2B4JC

Structural basis for the recognition between hiv-1 integrase and ledgf/p75
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
82
structure length
82
Chain Sequence
GSSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein, recombination
molecule keywords Integrase (IN)
publication title Structural basis for the recognition between HIV-1 integrase and transcriptional coactivator p75
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 34
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2b4jC00
1WJTA 2B4JC 3F9KC 3HPGG 3U88C 3NFQA 1EO0A 1Z9EA 2XPPA 3O8ZA 2XPNA 2XPLA 3OAKA 2N3AB 3HPHE 2XPOA
chains in the Genus database with same CATH superfamily
3PFVA 4NGSA 4OC0A 2N3AB 2UV8G 4NGQA 1FBVA 3VRPA 4NGRA 2PVVA 5D29A 3BUOB 3S9MA 2XEIA 3F9KC 1Z9EA 2XEJA 3BXMA 4X3RA 4A4BA 1CX8A 3BUNB 4MCQA 3BUWB 1WJTA 1EO0A 3OB1B 2CBLA 3VRNA 3VRQA 2Y1NA 2XEGA 5J3XA 3SJEA 3VRRA 3BI0A 5F13A 2PVWA 2VKZG 3VGOA 3O8ZA 4MCSA 3ZNIA 2OOTA 3FF3A 4NGTA 4GPLB 1DE4C 2DLAA 3HPHE 4OC5A 4NGPA 3PT1A 3FEDA 3SJFA 4BPXB 2XPLA 2C6PA 3IWWA 4P4FA 1B47A 3BUXB 4MCPA 4JYWA 4P4DA 2OR4A 4A4CA 5HKYA 3KASA 5HKWA 4JZ0A 3S9NA 3PLFB 4BPUB 4NGMA 2B4JC 1Z8LA 5F09A 2C6GA 3S9LA 4OC1A 3OB2B 3U88C 3NFQA 2XPPA 1YVHA 4MCRA 5HKZA 5AXIA 3RBUA 3HMJG 4P4IA 4NGNA 3D7GA 4OC4A 5BY0A 2JBJA 3SJGA 3D7DA 2CIJA 4BPWB 2XPOA 4P44A 4RR2B 3D7HA 4W9YA 3BUMB 3SJXA 3VROA 4BTFA 4P45A 2JBKA 3OP0A 3BHXA 4OC3A 2XPNA 4P4JA 3BI1A 3FEEA 4OC2A 5ELYA 3D7FA 4OMEA 3HPGG 4P4BA 3OAKA 4P4EA 2XEFA 2Y1MA 2C6CA 3FECA 4LQGA
chains in the Genus database with same CATH topology
1WJTA 2B4JC 3F9KC 3HPGG 3U88C 3NFQA 1EO0A 1Z9EA 2XPPA 3O8ZA 2XPNA 2XPLA 3OAKA 2N3AB 3HPHE 2XPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJT A;  2B4J C;  3F9K C;  3HPG G;  3U88 C;  3NFQ A;  1EO0 A;  1Z9E A;  2XPP A;  3O8Z A;  2XPN A;  2XPL A;  3OAK A;  2N3A B;  3HPH E;  2XPO A; 
#chains in the Genus database with same CATH topology
 3PFV A;  4NGS A;  4OC0 A;  2N3A B;  2UV8 G;  4NGQ A;  1FBV A;  3VRP A;  4NGR A;  2PVV A;  5D29 A;  3BUO B;  3S9M A;  2XEI A;  3F9K C;  1Z9E A;  2XEJ A;  3BXM A;  4X3R A;  4A4B A;  1CX8 A;  3BUN B;  4MCQ A;  3BUW B;  1WJT A;  1EO0 A;  3OB1 B;  2CBL A;  3VRN A;  3VRQ A;  2Y1N A;  2XEG A;  5J3X A;  3SJE A;  3VRR A;  3BI0 A;  5F13 A;  2PVW A;  2VKZ G;  3VGO A;  3O8Z A;  4MCS A;  3ZNI A;  2OOT A;  3FF3 A;  4NGT A;  4GPL B;  1DE4 C;  2DLA A;  3HPH E;  4OC5 A;  4NGP A;  3PT1 A;  3FED A;  3SJF A;  4BPX B;  2XPL A;  2C6P A;  3IWW A;  4P4F A;  1B47 A;  3BUX B;  4MCP A;  4JYW A;  4P4D A;  2OR4 A;  4A4C A;  5HKY A;  3KAS A;  5HKW A;  4JZ0 A;  3S9N A;  3PLF B;  4BPU B;  4NGM A;  2B4J C;  1Z8L A;  5F09 A;  2C6G A;  3S9L A;  4OC1 A;  3OB2 B;  3U88 C;  3NFQ A;  2XPP A;  1YVH A;  4MCR A;  5HKZ A;  5AXI A;  3RBU A;  3HMJ G;  4P4I A;  4NGN A;  3D7G A;  4OC4 A;  5BY0 A;  2JBJ A;  3SJG A;  3D7D A;  2CIJ A;  4BPW B;  2XPO A;  4P44 A;  4RR2 B;  3D7H A;  4W9Y A;  3BUM B;  3SJX A;  3VRO A;  4BTF A;  4P45 A;  2JBK A;  3OP0 A;  3BHX A;  4OC3 A;  2XPN A;  4P4J A;  3BI1 A;  3FEE A;  4OC2 A;  5ELY A;  3D7F A;  4OME A;  3HPG G;  4P4B A;  3OAK A;  4P4E A;  2XEF A;  2Y1M A;  2C6C A;  3FEC A;  4LQG A; 
#chains in the Genus database with same CATH homology
 1WJT A;  2B4J C;  3F9K C;  3HPG G;  3U88 C;  3NFQ A;  1EO0 A;  1Z9E A;  2XPP A;  3O8Z A;  2XPN A;  2XPL A;  3OAK A;  2N3A B;  3HPH E;  2XPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...