 A;  3FH4 A;  4C86 A;  4OP4 A;  3V38 A;  4OME A;  2PJC A;  4NGS A;  4WWV A;  2AFU A;  1CPS A;  1ZG7 A;  1OBR A;  4DUK A;  4MCS A;  3NA6 A;  2F8H A;  1Z5R A;  1YW6 A;  2GRE A;  4X2T A;  2PE3 A;  2C6C A;  4OC0 A;  1RTQ A;  3D7G A;  3WAB A;  4CDK A;  3B7I A;  2CTC A;  4P4D A;  2JEW A;  4C8U A;  4MHY A;  1XFO A;  1Q7L A;  5IR2 A;  3WC5 A;  4JZ0 A;  5LRK A;  2AFX A;  1DE4 C;  2AFS A;  1ZG9 A;  3VAR A;  5K8M A;  4G1P A;  4ZYQ A;  5HVF A;  4P4B A;  5D29 A;  3KAS A;  3SJX A;  2C6P A;  3IEH A;  1Y9Z A;  1CPX A;  3FED A;  4KNG E;  4MRI A;  4F9V A;  4P44 A;  4A37 A;  2PRQ A;  1ARM A;  2ZEE A;  1YME A;  3RAM A;  1DTD A;  4FAI A;  2EK9 A;  4P4E A;  1XJO A;  2BCO A;  1XF1 A;  3PBE A;  4JYW A;  4W9Y A;  3T8W A;  5JH9 A;  3FMC A;  2Q43 A;  4K3N A;  3K2K A;  5J1Q A;  2AFO A;  2RB7 A;  2CIJ A;  3D4U A;  4MHZ A;  3RBU A;  4PXB A;  2PJA A;  1AYE A;  5LYD A;  7CPA A;  1YW4 A;  4NGR A;  1ZLI A;  4ZX8 A;  4B6Z A;  3HUV A;  2F7V A;  4UEF A;  4MHN A;  4NGP A;  4A39 A;  1Z2L A;  2OOT A;  4IHM A;  5HVH A;  3VH9 A;  3K9T A;  4R6T A;  2QVP A;  2NSM A;  1Y0Y A;  3WC7 A;  3FF3 A;  1TXR A;  4C8A A;  2ABZ A;  4EFD A;  5I4M A;  4EWT A;  3FX6 A;  2PJ0 A;  2V77 A;  4C84 A;  2PVV A;  2IQ6 A;  4C9U A;  3FJU A;  4NFR A;  3ICU A;  4C9R A;  2XEJ A;  3N5F A;  1JQG A;  5HXD A;  3PFO A;  1XMB A;  5THW A;  3KR4 A;  4YU9 A;  1CP7 A;  4P4J A;  4NGQ A;  3S9M A;  4MCQ A;  4DJL A;  3CPX A;  2ZEF A;  1TKH A;  1IGB A;  3FVL A;  1VHE A;  3IO1 A;  4CDJ A;  4ZY0 A;  1BPM A;  2I3C A;  3H8E A;  3IIB A;  5DS0 A;  2NYQ A;  1VGY A;  3NH5 A;  1XBU A;  3B3W A;  1R3N A;  4ONW A;  3LMS A;  3BI1 A;  1UWY A;  1TKJ A;  2HB6 A;  3FEE A;  4MMO A;  3KI9 A;  2PCU A;  2ZEM A;  1VHO A;  3PB9 X;  1V6C A;  4UF4 A;  2O53 A;  4FBE A;  1TF8 A;  3WC6 A;  3CPA A;  2ZEL A;  3B35 A;  3HLP A;  4Z65 A;  3ISX A;  3JRU A;  2AFM A;  4KSI A;  4NJR A;  3SJF A;  2AFW A;  4A94 A;  4OC5 A;  3SI0 A;  2PJ9 A;  1TKF A;  2PJ2 A;  4OC4 A;  4TJV A;  4R7M A;  4F8Z A;  3V7Z A;  5IB9 A;  4C85 A;  1Z8L A;  1R43 A;  2WZN A;  4MCP A;  1YSJ A;  4TWE A;  4EME A;  2RFH A;  1CX8 A;  2GU2 A;  4WJB A;  2EK8 A;  3PB7 X;  1AMP A;  3CDX A;  4MHP A;  3GUX A;  4DYO A;  1BLL E;  1LCP A;  2V8G A;  4P45 A;  3TX8 A;  3EIF A;  4C8F A;  3BI0 A;  4P10 A;  5LYI A;  4P4F A;  4NJQ A;  2QYV A;  2JBK A;  1KWM A;  1XRY A;  4MCR A;  5LRG A;  3BXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...