4MCRA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyltri-gamma-l-glutamic acid (pteroyltetra-gamma-l-glutamic acid)
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
695
structure length
693
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 269
structure length 693
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcrA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcrA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcrA02
2RFHA 1CG2A 3EIFA 4NGSA 1IY7A 3FEEA 2AFXA 4BD9A 4C86A 3K2KA 3TC8A 1NSAA 2XEJA 3K9TA 3D7DA 4YWYA 2ZEPA 2ZEHA 2AFSA 1CPSA 7CPAA 3MN8A 2Q4ZA 1RTQA 3T8WA 3WC5A 3SJGA 3QNVA 4IK2A 3PBEA 4YN3A 4NGTA 1XBUA 4Q7AA 1FNOA 3KASA 3FECA 3FEDA 5DS0A 3JRUA 5LRGA 3D7GA 3NH5A 4TJXA 1YW6A 1LANA 3KR4A 3I6SA 2PE3A 2QJ8A 3NFZA 2J9AA 2AFZA 2OOTA 1LAMA 2HC9A 3DLJA 4KNGE 3PFEA 4C8CA 4NFRA 2PJ1A 3PEIA 1DTDA 5LRJA 1VHOA 4A94A 4PXCA 1YSJA 1BPNA 1DE4C 1UWYA 4H2KA 3KQZA 2V8GA 4NGMA 3S9NA 1QMUA 4MCRA 3NH8A 2PJAA 4PPZA 4Z65A 2ABZA 1VGYA 4OC1A 3RZAA 4YU9A 2PJ0A 5LRKA 4C9RA 4NGPA 4A37A 4P10A 3B3VA 1ELMP 1TF9A 3KI9A 2XEGA 3NH4A 3ICUA 5K8PA 4JZ0A 4WJBA 2G9DA 4MCPA 3ISXA 4OC4A 4UIAA 3FF3A 1F2PA 4P4FA 2PJ6A 2F7VA 3HUVA 1PYTB 4MHNA 1F57A 2IQ6A 3B2YA 1YMEA 3B35A 3FVLA 3D7HA 3KQXA 4CPAA 4C8PA 2FVGA 5JM6A 3SI0A 5F09A 2HB6A 5D29A 2NYQA 3PB9X 3BI1A 3CT9A 1TXRA 3CDXA 2PJ8A 4ZY2A 5K8NA 2CTCA 1CBXA 2AFWA 3PB7X 1ZLHA 3VTAA 2PJBA 1KWMA 4MHPA 1CPXA 2JEWA 5J1QA 1Y9ZA 1R3NA 5LYLA 4ZI6A 2O4HA 2GLFA 4AXVA 4NJRA 5HVFA 4MHYA 1R43A 4IAVA 5LYFA 5IB9A 2ZOGA 2IJZA 1Y0RA 1WVMA 4P44A 3PFOA 3KL9A 4C8UA 4EFDA 3PB8X 4W9YA 3IJ3A 2BOAA 3H8EA 3KHZA 4FWUA 1LCPA 4TJVA 4FUUA 3VATA 2EK9A 4DJLA 3B7IA 4CDJA 1H8LA 4UIBA 4EWTA 3KHXA 4ZX8A 5HVHA 4C8TA 8CPAA 4C85A 1F2OA 2ZEDA 2V77A 4F8ZA 2PJCA 4X3RA 1Z8LA 1AMPA 4A39A 2F8HA 3LMSA 1TKJA 4MCQA 4TNUA 2C6CA 2ZEFA 3N5FA 3CPXA 4R76A 2POKA 1FT7A 3WT4A 4MXUA 4ONWA 1VIXA 1V6CA 1XJOA 3D68A 4MCSA 4C9EA 3BI0A 3FJUA 3B3TA 3FH4A 6CPAA 3IWWA 4MMOA 1ELLP 3VH9A 4KSIA 4C9AA 3DGVA 4ZYQA 3D67A 4NGQA 2ANPA 2ZEMA 4C8AA 3PB4X 2PVWA 4X8IA 2XEIA 2WYRA 2ZEEA 2V8HA 2C6PA 2VL1A 3BHXA 4G1PA 4IHMA 4UEZA 2GREA 4OIWA 4P4DA 4C8FA 2PRQA 2V8VA 3IFEA 3PBBA 2AFUA 2JBKA 2ZELA 3V38A 5THWA 2EWBA 1JQGA 4PXBA 1ARLA 1HDQA 2XEFA 2V8DA 3NA6A 4UEEA 2PIZA 4NGRA 3L2NA 4DUKA 1EE3P 3KR5A 4OIDA 4C9UA 1IGBA 1LFWA 2ZENA 5HXDA 1TF8A 4UEFA 2ZEOA 3TX8A 3VARA 3FX6A 1VHEA 3PRTA 4UF4A 3RBUA 4ZY1A 1BLLE 1LAPA 5K8OA 1ZLIA 2QVPA 1HDUA 1XMBA 3D7FA 1PCAA 3H8GA 4P4EA 3ISZA 3B3WA 1BPMA 3BXMA 1Q7LA 4FBEA 3I1UA 4OC0A 2IMOA 2I3CA 2AFOA 4X2TA 2PJ4A 4EMEA 4CDKA 1GYTA 4P6YA 4PXDA 5LYIA 4B6ZA 5ELYA 3V7ZA 4GM5A 3D4UA 2CTBA 2PJ9A 1Z2LA 4O23A 3S9MA 4LQGA 3I74A 4C9VA 4NJQA 4A38A 4DYOA 2NSMA 2PCUA 2C6GA 5CBMA 1ZG8A 2BO9A 3GLJA 3CPAA 1XFOA 4R7MA 2ZEGA 4OC2A 2DEAA 3B3SA 1HEEA 3SJXA 3H8FA 3MRUA 1Y7EA 3SI2A 5JH9A 4OC3A 1YW4A 4K3NA 4FAIA 4R8FA 3RAMA 2C1CA 3SJEA 5D8NA 2CIJA 1ZG9A 4P4BA 5K8MA 1TKFA 4OKOA 4TWEA 2EK8A 3PB6X 2PJ2A 1Z5RA 3S9LA 2GU2A 3WC7A 1AYEA 3KZWA 1CP6A 1M4LA 3IO1A 2CF4A 4PQAA 2RB7A 4MHZA 4P4JA 5CPAA 3FMCA 4P45A 1ARMA 1Y0YA 4NGNA 4WWVA 1TKHA 2PIYA 3KGQA 5HVGA 2WZNA 3LWUA 2ZOFA 2GLJA 4F9UA 1ZG7A 4JYWA 3WC6A 3B3CA 4R6TA 5JGFA 4ZX9A 3WABA 1OBRA 2JBJA 3GB0A 4C99A 2PVVA 4OP4A 4PXEA 4RUHA 2OR4A 5I4MA 2AFMA 4OMEA 4P4IA 2PJ3A 3IC1A 1XRYA 3IEHA 1CP7A 4C84A 3SJFA 1LOKA 3HLPA 2QYVA 2Q51A 3SI1A 2PJ7A 4ZY0A 1XF1A 1QQ9A 3D66A 2Q43A 1YLOA 4MRIA 1CX8A 3IIBA 4OC5A 3GUXA 4F9VA 2BCOA 2O53A 1BAVA 5LYDA 2PJ5A
chains in the Genus database with same CATH superfamily
2ZW6A 2RFHA 1M4GA 4BINA 1CG2A 4JJXA 3EIFA 4NGSA 4OLLA 3TLBA 4RN7A 1X10A 1IY7A 3PZJA 3LACA 4II9A 2HWGA 5BY0A 2AJ6A 2R82A 5KTCA 3FEEA 4MHDA 4CAXA 4NF1A 2HROA 2AFXA 4F6AA 4BD9A 4IIYA 4MI1A 3PFVA 2DLAA 3K2KA 4C86A 3TC8A 1NSAA 2XEJA 1Z9UA 3K9TA 3D7DA 2C5QA 1ZL0A 3TTHA 4CGMA 4YWYA 2B58A 2ZEPA 2ZEHA 4AVBA 5HKYA 5AG4A 4F0XA 2AFSA 3E0KA 2WSAA 1CPSA 1IU8A 7CPAA 3MN8A 2B4DA 2Q4ZA 1RTQA 3T8WA 2VBQA 3WC5A 3SJGA 4HNWB 3QNVA 3CXPA 4ZGYB 3HPHE 4IK2A 2DPSA 3PBEA 2BL1A 2EBJA 2GIVA 2J8NA 3K9UA 3T9YA 3EZBA 3G23A 4YN3A 4NGTA 1XBUA 1YK3A 3T05A 3BUXB 4Q7AA 2B0AA 1FNOA 4QUSA 4C2XA 1KC7A 1ON0A 5G1ZA 3NFQA 3KASA 3FECA 3FEDA 5DS0A 3JRUA 5LRGA 3D7GA 1ZO0A 2B5GB 4KSAA 3NH5A 1JDBC 4TJXA 4I49A 1YW6A 5ISVA 4EYSA 3TO6A 4BPXB 1LANA 2REEA 3KR4A 3TO9A 5J8FA 2QECA 1I12A 3I6SA 2PE3A 2R1IA 2QJ8A 1KEEB 3NFZA 4ORFA 5IR2A 4E94A 3VRPA 2J8RA 2P6GA 2J9AA 2AFZA 4QBJA 2AE6A 3OWCA 2OOTA 2D0OA 2AUNA 1LAMA 2HC9A 1JWQA 3DLJA 2PQ8A 4IUSA 3R1KA 4KNGE 2D4PA 3PFEA 1C3OB 4C8CA 5F9MA 3D2PA 2O28A 4CAFA 4NFRA 2PJ1A 4A4CA 3DR8A 3PEIA 4CRZB 1DTDA 5LRJA 2BUEA 3A9LA 4A30A 1N71A 5HXDA 1CM0A 1VHOA 2QMLA 4PXCA 1YSJA 4A94A 2VZZA 1BPNA 4BMHA 1DE4C 1B47A 1QSNA 1UWYA 2VEZA 4H2KA 2CY2A 2JDCA 2V8GA 4NGMA 3S9NA 1QMUA 3KQZA 4MCRA 3BLNA 3DNSA 3NH8A 2PJAA 4KZTA 4PPZA 4B5OA 2ABZA 1VGYA 4OC1A 4Z65A 3K4IA 1DIKA 2ATRA 2G3TA 4YU9A 2PC1A 3RZAA 1Z8WA 2EVNA 2JLMA 2PJ0A 4A33A 2B3UA 1WJTA 4M8DA 1KBLA 1VHSA 5FVJA 1X12A 5LRKA 1VI4A 3TOBA 1MJAA 2CXAA 4BBHA 4NGPA 4B10A 4A37A 4C9RA 4B5PB 5G22A 4Q36A 4P10A 3B3VA 4BPWB 1ELMP 1A2ZA 1TF9A 2FIAA 4CYQA 1WWZA 1YVHA 3KI9A 5JVLA 2XEGA 4KORA 3IU2A 3NH4A 3ICUA 3MGDA 5K8PA 4JZ0A 3TLEA 4WJBA 2OLSA 2G9DA 4MCPA 3JUWA 3ISXA 4OC4A 4A4BA 4UIAA 3FF3A 2YNCA 2BEIA 4KOWA 1F2PA 2OH1A 4P4FA 2PJ6A 3V8IA 3GJZA 2F7VA 4CYPA 3HUVA 4E2AA 1PYTB 4H89A 4COBA 2CNTA 1F57A 2IQ6A 3B2YA 1YMEA 1M4IA 3B35A 3QB8A 4MHNA 4XNHC 2B4JC 4F0YA 3S6HA 3FVLA 3D7HA 3KQXA 3SXNA 1B87A 3BJ8A 3FNCA 4CPAA 1NBWA 2Q4VA 4KOUA 4C8PA 2FVGA 5JM6A 1LRZA 4UWIA 3S6KA 3SI0A 5F09A 2HB6A 4KUAA 1PU9A 4PSWA 3FIXA 5D29A 3R95A 4KOSA 2NYQA 5EBVA 3PB9X 3BI1A 3CT9A 1TXRA 3CDXA 4H6ZA 5J8CA 1QSRA 2PJ8A 4ZY2A 4HKFA 5K8NA 2CTCA 1CBXA 2AFWA 2Z3PA 1ZLHA 3PB7X 3VTAA 2Y1MA 2VQYA 3EO4A 2PJBA 3IWEA 1YREA 5F47A 4H6UA 1KWMA 3BUOB 1XIXA 1NE9A 3I9SA 4MHPA 1CPXA 2FIWA 4XPDB 4CYOA 3BUNB 4MJ8A 4UCPA 5E96A 1S7KA 2YJVA 2JEWA 3HPGG 5J1QA 1Y9ZA 1R3NA 3TLGA 4UCNA 1T36B 5AGEA 3TO7A 1S60A 3G8WA 4B13A 4C7HA 5LYLA 2P6FA 2X7BA 4ZI6A 2O4HA 4NSQA 2AUMA 1S7LA 2ARHA 2GLFA 4KLWA 4YFJA 3BUMB 5IV0A 4AXVA 3FBUA 1S7NA 5I0CA 2CNMA 1MK4A 3ZJ0A 3FRMA 1A9XB 3GYAA 2Z3LA 4NJRA 2HUZA 3OB1B 5HVFA 1ZYMA 2DIKA 4Y49C 3JVNA 4KOTA 4MHYA 4NCZA 4UWJA 3T90A 1Z4RA 3QAHA 1R57A 1R43A 1NSLA 4J3GA 3BUWB 4IAVA 2B3VA 5LYFA 5IB9A 2ZOGA 2IJZA 2P0WA 3NE8A 2GANA 2X0SA 1Y0RA 1YVKA 3D3SA 1WVMA 4P44A 3PFOA 4Q38A 3KL9A 4C8UA 4EFDA 3PB8X 4W9YA 3IJ3A 3ZNIA 3VRRA 2BOAA 3H8EA 4CZ1A 3KHZA 4FWUA 4K30A 4MFLA 1LCPA 4TJVA 5LYDA 3TLZA 3O8ZA 2G3AA 4ONUA 4X5KA 3SXOA 4B11A 4UCMA 3TFYA 2HQYA 4JVOA 4FUUA 1J4JA 4M6HA 3VATA 2EK9A 1Q2CA 3EY5A 4DJLA 3B7IA 4CDJA 1H8LA 4UIBA 4EWTA 3KHXA 4ZX8A 4R57A 4AG9A 3F5BA 5HVHA 1CE8B 4C8TA 5F49A 8CPAA 3P2FA 2Y0MA 4C85A 1F2OA 2HV2A 2V77A 2ZEDA 1I1DA 3F8KA 4YGOA 3B8GA 2PJCA 4F8ZA 4NXYA 4XPKA 4A32A 4UFWA 4X3RA 1IOIA 1Z4EA 4M85A 3UY5A 2R98A 2VI7A 4CGLA 1Z8LA 3DSBA 4ZBGA 1AMPA 3W6SA 4AG7A 1AUGA 4A39A 2F8HA 1QSMA 2Q44A 5AG7A 2VKZG 3LMSA 1EZAA 3LODA 4L8AA 1TKJA 5HMNA 4MCQA 3OB2B 2R8VA 3FXTA 4TNUA 2C6CA 4INJA 2WPWA 4R3KA 2ZEFA 3N5FA 2Q04A 3CPXA 1JDEA 3U88C 4R76A 2POKA 4EVYA 1FT7A 1Y7RA 2DPTA 4MXUA 5EMIA 3WT4A 1EO0A 4ONWA 1VIXA 1Z8TA 1V6CA 4UBRA 1IICA 2BSWA 1XJOA 2Z0ZA 3NOJA 3D68A 3OP0A 4MCSA 4BPUB 2XPNA 1KUXA 2ZXVA 3BI0A 3FJUA 4RI1A 4C2YA 1ZRSA 3B3TA 4IIXA 4CGPA 3FH4A 4E0AA 2KCWA 1KUVA 4UA3A 3IWWA 4MMOA 6CPAA 4E5SA 3TOAA 1ELLP 3VH9A 4KSIA 3EFAA 5EC4A 4UFVA 4CS0B 4C9AA 3DGVA 4CAWA 4KLVA 4KVXA 4ZYQA 3D2MA 2YNEA 2I79A 3D67A 4L89A 4NGQA 2ANPA 4RS2A 2ZEMA 3H5ZA 4UFXA 4C8AA 3PB4X 3EZAA 2PVWA 3TE4A 1C30B 4X8IA 2XEIA 1Y9WA 2WYRA 2ZEEA 2JEVA 4U9ZA 4C7IA 2G0BA 1IIDA 2PCNA 3TCVA 2V8HA 5AG6A 4MFKA 2C6PA 2VL1A 3BHXA 4G1PA 4IHMA 4UEZA 4JXRA 5DWMA 4DNCA 4COGA 2GREA 3LD2A 4OIWA 2Z11A 4P4DA 4C8FA 2PRQA 2V8VA 2B4DB 3IFEA 4KVME 3PBBA 2AFUA 2JBKA 2FE7A 2ZELA 4LX9A 2Z3NA 3V38A 1YLEA 5THWA 2EWBA 3FB3A 2HI6A 1JQGA 4PXBA 4KSFA 1ARLA 1CS0B 4KOYA 3PP9A 1HDQA 4R87A 1YX0A 4LQ6A 4MY3A 3I3GA 4AVAA 4JWPA 2EZAA 4C9EA 5KTAA 2XEFA 2B5GA 2V8DA 3NA6A 4MFPA 2PIZA 4UEEA 2XPOA 4NGRA 3SHPA 3EZEA 5F1YA 3L2NA 2Z3OA 3S6GA 4DUKA 1EE3P 3KR5A 2C27A 4A31A 4OIDA 2D0PA 3SR3A 4C9UA 1IGBA 4KS9A 3KKWA 4LUAA 3H4QA 1UFHA 1LFWA 1XOVA 1YVOA 5JPHA 4CO9A 1BOBA 2ZENA 1TF8A 4UEFA 2ZEOA 2Q7BA 1IYKA 3TX8A 3VARA 3FX6A 4CRYB 1VHEA 3PRTA 4CGNA 1NMTA 4UF4A 3GKRA 3RBUA 4ZY1A 2DXQA 1BLLE 1KZFA 1LAPA 2VZYA 5K8OA 5C88A 2B4BA 5HH1A 2YNCC 5F48A 1ZLIA 2QVPA 3R9GA 1HDUA 1NXJA 3U1BA 2YNDA 4XNHB 2EZCA 5FD8A 3WR7A 1R61A 3TYXA 4HNXB 1Q2DA 4PSXA 1XMBA 2EUIA 4U5YA 3D7FA 2REFA 3VGOA 1PCAA 2PR8A 3H8GA 3W91A 4P4EA 2Z3KA 3ISZA 1FY7A 3IU1A 5JQ4A 1Q5XA 3B3WA 5HKZA 5J3XA 2CNSA 3W6XA 4AVCA 2CBLA 1BPMA 1TIQA 4MFQA 2PSWA 2FL4A 3BXMA 1Q7LA 4FBEA 4FD6A 3I1UA 4OC0A 3ZZIA 1PUAA 2IMOA 4CAEA 2I3CA 2AFOA 5AXIA 4X2TA 1M4DA 2PJ4A 4OADA 3G3SA 4EMEA 3RO0A 4A2ZA 3OAKA 1GYTA 4B5PA 4CYNA 4P6YA 4PXDA 4U9YA 5LYIA 4CDKA 4B6ZA 5ELYA 4GPLB 2ZW4A 3V7ZA 4PK3A 4GM5A 5KTDA 1P4NA 3F9KC 3C8OA 2OU2A 3D4UA 1WK4A 4QB9A 2EZBA 1GGOA 3T07A 2CTBA 2FS5A 1Y9KA 1FBVA 1MJBA 2PJ9A 1Z2LA 3VWEA 1K4JA 2OB0A 2YJTA 2OZHA 4O23A 4IF5A 2UV8G 3S9MA 4LQGA 4JXQA 3I74A 4C9VA 5BWAB 2MP0A 4NJQA 4A38A 1S5KA 3RYOA 4DYOA 1RO5A 2NSMA 2PCUA 2NMTA 2C6GA 2FT0A 1ZG8A 1GHEA 3CZXA 3N7ZA 1I21A 2BO9A 3GLJA 3QAYA 5GCNA 4QC6A 1RXTA 3T0TA 4C2ZA 1YGHA 4MFZA 4Y49B 5AG5A 3R9FA 2P6EA 2ZW7A 3CPAA 1XFOA 4R7MA 2Z3MA 4M3SA 4XPLA 4A95A 2ZEGA 4OC2A 4FD7A 2PDOA 2DEAA 2J8MA 4FD4A 4M6IA 4B14A 1IYLA 3B3SA 2JDDA 1HEEA 1Z9EA 4AB7A 4B12A 2N3AB 3SJXA 1S3ZA 1YR0A 3H8FA 3DDDA 3MRUA 2YGWA 4NEXA 5A27A 1Z8XA 1Y7EA 4KOVA 2RC4A 3PLFB 4HNYB 4GXHA 3SI2A 5JH9A 1Q2YA 1XEBA 2QIRA 4OC3A 1IB1E 1YW4A 2GFQA 3EC4A 4K3NA 3R9EA 4FAIA 1OZPA 1M6VB 1VBHA 1QSOA 1V0CA 2K5TA 4R8FA 4JLYA 3FYNA 3TLGB 4OAEA 2C1CA 3RAMA 4MFJA 2ZPAA 4PK2A 5K99A 1BO4A 3SJEA 2WUUA 5D8NA 2CIJA 2GE3A 3PGPA 1KUYA 1XE4A 5DWNA 1ZG9A 4P4BA 5K8MA 2E28A 1TKFA 4OKOA 4TWEA 1YQEA 5F13A 3P2HA 5JYBA 3BJ7A 3GY9A 5A28A 1XMTA 1BXRB 2XPPA 5IX3A 2EK8A 3C26A 3HMJG 3PB6X 3DR6A 3IWGA 5C82A 2PJ2A 5IB0A 1Z5RA 1U6MA 5CBMA 2Z10A 2Q0YA 3S9LA 2EO8A 2GU2A 3VWDA 3WC7A 1VKCA 1AYEA 3TLYA 5F5XA 1EZBA 3NE7A 3KZWA 1CP6A 1M4LA 2VXKA 3IO1A 4PV6A 4QVTA 1MJ9A 1IOFA 2CF4A 1XF8A 4GS4A 4PQAA 1QSTA 3CXSA 1VBGA 1SQHA 5G21A 2RB7A 4MHZA 4P4JA 3EXNA 5CPAA 3RNZA 4CAVA 2FXFA 4J0NA 3FMCA 4P45A 2FM4A 3TT2A 4MI4A 1ARMA 1Y0YA 4XPDC 2A4NA 2I00A 4HPSA 1P0HA 4NGNA 2IL4A 3VROA 2PR1A 4WWVA 1TKHA 2XPLA 3VRNA 1M44A 5HKWA 2PIYA 1L0CA 2WZNA 3KGQA 3LWUA 2ZOFA 2GLJA 5HVGA 1J3LA 2OZGA 3TLAA 4F9UA 3T5MA 1ZG7A 4JYWA 3TLCA 3WC6A 3PT1A 3B3CA 4R6TA 4CGOA 4ZX9A 4R3LA 2WPXA 3WABA 5JGFA 1OBRA 4FD5A 2JBJA 2DF5A 2ODFA 2OZUA 3GB0A 4JD6A 4C99A 2PVVA 2D4OA 2ZW5A 4M6GA 5G20A 1S7FA 1B6BA 4OP4A 4PXEA 4KUBA 4RUHA 2OR4A 2F5IA 5F46A 2AFMA 5I4MA 4OMEA 4P4IA 2PJ3A 2FSRA 3VRQA 4MY0A 4H1HA 3IC1A 1XRYA 3IEHA 1CP7A 4C84A 3SJFA 1M1DA 1LOKA 3HLPA 3KRVA 4RR2B 2QYVA 2Q51A 3D8PA 3SI1A 2PJ7A 3S6FA 4C68A 4BTFA 5CNPA 4ZY0A 3GIUA 1XF1A 2PRBA 1QQ9A 3D66A 2Q7SA 4MBUA 1CJWA 2Q43A 3CXQA 1YLOA 4KOXA 4MRIA 1CX8A 3R96A 4OC5A 3IGRA 3IIBA 2GP4A 2Q4YA 2FCKA 3GUXA 3F0AA 2H5MA 2BCOA 2O53A 3JTKA 2Y1NA 4YRHA 2R7HA 5H84A 5H86A 4F9VA 4MJXA 1BAVA 4R9MA 4KVOE 4E8OA 2PJ5A
chains in the Genus database with same CATH topology
2RFHA 1CG2A 3EIFA 4NGSA 1IY7A 3FEEA 2AFXA 4BD9A 4C86A 3K2KA 3TC8A 1NSAA 2XEJA 3K9TA 3D7DA 2C5QA 4YWYA 2ZEPA 2ZEHA 2AFSA 1CPSA 7CPAA 3MN8A 2Q4ZA 1RTQA 3T8WA 3WC5A 3SJGA 3QNVA 4IK2A 3PBEA 4YN3A 4NGTA 1XBUA 4Q7AA 1FNOA 3KASA 3FECA 3FEDA 5DS0A 3JRUA 5LRGA 3D7GA 3NH5A 4TJXA 1YW6A 1LANA 3KR4A 3I6SA 2PE3A 2QJ8A 5IR2A 3NFZA 2J9AA 2AFZA 2OOTA 1LAMA 2HC9A 3DLJA 4KNGE 3PFEA 4C8CA 4NFRA 2PJ1A 3PEIA 1DTDA 5LRJA 1VHOA 4A94A 4PXCA 1YSJA 1BPNA 1DE4C 1UWYA 4H2KA 3KQZA 2V8GA 4NGMA 3S9NA 1QMUA 4MCRA 3NH8A 2PJAA 4PPZA 4Z65A 2ABZA 1VGYA 4OC1A 3RZAA 4YU9A 2PJ0A 5LRKA 4C9RA 4NGPA 4A37A 4P10A 3B3VA 1ELMP 1TF9A 3KI9A 2XEGA 3NH4A 3ICUA 5K8PA 4JZ0A 4WJBA 2G9DA 4MCPA 3ISXA 4OC4A 4UIAA 3FF3A 1F2PA 4P4FA 2PJ6A 2F7VA 3HUVA 1PYTB 4MHNA 1F57A 2IQ6A 3B2YA 1YMEA 3B35A 3FVLA 3D7HA 3KQXA 4CPAA 4C8PA 2FVGA 5JM6A 3SI0A 5F09A 2HB6A 5D29A 2NYQA 3PB9X 3BI1A 3CT9A 1TXRA 3CDXA 2PJ8A 4ZY2A 5K8NA 2CTCA 1CBXA 2AFWA 3PB7X 1ZLHA 3VTAA 2PJBA 1KWMA 4MHPA 1CPXA 2JEWA 5J1QA 1Y9ZA 1R3NA 5LYLA 4ZI6A 2O4HA 2GLFA 4AXVA 4NJRA 5HVFA 4MHYA 1R43A 4IAVA 5LYFA 5IB9A 2ZOGA 2IJZA 1Y0RA 1WVMA 4P44A 3PFOA 3KL9A 4C8UA 4EFDA 3PB8X 4W9YA 3IJ3A 2BOAA 3H8EA 3KHZA 4FWUA 1LCPA 4TJVA 4FUUA 3VATA 2EK9A 4DJLA 3B7IA 4CDJA 1H8LA 4UIBA 4EWTA 3KHXA 4ZX8A 5HVHA 4C8TA 8CPAA 4C85A 1F2OA 2ZEDA 2V77A 4F8ZA 2PJCA 4X3RA 1Z8LA 1AMPA 4A39A 2F8HA 3LMSA 1TKJA 4MCQA 4TNUA 2C6CA 2ZEFA 3N5FA 3CPXA 4R76A 2POKA 1FT7A 3WT4A 4MXUA 4ONWA 1VIXA 1V6CA 1XJOA 3D68A 4MCSA 4C9EA 3BI0A 3FJUA 3B3TA 3FH4A 6CPAA 3IWWA 4MMOA 1ELLP 3VH9A 4KSIA 4C9AA 3DGVA 4ZYQA 3D67A 4NGQA 2ANPA 2ZEMA 4C8AA 3PB4X 2PVWA 4X8IA 2XEIA 2WYRA 2ZEEA 2V8HA 2C6PA 2VL1A 3BHXA 4G1PA 4IHMA 4UEZA 2GREA 4OIWA 4P4DA 4C8FA 2PRQA 2V8VA 3IFEA 3PBBA 2AFUA 2JBKA 2ZELA 3V38A 5THWA 2EWBA 1JQGA 4PXBA 1ARLA 1HDQA 2XEFA 2V8DA 3NA6A 4UEEA 2PIZA 4NGRA 3L2NA 4DUKA 1EE3P 3KR5A 4OIDA 4C9UA 1IGBA 1LFWA 2ZENA 5HXDA 1TF8A 4UEFA 2ZEOA 3TX8A 3VARA 3FX6A 1VHEA 3PRTA 4UF4A 3RBUA 4ZY1A 1BLLE 1LAPA 5K8OA 1ZLIA 2QVPA 1HDUA 1XMBA 3D7FA 1PCAA 3H8GA 4P4EA 3ISZA 3B3WA 1BPMA 3BXMA 1Q7LA 4FBEA 3I1UA 4OC0A 2IMOA 2I3CA 2AFOA 4X2TA 2PJ4A 4EMEA 4CDKA 1GYTA 4P6YA 4PXDA 5LYIA 4B6ZA 5ELYA 3V7ZA 4GM5A 3D4UA 2CTBA 2PJ9A 1Z2LA 4O23A 3S9MA 4LQGA 3I74A 4C9VA 4NJQA 4A38A 4DYOA 2NSMA 2PCUA 2C6GA 5CBMA 1ZG8A 2BO9A 3GLJA 3CPAA 1XFOA 4R7MA 2ZEGA 4OC2A 2DEAA 3B3SA 1HEEA 3SJXA 3H8FA 3MRUA 1Y7EA 3SI2A 5JH9A 4OC3A 1YW4A 4K3NA 4FAIA 4R8FA 3RAMA 2C1CA 3SJEA 5D8NA 2CIJA 1ZG9A 4P4BA 5K8MA 1TKFA 4OKOA 4TWEA 2EK8A 3PB6X 2PJ2A 1Z5RA 3S9LA 2GU2A 3WC7A 1AYEA 3KZWA 1CP6A 1M4LA 3IO1A 2CF4A 4PQAA 2RB7A 4MHZA 4P4JA 5CPAA 3FMCA 4P45A 1ARMA 1Y0YA 4NGNA 4WWVA 1TKHA 2PIYA 3KGQA 5HVGA 2WZNA 3LWUA 2ZOFA 2GLJA 4F9UA 1ZG7A 4JYWA 3WC6A 3B3CA 4R6TA 5JGFA 4ZX9A 3WABA 1OBRA 2JBJA 3GB0A 4C99A 2PVVA 4OP4A 4PXEA 4RUHA 2OR4A 5I4MA 2AFMA 4OMEA 4P4IA 2PJ3A 3IC1A 1XRYA 3IEHA 1CP7A 4C84A 3SJFA 1LOKA 3HLPA 2QYVA 2Q51A 3SI1A 2PJ7A 4ZY0A 1XF1A 1QQ9A 3D66A 2Q43A 1YLOA 4MRIA 1CX8A 2GP4A 3IIBA 4OC5A 3GUXA 4F9VA 2BCOA 2O53A 1BAVA 5LYDA 2PJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RFH A;  1CG2 A;  3EIF A;  4NGS A;  1IY7 A;  3FEE A;  2AFX A;  4BD9 A;  4C86 A;  3K2K A;  3TC8 A;  1NSA A;  2XEJ A;  3K9T A;  3D7D A;  4YWY A;  2ZEP A;  2ZEH A;  2AFS A;  1CPS A;  7CPA A;  3MN8 A;  2Q4Z A;  1RTQ A;  3T8W A;  3WC5 A;  3SJG A;  3QNV A;  4IK2 A;  3PBE A;  4YN3 A;  4NGT A;  1XBU A;  4Q7A A;  1FNO A;  3KAS A;  3FEC A;  3FED A;  5DS0 A;  3JRU A;  5LRG A;  3D7G A;  3NH5 A;  4TJX A;  1YW6 A;  1LAN A;  3KR4 A;  3I6S A;  2PE3 A;  2QJ8 A;  3NFZ A;  2J9A A;  2AFZ A;  2OOT A;  1LAM A;  2HC9 A;  3DLJ A;  4KNG E;  3PFE A;  4C8C A;  4NFR A;  2PJ1 A;  3PEI A;  1DTD A;  5LRJ A;  1VHO A;  4A94 A;  4PXC A;  1YSJ A;  1BPN A;  1DE4 C;  1UWY A;  4H2K A;  3KQZ A;  2V8G A;  4NGM A;  3S9N A;  1QMU A;  4MCR A;  3NH8 A;  2PJA A;  4PPZ A;  4Z65 A;  2ABZ A;  1VGY A;  4OC1 A;  3RZA A;  4YU9 A;  2PJ0 A;  5LRK A;  4C9R A;  4NGP A;  4A37 A;  4P10 A;  3B3V A;  1ELM P;  1TF9 A;  3KI9 A;  2XEG A;  3NH4 A;  3ICU A;  5K8P A;  4JZ0 A;  4WJB A;  2G9D A;  4MCP A;  3ISX A;  4OC4 A;  4UIA A;  3FF3 A;  1F2P A;  4P4F A;  2PJ6 A;  2F7V A;  3HUV A;  1PYT B;  4MHN A;  1F57 A;  2IQ6 A;  3B2Y A;  1YME A;  3B35 A;  3FVL A;  3D7H A;  3KQX A;  4CPA A;  4C8P A;  2FVG A;  5JM6 A;  3SI0 A;  5F09 A;  2HB6 A;  5D29 A;  2NYQ A;  3PB9 X;  3BI1 A;  3CT9 A;  1TXR A;  3CDX A;  2PJ8 A;  4ZY2 A;  5K8N A;  2CTC A;  1CBX A;  2AFW A;  3PB7 X;  1ZLH A;  3VTA A;  2PJB A;  1KWM A;  4MHP A;  1CPX A;  2JEW A;  5J1Q A;  1Y9Z A;  1R3N A;  5LYL A;  4ZI6 A;  2O4H A;  2GLF A;  4AXV A;  4NJR A;  5HVF A;  4MHY A;  1R43 A;  4IAV A;  5LYF A;  5IB9 A;  2ZOG A;  2IJZ A;  1Y0R A;  1WVM A;  4P44 A;  3PFO A;  3KL9 A;  4C8U A;  4EFD A;  3PB8 X;  4W9Y A;  3IJ3 A;  2BOA A;  3H8E A;  3KHZ A;  4FWU A;  1LCP A;  4TJV A;  4FUU A;  3VAT A;  2EK9 A;  4DJL A;  3B7I A;  4CDJ A;  1H8L A;  4UIB A;  4EWT A;  3KHX A;  4ZX8 A;  5HVH A;  4C8T A;  8CPA A;  4C85 A;  1F2O A;  2ZED A;  2V77 A;  4F8Z A;  2PJC A;  4X3R A;  1Z8L A;  1AMP A;  4A39 A;  2F8H A;  3LMS A;  1TKJ A;  4MCQ A;  4TNU A;  2C6C A;  2ZEF A;  3N5F A;  3CPX A;  4R76 A;  2POK A;  1FT7 A;  3WT4 A;  4MXU A;  4ONW A;  1VIX A;  1V6C A;  1XJO A;  3D68 A;  4MCS A;  4C9E A;  3BI0 A;  3FJU A;  3B3T A;  3FH4 A;  6CPA A;  3IWW A;  4MMO A;  1ELL P;  3VH9 A;  4KSI A;  4C9A A;  3DGV A;  4ZYQ A;  3D67 A;  4NGQ A;  2ANP A;  2ZEM A;  4C8A A;  3PB4 X;  2PVW A;  4X8I A;  2XEI A;  2WYR A;  2ZEE A;  2V8H A;  2C6P A;  2VL1 A;  3BHX A;  4G1P A;  4IHM A;  4UEZ A;  2GRE A;  4OIW A;  4P4D A;  4C8F A;  2PRQ A;  2V8V A;  3IFE A;  3PBB A;  2AFU A;  2JBK A;  2ZEL A;  3V38 A;  5THW A;  2EWB A;  1JQG A;  4PXB A;  1ARL A;  1HDQ A;  2XEF A;  2V8D A;  3NA6 A;  4UEE A;  2PIZ A;  4NGR A;  3L2N A;  4DUK A;  1EE3 P;  3KR5 A;  4OID A;  4C9U A;  1IGB A;  1LFW A;  2ZEN A;  5HXD A;  1TF8 A;  4UEF A;  2ZEO A;  3TX8 A;  3VAR A;  3FX6 A;  1VHE A;  3PRT A;  4UF4 A;  3RBU A;  4ZY1 A;  1BLL E;  1LAP A;  5K8O A;  1ZLI A;  2QVP A;  1HDU A;  1XMB A;  3D7F A;  1PCA A;  3H8G A;  4P4E A;  3ISZ A;  3B3W A;  1BPM A;  3BXM A;  1Q7L A;  4FBE A;  3I1U A;  4OC0 A;  2IMO A;  2I3C A;  2AFO A;  4X2T A;  2PJ4 A;  4EME A;  4CDK A;  1GYT A;  4P6Y A;  4PXD A;  5LYI A;  4B6Z A;  5ELY A;  3V7Z A;  4GM5 A;  3D4U A;  2CTB A;  2PJ9 A;  1Z2L A;  4O23 A;  3S9M A;  4LQG A;  3I74 A;  4C9V A;  4NJQ A;  4A38 A;  4DYO A;  2NSM A;  2PCU A;  2C6G A;  5CBM A;  1ZG8 A;  2BO9 A;  3GLJ A;  3CPA A;  1XFO A;  4R7M A;  2ZEG A;  4OC2 A;  2DEA A;  3B3S A;  1HEE A;  3SJX A;  3H8F A;  3MRU A;  1Y7E A;  3SI2 A;  5JH9 A;  4OC3 A;  1YW4 A;  4K3N A;  4FAI A;  4R8F A;  3RAM A;  2C1C A;  3SJE A;  5D8N A;  2CIJ A;  1ZG9 A;  4P4B A;  5K8M A;  1TKF A;  4OKO A;  4TWE A;  2EK8 A;  3PB6 X;  2PJ2 A;  1Z5R A;  3S9L A;  2GU2 A;  3WC7 A;  1AYE A;  3KZW A;  1CP6 A;  1M4L A;  3IO1 A;  2CF4 A;  4PQA A;  2RB7 A;  4MHZ A;  4P4J A;  5CPA A;  3FMC A;  4P45 A;  1ARM A;  1Y0Y A;  4NGN A;  4WWV A;  1TKH A;  2PIY A;  3KGQ A;  5HVG A;  2WZN A;  3LWU A;  2ZOF A;  2GLJ A;  4F9U A;  1ZG7 A;  4JYW A;  3WC6 A;  3B3C A;  4R6T A;  5JGF A;  4ZX9 A;  3WAB A;  1OBR A;  2JBJ A;  3GB0 A;  4C99 A;  2PVV A;  4OP4 A;  4PXE A;  4RUH A;  2OR4 A;  5I4M A;  2AFM A;  4OME A;  4P4I A;  2PJ3 A;  3IC1 A;  1XRY A;  3IEH A;  1CP7 A;  4C84 A;  3SJF A;  1LOK A;  3HLP A;  2QYV A;  2Q51 A;  3SI1 A;  2PJ7 A;  4ZY0 A;  1XF1 A;  1QQ9 A;  3D66 A;  2Q43 A;  1YLO A;  4MRI A;  1CX8 A;  3IIB A;  4OC5 A;  3GUX A;  4F9V A;  2BCO A;  2O53 A;  1BAV A;  5LYD A;  2PJ5 A; 
#chains in the Genus database with same CATH topology
 2ZW6 A;  2RFH A;  1M4G A;  4BIN A;  1CG2 A;  4JJX A;  3EIF A;  4NGS A;  4OLL A;  3TLB A;  4RN7 A;  1X10 A;  1IY7 A;  3PZJ A;  3LAC A;  4II9 A;  2HWG A;  5BY0 A;  2AJ6 A;  2R82 A;  5KTC A;  3FEE A;  4MHD A;  4CAX A;  4NF1 A;  2HRO A;  2AFX A;  4F6A A;  4BD9 A;  4IIY A;  4MI1 A;  3PFV A;  2DLA A;  3K2K A;  4C86 A;  3TC8 A;  1NSA A;  2XEJ A;  1Z9U A;  3K9T A;  3D7D A;  2C5Q A;  1ZL0 A;  3TTH A;  4CGM A;  4YWY A;  2B58 A;  2ZEP A;  2ZEH A;  4AVB A;  5HKY A;  5AG4 A;  4F0X A;  2AFS A;  3E0K A;  2WSA A;  1CPS A;  1IU8 A;  7CPA A;  3MN8 A;  2B4D A;  2Q4Z A;  1RTQ A;  3T8W A;  2VBQ A;  3WC5 A;  3SJG A;  4HNW B;  3QNV A;  3CXP A;  4ZGY B;  3HPH E;  4IK2 A;  2DPS A;  3PBE A;  2BL1 A;  2EBJ A;  2GIV A;  2J8N A;  3K9U A;  3T9Y A;  3EZB A;  3G23 A;  4YN3 A;  4NGT A;  1XBU A;  1YK3 A;  3T05 A;  3BUX B;  4Q7A A;  2B0A A;  1FNO A;  4QUS A;  4C2X A;  1KC7 A;  1ON0 A;  5G1Z A;  3NFQ A;  3KAS A;  3FEC A;  3FED A;  5DS0 A;  3JRU A;  5LRG A;  3D7G A;  1ZO0 A;  2B5G B;  4KSA A;  3NH5 A;  1JDB C;  4TJX A;  4I49 A;  1YW6 A;  5ISV A;  4EYS A;  3TO6 A;  4BPX B;  1LAN A;  2REE A;  3KR4 A;  3TO9 A;  5J8F A;  2QEC A;  1I12 A;  3I6S A;  2PE3 A;  2R1I A;  2QJ8 A;  1KEE B;  3NFZ A;  4ORF A;  5IR2 A;  4E94 A;  3VRP A;  2J8R A;  2P6G A;  2J9A A;  2AFZ A;  4QBJ A;  2AE6 A;  3OWC A;  2OOT A;  2D0O A;  2AUN A;  1LAM A;  2HC9 A;  1JWQ A;  3DLJ A;  2PQ8 A;  4IUS A;  3R1K A;  4KNG E;  2D4P A;  3PFE A;  1C3O B;  4C8C A;  5F9M A;  3D2P A;  2O28 A;  4CAF A;  4NFR A;  2PJ1 A;  4A4C A;  3DR8 A;  3PEI A;  4CRZ B;  1DTD A;  5LRJ A;  2BUE A;  3A9L A;  4A30 A;  1N71 A;  5HXD A;  1CM0 A;  1VHO A;  2QML A;  4PXC A;  1YSJ A;  4A94 A;  2VZZ A;  1BPN A;  4BMH A;  1DE4 C;  1B47 A;  1QSN A;  1UWY A;  2VEZ A;  4H2K A;  2CY2 A;  2JDC A;  2V8G A;  4NGM A;  3S9N A;  1QMU A;  3KQZ A;  4MCR A;  3BLN A;  3DNS A;  3NH8 A;  2PJA A;  4KZT A;  4PPZ A;  4B5O A;  2ABZ A;  1VGY A;  4OC1 A;  4Z65 A;  3K4I A;  1DIK A;  2ATR A;  2G3T A;  4YU9 A;  2PC1 A;  3RZA A;  1Z8W A;  2EVN A;  2JLM A;  2PJ0 A;  4A33 A;  2B3U A;  1WJT A;  4M8D A;  1KBL A;  1VHS A;  5FVJ A;  1X12 A;  5LRK A;  1VI4 A;  3TOB A;  1MJA A;  2CXA A;  4BBH A;  4NGP A;  4B10 A;  4A37 A;  4C9R A;  4B5P B;  5G22 A;  4Q36 A;  4P10 A;  3B3V A;  4BPW B;  1ELM P;  1A2Z A;  1TF9 A;  2FIA A;  4CYQ A;  1WWZ A;  1YVH A;  3KI9 A;  5JVL A;  2XEG A;  4KOR A;  3IU2 A;  3NH4 A;  3ICU A;  3MGD A;  5K8P A;  4JZ0 A;  3TLE A;  4WJB A;  2OLS A;  2G9D A;  4MCP A;  3JUW A;  3ISX A;  4OC4 A;  4A4B A;  4UIA A;  3FF3 A;  2YNC A;  2BEI A;  4KOW A;  1F2P A;  2OH1 A;  4P4F A;  2PJ6 A;  3V8I A;  3GJZ A;  2F7V A;  4CYP A;  3HUV A;  4E2A A;  1PYT B;  4H89 A;  4COB A;  2CNT A;  1F57 A;  2IQ6 A;  3B2Y A;  1YME A;  1M4I A;  3B35 A;  3QB8 A;  4MHN A;  4XNH C;  2B4J C;  4F0Y A;  3S6H A;  3FVL A;  3D7H A;  3KQX A;  3SXN A;  1B87 A;  3BJ8 A;  3FNC A;  4CPA A;  1NBW A;  2Q4V A;  4KOU A;  4C8P A;  2FVG A;  5JM6 A;  1LRZ A;  4UWI A;  3S6K A;  3SI0 A;  5F09 A;  2HB6 A;  4KUA A;  1PU9 A;  4PSW A;  3FIX A;  5D29 A;  3R95 A;  4KOS A;  2NYQ A;  5EBV A;  3PB9 X;  3BI1 A;  3CT9 A;  1TXR A;  3CDX A;  4H6Z A;  5J8C A;  1QSR A;  2PJ8 A;  4ZY2 A;  4HKF A;  5K8N A;  2CTC A;  1CBX A;  2AFW A;  2Z3P A;  1ZLH A;  3PB7 X;  3VTA A;  2Y1M A;  2VQY A;  3EO4 A;  2PJB A;  3IWE A;  1YRE A;  5F47 A;  4H6U A;  1KWM A;  3BUO B;  1XIX A;  1NE9 A;  3I9S A;  4MHP A;  1CPX A;  2FIW A;  4XPD B;  4CYO A;  3BUN B;  4MJ8 A;  4UCP A;  5E96 A;  1S7K A;  2YJV A;  2JEW A;  3HPG G;  5J1Q A;  1Y9Z A;  1R3N A;  3TLG A;  4UCN A;  1T36 B;  5AGE A;  3TO7 A;  1S60 A;  3G8W A;  4B13 A;  4C7H A;  5LYL A;  2P6F A;  2X7B A;  4ZI6 A;  2O4H A;  4NSQ A;  2AUM A;  1S7L A;  2ARH A;  2GLF A;  4KLW A;  4YFJ A;  3BUM B;  5IV0 A;  4AXV A;  3FBU A;  1S7N A;  5I0C A;  2CNM A;  1MK4 A;  3ZJ0 A;  3FRM A;  1A9X B;  3GYA A;  2Z3L A;  4NJR A;  2HUZ A;  3OB1 B;  5HVF A;  1ZYM A;  2DIK A;  4Y49 C;  3JVN A;  4KOT A;  4MHY A;  4NCZ A;  4UWJ A;  3T90 A;  1Z4R A;  3QAH A;  1R57 A;  1R43 A;  1NSL A;  4J3G A;  3BUW B;  4IAV A;  2B3V A;  5LYF A;  5IB9 A;  2ZOG A;  2IJZ A;  2P0W A;  3NE8 A;  2GAN A;  2X0S A;  1Y0R A;  1YVK A;  3D3S A;  1WVM A;  4P44 A;  3PFO A;  4Q38 A;  3KL9 A;  4C8U A;  4EFD A;  3PB8 X;  4W9Y A;  3IJ3 A;  3ZNI A;  3VRR A;  2BOA A;  3H8E A;  4CZ1 A;  3KHZ A;  4FWU A;  4K30 A;  4MFL A;  1LCP A;  4TJV A;  5LYD A;  3TLZ A;  3O8Z A;  2G3A A;  4ONU A;  4X5K A;  3SXO A;  4B11 A;  4UCM A;  3TFY A;  2HQY A;  4JVO A;  4FUU A;  1J4J A;  4M6H A;  3VAT A;  2EK9 A;  1Q2C A;  3EY5 A;  4DJL A;  3B7I A;  4CDJ A;  1H8L A;  4UIB A;  4EWT A;  3KHX A;  4ZX8 A;  4R57 A;  4AG9 A;  3F5B A;  5HVH A;  1CE8 B;  4C8T A;  5F49 A;  8CPA A;  3P2F A;  2Y0M A;  4C85 A;  1F2O A;  2HV2 A;  2V77 A;  2ZED A;  1I1D A;  3F8K A;  4YGO A;  3B8G A;  2PJC A;  4F8Z A;  4NXY A;  4XPK A;  4A32 A;  4UFW A;  4X3R A;  1IOI A;  1Z4E A;  4M85 A;  3UY5 A;  2R98 A;  2VI7 A;  4CGL A;  1Z8L A;  3DSB A;  4ZBG A;  1AMP A;  3W6S A;  4AG7 A;  1AUG A;  4A39 A;  2F8H A;  1QSM A;  2Q44 A;  5AG7 A;  2VKZ G;  3LMS A;  1EZA A;  3LOD A;  4L8A A;  1TKJ A;  5HMN A;  4MCQ A;  3OB2 B;  2R8V A;  3FXT A;  4TNU A;  2C6C A;  4INJ A;  2WPW A;  4R3K A;  2ZEF A;  3N5F A;  2Q04 A;  3CPX A;  1JDE A;  3U88 C;  4R76 A;  2POK A;  4EVY A;  1FT7 A;  1Y7R A;  2DPT A;  4MXU A;  5EMI A;  3WT4 A;  1EO0 A;  4ONW A;  1VIX A;  1Z8T A;  1V6C A;  4UBR A;  1IIC A;  2BSW A;  1XJO A;  2Z0Z A;  3NOJ A;  3D68 A;  3OP0 A;  4MCS A;  4BPU B;  2XPN A;  1KUX A;  2ZXV A;  3BI0 A;  3FJU A;  4RI1 A;  4C2Y A;  1ZRS A;  3B3T A;  4IIX A;  4CGP A;  3FH4 A;  4E0A A;  2KCW A;  1KUV A;  4UA3 A;  3IWW A;  4MMO A;  6CPA A;  4E5S A;  3TOA A;  1ELL P;  3VH9 A;  4KSI A;  3EFA A;  5EC4 A;  4UFV A;  4CS0 B;  4C9A A;  3DGV A;  4CAW A;  4KLV A;  4KVX A;  4ZYQ A;  3D2M A;  2YNE A;  2I79 A;  3D67 A;  4L89 A;  4NGQ A;  2ANP A;  4RS2 A;  2ZEM A;  3H5Z A;  4UFX A;  4C8A A;  3PB4 X;  3EZA A;  2PVW A;  3TE4 A;  1C30 B;  4X8I A;  2XEI A;  1Y9W A;  2WYR A;  2ZEE A;  2JEV A;  4U9Z A;  4C7I A;  2G0B A;  1IID A;  2PCN A;  3TCV A;  2V8H A;  5AG6 A;  4MFK A;  2C6P A;  2VL1 A;  3BHX A;  4G1P A;  4IHM A;  4UEZ A;  4JXR A;  5DWM A;  4DNC A;  4COG A;  2GRE A;  3LD2 A;  4OIW A;  2Z11 A;  4P4D A;  4C8F A;  2PRQ A;  2V8V A;  2B4D B;  3IFE A;  4KVM E;  3PBB A;  2AFU A;  2JBK A;  2FE7 A;  2ZEL A;  4LX9 A;  2Z3N A;  3V38 A;  1YLE A;  5THW A;  2EWB A;  3FB3 A;  2HI6 A;  1JQG A;  4PXB A;  4KSF A;  1ARL A;  1CS0 B;  4KOY A;  3PP9 A;  1HDQ A;  4R87 A;  1YX0 A;  4LQ6 A;  4MY3 A;  3I3G A;  4AVA A;  4JWP A;  2EZA A;  4C9E A;  5KTA A;  2XEF A;  2B5G A;  2V8D A;  3NA6 A;  4MFP A;  2PIZ A;  4UEE A;  2XPO A;  4NGR A;  3SHP A;  3EZE A;  5F1Y A;  3L2N A;  2Z3O A;  3S6G A;  4DUK A;  1EE3 P;  3KR5 A;  2C27 A;  4A31 A;  4OID A;  2D0P A;  3SR3 A;  4C9U A;  1IGB A;  4KS9 A;  3KKW A;  4LUA A;  3H4Q A;  1UFH A;  1LFW A;  1XOV A;  1YVO A;  5JPH A;  4CO9 A;  1BOB A;  2ZEN A;  1TF8 A;  4UEF A;  2ZEO A;  2Q7B A;  1IYK A;  3TX8 A;  3VAR A;  3FX6 A;  4CRY B;  1VHE A;  3PRT A;  4CGN A;  1NMT A;  4UF4 A;  3GKR A;  3RBU A;  4ZY1 A;  2DXQ A;  1BLL E;  1KZF A;  1LAP A;  2VZY A;  5K8O A;  5C88 A;  2B4B A;  5HH1 A;  2YNC C;  5F48 A;  1ZLI A;  2QVP A;  3R9G A;  1HDU A;  1NXJ A;  3U1B A;  2YND A;  4XNH B;  2EZC A;  5FD8 A;  3WR7 A;  1R61 A;  3TYX A;  4HNX B;  1Q2D A;  4PSX A;  1XMB A;  2EUI A;  4U5Y A;  3D7F A;  2REF A;  3VGO A;  1PCA A;  2PR8 A;  3H8G A;  3W91 A;  4P4E A;  2Z3K A;  3ISZ A;  1FY7 A;  3IU1 A;  5JQ4 A;  1Q5X A;  3B3W A;  5HKZ A;  5J3X A;  2CNS A;  3W6X A;  4AVC A;  2CBL A;  1BPM A;  1TIQ A;  4MFQ A;  2PSW A;  2FL4 A;  3BXM A;  1Q7L A;  4FBE A;  4FD6 A;  3I1U A;  4OC0 A;  3ZZI A;  1PUA A;  2IMO A;  4CAE A;  2I3C A;  2AFO A;  5AXI A;  4X2T A;  1M4D A;  2PJ4 A;  4OAD A;  3G3S A;  4EME A;  3RO0 A;  4A2Z A;  3OAK A;  1GYT A;  4B5P A;  4CYN A;  4P6Y A;  4PXD A;  4U9Y A;  5LYI A;  4CDK A;  4B6Z A;  5ELY A;  4GPL B;  2ZW4 A;  3V7Z A;  4PK3 A;  4GM5 A;  5KTD A;  1P4N A;  3F9K C;  3C8O A;  2OU2 A;  3D4U A;  1WK4 A;  4QB9 A;  2EZB A;  1GGO A;  3T07 A;  2CTB A;  2FS5 A;  1Y9K A;  1FBV A;  1MJB A;  2PJ9 A;  1Z2L A;  3VWE A;  1K4J A;  2OB0 A;  2YJT A;  2OZH A;  4O23 A;  4IF5 A;  2UV8 G;  3S9M A;  4LQG A;  4JXQ A;  3I74 A;  4C9V A;  5BWA B;  2MP0 A;  4NJQ A;  4A38 A;  1S5K A;  3RYO A;  4DYO A;  1RO5 A;  2NSM A;  2PCU A;  2NMT A;  2C6G A;  2FT0 A;  1ZG8 A;  1GHE A;  3CZX A;  3N7Z A;  1I21 A;  2BO9 A;  3GLJ A;  3QAY A;  5GCN A;  4QC6 A;  1RXT A;  3T0T A;  4C2Z A;  1YGH A;  4MFZ A;  4Y49 B;  5AG5 A;  3R9F A;  2P6E A;  2ZW7 A;  3CPA A;  1XFO A;  4R7M A;  2Z3M A;  4M3S A;  4XPL A;  4A95 A;  2ZEG A;  4OC2 A;  4FD7 A;  2PDO A;  2DEA A;  2J8M A;  4FD4 A;  4M6I A;  4B14 A;  1IYL A;  3B3S A;  2JDD A;  1HEE A;  1Z9E A;  4AB7 A;  4B12 A;  2N3A B;  3SJX A;  1S3Z A;  1YR0 A;  3H8F A;  3DDD A;  3MRU A;  2YGW A;  4NEX A;  5A27 A;  1Z8X A;  1Y7E A;  4KOV A;  2RC4 A;  3PLF B;  4HNY B;  4GXH A;  3SI2 A;  5JH9 A;  1Q2Y A;  1XEB A;  2QIR A;  4OC3 A;  1IB1 E;  1YW4 A;  2GFQ A;  3EC4 A;  4K3N A;  3R9E A;  4FAI A;  1OZP A;  1M6V B;  1VBH A;  1QSO A;  1V0C A;  2K5T A;  4R8F A;  4JLY A;  3FYN A;  3TLG B;  4OAE A;  2C1C A;  3RAM A;  4MFJ A;  2ZPA A;  4PK2 A;  5K99 A;  1BO4 A;  3SJE A;  2WUU A;  5D8N A;  2CIJ A;  2GE3 A;  3PGP A;  1KUY A;  1XE4 A;  5DWN A;  1ZG9 A;  4P4B A;  5K8M A;  2E28 A;  1TKF A;  4OKO A;  4TWE A;  1YQE A;  5F13 A;  3P2H A;  5JYB A;  3BJ7 A;  3GY9 A;  5A28 A;  1XMT A;  1BXR B;  2XPP A;  5IX3 A;  2EK8 A;  3C26 A;  3HMJ G;  3PB6 X;  3DR6 A;  3IWG A;  5C82 A;  2PJ2 A;  5IB0 A;  1Z5R A;  1U6M A;  5CBM A;  2Z10 A;  2Q0Y A;  3S9L A;  2EO8 A;  2GU2 A;  3VWD A;  3WC7 A;  1VKC A;  1AYE A;  3TLY A;  5F5X A;  1EZB A;  3NE7 A;  3KZW A;  1CP6 A;  1M4L A;  2VXK A;  3IO1 A;  4PV6 A;  4QVT A;  1MJ9 A;  1IOF A;  2CF4 A;  1XF8 A;  4GS4 A;  4PQA A;  1QST A;  3CXS A;  1VBG A;  1SQH A;  5G21 A;  2RB7 A;  4MHZ A;  4P4J A;  3EXN A;  5CPA A;  3RNZ A;  4CAV A;  2FXF A;  4J0N A;  3FMC A;  4P45 A;  2FM4 A;  3TT2 A;  4MI4 A;  1ARM A;  1Y0Y A;  4XPD C;  2A4N A;  2I00 A;  4HPS A;  1P0H A;  4NGN A;  2IL4 A;  3VRO A;  2PR1 A;  4WWV A;  1TKH A;  2XPL A;  3VRN A;  1M44 A;  5HKW A;  2PIY A;  1L0C A;  2WZN A;  3KGQ A;  3LWU A;  2ZOF A;  2GLJ A;  5HVG A;  1J3L A;  2OZG A;  3TLA A;  4F9U A;  3T5M A;  1ZG7 A;  4JYW A;  3TLC A;  3WC6 A;  3PT1 A;  3B3C A;  4R6T A;  4CGO A;  4ZX9 A;  4R3L A;  2WPX A;  3WAB A;  5JGF A;  1OBR A;  4FD5 A;  2JBJ A;  2DF5 A;  2ODF A;  2OZU A;  3GB0 A;  4JD6 A;  4C99 A;  2PVV A;  2D4O A;  2ZW5 A;  4M6G A;  5G20 A;  1S7F A;  1B6B A;  4OP4 A;  4PXE A;  4KUB A;  4RUH A;  2OR4 A;  2F5I A;  5F46 A;  2AFM A;  5I4M A;  4OME A;  4P4I A;  2PJ3 A;  2FSR A;  3VRQ A;  4MY0 A;  4H1H A;  3IC1 A;  1XRY A;  3IEH A;  1CP7 A;  4C84 A;  3SJF A;  1M1D A;  1LOK A;  3HLP A;  3KRV A;  4RR2 B;  2QYV A;  2Q51 A;  3D8P A;  3SI1 A;  2PJ7 A;  3S6F A;  4C68 A;  4BTF A;  5CNP A;  4ZY0 A;  3GIU A;  1XF1 A;  2PRB A;  1QQ9 A;  3D66 A;  2Q7S A;  4MBU A;  1CJW A;  2Q43 A;  3CXQ A;  1YLO A;  4KOX A;  4MRI A;  1CX8 A;  3R96 A;  4OC5 A;  3IGR A;  3IIB A;  2GP4 A;  2Q4Y A;  2FCK A;  3GUX A;  3F0A A;  2H5M A;  2BCO A;  2O53 A;  3JTK A;  2Y1N A;  4YRH A;  2R7H A;  5H84 A;  5H86 A;  4F9V A;  4MJX A;  1BAV A;  4R9M A;  4KVO E;  4E8O A;  2PJ5 A; 
#chains in the Genus database with same CATH homology
 2RFH A;  1CG2 A;  3EIF A;  4NGS A;  1IY7 A;  3FEE A;  2AFX A;  4BD9 A;  4C86 A;  3K2K A;  3TC8 A;  1NSA A;  2XEJ A;  3K9T A;  3D7D A;  2C5Q A;  4YWY A;  2ZEP A;  2ZEH A;  2AFS A;  1CPS A;  7CPA A;  3MN8 A;  2Q4Z A;  1RTQ A;  3T8W A;  3WC5 A;  3SJG A;  3QNV A;  4IK2 A;  3PBE A;  4YN3 A;  4NGT A;  1XBU A;  4Q7A A;  1FNO A;  3KAS A;  3FEC A;  3FED A;  5DS0 A;  3JRU A;  5LRG A;  3D7G A;  3NH5 A;  4TJX A;  1YW6 A;  1LAN A;  3KR4 A;  3I6S A;  2PE3 A;  2QJ8 A;  5IR2 A;  3NFZ A;  2J9A A;  2AFZ A;  2OOT A;  1LAM A;  2HC9 A;  3DLJ A;  4KNG E;  3PFE A;  4C8C A;  4NFR A;  2PJ1 A;  3PEI A;  1DTD A;  5LRJ A;  1VHO A;  4A94 A;  4PXC A;  1YSJ A;  1BPN A;  1DE4 C;  1UWY A;  4H2K A;  3KQZ A;  2V8G A;  4NGM A;  3S9N A;  1QMU A;  4MCR A;  3NH8 A;  2PJA A;  4PPZ A;  4Z65 A;  2ABZ A;  1VGY A;  4OC1 A;  3RZA A;  4YU9 A;  2PJ0 A;  5LRK A;  4C9R A;  4NGP A;  4A37 A;  4P10 A;  3B3V A;  1ELM P;  1TF9 A;  3KI9 A;  2XEG A;  3NH4 A;  3ICU A;  5K8P A;  4JZ0 A;  4WJB A;  2G9D A;  4MCP A;  3ISX A;  4OC4 A;  4UIA A;  3FF3 A;  1F2P A;  4P4F A;  2PJ6 A;  2F7V A;  3HUV A;  1PYT B;  4MHN A;  1F57 A;  2IQ6 A;  3B2Y A;  1YME A;  3B35 A;  3FVL A;  3D7H A;  3KQX A;  4CPA A;  4C8P A;  2FVG A;  5JM6 A;  3SI0 A;  5F09 A;  2HB6 A;  5D29 A;  2NYQ A;  3PB9 X;  3BI1 A;  3CT9 A;  1TXR A;  3CDX A;  2PJ8 A;  4ZY2 A;  5K8N A;  2CTC A;  1CBX A;  2AFW A;  3PB7 X;  1ZLH A;  3VTA A;  2PJB A;  1KWM A;  4MHP A;  1CPX A;  2JEW A;  5J1Q A;  1Y9Z A;  1R3N A;  5LYL A;  4ZI6 A;  2O4H A;  2GLF A;  4AXV A;  4NJR A;  5HVF A;  4MHY A;  1R43 A;  4IAV A;  5LYF A;  5IB9 A;  2ZOG A;  2IJZ A;  1Y0R A;  1WVM A;  4P44 A;  3PFO A;  3KL9 A;  4C8U A;  4EFD A;  3PB8 X;  4W9Y A;  3IJ3 A;  2BOA A;  3H8E A;  3KHZ A;  4FWU A;  1LCP A;  4TJV A;  4FUU A;  3VAT A;  2EK9 A;  4DJL A;  3B7I A;  4CDJ A;  1H8L A;  4UIB A;  4EWT A;  3KHX A;  4ZX8 A;  5HVH A;  4C8T A;  8CPA A;  4C85 A;  1F2O A;  2ZED A;  2V77 A;  4F8Z A;  2PJC A;  4X3R A;  1Z8L A;  1AMP A;  4A39 A;  2F8H A;  3LMS A;  1TKJ A;  4MCQ A;  4TNU A;  2C6C A;  2ZEF A;  3N5F A;  3CPX A;  4R76 A;  2POK A;  1FT7 A;  3WT4 A;  4MXU A;  4ONW A;  1VIX A;  1V6C A;  1XJO A;  3D68 A;  4MCS A;  4C9E A;  3BI0 A;  3FJU A;  3B3T A;  3FH4 A;  6CPA A;  3IWW A;  4MMO A;  1ELL P;  3VH9 A;  4KSI A;  4C9A A;  3DGV A;  4ZYQ A;  3D67 A;  4NGQ A;  2ANP A;  2ZEM A;  4C8A A;  3PB4 X;  2PVW A;  4X8I A;  2XEI A;  2WYR A;  2ZEE A;  2V8H A;  2C6P A;  2VL1 A;  3BHX A;  4G1P A;  4IHM A;  4UEZ A;  2GRE A;  4OIW A;  4P4D A;  4C8F A;  2PRQ A;  2V8V A;  3IFE A;  3PBB A;  2AFU A;  2JBK A;  2ZEL A;  3V38 A;  5THW A;  2EWB A;  1JQG A;  4PXB A;  1ARL A;  1HDQ A;  2XEF A;  2V8D A;  3NA6 A;  4UEE A;  2PIZ A;  4NGR A;  3L2N A;  4DUK A;  1EE3 P;  3KR5 A;  4OID A;  4C9U A;  1IGB A;  1LFW A;  2ZEN A;  5HXD A;  1TF8 A;  4UEF A;  2ZEO A;  3TX8 A;  3VAR A;  3FX6 A;  1VHE A;  3PRT A;  4UF4 A;  3RBU A;  4ZY1 A;  1BLL E;  1LAP A;  5K8O A;  1ZLI A;  2QVP A;  1HDU A;  1XMB A;  3D7F A;  1PCA A;  3H8G A;  4P4E A;  3ISZ A;  3B3W A;  1BPM A;  3BXM A;  1Q7L A;  4FBE A;  3I1U A;  4OC0 A;  2IMO A;  2I3C A;  2AFO A;  4X2T A;  2PJ4 A;  4EME A;  4CDK A;  1GYT A;  4P6Y A;  4PXD A;  5LYI A;  4B6Z A;  5ELY A;  3V7Z A;  4GM5 A;  3D4U A;  2CTB A;  2PJ9 A;  1Z2L A;  4O23 A;  3S9M A;  4LQG A;  3I74 A;  4C9V A;  4NJQ A;  4A38 A;  4DYO A;  2NSM A;  2PCU A;  2C6G A;  5CBM A;  1ZG8 A;  2BO9 A;  3GLJ A;  3CPA A;  1XFO A;  4R7M A;  2ZEG A;  4OC2 A;  2DEA A;  3B3S A;  1HEE A;  3SJX A;  3H8F A;  3MRU A;  1Y7E A;  3SI2 A;  5JH9 A;  4OC3 A;  1YW4 A;  4K3N A;  4FAI A;  4R8F A;  3RAM A;  2C1C A;  3SJE A;  5D8N A;  2CIJ A;  1ZG9 A;  4P4B A;  5K8M A;  1TKF A;  4OKO A;  4TWE A;  2EK8 A;  3PB6 X;  2PJ2 A;  1Z5R A;  3S9L A;  2GU2 A;  3WC7 A;  1AYE A;  3KZW A;  1CP6 A;  1M4L A;  3IO1 A;  2CF4 A;  4PQA A;  2RB7 A;  4MHZ A;  4P4J A;  5CPA A;  3FMC A;  4P45 A;  1ARM A;  1Y0Y A;  4NGN A;  4WWV A;  1TKH A;  2PIY A;  3KGQ A;  5HVG A;  2WZN A;  3LWU A;  2ZOF A;  2GLJ A;  4F9U A;  1ZG7 A;  4JYW A;  3WC6 A;  3B3C A;  4R6T A;  5JGF A;  4ZX9 A;  3WAB A;  1OBR A;  2JBJ A;  3GB0 A;  4C99 A;  2PVV A;  4OP4 A;  4PXE A;  4RUH A;  2OR4 A;  5I4M A;  2AFM A;  4OME A;  4P4I A;  2PJ3 A;  3IC1 A;  1XRY A;  3IEH A;  1CP7 A;  4C84 A;  3SJF A;  1LOK A;  3HLP A;  2QYV A;  2Q51 A;  3SI1 A;  2PJ7 A;  4ZY0 A;  1XF1 A;  1QQ9 A;  3D66 A;  2Q43 A;  1YLO A;  4MRI A;  1CX8 A;  2GP4 A;  3IIB A;  4OC5 A;  3GUX A;  4F9V A;  2BCO A;  2O53 A;  1BAV A;  5LYD A;  2PJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...