2B4JC

Structural basis for the recognition between hiv-1 integrase and ledgf/p75
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
82
structure length
82
Chain Sequence
GSSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrase (IN)
publication title Structural basis for the recognition between HIV-1 integrase and transcriptional coactivator p75
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, recombination
total genus 34
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2b4jC00
3HPGG 1Z9EA 3F9KC 2XPPA 1EO0A 2B4JC 2XPNA 2XPOA 3O8ZA 3OAKA 2XPLA 1WJTA 3U88C 3HPHE 2N3AB 3NFQA
chains in the Genus database with same CATH superfamily
3SJFA 2XPNA 3FF3A 5HKWA 3BUWB 4P4EA 2DLAA 3IWWA 3D7FA 4BPWB 1WJTA 3BI1A 2Y1NA 4GPLB 2XEFA 2VKZG 5F09A 1Z9EA 5F13A 4P4BA 4A4BA 2PVVA 4P45A 3KASA 2JBJA 3FECA 4W9YA 1CX8A 3PT1A 4MCPA 2XPPA 5HKZA 5J3XA 3RBUA 5ELYA 3SJGA 5AXIA 3O8ZA 1Z8LA 4OC1A 4OC5A 2XPLA 4MCSA 4P4JA 3OP0A 4P4FA 3PLFB 2PVWA 3BXMA 4NGNA 3VGOA 2CIJA 5BY0A 4MCRA 5D29A 4BTFA 3BUNB 3OB1B 3S9NA 2OOTA 2XEGA 4P44A 3U88C 2N3AB 4X3RA 3FEDA 4NGQA 3D7GA 3F9KC 2JBKA 4OC0A 3D7DA 3S9MA 3VRRA 1YVHA 4NGSA 3VRNA 3OB2B 4OC2A 3ZNIA 4MCQA 3BI0A 4BPUB 4NGPA 4RR2B 3D7HA 4JZ0A 4P4DA 3BUXB 4BPXB 3S9LA 3SJXA 3FEEA 4NGMA 4P4IA 3NFQA 3BUOB 2CBLA 2C6CA 3BHXA 4OMEA 1B47A 3SJEA 3HPHE 3OAKA 3VRQA 3HPGG 3HMJG 4OC4A 2UV8G 1EO0A 2B4JC 2XEJA 4NGRA 1DE4C 4A4CA 3BUMB 2XEIA 5HKYA 2C6GA 4OC3A 3VROA 2XPOA 3PFVA 3VRPA 4JYWA 2OR4A 2C6PA 1FBVA 2Y1MA 4LQGA 4NGTA
chains in the Genus database with same CATH topology
3HPGG 1Z9EA 3F9KC 2XPPA 1EO0A 2B4JC 2XPNA 2XPOA 3O8ZA 3OAKA 2XPLA 1WJTA 3U88C 3HPHE 2N3AB 3NFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPG G;  1Z9E A;  3F9K C;  2XPP A;  1EO0 A;  2B4J C;  2XPN A;  2XPO A;  3O8Z A;  3OAK A;  2XPL A;  1WJT A;  3U88 C;  3HPH E;  2N3A B;  3NFQ A; 
#chains in the Genus database with same CATH topology
 3SJF A;  2XPN A;  3FF3 A;  5HKW A;  3BUW B;  4P4E A;  2DLA A;  3IWW A;  3D7F A;  4BPW B;  1WJT A;  3BI1 A;  2Y1N A;  4GPL B;  2XEF A;  2VKZ G;  5F09 A;  1Z9E A;  5F13 A;  4P4B A;  4A4B A;  2PVV A;  4P45 A;  3KAS A;  2JBJ A;  3FEC A;  4W9Y A;  1CX8 A;  3PT1 A;  4MCP A;  2XPP A;  5HKZ A;  5J3X A;  3RBU A;  5ELY A;  3SJG A;  5AXI A;  3O8Z A;  1Z8L A;  4OC1 A;  4OC5 A;  2XPL A;  4MCS A;  4P4J A;  3OP0 A;  4P4F A;  3PLF B;  2PVW A;  3BXM A;  4NGN A;  3VGO A;  2CIJ A;  5BY0 A;  4MCR A;  5D29 A;  4BTF A;  3BUN B;  3OB1 B;  3S9N A;  2OOT A;  2XEG A;  4P44 A;  3U88 C;  2N3A B;  4X3R A;  3FED A;  4NGQ A;  3D7G A;  3F9K C;  2JBK A;  4OC0 A;  3D7D A;  3S9M A;  3VRR A;  1YVH A;  4NGS A;  3VRN A;  3OB2 B;  4OC2 A;  3ZNI A;  4MCQ A;  3BI0 A;  4BPU B;  4NGP A;  4RR2 B;  3D7H A;  4JZ0 A;  4P4D A;  3BUX B;  4BPX B;  3S9L A;  3SJX A;  3FEE A;  4NGM A;  4P4I A;  3NFQ A;  3BUO B;  2CBL A;  2C6C A;  3BHX A;  4OME A;  1B47 A;  3SJE A;  3HPH E;  3OAK A;  3VRQ A;  3HPG G;  3HMJ G;  4OC4 A;  2UV8 G;  1EO0 A;  2B4J C;  2XEJ A;  4NGR A;  1DE4 C;  4A4C A;  3BUM B;  2XEI A;  5HKY A;  2C6G A;  4OC3 A;  3VRO A;  2XPO A;  3PFV A;  3VRP A;  4JYW A;  2OR4 A;  2C6P A;  1FBV A;  2Y1M A;  4LQG A;  4NGT A; 
#chains in the Genus database with same CATH homology
 3HPG G;  1Z9E A;  3F9K C;  2XPP A;  1EO0 A;  2B4J C;  2XPN A;  2XPO A;  3O8Z A;  3OAK A;  2XPL A;  1WJT A;  3U88 C;  3HPH E;  2N3A B;  3NFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...