4MCRA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyltri-gamma-l-glutamic acid (pteroyltetra-gamma-l-glutamic acid)
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
695
structure length
693
Chain Sequence
b'HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 269
structure length 693
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcrA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcrA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcrA02
2PJ7A 3H8GA 1XBUA 1TXRA 1ZLHA 1XMBA 4P4DA 3FEEA 3IO1A 3HLPA 1R3NA 3WC5A 3BI1A 2ZEOA 3WC7A 3WC6A 1ZG8A 4DYOA 2AFOA 4C86A 3D66A 3KR5A 3IJ3A 3VARA 2EWBA 5JH9A 3S9NA 4NGPA 4C9VA 2IJZA 3NFZA 4NJRA 2XEIA 1WVMA 4ZX9A 1ARMA 1CPSA 4OC0A 3SJGA 4UEZA 4C9AA 3K2KA 1H8LA 1QMUA 3D68A 4IHMA 4C84A 1IY7A 2PRQA 2ZOGA 2ZEEA 4R6TA 3B3TA 4A39A 3MN8A 1PYTB 4PXCA 4C8UA 5LRJA 2O4HA 3PB7X 4TJVA 1HEEA 4FBEA 4GM5A 1TF9A 4MHNA 3S9LA 3KGQA 3BHXA 3B3VA 4UIAA 4PXDA 4FUUA 1VHOA 1Z5RA 1PCAA 4W9YA 3B35A 2ABZA 3PBEA 1DTDA 4NGNA 2CTBA 1F2OA 2V8GA 4PPZA 3KHXA 3PB8X 1LAMA 4EWTA 1Z2LA 2ZENA 2XEJA 1HDQA 3CDXA 4DUKA 1AYEA 4Q7AA 4EFDA 1RTQA 2GU2A 3HUVA 2ANPA 2AFSA 1Z8LA 3WABA 3B7IA 4C8AA 2PVWA 2GLJA 4UIBA 5J1QA 5JGFA 4A38A 3BI0A 3I6SA 2G9DA 3LMSA 4KSIA 6CPAA 3S9MA 1LCPA 2CIJA 1TKFA 1F57A 2PE3A 1OBRA 1ARLA 4NGQA 1Y7EA 2NYQA 4WWVA 2ZELA 3D67A 3IFEA 2HB6A 1CBXA 2ZEPA 3FVLA 1VGYA 3SI2A 3SI0A 3LWUA 4ZY2A 4IAVA 4ZX8A 3B3SA 3KR4A 3KASA 3FECA 2ZOFA 2PJ0A 4Z65A 3T8WA 2RFHA 3KQXA 2Q43A 2HC9A 4MCSA 2ZEMA 4F8ZA 4C85A 3SJXA 4X3RA 1LAPA 4X2TA 1TKHA 3CPXA 1ELLP 4P10A 4OC3A 4A94A 4RUHA 1NSAA 3B3WA 4NGSA 1LOKA 3FX6A 4TJXA 4G1PA 1R43A 4P4IA 1IGBA 3H8EA 2EK9A 2CF4A 3V38A 4LQGA 1BAVA 1YSJA 3I74A 1CP7A 3GLJA 3IEHA 4C9EA 2ZEDA 5LRKA 2BOAA 1QQ9A 1ZG9A 3KQZA 3VATA 3K9TA 4MMOA 4MHYA 5K8PA 5K8NA 4MCPA 3PB9X 4OIDA 2PVVA 3V7ZA 3IWWA 1LANA 5LYFA 4OC4A 2J9AA 2Q51A 1EE3P 4TWEA 2VL1A 3PFEA 1TF8A 3RBUA 1YW4A 2QJ8A 1LFWA 2PJ5A 3TC8A 4P45A 2OR4A 2EK8A 3I1UA 4X8IA 3D7FA 2WZNA 2PCUA 2PJ3A 3KHZA 4PXEA 2PJAA 3SJFA 5CBMA 3EIFA 2JBJA 3CPAA 1FT7A 5HVGA 3L2NA 3D7GA 4C8TA 2BCOA 3NH4A 5HXDA 3QNVA 4DJLA 1CX8A 2QVPA 4P4FA 4C9RA 3B2YA 2PJ9A 2AFWA 3KL9A 4FAIA 3H8FA 5THWA 1XFOA 4PQAA 2PJ4A 3IIBA 3ISXA 4JYWA 2OOTA 1VHEA 2CTCA 2POKA 2FVGA 3GB0A 2XEGA 1BPNA 2PJ6A 2JEWA 4WJBA 2JBKA 3FF3A 4P4JA 3KI9A 5D29A 4AXVA 1VIXA 3RZAA 5HVHA 3MRUA 4UEEA 4MCQA 4PXBA 2C6PA 1YLOA 1TKJA 2C1CA 3TX8A 4UF4A 2PJCA 3D4UA 2ZEGA 1Y0RA 2GREA 4ZYQA 3BXMA 3GUXA 2NSMA 4ZI6A 4P4BA 4UEFA 3ISZA 4R7MA 3CT9A 5CPAA 3FJUA 3PEIA 2C6CA 2PJ1A 1UWYA 3N5FA 4MXUA 3VTAA 4MRIA 4C9UA 2PJ8A 4NGRA 4OC1A 3PB4X 4YWYA 5I4MA 1BPMA 2PIYA 3VH9A 2ZEFA 4BD9A 2PJBA 5LYDA 4MCRA 4NGTA 1Q7LA 4CPAA 4C8CA 1ZG7A 1HDUA 4A37A 2XEFA 2RB7A 4R76A 4O23A 7CPAA 4YU9A 2O53A 1JQGA 4NGMA 3FH4A 3RAMA 3JRUA 3KZWA 3DLJA 2Q4ZA 3PBBA 4P4EA 4C8FA 5LYIA 3B3CA 2V8HA 1CG2A 4MHPA 3WT4A 5LYLA 1ELMP 4F9UA 4YN3A 4NFRA 2I3CA 3DGVA 4NJQA 4OIWA 3NA6A 4FWUA 1BLLE 4MHZA 5JM6A 4P6YA 2AFXA 3SI1A 3NH8A 4EMEA 1F2PA 3PRTA 4H2KA 3SJEA 3PFOA 8CPAA 4ONWA 1Y9ZA 4JZ0A 4R8FA 1XRYA 4C99A 1CP6A 3NH5A 3FMCA 4CDJA 2BO9A 4CDKA 2AFUA 4B6ZA 3PB6X 5HVFA 1XF1A 4KNGE 5F09A 2IMOA 1ZLIA 5DS0A 2IQ6A 1KWMA 4C8PA 4ZY1A 1CPXA 4OC2A 3IC1A 1AMPA 2QYVA 2V8DA 3FEDA 2DEAA 1YW6A 2C6GA 4P44A 1XJOA 4OC5A 5ELYA 5IB9A 2F8HA 2V8VA 2PIZA 4OP4A 2PJ2A 1FNOA 4K3NA 4OMEA 4OKOA 1Y0YA 4ZY0A 4IK2A 2ZEHA 2AFMA 2F7VA 1M4LA 1DE4C 2GLFA 3D7DA 1V6CA 2AFZA 4TNUA 1YMEA 5K8OA 3D7HA 5D8NA 5LRGA 5K8MA 3ICUA 2WYRA 1GYTA 4F9VA 2V77A
chains in the Genus database with same CATH superfamily
2PJ7A 4BPWB 4M85A 2FM4A 3H8GA 5EC4A 3MGDA 4IIYA 1BO4A 2Q04A 1XBUA 1TXRA 1ZLHA 1XMBA 3B8GA 4P4DA 3FEEA 3IO1A 2PR8A 2WPXA 3HLPA 1Q2DA 3S6KA 1R3NA 4RN7A 3BI1A 3WC5A 2ZEOA 1YGHA 5G1ZA 3WC6A 2EO8A 3WC7A 1ZG8A 3FNCA 2Z3PA 4DYOA 2AFOA 1RXTA 5A27A 4C8PA 5JPHA 1MJBA 3R9FA 4C86A 1GGOA 3W6XA 3D66A 3WR7A 3IU2A 2PC1A 3KR5A 1R61A 2VEZA 3IJ3A 2Q44A 4MY0A 5CNPA 3VARA 5JVLA 1VKCA 2GE3A 2EWBA 2C27A 3BUNB 4A31A 5F47A 5JH9A 1QSTA 4NCZA 1CM0A 2Q4YA 3S9NA 2Q4VA 1C30B 3F9KC 4NGPA 2HROA 1KEEB 4CAVA 4B5PA 4B12A 4UFVA 4C9VA 2IJZA 3NFZA 3OB2B 4NJRA 4AG9A 3SHPA 5KTAA 3CXPA 2A4NA 2X0SA 2XEIA 1S5KA 3CZXA 1Y7RA 2R98A 3EC4A 4KORA 5DWMA 4ZX9A 1WVMA 4R9MA 2J8RA 2OZHA 2VXKA 1ARMA 1CPSA 5ISVA 2O28A 2F5IA 4OC0A 3SJGA 4EVYA 2K5TA 4UEZA 2Z3MA 4MJ8A 3K2KA 4C9AA 1H8LA 2VZYA 1QMUA 3D68A 4IHMA 4CGNA 4C84A 1IY7A 2PRQA 2ZOGA 4EYSA 4C2XA 2ZEEA 4R6TA 4MFJA 3OP0A 1Q5XA 1SQHA 3B3TA 4A39A 1Z8TA 4C2YA 1ON0A 3MN8A 4HNWB 1C3OB 4H1HA 1PYTB 1M44A 4PXCA 4C8UA 5LRJA 2O4HA 4R3LA 1MJ9A 3PB7X 4A95A 4MFPA 3IWEA 1HEEA 1RO5A 4TJVA 4CGOA 4XPLA 4FBEA 4AVAA 4GM5A 1TF9A 4MHNA 2EZBA 3S9LA 3KGQA 5K99A 2CNTA 2KCWA 3BHXA 3B3VA 2E28A 4KOWA 3EFAA 4UIAA 4PXDA 3D8PA 1Y9WA 4BTFA 3R9EA 4FUUA 1VHOA 1Z5RA 4UFXA 4K30A 1K4JA 1PCAA 4W9YA 1IOFA 1S7FA 2X7BA 3IGRA 1WWZA 4R87A 3B35A 2ABZA 4R3KA 5HKYA 5F46A 1GHEA 3PBEA 2YJVA 1DTDA 5G20A 4E5SA 4NGNA 2CTBA 1F2OA 1FY7A 2V8GA 4KLWA 4CRYB 4PPZA 3KHXA 3TO7A 3PB8X 1LAMA 4AVBA 4EWTA 4E0AA 1Z2LA 2ZENA 2XEJA 1HDQA 3BJ7A 3CDXA 4UWIA 4DUKA 3BUXB 1AYEA 2P6GA 4Q7AA 4EFDA 1RTQA 2XPPA 2GU2A 1YREA 4CAEA 4ZY0A 3HUVA 1KBLA 2ANPA 5F13A 2Q7SA 2AFSA 5A28A 2DIKA 1Z8LA 3WABA 1VHSA 3SXNA 3B7IA 2EBJA 4CGPA 4C8AA 1S7LA 4MFQA 2PVWA 3TLYA 2GLJA 1IOIA 4UIBA 5JGFA 5E96A 3BI0A 4A38A 5J1QA 2G9DA 3LMSA 4KSIA 4CGLA 3PGPA 3QAYA 4QVTA 1VI4A 3KRVA 2YNEA 6CPAA 4ZGYB 5IX3A 5HKZA 3S9MA 2FL4A 4B13A 3EZEA 1LCPA 2CIJA 4FD6A 2EUIA 4XPKA 4MFLA 4B5PB 1IICA 4MI4A 5KTDA 1OZPA 1TKFA 1F57A 1VBHA 2Y0MA 1P0HA 2PE3A 1DIKA 1OBRA 1I12A 1ARLA 3D2MA 4NGQA 4MY3A 1Y7EA 2NYQA 4WWVA 1CS0B 2HV2A 3T9YA 2ZW4A 2ZELA 4Q36A 2FIWA 2FS5A 3D67A 3IFEA 4NSQA 4LX9A 3BUWB 4UFWA 2HB6A 1CBXA 4RR2B 2QMLA 2AUMA 2D0PA 1YLEA 3TE4A 4J0NA 2VQYA 3FYNA 3TLCA 1Y9KA 2ZEPA 3FVLA 1VGYA 3SI2A 4XPDC 3EO4A 2P0WA 1QSNA 3LWUA 4ZY2A 3SI0A 2B3VA 2CY2A 1IIDA 1WK4A 2D4PA 2OH1A 4IAVA 2N3AB 4MBUA 4MFZA 3G8WA 1NE9A 4ZX8A 2WPWA 3B3SA 3HPHE 2BEIA 3KR4A 3P2FA 4I49A 1FBVA 3KASA 2R82A 3FECA 2ZOFA 2PJ0A 4Z65A 4PK3A 3T8WA 2RFHA 3KQXA 2GANA 2Q43A 3PFVA 2HC9A 4MCSA 4LUAA 5BWAB 3VRNA 2ZEMA 1KZFA 4MI1A 4CZ1A 4F8ZA 5JYBA 4MJXA 3T90A 4C85A 3SJXA 4X3RA 1LAPA 2VBQA 4X2TA 1TKHA 3CPXA 3IWGA 1ELLP 1A9XB 4P10A 5F1YA 4OC3A 2Z3NA 1ZRSA 2J8MA 4C7HA 2B0AA 3KKWA 4A94A 4RUHA 1NSAA 3B3WA 2REFA 4NGSA 1LOKA 2YNDA 3FX6A 2I00A 5J3XA 4PSXA 4G1PA 4TJXA 4COGA 4KOXA 5AXIA 1R43A 3G3SA 4KUAA 4XNHB 2HWGA 1KC7A 4P4IA 1IGBA 3H8EA 2EK9A 3NE7A 2CF4A 3TCVA 2GP4A 3U88C 4LQGA 1BAVA 1YSJA 4FD4A 3V38A 3W6SA 3I74A 1CP7A 3GLJA 3IEHA 4XNHC 2Y1NA 4C9EA 2ZEDA 5LRKA 2VZZA 2BOAA 1QQ9A 2ODFA 1JDBC 1ZG9A 2FXFA 3KQZA 3VATA 5FD8A 2EZCA 3K9TA 4JWPA 1AUGA 4MMOA 4MHYA 4PV6A 5K8NA 4MCPA 2XPLA 2Z0ZA 3BJ8A 5K8PA 2HQYA 4Q38A 2J8NA 1P4NA 3PB9X 2ZXVA 4OIDA 1QSOA 3FBUA 4KVXA 2PVVA 3V7ZA 3IWWA 1LANA 5LYFA 1PUAA 3K9UA 4CRZB 4OC4A 2J9AA 2Q51A 2C5QA 3BUMB 1EE3P 4TWEA 2VL1A 3PFEA 2GFQA 1S3ZA 3RBUA 1TF8A 1YW4A 2OZGA 4KOSA 2QJ8A 1LFWA 3C8OA 2PJ5A 2I79A 3DR6A 3TC8A 4CYQA 3T07A 4P45A 2BSWA 4JXQA 4UCMA 1YVHA 2OR4A 2Z3KA 5G22A 2AUNA 3SR3A 4FD5A 1Z8XA 2EK8A 2PDOA 4GPLB 3I1UA 4UA3A 4X8IA 3D7FA 2JDCA 2WZNA 3R96A 1CJWA 2B5GA 2PCUA 2PJ3A 3KHZA 2MP0A 1ZL0A 4CAXA 4YFJA 4B5OA 4PXEA 4RS2A 2PJAA 4IIXA 1Z8WA 4INJA 3SJFA 5CBMA 4C9RA 2WSAA 3F0AA 3VROA 3S6HA 1M1DA 1QSRA 1S7KA 3R1KA 2EZAA 3EIFA 3H4QA 5AG4A 5AG5A 4F0XA 5F5XA 2JBJA 3QAHA 4OAEA 3CPAA 2XPNA 1FT7A 1Z4EA 3H5ZA 5HVGA 1CE8B 4PSWA 4A4BA 3L2NA 2VKZG 3D7GA 4QUSA 3U1BA 2CBLA 4NF1A 2Z11A 4FD7A 3ZJ0A 2BCOA 4C8TA 2B4JC 1YK3A 3NH4A 5HXDA 2AE6A 3NFQA 1UFHA 3D2PA 3QNVA 4DJLA 1T36B 1CX8A 2QVPA 4M6GA 4P4FA 4B10A 1EZAA 3B2YA 2PJ9A 4KOVA 2WUUA 4KOTA 1KUYA 2AFWA 1KUXA 2B58A 1S60A 3KL9A 4NEXA 3OB1B 1JWQA 4JD6A 4FAIA 3RNZA 3H8FA 5THWA 1XFOA 4PQAA 2JDDA 2PJ4A 3IIBA 4HKFA 4L8AA 5AGEA 2UV8G 3RO0A 4C7IA 3ISXA 4JYWA 2OOTA 3VRPA 5I4MA 1BXRB 1VHEA 2CTCA 1M4DA 2FVGA 2POKA 3GB0A 2XEGA 4JLYA 4M6HA 1BPNA 4PK2A 5HMNA 5JQ4A 1XMTA 4OADA 2PJ6A 3EZAA 1X10A 3TOBA 3OAKA 1YVKA 4AB7A 2JEWA 3FRMA 4B14A 3EXNA 1J3LA 4WJBA 2JBKA 2Q7BA 4CYOA 4HNYB 3FF3A 4KVOE 3UY5A 4BPUB 5EMIA 4P4JA 2ZW6A 4U9YA 3KI9A 3FXTA 3TLBA 5D29A 1YVOA 2P6FA 3ZZIA 2PRBA 4AG7A 4M8DA 3C26A 2PQ8A 2PSWA 4AXVA 1Q2CA 2RC4A 4XPDB 1VIXA 3RZAA 5H84A 5HVHA 3GYAA 3MRUA 4UEEA 1ZO0A 4ONUA 3TYXA 3CXSA 4MCQA 3VWEA 4JXRA 4C2ZA 4PXBA 3BUOB 2C6PA 4Y49C 1YLOA 1TKJA 2OU2A 4U5YA 1X12A 2HUZA 4A33A 4KSAA 2C1CA 1NBWA 3TX8A 4UF4A 5KTCA 2PJCA 4COBA 1IB1E 3DSBA 4UCPA 4QBJA 3D4UA 3K4IA 1LRZA 1YQEA 4AVCA 1MK4A 2ZEGA 5GCNA 1I1DA 1Y0RA 2B5GB 2GREA 4ZYQA 3IU1A 3BXMA 3GUXA 2NSMA 3GJZA 4ZI6A 4UBRA 2D4OA 4A4CA 5HKWA 4P4BA 4UEFA 2FCKA 4M6IA 2H5MA 2ATRA 4HPSA 3ISZA 4R7MA 1A2ZA 4CS0B 2DPTA 2CNSA 3OWCA 4H6UA 2ARHA 4DNCA 3CT9A 3GY9A 5CPAA 3FJUA 1Z9UA 4R57A 3PEIA 2G0BA 2C6CA 2PJ1A 5FVJA 1UWYA 3N5FA 5BY0A 3PP9A 4A2ZA 4CYPA 2IL4A 3JVNA 4MXUA 1WJTA 5F9MA 1TIQA 3VTAA 2NMTA 4GS4A 4MRIA 1M4IA 4J3GA 4C68A 2PJ8A 3BLNA 4C9UA 4NGRA 4OC1A 1U6MA 3PB4X 4YWYA 3F5BA 3RYOA 3TOAA 1B87A 5C82A 1BPMA 2PIYA 3VH9A 2YNCA 2ZEFA 3ZNIA 3VWDA 4BD9A 2PJBA 2R7HA 3T05A 4KSFA 5LYDA 4MCRA 4NGTA 1Q7LA 2P6EA 3DDDA 1B47A 5J8CA 2BUEA 4KZTA 2QECA 4JVOA 3FIXA 5EBVA 4CPAA 4C8CA 4QC6A 4MFKA 3HPGG 1ZG7A 4H6ZA 3SXOA 4MHDA 3TLAA 1HDUA 2JLMA 4X5KA 3FB3A 3TO6A 4A37A 3DR8A 2XEFA 1JDEA 3E0KA 2RB7A 2Q0YA 4R76A 4O23A 7CPAA 4YU9A 2O53A 4E8OA 1JQGA 3PLFB 2DXQA 4NGMA 1Z9EA 2DF5A 2FIAA 2Z10A 3FH4A 4H89A 1PU9A 4ORFA 3RAMA 2B4DA 5I0CA 5J8FA 3JRUA 3KZWA 3TT2A 3DLJA 2Q4ZA 2YGWA 3JUWA 3PBBA 2ZPAA 2GIVA 2FE7A 4HNXB 3LACA 1S7NA 3D3SA 3N7ZA 1VBGA 3R9GA 4NXYA 4P4EA 1ZYMA 4KLVA 4C8FA 5LYIA 3I9SA 4QB9A 3A9LA 3B3CA 4U9ZA 2PR1A 2V8HA 1CG2A 1XOVA 4MHPA 4KOYA 5AG7A 3WT4A 2ZW7A 5LYLA 1B6BA 1ELMP 1QSMA 4JJXA 4KVME 4E94A 1KUVA 1EZBA 3VRRA 4F0YA 1IYLA 3T5MA 4F9UA 5IV0A 1NMTA 2G3TA 4NFRA 2I3CA 3I3GA 4YN3A 3TLGA 5IR2A 3DGVA 4NJQA 4OIWA 3NA6A 4FWUA 3R95A 4IUSA 1BLLE 2ZW5A 3PZJA 4MHZA 5JM6A 2OB0A 2FSRA 1L0CA 5IB0A 4IF5A 2CNMA 2AFXA 4P6YA 3F8KA 3SI1A 4CAWA 1EO0A 2Z3OA 3G23A 3NH8A 2QIRA 4EMEA 1F2PA 3PRTA 1XF8A 3LD2A 2FT0A 1N71A 4H2KA 3SJEA 3PFOA 1M6VB 1NXJA 1Q2YA 3DNSA 8CPAA 3NOJA 4KOUA 1XIXA 3TO9A 4B11A 3T0TA 4OLLA 4ONWA 5HH1A 3QB8A 1M4GA 1Y9ZA 4JZ0A 2Y1MA 2B3UA 4BPXB 1XEBA 1XRYA 4R8FA 5DWNA 5H86A 3S6FA 2HI6A 4C99A 4L89A 4M3SA 1CP6A 2OZUA 4CAFA 3NH5A 3FMCA 2R8VA 3PT1A 4CDJA 2BO9A 1IU8A 3V8IA 4BBHA 4CDKA 4A30A 2AFUA 2G3AA 3S6GA 4B6ZA 2AJ6A 3PB6X 4ZBGA 5HVFA 4E2AA 1XF1A 4KNGE 5F09A 2IMOA 3GIUA 4A32A 1ZLIA 2YNCC 5DS0A 2IQ6A 2REEA 1KWMA 4F6AA 1R57A 5AG6A 3I6SA 2JEVA 4KUBA 4Y49B 1CPXA 4ZY1A 4OC2A 2EVNA 4II9A 2OLSA 3IC1A 1AMPA 1YR0A 1BOBA 2B4BA 2QYVA 3EY5A 2V8DA 4UCNA 3FEDA 4YRHA 2DEAA 2Z3LA 1YW6A 5F48A 3TTHA 4BMHA 2D0OA 3TLEA 2C6GA 3VGOA 1YX0A 1XE4A 4P44A 2VI7A 1IYKA 2PCNA 1XJOA 2BL1A 4OC5A 5ELYA 1Z4RA 2CXAA 2F8HA 5C88A 5IB9A 3HMJG 3TLZA 1I21A 2YJTA 2V8VA 2B4DB 2PIZA 3VRQA 3GKRA 3JTKA 4OP4A 3W91A 2PJ2A 1J4JA 2DPSA 1FNOA 4BINA 3O8ZA 3LODA 4OMEA 4K3NA 4CGMA 4GXHA 4RI1A 3NE8A 4OKOA 2XPOA 1V0CA 1Y0YA 3CXQA 4IK2A 2ZEHA 4KS9A 4CYNA 2AFMA 2F7VA 1M4LA 1DE4C 2GLFA 3D7DA 1V6CA 4CO9A 2AFZA 3TFYA 4TNUA 1YMEA 5K8OA 3D7HA 5F49A 5D8NA 5LRGA 5K8MA 1MJAA 4YGOA 3ICUA 3EZBA 1NSLA 3P2HA 4UWJA 2R1IA 2WYRA 5G21A 2DLAA 1GYTA 4LQ6A 4F9VA 3TLGB 2V77A
chains in the Genus database with same CATH topology
2PJ7A 3H8GA 1XBUA 1TXRA 1ZLHA 1XMBA 4P4DA 3FEEA 3IO1A 3HLPA 1R3NA 3WC5A 3BI1A 2ZEOA 3WC7A 3WC6A 1ZG8A 4DYOA 2AFOA 4C86A 3D66A 3KR5A 3IJ3A 3VARA 2EWBA 5JH9A 3S9NA 4NGPA 4C9VA 2IJZA 3NFZA 4NJRA 2XEIA 1WVMA 4ZX9A 1ARMA 1CPSA 4OC0A 3SJGA 4UEZA 4C9AA 3K2KA 1H8LA 1QMUA 3D68A 4IHMA 4C84A 1IY7A 2PRQA 2ZOGA 2ZEEA 4R6TA 3B3TA 4A39A 3MN8A 1PYTB 4PXCA 4C8UA 5LRJA 2O4HA 3PB7X 4TJVA 1HEEA 4FBEA 4GM5A 1TF9A 4MHNA 3S9LA 3KGQA 3BHXA 3B3VA 4UIAA 4PXDA 4FUUA 1VHOA 1Z5RA 1PCAA 4W9YA 3B35A 2ABZA 3PBEA 1DTDA 4NGNA 2CTBA 1F2OA 2V8GA 4PPZA 3KHXA 3PB8X 1LAMA 4EWTA 1Z2LA 2ZENA 2XEJA 1HDQA 3CDXA 4DUKA 1AYEA 4Q7AA 4EFDA 1RTQA 2GU2A 3HUVA 2ANPA 2AFSA 1Z8LA 3WABA 3B7IA 4C8AA 2PVWA 2GLJA 4UIBA 5J1QA 5JGFA 4A38A 3BI0A 3I6SA 2G9DA 3LMSA 4KSIA 6CPAA 3S9MA 1LCPA 2CIJA 1TKFA 1F57A 2PE3A 1OBRA 1ARLA 4NGQA 1Y7EA 2NYQA 4WWVA 2ZELA 3D67A 3IFEA 2HB6A 1CBXA 2ZEPA 3FVLA 1VGYA 3SI2A 3SI0A 3LWUA 4ZY2A 4IAVA 4ZX8A 3B3SA 3KR4A 3KASA 3FECA 2ZOFA 2PJ0A 4Z65A 3T8WA 2RFHA 3KQXA 2Q43A 2HC9A 4MCSA 2ZEMA 4F8ZA 4C85A 3SJXA 4X3RA 1LAPA 4X2TA 1TKHA 3CPXA 1ELLP 4P10A 4OC3A 4A94A 4RUHA 1NSAA 3B3WA 4NGSA 1LOKA 3FX6A 4TJXA 4G1PA 1R43A 4P4IA 1IGBA 3H8EA 2EK9A 2CF4A 2GP4A 3V38A 4LQGA 1BAVA 1YSJA 3I74A 1CP7A 3GLJA 3IEHA 4C9EA 2ZEDA 5LRKA 2BOAA 1QQ9A 1ZG9A 3KQZA 3VATA 3K9TA 4MMOA 4MHYA 5K8PA 5K8NA 4MCPA 3PB9X 4OIDA 2PVVA 3V7ZA 3IWWA 1LANA 5LYFA 4OC4A 2J9AA 2Q51A 2C5QA 1EE3P 4TWEA 2VL1A 3PFEA 1TF8A 3RBUA 1YW4A 2QJ8A 1LFWA 2PJ5A 3TC8A 4P45A 2OR4A 2EK8A 3I1UA 4X8IA 3D7FA 2WZNA 2PCUA 2PJ3A 3KHZA 4PXEA 2PJAA 3SJFA 5CBMA 3EIFA 2JBJA 3CPAA 1FT7A 5HVGA 3L2NA 3D7GA 4C8TA 2BCOA 3NH4A 5HXDA 3QNVA 4DJLA 1CX8A 2QVPA 4P4FA 4C9RA 3B2YA 2PJ9A 2AFWA 3KL9A 4FAIA 3H8FA 5THWA 1XFOA 4PQAA 2PJ4A 3IIBA 3ISXA 4JYWA 2OOTA 1VHEA 2CTCA 2POKA 2FVGA 3GB0A 2XEGA 1BPNA 2PJ6A 2JEWA 4WJBA 2JBKA 3FF3A 4P4JA 3KI9A 5D29A 4AXVA 1VIXA 3RZAA 5HVHA 3MRUA 4UEEA 4MCQA 4PXBA 2C6PA 1YLOA 1TKJA 2C1CA 3TX8A 4UF4A 2PJCA 3D4UA 2ZEGA 1Y0RA 2GREA 4ZYQA 3BXMA 3GUXA 2NSMA 4ZI6A 4P4BA 4UEFA 3ISZA 4R7MA 3CT9A 5CPAA 3FJUA 3PEIA 2C6CA 2PJ1A 1UWYA 3N5FA 4MXUA 3VTAA 4MRIA 4C9UA 2PJ8A 4NGRA 4OC1A 3PB4X 4YWYA 5I4MA 1BPMA 2PIYA 3VH9A 2ZEFA 4BD9A 2PJBA 5LYDA 4MCRA 4NGTA 1Q7LA 4CPAA 4C8CA 1ZG7A 1HDUA 4A37A 2XEFA 2RB7A 4R76A 4O23A 7CPAA 4YU9A 2O53A 1JQGA 4NGMA 3FH4A 3RAMA 3JRUA 3KZWA 3DLJA 2Q4ZA 3PBBA 4P4EA 4C8FA 5LYIA 3B3CA 2V8HA 1CG2A 4MHPA 3WT4A 5LYLA 1ELMP 4F9UA 4YN3A 4NFRA 2I3CA 5IR2A 3DGVA 4NJQA 4OIWA 3NA6A 4FWUA 1BLLE 4MHZA 5JM6A 4P6YA 2AFXA 3SI1A 3NH8A 4EMEA 1F2PA 3PRTA 4H2KA 3SJEA 3PFOA 8CPAA 4ONWA 1Y9ZA 4JZ0A 4R8FA 1XRYA 4C99A 1CP6A 3NH5A 3FMCA 4CDJA 2BO9A 4CDKA 2AFUA 4B6ZA 3PB6X 5HVFA 1XF1A 4KNGE 5F09A 2IMOA 1ZLIA 5DS0A 2IQ6A 1KWMA 4C8PA 4ZY1A 1CPXA 4OC2A 3IC1A 1AMPA 2QYVA 2V8DA 3FEDA 2DEAA 1YW6A 2C6GA 4P44A 1XJOA 4OC5A 5ELYA 5IB9A 2F8HA 2V8VA 2PIZA 4OP4A 2PJ2A 1FNOA 4K3NA 4OMEA 4OKOA 1Y0YA 4ZY0A 4IK2A 2ZEHA 2AFMA 2F7VA 1M4LA 1DE4C 2GLFA 3D7DA 1V6CA 2AFZA 4TNUA 1YMEA 5K8OA 3D7HA 5D8NA 5LRGA 5K8MA 3ICUA 2WYRA 1GYTA 4F9VA 2V77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ7 A;  3H8G A;  1XBU A;  1TXR A;  1ZLH A;  1XMB A;  4P4D A;  3FEE A;  3IO1 A;  3HLP A;  1R3N A;  3WC5 A;  3BI1 A;  2ZEO A;  3WC7 A;  3WC6 A;  1ZG8 A;  4DYO A;  2AFO A;  4C86 A;  3D66 A;  3KR5 A;  3IJ3 A;  3VAR A;  2EWB A;  5JH9 A;  3S9N A;  4NGP A;  4C9V A;  2IJZ A;  3NFZ A;  4NJR A;  2XEI A;  1WVM A;  4ZX9 A;  1ARM A;  1CPS A;  4OC0 A;  3SJG A;  4UEZ A;  4C9A A;  3K2K A;  1H8L A;  1QMU A;  3D68 A;  4IHM A;  4C84 A;  1IY7 A;  2PRQ A;  2ZOG A;  2ZEE A;  4R6T A;  3B3T A;  4A39 A;  3MN8 A;  1PYT B;  4PXC A;  4C8U A;  5LRJ A;  2O4H A;  3PB7 X;  4TJV A;  1HEE A;  4FBE A;  4GM5 A;  1TF9 A;  4MHN A;  3S9L A;  3KGQ A;  3BHX A;  3B3V A;  4UIA A;  4PXD A;  4FUU A;  1VHO A;  1Z5R A;  1PCA A;  4W9Y A;  3B35 A;  2ABZ A;  3PBE A;  1DTD A;  4NGN A;  2CTB A;  1F2O A;  2V8G A;  4PPZ A;  3KHX A;  3PB8 X;  1LAM A;  4EWT A;  1Z2L A;  2ZEN A;  2XEJ A;  1HDQ A;  3CDX A;  4DUK A;  1AYE A;  4Q7A A;  4EFD A;  1RTQ A;  2GU2 A;  3HUV A;  2ANP A;  2AFS A;  1Z8L A;  3WAB A;  3B7I A;  4C8A A;  2PVW A;  2GLJ A;  4UIB A;  5J1Q A;  5JGF A;  4A38 A;  3BI0 A;  3I6S A;  2G9D A;  3LMS A;  4KSI A;  6CPA A;  3S9M A;  1LCP A;  2CIJ A;  1TKF A;  1F57 A;  2PE3 A;  1OBR A;  1ARL A;  4NGQ A;  1Y7E A;  2NYQ A;  4WWV A;  2ZEL A;  3D67 A;  3IFE A;  2HB6 A;  1CBX A;  2ZEP A;  3FVL A;  1VGY A;  3SI2 A;  3SI0 A;  3LWU A;  4ZY2 A;  4IAV A;  4ZX8 A;  3B3S A;  3KR4 A;  3KAS A;  3FEC A;  2ZOF A;  2PJ0 A;  4Z65 A;  3T8W A;  2RFH A;  3KQX A;  2Q43 A;  2HC9 A;  4MCS A;  2ZEM A;  4F8Z A;  4C85 A;  3SJX A;  4X3R A;  1LAP A;  4X2T A;  1TKH A;  3CPX A;  1ELL P;  4P10 A;  4OC3 A;  4A94 A;  4RUH A;  1NSA A;  3B3W A;  4NGS A;  1LOK A;  3FX6 A;  4TJX A;  4G1P A;  1R43 A;  4P4I A;  1IGB A;  3H8E A;  2EK9 A;  2CF4 A;  3V38 A;  4LQG A;  1BAV A;  1YSJ A;  3I74 A;  1CP7 A;  3GLJ A;  3IEH A;  4C9E A;  2ZED A;  5LRK A;  2BOA A;  1QQ9 A;  1ZG9 A;  3KQZ A;  3VAT A;  3K9T A;  4MMO A;  4MHY A;  5K8P A;  5K8N A;  4MCP A;  3PB9 X;  4OID A;  2PVV A;  3V7Z A;  3IWW A;  1LAN A;  5LYF A;  4OC4 A;  2J9A A;  2Q51 A;  1EE3 P;  4TWE A;  2VL1 A;  3PFE A;  1TF8 A;  3RBU A;  1YW4 A;  2QJ8 A;  1LFW A;  2PJ5 A;  3TC8 A;  4P45 A;  2OR4 A;  2EK8 A;  3I1U A;  4X8I A;  3D7F A;  2WZN A;  2PCU A;  2PJ3 A;  3KHZ A;  4PXE A;  2PJA A;  3SJF A;  5CBM A;  3EIF A;  2JBJ A;  3CPA A;  1FT7 A;  5HVG A;  3L2N A;  3D7G A;  4C8T A;  2BCO A;  3NH4 A;  5HXD A;  3QNV A;  4DJL A;  1CX8 A;  2QVP A;  4P4F A;  4C9R A;  3B2Y A;  2PJ9 A;  2AFW A;  3KL9 A;  4FAI A;  3H8F A;  5THW A;  1XFO A;  4PQA A;  2PJ4 A;  3IIB A;  3ISX A;  4JYW A;  2OOT A;  1VHE A;  2CTC A;  2POK A;  2FVG A;  3GB0 A;  2XEG A;  1BPN A;  2PJ6 A;  2JEW A;  4WJB A;  2JBK A;  3FF3 A;  4P4J A;  3KI9 A;  5D29 A;  4AXV A;  1VIX A;  3RZA A;  5HVH A;  3MRU A;  4UEE A;  4MCQ A;  4PXB A;  2C6P A;  1YLO A;  1TKJ A;  2C1C A;  3TX8 A;  4UF4 A;  2PJC A;  3D4U A;  2ZEG A;  1Y0R A;  2GRE A;  4ZYQ A;  3BXM A;  3GUX A;  2NSM A;  4ZI6 A;  4P4B A;  4UEF A;  3ISZ A;  4R7M A;  3CT9 A;  5CPA A;  3FJU A;  3PEI A;  2C6C A;  2PJ1 A;  1UWY A;  3N5F A;  4MXU A;  3VTA A;  4MRI A;  4C9U A;  2PJ8 A;  4NGR A;  4OC1 A;  3PB4 X;  4YWY A;  5I4M A;  1BPM A;  2PIY A;  3VH9 A;  2ZEF A;  4BD9 A;  2PJB A;  5LYD A;  4MCR A;  4NGT A;  1Q7L A;  4CPA A;  4C8C A;  1ZG7 A;  1HDU A;  4A37 A;  2XEF A;  2RB7 A;  4R76 A;  4O23 A;  7CPA A;  4YU9 A;  2O53 A;  1JQG A;  4NGM A;  3FH4 A;  3RAM A;  3JRU A;  3KZW A;  3DLJ A;  2Q4Z A;  3PBB A;  4P4E A;  4C8F A;  5LYI A;  3B3C A;  2V8H A;  1CG2 A;  4MHP A;  3WT4 A;  5LYL A;  1ELM P;  4F9U A;  4YN3 A;  4NFR A;  2I3C A;  3DGV A;  4NJQ A;  4OIW A;  3NA6 A;  4FWU A;  1BLL E;  4MHZ A;  5JM6 A;  4P6Y A;  2AFX A;  3SI1 A;  3NH8 A;  4EME A;  1F2P A;  3PRT A;  4H2K A;  3SJE A;  3PFO A;  8CPA A;  4ONW A;  1Y9Z A;  4JZ0 A;  4R8F A;  1XRY A;  4C99 A;  1CP6 A;  3NH5 A;  3FMC A;  4CDJ A;  2BO9 A;  4CDK A;  2AFU A;  4B6Z A;  3PB6 X;  5HVF A;  1XF1 A;  4KNG E;  5F09 A;  2IMO A;  1ZLI A;  5DS0 A;  2IQ6 A;  1KWM A;  4C8P A;  4ZY1 A;  1CPX A;  4OC2 A;  3IC1 A;  1AMP A;  2QYV A;  2V8D A;  3FED A;  2DEA A;  1YW6 A;  2C6G A;  4P44 A;  1XJO A;  4OC5 A;  5ELY A;  5IB9 A;  2F8H A;  2V8V A;  2PIZ A;  4OP4 A;  2PJ2 A;  1FNO A;  4K3N A;  4OME A;  4OKO A;  1Y0Y A;  4ZY0 A;  4IK2 A;  2ZEH A;  2AFM A;  2F7V A;  1M4L A;  1DE4 C;  2GLF A;  3D7D A;  1V6C A;  2AFZ A;  4TNU A;  1YME A;  5K8O A;  3D7H A;  5D8N A;  5LRG A;  5K8M A;  3ICU A;  2WYR A;  1GYT A;  4F9V A;  2V77 A; 
#chains in the Genus database with same CATH topology
 2PJ7 A;  4BPW B;  4M85 A;  2FM4 A;  3H8G A;  5EC4 A;  3MGD A;  4IIY A;  1BO4 A;  2Q04 A;  1XBU A;  1TXR A;  1ZLH A;  1XMB A;  3B8G A;  4P4D A;  3FEE A;  3IO1 A;  2PR8 A;  2WPX A;  3HLP A;  1Q2D A;  3S6K A;  1R3N A;  4RN7 A;  3BI1 A;  3WC5 A;  2ZEO A;  1YGH A;  5G1Z A;  3WC6 A;  2EO8 A;  3WC7 A;  1ZG8 A;  3FNC A;  2Z3P A;  4DYO A;  2AFO A;  1RXT A;  5A27 A;  4C8P A;  5JPH A;  1MJB A;  3R9F A;  4C86 A;  1GGO A;  3W6X A;  3D66 A;  3WR7 A;  3IU2 A;  2PC1 A;  3KR5 A;  1R61 A;  2VEZ A;  3IJ3 A;  2Q44 A;  4MY0 A;  5CNP A;  3VAR A;  5JVL A;  1VKC A;  2GE3 A;  2EWB A;  2C27 A;  3BUN B;  4A31 A;  5F47 A;  5JH9 A;  1QST A;  4NCZ A;  1CM0 A;  2Q4Y A;  3S9N A;  2Q4V A;  1C30 B;  3F9K C;  4NGP A;  2HRO A;  1KEE B;  4CAV A;  4B5P A;  4B12 A;  4UFV A;  4C9V A;  2IJZ A;  3NFZ A;  3OB2 B;  4NJR A;  4AG9 A;  3SHP A;  5KTA A;  3CXP A;  2A4N A;  2X0S A;  2XEI A;  1S5K A;  3CZX A;  1Y7R A;  2R98 A;  3EC4 A;  4KOR A;  5DWM A;  4ZX9 A;  1WVM A;  4R9M A;  2J8R A;  2OZH A;  2VXK A;  1ARM A;  1CPS A;  5ISV A;  2O28 A;  2F5I A;  4OC0 A;  3SJG A;  4EVY A;  2K5T A;  4UEZ A;  2Z3M A;  4MJ8 A;  3K2K A;  4C9A A;  1H8L A;  2VZY A;  1QMU A;  3D68 A;  4IHM A;  4CGN A;  4C84 A;  1IY7 A;  2PRQ A;  2ZOG A;  4EYS A;  4C2X A;  2ZEE A;  4R6T A;  4MFJ A;  3OP0 A;  1Q5X A;  1SQH A;  3B3T A;  4A39 A;  1Z8T A;  4C2Y A;  1ON0 A;  3MN8 A;  4HNW B;  1C3O B;  4H1H A;  1PYT B;  1M44 A;  4PXC A;  4C8U A;  5LRJ A;  2O4H A;  4R3L A;  1MJ9 A;  3PB7 X;  4A95 A;  4MFP A;  3IWE A;  1HEE A;  1RO5 A;  4TJV A;  4CGO A;  4XPL A;  4FBE A;  4AVA A;  4GM5 A;  1TF9 A;  4MHN A;  2EZB A;  3S9L A;  3KGQ A;  5K99 A;  2CNT A;  2KCW A;  3BHX A;  3B3V A;  2E28 A;  4KOW A;  3EFA A;  4UIA A;  4PXD A;  3D8P A;  1Y9W A;  4BTF A;  3R9E A;  4FUU A;  1VHO A;  1Z5R A;  4UFX A;  4K30 A;  1K4J A;  1PCA A;  4W9Y A;  1IOF A;  1S7F A;  2X7B A;  3IGR A;  1WWZ A;  4R87 A;  3B35 A;  2ABZ A;  4R3K A;  5HKY A;  5F46 A;  1GHE A;  3PBE A;  2YJV A;  1DTD A;  5G20 A;  4E5S A;  4NGN A;  2CTB A;  1F2O A;  1FY7 A;  2V8G A;  4KLW A;  4CRY B;  4PPZ A;  3KHX A;  3TO7 A;  3PB8 X;  1LAM A;  4AVB A;  4EWT A;  4E0A A;  1Z2L A;  2ZEN A;  2XEJ A;  1HDQ A;  3BJ7 A;  3CDX A;  4UWI A;  4DUK A;  3BUX B;  1AYE A;  2P6G A;  4Q7A A;  4EFD A;  1RTQ A;  2XPP A;  2GU2 A;  1YRE A;  4CAE A;  4ZY0 A;  3HUV A;  1KBL A;  2ANP A;  5F13 A;  2Q7S A;  2AFS A;  5A28 A;  2DIK A;  1Z8L A;  3WAB A;  1VHS A;  3SXN A;  3B7I A;  2EBJ A;  4CGP A;  4C8A A;  1S7L A;  4MFQ A;  2PVW A;  3TLY A;  2GLJ A;  1IOI A;  4UIB A;  5JGF A;  5E96 A;  3BI0 A;  4A38 A;  5J1Q A;  2G9D A;  3LMS A;  4KSI A;  4CGL A;  3PGP A;  3QAY A;  4QVT A;  1VI4 A;  3KRV A;  2YNE A;  6CPA A;  4ZGY B;  5IX3 A;  5HKZ A;  3S9M A;  2FL4 A;  4B13 A;  3EZE A;  1LCP A;  2CIJ A;  4FD6 A;  2EUI A;  4XPK A;  4MFL A;  4B5P B;  1IIC A;  4MI4 A;  5KTD A;  1OZP A;  1TKF A;  1F57 A;  1VBH A;  2Y0M A;  1P0H A;  2PE3 A;  1DIK A;  1OBR A;  1I12 A;  1ARL A;  3D2M A;  4NGQ A;  4MY3 A;  1Y7E A;  2NYQ A;  4WWV A;  1CS0 B;  2HV2 A;  3T9Y A;  2ZW4 A;  2ZEL A;  4Q36 A;  2FIW A;  2FS5 A;  3D67 A;  3IFE A;  4NSQ A;  4LX9 A;  3BUW B;  4UFW A;  2HB6 A;  1CBX A;  4RR2 B;  2QML A;  2AUM A;  2D0P A;  1YLE A;  3TE4 A;  4J0N A;  2VQY A;  3FYN A;  3TLC A;  1Y9K A;  2ZEP A;  3FVL A;  1VGY A;  3SI2 A;  4XPD C;  3EO4 A;  2P0W A;  1QSN A;  3LWU A;  4ZY2 A;  3SI0 A;  2B3V A;  2CY2 A;  1IID A;  1WK4 A;  2D4P A;  2OH1 A;  4IAV A;  2N3A B;  4MBU A;  4MFZ A;  3G8W A;  1NE9 A;  4ZX8 A;  2WPW A;  3B3S A;  3HPH E;  2BEI A;  3KR4 A;  3P2F A;  4I49 A;  1FBV A;  3KAS A;  2R82 A;  3FEC A;  2ZOF A;  2PJ0 A;  4Z65 A;  4PK3 A;  3T8W A;  2RFH A;  3KQX A;  2GAN A;  2Q43 A;  3PFV A;  2HC9 A;  4MCS A;  4LUA A;  5BWA B;  3VRN A;  2ZEM A;  1KZF A;  4MI1 A;  4CZ1 A;  4F8Z A;  5JYB A;  4MJX A;  3T90 A;  4C85 A;  3SJX A;  4X3R A;  1LAP A;  2VBQ A;  4X2T A;  1TKH A;  3CPX A;  3IWG A;  1ELL P;  1A9X B;  4P10 A;  5F1Y A;  4OC3 A;  2Z3N A;  1ZRS A;  2J8M A;  4C7H A;  2B0A A;  3KKW A;  4A94 A;  4RUH A;  1NSA A;  3B3W A;  2REF A;  4NGS A;  1LOK A;  2YND A;  3FX6 A;  2I00 A;  5J3X A;  4PSX A;  4G1P A;  4TJX A;  4COG A;  4KOX A;  5AXI A;  1R43 A;  3G3S A;  4KUA A;  4XNH B;  2HWG A;  1KC7 A;  4P4I A;  1IGB A;  3H8E A;  2EK9 A;  3NE7 A;  2CF4 A;  3TCV A;  2GP4 A;  3U88 C;  4LQG A;  1BAV A;  1YSJ A;  4FD4 A;  3V38 A;  3W6S A;  3I74 A;  1CP7 A;  3GLJ A;  3IEH A;  4XNH C;  2Y1N A;  4C9E A;  2ZED A;  5LRK A;  2VZZ A;  2BOA A;  1QQ9 A;  2ODF A;  1JDB C;  1ZG9 A;  2FXF A;  3KQZ A;  3VAT A;  5FD8 A;  2EZC A;  3K9T A;  4JWP A;  1AUG A;  4MMO A;  4MHY A;  4PV6 A;  5K8N A;  4MCP A;  2XPL A;  2Z0Z A;  3BJ8 A;  5K8P A;  2HQY A;  4Q38 A;  2J8N A;  1P4N A;  3PB9 X;  2ZXV A;  4OID A;  1QSO A;  3FBU A;  4KVX A;  2PVV A;  3V7Z A;  3IWW A;  1LAN A;  5LYF A;  1PUA A;  3K9U A;  4CRZ B;  4OC4 A;  2J9A A;  2Q51 A;  2C5Q A;  3BUM B;  1EE3 P;  4TWE A;  2VL1 A;  3PFE A;  2GFQ A;  1S3Z A;  3RBU A;  1TF8 A;  1YW4 A;  2OZG A;  4KOS A;  2QJ8 A;  1LFW A;  3C8O A;  2PJ5 A;  2I79 A;  3DR6 A;  3TC8 A;  4CYQ A;  3T07 A;  4P45 A;  2BSW A;  4JXQ A;  4UCM A;  1YVH A;  2OR4 A;  2Z3K A;  5G22 A;  2AUN A;  3SR3 A;  4FD5 A;  1Z8X A;  2EK8 A;  2PDO A;  4GPL B;  3I1U A;  4UA3 A;  4X8I A;  3D7F A;  2JDC A;  2WZN A;  3R96 A;  1CJW A;  2B5G A;  2PCU A;  2PJ3 A;  3KHZ A;  2MP0 A;  1ZL0 A;  4CAX A;  4YFJ A;  4B5O A;  4PXE A;  4RS2 A;  2PJA A;  4IIX A;  1Z8W A;  4INJ A;  3SJF A;  5CBM A;  4C9R A;  2WSA A;  3F0A A;  3VRO A;  3S6H A;  1M1D A;  1QSR A;  1S7K A;  3R1K A;  2EZA A;  3EIF A;  3H4Q A;  5AG4 A;  5AG5 A;  4F0X A;  5F5X A;  2JBJ A;  3QAH A;  4OAE A;  3CPA A;  2XPN A;  1FT7 A;  1Z4E A;  3H5Z A;  5HVG A;  1CE8 B;  4PSW A;  4A4B A;  3L2N A;  2VKZ G;  3D7G A;  4QUS A;  3U1B A;  2CBL A;  4NF1 A;  2Z11 A;  4FD7 A;  3ZJ0 A;  2BCO A;  4C8T A;  2B4J C;  1YK3 A;  3NH4 A;  5HXD A;  2AE6 A;  3NFQ A;  1UFH A;  3D2P A;  3QNV A;  4DJL A;  1T36 B;  1CX8 A;  2QVP A;  4M6G A;  4P4F A;  4B10 A;  1EZA A;  3B2Y A;  2PJ9 A;  4KOV A;  2WUU A;  4KOT A;  1KUY A;  2AFW A;  1KUX A;  2B58 A;  1S60 A;  3KL9 A;  4NEX A;  3OB1 B;  1JWQ A;  4JD6 A;  4FAI A;  3RNZ A;  3H8F A;  5THW A;  1XFO A;  4PQA A;  2JDD A;  2PJ4 A;  3IIB A;  4HKF A;  4L8A A;  5AGE A;  2UV8 G;  3RO0 A;  4C7I A;  3ISX A;  4JYW A;  2OOT A;  3VRP A;  5I4M A;  1BXR B;  1VHE A;  2CTC A;  1M4D A;  2FVG A;  2POK A;  3GB0 A;  2XEG A;  4JLY A;  4M6H A;  1BPN A;  4PK2 A;  5HMN A;  5JQ4 A;  1XMT A;  4OAD A;  2PJ6 A;  3EZA A;  1X10 A;  3TOB A;  3OAK A;  1YVK A;  4AB7 A;  2JEW A;  3FRM A;  4B14 A;  3EXN A;  1J3L A;  4WJB A;  2JBK A;  2Q7B A;  4CYO A;  4HNY B;  3FF3 A;  4KVO E;  3UY5 A;  4BPU B;  5EMI A;  4P4J A;  2ZW6 A;  4U9Y A;  3KI9 A;  3FXT A;  3TLB A;  5D29 A;  1YVO A;  2P6F A;  3ZZI A;  2PRB A;  4AG7 A;  4M8D A;  3C26 A;  2PQ8 A;  2PSW A;  4AXV A;  1Q2C A;  2RC4 A;  4XPD B;  1VIX A;  3RZA A;  5H84 A;  5HVH A;  3GYA A;  3MRU A;  4UEE A;  1ZO0 A;  4ONU A;  3TYX A;  3CXS A;  4MCQ A;  3VWE A;  4JXR A;  4C2Z A;  4PXB A;  3BUO B;  2C6P A;  4Y49 C;  1YLO A;  1TKJ A;  2OU2 A;  4U5Y A;  1X12 A;  2HUZ A;  4A33 A;  4KSA A;  2C1C A;  1NBW A;  3TX8 A;  4UF4 A;  5KTC A;  2PJC A;  4COB A;  1IB1 E;  3DSB A;  4UCP A;  4QBJ A;  3D4U A;  3K4I A;  1LRZ A;  1YQE A;  4AVC A;  1MK4 A;  2ZEG A;  5GCN A;  1I1D A;  1Y0R A;  2B5G B;  2GRE A;  4ZYQ A;  3IU1 A;  3BXM A;  3GUX A;  2NSM A;  3GJZ A;  4ZI6 A;  4UBR A;  2D4O A;  4A4C A;  5HKW A;  4P4B A;  4UEF A;  2FCK A;  4M6I A;  2H5M A;  2ATR A;  4HPS A;  3ISZ A;  4R7M A;  1A2Z A;  4CS0 B;  2DPT A;  2CNS A;  3OWC A;  4H6U A;  2ARH A;  4DNC A;  3CT9 A;  3GY9 A;  5CPA A;  3FJU A;  1Z9U A;  4R57 A;  3PEI A;  2G0B A;  2C6C A;  2PJ1 A;  5FVJ A;  1UWY A;  3N5F A;  5BY0 A;  3PP9 A;  4A2Z A;  4CYP A;  2IL4 A;  3JVN A;  4MXU A;  1WJT A;  5F9M A;  1TIQ A;  3VTA A;  2NMT A;  4GS4 A;  4MRI A;  1M4I A;  4J3G A;  4C68 A;  2PJ8 A;  3BLN A;  4C9U A;  4NGR A;  4OC1 A;  1U6M A;  3PB4 X;  4YWY A;  3F5B A;  3RYO A;  3TOA A;  1B87 A;  5C82 A;  1BPM A;  2PIY A;  3VH9 A;  2YNC A;  2ZEF A;  3ZNI A;  3VWD A;  4BD9 A;  2PJB A;  2R7H A;  3T05 A;  4KSF A;  5LYD A;  4MCR A;  4NGT A;  1Q7L A;  2P6E A;  3DDD A;  1B47 A;  5J8C A;  2BUE A;  4KZT A;  2QEC A;  4JVO A;  3FIX A;  5EBV A;  4CPA A;  4C8C A;  4QC6 A;  4MFK A;  3HPG G;  1ZG7 A;  4H6Z A;  3SXO A;  4MHD A;  3TLA A;  1HDU A;  2JLM A;  4X5K A;  3FB3 A;  3TO6 A;  4A37 A;  3DR8 A;  2XEF A;  1JDE A;  3E0K A;  2RB7 A;  2Q0Y A;  4R76 A;  4O23 A;  7CPA A;  4YU9 A;  2O53 A;  4E8O A;  1JQG A;  3PLF B;  2DXQ A;  4NGM A;  1Z9E A;  2DF5 A;  2FIA A;  2Z10 A;  3FH4 A;  4H89 A;  1PU9 A;  4ORF A;  3RAM A;  2B4D A;  5I0C A;  5J8F A;  3JRU A;  3KZW A;  3TT2 A;  3DLJ A;  2Q4Z A;  2YGW A;  3JUW A;  3PBB A;  2ZPA A;  2GIV A;  2FE7 A;  4HNX B;  3LAC A;  1S7N A;  3D3S A;  3N7Z A;  1VBG A;  3R9G A;  4NXY A;  4P4E A;  1ZYM A;  4KLV A;  4C8F A;  5LYI A;  3I9S A;  4QB9 A;  3A9L A;  3B3C A;  4U9Z A;  2PR1 A;  2V8H A;  1CG2 A;  1XOV A;  4MHP A;  4KOY A;  5AG7 A;  3WT4 A;  2ZW7 A;  5LYL A;  1B6B A;  1ELM P;  1QSM A;  4JJX A;  4KVM E;  4E94 A;  1KUV A;  1EZB A;  3VRR A;  4F0Y A;  1IYL A;  3T5M A;  4F9U A;  5IV0 A;  1NMT A;  2G3T A;  4NFR A;  2I3C A;  3I3G A;  4YN3 A;  3TLG A;  5IR2 A;  3DGV A;  4NJQ A;  4OIW A;  3NA6 A;  4FWU A;  3R95 A;  4IUS A;  1BLL E;  2ZW5 A;  3PZJ A;  4MHZ A;  5JM6 A;  2OB0 A;  2FSR A;  1L0C A;  5IB0 A;  4IF5 A;  2CNM A;  2AFX A;  4P6Y A;  3F8K A;  3SI1 A;  4CAW A;  1EO0 A;  2Z3O A;  3G23 A;  3NH8 A;  2QIR A;  4EME A;  1F2P A;  3PRT A;  1XF8 A;  3LD2 A;  2FT0 A;  1N71 A;  4H2K A;  3SJE A;  3PFO A;  1M6V B;  1NXJ A;  1Q2Y A;  3DNS A;  8CPA A;  3NOJ A;  4KOU A;  1XIX A;  3TO9 A;  4B11 A;  3T0T A;  4OLL A;  4ONW A;  5HH1 A;  3QB8 A;  1M4G A;  1Y9Z A;  4JZ0 A;  2Y1M A;  2B3U A;  4BPX B;  1XEB A;  1XRY A;  4R8F A;  5DWN A;  5H86 A;  3S6F A;  2HI6 A;  4C99 A;  4L89 A;  4M3S A;  1CP6 A;  2OZU A;  4CAF A;  3NH5 A;  3FMC A;  2R8V A;  3PT1 A;  4CDJ A;  2BO9 A;  1IU8 A;  3V8I A;  4BBH A;  4CDK A;  4A30 A;  2AFU A;  2G3A A;  3S6G A;  4B6Z A;  2AJ6 A;  3PB6 X;  4ZBG A;  5HVF A;  4E2A A;  1XF1 A;  4KNG E;  5F09 A;  2IMO A;  3GIU A;  4A32 A;  1ZLI A;  2YNC C;  5DS0 A;  2IQ6 A;  2REE A;  1KWM A;  4F6A A;  1R57 A;  5AG6 A;  3I6S A;  2JEV A;  4KUB A;  4Y49 B;  1CPX A;  4ZY1 A;  4OC2 A;  2EVN A;  4II9 A;  2OLS A;  3IC1 A;  1AMP A;  1YR0 A;  1BOB A;  2B4B A;  2QYV A;  3EY5 A;  2V8D A;  4UCN A;  3FED A;  4YRH A;  2DEA A;  2Z3L A;  1YW6 A;  5F48 A;  3TTH A;  4BMH A;  2D0O A;  3TLE A;  2C6G A;  3VGO A;  1YX0 A;  1XE4 A;  4P44 A;  2VI7 A;  1IYK A;  2PCN A;  1XJO A;  2BL1 A;  4OC5 A;  5ELY A;  1Z4R A;  2CXA A;  2F8H A;  5C88 A;  5IB9 A;  3HMJ G;  3TLZ A;  1I21 A;  2YJT A;  2V8V A;  2B4D B;  2PIZ A;  3VRQ A;  3GKR A;  3JTK A;  4OP4 A;  3W91 A;  2PJ2 A;  1J4J A;  2DPS A;  1FNO A;  4BIN A;  3O8Z A;  3LOD A;  4OME A;  4K3N A;  4CGM A;  4GXH A;  4RI1 A;  3NE8 A;  4OKO A;  2XPO A;  1V0C A;  1Y0Y A;  3CXQ A;  4IK2 A;  2ZEH A;  4KS9 A;  4CYN A;  2AFM A;  2F7V A;  1M4L A;  1DE4 C;  2GLF A;  3D7D A;  1V6C A;  4CO9 A;  2AFZ A;  3TFY A;  4TNU A;  1YME A;  5K8O A;  3D7H A;  5F49 A;  5D8N A;  5LRG A;  5K8M A;  1MJA A;  4YGO A;  3ICU A;  3EZB A;  1NSL A;  3P2H A;  4UWJ A;  2R1I A;  2WYR A;  5G21 A;  2DLA A;  1GYT A;  4LQ6 A;  4F9V A;  3TLG B;  2V77 A; 
#chains in the Genus database with same CATH homology
 2PJ7 A;  3H8G A;  1XBU A;  1TXR A;  1ZLH A;  1XMB A;  4P4D A;  3FEE A;  3IO1 A;  3HLP A;  1R3N A;  3WC5 A;  3BI1 A;  2ZEO A;  3WC7 A;  3WC6 A;  1ZG8 A;  4DYO A;  2AFO A;  4C86 A;  3D66 A;  3KR5 A;  3IJ3 A;  3VAR A;  2EWB A;  5JH9 A;  3S9N A;  4NGP A;  4C9V A;  2IJZ A;  3NFZ A;  4NJR A;  2XEI A;  1WVM A;  4ZX9 A;  1ARM A;  1CPS A;  4OC0 A;  3SJG A;  4UEZ A;  4C9A A;  3K2K A;  1H8L A;  1QMU A;  3D68 A;  4IHM A;  4C84 A;  1IY7 A;  2PRQ A;  2ZOG A;  2ZEE A;  4R6T A;  3B3T A;  4A39 A;  3MN8 A;  1PYT B;  4PXC A;  4C8U A;  5LRJ A;  2O4H A;  3PB7 X;  4TJV A;  1HEE A;  4FBE A;  4GM5 A;  1TF9 A;  4MHN A;  3S9L A;  3KGQ A;  3BHX A;  3B3V A;  4UIA A;  4PXD A;  4FUU A;  1VHO A;  1Z5R A;  1PCA A;  4W9Y A;  3B35 A;  2ABZ A;  3PBE A;  1DTD A;  4NGN A;  2CTB A;  1F2O A;  2V8G A;  4PPZ A;  3KHX A;  3PB8 X;  1LAM A;  4EWT A;  1Z2L A;  2ZEN A;  2XEJ A;  1HDQ A;  3CDX A;  4DUK A;  1AYE A;  4Q7A A;  4EFD A;  1RTQ A;  2GU2 A;  3HUV A;  2ANP A;  2AFS A;  1Z8L A;  3WAB A;  3B7I A;  4C8A A;  2PVW A;  2GLJ A;  4UIB A;  5J1Q A;  5JGF A;  4A38 A;  3BI0 A;  3I6S A;  2G9D A;  3LMS A;  4KSI A;  6CPA A;  3S9M A;  1LCP A;  2CIJ A;  1TKF A;  1F57 A;  2PE3 A;  1OBR A;  1ARL A;  4NGQ A;  1Y7E A;  2NYQ A;  4WWV A;  2ZEL A;  3D67 A;  3IFE A;  2HB6 A;  1CBX A;  2ZEP A;  3FVL A;  1VGY A;  3SI2 A;  3SI0 A;  3LWU A;  4ZY2 A;  4IAV A;  4ZX8 A;  3B3S A;  3KR4 A;  3KAS A;  3FEC A;  2ZOF A;  2PJ0 A;  4Z65 A;  3T8W A;  2RFH A;  3KQX A;  2Q43 A;  2HC9 A;  4MCS A;  2ZEM A;  4F8Z A;  4C85 A;  3SJX A;  4X3R A;  1LAP A;  4X2T A;  1TKH A;  3CPX A;  1ELL P;  4P10 A;  4OC3 A;  4A94 A;  4RUH A;  1NSA A;  3B3W A;  4NGS A;  1LOK A;  3FX6 A;  4TJX A;  4G1P A;  1R43 A;  4P4I A;  1IGB A;  3H8E A;  2EK9 A;  2CF4 A;  2GP4 A;  3V38 A;  4LQG A;  1BAV A;  1YSJ A;  3I74 A;  1CP7 A;  3GLJ A;  3IEH A;  4C9E A;  2ZED A;  5LRK A;  2BOA A;  1QQ9 A;  1ZG9 A;  3KQZ A;  3VAT A;  3K9T A;  4MMO A;  4MHY A;  5K8P A;  5K8N A;  4MCP A;  3PB9 X;  4OID A;  2PVV A;  3V7Z A;  3IWW A;  1LAN A;  5LYF A;  4OC4 A;  2J9A A;  2Q51 A;  2C5Q A;  1EE3 P;  4TWE A;  2VL1 A;  3PFE A;  1TF8 A;  3RBU A;  1YW4 A;  2QJ8 A;  1LFW A;  2PJ5 A;  3TC8 A;  4P45 A;  2OR4 A;  2EK8 A;  3I1U A;  4X8I A;  3D7F A;  2WZN A;  2PCU A;  2PJ3 A;  3KHZ A;  4PXE A;  2PJA A;  3SJF A;  5CBM A;  3EIF A;  2JBJ A;  3CPA A;  1FT7 A;  5HVG A;  3L2N A;  3D7G A;  4C8T A;  2BCO A;  3NH4 A;  5HXD A;  3QNV A;  4DJL A;  1CX8 A;  2QVP A;  4P4F A;  4C9R A;  3B2Y A;  2PJ9 A;  2AFW A;  3KL9 A;  4FAI A;  3H8F A;  5THW A;  1XFO A;  4PQA A;  2PJ4 A;  3IIB A;  3ISX A;  4JYW A;  2OOT A;  1VHE A;  2CTC A;  2POK A;  2FVG A;  3GB0 A;  2XEG A;  1BPN A;  2PJ6 A;  2JEW A;  4WJB A;  2JBK A;  3FF3 A;  4P4J A;  3KI9 A;  5D29 A;  4AXV A;  1VIX A;  3RZA A;  5HVH A;  3MRU A;  4UEE A;  4MCQ A;  4PXB A;  2C6P A;  1YLO A;  1TKJ A;  2C1C A;  3TX8 A;  4UF4 A;  2PJC A;  3D4U A;  2ZEG A;  1Y0R A;  2GRE A;  4ZYQ A;  3BXM A;  3GUX A;  2NSM A;  4ZI6 A;  4P4B A;  4UEF A;  3ISZ A;  4R7M A;  3CT9 A;  5CPA A;  3FJU A;  3PEI A;  2C6C A;  2PJ1 A;  1UWY A;  3N5F A;  4MXU A;  3VTA A;  4MRI A;  4C9U A;  2PJ8 A;  4NGR A;  4OC1 A;  3PB4 X;  4YWY A;  5I4M A;  1BPM A;  2PIY A;  3VH9 A;  2ZEF A;  4BD9 A;  2PJB A;  5LYD A;  4MCR A;  4NGT A;  1Q7L A;  4CPA A;  4C8C A;  1ZG7 A;  1HDU A;  4A37 A;  2XEF A;  2RB7 A;  4R76 A;  4O23 A;  7CPA A;  4YU9 A;  2O53 A;  1JQG A;  4NGM A;  3FH4 A;  3RAM A;  3JRU A;  3KZW A;  3DLJ A;  2Q4Z A;  3PBB A;  4P4E A;  4C8F A;  5LYI A;  3B3C A;  2V8H A;  1CG2 A;  4MHP A;  3WT4 A;  5LYL A;  1ELM P;  4F9U A;  4YN3 A;  4NFR A;  2I3C A;  5IR2 A;  3DGV A;  4NJQ A;  4OIW A;  3NA6 A;  4FWU A;  1BLL E;  4MHZ A;  5JM6 A;  4P6Y A;  2AFX A;  3SI1 A;  3NH8 A;  4EME A;  1F2P A;  3PRT A;  4H2K A;  3SJE A;  3PFO A;  8CPA A;  4ONW A;  1Y9Z A;  4JZ0 A;  4R8F A;  1XRY A;  4C99 A;  1CP6 A;  3NH5 A;  3FMC A;  4CDJ A;  2BO9 A;  4CDK A;  2AFU A;  4B6Z A;  3PB6 X;  5HVF A;  1XF1 A;  4KNG E;  5F09 A;  2IMO A;  1ZLI A;  5DS0 A;  2IQ6 A;  1KWM A;  4C8P A;  4ZY1 A;  1CPX A;  4OC2 A;  3IC1 A;  1AMP A;  2QYV A;  2V8D A;  3FED A;  2DEA A;  1YW6 A;  2C6G A;  4P44 A;  1XJO A;  4OC5 A;  5ELY A;  5IB9 A;  2F8H A;  2V8V A;  2PIZ A;  4OP4 A;  2PJ2 A;  1FNO A;  4K3N A;  4OME A;  4OKO A;  1Y0Y A;  4ZY0 A;  4IK2 A;  2ZEH A;  2AFM A;  2F7V A;  1M4L A;  1DE4 C;  2GLF A;  3D7D A;  1V6C A;  2AFZ A;  4TNU A;  1YME A;  5K8O A;  3D7H A;  5D8N A;  5LRG A;  5K8M A;  3ICU A;  2WYR A;  1GYT A;  4F9V A;  2V77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...