4MCRA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyltri-gamma-l-glutamic acid (pteroyltetra-gamma-l-glutamic acid)
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
695
structure length
693
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 269
structure length 693
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcrA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcrA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcrA02
1Z5RA 4P4FA 4UEZA 4UIBA 8CPAA 4WWVA 3BI1A 4PPZA 4OC1A 1JQGA 2PJ2A 2AFMA 4MXUA 4ZYQA 3CPAA 3KL9A 4P44A 3PB6X 3SJEA 1TKJA 3D7DA 3SJGA 3KZWA 2F7VA 4A94A 3NH8A 4Z65A 3IC1A 3RZAA 2JBKA 3KASA 3HLPA 3ISXA 3PB9X 1LAPA 1YMEA 1ZG7A 2CTCA 3RBUA 3D68A 2GREA 3PB7X 4NGMA 4P4BA 4RUHA 3VH9A 3IFEA 2PJ8A 4TJVA 3B7IA 4R7MA 5JH9A 3IIBA 3PB4X 2EWBA 2QJ8A 3B2YA 2CF4A 2IJZA 1VIXA 2ZEFA 3CPXA 1Z8LA 5JGFA 3T8WA 1AMPA 4OC2A 2CIJA 1H8LA 1XFOA 4BD9A 2WZNA 2ZENA 4IAVA 3BI0A 2AFSA 4A38A 3FMCA 3ICUA 2VL1A 4TWEA 1OBRA 2XEJA 5D8NA 1CG2A 3B3CA 2C1CA 3K2KA 4X8IA 4MMOA 3FEDA 3VARA 2OOTA 4EMEA 1LAMA 4TNUA 4C8TA 3TX8A 1VHEA 2O4HA 3D7FA 5K8OA 4A37A 2RB7A 2POKA 4JZ0A 4C8FA 3V7ZA 1YW4A 3MN8A 3LMSA 1LCPA 2XEGA 3CDXA 1BPNA 5HVGA 4C8AA 4MHNA 3SJXA 3SI1A 4FUUA 3S9NA 1VGYA 2DEAA 1ELMP 4UEFA 5K8NA 2PIYA 2ZOGA 4P45A 3NFZA 5LYIA 2ZEDA 3PBEA 3DGVA 3I6SA 4PXDA 5F09A 3B3WA 4PXCA 2OR4A 2PJBA 1HDQA 4OP4A 3CT9A 1VHOA 5JM6A 1NSAA 2V8GA 4C9UA 4UIAA 1ARMA 3FECA 3H8GA 4ZX8A 3VATA 4IK2A 3WC6A 1Y0YA 4NJQA 4MHYA 2XEIA 1QQ9A 3GB0A 5THWA 5LRKA 2JBJA 1QMUA 3PFOA 5HVFA 3EIFA 4NGQA 4P10A 4ZY2A 4DJLA 1F2PA 2PVWA 2PJ3A 3HUVA 3NA6A 1F2OA 1RTQA 1WVMA 4MCRA 1ARLA 3JRUA 4YWYA 4NGTA 4C99A 2Q4ZA 3IJ3A 2CTBA 3WT4A 4NJRA 4X2TA 2PJ0A 4WJBA 1FT7A 5HXDA 4C86A 1TF9A 4C9RA 1AYEA 4K3NA 1V6CA 4R76A 5CPAA 3LWUA 2ANPA 4R6TA 2V8HA 3IEHA 4B6ZA 2ZEHA 4MHPA 2RFHA 1Y9ZA 5ELYA 1LANA 3KHXA 4H2KA 3TC8A 3BXMA 2PJ1A 4PXBA 1LOKA 1KWMA 1R43A 2V77A 3PRTA 1XJOA 4MRIA 3KR4A 4C8PA 4NGPA 2PJ4A 2HB6A 4ZY1A 4KNGE 4YU9A 2XEFA 5K8PA 2NYQA 4MCSA 4CDJA 2AFWA 3K9TA 4P4JA 4C85A 3D7GA 3L2NA 2O53A 5LYLA 2Q51A 3MRUA 1YLOA 1CPXA 4UF4A 1CX8A 3PB8X 4PQAA 4NFRA 3PEIA 3D66A 4NGRA 3SI2A 1BAVA 3FX6A 2JEWA 3RAMA 1BPMA 1IGBA 2BCOA 4KSIA 2FVGA 5IB9A 2PRQA 3S9LA 4NGNA 3I74A 3KR5A 3D4UA 4P4DA 5LRJA 3N5FA 2PJ9A 4NGSA 1R3NA 3SI0A 1TKFA 1PYTB 2BO9A 4EFDA 4P4EA 4X3RA 2PJ6A 3FH4A 4JYWA 1LFWA 2ABZA 5J1QA 5LYDA 2WYRA 4DYOA 1ZG8A 2G9DA 2IQ6A 3V38A 1Y7EA 5D29A 1F57A 3KQXA 2AFUA 2J9AA 4OMEA 1ZG9A 4DUKA 4FAIA 4C9VA 5LYFA 1BLLE 2EK8A 5LRGA 4G1PA 4C9EA 1UWYA 4CDKA 3KGQA 2PJCA 4FBEA 4ZI6A 3VTAA 4FWUA 3FEEA 1IY7A 4OIDA 1FNOA 3NH4A 4YN3A 3NH5A 4CPAA 2GU2A 1Z2LA 3H8FA 1ZLIA 5K8MA 2ZOFA 3S9MA 4IHMA 2ZEEA 4A39A 3D7HA 4P6YA 1EE3P 1HDUA 1DE4C 1ELLP 1TKHA 4OC3A 3D67A 1XRYA 2HC9A 1CBXA 1PCAA 1TF8A 4OC4A 1YSJA 3SJFA 1Q7LA 3WABA 3DLJA 1CP6A 4PXEA 3KQZA 2C6PA 1XBUA 2GLFA 4LQGA 3B35A 4ONWA 2NSMA 2PJ7A 4C8CA 5CBMA 4EWTA 4AXVA 1Y0RA 2PJ5A 4UEEA 2V8VA 2PCUA 3BHXA 4OIWA 2BOAA 2Q43A 2AFOA 2AFZA 3I1UA 2QVPA 3PFEA 2C6CA 1DTDA 4F9UA 2GLJA 4F9VA 1M4LA 3WC5A 1TXRA 2ZEPA 4R8FA 3FJUA 4TJXA 3IO1A 3B3SA 2ZELA 4OKOA 4ZX9A 2PIZA 2ZEMA 4C9AA 1CPSA 4OC5A 2QYVA 3FVLA 4MCQA 3ISZA 2AFXA 4OC0A 6CPAA 4MCPA 3KHZA 1XF1A 3PBBA 5I4MA 3KI9A 2C6GA 2EK9A 4O23A 2I3CA 1GYTA 2PVVA 2ZEOA 3H8EA 1CP7A 2F8HA 1HEEA 4P4IA 4W9YA 2PE3A 3B3TA 4C8UA 3FF3A 1XMBA 2ZEGA 4C84A 1YW6A 3GLJA 3B3VA 4GM5A 2V8DA 5HVHA 5DS0A 4MHZA 3GUXA 7CPAA 1ZLHA 3WC7A 4ZY0A 2PJAA 4Q7AA 4F8ZA 2IMOA 3QNVA 3IWWA
chains in the Genus database with same CATH superfamily
1KZFA 4KOVA 3OB2B 1Z5RA 4P4FA 4UEZA 5J8CA 4UIBA 2GIVA 4MBUA 4C2ZA 1IU8A 3T9YA 1KBLA 2B5GB 2FSRA 3SXNA 8CPAA 4WWVA 2YNCC 4A31A 4A30A 3NE8A 3HPHE 2BUEA 3BI1A 2EO8A 4OC1A 4PPZA 4NSQA 5EMIA 1JQGA 2PJ2A 2VZZA 2AFMA 4Y49C 3VROA 3NFQA 1IOFA 1P4NA 2F5IA 4MXUA 1XIXA 3CPAA 4CGPA 4ZYQA 2HV2A 3KL9A 3LACA 4P44A 4KZTA 2P6FA 2Z11A 4NXYA 1JDEA 5AXIA 3GKRA 3SJEA 3PB6X 1TKJA 3D7DA 3SJGA 3KZWA 2F7VA 1L0CA 4A94A 1VBGA 1Q2CA 2WUUA 3NH8A 4UBRA 4Z65A 3PZJA 1S7LA 4R3LA 3TLGB 3PLFB 1VHSA 5FD8A 3IC1A 1J4JA 2PDOA 3RZAA 2JBKA 3KASA 3HLPA 3ISXA 3PB9X 1LAPA 1YMEA 1ZG7A 4YGOA 2PC1A 2CTCA 2R7HA 4B5PB 3BUOB 1M4GA 3TLEA 5F46A 2XPPA 2CXAA 1IICA 1I12A 3TE4A 3RBUA 3D68A 5C88A 4C2YA 4CYPA 2QIRA 4PK3A 2GREA 3PB7X 4NGMA 4P4BA 5KTAA 4RUHA 1S7KA 4M6GA 5CNPA 4KVXA 4NCZA 3IFEA 2GE3A 3A9LA 2PJ8A 3VH9A 2E28A 4TJVA 3T05A 3B7IA 5H86A 3R95A 4R9MA 2IL4A 4R7MA 4FD7A 2B4DA 4LX9A 5AG7A 4MFZA 5JH9A 4KOTA 3IIBA 5KTDA 2G3AA 2EWBA 2QJ8A 1CJWA 3PB4X 2Q4VA 5AGEA 3R96A 3B2YA 1S60A 4CGMA 2PQ8A 4KOYA 2Q0YA 2VXKA 1CS0B 4U5YA 4UFVA 2VEZA 2CF4A 2WPXA 5F5XA 3E0KA 1M1DA 2MP0A 4XPDB 1A2ZA 2CBLA 2IJZA 1X10A 1VIXA 4LQ6A 1XE4A 2ZEFA 3PGPA 2GP4A 2ZW6A 4KOWA 3CPXA 4QB9A 1ZL0A 1Z8LA 2YNEA 4PSXA 2OLSA 5JGFA 4XNHB 3T8WA 4M8DA 2C27A 4M3SA 1AMPA 4OC2A 3CXPA 2CIJA 1V0CA 3EY5A 1H8LA 4KVME 5DWNA 1XFOA 4KUAA 2JLMA 3GY9A 4M85A 2WZNA 3TCVA 4BD9A 1BOBA 4CAFA 2K5TA 3EZBA 2N3AB 1XEBA 2ZENA 1Q2DA 3VWDA 3NE7A 4IAVA 4UCNA 3BI0A 2BSWA 3VRPA 5F48A 5DWMA 2AFSA 2ODFA 4A38A 4FD5A 1VBHA 1Q2YA 2JDDA 4CAXA 5G20A 3FMCA 3IWGA 3ICUA 4MY0A 2VL1A 3FRMA 4TWEA 5JQ4A 2X0SA 3EZEA 1OBRA 5G22A 5F47A 4CYNA 2XEJA 4LUAA 3CXSA 2RC4A 1CG2A 5D8NA 3B3CA 2C1CA 5F1YA 1AUGA 3K2KA 4X8IA 4JVOA 4IIXA 1KC7A 4MMOA 3FEDA 5JYBA 4Y49B 4UFWA 1K4JA 2R1IA 3DNSA 3VARA 2OOTA 4AVCA 3C26A 4MY3A 4EMEA 1IYKA 2G3TA 4E5SA 1LAMA 2EUIA 2J8NA 3D3SA 4CGNA 1Z9UA 3T5MA 4TNUA 4ZBGA 1KEEB 3TX8A 1VHEA 4C8TA 4KORA 2O4HA 4KOUA 3D7FA 5K8OA 4A37A 4H89A 3BUXB 2RB7A 3V8IA 4KLVA 2POKA 4A32A 3BUWB 4MJXA 2G0BA 3HMJG 4JZ0A 2FE7A 4GS4A 4C8FA 3V7ZA 1YW4A 3MN8A 3LMSA 3BJ8A 3EC4A 1LCPA 2XEGA 3CDXA 3KRVA 2ZW7A 2Z3MA 1BPNA 4NF1A 5HVGA 1EO0A 4BPWB 3W6SA 2OU2A 4MFQA 1JWQA 2BL1A 1Z4RA 4MFPA 4MHNA 3G3SA 4C8AA 3SJXA 2Z3PA 4JLYA 3SI1A 4C68A 5A28A 1NSLA 1ZO0A 4FUUA 3S9NA 2BEIA 4C7HA 1GGOA 1VGYA 2DEAA 3TO7A 4HNXB 1ELMP 4UEFA 5K8NA 2YJTA 4PV6A 5KTCA 2HQYA 2FXFA 2OZUA 2PIYA 3IGRA 5EBVA 2ZOGA 4P45A 3NFZA 5LYIA 1C30B 2ZEDA 3PBEA 4YFJA 3DGVA 3F0AA 4U9YA 3I6SA 4JD6A 1QSMA 3EO4A 3JTKA 1WJTA 4HNYB 4PXDA 1IYLA 5F09A 2VQYA 3CXQA 1R61A 2VI7A 3B3WA 4PXCA 2OR4A 3DSBA 2PJBA 4ORFA 1HDQA 4OP4A 1EZBA 2YGWA 1P0HA 1VHOA 3CT9A 4H6ZA 2Z3OA 4HKFA 1Z9EA 5JM6A 1NSAA 2V8GA 4C9UA 4HPSA 4M6HA 4UIAA 3D2MA 1ARMA 3FNCA 3FECA 3H8GA 4KVOE 3R9FA 4ZX8A 3C8OA 3VATA 4A95A 3GIUA 4IK2A 4CGOA 4XPKA 3WC6A 4E8OA 4MFLA 1Y0YA 3TLYA 1YQEA 4NJQA 4XPLA 1Z8XA 5HH1A 4MHYA 4CS0B 4DJLA 1C3OB 2XEIA 1B6BA 4JJXA 1NXJA 1QQ9A 5A27A 2B4DB 2FIWA 3GB0A 5THWA 1YK3A 3T07A 5LRKA 4QUSA 2JBJA 1QMUA 2ZPAA 3RO0A 4PK2A 3PFOA 4R3KA 5HVFA 3EIFA 4J0NA 4NGQA 4P10A 5G21A 1FY7A 1RO5A 4HNWB 1F2PA 2PVWA 2PJ3A 3JUWA 5E96A 4ZY2A 3HUVA 1X12A 3NA6A 1F2OA 1RTQA 1WVMA 4MCRA 3SR3A 2OB0A 1ARLA 3JRUA 1B87A 4BPUB 4RN7A 4YWYA 4NGTA 2ZW5A 4C99A 3TT2A 1Q5XA 2Q4ZA 3IJ3A 2CTBA 4MI4A 3SHPA 3WT4A 5J3XA 4NJRA 5BY0A 4RI1A 3BUMB 4C2XA 2FM4A 4B11A 1LRZA 4X2TA 2PJ0A 1S7NA 1XMTA 5AG4A 3FBUA 2WPWA 3QAHA 4WJBA 1M4DA 5GCNA 3WABA 4H6UA 1FT7A 1KUVA 1Y7RA 5HXDA 3TO6A 4C86A 1TF9A 4C9RA 1AYEA 3VGOA 3TLGA 4K3NA 3IU1A 1V6CA 5BWAB 2OZGA 4R76A 2XPNA 4B5PA 3RYOA 5H84A 4L89A 2YJVA 5CPAA 2A4NA 3LWUA 2ANPA 4R6TA 2V8HA 3IEHA 4UWIA 2AE6A 3OAKA 2Z3KA 2ZEHA 4B6ZA 5F9MA 1N71A 1PUAA 1ON0A 2EZAA 4MHPA 2RFHA 1Y9ZA 5ELYA 2QECA 1KUYA 1LANA 3TLAA 3KHXA 2AUNA 4H2KA 3LD2A 3RNZA 3BXMA 2PJ1A 4PXBA 3TC8A 1WK4A 2O28A 4KUBA 3GYAA 4B5OA 1BXRB 1LOKA 2NMTA 2DXQA 2Q7SA 3DDDA 3I3GA 1KWMA 1R43A 2V77A 3PRTA 2HROA 4J3GA 2DIKA 1XJOA 2KCWA 4MRIA 2J8RA 2GFQA 3IU2A 1I21A 3KR4A 4C8PA 1SQHA 3W91A 3TTHA 4NGPA 4CRYB 2B4BA 2C5QA 3H5ZA 2JDCA 1U6MA 2H5MA 3TYXA 2PJ4A 2HB6A 4ZY1A 4KNGE 2EBJA 4YU9A 4OLLA 2XEFA 5K8PA 2B3UA 2NYQA 4MCSA 5HKZA 4KS9A 4CYOA 4CDJA 4BINA 2PCNA 4MFJA 2AFWA 5C82A 2OZHA 4QC6A 4M6IA 2ZXVA 3K9TA 4P4JA 3KKWA 2XPOA 2ZW4A 3U88C 4C85A 1YVHA 4AG7A 3D7GA 4JWPA 4II9A 3L2NA 3PP9A 3G23A 2O53A 4R87A 5LYLA 1JDBC 2Q51A 4IF5A 2AJ6A 3F5BA 3MRUA 2ATRA 1YLOA 2HWGA 1CPXA 3GJZA 1PU9A 2DPTA 4UF4A 4A33A 3H4QA 1CX8A 1QSOA 3F8KA 3PB8X 4PQAA 4NFRA 3DR6A 4CZ1A 1NE9A 4AB7A 1BO4A 3PEIA 4CO9A 2D4PA 3D66A 4CAWA 5J8FA 5JVLA 4NGRA 1A9XB 3EZAA 3SI2A 3JVNA 4AVAA 1BAVA 3FX6A 3BJ7A 2JEWA 4CRZB 3RAMA 1BPMA 1IGBA 2ARHA 2BCOA 4KSIA 2HUZA 2EZBA 4FD6A 2FVGA 4GXHA 1J3LA 2D0OA 3TOAA 2HI6A 5K99A 4QVTA 5IB9A 3CZXA 3FIXA 2PRQA 3S9LA 1MK4A 4NGNA 4UA3A 2Z3NA 3I74A 1XF8A 4H1HA 3KR5A 1UFHA 3D4UA 2Z0ZA 4XNHC 4P4DA 5LRJA 1WWZA 4RR2B 3T0TA 4K30A 3N5FA 2PJ9A 2D4OA 3ZZIA 4NGSA 3ZJ0A 1R3NA 3SI0A 5I0CA 1TKFA 3FB3A 3FXTA 1PYTB 2R98A 2BO9A 4EFDA 4P4EA 2B4JC 4X3RA 4QBJA 1I1DA 2PJ6A 3FH4A 5EC4A 4BBHA 4JYWA 4IUSA 1LFWA 2ABZA 3DR8A 5J1QA 5LYDA 2WYRA 4DYOA 2D0PA 1ZG8A 4COBA 3HPGG 2G9DA 2IQ6A 2Z3LA 3FYNA 5F49A 3TO9A 3V38A 3PFVA 2Y1MA 5IV0A 2R8VA 4PSWA 3QAYA 1Y7EA 5D29A 1F57A 2PR1A 2Q44A 2REFA 5AG5A 1CM0A 3VRRA 2X7BA 3TOBA 3R1KA 3KQXA 1M4IA 2AFUA 2B3VA 4EVYA 2J9AA 4OMEA 1ZG9A 3EXNA 3MGDA 4DUKA 4FAIA 4C9VA 5LYFA 1BLLE 3VRQA 4A4BA 1MJBA 4MFKA 4UWJA 2EK8A 3LODA 2PSWA 4KLWA 5LRGA 5HKWA 3P2HA 4G1PA 4F6AA 4EYSA 4MI1A 4C9EA 1UWYA 5FVJA 4CDKA 3KGQA 2B5GA 2PJCA 4FBEA 4ZI6A 2I79A 1M6VB 2CNSA 3VTAA 4FWUA 4DNCA 3FEEA 1IY7A 4KOXA 2DPSA 1FNOA 1IIDA 4OIDA 4INJA 3QB8A 2P0WA 4B10A 3NOJA 1VI4A 1OZPA 3NH4A 4YN3A 1MJAA 1YR0A 3NH5A 4I49A 4CPAA 2GU2A 1Z2LA 3H8FA 5AG6A 1ZLIA 2AUMA 1NBWA 1Z8TA 2XPLA 5HMNA 5JPHA 5K8MA 2ZOFA 4JXRA 3S9MA 4A2ZA 2OH1A 4IHMA 3PT1A 3TLCA 1R57A 2ZEEA 4F0YA 4OADA 4A39A 2UV8G 2PR8A 3D7HA 4P6YA 1EE3P 1HDUA 2GANA 1Y9KA 2VZYA 2Y0MA 1YVKA 1DE4C 2WSAA 1ELLP 1TKHA 3U1BA 4E0AA 1IB1E 4OC3A 1YVOA 1XRYA 2QMLA 3D67A 3G8WA 2HC9A 4KSAA 3S6KA 1CBXA 1PCAA 2I00A 3TLBA 1TF8A 4OC4A 1YSJA 1TIQA 2FL4A 3SJFA 4A4CA 1YLEA 1Q7LA 2B58A 4YRHA 4GPLB 1KUXA 2VKZG 2CNMA 3DLJA 1CP6A 5G1ZA 4CGLA 4PXEA 1T36B 4E94A 1ZYMA 3KQZA 2C6PA 1XBUA 2GLFA 4RS2A 4AVBA 4LQGA 3K9UA 3B35A 1IOIA 2DLAA 4L8AA 2NSMA 4ONWA 4MJ8A 2FIAA 3B8GA 3OP0A 3VRNA 2PJ7A 3S6GA 3UY5A 5CBMA 4C8CA 2FCKA 2B0AA 4EWTA 4R57A 1VKCA 1QSRA 3O8ZA 1Z8WA 4AXVA 1ZRSA 1Y0RA 3OB1B 4C7IA 1DIKA 4IIYA 4B14A 2PJ5A 4UEEA 2V8VA 2PCUA 4E2AA 3BHXA 1S7FA 3S6FA 1S5KA 4OIWA 2BOAA 2Q43A 2AFOA 2AFZA 4CYQA 3I1UA 2QVPA 3PFEA 2CY2A 2FT0A 4ONUA 2C6CA 4BPXB 1FBVA 1DTDA 1Z4EA 4F9UA 3F9KC 1GHEA 1M44A 2GLJA 4U9ZA 1EZAA 4KOSA 5HKYA 4F9VA 1M4LA 1MJ9A 1QSTA 5IB0A 3BUNB 3WC5A 1TXRA 3BLNA 2REEA 2ZEPA 4R8FA 4MHDA 3FJUA 3S6HA 4BMHA 4TJXA 2J8MA 1NMTA 3IO1A 2VBQA 2EVNA 3B3SA 4Q36A 3VWEA 2ZELA 4OKOA 3W6XA 4B12A 2R82A 4ZX9A 3K4IA 2FS5A 2DF5A 2PIZA 2ZEMA 4C9AA 1CPSA 3EFAA 4OC5A 2Q4YA 2QYVA 1S3ZA 3FVLA 4MCQA 4F0XA 3ISZA 1YGHA 2AFXA 4BTFA 2CNTA 4OC0A 3N7ZA 4UCPA 4CAEA 2EZCA 4Q38A 6CPAA 3TFYA 1QSNA 4MCPA 1YREA 3KHZA 1XF1A 3PBBA 2YNCA 5I4MA 5ISVA 3KI9A 2C6GA 2EK9A 3ZNIA 4KSFA 4O23A 4COGA 3WR7A 4AG9A 2I3CA 2P6GA 4B13A 4NEXA 4XPDC 3OWCA 4CAVA 1GYTA 2YNDA 4UCMA 2PVVA 1Y9WA 4UFXA 2ZEOA 3T90A 1CP7A 3H8EA 2F8HA 2PRBA 1HEEA 4P4IA 4W9YA 2PE3A 3B3TA 2Z10A 3R9EA 1RXTA 5IX3A 3FF3A 4C8UA 1XMBA 2ZEGA 4JXQA 1XOVA 5F13A 4C84A 1YW6A 3GLJA 3B3VA 3P2FA 4GM5A 3D8PA 2V8DA 5IR2A 2Q04A 3I9SA 3SXOA 4OAEA 5DS0A 5HVHA 2Q7BA 4MHZA 3GUXA 7CPAA 2JEVA 1ZLHA 2P6EA 3WC7A 3D2PA 4ZY0A 2PJAA 4Q7AA 4F8ZA 3TLZA 3R9GA 2IMOA 4X5KA 3QNVA 3IWEA 2Y1NA 4ZGYB 1CE8B 1YX0A 3IWWA 4FD4A 1B47A
chains in the Genus database with same CATH topology
1Z5RA 4P4FA 4UEZA 4UIBA 8CPAA 4WWVA 3BI1A 4PPZA 4OC1A 1JQGA 2PJ2A 2AFMA 4MXUA 4ZYQA 3CPAA 3KL9A 4P44A 3PB6X 3SJEA 1TKJA 3D7DA 3SJGA 3KZWA 2F7VA 4A94A 3NH8A 4Z65A 3IC1A 3RZAA 2JBKA 3KASA 3HLPA 3ISXA 3PB9X 1LAPA 1YMEA 1ZG7A 2CTCA 3RBUA 3D68A 2GREA 3PB7X 4NGMA 4P4BA 4RUHA 3VH9A 3IFEA 2PJ8A 4TJVA 3B7IA 4R7MA 5JH9A 3IIBA 3PB4X 2EWBA 2QJ8A 3B2YA 2CF4A 2IJZA 1VIXA 2ZEFA 2GP4A 3CPXA 1Z8LA 5JGFA 3T8WA 1AMPA 4OC2A 2CIJA 1H8LA 1XFOA 4BD9A 2WZNA 2ZENA 4IAVA 3BI0A 2AFSA 4A38A 3FMCA 3ICUA 2VL1A 4TWEA 1OBRA 2XEJA 5D8NA 1CG2A 3B3CA 2C1CA 3K2KA 4X8IA 4MMOA 3FEDA 3VARA 2OOTA 4EMEA 1LAMA 4TNUA 4C8TA 3TX8A 1VHEA 2O4HA 3D7FA 5K8OA 4A37A 2RB7A 2POKA 4JZ0A 4C8FA 3V7ZA 1YW4A 3MN8A 3LMSA 1LCPA 2XEGA 3CDXA 1BPNA 5HVGA 4C8AA 4MHNA 3SJXA 3SI1A 4FUUA 3S9NA 1VGYA 2DEAA 1ELMP 4UEFA 5K8NA 2PIYA 2ZOGA 4P45A 3NFZA 5LYIA 2ZEDA 3PBEA 3DGVA 3I6SA 4PXDA 5F09A 3B3WA 4PXCA 2OR4A 2PJBA 1HDQA 4OP4A 3CT9A 1VHOA 5JM6A 1NSAA 2V8GA 4C9UA 4UIAA 1ARMA 3FECA 3H8GA 4ZX8A 3VATA 4IK2A 3WC6A 1Y0YA 4NJQA 4MHYA 2XEIA 1QQ9A 3GB0A 5THWA 5LRKA 2JBJA 1QMUA 3PFOA 5HVFA 3EIFA 4NGQA 4P10A 4ZY2A 4DJLA 1F2PA 2PVWA 2PJ3A 3HUVA 3NA6A 1F2OA 1RTQA 1WVMA 4MCRA 1ARLA 3JRUA 4YWYA 4NGTA 4C99A 2Q4ZA 3IJ3A 2CTBA 3WT4A 4NJRA 4X2TA 2PJ0A 4WJBA 1FT7A 5HXDA 4C86A 1TF9A 4C9RA 1AYEA 4K3NA 1V6CA 4R76A 5CPAA 3LWUA 2ANPA 4R6TA 2V8HA 3IEHA 4B6ZA 2ZEHA 4MHPA 2RFHA 1Y9ZA 5ELYA 1LANA 3KHXA 4H2KA 3TC8A 3BXMA 2PJ1A 4PXBA 1LOKA 1KWMA 1R43A 2V77A 3PRTA 1XJOA 4MRIA 3KR4A 4C8PA 2C5QA 4NGPA 2PJ4A 2HB6A 4ZY1A 4KNGE 4YU9A 2XEFA 5K8PA 2NYQA 4MCSA 4CDJA 2AFWA 3K9TA 4P4JA 4C85A 3D7GA 3L2NA 2O53A 5LYLA 2Q51A 3MRUA 1YLOA 1CPXA 4UF4A 1CX8A 3PB8X 4PQAA 4NFRA 3PEIA 3D66A 4NGRA 3SI2A 1BAVA 3FX6A 2JEWA 3RAMA 1BPMA 1IGBA 2BCOA 4KSIA 2FVGA 5IB9A 2PRQA 3S9LA 4NGNA 3I74A 3KR5A 3D4UA 4P4DA 5LRJA 3N5FA 2PJ9A 4NGSA 1R3NA 3SI0A 1TKFA 1PYTB 2BO9A 4EFDA 4P4EA 4X3RA 2PJ6A 3FH4A 4JYWA 1LFWA 2ABZA 5J1QA 5LYDA 2WYRA 4DYOA 1ZG8A 2G9DA 2IQ6A 3V38A 1Y7EA 5D29A 1F57A 3KQXA 2AFUA 2J9AA 4OMEA 1ZG9A 4DUKA 4FAIA 4C9VA 5LYFA 1BLLE 2EK8A 5LRGA 4G1PA 4C9EA 1UWYA 4CDKA 3KGQA 2PJCA 4FBEA 4ZI6A 3VTAA 4FWUA 3FEEA 1IY7A 4OIDA 1FNOA 3NH4A 4YN3A 3NH5A 4CPAA 2GU2A 1Z2LA 3H8FA 1ZLIA 5K8MA 2ZOFA 3S9MA 4IHMA 2ZEEA 4A39A 3D7HA 4P6YA 1EE3P 1HDUA 1DE4C 1ELLP 1TKHA 4OC3A 3D67A 1XRYA 2HC9A 1CBXA 1PCAA 1TF8A 4OC4A 1YSJA 3SJFA 1Q7LA 3WABA 3DLJA 1CP6A 4PXEA 3KQZA 2C6PA 1XBUA 2GLFA 4LQGA 3B35A 4ONWA 2NSMA 2PJ7A 4C8CA 5CBMA 4EWTA 4AXVA 1Y0RA 2PJ5A 4UEEA 2V8VA 2PCUA 3BHXA 4OIWA 2BOAA 2Q43A 2AFOA 2AFZA 3I1UA 2QVPA 3PFEA 2C6CA 1DTDA 4F9UA 2GLJA 4F9VA 1M4LA 3WC5A 1TXRA 2ZEPA 4R8FA 3FJUA 4TJXA 3IO1A 3B3SA 2ZELA 4OKOA 4ZX9A 2PIZA 2ZEMA 4C9AA 1CPSA 4OC5A 2QYVA 3FVLA 4MCQA 3ISZA 2AFXA 4OC0A 6CPAA 4MCPA 3KHZA 1XF1A 3PBBA 5I4MA 3KI9A 2C6GA 2EK9A 4O23A 2I3CA 1GYTA 2PVVA 2ZEOA 3H8EA 1CP7A 2F8HA 1HEEA 4P4IA 4W9YA 2PE3A 3B3TA 4C8UA 3FF3A 1XMBA 2ZEGA 4C84A 1YW6A 3GLJA 3B3VA 4GM5A 5IR2A 2V8DA 5HVHA 5DS0A 4MHZA 3GUXA 7CPAA 1ZLHA 3WC7A 4ZY0A 2PJAA 4Q7AA 4F8ZA 2IMOA 3QNVA 3IWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5R A;  4P4F A;  4UEZ A;  4UIB A;  8CPA A;  4WWV A;  3BI1 A;  4PPZ A;  4OC1 A;  1JQG A;  2PJ2 A;  2AFM A;  4MXU A;  4ZYQ A;  3CPA A;  3KL9 A;  4P44 A;  3PB6 X;  3SJE A;  1TKJ A;  3D7D A;  3SJG A;  3KZW A;  2F7V A;  4A94 A;  3NH8 A;  4Z65 A;  3IC1 A;  3RZA A;  2JBK A;  3KAS A;  3HLP A;  3ISX A;  3PB9 X;  1LAP A;  1YME A;  1ZG7 A;  2CTC A;  3RBU A;  3D68 A;  2GRE A;  3PB7 X;  4NGM A;  4P4B A;  4RUH A;  3VH9 A;  3IFE A;  2PJ8 A;  4TJV A;  3B7I A;  4R7M A;  5JH9 A;  3IIB A;  3PB4 X;  2EWB A;  2QJ8 A;  3B2Y A;  2CF4 A;  2IJZ A;  1VIX A;  2ZEF A;  3CPX A;  1Z8L A;  5JGF A;  3T8W A;  1AMP A;  4OC2 A;  2CIJ A;  1H8L A;  1XFO A;  4BD9 A;  2WZN A;  2ZEN A;  4IAV A;  3BI0 A;  2AFS A;  4A38 A;  3FMC A;  3ICU A;  2VL1 A;  4TWE A;  1OBR A;  2XEJ A;  5D8N A;  1CG2 A;  3B3C A;  2C1C A;  3K2K A;  4X8I A;  4MMO A;  3FED A;  3VAR A;  2OOT A;  4EME A;  1LAM A;  4TNU A;  4C8T A;  3TX8 A;  1VHE A;  2O4H A;  3D7F A;  5K8O A;  4A37 A;  2RB7 A;  2POK A;  4JZ0 A;  4C8F A;  3V7Z A;  1YW4 A;  3MN8 A;  3LMS A;  1LCP A;  2XEG A;  3CDX A;  1BPN A;  5HVG A;  4C8A A;  4MHN A;  3SJX A;  3SI1 A;  4FUU A;  3S9N A;  1VGY A;  2DEA A;  1ELM P;  4UEF A;  5K8N A;  2PIY A;  2ZOG A;  4P45 A;  3NFZ A;  5LYI A;  2ZED A;  3PBE A;  3DGV A;  3I6S A;  4PXD A;  5F09 A;  3B3W A;  4PXC A;  2OR4 A;  2PJB A;  1HDQ A;  4OP4 A;  3CT9 A;  1VHO A;  5JM6 A;  1NSA A;  2V8G A;  4C9U A;  4UIA A;  1ARM A;  3FEC A;  3H8G A;  4ZX8 A;  3VAT A;  4IK2 A;  3WC6 A;  1Y0Y A;  4NJQ A;  4MHY A;  2XEI A;  1QQ9 A;  3GB0 A;  5THW A;  5LRK A;  2JBJ A;  1QMU A;  3PFO A;  5HVF A;  3EIF A;  4NGQ A;  4P10 A;  4ZY2 A;  4DJL A;  1F2P A;  2PVW A;  2PJ3 A;  3HUV A;  3NA6 A;  1F2O A;  1RTQ A;  1WVM A;  4MCR A;  1ARL A;  3JRU A;  4YWY A;  4NGT A;  4C99 A;  2Q4Z A;  3IJ3 A;  2CTB A;  3WT4 A;  4NJR A;  4X2T A;  2PJ0 A;  4WJB A;  1FT7 A;  5HXD A;  4C86 A;  1TF9 A;  4C9R A;  1AYE A;  4K3N A;  1V6C A;  4R76 A;  5CPA A;  3LWU A;  2ANP A;  4R6T A;  2V8H A;  3IEH A;  4B6Z A;  2ZEH A;  4MHP A;  2RFH A;  1Y9Z A;  5ELY A;  1LAN A;  3KHX A;  4H2K A;  3TC8 A;  3BXM A;  2PJ1 A;  4PXB A;  1LOK A;  1KWM A;  1R43 A;  2V77 A;  3PRT A;  1XJO A;  4MRI A;  3KR4 A;  4C8P A;  4NGP A;  2PJ4 A;  2HB6 A;  4ZY1 A;  4KNG E;  4YU9 A;  2XEF A;  5K8P A;  2NYQ A;  4MCS A;  4CDJ A;  2AFW A;  3K9T A;  4P4J A;  4C85 A;  3D7G A;  3L2N A;  2O53 A;  5LYL A;  2Q51 A;  3MRU A;  1YLO A;  1CPX A;  4UF4 A;  1CX8 A;  3PB8 X;  4PQA A;  4NFR A;  3PEI A;  3D66 A;  4NGR A;  3SI2 A;  1BAV A;  3FX6 A;  2JEW A;  3RAM A;  1BPM A;  1IGB A;  2BCO A;  4KSI A;  2FVG A;  5IB9 A;  2PRQ A;  3S9L A;  4NGN A;  3I74 A;  3KR5 A;  3D4U A;  4P4D A;  5LRJ A;  3N5F A;  2PJ9 A;  4NGS A;  1R3N A;  3SI0 A;  1TKF A;  1PYT B;  2BO9 A;  4EFD A;  4P4E A;  4X3R A;  2PJ6 A;  3FH4 A;  4JYW A;  1LFW A;  2ABZ A;  5J1Q A;  5LYD A;  2WYR A;  4DYO A;  1ZG8 A;  2G9D A;  2IQ6 A;  3V38 A;  1Y7E A;  5D29 A;  1F57 A;  3KQX A;  2AFU A;  2J9A A;  4OME A;  1ZG9 A;  4DUK A;  4FAI A;  4C9V A;  5LYF A;  1BLL E;  2EK8 A;  5LRG A;  4G1P A;  4C9E A;  1UWY A;  4CDK A;  3KGQ A;  2PJC A;  4FBE A;  4ZI6 A;  3VTA A;  4FWU A;  3FEE A;  1IY7 A;  4OID A;  1FNO A;  3NH4 A;  4YN3 A;  3NH5 A;  4CPA A;  2GU2 A;  1Z2L A;  3H8F A;  1ZLI A;  5K8M A;  2ZOF A;  3S9M A;  4IHM A;  2ZEE A;  4A39 A;  3D7H A;  4P6Y A;  1EE3 P;  1HDU A;  1DE4 C;  1ELL P;  1TKH A;  4OC3 A;  3D67 A;  1XRY A;  2HC9 A;  1CBX A;  1PCA A;  1TF8 A;  4OC4 A;  1YSJ A;  3SJF A;  1Q7L A;  3WAB A;  3DLJ A;  1CP6 A;  4PXE A;  3KQZ A;  2C6P A;  1XBU A;  2GLF A;  4LQG A;  3B35 A;  4ONW A;  2NSM A;  2PJ7 A;  4C8C A;  5CBM A;  4EWT A;  4AXV A;  1Y0R A;  2PJ5 A;  4UEE A;  2V8V A;  2PCU A;  3BHX A;  4OIW A;  2BOA A;  2Q43 A;  2AFO A;  2AFZ A;  3I1U A;  2QVP A;  3PFE A;  2C6C A;  1DTD A;  4F9U A;  2GLJ A;  4F9V A;  1M4L A;  3WC5 A;  1TXR A;  2ZEP A;  4R8F A;  3FJU A;  4TJX A;  3IO1 A;  3B3S A;  2ZEL A;  4OKO A;  4ZX9 A;  2PIZ A;  2ZEM A;  4C9A A;  1CPS A;  4OC5 A;  2QYV A;  3FVL A;  4MCQ A;  3ISZ A;  2AFX A;  4OC0 A;  6CPA A;  4MCP A;  3KHZ A;  1XF1 A;  3PBB A;  5I4M A;  3KI9 A;  2C6G A;  2EK9 A;  4O23 A;  2I3C A;  1GYT A;  2PVV A;  2ZEO A;  3H8E A;  1CP7 A;  2F8H A;  1HEE A;  4P4I A;  4W9Y A;  2PE3 A;  3B3T A;  4C8U A;  3FF3 A;  1XMB A;  2ZEG A;  4C84 A;  1YW6 A;  3GLJ A;  3B3V A;  4GM5 A;  2V8D A;  5HVH A;  5DS0 A;  4MHZ A;  3GUX A;  7CPA A;  1ZLH A;  3WC7 A;  4ZY0 A;  2PJA A;  4Q7A A;  4F8Z A;  2IMO A;  3QNV A;  3IWW A; 
#chains in the Genus database with same CATH topology
 1KZF A;  4KOV A;  3OB2 B;  1Z5R A;  4P4F A;  4UEZ A;  5J8C A;  4UIB A;  2GIV A;  4MBU A;  4C2Z A;  1IU8 A;  3T9Y A;  1KBL A;  2B5G B;  2FSR A;  3SXN A;  8CPA A;  4WWV A;  2YNC C;  4A31 A;  4A30 A;  3NE8 A;  3HPH E;  2BUE A;  3BI1 A;  2EO8 A;  4OC1 A;  4PPZ A;  4NSQ A;  5EMI A;  1JQG A;  2PJ2 A;  2VZZ A;  2AFM A;  4Y49 C;  3VRO A;  3NFQ A;  1IOF A;  1P4N A;  2F5I A;  4MXU A;  1XIX A;  3CPA A;  4CGP A;  4ZYQ A;  2HV2 A;  3KL9 A;  3LAC A;  4P44 A;  4KZT A;  2P6F A;  2Z11 A;  4NXY A;  1JDE A;  5AXI A;  3GKR A;  3SJE A;  3PB6 X;  1TKJ A;  3D7D A;  3SJG A;  3KZW A;  2F7V A;  1L0C A;  4A94 A;  1VBG A;  1Q2C A;  2WUU A;  3NH8 A;  4UBR A;  4Z65 A;  3PZJ A;  1S7L A;  4R3L A;  3TLG B;  3PLF B;  1VHS A;  5FD8 A;  3IC1 A;  1J4J A;  2PDO A;  3RZA A;  2JBK A;  3KAS A;  3HLP A;  3ISX A;  3PB9 X;  1LAP A;  1YME A;  1ZG7 A;  4YGO A;  2PC1 A;  2CTC A;  2R7H A;  4B5P B;  3BUO B;  1M4G A;  3TLE A;  5F46 A;  2XPP A;  2CXA A;  1IIC A;  1I12 A;  3TE4 A;  3RBU A;  3D68 A;  5C88 A;  4C2Y A;  4CYP A;  2QIR A;  4PK3 A;  2GRE A;  3PB7 X;  4NGM A;  4P4B A;  5KTA A;  4RUH A;  1S7K A;  4M6G A;  5CNP A;  4KVX A;  4NCZ A;  3IFE A;  2GE3 A;  3A9L A;  2PJ8 A;  3VH9 A;  2E28 A;  4TJV A;  3T05 A;  3B7I A;  5H86 A;  3R95 A;  4R9M A;  2IL4 A;  4R7M A;  4FD7 A;  2B4D A;  4LX9 A;  5AG7 A;  4MFZ A;  5JH9 A;  4KOT A;  3IIB A;  5KTD A;  2G3A A;  2EWB A;  2QJ8 A;  1CJW A;  3PB4 X;  2Q4V A;  5AGE A;  3R96 A;  3B2Y A;  1S60 A;  4CGM A;  2PQ8 A;  4KOY A;  2Q0Y A;  2VXK A;  1CS0 B;  4U5Y A;  4UFV A;  2VEZ A;  2CF4 A;  2WPX A;  5F5X A;  3E0K A;  1M1D A;  2MP0 A;  4XPD B;  1A2Z A;  2CBL A;  2IJZ A;  1X10 A;  1VIX A;  4LQ6 A;  1XE4 A;  2ZEF A;  3PGP A;  2GP4 A;  2ZW6 A;  4KOW A;  3CPX A;  4QB9 A;  1ZL0 A;  1Z8L A;  2YNE A;  4PSX A;  2OLS A;  5JGF A;  4XNH B;  3T8W A;  4M8D A;  2C27 A;  4M3S A;  1AMP A;  4OC2 A;  3CXP A;  2CIJ A;  1V0C A;  3EY5 A;  1H8L A;  4KVM E;  5DWN A;  1XFO A;  4KUA A;  2JLM A;  3GY9 A;  4M85 A;  2WZN A;  3TCV A;  4BD9 A;  1BOB A;  4CAF A;  2K5T A;  3EZB A;  2N3A B;  1XEB A;  2ZEN A;  1Q2D A;  3VWD A;  3NE7 A;  4IAV A;  4UCN A;  3BI0 A;  2BSW A;  3VRP A;  5F48 A;  5DWM A;  2AFS A;  2ODF A;  4A38 A;  4FD5 A;  1VBH A;  1Q2Y A;  2JDD A;  4CAX A;  5G20 A;  3FMC A;  3IWG A;  3ICU A;  4MY0 A;  2VL1 A;  3FRM A;  4TWE A;  5JQ4 A;  2X0S A;  3EZE A;  1OBR A;  5G22 A;  5F47 A;  4CYN A;  2XEJ A;  4LUA A;  3CXS A;  2RC4 A;  1CG2 A;  5D8N A;  3B3C A;  2C1C A;  5F1Y A;  1AUG A;  3K2K A;  4X8I A;  4JVO A;  4IIX A;  1KC7 A;  4MMO A;  3FED A;  5JYB A;  4Y49 B;  4UFW A;  1K4J A;  2R1I A;  3DNS A;  3VAR A;  2OOT A;  4AVC A;  3C26 A;  4MY3 A;  4EME A;  1IYK A;  2G3T A;  4E5S A;  1LAM A;  2EUI A;  2J8N A;  3D3S A;  4CGN A;  1Z9U A;  3T5M A;  4TNU A;  4ZBG A;  1KEE B;  3TX8 A;  1VHE A;  4C8T A;  4KOR A;  2O4H A;  4KOU A;  3D7F A;  5K8O A;  4A37 A;  4H89 A;  3BUX B;  2RB7 A;  3V8I A;  4KLV A;  2POK A;  4A32 A;  3BUW B;  4MJX A;  2G0B A;  3HMJ G;  4JZ0 A;  2FE7 A;  4GS4 A;  4C8F A;  3V7Z A;  1YW4 A;  3MN8 A;  3LMS A;  3BJ8 A;  3EC4 A;  1LCP A;  2XEG A;  3CDX A;  3KRV A;  2ZW7 A;  2Z3M A;  1BPN A;  4NF1 A;  5HVG A;  1EO0 A;  4BPW B;  3W6S A;  2OU2 A;  4MFQ A;  1JWQ A;  2BL1 A;  1Z4R A;  4MFP A;  4MHN A;  3G3S A;  4C8A A;  3SJX A;  2Z3P A;  4JLY A;  3SI1 A;  4C68 A;  5A28 A;  1NSL A;  1ZO0 A;  4FUU A;  3S9N A;  2BEI A;  4C7H A;  1GGO A;  1VGY A;  2DEA A;  3TO7 A;  4HNX B;  1ELM P;  4UEF A;  5K8N A;  2YJT A;  4PV6 A;  5KTC A;  2HQY A;  2FXF A;  2OZU A;  2PIY A;  3IGR A;  5EBV A;  2ZOG A;  4P45 A;  3NFZ A;  5LYI A;  1C30 B;  2ZED A;  3PBE A;  4YFJ A;  3DGV A;  3F0A A;  4U9Y A;  3I6S A;  4JD6 A;  1QSM A;  3EO4 A;  3JTK A;  1WJT A;  4HNY B;  4PXD A;  1IYL A;  5F09 A;  2VQY A;  3CXQ A;  1R61 A;  2VI7 A;  3B3W A;  4PXC A;  2OR4 A;  3DSB A;  2PJB A;  4ORF A;  1HDQ A;  4OP4 A;  1EZB A;  2YGW A;  1P0H A;  1VHO A;  3CT9 A;  4H6Z A;  2Z3O A;  4HKF A;  1Z9E A;  5JM6 A;  1NSA A;  2V8G A;  4C9U A;  4HPS A;  4M6H A;  4UIA A;  3D2M A;  1ARM A;  3FNC A;  3FEC A;  3H8G A;  4KVO E;  3R9F A;  4ZX8 A;  3C8O A;  3VAT A;  4A95 A;  3GIU A;  4IK2 A;  4CGO A;  4XPK A;  3WC6 A;  4E8O A;  4MFL A;  1Y0Y A;  3TLY A;  1YQE A;  4NJQ A;  4XPL A;  1Z8X A;  5HH1 A;  4MHY A;  4CS0 B;  4DJL A;  1C3O B;  2XEI A;  1B6B A;  4JJX A;  1NXJ A;  1QQ9 A;  5A27 A;  2B4D B;  2FIW A;  3GB0 A;  5THW A;  1YK3 A;  3T07 A;  5LRK A;  4QUS A;  2JBJ A;  1QMU A;  2ZPA A;  3RO0 A;  4PK2 A;  3PFO A;  4R3K A;  5HVF A;  3EIF A;  4J0N A;  4NGQ A;  4P10 A;  5G21 A;  1FY7 A;  1RO5 A;  4HNW B;  1F2P A;  2PVW A;  2PJ3 A;  3JUW A;  5E96 A;  4ZY2 A;  3HUV A;  1X12 A;  3NA6 A;  1F2O A;  1RTQ A;  1WVM A;  4MCR A;  3SR3 A;  2OB0 A;  1ARL A;  3JRU A;  1B87 A;  4BPU B;  4RN7 A;  4YWY A;  4NGT A;  2ZW5 A;  4C99 A;  3TT2 A;  1Q5X A;  2Q4Z A;  3IJ3 A;  2CTB A;  4MI4 A;  3SHP A;  3WT4 A;  5J3X A;  4NJR A;  5BY0 A;  4RI1 A;  3BUM B;  4C2X A;  2FM4 A;  4B11 A;  1LRZ A;  4X2T A;  2PJ0 A;  1S7N A;  1XMT A;  5AG4 A;  3FBU A;  2WPW A;  3QAH A;  4WJB A;  1M4D A;  5GCN A;  3WAB A;  4H6U A;  1FT7 A;  1KUV A;  1Y7R A;  5HXD A;  3TO6 A;  4C86 A;  1TF9 A;  4C9R A;  1AYE A;  3VGO A;  3TLG A;  4K3N A;  3IU1 A;  1V6C A;  5BWA B;  2OZG A;  4R76 A;  2XPN A;  4B5P A;  3RYO A;  5H84 A;  4L89 A;  2YJV A;  5CPA A;  2A4N A;  3LWU A;  2ANP A;  4R6T A;  2V8H A;  3IEH A;  4UWI A;  2AE6 A;  3OAK A;  2Z3K A;  2ZEH A;  4B6Z A;  5F9M A;  1N71 A;  1PUA A;  1ON0 A;  2EZA A;  4MHP A;  2RFH A;  1Y9Z A;  5ELY A;  2QEC A;  1KUY A;  1LAN A;  3TLA A;  3KHX A;  2AUN A;  4H2K A;  3LD2 A;  3RNZ A;  3BXM A;  2PJ1 A;  4PXB A;  3TC8 A;  1WK4 A;  2O28 A;  4KUB A;  3GYA A;  4B5O A;  1BXR B;  1LOK A;  2NMT A;  2DXQ A;  2Q7S A;  3DDD A;  3I3G A;  1KWM A;  1R43 A;  2V77 A;  3PRT A;  2HRO A;  4J3G A;  2DIK A;  1XJO A;  2KCW A;  4MRI A;  2J8R A;  2GFQ A;  3IU2 A;  1I21 A;  3KR4 A;  4C8P A;  1SQH A;  3W91 A;  3TTH A;  4NGP A;  4CRY B;  2B4B A;  2C5Q A;  3H5Z A;  2JDC A;  1U6M A;  2H5M A;  3TYX A;  2PJ4 A;  2HB6 A;  4ZY1 A;  4KNG E;  2EBJ A;  4YU9 A;  4OLL A;  2XEF A;  5K8P A;  2B3U A;  2NYQ A;  4MCS A;  5HKZ A;  4KS9 A;  4CYO A;  4CDJ A;  4BIN A;  2PCN A;  4MFJ A;  2AFW A;  5C82 A;  2OZH A;  4QC6 A;  4M6I A;  2ZXV A;  3K9T A;  4P4J A;  3KKW A;  2XPO A;  2ZW4 A;  3U88 C;  4C85 A;  1YVH A;  4AG7 A;  3D7G A;  4JWP A;  4II9 A;  3L2N A;  3PP9 A;  3G23 A;  2O53 A;  4R87 A;  5LYL A;  1JDB C;  2Q51 A;  4IF5 A;  2AJ6 A;  3F5B A;  3MRU A;  2ATR A;  1YLO A;  2HWG A;  1CPX A;  3GJZ A;  1PU9 A;  2DPT A;  4UF4 A;  4A33 A;  3H4Q A;  1CX8 A;  1QSO A;  3F8K A;  3PB8 X;  4PQA A;  4NFR A;  3DR6 A;  4CZ1 A;  1NE9 A;  4AB7 A;  1BO4 A;  3PEI A;  4CO9 A;  2D4P A;  3D66 A;  4CAW A;  5J8F A;  5JVL A;  4NGR A;  1A9X B;  3EZA A;  3SI2 A;  3JVN A;  4AVA A;  1BAV A;  3FX6 A;  3BJ7 A;  2JEW A;  4CRZ B;  3RAM A;  1BPM A;  1IGB A;  2ARH A;  2BCO A;  4KSI A;  2HUZ A;  2EZB A;  4FD6 A;  2FVG A;  4GXH A;  1J3L A;  2D0O A;  3TOA A;  2HI6 A;  5K99 A;  4QVT A;  5IB9 A;  3CZX A;  3FIX A;  2PRQ A;  3S9L A;  1MK4 A;  4NGN A;  4UA3 A;  2Z3N A;  3I74 A;  1XF8 A;  4H1H A;  3KR5 A;  1UFH A;  3D4U A;  2Z0Z A;  4XNH C;  4P4D A;  5LRJ A;  1WWZ A;  4RR2 B;  3T0T A;  4K30 A;  3N5F A;  2PJ9 A;  2D4O A;  3ZZI A;  4NGS A;  3ZJ0 A;  1R3N A;  3SI0 A;  5I0C A;  1TKF A;  3FB3 A;  3FXT A;  1PYT B;  2R98 A;  2BO9 A;  4EFD A;  4P4E A;  2B4J C;  4X3R A;  4QBJ A;  1I1D A;  2PJ6 A;  3FH4 A;  5EC4 A;  4BBH A;  4JYW A;  4IUS A;  1LFW A;  2ABZ A;  3DR8 A;  5J1Q A;  5LYD A;  2WYR A;  4DYO A;  2D0P A;  1ZG8 A;  4COB A;  3HPG G;  2G9D A;  2IQ6 A;  2Z3L A;  3FYN A;  5F49 A;  3TO9 A;  3V38 A;  3PFV A;  2Y1M A;  5IV0 A;  2R8V A;  4PSW A;  3QAY A;  1Y7E A;  5D29 A;  1F57 A;  2PR1 A;  2Q44 A;  2REF A;  5AG5 A;  1CM0 A;  3VRR A;  2X7B A;  3TOB A;  3R1K A;  3KQX A;  1M4I A;  2AFU A;  2B3V A;  4EVY A;  2J9A A;  4OME A;  1ZG9 A;  3EXN A;  3MGD A;  4DUK A;  4FAI A;  4C9V A;  5LYF A;  1BLL E;  3VRQ A;  4A4B A;  1MJB A;  4MFK A;  4UWJ A;  2EK8 A;  3LOD A;  2PSW A;  4KLW A;  5LRG A;  5HKW A;  3P2H A;  4G1P A;  4F6A A;  4EYS A;  4MI1 A;  4C9E A;  1UWY A;  5FVJ A;  4CDK A;  3KGQ A;  2B5G A;  2PJC A;  4FBE A;  4ZI6 A;  2I79 A;  1M6V B;  2CNS A;  3VTA A;  4FWU A;  4DNC A;  3FEE A;  1IY7 A;  4KOX A;  2DPS A;  1FNO A;  1IID A;  4OID A;  4INJ A;  3QB8 A;  2P0W A;  4B10 A;  3NOJ A;  1VI4 A;  1OZP A;  3NH4 A;  4YN3 A;  1MJA A;  1YR0 A;  3NH5 A;  4I49 A;  4CPA A;  2GU2 A;  1Z2L A;  3H8F A;  5AG6 A;  1ZLI A;  2AUM A;  1NBW A;  1Z8T A;  2XPL A;  5HMN A;  5JPH A;  5K8M A;  2ZOF A;  4JXR A;  3S9M A;  4A2Z A;  2OH1 A;  4IHM A;  3PT1 A;  3TLC A;  1R57 A;  2ZEE A;  4F0Y A;  4OAD A;  4A39 A;  2UV8 G;  2PR8 A;  3D7H A;  4P6Y A;  1EE3 P;  1HDU A;  2GAN A;  1Y9K A;  2VZY A;  2Y0M A;  1YVK A;  1DE4 C;  2WSA A;  1ELL P;  1TKH A;  3U1B A;  4E0A A;  1IB1 E;  4OC3 A;  1YVO A;  1XRY A;  2QML A;  3D67 A;  3G8W A;  2HC9 A;  4KSA A;  3S6K A;  1CBX A;  1PCA A;  2I00 A;  3TLB A;  1TF8 A;  4OC4 A;  1YSJ A;  1TIQ A;  2FL4 A;  3SJF A;  4A4C A;  1YLE A;  1Q7L A;  2B58 A;  4YRH A;  4GPL B;  1KUX A;  2VKZ G;  2CNM A;  3DLJ A;  1CP6 A;  5G1Z A;  4CGL A;  4PXE A;  1T36 B;  4E94 A;  1ZYM A;  3KQZ A;  2C6P A;  1XBU A;  2GLF A;  4RS2 A;  4AVB A;  4LQG A;  3K9U A;  3B35 A;  1IOI A;  2DLA A;  4L8A A;  2NSM A;  4ONW A;  4MJ8 A;  2FIA A;  3B8G A;  3OP0 A;  3VRN A;  2PJ7 A;  3S6G A;  3UY5 A;  5CBM A;  4C8C A;  2FCK A;  2B0A A;  4EWT A;  4R57 A;  1VKC A;  1QSR A;  3O8Z A;  1Z8W A;  4AXV A;  1ZRS A;  1Y0R A;  3OB1 B;  4C7I A;  1DIK A;  4IIY A;  4B14 A;  2PJ5 A;  4UEE A;  2V8V A;  2PCU A;  4E2A A;  3BHX A;  1S7F A;  3S6F A;  1S5K A;  4OIW A;  2BOA A;  2Q43 A;  2AFO A;  2AFZ A;  4CYQ A;  3I1U A;  2QVP A;  3PFE A;  2CY2 A;  2FT0 A;  4ONU A;  2C6C A;  4BPX B;  1FBV A;  1DTD A;  1Z4E A;  4F9U A;  3F9K C;  1GHE A;  1M44 A;  2GLJ A;  4U9Z A;  1EZA A;  4KOS A;  5HKY A;  4F9V A;  1M4L A;  1MJ9 A;  1QST A;  5IB0 A;  3BUN B;  3WC5 A;  1TXR A;  3BLN A;  2REE A;  2ZEP A;  4R8F A;  4MHD A;  3FJU A;  3S6H A;  4BMH A;  4TJX A;  2J8M A;  1NMT A;  3IO1 A;  2VBQ A;  2EVN A;  3B3S A;  4Q36 A;  3VWE A;  2ZEL A;  4OKO A;  3W6X A;  4B12 A;  2R82 A;  4ZX9 A;  3K4I A;  2FS5 A;  2DF5 A;  2PIZ A;  2ZEM A;  4C9A A;  1CPS A;  3EFA A;  4OC5 A;  2Q4Y A;  2QYV A;  1S3Z A;  3FVL A;  4MCQ A;  4F0X A;  3ISZ A;  1YGH A;  2AFX A;  4BTF A;  2CNT A;  4OC0 A;  3N7Z A;  4UCP A;  4CAE A;  2EZC A;  4Q38 A;  6CPA A;  3TFY A;  1QSN A;  4MCP A;  1YRE A;  3KHZ A;  1XF1 A;  3PBB A;  2YNC A;  5I4M A;  5ISV A;  3KI9 A;  2C6G A;  2EK9 A;  3ZNI A;  4KSF A;  4O23 A;  4COG A;  3WR7 A;  4AG9 A;  2I3C A;  2P6G A;  4B13 A;  4NEX A;  4XPD C;  3OWC A;  4CAV A;  1GYT A;  2YND A;  4UCM A;  2PVV A;  1Y9W A;  4UFX A;  2ZEO A;  3T90 A;  1CP7 A;  3H8E A;  2F8H A;  2PRB A;  1HEE A;  4P4I A;  4W9Y A;  2PE3 A;  3B3T A;  2Z10 A;  3R9E A;  1RXT A;  5IX3 A;  3FF3 A;  4C8U A;  1XMB A;  2ZEG A;  4JXQ A;  1XOV A;  5F13 A;  4C84 A;  1YW6 A;  3GLJ A;  3B3V A;  3P2F A;  4GM5 A;  3D8P A;  2V8D A;  5IR2 A;  2Q04 A;  3I9S A;  3SXO A;  4OAE A;  5DS0 A;  5HVH A;  2Q7B A;  4MHZ A;  3GUX A;  7CPA A;  2JEV A;  1ZLH A;  2P6E A;  3WC7 A;  3D2P A;  4ZY0 A;  2PJA A;  4Q7A A;  4F8Z A;  3TLZ A;  3R9G A;  2IMO A;  4X5K A;  3QNV A;  3IWE A;  2Y1N A;  4ZGY B;  1CE8 B;  1YX0 A;  3IWW A;  4FD4 A;  1B47 A; 
#chains in the Genus database with same CATH homology
 1Z5R A;  4P4F A;  4UEZ A;  4UIB A;  8CPA A;  4WWV A;  3BI1 A;  4PPZ A;  4OC1 A;  1JQG A;  2PJ2 A;  2AFM A;  4MXU A;  4ZYQ A;  3CPA A;  3KL9 A;  4P44 A;  3PB6 X;  3SJE A;  1TKJ A;  3D7D A;  3SJG A;  3KZW A;  2F7V A;  4A94 A;  3NH8 A;  4Z65 A;  3IC1 A;  3RZA A;  2JBK A;  3KAS A;  3HLP A;  3ISX A;  3PB9 X;  1LAP A;  1YME A;  1ZG7 A;  2CTC A;  3RBU A;  3D68 A;  2GRE A;  3PB7 X;  4NGM A;  4P4B A;  4RUH A;  3VH9 A;  3IFE A;  2PJ8 A;  4TJV A;  3B7I A;  4R7M A;  5JH9 A;  3IIB A;  3PB4 X;  2EWB A;  2QJ8 A;  3B2Y A;  2CF4 A;  2IJZ A;  1VIX A;  2ZEF A;  2GP4 A;  3CPX A;  1Z8L A;  5JGF A;  3T8W A;  1AMP A;  4OC2 A;  2CIJ A;  1H8L A;  1XFO A;  4BD9 A;  2WZN A;  2ZEN A;  4IAV A;  3BI0 A;  2AFS A;  4A38 A;  3FMC A;  3ICU A;  2VL1 A;  4TWE A;  1OBR A;  2XEJ A;  5D8N A;  1CG2 A;  3B3C A;  2C1C A;  3K2K A;  4X8I A;  4MMO A;  3FED A;  3VAR A;  2OOT A;  4EME A;  1LAM A;  4TNU A;  4C8T A;  3TX8 A;  1VHE A;  2O4H A;  3D7F A;  5K8O A;  4A37 A;  2RB7 A;  2POK A;  4JZ0 A;  4C8F A;  3V7Z A;  1YW4 A;  3MN8 A;  3LMS A;  1LCP A;  2XEG A;  3CDX A;  1BPN A;  5HVG A;  4C8A A;  4MHN A;  3SJX A;  3SI1 A;  4FUU A;  3S9N A;  1VGY A;  2DEA A;  1ELM P;  4UEF A;  5K8N A;  2PIY A;  2ZOG A;  4P45 A;  3NFZ A;  5LYI A;  2ZED A;  3PBE A;  3DGV A;  3I6S A;  4PXD A;  5F09 A;  3B3W A;  4PXC A;  2OR4 A;  2PJB A;  1HDQ A;  4OP4 A;  3CT9 A;  1VHO A;  5JM6 A;  1NSA A;  2V8G A;  4C9U A;  4UIA A;  1ARM A;  3FEC A;  3H8G A;  4ZX8 A;  3VAT A;  4IK2 A;  3WC6 A;  1Y0Y A;  4NJQ A;  4MHY A;  2XEI A;  1QQ9 A;  3GB0 A;  5THW A;  5LRK A;  2JBJ A;  1QMU A;  3PFO A;  5HVF A;  3EIF A;  4NGQ A;  4P10 A;  4ZY2 A;  4DJL A;  1F2P A;  2PVW A;  2PJ3 A;  3HUV A;  3NA6 A;  1F2O A;  1RTQ A;  1WVM A;  4MCR A;  1ARL A;  3JRU A;  4YWY A;  4NGT A;  4C99 A;  2Q4Z A;  3IJ3 A;  2CTB A;  3WT4 A;  4NJR A;  4X2T A;  2PJ0 A;  4WJB A;  1FT7 A;  5HXD A;  4C86 A;  1TF9 A;  4C9R A;  1AYE A;  4K3N A;  1V6C A;  4R76 A;  5CPA A;  3LWU A;  2ANP A;  4R6T A;  2V8H A;  3IEH A;  4B6Z A;  2ZEH A;  4MHP A;  2RFH A;  1Y9Z A;  5ELY A;  1LAN A;  3KHX A;  4H2K A;  3TC8 A;  3BXM A;  2PJ1 A;  4PXB A;  1LOK A;  1KWM A;  1R43 A;  2V77 A;  3PRT A;  1XJO A;  4MRI A;  3KR4 A;  4C8P A;  2C5Q A;  4NGP A;  2PJ4 A;  2HB6 A;  4ZY1 A;  4KNG E;  4YU9 A;  2XEF A;  5K8P A;  2NYQ A;  4MCS A;  4CDJ A;  2AFW A;  3K9T A;  4P4J A;  4C85 A;  3D7G A;  3L2N A;  2O53 A;  5LYL A;  2Q51 A;  3MRU A;  1YLO A;  1CPX A;  4UF4 A;  1CX8 A;  3PB8 X;  4PQA A;  4NFR A;  3PEI A;  3D66 A;  4NGR A;  3SI2 A;  1BAV A;  3FX6 A;  2JEW A;  3RAM A;  1BPM A;  1IGB A;  2BCO A;  4KSI A;  2FVG A;  5IB9 A;  2PRQ A;  3S9L A;  4NGN A;  3I74 A;  3KR5 A;  3D4U A;  4P4D A;  5LRJ A;  3N5F A;  2PJ9 A;  4NGS A;  1R3N A;  3SI0 A;  1TKF A;  1PYT B;  2BO9 A;  4EFD A;  4P4E A;  4X3R A;  2PJ6 A;  3FH4 A;  4JYW A;  1LFW A;  2ABZ A;  5J1Q A;  5LYD A;  2WYR A;  4DYO A;  1ZG8 A;  2G9D A;  2IQ6 A;  3V38 A;  1Y7E A;  5D29 A;  1F57 A;  3KQX A;  2AFU A;  2J9A A;  4OME A;  1ZG9 A;  4DUK A;  4FAI A;  4C9V A;  5LYF A;  1BLL E;  2EK8 A;  5LRG A;  4G1P A;  4C9E A;  1UWY A;  4CDK A;  3KGQ A;  2PJC A;  4FBE A;  4ZI6 A;  3VTA A;  4FWU A;  3FEE A;  1IY7 A;  4OID A;  1FNO A;  3NH4 A;  4YN3 A;  3NH5 A;  4CPA A;  2GU2 A;  1Z2L A;  3H8F A;  1ZLI A;  5K8M A;  2ZOF A;  3S9M A;  4IHM A;  2ZEE A;  4A39 A;  3D7H A;  4P6Y A;  1EE3 P;  1HDU A;  1DE4 C;  1ELL P;  1TKH A;  4OC3 A;  3D67 A;  1XRY A;  2HC9 A;  1CBX A;  1PCA A;  1TF8 A;  4OC4 A;  1YSJ A;  3SJF A;  1Q7L A;  3WAB A;  3DLJ A;  1CP6 A;  4PXE A;  3KQZ A;  2C6P A;  1XBU A;  2GLF A;  4LQG A;  3B35 A;  4ONW A;  2NSM A;  2PJ7 A;  4C8C A;  5CBM A;  4EWT A;  4AXV A;  1Y0R A;  2PJ5 A;  4UEE A;  2V8V A;  2PCU A;  3BHX A;  4OIW A;  2BOA A;  2Q43 A;  2AFO A;  2AFZ A;  3I1U A;  2QVP A;  3PFE A;  2C6C A;  1DTD A;  4F9U A;  2GLJ A;  4F9V A;  1M4L A;  3WC5 A;  1TXR A;  2ZEP A;  4R8F A;  3FJU A;  4TJX A;  3IO1 A;  3B3S A;  2ZEL A;  4OKO A;  4ZX9 A;  2PIZ A;  2ZEM A;  4C9A A;  1CPS A;  4OC5 A;  2QYV A;  3FVL A;  4MCQ A;  3ISZ A;  2AFX A;  4OC0 A;  6CPA A;  4MCP A;  3KHZ A;  1XF1 A;  3PBB A;  5I4M A;  3KI9 A;  2C6G A;  2EK9 A;  4O23 A;  2I3C A;  1GYT A;  2PVV A;  2ZEO A;  3H8E A;  1CP7 A;  2F8H A;  1HEE A;  4P4I A;  4W9Y A;  2PE3 A;  3B3T A;  4C8U A;  3FF3 A;  1XMB A;  2ZEG A;  4C84 A;  1YW6 A;  3GLJ A;  3B3V A;  4GM5 A;  5IR2 A;  2V8D A;  5HVH A;  5DS0 A;  4MHZ A;  3GUX A;  7CPA A;  1ZLH A;  3WC7 A;  4ZY0 A;  2PJA A;  4Q7A A;  4F8Z A;  2IMO A;  3QNV A;  3IWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...