4MCRA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyltri-gamma-l-glutamic acid (pteroyltetra-gamma-l-glutamic acid)
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
695
structure length
693
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 269
structure length 693
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcrA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcrA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcrA02
3D68A 4C8CA 1LCPA 4P4IA 1UWYA 4P10A 3KZWA 3SI2A 4YWYA 5D8NA 3D7DA 1Y0RA 2O53A 1R43A 4AXVA 2ZEPA 3L2NA 3PB7X 3BHXA 3MRUA 1IY7A 4MXUA 3D7HA 1XRYA 5K8MA 5LRJA 2ZEDA 2C6PA 3BXMA 3CDXA 2PJ2A 5K8OA 2BCOA 1F2PA 1VGYA 2PJCA 1Z2LA 1XJOA 4A39A 3BI0A 4F8ZA 2QVPA 4MCSA 3GUXA 4MHNA 2ZENA 4O23A 4ZY1A 2GLFA 4ZY2A 4C8UA 2PJ6A 3IO1A 4C8FA 2JBKA 4NGQA 1DE4C 3D7GA 3I1UA 1BPMA 4C85A 1TXRA 2IJZA 2CTCA 4TJXA 2WYRA 3D67A 3PB8X 4NGNA 1BPNA 2WZNA 5I4MA 2IQ6A 5HVFA 3FJUA 3NH8A 3NA6A 1QQ9A 1WVMA 2PJ4A 3B7IA 2GU2A 3PRTA 4P4EA 5CBMA 3SI1A 3B3TA 2PJBA 2Q51A 1ZLIA 4ZYQA 2BO9A 1CP7A 3PB9X 3LMSA 3CPAA 2XEGA 2V8HA 1XMBA 3ISZA 4A38A 4P45A 3KASA 4JYWA 1F57A 2AFXA 2ZEEA 4MCPA 4PXCA 5HVGA 3IC1A 5JH9A 3RAMA 2F7VA 1LAMA 3IWWA 4OP4A 1Y9ZA 6CPAA 4NGSA 1ARLA 3B35A 3ISXA 1VHOA 1CP6A 4DJLA 5HXDA 3CPXA 4C84A 4WJBA 4DUKA 5ELYA 5LRKA 3VH9A 2RB7A 3H8GA 2ZELA 4P4BA 3WC7A 3KI9A 2G9DA 3K2KA 3VARA 1TF8A 4P4JA 4C9VA 2IMOA 1CPXA 2NYQA 4C8AA 4X2TA 5K8PA 3K9TA 1LAPA 1PCAA 2ANPA 4TWEA 4C99A 4MHZA 5K8NA 1CBXA 2EK8A 5LYFA 1Y0YA 3SI0A 4W9YA 1HDQA 4IAVA 4ZX9A 4H2KA 2AFOA 4MRIA 2EWBA 2AFMA 3DGVA 2PJAA 2ZEOA 2ABZA 4JZ0A 4EMEA 1XBUA 1ZG8A 4NJRA 1YLOA 4OKOA 4ZY0A 4KNGE 4FAIA 1Z5RA 3WABA 3B3VA 1ZG9A 2V8DA 3V38A 5F09A 3FECA 2ZEHA 1KWMA 1FT7A 4G1PA 5HVHA 2C1CA 1YW4A 1JQGA 2EK9A 5D29A 1Y7EA 3KHZA 4NJQA 2PJ5A 1YW6A 4DYOA 3S9LA 3KHXA 2Q4ZA 2CIJA 4MCRA 3ICUA 2FVGA 4C9AA 2PJ8A 4IHMA 3NFZA 1H8LA 5LYDA 3IEHA 5DS0A 4NGMA 1ARMA 3FX6A 4OIDA 2HB6A 4X8IA 3JRUA 3H8EA 2PJ9A 4WWVA 4TJVA 3KL9A 4P4DA 3SJGA 2Q43A 2PVVA 3KGQA 1NSAA 2QJ8A 3HLPA 2PIZA 5LYLA 3KR5A 3RBUA 1RTQA 1VHEA 5JGFA 2AFWA 1Z8LA 2JBJA 4OIWA 2GREA 4X3RA 1FNOA 3WT4A 2V77A 3FF3A 3FEDA 4C9EA 3MN8A 4YN3A 2I3CA 3B2YA 4MMOA 3NH5A 3CT9A 3KR4A 1PYTB 2F8HA 2OR4A 3N5FA 1R3NA 4R8FA 1BAVA 4OC5A 3TC8A 5CPAA 4OC2A 3B3WA 5LYIA 4EFDA 2PJ1A 4F9UA 4A94A 3VTAA 1V6CA 4A37A 1TKHA 4NGPA 3GLJA 4PXBA 1YSJA 2PCUA 1CPSA 3S9MA 1TKFA 2PVWA 2POKA 3H8FA 4OC1A 1F2OA 4NGTA 4PXDA 1ELMP 2V8VA 1YMEA 3D66A 2PIYA 4R6TA 3GB0A 4UIAA 4PPZA 1Q7LA 2ZEFA 3NH4A 3EIFA 3KQZA 3QNVA 4KSIA 3VATA 2C6CA 1BLLE 4RUHA 3PEIA 2JEWA 2C6GA 2PJ7A 8CPAA 1TF9A 3DLJA 1VIXA 1LANA 4EWTA 2XEJA 3HUVA 4FBEA 4ONWA 4P44A 4TNUA 3PBEA 3IJ3A 4YU9A 2PJ3A 1ELLP 2J9AA 3BI1A 3FVLA 2AFSA 2ZOFA 2V8GA 4PXEA 3IFEA 4C86A 5IB9A 3WC5A 2ZEMA 3FMCA 4P4FA 4NGRA 4MCQA 4ZI6A 2XEFA 4GM5A 3KQXA 3RZAA 3D7FA 4UEZA 2PE3A 4C8TA 1HDUA 2XEIA 7CPAA 4OC4A 4CDJA 1CG2A 2RFHA 3PFEA 3I6SA 4CDKA 5J1QA 4FUUA 4LQGA 2O4HA 4MHPA 4CPAA 5JM6A 2ZEGA 3B3SA 2AFUA 1GYTA 4K3NA 4OC0A 3SJXA 3PB4X 4UIBA 4Q7AA 3B3CA 4R76A 4C9RA 4C8PA 4B6ZA 2CF4A 3FEEA 2CTBA 3IIBA 4OC3A 3I74A 1CX8A 4FWUA 3T8WA 4UEEA 1ZG7A 3TX8A 1LFWA 2BOAA 5THWA 4IK2A 1QMUA 2GLJA 1IGBA 1OBRA 4NFRA 3PB6X 3SJFA 2PJ0A 3WC6A 4PQAA 1TKJA 1HEEA 1AMPA 3D4UA 2NSMA 4C9UA 3V7ZA 2ZOGA 4MHYA 1ZLHA 4UF4A 3PBBA 3S9NA 2HC9A 4ZX8A 1DTDA 1AYEA 4F9VA 4Z65A 2PRQA 4OMEA 2DEAA 3LWUA 3FH4A 1M4LA 2QYVA 4UEFA 1EE3P 3SJEA 3PFOA 1LOKA 1XFOA 2VL1A 4P6YA 5LRGA 1XF1A 2AFZA 4R7MA 4BD9A 2OOTA
chains in the Genus database with same CATH superfamily
5IV0A 3D68A 5EBVA 3SR3A 1Z9EA 2DF5A 2Z3KA 4JD6A 4KVME 1S5KA 2Y1NA 4UCNA 4C8CA 1LCPA 4P4IA 5J3XA 1UWYA 4XNHB 5G21A 4P10A 3TLYA 3BUXB 3FIXA 3KZWA 4H89A 4KOUA 4ZBGA 3SI2A 1GGOA 2A4NA 3I3GA 4E0AA 4YWYA 1Y9WA 5JPHA 3F8KA 5D8NA 1MJAA 5IB0A 3TLEA 3D7DA 2D0PA 1Y0RA 2O53A 1R43A 4KORA 5A28A 4KVOE 3B8GA 3PP9A 4AXVA 3HPHE 2I79A 2ZEPA 4UFXA 2YGWA 2Z3NA 3L2NA 3PB7X 4XPKA 3BHXA 3MRUA 4KUBA 4KS9A 3TCVA 4CRZB 1I21A 1IY7A 2HV2A 4MXUA 3D7HA 1XRYA 4C7IA 1QSRA 4UWIA 3TO7A 5K8MA 5LRJA 3S6KA 2OZGA 2ZEDA 2C6PA 3BXMA 3D8PA 4F0YA 3CDXA 2C5QA 2VZYA 2PJ2A 1FY7A 5K8OA 2BCOA 5AG5A 3EXNA 1F2PA 1VGYA 5F9MA 2PJCA 3W91A 3CXQA 3SHPA 4BPWB 1Z2LA 1XJOA 3PGPA 4A39A 3BI0A 3PLFB 1VKCA 5I0CA 4MI1A 3OP0A 1OZPA 4F8ZA 2OH1A 4CGOA 4QBJA 1M1DA 2F5IA 1S7NA 3TO6A 4CYNA 2B5GA 2C27A 2ARHA 1AUGA 2QVPA 3OWCA 4PSWA 3T90A 2AUNA 4MCSA 4JXQA 2EZAA 3GUXA 2R82A 3I9SA 5HKZA 4PSXA 4ZGYB 4MHNA 4C68A 2ZENA 3G8WA 2AE6A 4O23A 2FSRA 2GLFA 4XPLA 4ZY2A 4NCZA 2PJ6A 4ZY1A 1Z8TA 4C8UA 3IO1A 4CGMA 1MJ9A 1Z8WA 3BJ8A 3OB2B 2CY2A 1CE8B 1Q5XA 4C8FA 2BEIA 4OAEA 1X12A 2JBKA 4NGQA 4M85A 1DE4C 3D7GA 2OZHA 3EZEA 3RNZA 1Q2YA 3GJZA 3I1UA 1BPMA 2ZW6A 4C85A 3TO9A 1TXRA 1L0CA 4HNWB 5EMIA 4XPDB 5ISVA 2IJZA 1DIKA 2CTCA 3U88C 1EZBA 4TJXA 2WYRA 3D67A 3PB8X 5H86A 3EZBA 4NGNA 3BUMB 2CBLA 1BPNA 2WZNA 2CNTA 5AGEA 5I4MA 1YX0A 3NE8A 2CXAA 2IQ6A 5HVFA 3FJUA 4MFJA 3NH8A 5J8CA 3TOAA 2IL4A 3D2MA 3NA6A 1QQ9A 3W6SA 5JVLA 1WVMA 2B4BA 1S60A 2PJ4A 3TLGB 3B7IA 5A27A 1PU9A 2GU2A 3C8OA 2PDOA 4UA3A 3TE4A 3PRTA 2DPTA 4P4EA 5BWAB 5CBMA 4A95A 4Q36A 2Z3MA 3SI1A 2DIKA 2D4OA 1R57A 3B3TA 2PJBA 2Q51A 4MJ8A 5KTDA 1C3OB 1ZLIA 3T9YA 4ZYQA 1B6BA 2BO9A 3EC4A 1CP7A 2YJVA 3PB9X 3LMSA 4MFLA 3CPAA 2XEGA 3VROA 2V8HA 1XMBA 3ISZA 4A38A 3JTKA 3SXNA 1I12A 2FIAA 4P45A 3GIUA 5F49A 3KASA 3QAHA 4CGLA 4JYWA 2B58A 4QC6A 4Y49B 1J3LA 1F57A 1T36B 4MI4A 2AFXA 2ZEEA 4MCPA 4PXCA 4MFQA 1U6MA 3SXOA 5HVGA 3IWEA 2DLAA 1B87A 3IC1A 2VXKA 3RAMA 5JH9A 2F7VA 1LAMA 4COGA 3IWWA 2BSWA 2VZZA 3TOBA 2E28A 4OP4A 1R61A 3EZAA 2ZW5A 4MFZA 6CPAA 4OADA 4R9MA 4NGSA 4EVYA 1Y9ZA 5C88A 1ARLA 3B35A 2EBJA 3ISXA 1QSNA 2HWGA 4CYPA 1VHOA 1NMTA 2DPSA 5F46A 3T05A 1CP6A 4DJLA 5HXDA 4CAEA 2OB0A 3CPXA 1BOBA 1N71A 4C84A 3TLZA 1LRZA 1X10A 1PUAA 5HKWA 4I49A 4WJBA 4DUKA 5ELYA 4CAXA 5LRKA 1ZRSA 5F5XA 3VH9A 2RB7A 4GS4A 1KUVA 1XOVA 2J8RA 3OAKA 3H8GA 3P2FA 2B0AA 2ZELA 4P4BA 1M44A 4UFWA 1A9XB 3R95A 2PRBA 1IYLA 1YR0A 1A2ZA 4K30A 3WC7A 3F0AA 3KI9A 2G9DA 3K2KA 4GXHA 1JWQA 3S6GA 3VARA 1TF8A 2GIVA 4CAWA 5J8FA 4P4JA 1M4IA 4C9VA 1IOFA 3S6FA 2IMOA 1CPXA 1IB1E 2NYQA 4C8AA 4KZTA 4R3LA 4X2TA 3P2HA 4M3SA 5K8PA 2HROA 3K9TA 3TLGA 1LAPA 1PCAA 2ANPA 3DR6A 4KUAA 5AG7A 2PC1A 3CXSA 4TWEA 4C99A 4MHZA 5G20A 5K8NA 2FS5A 3OB1B 1CBXA 2EK8A 5LYFA 2D0OA 1Y0YA 4KOWA 4QB9A 5F13A 3R1KA 3VWEA 1QSMA 3VRNA 3SI0A 5C82A 4W9YA 3QB8A 5HH1A 4H6ZA 1XIXA 1HDQA 4IAVA 4ZX9A 4H2KA 1ON0A 2AFOA 4A2ZA 4MRIA 2EWBA 2AFMA 4ORFA 1S3ZA 3DGVA 4C7HA 3TLAA 2FL4A 2PJAA 2ZEOA 2ABZA 3FYNA 4FD7A 1BXRB 4JZ0A 4MFPA 4C2XA 1XBUA 3CZXA 4EMEA 1ZG8A 1KZFA 4CAFA 4J0NA 4NJRA 3BJ7A 2FT0A 1YLEA 3T0TA 1CS0B 1YLOA 4BINA 4OKOA 4ZY0A 4KNGE 3FB3A 4L8AA 2QIRA 4FAIA 1Z5RA 3WABA 2G3TA 3B3VA 1UFHA 2AJ6A 1ZG9A 2P0WA 2Q7SA 3A9LA 5G22A 3D2PA 3NOJA 2V8DA 3V38A 3N7ZA 4A30A 4J3GA 5F09A 3FECA 3R9EA 4KOYA 2VQYA 1Y9KA 2Q4YA 1KWMA 2ZEHA 1FT7A 3IWGA 2OZUA 4PK3A 4G1PA 4HNXB 5HVHA 3BUOB 1YW4A 2C1CA 4MY3A 3LACA 1KUYA 1S7LA 4PK2A 4YGOA 1VBHA 5KTCA 1YVOA 1JQGA 2EK9A 1M4GA 1YK3A 4CO9A 1Z9UA 2R8VA 5D29A 2B3UA 1SQHA 2ZXVA 1Y7EA 3KHZA 4NJQA 2YNEA 2PJ5A 1YW6A 4DYOA 3FRMA 3S9LA 3KHXA 3K4IA 3F5BA 1CJWA 4LX9A 4XNHC 3RYOA 1EO0A 1Z4RA 3PZJA 2Q4ZA 2CIJA 4A32A 1EZAA 4MCRA 3ICUA 3VRRA 2FVGA 4NXYA 2PJ8A 4C9AA 2BUEA 3NFZA 1H8LA 1K4JA 2J8NA 4IHMA 2ZW7A 5LYDA 3IEHA 2FE7A 4FD4A 1WJTA 5DS0A 1Q2DA 4NGMA 1ARMA 3FX6A 2REEA 2YNCC 4OIDA 4KVXA 2HB6A 4CYOA 5H84A 4X8IA 1MJBA 3H8EA 2PJ9A 3JRUA 4WWVA 2FM4A 1VHSA 4KOSA 4B5PA 1Y7RA 4TJVA 1MK4A 3S6HA 4YFJA 3BUWB 3KL9A 3IU2A 4XPDC 4P4DA 3SJGA 4X5KA 5KTAA 4UWJA 1JDEA 2Q43A 2Y0MA 2PVVA 4B5OA 2Z0ZA 3EFAA 4YRHA 3KGQA 4B14A 4B11A 2O28A 4B12A 1NSAA 2QJ8A 3HLPA 4E2AA 2PIZA 3HMJG 5F47A 4UCMA 4FD5A 5LYLA 3U1BA 3FNCA 3KR5A 3RBUA 4R3KA 1RTQA 5BY0A 4IIXA 1VHEA 2J8MA 5JGFA 2AFWA 1Z8LA 2JBJA 4NEXA 4JVOA 2JDCA 4OIWA 1NXJA 3JUWA 2GREA 4JJXA 4F6AA 1ZYMA 4FD6A 1IU8A 4X3RA 1FNOA 3GY9A 3WT4A 1ZO0A 3GKRA 2V77A 3FF3A 1YREA 5FD8A 3FEDA 4A4BA 4C9EA 3MN8A 3IGRA 2I3CA 3B2YA 4MMOA 4YN3A 1KEEB 4E5SA 1I1DA 3NH5A 2REFA 3CT9A 3KR4A 1PYTB 4INJA 4R87A 1QSTA 2Z11A 2F8HA 4AVCA 5IX3A 2EO8A 2GFQA 2OR4A 4CGPA 4CRYB 2WPXA 4H1HA 3N5FA 1R3NA 4R8FA 1BAVA 4JLYA 4OC5A 3TC8A 2JEVA 5CPAA 4MBUA 3F9KC 4OC2A 3B3WA 4Y49C 2PSWA 5LYIA 4EFDA 2PJ1A 4UCPA 4AVAA 3MGDA 1Q2CA 4F9UA 3FBUA 2HQYA 4A94A 1ZL0A 3VTAA 2VKZG 3R9GA 3R96A 5F48A 1V6CA 1WK4A 4A37A 1TKHA 2ODFA 4ONUA 2HI6A 4NGPA 3GLJA 4M6IA 5K99A 2DXQA 4PXBA 1YSJA 2HUZA 2PCNA 2PCUA 3TYXA 3PFVA 1CPSA 3S9MA 2EUIA 3CXPA 5AXIA 2PVWA 1TKFA 1RXTA 2G0BA 2POKA 3O8ZA 3H8FA 4OC1A 2R7HA 1XE4A 2FIWA 3NFQA 3H5ZA 4LQ6A 2BL1A 2Z3LA 1NE9A 4RI1A 1F2OA 3KRVA 3G3SA 3TLBA 4NGTA 4PXDA 1ELMP 2V8VA 1J4JA 1YMEA 1IICA 2PIYA 3D66A 4R6TA 3VRQA 3GB0A 4UIAA 3NE7A 1V0CA 1Q7LA 2ZEFA 3NH4A 4PPZA 2WPWA 4QUSA 5E96A 3KQZA 3QNVA 3WR7A 4F0XA 3EIFA 5FVJA 2GP4A 2X7BA 4KSIA 3VATA 2C6CA 2OU2A 4HNYB 1BLLE 4RUHA 1KC7A 4OLLA 3R9FA 3PEIA 2I00A 2JEWA 2CNMA 2Z3OA 2Q7BA 2C6GA 1M4DA 2PJ7A 3UY5A 2JDDA 4II9A 1JDBC 8CPAA 3DSBA 3QAYA 1TF9A 1VIXA 2R98A 1LANA 3DDDA 3DLJA 4EWTA 2XEJA 2ZW4A 3HUVA 4M6HA 4FBEA 4ONWA 4P44A 4PV6A 4TNUA 4C2ZA 3PBEA 3IJ3A 4B10A 4YU9A 2PJ3A 1ELLP 2J9AA 4A33A 3BI1A 2Q4VA 4BPUB 3FVLA 2AFSA 2ZOFA 4AB7A 4JWPA 2V8GA 4IUSA 3VRPA 3K9UA 4PXEA 4U9YA 4BBHA 3IFEA 4KSAA 1YVHA 5IB9A 3WC5A 4C86A 1RO5A 2XPNA 2Q0YA 2XPOA 2ZEMA 3FMCA 1NSLA 4Q38A 2VI7A 3T07A 5JQ4A 4P4FA 2Z10A 4AG7A 4DNCA 4BTFA 4E8OA 4E94A 1P4NA 2R1IA 4NSQA 2G3AA 2FXFA 4B13A 4NGRA 4MCQA 2Y1MA 2XEFA 1S7FA 4ZI6A 5HMNA 5HKYA 4A4CA 4GM5A 2YNDA 3KQXA 2YJTA 1XF8A 3RZAA 2AUMA 3D7FA 4UEZA 2H5MA 1GHEA 2PE3A 4C8TA 1HDUA 2XEIA 3PT1A 2X0SA 7CPAA 4OC4A 4CDJA 4JXRA 4CGNA 2VBQA 1CG2A 4M6GA 4C2YA 3TFYA 2KCWA 1B47A 3LD2A 1NBWA 3ZJ0A 2B5GB 2RFHA 3E0KA 3PFEA 5AG6A 3I6SA 4CDKA 4EYSA 3FXTA 3D3SA 5J1QA 2CNSA 4FUUA 4KOVA 4LQGA 2B4DA 2O4HA 4MHPA 4IF5A 4CPAA 5JM6A 2AFUA 2ZEGA 3B3SA 4KLWA 1GYTA 4K3NA 4OC0A 3SJXA 2P6EA 3V8IA 3PB4X 3DNSA 3BUNB 1CM0A 2JLMA 4UIBA 5GCNA 4Q7AA 3TLCA 3B3CA 4R76A 4M8DA 4C9RA 4C8PA 4CZ1A 4GPLB 3JVNA 4B6ZA 2B4JC 2B4DB 2CF4A 3FEEA 4KSFA 5DWMA 4CAVA 4IIYA 3T5MA 1KBLA 4AVBA 2CTBA 4CS0B 4U9ZA 4BPXB 4KOTA 3IIBA 1BO4A 4OC3A 1S7KA 2XPPA 4HKFA 5IR2A 4COBA 3I74A 4MY0A 1CX8A 4FWUA 2QECA 2FCKA 3T8WA 1VBGA 4UEEA 3ZNIA 1ZG7A 4RS2A 2P6GA 3TX8A 2WSAA 1LFWA 2BOAA 3LODA 2GE3A 1IIDA 3EY5A 5THWA 1Z8XA 5F1YA 3H4QA 4IK2A 4CYQA 3VGOA 1QMUA 2QMLA 2GLJA 4MJXA 1YQEA 2PR1A 4AG9A 1IGBA 1OBRA 2K5TA 2PR8A 2XPLA 3GYAA 4NFRA 3C26A 3TT2A 2D4PA 3PB6X 2EVNA 3SJFA 2PJ0A 3TTHA 3WC6A 3KKWA 5G1ZA 2YNCA 2VEZA 4PQAA 4B5PB 4KOXA 4LUAA 5EC4A 3ZZIA 1TKJA 1VI4A 1HEEA 1AMPA 5AG4A 3D4UA 2Q04A 2NSMA 4C9UA 1Z4EA 4L89A 2P6FA 3V7ZA 2ZOGA 5CNPA 4MHYA 1ZLHA 4UF4A 1KUXA 4KLVA 4UFVA 1IYKA 3PBBA 3S9NA 2RC4A 3IU1A 2GANA 2HC9A 3VWDA 2EZCA 4R57A 4ZX8A 5DWNA 1DTDA 1AYEA 5JYBA 2UV8G 4F9VA 4Z65A 1QSOA 2OLSA 4NF1A 2Z3PA 4QVTA 4A31A 1XMTA 1P0HA 4UBRA 3HPGG 2PRQA 3DR8A 4OMEA 1FBVA 2ZPAA 1YGHA 4MHDA 2EZBA 1XEBA 1YVKA 2DEAA 2NMTA 3LWUA 3FH4A 1M4LA 2QYVA 2WUUA 4H6UA 4UEFA 2PQ8A 4RR2B 1EE3P 2ATRA 3W6XA 4RN7A 4U5YA 1C30B 3BLNA 3SJEA 1TIQA 3PFOA 1IOIA 3G23A 1LOKA 3EO4A 1XFOA 2VL1A 2B3VA 4P6YA 1M6VB 4MFKA 2MP0A 5LRGA 1XF1A 2AFZA 4R7MA 2Q44A 4BMHA 1WWZA 4BD9A 4HPSA 2N3AB 3RO0A 2OOTA
chains in the Genus database with same CATH topology
3D68A 4C8CA 1LCPA 4P4IA 1UWYA 4P10A 3KZWA 3SI2A 4YWYA 5D8NA 3D7DA 1Y0RA 2O53A 1R43A 4AXVA 2ZEPA 3L2NA 3PB7X 3BHXA 3MRUA 1IY7A 4MXUA 3D7HA 1XRYA 5K8MA 5LRJA 2ZEDA 2C6PA 3BXMA 3CDXA 2C5QA 2PJ2A 5K8OA 2BCOA 1F2PA 1VGYA 2PJCA 1Z2LA 1XJOA 4A39A 3BI0A 4F8ZA 2QVPA 4MCSA 3GUXA 4MHNA 2ZENA 4O23A 4ZY1A 2GLFA 4ZY2A 4C8UA 2PJ6A 3IO1A 4C8FA 2JBKA 4NGQA 1DE4C 3D7GA 3I1UA 1BPMA 4C85A 1TXRA 2IJZA 2CTCA 4TJXA 2WYRA 3D67A 3PB8X 4NGNA 1BPNA 2WZNA 5I4MA 2IQ6A 5HVFA 3FJUA 3NH8A 3NA6A 1QQ9A 1WVMA 2PJ4A 3B7IA 2GU2A 3PRTA 4P4EA 5CBMA 3SI1A 3B3TA 2PJBA 2Q51A 1ZLIA 4ZYQA 2BO9A 1CP7A 3PB9X 3LMSA 3CPAA 2XEGA 2V8HA 1XMBA 3ISZA 4A38A 4P45A 3KASA 4JYWA 1F57A 2AFXA 2ZEEA 4MCPA 4PXCA 5HVGA 3IC1A 5JH9A 3RAMA 2F7VA 1LAMA 3IWWA 4OP4A 1Y9ZA 6CPAA 4NGSA 1ARLA 3B35A 3ISXA 1VHOA 1CP6A 4DJLA 5HXDA 3CPXA 4C84A 4WJBA 4DUKA 5ELYA 5LRKA 3VH9A 2RB7A 3H8GA 2ZELA 4P4BA 3WC7A 3KI9A 2G9DA 3K2KA 3VARA 1TF8A 4P4JA 4C9VA 2IMOA 1CPXA 2NYQA 4C8AA 4X2TA 5K8PA 3K9TA 1LAPA 1PCAA 2ANPA 4TWEA 4C99A 4MHZA 5K8NA 1CBXA 2EK8A 5LYFA 1Y0YA 3SI0A 4W9YA 1HDQA 4IAVA 4ZX9A 4H2KA 2AFOA 4MRIA 2EWBA 2AFMA 3DGVA 2PJAA 2ZEOA 2ABZA 4JZ0A 4EMEA 1XBUA 1ZG8A 4NJRA 1YLOA 4OKOA 4ZY0A 4KNGE 4FAIA 1Z5RA 3WABA 3B3VA 1ZG9A 2V8DA 3V38A 5F09A 3FECA 2ZEHA 1KWMA 1FT7A 4G1PA 5HVHA 2C1CA 1YW4A 1JQGA 2EK9A 5D29A 1Y7EA 3KHZA 4NJQA 2PJ5A 1YW6A 4DYOA 3S9LA 3KHXA 2Q4ZA 2CIJA 4MCRA 3ICUA 2FVGA 4C9AA 2PJ8A 4IHMA 3NFZA 1H8LA 5LYDA 3IEHA 5DS0A 4NGMA 1ARMA 3FX6A 4OIDA 2HB6A 4X8IA 3JRUA 3H8EA 2PJ9A 4WWVA 4TJVA 3KL9A 4P4DA 3SJGA 2Q43A 2PVVA 3KGQA 1NSAA 2QJ8A 3HLPA 2PIZA 5LYLA 3KR5A 3RBUA 1RTQA 1VHEA 5JGFA 2AFWA 1Z8LA 2JBJA 4OIWA 2GREA 4X3RA 1FNOA 3WT4A 2V77A 3FF3A 3FEDA 4C9EA 3MN8A 4YN3A 2I3CA 3B2YA 4MMOA 3NH5A 3CT9A 3KR4A 1PYTB 2F8HA 2OR4A 3N5FA 1R3NA 4R8FA 1BAVA 4OC5A 3TC8A 5CPAA 4OC2A 3B3WA 5LYIA 4EFDA 2PJ1A 4F9UA 4A94A 3VTAA 1V6CA 4A37A 1TKHA 4NGPA 3GLJA 4PXBA 1YSJA 2PCUA 1CPSA 3S9MA 1TKFA 2PVWA 2POKA 3H8FA 4OC1A 1F2OA 4NGTA 4PXDA 1ELMP 2V8VA 1YMEA 3D66A 2PIYA 4R6TA 3GB0A 4UIAA 4PPZA 1Q7LA 2ZEFA 3NH4A 3EIFA 3KQZA 3QNVA 2GP4A 4KSIA 3VATA 2C6CA 1BLLE 4RUHA 3PEIA 2JEWA 2C6GA 2PJ7A 8CPAA 1TF9A 3DLJA 1VIXA 1LANA 4EWTA 2XEJA 3HUVA 4FBEA 4ONWA 4P44A 4TNUA 3PBEA 3IJ3A 4YU9A 2PJ3A 1ELLP 2J9AA 3BI1A 3FVLA 2AFSA 2ZOFA 2V8GA 4PXEA 3IFEA 4C86A 5IB9A 3WC5A 2ZEMA 3FMCA 4P4FA 4NGRA 4MCQA 4ZI6A 2XEFA 4GM5A 3KQXA 3RZAA 3D7FA 4UEZA 2PE3A 4C8TA 1HDUA 2XEIA 7CPAA 4OC4A 4CDJA 1CG2A 2RFHA 3PFEA 3I6SA 4CDKA 5J1QA 4FUUA 4LQGA 2O4HA 4MHPA 4CPAA 5JM6A 2ZEGA 3B3SA 2AFUA 1GYTA 4K3NA 4OC0A 3SJXA 3PB4X 4UIBA 4Q7AA 3B3CA 4R76A 4C9RA 4C8PA 4B6ZA 2CF4A 3FEEA 2CTBA 3IIBA 4OC3A 5IR2A 3I74A 1CX8A 4FWUA 3T8WA 4UEEA 1ZG7A 3TX8A 1LFWA 2BOAA 5THWA 4IK2A 1QMUA 2GLJA 1IGBA 1OBRA 4NFRA 3PB6X 3SJFA 2PJ0A 3WC6A 4PQAA 1TKJA 1HEEA 1AMPA 3D4UA 2NSMA 4C9UA 3V7ZA 2ZOGA 4MHYA 1ZLHA 4UF4A 3PBBA 3S9NA 2HC9A 4ZX8A 1DTDA 1AYEA 4F9VA 4Z65A 2PRQA 4OMEA 2DEAA 3LWUA 3FH4A 1M4LA 2QYVA 4UEFA 1EE3P 3SJEA 3PFOA 1LOKA 1XFOA 2VL1A 4P6YA 5LRGA 1XF1A 2AFZA 4R7MA 4BD9A 2OOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D68 A;  4C8C A;  1LCP A;  4P4I A;  1UWY A;  4P10 A;  3KZW A;  3SI2 A;  4YWY A;  5D8N A;  3D7D A;  1Y0R A;  2O53 A;  1R43 A;  4AXV A;  2ZEP A;  3L2N A;  3PB7 X;  3BHX A;  3MRU A;  1IY7 A;  4MXU A;  3D7H A;  1XRY A;  5K8M A;  5LRJ A;  2ZED A;  2C6P A;  3BXM A;  3CDX A;  2PJ2 A;  5K8O A;  2BCO A;  1F2P A;  1VGY A;  2PJC A;  1Z2L A;  1XJO A;  4A39 A;  3BI0 A;  4F8Z A;  2QVP A;  4MCS A;  3GUX A;  4MHN A;  2ZEN A;  4O23 A;  4ZY1 A;  2GLF A;  4ZY2 A;  4C8U A;  2PJ6 A;  3IO1 A;  4C8F A;  2JBK A;  4NGQ A;  1DE4 C;  3D7G A;  3I1U A;  1BPM A;  4C85 A;  1TXR A;  2IJZ A;  2CTC A;  4TJX A;  2WYR A;  3D67 A;  3PB8 X;  4NGN A;  1BPN A;  2WZN A;  5I4M A;  2IQ6 A;  5HVF A;  3FJU A;  3NH8 A;  3NA6 A;  1QQ9 A;  1WVM A;  2PJ4 A;  3B7I A;  2GU2 A;  3PRT A;  4P4E A;  5CBM A;  3SI1 A;  3B3T A;  2PJB A;  2Q51 A;  1ZLI A;  4ZYQ A;  2BO9 A;  1CP7 A;  3PB9 X;  3LMS A;  3CPA A;  2XEG A;  2V8H A;  1XMB A;  3ISZ A;  4A38 A;  4P45 A;  3KAS A;  4JYW A;  1F57 A;  2AFX A;  2ZEE A;  4MCP A;  4PXC A;  5HVG A;  3IC1 A;  5JH9 A;  3RAM A;  2F7V A;  1LAM A;  3IWW A;  4OP4 A;  1Y9Z A;  6CPA A;  4NGS A;  1ARL A;  3B35 A;  3ISX A;  1VHO A;  1CP6 A;  4DJL A;  5HXD A;  3CPX A;  4C84 A;  4WJB A;  4DUK A;  5ELY A;  5LRK A;  3VH9 A;  2RB7 A;  3H8G A;  2ZEL A;  4P4B A;  3WC7 A;  3KI9 A;  2G9D A;  3K2K A;  3VAR A;  1TF8 A;  4P4J A;  4C9V A;  2IMO A;  1CPX A;  2NYQ A;  4C8A A;  4X2T A;  5K8P A;  3K9T A;  1LAP A;  1PCA A;  2ANP A;  4TWE A;  4C99 A;  4MHZ A;  5K8N A;  1CBX A;  2EK8 A;  5LYF A;  1Y0Y A;  3SI0 A;  4W9Y A;  1HDQ A;  4IAV A;  4ZX9 A;  4H2K A;  2AFO A;  4MRI A;  2EWB A;  2AFM A;  3DGV A;  2PJA A;  2ZEO A;  2ABZ A;  4JZ0 A;  4EME A;  1XBU A;  1ZG8 A;  4NJR A;  1YLO A;  4OKO A;  4ZY0 A;  4KNG E;  4FAI A;  1Z5R A;  3WAB A;  3B3V A;  1ZG9 A;  2V8D A;  3V38 A;  5F09 A;  3FEC A;  2ZEH A;  1KWM A;  1FT7 A;  4G1P A;  5HVH A;  2C1C A;  1YW4 A;  1JQG A;  2EK9 A;  5D29 A;  1Y7E A;  3KHZ A;  4NJQ A;  2PJ5 A;  1YW6 A;  4DYO A;  3S9L A;  3KHX A;  2Q4Z A;  2CIJ A;  4MCR A;  3ICU A;  2FVG A;  4C9A A;  2PJ8 A;  4IHM A;  3NFZ A;  1H8L A;  5LYD A;  3IEH A;  5DS0 A;  4NGM A;  1ARM A;  3FX6 A;  4OID A;  2HB6 A;  4X8I A;  3JRU A;  3H8E A;  2PJ9 A;  4WWV A;  4TJV A;  3KL9 A;  4P4D A;  3SJG A;  2Q43 A;  2PVV A;  3KGQ A;  1NSA A;  2QJ8 A;  3HLP A;  2PIZ A;  5LYL A;  3KR5 A;  3RBU A;  1RTQ A;  1VHE A;  5JGF A;  2AFW A;  1Z8L A;  2JBJ A;  4OIW A;  2GRE A;  4X3R A;  1FNO A;  3WT4 A;  2V77 A;  3FF3 A;  3FED A;  4C9E A;  3MN8 A;  4YN3 A;  2I3C A;  3B2Y A;  4MMO A;  3NH5 A;  3CT9 A;  3KR4 A;  1PYT B;  2F8H A;  2OR4 A;  3N5F A;  1R3N A;  4R8F A;  1BAV A;  4OC5 A;  3TC8 A;  5CPA A;  4OC2 A;  3B3W A;  5LYI A;  4EFD A;  2PJ1 A;  4F9U A;  4A94 A;  3VTA A;  1V6C A;  4A37 A;  1TKH A;  4NGP A;  3GLJ A;  4PXB A;  1YSJ A;  2PCU A;  1CPS A;  3S9M A;  1TKF A;  2PVW A;  2POK A;  3H8F A;  4OC1 A;  1F2O A;  4NGT A;  4PXD A;  1ELM P;  2V8V A;  1YME A;  3D66 A;  2PIY A;  4R6T A;  3GB0 A;  4UIA A;  4PPZ A;  1Q7L A;  2ZEF A;  3NH4 A;  3EIF A;  3KQZ A;  3QNV A;  4KSI A;  3VAT A;  2C6C A;  1BLL E;  4RUH A;  3PEI A;  2JEW A;  2C6G A;  2PJ7 A;  8CPA A;  1TF9 A;  3DLJ A;  1VIX A;  1LAN A;  4EWT A;  2XEJ A;  3HUV A;  4FBE A;  4ONW A;  4P44 A;  4TNU A;  3PBE A;  3IJ3 A;  4YU9 A;  2PJ3 A;  1ELL P;  2J9A A;  3BI1 A;  3FVL A;  2AFS A;  2ZOF A;  2V8G A;  4PXE A;  3IFE A;  4C86 A;  5IB9 A;  3WC5 A;  2ZEM A;  3FMC A;  4P4F A;  4NGR A;  4MCQ A;  4ZI6 A;  2XEF A;  4GM5 A;  3KQX A;  3RZA A;  3D7F A;  4UEZ A;  2PE3 A;  4C8T A;  1HDU A;  2XEI A;  7CPA A;  4OC4 A;  4CDJ A;  1CG2 A;  2RFH A;  3PFE A;  3I6S A;  4CDK A;  5J1Q A;  4FUU A;  4LQG A;  2O4H A;  4MHP A;  4CPA A;  5JM6 A;  2ZEG A;  3B3S A;  2AFU A;  1GYT A;  4K3N A;  4OC0 A;  3SJX A;  3PB4 X;  4UIB A;  4Q7A A;  3B3C A;  4R76 A;  4C9R A;  4C8P A;  4B6Z A;  2CF4 A;  3FEE A;  2CTB A;  3IIB A;  4OC3 A;  3I74 A;  1CX8 A;  4FWU A;  3T8W A;  4UEE A;  1ZG7 A;  3TX8 A;  1LFW A;  2BOA A;  5THW A;  4IK2 A;  1QMU A;  2GLJ A;  1IGB A;  1OBR A;  4NFR A;  3PB6 X;  3SJF A;  2PJ0 A;  3WC6 A;  4PQA A;  1TKJ A;  1HEE A;  1AMP A;  3D4U A;  2NSM A;  4C9U A;  3V7Z A;  2ZOG A;  4MHY A;  1ZLH A;  4UF4 A;  3PBB A;  3S9N A;  2HC9 A;  4ZX8 A;  1DTD A;  1AYE A;  4F9V A;  4Z65 A;  2PRQ A;  4OME A;  2DEA A;  3LWU A;  3FH4 A;  1M4L A;  2QYV A;  4UEF A;  1EE3 P;  3SJE A;  3PFO A;  1LOK A;  1XFO A;  2VL1 A;  4P6Y A;  5LRG A;  1XF1 A;  2AFZ A;  4R7M A;  4BD9 A;  2OOT A; 
#chains in the Genus database with same CATH topology
 5IV0 A;  3D68 A;  5EBV A;  3SR3 A;  1Z9E A;  2DF5 A;  2Z3K A;  4JD6 A;  4KVM E;  1S5K A;  2Y1N A;  4UCN A;  4C8C A;  1LCP A;  4P4I A;  5J3X A;  1UWY A;  4XNH B;  5G21 A;  4P10 A;  3TLY A;  3BUX B;  3FIX A;  3KZW A;  4H89 A;  4KOU A;  4ZBG A;  3SI2 A;  1GGO A;  2A4N A;  3I3G A;  4E0A A;  4YWY A;  1Y9W A;  5JPH A;  3F8K A;  5D8N A;  1MJA A;  5IB0 A;  3TLE A;  3D7D A;  2D0P A;  1Y0R A;  2O53 A;  1R43 A;  4KOR A;  5A28 A;  4KVO E;  3B8G A;  3PP9 A;  4AXV A;  3HPH E;  2I79 A;  2ZEP A;  4UFX A;  2YGW A;  2Z3N A;  3L2N A;  3PB7 X;  4XPK A;  3BHX A;  3MRU A;  4KUB A;  4KS9 A;  3TCV A;  4CRZ B;  1I21 A;  1IY7 A;  2HV2 A;  4MXU A;  3D7H A;  1XRY A;  4C7I A;  1QSR A;  4UWI A;  3TO7 A;  5K8M A;  5LRJ A;  3S6K A;  2OZG A;  2ZED A;  2C6P A;  3BXM A;  3D8P A;  4F0Y A;  3CDX A;  2C5Q A;  2VZY A;  2PJ2 A;  1FY7 A;  5K8O A;  2BCO A;  5AG5 A;  3EXN A;  1F2P A;  1VGY A;  5F9M A;  2PJC A;  3W91 A;  3CXQ A;  3SHP A;  4BPW B;  1Z2L A;  1XJO A;  3PGP A;  4A39 A;  3BI0 A;  3PLF B;  1VKC A;  5I0C A;  4MI1 A;  3OP0 A;  1OZP A;  4F8Z A;  2OH1 A;  4CGO A;  4QBJ A;  1M1D A;  2F5I A;  1S7N A;  3TO6 A;  4CYN A;  2B5G A;  2C27 A;  2ARH A;  1AUG A;  2QVP A;  3OWC A;  4PSW A;  3T90 A;  2AUN A;  4MCS A;  4JXQ A;  2EZA A;  3GUX A;  2R82 A;  3I9S A;  5HKZ A;  4PSX A;  4ZGY B;  4MHN A;  4C68 A;  2ZEN A;  3G8W A;  2AE6 A;  4O23 A;  2FSR A;  2GLF A;  4XPL A;  4ZY2 A;  4NCZ A;  2PJ6 A;  4ZY1 A;  1Z8T A;  4C8U A;  3IO1 A;  4CGM A;  1MJ9 A;  1Z8W A;  3BJ8 A;  3OB2 B;  2CY2 A;  1CE8 B;  1Q5X A;  4C8F A;  2BEI A;  4OAE A;  1X12 A;  2JBK A;  4NGQ A;  4M85 A;  1DE4 C;  3D7G A;  2OZH A;  3EZE A;  3RNZ A;  1Q2Y A;  3GJZ A;  3I1U A;  1BPM A;  2ZW6 A;  4C85 A;  3TO9 A;  1TXR A;  1L0C A;  4HNW B;  5EMI A;  4XPD B;  5ISV A;  2IJZ A;  1DIK A;  2CTC A;  3U88 C;  1EZB A;  4TJX A;  2WYR A;  3D67 A;  3PB8 X;  5H86 A;  3EZB A;  4NGN A;  3BUM B;  2CBL A;  1BPN A;  2WZN A;  2CNT A;  5AGE A;  5I4M A;  1YX0 A;  3NE8 A;  2CXA A;  2IQ6 A;  5HVF A;  3FJU A;  4MFJ A;  3NH8 A;  5J8C A;  3TOA A;  2IL4 A;  3D2M A;  3NA6 A;  1QQ9 A;  3W6S A;  5JVL A;  1WVM A;  2B4B A;  1S60 A;  2PJ4 A;  3TLG B;  3B7I A;  5A27 A;  1PU9 A;  2GU2 A;  3C8O A;  2PDO A;  4UA3 A;  3TE4 A;  3PRT A;  2DPT A;  4P4E A;  5BWA B;  5CBM A;  4A95 A;  4Q36 A;  2Z3M A;  3SI1 A;  2DIK A;  2D4O A;  1R57 A;  3B3T A;  2PJB A;  2Q51 A;  4MJ8 A;  5KTD A;  1C3O B;  1ZLI A;  3T9Y A;  4ZYQ A;  1B6B A;  2BO9 A;  3EC4 A;  1CP7 A;  2YJV A;  3PB9 X;  3LMS A;  4MFL A;  3CPA A;  2XEG A;  3VRO A;  2V8H A;  1XMB A;  3ISZ A;  4A38 A;  3JTK A;  3SXN A;  1I12 A;  2FIA A;  4P45 A;  3GIU A;  5F49 A;  3KAS A;  3QAH A;  4CGL A;  4JYW A;  2B58 A;  4QC6 A;  4Y49 B;  1J3L A;  1F57 A;  1T36 B;  4MI4 A;  2AFX A;  2ZEE A;  4MCP A;  4PXC A;  4MFQ A;  1U6M A;  3SXO A;  5HVG A;  3IWE A;  2DLA A;  1B87 A;  3IC1 A;  2VXK A;  3RAM A;  5JH9 A;  2F7V A;  1LAM A;  4COG A;  3IWW A;  2BSW A;  2VZZ A;  3TOB A;  2E28 A;  4OP4 A;  1R61 A;  3EZA A;  2ZW5 A;  4MFZ A;  6CPA A;  4OAD A;  4R9M A;  4NGS A;  4EVY A;  1Y9Z A;  5C88 A;  1ARL A;  3B35 A;  2EBJ A;  3ISX A;  1QSN A;  2HWG A;  4CYP A;  1VHO A;  1NMT A;  2DPS A;  5F46 A;  3T05 A;  1CP6 A;  4DJL A;  5HXD A;  4CAE A;  2OB0 A;  3CPX A;  1BOB A;  1N71 A;  4C84 A;  3TLZ A;  1LRZ A;  1X10 A;  1PUA A;  5HKW A;  4I49 A;  4WJB A;  4DUK A;  5ELY A;  4CAX A;  5LRK A;  1ZRS A;  5F5X A;  3VH9 A;  2RB7 A;  4GS4 A;  1KUV A;  1XOV A;  2J8R A;  3OAK A;  3H8G A;  3P2F A;  2B0A A;  2ZEL A;  4P4B A;  1M44 A;  4UFW A;  1A9X B;  3R95 A;  2PRB A;  1IYL A;  1YR0 A;  1A2Z A;  4K30 A;  3WC7 A;  3F0A A;  3KI9 A;  2G9D A;  3K2K A;  4GXH A;  1JWQ A;  3S6G A;  3VAR A;  1TF8 A;  2GIV A;  4CAW A;  5J8F A;  4P4J A;  1M4I A;  4C9V A;  1IOF A;  3S6F A;  2IMO A;  1CPX A;  1IB1 E;  2NYQ A;  4C8A A;  4KZT A;  4R3L A;  4X2T A;  3P2H A;  4M3S A;  5K8P A;  2HRO A;  3K9T A;  3TLG A;  1LAP A;  1PCA A;  2ANP A;  3DR6 A;  4KUA A;  5AG7 A;  2PC1 A;  3CXS A;  4TWE A;  4C99 A;  4MHZ A;  5G20 A;  5K8N A;  2FS5 A;  3OB1 B;  1CBX A;  2EK8 A;  5LYF A;  2D0O A;  1Y0Y A;  4KOW A;  4QB9 A;  5F13 A;  3R1K A;  3VWE A;  1QSM A;  3VRN A;  3SI0 A;  5C82 A;  4W9Y A;  3QB8 A;  5HH1 A;  4H6Z A;  1XIX A;  1HDQ A;  4IAV A;  4ZX9 A;  4H2K A;  1ON0 A;  2AFO A;  4A2Z A;  4MRI A;  2EWB A;  2AFM A;  4ORF A;  1S3Z A;  3DGV A;  4C7H A;  3TLA A;  2FL4 A;  2PJA A;  2ZEO A;  2ABZ A;  3FYN A;  4FD7 A;  1BXR B;  4JZ0 A;  4MFP A;  4C2X A;  1XBU A;  3CZX A;  4EME A;  1ZG8 A;  1KZF A;  4CAF A;  4J0N A;  4NJR A;  3BJ7 A;  2FT0 A;  1YLE A;  3T0T A;  1CS0 B;  1YLO A;  4BIN A;  4OKO A;  4ZY0 A;  4KNG E;  3FB3 A;  4L8A A;  2QIR A;  4FAI A;  1Z5R A;  3WAB A;  2G3T A;  3B3V A;  1UFH A;  2AJ6 A;  1ZG9 A;  2P0W A;  2Q7S A;  3A9L A;  5G22 A;  3D2P A;  3NOJ A;  2V8D A;  3V38 A;  3N7Z A;  4A30 A;  4J3G A;  5F09 A;  3FEC A;  3R9E A;  4KOY A;  2VQY A;  1Y9K A;  2Q4Y A;  1KWM A;  2ZEH A;  1FT7 A;  3IWG A;  2OZU A;  4PK3 A;  4G1P A;  4HNX B;  5HVH A;  3BUO B;  1YW4 A;  2C1C A;  4MY3 A;  3LAC A;  1KUY A;  1S7L A;  4PK2 A;  4YGO A;  1VBH A;  5KTC A;  1YVO A;  1JQG A;  2EK9 A;  1M4G A;  1YK3 A;  4CO9 A;  1Z9U A;  2R8V A;  5D29 A;  2B3U A;  1SQH A;  2ZXV A;  1Y7E A;  3KHZ A;  4NJQ A;  2YNE A;  2PJ5 A;  1YW6 A;  4DYO A;  3FRM A;  3S9L A;  3KHX A;  3K4I A;  3F5B A;  1CJW A;  4LX9 A;  4XNH C;  3RYO A;  1EO0 A;  1Z4R A;  3PZJ A;  2Q4Z A;  2CIJ A;  4A32 A;  1EZA A;  4MCR A;  3ICU A;  3VRR A;  2FVG A;  4NXY A;  2PJ8 A;  4C9A A;  2BUE A;  3NFZ A;  1H8L A;  1K4J A;  2J8N A;  4IHM A;  2ZW7 A;  5LYD A;  3IEH A;  2FE7 A;  4FD4 A;  1WJT A;  5DS0 A;  1Q2D A;  4NGM A;  1ARM A;  3FX6 A;  2REE A;  2YNC C;  4OID A;  4KVX A;  2HB6 A;  4CYO A;  5H84 A;  4X8I A;  1MJB A;  3H8E A;  2PJ9 A;  3JRU A;  4WWV A;  2FM4 A;  1VHS A;  4KOS A;  4B5P A;  1Y7R A;  4TJV A;  1MK4 A;  3S6H A;  4YFJ A;  3BUW B;  3KL9 A;  3IU2 A;  4XPD C;  4P4D A;  3SJG A;  4X5K A;  5KTA A;  4UWJ A;  1JDE A;  2Q43 A;  2Y0M A;  2PVV A;  4B5O A;  2Z0Z A;  3EFA A;  4YRH A;  3KGQ A;  4B14 A;  4B11 A;  2O28 A;  4B12 A;  1NSA A;  2QJ8 A;  3HLP A;  4E2A A;  2PIZ A;  3HMJ G;  5F47 A;  4UCM A;  4FD5 A;  5LYL A;  3U1B A;  3FNC A;  3KR5 A;  3RBU A;  4R3K A;  1RTQ A;  5BY0 A;  4IIX A;  1VHE A;  2J8M A;  5JGF A;  2AFW A;  1Z8L A;  2JBJ A;  4NEX A;  4JVO A;  2JDC A;  4OIW A;  1NXJ A;  3JUW A;  2GRE A;  4JJX A;  4F6A A;  1ZYM A;  4FD6 A;  1IU8 A;  4X3R A;  1FNO A;  3GY9 A;  3WT4 A;  1ZO0 A;  3GKR A;  2V77 A;  3FF3 A;  1YRE A;  5FD8 A;  3FED A;  4A4B A;  4C9E A;  3MN8 A;  3IGR A;  2I3C A;  3B2Y A;  4MMO A;  4YN3 A;  1KEE B;  4E5S A;  1I1D A;  3NH5 A;  2REF A;  3CT9 A;  3KR4 A;  1PYT B;  4INJ A;  4R87 A;  1QST A;  2Z11 A;  2F8H A;  4AVC A;  5IX3 A;  2EO8 A;  2GFQ A;  2OR4 A;  4CGP A;  4CRY B;  2WPX A;  4H1H A;  3N5F A;  1R3N A;  4R8F A;  1BAV A;  4JLY A;  4OC5 A;  3TC8 A;  2JEV A;  5CPA A;  4MBU A;  3F9K C;  4OC2 A;  3B3W A;  4Y49 C;  2PSW A;  5LYI A;  4EFD A;  2PJ1 A;  4UCP A;  4AVA A;  3MGD A;  1Q2C A;  4F9U A;  3FBU A;  2HQY A;  4A94 A;  1ZL0 A;  3VTA A;  2VKZ G;  3R9G A;  3R96 A;  5F48 A;  1V6C A;  1WK4 A;  4A37 A;  1TKH A;  2ODF A;  4ONU A;  2HI6 A;  4NGP A;  3GLJ A;  4M6I A;  5K99 A;  2DXQ A;  4PXB A;  1YSJ A;  2HUZ A;  2PCN A;  2PCU A;  3TYX A;  3PFV A;  1CPS A;  3S9M A;  2EUI A;  3CXP A;  5AXI A;  2PVW A;  1TKF A;  1RXT A;  2G0B A;  2POK A;  3O8Z A;  3H8F A;  4OC1 A;  2R7H A;  1XE4 A;  2FIW A;  3NFQ A;  3H5Z A;  4LQ6 A;  2BL1 A;  2Z3L A;  1NE9 A;  4RI1 A;  1F2O A;  3KRV A;  3G3S A;  3TLB A;  4NGT A;  4PXD A;  1ELM P;  2V8V A;  1J4J A;  1YME A;  1IIC A;  2PIY A;  3D66 A;  4R6T A;  3VRQ A;  3GB0 A;  4UIA A;  3NE7 A;  1V0C A;  1Q7L A;  2ZEF A;  3NH4 A;  4PPZ A;  2WPW A;  4QUS A;  5E96 A;  3KQZ A;  3QNV A;  3WR7 A;  4F0X A;  3EIF A;  5FVJ A;  2GP4 A;  2X7B A;  4KSI A;  3VAT A;  2C6C A;  2OU2 A;  4HNY B;  1BLL E;  4RUH A;  1KC7 A;  4OLL A;  3R9F A;  3PEI A;  2I00 A;  2JEW A;  2CNM A;  2Z3O A;  2Q7B A;  2C6G A;  1M4D A;  2PJ7 A;  3UY5 A;  2JDD A;  4II9 A;  1JDB C;  8CPA A;  3DSB A;  3QAY A;  1TF9 A;  1VIX A;  2R98 A;  1LAN A;  3DDD A;  3DLJ A;  4EWT A;  2XEJ A;  2ZW4 A;  3HUV A;  4M6H A;  4FBE A;  4ONW A;  4P44 A;  4PV6 A;  4TNU A;  4C2Z A;  3PBE A;  3IJ3 A;  4B10 A;  4YU9 A;  2PJ3 A;  1ELL P;  2J9A A;  4A33 A;  3BI1 A;  2Q4V A;  4BPU B;  3FVL A;  2AFS A;  2ZOF A;  4AB7 A;  4JWP A;  2V8G A;  4IUS A;  3VRP A;  3K9U A;  4PXE A;  4U9Y A;  4BBH A;  3IFE A;  4KSA A;  1YVH A;  5IB9 A;  3WC5 A;  4C86 A;  1RO5 A;  2XPN A;  2Q0Y A;  2XPO A;  2ZEM A;  3FMC A;  1NSL A;  4Q38 A;  2VI7 A;  3T07 A;  5JQ4 A;  4P4F A;  2Z10 A;  4AG7 A;  4DNC A;  4BTF A;  4E8O A;  4E94 A;  1P4N A;  2R1I A;  4NSQ A;  2G3A A;  2FXF A;  4B13 A;  4NGR A;  4MCQ A;  2Y1M A;  2XEF A;  1S7F A;  4ZI6 A;  5HMN A;  5HKY A;  4A4C A;  4GM5 A;  2YND A;  3KQX A;  2YJT A;  1XF8 A;  3RZA A;  2AUM A;  3D7F A;  4UEZ A;  2H5M A;  1GHE A;  2PE3 A;  4C8T A;  1HDU A;  2XEI A;  3PT1 A;  2X0S A;  7CPA A;  4OC4 A;  4CDJ A;  4JXR A;  4CGN A;  2VBQ A;  1CG2 A;  4M6G A;  4C2Y A;  3TFY A;  2KCW A;  1B47 A;  3LD2 A;  1NBW A;  3ZJ0 A;  2B5G B;  2RFH A;  3E0K A;  3PFE A;  5AG6 A;  3I6S A;  4CDK A;  4EYS A;  3FXT A;  3D3S A;  5J1Q A;  2CNS A;  4FUU A;  4KOV A;  4LQG A;  2B4D A;  2O4H A;  4MHP A;  4IF5 A;  4CPA A;  5JM6 A;  2AFU A;  2ZEG A;  3B3S A;  4KLW A;  1GYT A;  4K3N A;  4OC0 A;  3SJX A;  2P6E A;  3V8I A;  3PB4 X;  3DNS A;  3BUN B;  1CM0 A;  2JLM A;  4UIB A;  5GCN A;  4Q7A A;  3TLC A;  3B3C A;  4R76 A;  4M8D A;  4C9R A;  4C8P A;  4CZ1 A;  4GPL B;  3JVN A;  4B6Z A;  2B4J C;  2B4D B;  2CF4 A;  3FEE A;  4KSF A;  5DWM A;  4CAV A;  4IIY A;  3T5M A;  1KBL A;  4AVB A;  2CTB A;  4CS0 B;  4U9Z A;  4BPX B;  4KOT A;  3IIB A;  1BO4 A;  4OC3 A;  1S7K A;  2XPP A;  4HKF A;  5IR2 A;  4COB A;  3I74 A;  4MY0 A;  1CX8 A;  4FWU A;  2QEC A;  2FCK A;  3T8W A;  1VBG A;  4UEE A;  3ZNI A;  1ZG7 A;  4RS2 A;  2P6G A;  3TX8 A;  2WSA A;  1LFW A;  2BOA A;  3LOD A;  2GE3 A;  1IID A;  3EY5 A;  5THW A;  1Z8X A;  5F1Y A;  3H4Q A;  4IK2 A;  4CYQ A;  3VGO A;  1QMU A;  2QML A;  2GLJ A;  4MJX A;  1YQE A;  2PR1 A;  4AG9 A;  1IGB A;  1OBR A;  2K5T A;  2PR8 A;  2XPL A;  3GYA A;  4NFR A;  3C26 A;  3TT2 A;  2D4P A;  3PB6 X;  2EVN A;  3SJF A;  2PJ0 A;  3TTH A;  3WC6 A;  3KKW A;  5G1Z A;  2YNC A;  2VEZ A;  4PQA A;  4B5P B;  4KOX A;  4LUA A;  5EC4 A;  3ZZI A;  1TKJ A;  1VI4 A;  1HEE A;  1AMP A;  5AG4 A;  3D4U A;  2Q04 A;  2NSM A;  4C9U A;  1Z4E A;  4L89 A;  2P6F A;  3V7Z A;  2ZOG A;  5CNP A;  4MHY A;  1ZLH A;  4UF4 A;  1KUX A;  4KLV A;  4UFV A;  1IYK A;  3PBB A;  3S9N A;  2RC4 A;  3IU1 A;  2GAN A;  2HC9 A;  3VWD A;  2EZC A;  4R57 A;  4ZX8 A;  5DWN A;  1DTD A;  1AYE A;  5JYB A;  2UV8 G;  4F9V A;  4Z65 A;  1QSO A;  2OLS A;  4NF1 A;  2Z3P A;  4QVT A;  4A31 A;  1XMT A;  1P0H A;  4UBR A;  3HPG G;  2PRQ A;  3DR8 A;  4OME A;  1FBV A;  2ZPA A;  1YGH A;  4MHD A;  2EZB A;  1XEB A;  1YVK A;  2DEA A;  2NMT A;  3LWU A;  3FH4 A;  1M4L A;  2QYV A;  2WUU A;  4H6U A;  4UEF A;  2PQ8 A;  4RR2 B;  1EE3 P;  2ATR A;  3W6X A;  4RN7 A;  4U5Y A;  1C30 B;  3BLN A;  3SJE A;  1TIQ A;  3PFO A;  1IOI A;  3G23 A;  1LOK A;  3EO4 A;  1XFO A;  2VL1 A;  2B3V A;  4P6Y A;  1M6V B;  4MFK A;  2MP0 A;  5LRG A;  1XF1 A;  2AFZ A;  4R7M A;  2Q44 A;  4BMH A;  1WWZ A;  4BD9 A;  4HPS A;  2N3A B;  3RO0 A;  2OOT A; 
#chains in the Genus database with same CATH homology
 3D68 A;  4C8C A;  1LCP A;  4P4I A;  1UWY A;  4P10 A;  3KZW A;  3SI2 A;  4YWY A;  5D8N A;  3D7D A;  1Y0R A;  2O53 A;  1R43 A;  4AXV A;  2ZEP A;  3L2N A;  3PB7 X;  3BHX A;  3MRU A;  1IY7 A;  4MXU A;  3D7H A;  1XRY A;  5K8M A;  5LRJ A;  2ZED A;  2C6P A;  3BXM A;  3CDX A;  2C5Q A;  2PJ2 A;  5K8O A;  2BCO A;  1F2P A;  1VGY A;  2PJC A;  1Z2L A;  1XJO A;  4A39 A;  3BI0 A;  4F8Z A;  2QVP A;  4MCS A;  3GUX A;  4MHN A;  2ZEN A;  4O23 A;  4ZY1 A;  2GLF A;  4ZY2 A;  4C8U A;  2PJ6 A;  3IO1 A;  4C8F A;  2JBK A;  4NGQ A;  1DE4 C;  3D7G A;  3I1U A;  1BPM A;  4C85 A;  1TXR A;  2IJZ A;  2CTC A;  4TJX A;  2WYR A;  3D67 A;  3PB8 X;  4NGN A;  1BPN A;  2WZN A;  5I4M A;  2IQ6 A;  5HVF A;  3FJU A;  3NH8 A;  3NA6 A;  1QQ9 A;  1WVM A;  2PJ4 A;  3B7I A;  2GU2 A;  3PRT A;  4P4E A;  5CBM A;  3SI1 A;  3B3T A;  2PJB A;  2Q51 A;  1ZLI A;  4ZYQ A;  2BO9 A;  1CP7 A;  3PB9 X;  3LMS A;  3CPA A;  2XEG A;  2V8H A;  1XMB A;  3ISZ A;  4A38 A;  4P45 A;  3KAS A;  4JYW A;  1F57 A;  2AFX A;  2ZEE A;  4MCP A;  4PXC A;  5HVG A;  3IC1 A;  5JH9 A;  3RAM A;  2F7V A;  1LAM A;  3IWW A;  4OP4 A;  1Y9Z A;  6CPA A;  4NGS A;  1ARL A;  3B35 A;  3ISX A;  1VHO A;  1CP6 A;  4DJL A;  5HXD A;  3CPX A;  4C84 A;  4WJB A;  4DUK A;  5ELY A;  5LRK A;  3VH9 A;  2RB7 A;  3H8G A;  2ZEL A;  4P4B A;  3WC7 A;  3KI9 A;  2G9D A;  3K2K A;  3VAR A;  1TF8 A;  4P4J A;  4C9V A;  2IMO A;  1CPX A;  2NYQ A;  4C8A A;  4X2T A;  5K8P A;  3K9T A;  1LAP A;  1PCA A;  2ANP A;  4TWE A;  4C99 A;  4MHZ A;  5K8N A;  1CBX A;  2EK8 A;  5LYF A;  1Y0Y A;  3SI0 A;  4W9Y A;  1HDQ A;  4IAV A;  4ZX9 A;  4H2K A;  2AFO A;  4MRI A;  2EWB A;  2AFM A;  3DGV A;  2PJA A;  2ZEO A;  2ABZ A;  4JZ0 A;  4EME A;  1XBU A;  1ZG8 A;  4NJR A;  1YLO A;  4OKO A;  4ZY0 A;  4KNG E;  4FAI A;  1Z5R A;  3WAB A;  3B3V A;  1ZG9 A;  2V8D A;  3V38 A;  5F09 A;  3FEC A;  2ZEH A;  1KWM A;  1FT7 A;  4G1P A;  5HVH A;  2C1C A;  1YW4 A;  1JQG A;  2EK9 A;  5D29 A;  1Y7E A;  3KHZ A;  4NJQ A;  2PJ5 A;  1YW6 A;  4DYO A;  3S9L A;  3KHX A;  2Q4Z A;  2CIJ A;  4MCR A;  3ICU A;  2FVG A;  4C9A A;  2PJ8 A;  4IHM A;  3NFZ A;  1H8L A;  5LYD A;  3IEH A;  5DS0 A;  4NGM A;  1ARM A;  3FX6 A;  4OID A;  2HB6 A;  4X8I A;  3JRU A;  3H8E A;  2PJ9 A;  4WWV A;  4TJV A;  3KL9 A;  4P4D A;  3SJG A;  2Q43 A;  2PVV A;  3KGQ A;  1NSA A;  2QJ8 A;  3HLP A;  2PIZ A;  5LYL A;  3KR5 A;  3RBU A;  1RTQ A;  1VHE A;  5JGF A;  2AFW A;  1Z8L A;  2JBJ A;  4OIW A;  2GRE A;  4X3R A;  1FNO A;  3WT4 A;  2V77 A;  3FF3 A;  3FED A;  4C9E A;  3MN8 A;  4YN3 A;  2I3C A;  3B2Y A;  4MMO A;  3NH5 A;  3CT9 A;  3KR4 A;  1PYT B;  2F8H A;  2OR4 A;  3N5F A;  1R3N A;  4R8F A;  1BAV A;  4OC5 A;  3TC8 A;  5CPA A;  4OC2 A;  3B3W A;  5LYI A;  4EFD A;  2PJ1 A;  4F9U A;  4A94 A;  3VTA A;  1V6C A;  4A37 A;  1TKH A;  4NGP A;  3GLJ A;  4PXB A;  1YSJ A;  2PCU A;  1CPS A;  3S9M A;  1TKF A;  2PVW A;  2POK A;  3H8F A;  4OC1 A;  1F2O A;  4NGT A;  4PXD A;  1ELM P;  2V8V A;  1YME A;  3D66 A;  2PIY A;  4R6T A;  3GB0 A;  4UIA A;  4PPZ A;  1Q7L A;  2ZEF A;  3NH4 A;  3EIF A;  3KQZ A;  3QNV A;  2GP4 A;  4KSI A;  3VAT A;  2C6C A;  1BLL E;  4RUH A;  3PEI A;  2JEW A;  2C6G A;  2PJ7 A;  8CPA A;  1TF9 A;  3DLJ A;  1VIX A;  1LAN A;  4EWT A;  2XEJ A;  3HUV A;  4FBE A;  4ONW A;  4P44 A;  4TNU A;  3PBE A;  3IJ3 A;  4YU9 A;  2PJ3 A;  1ELL P;  2J9A A;  3BI1 A;  3FVL A;  2AFS A;  2ZOF A;  2V8G A;  4PXE A;  3IFE A;  4C86 A;  5IB9 A;  3WC5 A;  2ZEM A;  3FMC A;  4P4F A;  4NGR A;  4MCQ A;  4ZI6 A;  2XEF A;  4GM5 A;  3KQX A;  3RZA A;  3D7F A;  4UEZ A;  2PE3 A;  4C8T A;  1HDU A;  2XEI A;  7CPA A;  4OC4 A;  4CDJ A;  1CG2 A;  2RFH A;  3PFE A;  3I6S A;  4CDK A;  5J1Q A;  4FUU A;  4LQG A;  2O4H A;  4MHP A;  4CPA A;  5JM6 A;  2ZEG A;  3B3S A;  2AFU A;  1GYT A;  4K3N A;  4OC0 A;  3SJX A;  3PB4 X;  4UIB A;  4Q7A A;  3B3C A;  4R76 A;  4C9R A;  4C8P A;  4B6Z A;  2CF4 A;  3FEE A;  2CTB A;  3IIB A;  4OC3 A;  5IR2 A;  3I74 A;  1CX8 A;  4FWU A;  3T8W A;  4UEE A;  1ZG7 A;  3TX8 A;  1LFW A;  2BOA A;  5THW A;  4IK2 A;  1QMU A;  2GLJ A;  1IGB A;  1OBR A;  4NFR A;  3PB6 X;  3SJF A;  2PJ0 A;  3WC6 A;  4PQA A;  1TKJ A;  1HEE A;  1AMP A;  3D4U A;  2NSM A;  4C9U A;  3V7Z A;  2ZOG A;  4MHY A;  1ZLH A;  4UF4 A;  3PBB A;  3S9N A;  2HC9 A;  4ZX8 A;  1DTD A;  1AYE A;  4F9V A;  4Z65 A;  2PRQ A;  4OME A;  2DEA A;  3LWU A;  3FH4 A;  1M4L A;  2QYV A;  4UEF A;  1EE3 P;  3SJE A;  3PFO A;  1LOK A;  1XFO A;  2VL1 A;  4P6Y A;  5LRG A;  1XF1 A;  2AFZ A;  4R7M A;  4BD9 A;  2OOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...