2B4JC

Structural basis for the recognition between hiv-1 integrase and ledgf/p75
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
82
structure length
82
Chain Sequence
GSSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the recognition between HIV-1 integrase and transcriptional coactivator p75
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, recombination
molecule keywords Integrase (IN)
total genus 34
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2b4jC00
3F9KC 2XPOA 3O8ZA 2XPLA 3OAKA 2N3AB 2XPNA 2B4JC 1Z9EA 1WJTA 1EO0A 2XPPA 3U88C 3NFQA 3HPGG 3HPHE
chains in the Genus database with same CATH superfamily
2XEJA 3SJGA 1WJTA 3IWWA 3S9LA 4JZ0A 3KASA 2XEFA 3BUOB 2XEGA 3BHXA 2XPOA 3FECA 5J3XA 2Y1NA 4MCRA 4P44A 4LQGA 2C6PA 4BPWB 3SJFA 4GPLB 2XPLA 4OC1A 3RBUA 4OC3A 4BPUB 3VRNA 4P4DA 3FEDA 3VGOA 3D7DA 4BPXB 1CX8A 1YVHA 4NGPA 3U88C 4P4FA 5AXIA 2DLAA 3BUNB 3D7FA 1Z8LA 3D7GA 3VROA 2PVWA 4X3RA 4JYWA 3D7HA 2C6CA 2C6GA 4P4JA 4P4EA 3BUXB 4NGRA 4MCSA 4NGQA 5BY0A 3HPHE 3F9KC 3PFVA 3HMJG 4NGNA 3S9MA 3FEEA 3BUWB 3BXMA 4P45A 3HPGG 3PT1A 2OOTA 2JBKA 3OB2B 5F13A 2N3AB 3SJXA 2XPNA 2OR4A 2PVVA 5HKZA 4NGTA 3VRPA 4BTFA 2CBLA 2CIJA 3O8ZA 3OP0A 5F09A 4A4CA 3OAKA 4A4BA 3VRQA 3BI0A 4P4IA 3SJEA 3OB1B 3ZNIA 4OC2A 2XEIA 2B4JC 3BI1A 5D29A 1FBVA 3BUMB 5ELYA 1B47A 4RR2B 2JBJA 2UV8G 4OC0A 4W9YA 1DE4C 3FF3A 4MCQA 4OMEA 2VKZG 4MCPA 5HKWA 4NGSA 4P4BA 4OC4A 1Z9EA 3S9NA 3NFQA 4NGMA 4OC5A 3PLFB 2Y1MA 3VRRA 1EO0A 2XPPA 5HKYA
chains in the Genus database with same CATH topology
3F9KC 2XPOA 3O8ZA 2XPLA 3OAKA 2N3AB 2XPNA 2B4JC 1Z9EA 1WJTA 1EO0A 2XPPA 3U88C 3NFQA 3HPGG 3HPHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9K C;  2XPO A;  3O8Z A;  2XPL A;  3OAK A;  2N3A B;  2XPN A;  2B4J C;  1Z9E A;  1WJT A;  1EO0 A;  2XPP A;  3U88 C;  3NFQ A;  3HPG G;  3HPH E; 
#chains in the Genus database with same CATH topology
 2XEJ A;  3SJG A;  1WJT A;  3IWW A;  3S9L A;  4JZ0 A;  3KAS A;  2XEF A;  3BUO B;  2XEG A;  3BHX A;  2XPO A;  3FEC A;  5J3X A;  2Y1N A;  4MCR A;  4P44 A;  4LQG A;  2C6P A;  4BPW B;  3SJF A;  4GPL B;  2XPL A;  4OC1 A;  3RBU A;  4OC3 A;  4BPU B;  3VRN A;  4P4D A;  3FED A;  3VGO A;  3D7D A;  4BPX B;  1CX8 A;  1YVH A;  4NGP A;  3U88 C;  4P4F A;  5AXI A;  2DLA A;  3BUN B;  3D7F A;  1Z8L A;  3D7G A;  3VRO A;  2PVW A;  4X3R A;  4JYW A;  3D7H A;  2C6C A;  2C6G A;  4P4J A;  4P4E A;  3BUX B;  4NGR A;  4MCS A;  4NGQ A;  5BY0 A;  3HPH E;  3F9K C;  3PFV A;  3HMJ G;  4NGN A;  3S9M A;  3FEE A;  3BUW B;  3BXM A;  4P45 A;  3HPG G;  3PT1 A;  2OOT A;  2JBK A;  3OB2 B;  5F13 A;  2N3A B;  3SJX A;  2XPN A;  2OR4 A;  2PVV A;  5HKZ A;  4NGT A;  3VRP A;  4BTF A;  2CBL A;  2CIJ A;  3O8Z A;  3OP0 A;  5F09 A;  4A4C A;  3OAK A;  4A4B A;  3VRQ A;  3BI0 A;  4P4I A;  3SJE A;  3OB1 B;  3ZNI A;  4OC2 A;  2XEI A;  2B4J C;  3BI1 A;  5D29 A;  1FBV A;  3BUM B;  5ELY A;  1B47 A;  4RR2 B;  2JBJ A;  2UV8 G;  4OC0 A;  4W9Y A;  1DE4 C;  3FF3 A;  4MCQ A;  4OME A;  2VKZ G;  4MCP A;  5HKW A;  4NGS A;  4P4B A;  4OC4 A;  1Z9E A;  3S9N A;  3NFQ A;  4NGM A;  4OC5 A;  3PLF B;  2Y1M A;  3VRR A;  1EO0 A;  2XPP A;  5HKY A; 
#chains in the Genus database with same CATH homology
 3F9K C;  2XPO A;  3O8Z A;  2XPL A;  3OAK A;  2N3A B;  2XPN A;  2B4J C;  1Z9E A;  1WJT A;  1EO0 A;  2XPP A;  3U88 C;  3NFQ A;  3HPG G;  3HPH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...