2B4JC

Structural basis for the recognition between hiv-1 integrase and ledgf/p75
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
82
structure length
82
Chain Sequence
b'GSSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrase (IN)
publication title Structural basis for the recognition between HIV-1 integrase and transcriptional coactivator p75
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, recombination
total genus 34
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2b4jC00
3HPHE 3OAKA 2XPLA 3NFQA 1EO0A 2XPPA 3HPGG 2B4JC 1WJTA 2XPNA 2N3AB 1Z9EA 3F9KC 3U88C 3O8ZA 2XPOA
chains in the Genus database with same CATH superfamily
3KASA 4MCRA 2C6GA 3S9NA 5BY0A 4A4BA 3VRPA 2PVVA 2UV8G 4NGMA 4NGRA 4P44A 4NGQA 3PFVA 3PLFB 3VRQA 3VROA 4BPUB 3FF3A 4P4EA 3VGOA 4X3RA 3SJGA 1Z9EA 2N3AB 4OMEA 2XEJA 4GPLB 3HPHE 2CIJA 3NFQA 2CBLA 1CX8A 3HPGG 2JBKA 2VKZG 3BUXB 3ZNIA 4NGSA 2Y1NA 3D7DA 4LQGA 5HKWA 3PT1A 3IWWA 2OOTA 5J3XA 3SJEA 5HKYA 4P4JA 1Z8LA 4OC3A 4OC2A 3OP0A 4P4BA 3D7HA 2B4JC 3D7FA 3BUMB 3BI1A 4MCQA 4W9YA 4MCSA 5HKZA 2XEGA 4BPXB 3BI0A 3FECA 2OR4A 2XPLA 4JYWA 3BUNB 3OB2B 1WJTA 3FEDA 4NGTA 2XPOA 2PVWA 4OC1A 2C6CA 3BXMA 4P45A 3SJXA 2XEIA 5F13A 3BUOB 4JZ0A 1EO0A 4NGNA 3BUWB 4MCPA 4NGPA 3SJFA 4OC5A 1B47A 3VRNA 1FBVA 2DLAA 2XEFA 3F9KC 3U88C 4OC0A 3O8ZA 2Y1MA 3S9MA 4BPWB 5D29A 2XPPA 3VRRA 4BTFA 3FEEA 3S9LA 3OB1B 1DE4C 2JBJA 3HMJG 4P4FA 5F09A 3OAKA 4OC4A 2C6PA 5ELYA 4P4IA 3BHXA 4P4DA 1YVHA 4A4CA 5AXIA 3D7GA 3RBUA 4RR2B 2XPNA
chains in the Genus database with same CATH topology
3HPHE 3OAKA 2XPLA 3NFQA 1EO0A 2XPPA 3HPGG 2B4JC 1WJTA 2XPNA 2N3AB 1Z9EA 3F9KC 3U88C 3O8ZA 2XPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPH E;  3OAK A;  2XPL A;  3NFQ A;  1EO0 A;  2XPP A;  3HPG G;  2B4J C;  1WJT A;  2XPN A;  2N3A B;  1Z9E A;  3F9K C;  3U88 C;  3O8Z A;  2XPO A; 
#chains in the Genus database with same CATH topology
 3KAS A;  4MCR A;  2C6G A;  3S9N A;  5BY0 A;  4A4B A;  3VRP A;  2PVV A;  2UV8 G;  4NGM A;  4NGR A;  4P44 A;  4NGQ A;  3PFV A;  3PLF B;  3VRQ A;  3VRO A;  4BPU B;  3FF3 A;  4P4E A;  3VGO A;  4X3R A;  3SJG A;  1Z9E A;  2N3A B;  4OME A;  2XEJ A;  4GPL B;  3HPH E;  2CIJ A;  3NFQ A;  2CBL A;  1CX8 A;  3HPG G;  2JBK A;  2VKZ G;  3BUX B;  3ZNI A;  4NGS A;  2Y1N A;  3D7D A;  4LQG A;  5HKW A;  3PT1 A;  3IWW A;  2OOT A;  5J3X A;  3SJE A;  5HKY A;  4P4J A;  1Z8L A;  4OC3 A;  4OC2 A;  3OP0 A;  4P4B A;  3D7H A;  2B4J C;  3D7F A;  3BUM B;  3BI1 A;  4MCQ A;  4W9Y A;  4MCS A;  5HKZ A;  2XEG A;  4BPX B;  3BI0 A;  3FEC A;  2OR4 A;  2XPL A;  4JYW A;  3BUN B;  3OB2 B;  1WJT A;  3FED A;  4NGT A;  2XPO A;  2PVW A;  4OC1 A;  2C6C A;  3BXM A;  4P45 A;  3SJX A;  2XEI A;  5F13 A;  3BUO B;  4JZ0 A;  1EO0 A;  4NGN A;  3BUW B;  4MCP A;  4NGP A;  3SJF A;  4OC5 A;  1B47 A;  3VRN A;  1FBV A;  2DLA A;  2XEF A;  3F9K C;  3U88 C;  4OC0 A;  3O8Z A;  2Y1M A;  3S9M A;  4BPW B;  5D29 A;  2XPP A;  3VRR A;  4BTF A;  3FEE A;  3S9L A;  3OB1 B;  1DE4 C;  2JBJ A;  3HMJ G;  4P4F A;  5F09 A;  3OAK A;  4OC4 A;  2C6P A;  5ELY A;  4P4I A;  3BHX A;  4P4D A;  1YVH A;  4A4C A;  5AXI A;  3D7G A;  3RBU A;  4RR2 B;  2XPN A; 
#chains in the Genus database with same CATH homology
 3HPH E;  3OAK A;  2XPL A;  3NFQ A;  1EO0 A;  2XPP A;  3HPG G;  2B4J C;  1WJT A;  2XPN A;  2N3A B;  1Z9E A;  3F9K C;  3U88 C;  3O8Z A;  2XPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...