2C6PA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with phosphate anion
Total Genus 227
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
227
sequence length
694
structure length
677
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
publication title Structure of Glutamate Carboxypeptidase II, a Drug Target in Neuronal Damage and Prostate Cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 227
structure length 677
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2c6pA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2c6pA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c6pA02
4R8FA 8CPAA 4C9VA 2PE3A 3I1UA 2AFZA 2IMOA 3FEDA 3FEEA 5LYDA 4YN3A 1ELLP 2ZEMA 4YWYA 1TF9A 2EK8A 3VH9A 3KASA 4NJRA 1VGYA 4MCQA 1CPSA 3PEIA 3FMCA 2EK9A 1VHOA 1BPNA 1Z2LA 2XEIA 2AFSA 3EIFA 1IGBA 4TNUA 4C86A 1ZG8A 1LOKA 4KNGE 2V77A 4P10A 4MXUA 4P4EA 2C6PA 5D29A 3LMSA 3L2NA 2NSMA 4UEZA 4PPZA 4P6YA 3D7GA 4OC2A 4YU9A 1ZG7A 3T8WA 5HVHA 3GUXA 2IQ6A 4X2TA 3PB9X 1F2PA 5LYLA 1XFOA 4DYOA 5J1QA 2F7VA 4P4FA 3KL9A 1BLLE 3H8FA 1CPXA 2O53A 4ZYQA 4WJBA 2G9DA 3NFZA 4F9UA 3B35A 5HVFA 3SJFA 3D66A 2ZEHA 2ZEOA 5D8NA 2AFMA 1PYTB 4ZX9A 4NGTA 2NYQA 4R7MA 3NH5A 1XJOA 3PFEA 3I74A 2I3CA 3B7IA 3D7DA 1TKJA 3B3WA 4H2KA 3B3CA 2ZEPA 4OIWA 4OC4A 2PJ6A 3RZAA 4CPAA 3SJXA 1Z8LA 4PQAA 2PVVA 3D68A 2Q43A 2ZOFA 4MMOA 4MCSA 3PB8X 4JYWA 4UIAA 1BAVA 3WT4A 3MRUA 2HC9A 3QNVA 2XEGA 4FUUA 3WC5A 3BXMA 1Y0YA 2JBJA 3B3SA 2C1CA 3KGQA 4ONWA 1VIXA 2PJ7A 4C8FA 1LFWA 3K9TA 3HUVA 1ZG9A 2XEFA 1FNOA 1YW6A 1YMEA 4B6ZA 4C9RA 4BD9A 3BI0A 1H8LA 4C85A 4P4DA 4MHPA 2PJ0A 3WC7A 3V7ZA 3PB6X 1KWMA 4CDKA 4F8ZA 4P4JA 4C8AA 4W9YA 4EMEA 5JGFA 4Q7AA 3K2KA 3N5FA 2C6GA 1BPMA 5LYFA 4MCPA 2CF4A 1XF1A 1NSAA 4OC3A 4X3RA 1ELMP 2CTCA 4OC5A 2V8GA 3RAMA 1XMBA 3HLPA 2ZEEA 2PIZA 1JQGA 4FAIA 5JH9A 4TJXA 3SJEA 1HDQA 4NGMA 3BHXA 2AFWA 4P45A 1DE4C 3VTAA 3IC1A 4FBEA 3GLJA 2V8HA 4JZ0A 2PJ1A 1F57A 3H8EA 2ZELA 2PJ3A 2V8DA 5K8MA 4A38A 1GYTA 1TF8A 2PJCA 3KR5A 1Y0RA 3CPAA 2PIYA 3S9NA 3IFEA 3IWWA 3MN8A 4X8IA 5ELYA 4EWTA 1TXRA 3WC6A 3H8GA 3LWUA 4DJLA 1EE3P 1CP7A 5LYIA 2HB6A 2WZNA 1TKHA 2C6CA 2PJ8A 3B2YA 4NGPA 4PXDA 5K8PA 4NGQA 4MCRA 1CG2A 5K8NA 2EWBA 4R6TA 3FX6A 3NA6A 5CPAA 6CPAA 1YW4A 1Z5RA 2JEWA 3NH8A 1ARMA 2F8HA 2PJ5A 3KR4A 4C8PA 4TWEA 4P4BA 3ISZA 3CT9A 3SI1A 2PJAA 2OOTA 2GLFA 2PJ4A 4PXEA 1CP6A 1Y7EA 3SI2A 4KSIA 5K8OA 1AYEA 4NJQA 1VHEA 2FVGA 4C99A 3CDXA 2PVWA 2BO9A 3VATA 2WYRA 1LAPA 2PCUA 3FVLA 4P44A 3KZWA 4AXVA 3TX8A 5HXDA 2ZEFA 3KI9A 4CDJA 2PJ9A 4MHNA 4NGSA 4R76A 4ZX8A 4OIDA 3PB7X 4RUHA 4ZI6A 4UF4A 1LANA 1Q7LA 3FJUA 3IJ3A 5LRKA 1FT7A 2AFOA 3GB0A 5DS0A 3FECA 1DTDA 1HEEA 4C9EA 4IAVA 2V8VA 1LAMA 5LRGA 3PBEA 4EFDA 4IHMA 2BCOA 3I6SA 5F09A 4G1PA 4ZY1A 1F2OA 1R43A 3CPXA 4UIBA 5CBMA 1LCPA 3D7HA 4OC1A 2ZEGA 2RB7A 4O23A 5I4MA 4C84A 2POKA 1QQ9A 3JRUA 2QVPA 2QJ8A 5JM6A 2Q51A 1PCAA 4PXCA 1XBUA 2IJZA 3PFOA 3FF3A 2Q4ZA 4A37A 1OBRA 4PXBA 4C8UA 4ZY0A 2QYVA 3V38A 1CX8A 3DLJA 3VARA 3B3VA 4A39A 1UWYA 1IY7A 3SI0A 4NGNA 4LQGA 3NH4A 3PB4X 3ICUA 2CIJA 1ZLHA 3SJGA 4GM5A 1ZLIA 2OR4A 1YSJA 4ZY2A 1HDUA 2RFHA 3D67A 4UEFA 4C8TA 2DEAA 4OP4A 4Z65A 2AFUA 4OKOA 5HVGA 2GREA 4C8CA 3PBBA 3PRTA 1R3NA 2GU2A 4OC0A 3D7FA 4P4IA 1YLOA 3IEHA 2PRQA 2VL1A 5THWA 1XRYA 3ISXA 4C9UA 4C9AA 2O4HA 3IO1A 4WWVA 2GLJA 2JBKA 1WVMA 1Y9ZA 2PJ2A 3D4UA 4F9VA 4NGRA 3S9MA 2ABZA 2XEJA 4NFRA 5IB9A 2CTBA 3B3TA 3KQXA 4A94A 3KHXA 4MRIA 2AFXA 5LRJA 2BOAA 4K3NA 2PJBA 1AMPA 3IIBA 4UEEA 1RTQA 4OMEA 1M4LA 1CBXA 2ZENA 4FWUA 2J9AA 4TJVA 1QMUA 1TKFA 4IK2A 3TC8A 4DUKA 3KHZA 1V6CA 3RBUA 3FH4A 2ZEDA 4MHYA 2ANPA 2ZOGA 4MHZA 3KQZA 1ARLA 7CPAA 3S9LA 3DGVA 3WABA 3BI1A
chains in the Genus database with same CATH superfamily
3S6GA 3T5MA 3LD2A 5H86A 4UWJA 4R8FA 2E28A 3D2PA 3F0AA 1Z4EA 2FS5A 3EZEA 8CPAA 4C9VA 1YGHA 3CXQA 5C82A 2PE3A 3I1UA 1YQEA 2AFZA 1JWQA 2VZZA 1ZYMA 4IIYA 2YNDA 1BOBA 2IMOA 2D4PA 3PT1A 4LQ6A 4ZBGA 3FEDA 3S6HA 3FEEA 2CNMA 5LYDA 4CGPA 4KVOE 1Y7RA 1ELLP 2ZEMA 3ZNIA 1TF9A 2EK8A 4Q36A 3KASA 4YWYA 3VH9A 5BWAB 4COBA 2ARHA 4NJRA 3PGPA 1VGYA 4MCQA 1VBHA 1CPSA 4EYSA 1M4GA 1Q2DA 1RO5A 3FMCA 2EK9A 3O8ZA 1VHOA 1BPNA 2P0WA 1Z2LA 2FXFA 1WK4A 3D8PA 4OAEA 2XEIA 4R3LA 2REFA 5AG4A 1QSNA 2AFSA 5J8CA 1C3OB 3F5BA 3PP9A 2HI6A 1IGBA 4TNUA 3DNSA 3EIFA 4C86A 1ZG8A 3TTHA 2R8VA 1LOKA 4KNGE 1XOVA 2V77A 3TLBA 1IB1E 4CRYB 3VROA 4P10A 4MXUA 4CZ1A 4F6AA 4CAXA 4P4EA 2C6PA 5JPHA 4AVBA 1VI4A 4QUSA 5D29A 4KOVA 2GIVA 3LMSA 4CYPA 3A9LA 3L2NA 1YK3A 2NSMA 4UEZA 4PPZA 1T36B 5A28A 1R61A 4AG9A 4A95A 1A2ZA 2B4BA 2XPOA 4P6YA 3D7GA 4OC2A 4YU9A 5A27A 3KRVA 1ZG7A 3T8WA 5HVHA 3S6KA 3GUXA 4FD5A 2IQ6A 5J3XA 4CYOA 3BUOB 1CM0A 2B3VA 4RN7A 2VKZG 3TLZA 1ZO0A 3TO7A 1XEBA 4X2TA 4CO9A 3PB9X 1F2PA 2EVNA 4JXRA 5LYLA 3OB1B 1XFOA 4DYOA 5J1QA 3TLCA 2PCNA 4PK3A 2F7VA 1C30B 4P4FA 3VRRA 3KL9A 1BLLE 4XPKA 2Q7SA 1PUAA 1CPXA 2DF5A 2O53A 3H8FA 5JQ4A 4ZYQA 3TYXA 2YNEA 4WJBA 2G9DA 5EMIA 3NFZA 4M6IA 4F9UA 3B35A 2REEA 3OP0A 3SJFA 4KUAA 5HVFA 1PU9A 3D66A 2ZEHA 2ZEOA 2Q04A 3LACA 4KLWA 5D8NA 2Z11A 2C5QA 2AFMA 4R57A 1MJAA 1PYTB 2P6EA 1U6MA 4ZX9A 4NGTA 2GP4A 2NYQA 1Z9EA 2QIRA 4R7MA 4QC6A 1EZAA 3NH5A 1XJOA 3JTKA 3PFVA 3BJ7A 2Z3LA 4CS0B 5F47A 2DXQA 3BUXB 2HWGA 1NBWA 3PFEA 1LRZA 3I74A 2I3CA 3B7IA 3IGRA 4A31A 3TFYA 3D7DA 1TKJA 3B3WA 4H2KA 3B3CA 4BPXB 2ZEPA 4OC4A 1Z9UA 2PJ6A 4H6ZA 4OIWA 4ONUA 3RZAA 3SJXA 4A32A 4CPAA 3K4IA 4XNHC 2FE7A 1Z8LA 4PQAA 3WR7A 4KLVA 2PVVA 3HMJG 3D68A 2Q43A 2ZOFA 4MMOA 4MCSA 3PB8X 5KTAA 1DIKA 4FD4A 4MHDA 4JYWA 1XIXA 4UIAA 1BAVA 3T9YA 4QBJA 2ZW7A 3PEIA 3TO6A 3WT4A 3MRUA 4MBUA 5FD8A 1IOIA 2HC9A 1IOFA 1YVKA 3QNVA 2XEGA 1Z8TA 4FUUA 4UFVA 5HH1A 3WC5A 3T0TA 3BXMA 4KOTA 4ORFA 1Y0YA 3DSBA 3EO4A 3BUWB 2ATRA 4KUBA 2JBJA 4RS2A 1JDBC 2ZW6A 2C1CA 3B3SA 3KGQA 4ONWA 3G23A 3TO9A 5F9MA 2PSWA 1VIXA 2PJ7A 4C7HA 4C8FA 1LFWA 2WPWA 3K9TA 4MY3A 4BMHA 2P6FA 3VWEA 3P2FA 4JXQA 3EZBA 3HUVA 1ZG9A 2XEFA 1FNOA 1SQHA 4JD6A 5JVLA 2EZBA 3VWDA 4BTFA 4E8OA 1YW6A 1MJBA 2MP0A 1YMEA 4B6ZA 1KZFA 1Z8WA 3IU2A 4HKFA 4XPLA 4NCZA 4BD9A 4C9RA 3BI0A 1H8LA 3I3GA 1S5KA 2FL4A 4C85A 2X0SA 4OADA 1A9XB 4P4DA 3T05A 2PDOA 3E0KA 2PJ0A 3FBUA 4L89A 4MHPA 4U9YA 5FVJA 3V7ZA 3WC7A 4HNWB 3PB6X 1KWMA 3R1KA 4CDKA 3R95A 4KSAA 3VRNA 4F8ZA 4P4JA 4UCNA 2Q4YA 4W9YA 4C8AA 3EXNA 5KTDA 2XPNA 4B13A 5F13A 3OAKA 4UCPA 4A33A 4EMEA 4B14A 1ZL0A 4LUAA 5G22A 5JGFA 4Q7AA 3H4QA 2EUIA 3K2KA 4II9A 2R7HA 4NSQA 5AG5A 2Y1MA 2QECA 3N5FA 4UWIA 2C6GA 2YNCA 2Z0ZA 3T90A 4DNCA 1BPMA 5LYFA 4MCPA 5F1YA 2JEVA 2CF4A 4X5KA 4NEXA 1XF1A 4IIXA 1NSAA 4OC3A 4X3RA 1ELMP 2YGWA 2XPLA 2CTCA 4OC5A 2V8GA 1FY7A 3RAMA 2HV2A 4KOUA 5KTCA 4KVME 1CE8B 2YJVA 3B8GA 4PSXA 4C2ZA 1XMBA 3RYOA 3BLNA 1S7LA 4PV6A 1X10A 2Q0YA 3HLPA 5H84A 1L0CA 1P0HA 2ZEEA 3C8OA 2PIZA 1JQGA 3FNCA 3GYAA 2X7BA 5I4MA 4FAIA 2B5GA 2NMTA 3IWGA 4CAVA 2FT0A 3SJEA 5JH9A 4TJXA 4PSWA 2CY2A 1HDQA 1JDEA 3ZZIA 4NGMA 2HQYA 3BHXA 2AFWA 4P45A 1DE4C 2FIWA 2I00A 2I79A 3OB2B 3VTAA 2CNTA 3IC1A 1Y9WA 4K30A 4FBEA 3TLAA 5C88A 3BJ8A 3BUNB 3VRQA 1Q2CA 2WPXA 3GLJA 4UCMA 3U1BA 2V8HA 1CS0B 5DWMA 4JZ0A 2PJ1A 2EZAA 1F57A 3H8EA 2ZELA 3W91A 3G8WA 2PJ3A 4MFZA 2V8DA 1S3ZA 3RO0A 3D3SA 3FXTA 5K8MA 2Q4VA 1KC7A 1EZBA 1WJTA 1Z4RA 1VKCA 4A38A 2H5MA 5DWNA 1GYTA 2HROA 4BPWB 1TF8A 2PJCA 1I12A 3KR5A 5GCNA 2B58A 1Y0RA 4YFJA 1S7NA 2OH1A 3CPAA 1MJ9A 2PIYA 4CAWA 4H89A 3S9NA 4FD6A 4GXHA 3IFEA 3IWWA 4B5PA 3MN8A 2EZCA 2PR1A 4X8IA 2BL1A 5G20A 3FIXA 2GANA 4AVCA 2AUNA 5ELYA 4QB9A 4JWPA 3G3SA 4EWTA 2PR8A 4CRZB 3JVNA 3TOBA 4CAFA 1TXRA 3PZJA 3WC6A 2PRBA 4MJXA 4C84A 3H8GA 3LWUA 2J8MA 5AGEA 4QVTA 4FD7A 4DJLA 1XF8A 2VXKA 1EE3P 1CP7A 3FRMA 4HPSA 4OLLA 4UBRA 4R87A 1XE4A 5LYIA 2HB6A 2WZNA 4NXYA 1TKHA 5EBVA 3HPHE 1QSTA 4E94A 2C6CA 5IR2A 1YR0A 4R3KA 2PJ8A 3CXSA 5ISVA 3B2YA 2GFQA 3OWCA 4C7IA 2IL4A 4NGPA 5E96A 4NF1A 4CGLA 3SXOA 4PXDA 5K8PA 3IU1A 4NGQA 5BY0A 4HNXB 4MCRA 1CG2A 3H5ZA 4F0XA 2BSWA 5K8NA 1RXTA 4BPUB 2EWBA 3ZJ0A 4R6TA 1NE9A 3FX6A 3NA6A 4E2AA 3NE7A 4MFKA 5CPAA 4CAEA 3K9UA 4XNHB 3TCVA 6CPAA 1YW4A 1Z5RA 2JEWA 1N71A 2PC1A 3NH8A 1ARMA 2F8HA 2PJ5A 3KR4A 4B11A 1I21A 4TWEA 1KUXA 1ZRSA 4C8PA 4P4BA 5K99A 5AXIA 2FCKA 3ISZA 1M6VB 4M8DA 3U88C 2VEZA 3T07A 4M6GA 3R96A 3CT9A 3SI1A 1IYKA 3C26A 2PJAA 4UA3A 3W6SA 2OOTA 2GLFA 2PJ4A 4PXEA 4AG7A 1CP6A 1Y7EA 1UFHA 3S6FA 3SHPA 5F48A 2ZW5A 1KUYA 3SI2A 2YNCC 1YX0A 2AE6A 3VGOA 4KSIA 2ODFA 4XPDC 2R1IA 1OZPA 1Z8XA 5K8OA 1AYEA 2O28A 1Q5XA 3TLYA 4E5SA 4NJQA 1VHEA 2FVGA 2OU2A 1V0CA 3DDDA 4C99A 2OZGA 3CDXA 4KS9A 2PVWA 2BO9A 4KVXA 3GKRA 3QAYA 2Q7BA 2C27A 3VATA 2WYRA 4CGNA 2Z3PA 3TLEA 3EY5A 3GIUA 1LAPA 2PCUA 4H6UA 3FVLA 4P44A 3FYNA 3F8KA 2DPTA 3KZWA 4AXVA 3TX8A 2Z3KA 4KOWA 5HXDA 3PLFB 2ZEFA 3KI9A 4CDJA 1CJWA 2PJ9A 1P4NA 4NGSA 1MK4A 4MHNA 4R76A 1KBLA 4ZX8A 3NFQA 4OIDA 3PB7X 4KOXA 4RUHA 4ZI6A 2B4JC 2B5GB 4UF4A 1YVHA 1KUVA 1IYLA 1LANA 1Q7LA 2EBJA 2EO8A 2VI7A 2Y0MA 3FJUA 1GHEA 3IJ3A 4IF5A 2PQ8A 4BBHA 2D0PA 3R9FA 4INJA 1YVOA 2Z3OA 1QSMA 5LRKA 3R9GA 1FT7A 2AFOA 3GB0A 4F0YA 4RR2B 4CGOA 1B6BA 2OZHA 3N7ZA 5DS0A 3FECA 1DTDA 1HEEA 1S7FA 4C9EA 4IAVA 2G0BA 1Y9KA 2V8VA 2UV8G 1LAMA 2Y1NA 5LRGA 5HKZA 3PBEA 5F5XA 2FIAA 4EFDA 4IHMA 2JLMA 2BCOA 3I6SA 5F09A 4G1PA 4ZY1A 1F2OA 1J3LA 1R43A 1M44A 3CPXA 1EO0A 2BEIA 2GE3A 3UY5A 2ZXVA 4UIBA 1LCPA 3D7HA 4OC1A 1S7KA 2ZEGA 4CYNA 5CBMA 2RB7A 2BUEA 4JLYA 2J8NA 3F9KC 3P2HA 4O23A 2POKA 4B5OA 3DR8A 1QQ9A 3JRUA 4B5PB 1R57A 4CYQA 2QVPA 2QJ8A 5JM6A 1BXRB 3NE8A 2Q51A 1PCAA 4MFQA 1XBUA 4PXCA 4U9ZA 4B10A 2IJZA 3PFOA 4UFXA 5F49A 3EZAA 3FF3A 2Q4ZA 4A37A 2FM4A 1OBRA 2G3AA 4PXBA 4C8UA 4ZY0A 2QYVA 4PK2A 4U5YA 3V38A 3EC4A 1CX8A 1M1DA 1YREA 2J8RA 3DLJA 3VARA 3B3VA 4A39A 1UWYA 4MY0A 4UFWA 2YJTA 1NMTA 4YN3A 1IY7A 3SI0A 4NGNA 5HKWA 4LQGA 4BINA 2QMLA 3NH4A 4C2XA 1FBVA 4I49A 4YRHA 3W6XA 1K4JA 1ON0A 1GGOA 2Q44A 2Z10A 2P6GA 3PB4X 5AG7A 3ICUA 5F46A 3R9EA 5HMNA 2CIJA 3GJZA 3TOAA 1ZLHA 2ZW4A 3D2MA 4MFLA 4YGOA 3SJGA 5HKYA 4GM5A 1ZLIA 3GY9A 1M4DA 3CXPA 4COGA 2OR4A 1YSJA 4MI1A 5IB0A 2VQYA 2B4DB 4ZY2A 1HDUA 4C68A 2D4OA 2RFHA 1AUGA 3D67A 4J3GA 4MI4A 3HPGG 4UEFA 3RNZA 2CNSA 4GS4A 1I1DA 1WWZA 2DEAA 5IX3A 4C8TA 4OP4A 4Z65A 2AFUA 4OKOA 1NSLA 4E0AA 2RC4A 3CZXA 4RI1A 5HVGA 2GREA 3JUWA 4C8CA 4MJ8A 3PBBA 1J4JA 1S60A 3PRTA 2B4DA 4B12A 1R3NA 2GU2A 2JDCA 2VZYA 4KSFA 4OC0A 4A2ZA 2R82A 3QAHA 1QSRA 3FB3A 3TE4A 3D7FA 4P4IA 4H1HA 3IWEA 1YLOA 2KCWA 2B3UA 3IEHA 4M6HA 4CGMA 2PRQA 2FSRA 2VL1A 1IIDA 2R98A 5THWA 4LX9A 1XRYA 2VBQA 4HNYB 2WUUA 3ISXA 4M3SA 3TT2A 4AVAA 2AUMA 1Q2YA 1X12A 4C9AA 4C9UA 1IU8A 2O4HA 3IO1A 5I0CA 4WWVA 2CBLA 2DPSA 2GLJA 2JBKA 4L8AA 5IV0A 1WVMA 1Y9ZA 1VHSA 2DIKA 4R9MA 1IICA 2CXAA 2PJ2A 3V8IA 3D4UA 4F9VA 2Z3NA 2F5IA 5JYBA 3QB8A 3LODA 4NGRA 3S9MA 2ABZA 4KOYA 5AG6A 2OB0A 2XEJA 2A4NA 2JDDA 1BO4A 3EFAA 1B87A 4NFRA 2CTBA 3B3TA 3KQXA 4Q38A 4A94A 5IB9A 3KHXA 4KOSA 4MRIA 2AFXA 2G3TA 1B47A 2OLSA 2WSAA 5LRJA 4EVYA 4JJXA 1QSOA 2BOAA 3KKWA 4K3NA 4C2YA 4J0NA 2PJBA 1AMPA 2AJ6A 2K5TA 3IIBA 1M4IA 4UEEA 4M85A 1TIQA 1RTQA 4KZTA 5G1ZA 4OMEA 4A4CA 1M4LA 4Y49C 1CBXA 2ZENA 3BUMB 4A4BA 4FWUA 3TLGB 1XMTA 2J9AA 2HUZA 2Z3MA 4TJVA 1QMUA 3DR6A 4XPDB 4MFPA 1TKFA 1YLEA 4IK2A 3TC8A 3SXNA 4AB7A 5CNPA 4DUKA 2N3AB 4Y49B 2OZUA 3I9SA 3KHZA 3VRPA 1V6CA 2ZPAA 1KEEB 4ZGYB 1VBGA 3RBUA 5EC4A 3NOJA 4KORA 3FH4A 2ZEDA 4MHYA 2ANPA 2DLAA 3TLGA 2ZOGA 4MHZA 4GPLB 3KQZA 1NXJA 2B0AA 5J8FA 2D0OA 4IUSA 3MGDA 4A30A 1ARLA 4MFJA 7CPAA 3SR3A 2XPPA 5G21A 3S9LA 3DGVA 3WABA 4JVOA 3BI1A
chains in the Genus database with same CATH topology
4R8FA 8CPAA 4C9VA 2PE3A 3I1UA 2AFZA 2IMOA 3FEDA 3FEEA 5LYDA 4YN3A 1ELLP 2ZEMA 4YWYA 1TF9A 2EK8A 3VH9A 3KASA 4NJRA 1VGYA 4MCQA 1CPSA 3PEIA 3FMCA 2EK9A 1VHOA 1BPNA 1Z2LA 2XEIA 2AFSA 3EIFA 1IGBA 4TNUA 4C86A 1ZG8A 1LOKA 4KNGE 2V77A 4P10A 4MXUA 4P4EA 2C6PA 5D29A 3LMSA 3L2NA 2NSMA 4UEZA 4PPZA 4P6YA 3D7GA 4OC2A 4YU9A 1ZG7A 3T8WA 5HVHA 3GUXA 2IQ6A 4X2TA 3PB9X 1F2PA 5LYLA 1XFOA 4DYOA 5J1QA 2F7VA 4P4FA 3KL9A 1BLLE 3H8FA 1CPXA 2O53A 4ZYQA 4WJBA 2G9DA 3NFZA 4F9UA 3B35A 5HVFA 3SJFA 3D66A 2ZEHA 2ZEOA 5D8NA 2C5QA 2AFMA 1PYTB 4ZX9A 4NGTA 2GP4A 2NYQA 4R7MA 3NH5A 1XJOA 3PFEA 3I74A 2I3CA 3B7IA 3D7DA 1TKJA 3B3WA 4H2KA 3B3CA 2ZEPA 4OIWA 4OC4A 2PJ6A 3RZAA 4CPAA 3SJXA 1Z8LA 4PQAA 2PVVA 3D68A 2Q43A 2ZOFA 4MMOA 4MCSA 3PB8X 4JYWA 4UIAA 1BAVA 3WT4A 3MRUA 2HC9A 3QNVA 2XEGA 4FUUA 3WC5A 3BXMA 1Y0YA 2JBJA 3B3SA 2C1CA 3KGQA 4ONWA 1VIXA 2PJ7A 4C8FA 1LFWA 3K9TA 3HUVA 1ZG9A 2XEFA 1FNOA 1YW6A 1YMEA 4B6ZA 4C9RA 4BD9A 3BI0A 1H8LA 4C85A 4P4DA 4MHPA 2PJ0A 3WC7A 3V7ZA 3PB6X 1KWMA 4CDKA 4F8ZA 4P4JA 4C8AA 4W9YA 4EMEA 5JGFA 4Q7AA 3K2KA 3N5FA 2C6GA 1BPMA 5LYFA 4MCPA 2CF4A 1XF1A 1NSAA 4OC3A 4X3RA 1ELMP 2CTCA 4OC5A 2V8GA 3RAMA 1XMBA 3HLPA 2ZEEA 2PIZA 1JQGA 4FAIA 5JH9A 4TJXA 3SJEA 1HDQA 4NGMA 3BHXA 2AFWA 4P45A 1DE4C 3VTAA 3IC1A 4FBEA 3GLJA 2V8HA 4JZ0A 2PJ1A 1F57A 3H8EA 2ZELA 2PJ3A 2V8DA 5K8MA 4A38A 1GYTA 1TF8A 2PJCA 3KR5A 1Y0RA 3CPAA 2PIYA 3S9NA 3IFEA 3IWWA 3MN8A 4X8IA 5ELYA 4EWTA 1TXRA 3WC6A 3H8GA 3LWUA 4DJLA 1EE3P 1CP7A 5LYIA 2HB6A 2WZNA 1TKHA 2C6CA 5IR2A 2PJ8A 3B2YA 4NGPA 4PXDA 5K8PA 4NGQA 4MCRA 1CG2A 5K8NA 2EWBA 4R6TA 3FX6A 3NA6A 5CPAA 6CPAA 1YW4A 1Z5RA 2JEWA 3NH8A 1ARMA 2F8HA 2PJ5A 3KR4A 4C8PA 4TWEA 4P4BA 3ISZA 3CT9A 3SI1A 2PJAA 2OOTA 2GLFA 2PJ4A 4PXEA 1CP6A 1Y7EA 3SI2A 4KSIA 5K8OA 1AYEA 4NJQA 1VHEA 2FVGA 4C99A 3CDXA 2PVWA 2BO9A 3VATA 2WYRA 1LAPA 2PCUA 3FVLA 4P44A 3KZWA 4AXVA 3TX8A 5HXDA 2ZEFA 3KI9A 4CDJA 2PJ9A 4MHNA 4NGSA 4R76A 4ZX8A 4OIDA 3PB7X 4RUHA 4ZI6A 4UF4A 1LANA 1Q7LA 3FJUA 3IJ3A 5LRKA 1FT7A 2AFOA 3GB0A 5DS0A 3FECA 1DTDA 1HEEA 4C9EA 4IAVA 2V8VA 1LAMA 5LRGA 3PBEA 4EFDA 4IHMA 2BCOA 3I6SA 5F09A 4G1PA 4ZY1A 1F2OA 1R43A 3CPXA 4UIBA 5CBMA 1LCPA 3D7HA 4OC1A 2ZEGA 2RB7A 4O23A 5I4MA 4C84A 2POKA 1QQ9A 3JRUA 2QVPA 2QJ8A 5JM6A 2Q51A 1PCAA 4PXCA 1XBUA 2IJZA 3PFOA 3FF3A 2Q4ZA 4A37A 1OBRA 4PXBA 4C8UA 4ZY0A 2QYVA 3V38A 1CX8A 3DLJA 3VARA 3B3VA 4A39A 1UWYA 1IY7A 3SI0A 4NGNA 4LQGA 3NH4A 3PB4X 3ICUA 2CIJA 1ZLHA 3SJGA 4GM5A 1ZLIA 2OR4A 1YSJA 4ZY2A 1HDUA 2RFHA 3D67A 4UEFA 4C8TA 2DEAA 4OP4A 4Z65A 2AFUA 4OKOA 5HVGA 2GREA 4C8CA 3PBBA 3PRTA 1R3NA 2GU2A 4OC0A 3D7FA 4P4IA 1YLOA 3IEHA 2PRQA 2VL1A 5THWA 1XRYA 3ISXA 4C9UA 4C9AA 2O4HA 3IO1A 4WWVA 2GLJA 2JBKA 1WVMA 1Y9ZA 2PJ2A 3D4UA 4F9VA 4NGRA 3S9MA 2ABZA 2XEJA 4NFRA 5IB9A 2CTBA 3B3TA 3KQXA 4A94A 3KHXA 4MRIA 2AFXA 5LRJA 2BOAA 4K3NA 2PJBA 1AMPA 3IIBA 4UEEA 1RTQA 4OMEA 1M4LA 1CBXA 2ZENA 4FWUA 2J9AA 4TJVA 1QMUA 1TKFA 4IK2A 3TC8A 4DUKA 3KHZA 1V6CA 3RBUA 3FH4A 2ZEDA 4MHYA 2ANPA 2ZOGA 4MHZA 3KQZA 1ARLA 7CPAA 3S9LA 3DGVA 3WABA 3BI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8F A;  8CPA A;  4C9V A;  2PE3 A;  3I1U A;  2AFZ A;  2IMO A;  3FED A;  3FEE A;  5LYD A;  4YN3 A;  1ELL P;  2ZEM A;  4YWY A;  1TF9 A;  2EK8 A;  3VH9 A;  3KAS A;  4NJR A;  1VGY A;  4MCQ A;  1CPS A;  3PEI A;  3FMC A;  2EK9 A;  1VHO A;  1BPN A;  1Z2L A;  2XEI A;  2AFS A;  3EIF A;  1IGB A;  4TNU A;  4C86 A;  1ZG8 A;  1LOK A;  4KNG E;  2V77 A;  4P10 A;  4MXU A;  4P4E A;  2C6P A;  5D29 A;  3LMS A;  3L2N A;  2NSM A;  4UEZ A;  4PPZ A;  4P6Y A;  3D7G A;  4OC2 A;  4YU9 A;  1ZG7 A;  3T8W A;  5HVH A;  3GUX A;  2IQ6 A;  4X2T A;  3PB9 X;  1F2P A;  5LYL A;  1XFO A;  4DYO A;  5J1Q A;  2F7V A;  4P4F A;  3KL9 A;  1BLL E;  3H8F A;  1CPX A;  2O53 A;  4ZYQ A;  4WJB A;  2G9D A;  3NFZ A;  4F9U A;  3B35 A;  5HVF A;  3SJF A;  3D66 A;  2ZEH A;  2ZEO A;  5D8N A;  2AFM A;  1PYT B;  4ZX9 A;  4NGT A;  2NYQ A;  4R7M A;  3NH5 A;  1XJO A;  3PFE A;  3I74 A;  2I3C A;  3B7I A;  3D7D A;  1TKJ A;  3B3W A;  4H2K A;  3B3C A;  2ZEP A;  4OIW A;  4OC4 A;  2PJ6 A;  3RZA A;  4CPA A;  3SJX A;  1Z8L A;  4PQA A;  2PVV A;  3D68 A;  2Q43 A;  2ZOF A;  4MMO A;  4MCS A;  3PB8 X;  4JYW A;  4UIA A;  1BAV A;  3WT4 A;  3MRU A;  2HC9 A;  3QNV A;  2XEG A;  4FUU A;  3WC5 A;  3BXM A;  1Y0Y A;  2JBJ A;  3B3S A;  2C1C A;  3KGQ A;  4ONW A;  1VIX A;  2PJ7 A;  4C8F A;  1LFW A;  3K9T A;  3HUV A;  1ZG9 A;  2XEF A;  1FNO A;  1YW6 A;  1YME A;  4B6Z A;  4C9R A;  4BD9 A;  3BI0 A;  1H8L A;  4C85 A;  4P4D A;  4MHP A;  2PJ0 A;  3WC7 A;  3V7Z A;  3PB6 X;  1KWM A;  4CDK A;  4F8Z A;  4P4J A;  4C8A A;  4W9Y A;  4EME A;  5JGF A;  4Q7A A;  3K2K A;  3N5F A;  2C6G A;  1BPM A;  5LYF A;  4MCP A;  2CF4 A;  1XF1 A;  1NSA A;  4OC3 A;  4X3R A;  1ELM P;  2CTC A;  4OC5 A;  2V8G A;  3RAM A;  1XMB A;  3HLP A;  2ZEE A;  2PIZ A;  1JQG A;  4FAI A;  5JH9 A;  4TJX A;  3SJE A;  1HDQ A;  4NGM A;  3BHX A;  2AFW A;  4P45 A;  1DE4 C;  3VTA A;  3IC1 A;  4FBE A;  3GLJ A;  2V8H A;  4JZ0 A;  2PJ1 A;  1F57 A;  3H8E A;  2ZEL A;  2PJ3 A;  2V8D A;  5K8M A;  4A38 A;  1GYT A;  1TF8 A;  2PJC A;  3KR5 A;  1Y0R A;  3CPA A;  2PIY A;  3S9N A;  3IFE A;  3IWW A;  3MN8 A;  4X8I A;  5ELY A;  4EWT A;  1TXR A;  3WC6 A;  3H8G A;  3LWU A;  4DJL A;  1EE3 P;  1CP7 A;  5LYI A;  2HB6 A;  2WZN A;  1TKH A;  2C6C A;  2PJ8 A;  3B2Y A;  4NGP A;  4PXD A;  5K8P A;  4NGQ A;  4MCR A;  1CG2 A;  5K8N A;  2EWB A;  4R6T A;  3FX6 A;  3NA6 A;  5CPA A;  6CPA A;  1YW4 A;  1Z5R A;  2JEW A;  3NH8 A;  1ARM A;  2F8H A;  2PJ5 A;  3KR4 A;  4C8P A;  4TWE A;  4P4B A;  3ISZ A;  3CT9 A;  3SI1 A;  2PJA A;  2OOT A;  2GLF A;  2PJ4 A;  4PXE A;  1CP6 A;  1Y7E A;  3SI2 A;  4KSI A;  5K8O A;  1AYE A;  4NJQ A;  1VHE A;  2FVG A;  4C99 A;  3CDX A;  2PVW A;  2BO9 A;  3VAT A;  2WYR A;  1LAP A;  2PCU A;  3FVL A;  4P44 A;  3KZW A;  4AXV A;  3TX8 A;  5HXD A;  2ZEF A;  3KI9 A;  4CDJ A;  2PJ9 A;  4MHN A;  4NGS A;  4R76 A;  4ZX8 A;  4OID A;  3PB7 X;  4RUH A;  4ZI6 A;  4UF4 A;  1LAN A;  1Q7L A;  3FJU A;  3IJ3 A;  5LRK A;  1FT7 A;  2AFO A;  3GB0 A;  5DS0 A;  3FEC A;  1DTD A;  1HEE A;  4C9E A;  4IAV A;  2V8V A;  1LAM A;  5LRG A;  3PBE A;  4EFD A;  4IHM A;  2BCO A;  3I6S A;  5F09 A;  4G1P A;  4ZY1 A;  1F2O A;  1R43 A;  3CPX A;  4UIB A;  5CBM A;  1LCP A;  3D7H A;  4OC1 A;  2ZEG A;  2RB7 A;  4O23 A;  5I4M A;  4C84 A;  2POK A;  1QQ9 A;  3JRU A;  2QVP A;  2QJ8 A;  5JM6 A;  2Q51 A;  1PCA A;  4PXC A;  1XBU A;  2IJZ A;  3PFO A;  3FF3 A;  2Q4Z A;  4A37 A;  1OBR A;  4PXB A;  4C8U A;  4ZY0 A;  2QYV A;  3V38 A;  1CX8 A;  3DLJ A;  3VAR A;  3B3V A;  4A39 A;  1UWY A;  1IY7 A;  3SI0 A;  4NGN A;  4LQG A;  3NH4 A;  3PB4 X;  3ICU A;  2CIJ A;  1ZLH A;  3SJG A;  4GM5 A;  1ZLI A;  2OR4 A;  1YSJ A;  4ZY2 A;  1HDU A;  2RFH A;  3D67 A;  4UEF A;  4C8T A;  2DEA A;  4OP4 A;  4Z65 A;  2AFU A;  4OKO A;  5HVG A;  2GRE A;  4C8C A;  3PBB A;  3PRT A;  1R3N A;  2GU2 A;  4OC0 A;  3D7F A;  4P4I A;  1YLO A;  3IEH A;  2PRQ A;  2VL1 A;  5THW A;  1XRY A;  3ISX A;  4C9U A;  4C9A A;  2O4H A;  3IO1 A;  4WWV A;  2GLJ A;  2JBK A;  1WVM A;  1Y9Z A;  2PJ2 A;  3D4U A;  4F9V A;  4NGR A;  3S9M A;  2ABZ A;  2XEJ A;  4NFR A;  5IB9 A;  2CTB A;  3B3T A;  3KQX A;  4A94 A;  3KHX A;  4MRI A;  2AFX A;  5LRJ A;  2BOA A;  4K3N A;  2PJB A;  1AMP A;  3IIB A;  4UEE A;  1RTQ A;  4OME A;  1M4L A;  1CBX A;  2ZEN A;  4FWU A;  2J9A A;  4TJV A;  1QMU A;  1TKF A;  4IK2 A;  3TC8 A;  4DUK A;  3KHZ A;  1V6C A;  3RBU A;  3FH4 A;  2ZED A;  4MHY A;  2ANP A;  2ZOG A;  4MHZ A;  3KQZ A;  1ARL A;  7CPA A;  3S9L A;  3DGV A;  3WAB A;  3BI1 A; 
#chains in the Genus database with same CATH topology
 3S6G A;  3T5M A;  3LD2 A;  5H86 A;  4UWJ A;  4R8F A;  2E28 A;  3D2P A;  3F0A A;  1Z4E A;  2FS5 A;  3EZE A;  8CPA A;  4C9V A;  1YGH A;  3CXQ A;  5C82 A;  2PE3 A;  3I1U A;  1YQE A;  2AFZ A;  1JWQ A;  2VZZ A;  1ZYM A;  4IIY A;  2YND A;  1BOB A;  2IMO A;  2D4P A;  3PT1 A;  4LQ6 A;  4ZBG A;  3FED A;  3S6H A;  3FEE A;  2CNM A;  5LYD A;  4CGP A;  4KVO E;  1Y7R A;  1ELL P;  2ZEM A;  3ZNI A;  1TF9 A;  2EK8 A;  4Q36 A;  3KAS A;  4YWY A;  3VH9 A;  5BWA B;  4COB A;  2ARH A;  4NJR A;  3PGP A;  1VGY A;  4MCQ A;  1VBH A;  1CPS A;  4EYS A;  1M4G A;  1Q2D A;  1RO5 A;  3FMC A;  2EK9 A;  3O8Z A;  1VHO A;  1BPN A;  2P0W A;  1Z2L A;  2FXF A;  1WK4 A;  3D8P A;  4OAE A;  2XEI A;  4R3L A;  2REF A;  5AG4 A;  1QSN A;  2AFS A;  5J8C A;  1C3O B;  3F5B A;  3PP9 A;  2HI6 A;  1IGB A;  4TNU A;  3DNS A;  3EIF A;  4C86 A;  1ZG8 A;  3TTH A;  2R8V A;  1LOK A;  4KNG E;  1XOV A;  2V77 A;  3TLB A;  1IB1 E;  4CRY B;  3VRO A;  4P10 A;  4MXU A;  4CZ1 A;  4F6A A;  4CAX A;  4P4E A;  2C6P A;  5JPH A;  4AVB A;  1VI4 A;  4QUS A;  5D29 A;  4KOV A;  2GIV A;  3LMS A;  4CYP A;  3A9L A;  3L2N A;  1YK3 A;  2NSM A;  4UEZ A;  4PPZ A;  1T36 B;  5A28 A;  1R61 A;  4AG9 A;  4A95 A;  1A2Z A;  2B4B A;  2XPO A;  4P6Y A;  3D7G A;  4OC2 A;  4YU9 A;  5A27 A;  3KRV A;  1ZG7 A;  3T8W A;  5HVH A;  3S6K A;  3GUX A;  4FD5 A;  2IQ6 A;  5J3X A;  4CYO A;  3BUO B;  1CM0 A;  2B3V A;  4RN7 A;  2VKZ G;  3TLZ A;  1ZO0 A;  3TO7 A;  1XEB A;  4X2T A;  4CO9 A;  3PB9 X;  1F2P A;  2EVN A;  4JXR A;  5LYL A;  3OB1 B;  1XFO A;  4DYO A;  5J1Q A;  3TLC A;  2PCN A;  4PK3 A;  2F7V A;  1C30 B;  4P4F A;  3VRR A;  3KL9 A;  1BLL E;  4XPK A;  2Q7S A;  1PUA A;  1CPX A;  2DF5 A;  2O53 A;  3H8F A;  5JQ4 A;  4ZYQ A;  3TYX A;  2YNE A;  4WJB A;  2G9D A;  5EMI A;  3NFZ A;  4M6I A;  4F9U A;  3B35 A;  2REE A;  3OP0 A;  3SJF A;  4KUA A;  5HVF A;  1PU9 A;  3D66 A;  2ZEH A;  2ZEO A;  2Q04 A;  3LAC A;  4KLW A;  5D8N A;  2Z11 A;  2C5Q A;  2AFM A;  4R57 A;  1MJA A;  1PYT B;  2P6E A;  1U6M A;  4ZX9 A;  4NGT A;  2GP4 A;  2NYQ A;  1Z9E A;  2QIR A;  4R7M A;  4QC6 A;  1EZA A;  3NH5 A;  1XJO A;  3JTK A;  3PFV A;  3BJ7 A;  2Z3L A;  4CS0 B;  5F47 A;  2DXQ A;  3BUX B;  2HWG A;  1NBW A;  3PFE A;  1LRZ A;  3I74 A;  2I3C A;  3B7I A;  3IGR A;  4A31 A;  3TFY A;  3D7D A;  1TKJ A;  3B3W A;  4H2K A;  3B3C A;  4BPX B;  2ZEP A;  4OC4 A;  1Z9U A;  2PJ6 A;  4H6Z A;  4OIW A;  4ONU A;  3RZA A;  3SJX A;  4A32 A;  4CPA A;  3K4I A;  4XNH C;  2FE7 A;  1Z8L A;  4PQA A;  3WR7 A;  4KLV A;  2PVV A;  3HMJ G;  3D68 A;  2Q43 A;  2ZOF A;  4MMO A;  4MCS A;  3PB8 X;  5KTA A;  1DIK A;  4FD4 A;  4MHD A;  4JYW A;  1XIX A;  4UIA A;  1BAV A;  3T9Y A;  4QBJ A;  2ZW7 A;  3PEI A;  3TO6 A;  3WT4 A;  3MRU A;  4MBU A;  5FD8 A;  1IOI A;  2HC9 A;  1IOF A;  1YVK A;  3QNV A;  2XEG A;  1Z8T A;  4FUU A;  4UFV A;  5HH1 A;  3WC5 A;  3T0T A;  3BXM A;  4KOT A;  4ORF A;  1Y0Y A;  3DSB A;  3EO4 A;  3BUW B;  2ATR A;  4KUB A;  2JBJ A;  4RS2 A;  1JDB C;  2ZW6 A;  2C1C A;  3B3S A;  3KGQ A;  4ONW A;  3G23 A;  3TO9 A;  5F9M A;  2PSW A;  1VIX A;  2PJ7 A;  4C7H A;  4C8F A;  1LFW A;  2WPW A;  3K9T A;  4MY3 A;  4BMH A;  2P6F A;  3VWE A;  3P2F A;  4JXQ A;  3EZB A;  3HUV A;  1ZG9 A;  2XEF A;  1FNO A;  1SQH A;  4JD6 A;  5JVL A;  2EZB A;  3VWD A;  4BTF A;  4E8O A;  1YW6 A;  1MJB A;  2MP0 A;  1YME A;  4B6Z A;  1KZF A;  1Z8W A;  3IU2 A;  4HKF A;  4XPL A;  4NCZ A;  4BD9 A;  4C9R A;  3BI0 A;  1H8L A;  3I3G A;  1S5K A;  2FL4 A;  4C85 A;  2X0S A;  4OAD A;  1A9X B;  4P4D A;  3T05 A;  2PDO A;  3E0K A;  2PJ0 A;  3FBU A;  4L89 A;  4MHP A;  4U9Y A;  5FVJ A;  3V7Z A;  3WC7 A;  4HNW B;  3PB6 X;  1KWM A;  3R1K A;  4CDK A;  3R95 A;  4KSA A;  3VRN A;  4F8Z A;  4P4J A;  4UCN A;  2Q4Y A;  4W9Y A;  4C8A A;  3EXN A;  5KTD A;  2XPN A;  4B13 A;  5F13 A;  3OAK A;  4UCP A;  4A33 A;  4EME A;  4B14 A;  1ZL0 A;  4LUA A;  5G22 A;  5JGF A;  4Q7A A;  3H4Q A;  2EUI A;  3K2K A;  4II9 A;  2R7H A;  4NSQ A;  5AG5 A;  2Y1M A;  2QEC A;  3N5F A;  4UWI A;  2C6G A;  2YNC A;  2Z0Z A;  3T90 A;  4DNC A;  1BPM A;  5LYF A;  4MCP A;  5F1Y A;  2JEV A;  2CF4 A;  4X5K A;  4NEX A;  1XF1 A;  4IIX A;  1NSA A;  4OC3 A;  4X3R A;  1ELM P;  2YGW A;  2XPL A;  2CTC A;  4OC5 A;  2V8G A;  1FY7 A;  3RAM A;  2HV2 A;  4KOU A;  5KTC A;  4KVM E;  1CE8 B;  2YJV A;  3B8G A;  4PSX A;  4C2Z A;  1XMB A;  3RYO A;  3BLN A;  1S7L A;  4PV6 A;  1X10 A;  2Q0Y A;  3HLP A;  5H84 A;  1L0C A;  1P0H A;  2ZEE A;  3C8O A;  2PIZ A;  1JQG A;  3FNC A;  3GYA A;  2X7B A;  5I4M A;  4FAI A;  2B5G A;  2NMT A;  3IWG A;  4CAV A;  2FT0 A;  3SJE A;  5JH9 A;  4TJX A;  4PSW A;  2CY2 A;  1HDQ A;  1JDE A;  3ZZI A;  4NGM A;  2HQY A;  3BHX A;  2AFW A;  4P45 A;  1DE4 C;  2FIW A;  2I00 A;  2I79 A;  3OB2 B;  3VTA A;  2CNT A;  3IC1 A;  1Y9W A;  4K30 A;  4FBE A;  3TLA A;  5C88 A;  3BJ8 A;  3BUN B;  3VRQ A;  1Q2C A;  2WPX A;  3GLJ A;  4UCM A;  3U1B A;  2V8H A;  1CS0 B;  5DWM A;  4JZ0 A;  2PJ1 A;  2EZA A;  1F57 A;  3H8E A;  2ZEL A;  3W91 A;  3G8W A;  2PJ3 A;  4MFZ A;  2V8D A;  1S3Z A;  3RO0 A;  3D3S A;  3FXT A;  5K8M A;  2Q4V A;  1KC7 A;  1EZB A;  1WJT A;  1Z4R A;  1VKC A;  4A38 A;  2H5M A;  5DWN A;  1GYT A;  2HRO A;  4BPW B;  1TF8 A;  2PJC A;  1I12 A;  3KR5 A;  5GCN A;  2B58 A;  1Y0R A;  4YFJ A;  1S7N A;  2OH1 A;  3CPA A;  1MJ9 A;  2PIY A;  4CAW A;  4H89 A;  3S9N A;  4FD6 A;  4GXH A;  3IFE A;  3IWW A;  4B5P A;  3MN8 A;  2EZC A;  2PR1 A;  4X8I A;  2BL1 A;  5G20 A;  3FIX A;  2GAN A;  4AVC A;  2AUN A;  5ELY A;  4QB9 A;  4JWP A;  3G3S A;  4EWT A;  2PR8 A;  4CRZ B;  3JVN A;  3TOB A;  4CAF A;  1TXR A;  3PZJ A;  3WC6 A;  2PRB A;  4MJX A;  4C84 A;  3H8G A;  3LWU A;  2J8M A;  5AGE A;  4QVT A;  4FD7 A;  4DJL A;  1XF8 A;  2VXK A;  1EE3 P;  1CP7 A;  3FRM A;  4HPS A;  4OLL A;  4UBR A;  4R87 A;  1XE4 A;  5LYI A;  2HB6 A;  2WZN A;  4NXY A;  1TKH A;  5EBV A;  3HPH E;  1QST A;  4E94 A;  2C6C A;  5IR2 A;  1YR0 A;  4R3K A;  2PJ8 A;  3CXS A;  5ISV A;  3B2Y A;  2GFQ A;  3OWC A;  4C7I A;  2IL4 A;  4NGP A;  5E96 A;  4NF1 A;  4CGL A;  3SXO A;  4PXD A;  5K8P A;  3IU1 A;  4NGQ A;  5BY0 A;  4HNX B;  4MCR A;  1CG2 A;  3H5Z A;  4F0X A;  2BSW A;  5K8N A;  1RXT A;  4BPU B;  2EWB A;  3ZJ0 A;  4R6T A;  1NE9 A;  3FX6 A;  3NA6 A;  4E2A A;  3NE7 A;  4MFK A;  5CPA A;  4CAE A;  3K9U A;  4XNH B;  3TCV A;  6CPA A;  1YW4 A;  1Z5R A;  2JEW A;  1N71 A;  2PC1 A;  3NH8 A;  1ARM A;  2F8H A;  2PJ5 A;  3KR4 A;  4B11 A;  1I21 A;  4TWE A;  1KUX A;  1ZRS A;  4C8P A;  4P4B A;  5K99 A;  5AXI A;  2FCK A;  3ISZ A;  1M6V B;  4M8D A;  3U88 C;  2VEZ A;  3T07 A;  4M6G A;  3R96 A;  3CT9 A;  3SI1 A;  1IYK A;  3C26 A;  2PJA A;  4UA3 A;  3W6S A;  2OOT A;  2GLF A;  2PJ4 A;  4PXE A;  4AG7 A;  1CP6 A;  1Y7E A;  1UFH A;  3S6F A;  3SHP A;  5F48 A;  2ZW5 A;  1KUY A;  3SI2 A;  2YNC C;  1YX0 A;  2AE6 A;  3VGO A;  4KSI A;  2ODF A;  4XPD C;  2R1I A;  1OZP A;  1Z8X A;  5K8O A;  1AYE A;  2O28 A;  1Q5X A;  3TLY A;  4E5S A;  4NJQ A;  1VHE A;  2FVG A;  2OU2 A;  1V0C A;  3DDD A;  4C99 A;  2OZG A;  3CDX A;  4KS9 A;  2PVW A;  2BO9 A;  4KVX A;  3GKR A;  3QAY A;  2Q7B A;  2C27 A;  3VAT A;  2WYR A;  4CGN A;  2Z3P A;  3TLE A;  3EY5 A;  3GIU A;  1LAP A;  2PCU A;  4H6U A;  3FVL A;  4P44 A;  3FYN A;  3F8K A;  2DPT A;  3KZW A;  4AXV A;  3TX8 A;  2Z3K A;  4KOW A;  5HXD A;  3PLF B;  2ZEF A;  3KI9 A;  4CDJ A;  1CJW A;  2PJ9 A;  1P4N A;  4NGS A;  1MK4 A;  4MHN A;  4R76 A;  1KBL A;  4ZX8 A;  3NFQ A;  4OID A;  3PB7 X;  4KOX A;  4RUH A;  4ZI6 A;  2B4J C;  2B5G B;  4UF4 A;  1YVH A;  1KUV A;  1IYL A;  1LAN A;  1Q7L A;  2EBJ A;  2EO8 A;  2VI7 A;  2Y0M A;  3FJU A;  1GHE A;  3IJ3 A;  4IF5 A;  2PQ8 A;  4BBH A;  2D0P A;  3R9F A;  4INJ A;  1YVO A;  2Z3O A;  1QSM A;  5LRK A;  3R9G A;  1FT7 A;  2AFO A;  3GB0 A;  4F0Y A;  4RR2 B;  4CGO A;  1B6B A;  2OZH A;  3N7Z A;  5DS0 A;  3FEC A;  1DTD A;  1HEE A;  1S7F A;  4C9E A;  4IAV A;  2G0B A;  1Y9K A;  2V8V A;  2UV8 G;  1LAM A;  2Y1N A;  5LRG A;  5HKZ A;  3PBE A;  5F5X A;  2FIA A;  4EFD A;  4IHM A;  2JLM A;  2BCO A;  3I6S A;  5F09 A;  4G1P A;  4ZY1 A;  1F2O A;  1J3L A;  1R43 A;  1M44 A;  3CPX A;  1EO0 A;  2BEI A;  2GE3 A;  3UY5 A;  2ZXV A;  4UIB A;  1LCP A;  3D7H A;  4OC1 A;  1S7K A;  2ZEG A;  4CYN A;  5CBM A;  2RB7 A;  2BUE A;  4JLY A;  2J8N A;  3F9K C;  3P2H A;  4O23 A;  2POK A;  4B5O A;  3DR8 A;  1QQ9 A;  3JRU A;  4B5P B;  1R57 A;  4CYQ A;  2QVP A;  2QJ8 A;  5JM6 A;  1BXR B;  3NE8 A;  2Q51 A;  1PCA A;  4MFQ A;  1XBU A;  4PXC A;  4U9Z A;  4B10 A;  2IJZ A;  3PFO A;  4UFX A;  5F49 A;  3EZA A;  3FF3 A;  2Q4Z A;  4A37 A;  2FM4 A;  1OBR A;  2G3A A;  4PXB A;  4C8U A;  4ZY0 A;  2QYV A;  4PK2 A;  4U5Y A;  3V38 A;  3EC4 A;  1CX8 A;  1M1D A;  1YRE A;  2J8R A;  3DLJ A;  3VAR A;  3B3V A;  4A39 A;  1UWY A;  4MY0 A;  4UFW A;  2YJT A;  1NMT A;  4YN3 A;  1IY7 A;  3SI0 A;  4NGN A;  5HKW A;  4LQG A;  4BIN A;  2QML A;  3NH4 A;  4C2X A;  1FBV A;  4I49 A;  4YRH A;  3W6X A;  1K4J A;  1ON0 A;  1GGO A;  2Q44 A;  2Z10 A;  2P6G A;  3PB4 X;  5AG7 A;  3ICU A;  5F46 A;  3R9E A;  5HMN A;  2CIJ A;  3GJZ A;  3TOA A;  1ZLH A;  2ZW4 A;  3D2M A;  4MFL A;  4YGO A;  3SJG A;  5HKY A;  4GM5 A;  1ZLI A;  3GY9 A;  1M4D A;  3CXP A;  4COG A;  2OR4 A;  1YSJ A;  4MI1 A;  5IB0 A;  2VQY A;  2B4D B;  4ZY2 A;  1HDU A;  4C68 A;  2D4O A;  2RFH A;  1AUG A;  3D67 A;  4J3G A;  4MI4 A;  3HPG G;  4UEF A;  3RNZ A;  2CNS A;  4GS4 A;  1I1D A;  1WWZ A;  2DEA A;  5IX3 A;  4C8T A;  4OP4 A;  4Z65 A;  2AFU A;  4OKO A;  1NSL A;  4E0A A;  2RC4 A;  3CZX A;  4RI1 A;  5HVG A;  2GRE A;  3JUW A;  4C8C A;  4MJ8 A;  3PBB A;  1J4J A;  1S60 A;  3PRT A;  2B4D A;  4B12 A;  1R3N A;  2GU2 A;  2JDC A;  2VZY A;  4KSF A;  4OC0 A;  4A2Z A;  2R82 A;  3QAH A;  1QSR A;  3FB3 A;  3TE4 A;  3D7F A;  4P4I A;  4H1H A;  3IWE A;  1YLO A;  2KCW A;  2B3U A;  3IEH A;  4M6H A;  4CGM A;  2PRQ A;  2FSR A;  2VL1 A;  1IID A;  2R98 A;  5THW A;  4LX9 A;  1XRY A;  2VBQ A;  4HNY B;  2WUU A;  3ISX A;  4M3S A;  3TT2 A;  4AVA A;  2AUM A;  1Q2Y A;  1X12 A;  4C9A A;  4C9U A;  1IU8 A;  2O4H A;  3IO1 A;  5I0C A;  4WWV A;  2CBL A;  2DPS A;  2GLJ A;  2JBK A;  4L8A A;  5IV0 A;  1WVM A;  1Y9Z A;  1VHS A;  2DIK A;  4R9M A;  1IIC A;  2CXA A;  2PJ2 A;  3V8I A;  3D4U A;  4F9V A;  2Z3N A;  2F5I A;  5JYB A;  3QB8 A;  3LOD A;  4NGR A;  3S9M A;  2ABZ A;  4KOY A;  5AG6 A;  2OB0 A;  2XEJ A;  2A4N A;  2JDD A;  1BO4 A;  3EFA A;  1B87 A;  4NFR A;  2CTB A;  3B3T A;  3KQX A;  4Q38 A;  4A94 A;  5IB9 A;  3KHX A;  4KOS A;  4MRI A;  2AFX A;  2G3T A;  1B47 A;  2OLS A;  2WSA A;  5LRJ A;  4EVY A;  4JJX A;  1QSO A;  2BOA A;  3KKW A;  4K3N A;  4C2Y A;  4J0N A;  2PJB A;  1AMP A;  2AJ6 A;  2K5T A;  3IIB A;  1M4I A;  4UEE A;  4M85 A;  1TIQ A;  1RTQ A;  4KZT A;  5G1Z A;  4OME A;  4A4C A;  1M4L A;  4Y49 C;  1CBX A;  2ZEN A;  3BUM B;  4A4B A;  4FWU A;  3TLG B;  1XMT A;  2J9A A;  2HUZ A;  2Z3M A;  4TJV A;  1QMU A;  3DR6 A;  4XPD B;  4MFP A;  1TKF A;  1YLE A;  4IK2 A;  3TC8 A;  3SXN A;  4AB7 A;  5CNP A;  4DUK A;  2N3A B;  4Y49 B;  2OZU A;  3I9S A;  3KHZ A;  3VRP A;  1V6C A;  2ZPA A;  1KEE B;  4ZGY B;  1VBG A;  3RBU A;  5EC4 A;  3NOJ A;  4KOR A;  3FH4 A;  2ZED A;  4MHY A;  2ANP A;  2DLA A;  3TLG A;  2ZOG A;  4MHZ A;  4GPL B;  3KQZ A;  1NXJ A;  2B0A A;  5J8F A;  2D0O A;  4IUS A;  3MGD A;  4A30 A;  1ARL A;  4MFJ A;  7CPA A;  3SR3 A;  2XPP A;  5G21 A;  3S9L A;  3DGV A;  3WAB A;  4JVO A;  3BI1 A; 
#chains in the Genus database with same CATH homology
 4R8F A;  8CPA A;  4C9V A;  2PE3 A;  3I1U A;  2AFZ A;  2IMO A;  3FED A;  3FEE A;  5LYD A;  4YN3 A;  1ELL P;  2ZEM A;  4YWY A;  1TF9 A;  2EK8 A;  3VH9 A;  3KAS A;  4NJR A;  1VGY A;  4MCQ A;  1CPS A;  3PEI A;  3FMC A;  2EK9 A;  1VHO A;  1BPN A;  1Z2L A;  2XEI A;  2AFS A;  3EIF A;  1IGB A;  4TNU A;  4C86 A;  1ZG8 A;  1LOK A;  4KNG E;  2V77 A;  4P10 A;  4MXU A;  4P4E A;  2C6P A;  5D29 A;  3LMS A;  3L2N A;  2NSM A;  4UEZ A;  4PPZ A;  4P6Y A;  3D7G A;  4OC2 A;  4YU9 A;  1ZG7 A;  3T8W A;  5HVH A;  3GUX A;  2IQ6 A;  4X2T A;  3PB9 X;  1F2P A;  5LYL A;  1XFO A;  4DYO A;  5J1Q A;  2F7V A;  4P4F A;  3KL9 A;  1BLL E;  3H8F A;  1CPX A;  2O53 A;  4ZYQ A;  4WJB A;  2G9D A;  3NFZ A;  4F9U A;  3B35 A;  5HVF A;  3SJF A;  3D66 A;  2ZEH A;  2ZEO A;  5D8N A;  2C5Q A;  2AFM A;  1PYT B;  4ZX9 A;  4NGT A;  2GP4 A;  2NYQ A;  4R7M A;  3NH5 A;  1XJO A;  3PFE A;  3I74 A;  2I3C A;  3B7I A;  3D7D A;  1TKJ A;  3B3W A;  4H2K A;  3B3C A;  2ZEP A;  4OIW A;  4OC4 A;  2PJ6 A;  3RZA A;  4CPA A;  3SJX A;  1Z8L A;  4PQA A;  2PVV A;  3D68 A;  2Q43 A;  2ZOF A;  4MMO A;  4MCS A;  3PB8 X;  4JYW A;  4UIA A;  1BAV A;  3WT4 A;  3MRU A;  2HC9 A;  3QNV A;  2XEG A;  4FUU A;  3WC5 A;  3BXM A;  1Y0Y A;  2JBJ A;  3B3S A;  2C1C A;  3KGQ A;  4ONW A;  1VIX A;  2PJ7 A;  4C8F A;  1LFW A;  3K9T A;  3HUV A;  1ZG9 A;  2XEF A;  1FNO A;  1YW6 A;  1YME A;  4B6Z A;  4C9R A;  4BD9 A;  3BI0 A;  1H8L A;  4C85 A;  4P4D A;  4MHP A;  2PJ0 A;  3WC7 A;  3V7Z A;  3PB6 X;  1KWM A;  4CDK A;  4F8Z A;  4P4J A;  4C8A A;  4W9Y A;  4EME A;  5JGF A;  4Q7A A;  3K2K A;  3N5F A;  2C6G A;  1BPM A;  5LYF A;  4MCP A;  2CF4 A;  1XF1 A;  1NSA A;  4OC3 A;  4X3R A;  1ELM P;  2CTC A;  4OC5 A;  2V8G A;  3RAM A;  1XMB A;  3HLP A;  2ZEE A;  2PIZ A;  1JQG A;  4FAI A;  5JH9 A;  4TJX A;  3SJE A;  1HDQ A;  4NGM A;  3BHX A;  2AFW A;  4P45 A;  1DE4 C;  3VTA A;  3IC1 A;  4FBE A;  3GLJ A;  2V8H A;  4JZ0 A;  2PJ1 A;  1F57 A;  3H8E A;  2ZEL A;  2PJ3 A;  2V8D A;  5K8M A;  4A38 A;  1GYT A;  1TF8 A;  2PJC A;  3KR5 A;  1Y0R A;  3CPA A;  2PIY A;  3S9N A;  3IFE A;  3IWW A;  3MN8 A;  4X8I A;  5ELY A;  4EWT A;  1TXR A;  3WC6 A;  3H8G A;  3LWU A;  4DJL A;  1EE3 P;  1CP7 A;  5LYI A;  2HB6 A;  2WZN A;  1TKH A;  2C6C A;  5IR2 A;  2PJ8 A;  3B2Y A;  4NGP A;  4PXD A;  5K8P A;  4NGQ A;  4MCR A;  1CG2 A;  5K8N A;  2EWB A;  4R6T A;  3FX6 A;  3NA6 A;  5CPA A;  6CPA A;  1YW4 A;  1Z5R A;  2JEW A;  3NH8 A;  1ARM A;  2F8H A;  2PJ5 A;  3KR4 A;  4C8P A;  4TWE A;  4P4B A;  3ISZ A;  3CT9 A;  3SI1 A;  2PJA A;  2OOT A;  2GLF A;  2PJ4 A;  4PXE A;  1CP6 A;  1Y7E A;  3SI2 A;  4KSI A;  5K8O A;  1AYE A;  4NJQ A;  1VHE A;  2FVG A;  4C99 A;  3CDX A;  2PVW A;  2BO9 A;  3VAT A;  2WYR A;  1LAP A;  2PCU A;  3FVL A;  4P44 A;  3KZW A;  4AXV A;  3TX8 A;  5HXD A;  2ZEF A;  3KI9 A;  4CDJ A;  2PJ9 A;  4MHN A;  4NGS A;  4R76 A;  4ZX8 A;  4OID A;  3PB7 X;  4RUH A;  4ZI6 A;  4UF4 A;  1LAN A;  1Q7L A;  3FJU A;  3IJ3 A;  5LRK A;  1FT7 A;  2AFO A;  3GB0 A;  5DS0 A;  3FEC A;  1DTD A;  1HEE A;  4C9E A;  4IAV A;  2V8V A;  1LAM A;  5LRG A;  3PBE A;  4EFD A;  4IHM A;  2BCO A;  3I6S A;  5F09 A;  4G1P A;  4ZY1 A;  1F2O A;  1R43 A;  3CPX A;  4UIB A;  5CBM A;  1LCP A;  3D7H A;  4OC1 A;  2ZEG A;  2RB7 A;  4O23 A;  5I4M A;  4C84 A;  2POK A;  1QQ9 A;  3JRU A;  2QVP A;  2QJ8 A;  5JM6 A;  2Q51 A;  1PCA A;  4PXC A;  1XBU A;  2IJZ A;  3PFO A;  3FF3 A;  2Q4Z A;  4A37 A;  1OBR A;  4PXB A;  4C8U A;  4ZY0 A;  2QYV A;  3V38 A;  1CX8 A;  3DLJ A;  3VAR A;  3B3V A;  4A39 A;  1UWY A;  1IY7 A;  3SI0 A;  4NGN A;  4LQG A;  3NH4 A;  3PB4 X;  3ICU A;  2CIJ A;  1ZLH A;  3SJG A;  4GM5 A;  1ZLI A;  2OR4 A;  1YSJ A;  4ZY2 A;  1HDU A;  2RFH A;  3D67 A;  4UEF A;  4C8T A;  2DEA A;  4OP4 A;  4Z65 A;  2AFU A;  4OKO A;  5HVG A;  2GRE A;  4C8C A;  3PBB A;  3PRT A;  1R3N A;  2GU2 A;  4OC0 A;  3D7F A;  4P4I A;  1YLO A;  3IEH A;  2PRQ A;  2VL1 A;  5THW A;  1XRY A;  3ISX A;  4C9U A;  4C9A A;  2O4H A;  3IO1 A;  4WWV A;  2GLJ A;  2JBK A;  1WVM A;  1Y9Z A;  2PJ2 A;  3D4U A;  4F9V A;  4NGR A;  3S9M A;  2ABZ A;  2XEJ A;  4NFR A;  5IB9 A;  2CTB A;  3B3T A;  3KQX A;  4A94 A;  3KHX A;  4MRI A;  2AFX A;  5LRJ A;  2BOA A;  4K3N A;  2PJB A;  1AMP A;  3IIB A;  4UEE A;  1RTQ A;  4OME A;  1M4L A;  1CBX A;  2ZEN A;  4FWU A;  2J9A A;  4TJV A;  1QMU A;  1TKF A;  4IK2 A;  3TC8 A;  4DUK A;  3KHZ A;  1V6C A;  3RBU A;  3FH4 A;  2ZED A;  4MHY A;  2ANP A;  2ZOG A;  4MHZ A;  3KQZ A;  1ARL A;  7CPA A;  3S9L A;  3DGV A;  3WAB A;  3BI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...