4NGMA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 263
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngmA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngmA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngmA02
1M4LA 4UIAA 1ELMP 2F7VA 2XEGA 4UEZA 4ZYQA 2GU2A 4DUKA 1YW6A 2HC9A 1FNOA 5THWA 4MXUA 2PJ4A 4P4FA 1OBRA 2PIYA 4ZX8A 2Q51A 3SI1A 1ELLP 3KGQA 4OC3A 5CBMA 4RUHA 4MCSA 3VARA 2PJ0A 1HDQA 4UEEA 1DTDA 2CIJA 5HVHA 2C6GA 2PVWA 2CTCA 4A94A 4OC5A 2ZEGA 2O53A 4WJBA 2ZENA 5JGFA 3KASA 3SJXA 3WABA 2GLFA 4NJRA 3K9TA 2Q4ZA 3SJFA 4C9UA 2PJ1A 4PPZA 2EK9A 3ISXA 1ZG8A 3VTAA 1Y7EA 4P4DA 3FF3A 4OC0A 3GUXA 1LOKA 4OKOA 1TXRA 5I4MA 3FMCA 6CPAA 1VIXA 2AFZA 3IJ3A 1PYTB 2VL1A 4F8ZA 3EIFA 4MRIA 5K8OA 3NH4A 1CX8A 1YLOA 3D66A 4C8UA 1Y9ZA 5K8PA 1TKFA 5DS0A 5LRJA 3S9LA 1H8LA 2V77A 3ISZA 2ABZA 3KHZA 2PJ3A 2ZELA 3DLJA 3WC6A 3S9MA 1ARLA 2POKA 4PXEA 2PVVA 4K3NA 2ANPA 3PB6X 3NFZA 4P4IA 1YMEA 2XEIA 3NH5A 3SI0A 2PCUA 1CPSA 3PRTA 4IAVA 3B3WA 4TJVA 1F57A 4P4BA 2WYRA 3PFEA 5LYLA 2ZEFA 1DE4C 3VH9A 1XJOA 2BCOA 3FH4A 1LCPA 4MHPA 1KWMA 3L2NA 3BI1A 4H2KA 4MCRA 1CG2A 3B3CA 2RB7A 4BD9A 4C8TA 1ZLIA 3D68A 1XFOA 2Q43A 3I1UA 4EWTA 1BLLE 4PQAA 4OMEA 1XBUA 2PJBA 3N5FA 4UEFA 4C8AA 1JQGA 2IQ6A 2AFMA 2AFOA 3BXMA 1FT7A 1CP6A 1VHOA 4C8FA 2PJ5A 3IWWA 4OIDA 4C9VA 2QJ8A 4ZI6A 3V7ZA 1R3NA 2AFSA 1AYEA 3IEHA 3KHXA 3PBEA 4PXDA 4TWEA 4FBEA 4MCQA 4FWUA 3KR5A 4OC4A 4P6YA 5LYDA 2XEFA 2PJ8A 4EMEA 1XF1A 4P4JA 2PIZA 4NJQA 3I74A 1ZG7A 3KZWA 1BPNA 1WVMA 4PXCA 3JRUA 4KNGE 2ZEOA 2ZEHA 1XRYA 2ZEPA 1ARMA 1Z2LA 3FECA 2G9DA 2HB6A 4P4EA 1QQ9A 3DGVA 7CPAA 5HVGA 3BHXA 2C6PA 4OP4A 5CPAA 2PJ7A 4MHYA 5LRGA 1IY7A 4YWYA 3KL9A 4C9AA 2ZOGA 4NGPA 3PBBA 1CP7A 3HLPA 2NYQA 3B3VA 4C8CA 2AFXA 3T8WA 4C84A 2JBKA 1GYTA 2EK8A 4OIWA 4R76A 2BOAA 1LANA 4CPAA 3B7IA 5LYFA 3PFOA 3MN8A 4JYWA 4MCPA 4EFDA 3WC7A 3H8EA 1VGYA 1Q7LA 2NSMA 4A39A 1V6CA 4Z65A 2I3CA 3FEEA 5F09A 4UIBA 3ICUA 3MRUA 2FVGA 1LFWA 5HVFA 1BAVA 3IC1A 4OC2A 5IB9A 2AFUA 4X8IA 2V8GA 2BO9A 4R7MA 4DJLA 1EE3P 2ZOFA 4C8PA 4R6TA 2O4HA 2PJ6A 2CTBA 3V38A 2QVPA 3RBUA 1HEEA 3PB9X 3NA6A 4X3RA 4A38A 3D7DA 2J9AA 2PJ2A 4ZY2A 4ONWA 3D7HA 5JM6A 3D4UA 1ZLHA 4W9YA 1TKJA 3D7FA 4JZ0A 3WT4A 3IFEA 5D8NA 3D7GA 3S9NA 3CT9A 3B3TA 4MHZA 3PEIA 4F9UA 4YU9A 2GREA 1LAMA 2OR4A 3TX8A 8CPAA 4CDJA 3LMSA 1XMBA 5LYIA 4C86A 5J1QA 2C1CA 3H8GA 2QYVA 4NGTA 4G1PA 5ELYA 4P10A 4P44A 1R43A 3RZAA 2V8DA 4LQGA 3K2KA 2JBJA 4NGMA 1ZG9A 1AMPA 2CF4A 2PJAA 1TF8A 4KSIA 3I6SA 2GLJA 4X2TA 4NGQA 3FX6A 3CPXA 3B2YA 2RFHA 4DYOA 3SI2A 3BI0A 4A37A 2OOTA 3GB0A 1PCAA 2V8VA 1Y0YA 2IMOA 3TC8A 3KR4A 4Q7AA 4TNUA 2WZNA 5K8MA 1YSJA 5JH9A 3QNVA 1F2OA 3FJUA 4OC1A 4MMOA 4P45A 3B35A 1YW4A 4C9EA 4PXBA 3KQXA 1HDUA 4NFRA 2PJ9A 3GLJA 1LAPA 4AXVA 3FEDA 2F8HA 4C85A 5K8NA 2ZEEA 3CPAA 3PB4X 3CDXA 4MHNA 4FUUA 4IK2A 3B3SA 4ZY1A 4ZX9A 5LRKA 1IGBA 1Z5RA 2AFWA 3PB7X 3H8FA 3PB8X 3D67A 4C99A 3IO1A 4NGRA 2PE3A 1CBXA 4ZY0A 4TJXA 4B6ZA 3HUVA 2ZEDA 1BPMA 4NGSA 3SJEA 3KQZA 1VHEA 3RAMA 2DEAA 2IJZA 2PRQA 3FVLA 4GM5A 4IHMA 5D29A 4NGNA 3NH8A 1Z8LA 3LWUA 4YN3A 4F9VA 4WWVA 3KI9A 4FAIA 2JEWA 4R8FA 4O23A 4C9RA 2V8HA 3VATA 3SJGA 1TKHA 3IIBA 1CPXA 2PJCA 1QMUA 1F2PA 3WC5A 1UWYA 4UF4A 2XEJA 2ZEMA 1RTQA 2C6CA 2EWBA 1Y0RA 4CDKA 1TF9A 1NSAA 5HXDA
chains in the Genus database with same CATH superfamily
2ZW5A 2Q44A 1M4LA 4UIAA 1ELMP 2F7VA 4KOXA 5GCNA 2XEGA 2FCKA 2JDDA 3HPGG 4UEZA 5H84A 5F5XA 4ZYQA 5I4MA 1IB1E 2J8NA 2GU2A 2YGWA 1YW6A 2HC9A 2Z3PA 4MI4A 4DUKA 5HKZA 1FNOA 2J8MA 3IWEA 3G8WA 5THWA 4MXUA 3ZNIA 2PJ4A 4P4FA 2G3AA 2D4OA 2XPPA 4FD5A 1OBRA 4AG7A 5AG7A 2C27A 2PIYA 4MY0A 4ZX8A 4C2XA 2Q51A 3GY9A 1ELLP 3SI1A 3KGQA 1JWQA 4OC3A 5CBMA 4UWIA 4RUHA 4II9A 4MJ8A 2PCNA 2DF5A 3T9YA 4MCSA 3VARA 2PJ0A 1Z9EA 1S5KA 1HDQA 5K99A 4UEEA 1DTDA 4U9ZA 1X10A 2CIJA 2XPLA 4CAVA 5HVHA 5C88A 2C6GA 2PVWA 2CTCA 4PK2A 3GYAA 4OC5A 4A94A 4CRYB 2I79A 2ZEGA 2O53A 4KUAA 4IIXA 4WJBA 1YK3A 5HKYA 2ZENA 4MFKA 4CYQA 5JGFA 3KASA 5BY0A 3SJXA 2HWGA 4OADA 4RN7A 4XNHB 2GLFA 3WABA 1TIQA 1YLEA 2R1IA 4R87A 4NJRA 3OB2B 3D2MA 3K9TA 4A31A 5BWAB 2Q4ZA 2KCWA 2FIAA 3PP9A 3G23A 3SJFA 4C9UA 2PJ1A 4PPZA 2EK9A 3T0TA 2Z3OA 3IU2A 1IICA 3ISXA 1GHEA 2B0AA 1ZG8A 3VTAA 2DPTA 1R61A 3S6GA 2Q7BA 1Y7EA 1Z4RA 3FF3A 4P4DA 4OC0A 3GUXA 3EY5A 5KTAA 1LOKA 4OKOA 3VRQA 3R9EA 2ZW7A 1L0CA 1TXRA 3BUWB 4J3GA 3JVNA 3DSBA 3MGDA 3FMCA 1YVKA 2Z3KA 3EO4A 3N7ZA 4GS4A 4MFZA 3TLZA 2B58A 4YFJA 1VIXA 2AFZA 2ZXVA 3IJ3A 4B5OA 6CPAA 5G1ZA 1MJ9A 1PYTB 2VL1A 3TTHA 4PV6A 4F8ZA 2IL4A 3UY5A 4NXYA 4E2AA 3EIFA 5F46A 4MRIA 5K8OA 3NH4A 1AUGA 2OZHA 5IB0A 3LD2A 1CX8A 1YLOA 3D66A 4C8UA 4CGOA 1Y9ZA 1CM0A 3CXQA 3RYOA 5K8PA 1TKFA 3FBUA 1C30B 5DS0A 4CS0B 5LRJA 3B8GA 3S9LA 1H8LA 2V77A 2VEZA 3ISZA 3D3SA 3BUNB 2ABZA 3KHZA 4OLLA 3TFYA 5E96A 1EO0A 1QSTA 1VHSA 2PJ3A 2MP0A 2ZELA 3DLJA 3WC6A 3TLAA 4L8AA 4CGNA 3S9MA 4KS9A 1ARLA 2POKA 3PGPA 4PXEA 1XEBA 1S7FA 2Z0ZA 2PVVA 4K3NA 2ANPA 3PB6X 2REFA 3NFZA 4P4IA 2HV2A 3TT2A 5JYBA 1XE4A 4JLYA 1YMEA 2XEIA 3NH5A 4C8AA 3SI0A 2PCUA 1CPSA 3PRTA 4IAVA 4KLVA 5KTDA 3B3WA 3TE4A 4R3LA 4FD6A 4TJVA 1F57A 4P4BA 2WYRA 3PFEA 4C68A 1KUVA 5LYLA 2ZEFA 1DE4C 2WPWA 4FD7A 4Y49C 4CYPA 3VH9A 5HKWA 4KVME 3TYXA 1XJOA 1EZAA 5G22A 3VROA 3NE8A 3EZEA 2BCOA 1XMTA 3FH4A 1LCPA 4HNWB 4IIYA 4MHPA 1KWMA 3L2NA 3BI1A 2BSWA 4H2KA 5CNPA 4MCRA 2OZGA 1CG2A 3B3CA 5F13A 1NXJA 5JPHA 2OZUA 5EMIA 5KTCA 1B6BA 2RB7A 4BD9A 4MI1A 1ZLIA 4X5KA 3D68A 4C8TA 1XFOA 2Q43A 3I1UA 4KOSA 1BLLE 1I21A 1M4IA 3TO7A 4PQAA 4OMEA 4CAXA 4UCPA 1XBUA 2PJBA 3N5FA 4UEFA 4EWTA 2P0WA 4CRZB 1JQGA 2IQ6A 4KOUA 2X7BA 2AFMA 1GGOA 2VXKA 1IYKA 1IIDA 3TLCA 4PK3A 2AFOA 3BXMA 2FE7A 1FT7A 4CGPA 1CP6A 5HXDA 1VHOA 4C8FA 1ZYMA 3FB3A 3R1KA 1VI4A 2PJ5A 2QIRA 3IWWA 2EBJA 4OIDA 1M6VB 4C9VA 2QJ8A 4ZI6A 3V7ZA 1R3NA 2GANA 2AFSA 2HROA 1AYEA 1X12A 3IEHA 3KHXA 4AG9A 2AJ6A 1M44A 3PBEA 4R57A 4CGMA 2QECA 4PXDA 4TWEA 1KBLA 1YGHA 2Z11A 1IYLA 4MFJA 5F47A 5G21A 3TO9A 4FBEA 4MCQA 4FWUA 2CY2A 3KR5A 2YJVA 2B4BA 4HNYB 4H1HA 4OC4A 4P6YA 5LYDA 2XEFA 2ATRA 1XOVA 2PJ8A 4A2ZA 4EMEA 1XF1A 3T05A 4P4JA 2PIZA 4NJQA 3I74A 1ZG7A 3LODA 3F0AA 1S3ZA 2B3UA 3TOBA 3KZWA 1BPNA 3W91A 1WVMA 1S7NA 4PXCA 3JRUA 2NMTA 3QAHA 4KSAA 5EC4A 2ZEOA 3JUWA 4KNGE 2AE6A 2ZEHA 1XRYA 2ZEPA 1ARMA 1Z2LA 3FECA 4NF1A 4E5SA 1K4JA 5H86A 2R82A 1M1DA 1MK4A 3C26A 2G9DA 4A4CA 2HB6A 2Z10A 3CXPA 2P6GA 2E28A 4COBA 3K9UA 4P4EA 1QQ9A 3DGVA 4A95A 7CPAA 5HVGA 3BHXA 2C6PA 4OP4A 5G20A 4B12A 5CPAA 4CAEA 2EZBA 2PJ7A 2QMLA 2ZW6A 3I3GA 3F5BA 4KLWA 1CE8B 4MHYA 5LRGA 1ZO0A 1IY7A 4YWYA 3KL9A 1VBHA 2FXFA 1FBVA 3FIXA 3TOAA 2CBLA 1Z8XA 1UFHA 2YNCA 4C9AA 1YVOA 2ZOGA 3CXSA 4A30A 4NGPA 3PBBA 1CP7A 3HLPA 2NYQA 4UFVA 4KVXA 3B3VA 4M6GA 5FD8A 4C8CA 2AFXA 4ONUA 4UWJA 3NFQA 3T8WA 4C84A 4H6ZA 2JBKA 5AG5A 2VI7A 2FS5A 1GYTA 2Y1MA 2EK8A 4OIWA 4M6HA 1YQEA 4R76A 1SQHA 1Z8WA 2UV8G 4XPKA 4B11A 2J8RA 4F0XA 2YJTA 2BOAA 2WPXA 1LANA 2Z3LA 3B7IA 4CPAA 5LYFA 3FNCA 4A32A 4MFPA 4IUSA 4ZBGA 2D4PA 1R57A 3OB1B 3PFOA 1NMTA 2PSWA 3MN8A 4JYWA 4MCPA 1NSLA 2H5MA 3BLNA 1WK4A 4EFDA 1A2ZA 3WC7A 1BOBA 1VKCA 1Y9KA 3H8EA 1VGYA 2YNEA 1Q7LA 2NSMA 2ZPAA 4LQ6A 4A39A 4JJXA 4Z65A 1MJBA 1V6CA 2I3CA 3FEEA 4MBUA 1T36B 5AGEA 1BO4A 5F09A 1MJAA 3O8ZA 2JEVA 4UIBA 1KUXA 4LUAA 4E8OA 3ICUA 3MRUA 1YREA 2FVGA 1OZPA 4CYOA 1LFWA 2PR8A 5HVFA 1BAVA 4CYNA 5AXIA 4NCZA 2HI6A 1JDEA 3P2HA 4YGOA 3D2PA 2AUMA 3PFVA 3IC1A 4OC2A 3QAYA 4GXHA 5IB9A 2AFUA 2R7HA 2WSAA 3F8KA 4X8IA 2V8GA 2BO9A 1WWZA 5C82A 4R7MA 4JD6A 4AVAA 4DJLA 3BJ8A 4H6UA 1EE3P 2ZOFA 2Y0MA 4I49A 4R6TA 3TLEA 4C8PA 4BPWB 2B4DB 4AVCA 2O4HA 2PJ6A 3GIUA 3R96A 4C7HA 4M8DA 2CNTA 2CTBA 2O28A 3TO6A 1Q2YA 4XPDC 1Z4EA 1QSNA 3V38A 1RO5A 1YX0A 3V8IA 3TLGB 3TCVA 1KEEB 2Y1NA 4C2ZA 4BPXB 2QVPA 4INJA 4CAFA 3RBUA 2Z3MA 3H5ZA 1HEEA 2JDCA 3PB9X 2JLMA 4X3RA 3NA6A 1FY7A 4A38A 3D7DA 2J9AA 2PJ2A 4OAEA 4ZY2A 4MFQA 5HH1A 3GKRA 5F9MA 1NE9A 2FT0A 4ONWA 2D0OA 3D7HA 5I0CA 4UFWA 4B5PB 5JM6A 3D4UA 1M4GA 2YNDA 2A4NA 1KUYA 1Z8TA 1ZLHA 2P6FA 3IGRA 4W9YA 3T90A 1TKJA 4QBJA 1IOFA 3D7FA 4JZ0A 3WT4A 3IFEA 2G0BA 3D7GA 3S9NA 2HUZA 2PQ8A 3CT9A 3D8PA 5D8NA 3RNZA 3B3TA 4BPUB 4MHZA 1J4JA 3FXTA 1B87A 1JDBC 2DPSA 2R8VA 3PLFB 3PEIA 4XPDB 4JVOA 3IWGA 4Y49B 3OAKA 1QSOA 2ARHA 2BL1A 3DR8A 4F9UA 3SR3A 4KUBA 4YU9A 4K30A 2PDOA 4J0NA 2FM4A 5F49A 3TLGA 2GREA 1LAMA 4LX9A 4GPLB 2K5TA 2OU2A 3R9GA 1V0CA 2OR4A 2N3AB 1S7KA 3TX8A 8CPAA 4CDJA 5J8CA 2BUEA 3LMSA 2OH1A 1XMBA 2Z3NA 2VBQA 5LYIA 3DDDA 4B13A 5J1QA 4C86A 2CNMA 5EBVA 1NBWA 4U5YA 4C2YA 1B47A 1U6MA 2C1CA 2QYVA 3H8GA 4NGTA 3KKWA 3IU1A 2P6EA 2PR1A 5F48A 4MY3A 2B3VA 4G1PA 3NOJA 3BUOB 5ELYA 1KZFA 2DXQA 4P10A 4P44A 2BEIA 1Q5XA 5IV0A 1EZBA 1R43A 3RZAA 1ZL0A 2V8DA 4LQGA 1LRZA 2G3TA 3K2KA 1S60A 2JBJA 4CO9A 5AG6A 3VGOA 2R98A 2VZYA 2B4JC 1XIXA 3DNSA 5IX3A 1CJWA 3FRMA 1WJTA 4NGMA 1I1DA 1ZG9A 4AB7A 4UFXA 3EZAA 4KOTA 1AMPA 4XNHC 3PT1A 4RR2B 2CF4A 1TF8A 2PJAA 2RC4A 3FYNA 4KZTA 5AG4A 4CGLA 4KSIA 5HMNA 1ZRSA 4Q38A 3I6SA 2GLJA 3CZXA 4UA3A 4UCNA 2GFQA 4X2TA 5FVJA 4NGQA 3FX6A 4NEXA 2ODFA 3CPXA 1Y7RA 3B2YA 2RFHA 3VWDA 3BJ7A 4QB9A 4DYOA 4KOYA 4CZ1A 1YVHA 4F0YA 1QSMA 2Q0YA 4IF5A 4KOVA 1PU9A 3BI0A 3SI2A 4A37A 2OOTA 1PCAA 2IMOA 2V8VA 1Y0YA 3GB0A 3TC8A 3DR6A 1A9XB 3KR4A 4Q7AA 4TNUA 2WZNA 3E0KA 5K8MA 1YSJA 2CXAA 4ORFA 5JH9A 3WR7A 3QNVA 3W6SA 1F2OA 3C8OA 3FJUA 4KVOE 1I12A 1C3OB 5DWNA 4OC1A 4MMOA 4P45A 1J3LA 4FD4A 3B35A 1YW4A 4CAWA 4C9EA 2FIWA 4UCMA 4QVTA 4PXBA 4NSQA 3KQXA 1PUAA 1HDUA 3S6HA 4NFRA 2PJ9A 4R9MA 4ZGYB 3GLJA 4HNXB 4C7IA 4MHDA 5IR2A 3SHPA 3RO0A 1CS0B 1LAPA 3JTKA 4AXVA 3TLYA 3FEDA 2F8HA 3VRPA 2ZW4A 5A28A 2CNSA 2REEA 3ZJ0A 4C85A 5F1YA 3G3SA 5K8NA 2EO8A 3P2FA 2ZEEA 3CPAA 2OLSA 1Q2DA 2FL4A 4HPSA 3PB4X 2WUUA 3QB8A 3R95A 3EXNA 2X0SA 4B10A 3CDXA 1IOIA 3EFAA 3W6XA 5ISVA 2XPNA 4R3KA 2VZZA 4MHNA 4FUUA 4IK2A 3B3SA 4ZY1A 3H4QA 4ZX9A 4A4BA 5LRKA 3I9SA 4KSFA 5J3XA 4E94A 2AUNA 1P4NA 1IGBA 2GE3A 1Z5RA 1P0HA 3EC4A 4XPLA 2Q4YA 2AFWA 3PB7X 4QC6A 3S6KA 3H8FA 1Z9UA 1DIKA 4L89A 4KOWA 3PB8X 3D67A 4B14A 2EZAA 4F6AA 4C99A 3IO1A 3NE7A 4JXQA 4A33A 4MJXA 2I00A 3SXOA 4KORA 2VKZG 4AVBA 4JXRA 3U1BA 1S7LA 4NGRA 4EYSA 4DNCA 2PE3A 2B5GB 3VRRA 4QUSA 1CBXA 4ZY0A 4TJXA 4B6ZA 3HUVA 2EVNA 2ZEDA 4EVYA 4E0AA 5JVLA 1BPMA 4NGSA 2GIVA 4BINA 3SJEA 3KQZA 2HQYA 5J8FA 1QSRA 1XF8A 3VRNA 1VHEA 2DEAA 3LACA 3RAMA 2IJZA 2C5QA 2PRQA 3FVLA 4BBHA 4GM5A 4IHMA 5D29A 4NGNA 2OB0A 4HKFA 3HMJG 3PZJA 3NH8A 2PRBA 2EUIA 2GP4A 4M85A 1Z8LA 2DLAA 1Y9WA 2B4DA 3T5MA 3LWUA 4YN3A 4F9VA 4WWVA 3KI9A 4FAIA 3TLBA 2JEWA 3SXNA 4R8FA 4O23A 1BXRB 3OWCA 2EZCA 4C9RA 3ZZIA 4RS2A 2V8HA 3VATA 2Q7SA 4RI1A 3OP0A 3SJGA 1TKHA 2B5GA 3IIBA 4M3SA 4PSWA 3GJZA 3VWEA 3K4IA 4MFLA 3KRVA 1RXTA 3T07A 1VBGA 1CPXA 3A9LA 2DIKA 1N71A 2PJCA 1QMUA 4BTFA 3S6FA 4BMHA 5JQ4A 3HPHE 3BUMB 4PSXA 3EZBA 1F2PA 4H89A 2Q04A 2YNCC 1YR0A 1UWYA 2FSRA 4YRHA 2VQYA 4UF4A 3WC5A 4B5PA 1M4DA 2XEJA 4M6IA 5A27A 2F5IA 1Q2CA 2Q4VA 2ZEMA 4Q36A 1RTQA 3U88C 4UBRA 2C6CA 2EWBA 5DWMA 4JWPA 2D0PA 2XPOA 1KC7A 1Y0RA 4U9YA 1IU8A 1ON0A 2PC1A 4CDKA 1TF9A 1NSAA 3F9KC 3R9FA 3BUXB 4COGA
chains in the Genus database with same CATH topology
1M4LA 4UIAA 1ELMP 2F7VA 2XEGA 4UEZA 4ZYQA 2GU2A 4DUKA 1YW6A 2HC9A 1FNOA 5THWA 4MXUA 2PJ4A 4P4FA 1OBRA 2PIYA 4ZX8A 2Q51A 3SI1A 1ELLP 3KGQA 4OC3A 5CBMA 4RUHA 4MCSA 3VARA 2PJ0A 1HDQA 4UEEA 1DTDA 2CIJA 5HVHA 2C6GA 2PVWA 2CTCA 4A94A 4OC5A 2ZEGA 2O53A 4WJBA 2ZENA 5JGFA 3KASA 3SJXA 3WABA 2GLFA 4NJRA 3K9TA 2Q4ZA 3SJFA 4C9UA 2PJ1A 4PPZA 2EK9A 3ISXA 1ZG8A 3VTAA 1Y7EA 4P4DA 3FF3A 4OC0A 3GUXA 1LOKA 4OKOA 1TXRA 5I4MA 3FMCA 6CPAA 1VIXA 2AFZA 3IJ3A 1PYTB 2VL1A 4F8ZA 3EIFA 4MRIA 5K8OA 3NH4A 1CX8A 1YLOA 3D66A 4C8UA 1Y9ZA 5K8PA 1TKFA 5DS0A 5LRJA 3S9LA 1H8LA 2V77A 3ISZA 2ABZA 3KHZA 2PJ3A 2ZELA 3DLJA 3WC6A 3S9MA 1ARLA 2POKA 4PXEA 2PVVA 4K3NA 2ANPA 3PB6X 3NFZA 4P4IA 1YMEA 2XEIA 3NH5A 3SI0A 2PCUA 1CPSA 3PRTA 4IAVA 3B3WA 4TJVA 1F57A 4P4BA 2WYRA 3PFEA 5LYLA 2ZEFA 1DE4C 3VH9A 1XJOA 2BCOA 3FH4A 1LCPA 4MHPA 1KWMA 3L2NA 3BI1A 4H2KA 4MCRA 1CG2A 3B3CA 2RB7A 4BD9A 4C8TA 1ZLIA 3D68A 1XFOA 2Q43A 3I1UA 4EWTA 1BLLE 4PQAA 4OMEA 1XBUA 2PJBA 3N5FA 4UEFA 4C8AA 1JQGA 2IQ6A 2AFMA 2AFOA 3BXMA 1FT7A 1CP6A 1VHOA 4C8FA 2PJ5A 3IWWA 4OIDA 4C9VA 2QJ8A 4ZI6A 3V7ZA 1R3NA 2AFSA 1AYEA 3IEHA 3KHXA 3PBEA 4PXDA 4TWEA 4FBEA 4MCQA 4FWUA 3KR5A 4OC4A 4P6YA 5LYDA 2XEFA 2PJ8A 4EMEA 1XF1A 4P4JA 2PIZA 4NJQA 3I74A 1ZG7A 3KZWA 1BPNA 1WVMA 4PXCA 3JRUA 4KNGE 2ZEOA 2ZEHA 1XRYA 2ZEPA 1ARMA 1Z2LA 3FECA 2G9DA 2HB6A 4P4EA 1QQ9A 3DGVA 7CPAA 5HVGA 3BHXA 2C6PA 4OP4A 5CPAA 2PJ7A 4MHYA 5LRGA 1IY7A 4YWYA 3KL9A 4C9AA 2ZOGA 4NGPA 3PBBA 1CP7A 3HLPA 2NYQA 3B3VA 4C8CA 2AFXA 3T8WA 4C84A 2JBKA 1GYTA 2EK8A 4OIWA 4R76A 2BOAA 1LANA 4CPAA 3B7IA 5LYFA 3PFOA 3MN8A 4JYWA 4MCPA 4EFDA 3WC7A 3H8EA 1VGYA 1Q7LA 2NSMA 4A39A 1V6CA 4Z65A 2I3CA 3FEEA 5F09A 4UIBA 3ICUA 3MRUA 2FVGA 1LFWA 5HVFA 1BAVA 3IC1A 4OC2A 5IB9A 2AFUA 4X8IA 2V8GA 2BO9A 4R7MA 4DJLA 1EE3P 2ZOFA 4C8PA 4R6TA 2O4HA 2PJ6A 2CTBA 3V38A 2QVPA 3RBUA 1HEEA 3PB9X 3NA6A 4X3RA 4A38A 3D7DA 2J9AA 2PJ2A 4ZY2A 4ONWA 3D7HA 5JM6A 3D4UA 1ZLHA 4W9YA 1TKJA 3D7FA 4JZ0A 3WT4A 3IFEA 5D8NA 3D7GA 3S9NA 3CT9A 3B3TA 4MHZA 3PEIA 4F9UA 4YU9A 2GREA 1LAMA 2OR4A 3TX8A 8CPAA 4CDJA 3LMSA 1XMBA 5LYIA 4C86A 5J1QA 2C1CA 3H8GA 2QYVA 4NGTA 4G1PA 5ELYA 4P10A 4P44A 1R43A 3RZAA 2V8DA 4LQGA 3K2KA 2JBJA 4NGMA 1ZG9A 1AMPA 2CF4A 2PJAA 1TF8A 4KSIA 3I6SA 2GLJA 4X2TA 4NGQA 3FX6A 3CPXA 3B2YA 2RFHA 4DYOA 3SI2A 3BI0A 4A37A 2OOTA 3GB0A 1PCAA 2V8VA 1Y0YA 2IMOA 3TC8A 3KR4A 4Q7AA 4TNUA 2WZNA 5K8MA 1YSJA 5JH9A 3QNVA 1F2OA 3FJUA 4OC1A 4MMOA 4P45A 3B35A 1YW4A 4C9EA 4PXBA 3KQXA 1HDUA 4NFRA 2PJ9A 3GLJA 5IR2A 1LAPA 4AXVA 3FEDA 2F8HA 4C85A 5K8NA 2ZEEA 3CPAA 3PB4X 3CDXA 4MHNA 4FUUA 4IK2A 3B3SA 4ZY1A 4ZX9A 5LRKA 1IGBA 1Z5RA 2AFWA 3PB7X 3H8FA 3PB8X 3D67A 4C99A 3IO1A 4NGRA 2PE3A 1CBXA 4ZY0A 4TJXA 4B6ZA 3HUVA 2ZEDA 1BPMA 4NGSA 3SJEA 3KQZA 1VHEA 3RAMA 2DEAA 2IJZA 2C5QA 2PRQA 3FVLA 4GM5A 4IHMA 5D29A 4NGNA 3NH8A 2GP4A 1Z8LA 3LWUA 4YN3A 4F9VA 4WWVA 3KI9A 4FAIA 2JEWA 4R8FA 4O23A 4C9RA 2V8HA 3VATA 3SJGA 1TKHA 3IIBA 1CPXA 2PJCA 1QMUA 1F2PA 3WC5A 1UWYA 4UF4A 2XEJA 2ZEMA 1RTQA 2C6CA 2EWBA 1Y0RA 4CDKA 1TF9A 1NSAA 5HXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4L A;  4UIA A;  1ELM P;  2F7V A;  2XEG A;  4UEZ A;  4ZYQ A;  2GU2 A;  4DUK A;  1YW6 A;  2HC9 A;  1FNO A;  5THW A;  4MXU A;  2PJ4 A;  4P4F A;  1OBR A;  2PIY A;  4ZX8 A;  2Q51 A;  3SI1 A;  1ELL P;  3KGQ A;  4OC3 A;  5CBM A;  4RUH A;  4MCS A;  3VAR A;  2PJ0 A;  1HDQ A;  4UEE A;  1DTD A;  2CIJ A;  5HVH A;  2C6G A;  2PVW A;  2CTC A;  4A94 A;  4OC5 A;  2ZEG A;  2O53 A;  4WJB A;  2ZEN A;  5JGF A;  3KAS A;  3SJX A;  3WAB A;  2GLF A;  4NJR A;  3K9T A;  2Q4Z A;  3SJF A;  4C9U A;  2PJ1 A;  4PPZ A;  2EK9 A;  3ISX A;  1ZG8 A;  3VTA A;  1Y7E A;  4P4D A;  3FF3 A;  4OC0 A;  3GUX A;  1LOK A;  4OKO A;  1TXR A;  5I4M A;  3FMC A;  6CPA A;  1VIX A;  2AFZ A;  3IJ3 A;  1PYT B;  2VL1 A;  4F8Z A;  3EIF A;  4MRI A;  5K8O A;  3NH4 A;  1CX8 A;  1YLO A;  3D66 A;  4C8U A;  1Y9Z A;  5K8P A;  1TKF A;  5DS0 A;  5LRJ A;  3S9L A;  1H8L A;  2V77 A;  3ISZ A;  2ABZ A;  3KHZ A;  2PJ3 A;  2ZEL A;  3DLJ A;  3WC6 A;  3S9M A;  1ARL A;  2POK A;  4PXE A;  2PVV A;  4K3N A;  2ANP A;  3PB6 X;  3NFZ A;  4P4I A;  1YME A;  2XEI A;  3NH5 A;  3SI0 A;  2PCU A;  1CPS A;  3PRT A;  4IAV A;  3B3W A;  4TJV A;  1F57 A;  4P4B A;  2WYR A;  3PFE A;  5LYL A;  2ZEF A;  1DE4 C;  3VH9 A;  1XJO A;  2BCO A;  3FH4 A;  1LCP A;  4MHP A;  1KWM A;  3L2N A;  3BI1 A;  4H2K A;  4MCR A;  1CG2 A;  3B3C A;  2RB7 A;  4BD9 A;  4C8T A;  1ZLI A;  3D68 A;  1XFO A;  2Q43 A;  3I1U A;  4EWT A;  1BLL E;  4PQA A;  4OME A;  1XBU A;  2PJB A;  3N5F A;  4UEF A;  4C8A A;  1JQG A;  2IQ6 A;  2AFM A;  2AFO A;  3BXM A;  1FT7 A;  1CP6 A;  1VHO A;  4C8F A;  2PJ5 A;  3IWW A;  4OID A;  4C9V A;  2QJ8 A;  4ZI6 A;  3V7Z A;  1R3N A;  2AFS A;  1AYE A;  3IEH A;  3KHX A;  3PBE A;  4PXD A;  4TWE A;  4FBE A;  4MCQ A;  4FWU A;  3KR5 A;  4OC4 A;  4P6Y A;  5LYD A;  2XEF A;  2PJ8 A;  4EME A;  1XF1 A;  4P4J A;  2PIZ A;  4NJQ A;  3I74 A;  1ZG7 A;  3KZW A;  1BPN A;  1WVM A;  4PXC A;  3JRU A;  4KNG E;  2ZEO A;  2ZEH A;  1XRY A;  2ZEP A;  1ARM A;  1Z2L A;  3FEC A;  2G9D A;  2HB6 A;  4P4E A;  1QQ9 A;  3DGV A;  7CPA A;  5HVG A;  3BHX A;  2C6P A;  4OP4 A;  5CPA A;  2PJ7 A;  4MHY A;  5LRG A;  1IY7 A;  4YWY A;  3KL9 A;  4C9A A;  2ZOG A;  4NGP A;  3PBB A;  1CP7 A;  3HLP A;  2NYQ A;  3B3V A;  4C8C A;  2AFX A;  3T8W A;  4C84 A;  2JBK A;  1GYT A;  2EK8 A;  4OIW A;  4R76 A;  2BOA A;  1LAN A;  4CPA A;  3B7I A;  5LYF A;  3PFO A;  3MN8 A;  4JYW A;  4MCP A;  4EFD A;  3WC7 A;  3H8E A;  1VGY A;  1Q7L A;  2NSM A;  4A39 A;  1V6C A;  4Z65 A;  2I3C A;  3FEE A;  5F09 A;  4UIB A;  3ICU A;  3MRU A;  2FVG A;  1LFW A;  5HVF A;  1BAV A;  3IC1 A;  4OC2 A;  5IB9 A;  2AFU A;  4X8I A;  2V8G A;  2BO9 A;  4R7M A;  4DJL A;  1EE3 P;  2ZOF A;  4C8P A;  4R6T A;  2O4H A;  2PJ6 A;  2CTB A;  3V38 A;  2QVP A;  3RBU A;  1HEE A;  3PB9 X;  3NA6 A;  4X3R A;  4A38 A;  3D7D A;  2J9A A;  2PJ2 A;  4ZY2 A;  4ONW A;  3D7H A;  5JM6 A;  3D4U A;  1ZLH A;  4W9Y A;  1TKJ A;  3D7F A;  4JZ0 A;  3WT4 A;  3IFE A;  5D8N A;  3D7G A;  3S9N A;  3CT9 A;  3B3T A;  4MHZ A;  3PEI A;  4F9U A;  4YU9 A;  2GRE A;  1LAM A;  2OR4 A;  3TX8 A;  8CPA A;  4CDJ A;  3LMS A;  1XMB A;  5LYI A;  4C86 A;  5J1Q A;  2C1C A;  3H8G A;  2QYV A;  4NGT A;  4G1P A;  5ELY A;  4P10 A;  4P44 A;  1R43 A;  3RZA A;  2V8D A;  4LQG A;  3K2K A;  2JBJ A;  4NGM A;  1ZG9 A;  1AMP A;  2CF4 A;  2PJA A;  1TF8 A;  4KSI A;  3I6S A;  2GLJ A;  4X2T A;  4NGQ A;  3FX6 A;  3CPX A;  3B2Y A;  2RFH A;  4DYO A;  3SI2 A;  3BI0 A;  4A37 A;  2OOT A;  3GB0 A;  1PCA A;  2V8V A;  1Y0Y A;  2IMO A;  3TC8 A;  3KR4 A;  4Q7A A;  4TNU A;  2WZN A;  5K8M A;  1YSJ A;  5JH9 A;  3QNV A;  1F2O A;  3FJU A;  4OC1 A;  4MMO A;  4P45 A;  3B35 A;  1YW4 A;  4C9E A;  4PXB A;  3KQX A;  1HDU A;  4NFR A;  2PJ9 A;  3GLJ A;  1LAP A;  4AXV A;  3FED A;  2F8H A;  4C85 A;  5K8N A;  2ZEE A;  3CPA A;  3PB4 X;  3CDX A;  4MHN A;  4FUU A;  4IK2 A;  3B3S A;  4ZY1 A;  4ZX9 A;  5LRK A;  1IGB A;  1Z5R A;  2AFW A;  3PB7 X;  3H8F A;  3PB8 X;  3D67 A;  4C99 A;  3IO1 A;  4NGR A;  2PE3 A;  1CBX A;  4ZY0 A;  4TJX A;  4B6Z A;  3HUV A;  2ZED A;  1BPM A;  4NGS A;  3SJE A;  3KQZ A;  1VHE A;  3RAM A;  2DEA A;  2IJZ A;  2PRQ A;  3FVL A;  4GM5 A;  4IHM A;  5D29 A;  4NGN A;  3NH8 A;  1Z8L A;  3LWU A;  4YN3 A;  4F9V A;  4WWV A;  3KI9 A;  4FAI A;  2JEW A;  4R8F A;  4O23 A;  4C9R A;  2V8H A;  3VAT A;  3SJG A;  1TKH A;  3IIB A;  1CPX A;  2PJC A;  1QMU A;  1F2P A;  3WC5 A;  1UWY A;  4UF4 A;  2XEJ A;  2ZEM A;  1RTQ A;  2C6C A;  2EWB A;  1Y0R A;  4CDK A;  1TF9 A;  1NSA A;  5HXD A; 
#chains in the Genus database with same CATH topology
 2ZW5 A;  2Q44 A;  1M4L A;  4UIA A;  1ELM P;  2F7V A;  4KOX A;  5GCN A;  2XEG A;  2FCK A;  2JDD A;  3HPG G;  4UEZ A;  5H84 A;  5F5X A;  4ZYQ A;  5I4M A;  1IB1 E;  2J8N A;  2GU2 A;  2YGW A;  1YW6 A;  2HC9 A;  2Z3P A;  4MI4 A;  4DUK A;  5HKZ A;  1FNO A;  2J8M A;  3IWE A;  3G8W A;  5THW A;  4MXU A;  3ZNI A;  2PJ4 A;  4P4F A;  2G3A A;  2D4O A;  2XPP A;  4FD5 A;  1OBR A;  4AG7 A;  5AG7 A;  2C27 A;  2PIY A;  4MY0 A;  4ZX8 A;  4C2X A;  2Q51 A;  3GY9 A;  1ELL P;  3SI1 A;  3KGQ A;  1JWQ A;  4OC3 A;  5CBM A;  4UWI A;  4RUH A;  4II9 A;  4MJ8 A;  2PCN A;  2DF5 A;  3T9Y A;  4MCS A;  3VAR A;  2PJ0 A;  1Z9E A;  1S5K A;  1HDQ A;  5K99 A;  4UEE A;  1DTD A;  4U9Z A;  1X10 A;  2CIJ A;  2XPL A;  4CAV A;  5HVH A;  5C88 A;  2C6G A;  2PVW A;  2CTC A;  4PK2 A;  3GYA A;  4OC5 A;  4A94 A;  4CRY B;  2I79 A;  2ZEG A;  2O53 A;  4KUA A;  4IIX A;  4WJB A;  1YK3 A;  5HKY A;  2ZEN A;  4MFK A;  4CYQ A;  5JGF A;  3KAS A;  5BY0 A;  3SJX A;  2HWG A;  4OAD A;  4RN7 A;  4XNH B;  2GLF A;  3WAB A;  1TIQ A;  1YLE A;  2R1I A;  4R87 A;  4NJR A;  3OB2 B;  3D2M A;  3K9T A;  4A31 A;  5BWA B;  2Q4Z A;  2KCW A;  2FIA A;  3PP9 A;  3G23 A;  3SJF A;  4C9U A;  2PJ1 A;  4PPZ A;  2EK9 A;  3T0T A;  2Z3O A;  3IU2 A;  1IIC A;  3ISX A;  1GHE A;  2B0A A;  1ZG8 A;  3VTA A;  2DPT A;  1R61 A;  3S6G A;  2Q7B A;  1Y7E A;  1Z4R A;  3FF3 A;  4P4D A;  4OC0 A;  3GUX A;  3EY5 A;  5KTA A;  1LOK A;  4OKO A;  3VRQ A;  3R9E A;  2ZW7 A;  1L0C A;  1TXR A;  3BUW B;  4J3G A;  3JVN A;  3DSB A;  3MGD A;  3FMC A;  1YVK A;  2Z3K A;  3EO4 A;  3N7Z A;  4GS4 A;  4MFZ A;  3TLZ A;  2B58 A;  4YFJ A;  1VIX A;  2AFZ A;  2ZXV A;  3IJ3 A;  4B5O A;  6CPA A;  5G1Z A;  1MJ9 A;  1PYT B;  2VL1 A;  3TTH A;  4PV6 A;  4F8Z A;  2IL4 A;  3UY5 A;  4NXY A;  4E2A A;  3EIF A;  5F46 A;  4MRI A;  5K8O A;  3NH4 A;  1AUG A;  2OZH A;  5IB0 A;  3LD2 A;  1CX8 A;  1YLO A;  3D66 A;  4C8U A;  4CGO A;  1Y9Z A;  1CM0 A;  3CXQ A;  3RYO A;  5K8P A;  1TKF A;  3FBU A;  1C30 B;  5DS0 A;  4CS0 B;  5LRJ A;  3B8G A;  3S9L A;  1H8L A;  2V77 A;  2VEZ A;  3ISZ A;  3D3S A;  3BUN B;  2ABZ A;  3KHZ A;  4OLL A;  3TFY A;  5E96 A;  1EO0 A;  1QST A;  1VHS A;  2PJ3 A;  2MP0 A;  2ZEL A;  3DLJ A;  3WC6 A;  3TLA A;  4L8A A;  4CGN A;  3S9M A;  4KS9 A;  1ARL A;  2POK A;  3PGP A;  4PXE A;  1XEB A;  1S7F A;  2Z0Z A;  2PVV A;  4K3N A;  2ANP A;  3PB6 X;  2REF A;  3NFZ A;  4P4I A;  2HV2 A;  3TT2 A;  5JYB A;  1XE4 A;  4JLY A;  1YME A;  2XEI A;  3NH5 A;  4C8A A;  3SI0 A;  2PCU A;  1CPS A;  3PRT A;  4IAV A;  4KLV A;  5KTD A;  3B3W A;  3TE4 A;  4R3L A;  4FD6 A;  4TJV A;  1F57 A;  4P4B A;  2WYR A;  3PFE A;  4C68 A;  1KUV A;  5LYL A;  2ZEF A;  1DE4 C;  2WPW A;  4FD7 A;  4Y49 C;  4CYP A;  3VH9 A;  5HKW A;  4KVM E;  3TYX A;  1XJO A;  1EZA A;  5G22 A;  3VRO A;  3NE8 A;  3EZE A;  2BCO A;  1XMT A;  3FH4 A;  1LCP A;  4HNW B;  4IIY A;  4MHP A;  1KWM A;  3L2N A;  3BI1 A;  2BSW A;  4H2K A;  5CNP A;  4MCR A;  2OZG A;  1CG2 A;  3B3C A;  5F13 A;  1NXJ A;  5JPH A;  2OZU A;  5EMI A;  5KTC A;  1B6B A;  2RB7 A;  4BD9 A;  4MI1 A;  1ZLI A;  4X5K A;  3D68 A;  4C8T A;  1XFO A;  2Q43 A;  3I1U A;  4KOS A;  1BLL E;  1I21 A;  1M4I A;  3TO7 A;  4PQA A;  4OME A;  4CAX A;  4UCP A;  1XBU A;  2PJB A;  3N5F A;  4UEF A;  4EWT A;  2P0W A;  4CRZ B;  1JQG A;  2IQ6 A;  4KOU A;  2X7B A;  2AFM A;  1GGO A;  2VXK A;  1IYK A;  1IID A;  3TLC A;  4PK3 A;  2AFO A;  3BXM A;  2FE7 A;  1FT7 A;  4CGP A;  1CP6 A;  5HXD A;  1VHO A;  4C8F A;  1ZYM A;  3FB3 A;  3R1K A;  1VI4 A;  2PJ5 A;  2QIR A;  3IWW A;  2EBJ A;  4OID A;  1M6V B;  4C9V A;  2QJ8 A;  4ZI6 A;  3V7Z A;  1R3N A;  2GAN A;  2AFS A;  2HRO A;  1AYE A;  1X12 A;  3IEH A;  3KHX A;  4AG9 A;  2AJ6 A;  1M44 A;  3PBE A;  4R57 A;  4CGM A;  2QEC A;  4PXD A;  4TWE A;  1KBL A;  1YGH A;  2Z11 A;  1IYL A;  4MFJ A;  5F47 A;  5G21 A;  3TO9 A;  4FBE A;  4MCQ A;  4FWU A;  2CY2 A;  3KR5 A;  2YJV A;  2B4B A;  4HNY B;  4H1H A;  4OC4 A;  4P6Y A;  5LYD A;  2XEF A;  2ATR A;  1XOV A;  2PJ8 A;  4A2Z A;  4EME A;  1XF1 A;  3T05 A;  4P4J A;  2PIZ A;  4NJQ A;  3I74 A;  1ZG7 A;  3LOD A;  3F0A A;  1S3Z A;  2B3U A;  3TOB A;  3KZW A;  1BPN A;  3W91 A;  1WVM A;  1S7N A;  4PXC A;  3JRU A;  2NMT A;  3QAH A;  4KSA A;  5EC4 A;  2ZEO A;  3JUW A;  4KNG E;  2AE6 A;  2ZEH A;  1XRY A;  2ZEP A;  1ARM A;  1Z2L A;  3FEC A;  4NF1 A;  4E5S A;  1K4J A;  5H86 A;  2R82 A;  1M1D A;  1MK4 A;  3C26 A;  2G9D A;  4A4C A;  2HB6 A;  2Z10 A;  3CXP A;  2P6G A;  2E28 A;  4COB A;  3K9U A;  4P4E A;  1QQ9 A;  3DGV A;  4A95 A;  7CPA A;  5HVG A;  3BHX A;  2C6P A;  4OP4 A;  5G20 A;  4B12 A;  5CPA A;  4CAE A;  2EZB A;  2PJ7 A;  2QML A;  2ZW6 A;  3I3G A;  3F5B A;  4KLW A;  1CE8 B;  4MHY A;  5LRG A;  1ZO0 A;  1IY7 A;  4YWY A;  3KL9 A;  1VBH A;  2FXF A;  1FBV A;  3FIX A;  3TOA A;  2CBL A;  1Z8X A;  1UFH A;  2YNC A;  4C9A A;  1YVO A;  2ZOG A;  3CXS A;  4A30 A;  4NGP A;  3PBB A;  1CP7 A;  3HLP A;  2NYQ A;  4UFV A;  4KVX A;  3B3V A;  4M6G A;  5FD8 A;  4C8C A;  2AFX A;  4ONU A;  4UWJ A;  3NFQ A;  3T8W A;  4C84 A;  4H6Z A;  2JBK A;  5AG5 A;  2VI7 A;  2FS5 A;  1GYT A;  2Y1M A;  2EK8 A;  4OIW A;  4M6H A;  1YQE A;  4R76 A;  1SQH A;  1Z8W A;  2UV8 G;  4XPK A;  4B11 A;  2J8R A;  4F0X A;  2YJT A;  2BOA A;  2WPX A;  1LAN A;  2Z3L A;  3B7I A;  4CPA A;  5LYF A;  3FNC A;  4A32 A;  4MFP A;  4IUS A;  4ZBG A;  2D4P A;  1R57 A;  3OB1 B;  3PFO A;  1NMT A;  2PSW A;  3MN8 A;  4JYW A;  4MCP A;  1NSL A;  2H5M A;  3BLN A;  1WK4 A;  4EFD A;  1A2Z A;  3WC7 A;  1BOB A;  1VKC A;  1Y9K A;  3H8E A;  1VGY A;  2YNE A;  1Q7L A;  2NSM A;  2ZPA A;  4LQ6 A;  4A39 A;  4JJX A;  4Z65 A;  1MJB A;  1V6C A;  2I3C A;  3FEE A;  4MBU A;  1T36 B;  5AGE A;  1BO4 A;  5F09 A;  1MJA A;  3O8Z A;  2JEV A;  4UIB A;  1KUX A;  4LUA A;  4E8O A;  3ICU A;  3MRU A;  1YRE A;  2FVG A;  1OZP A;  4CYO A;  1LFW A;  2PR8 A;  5HVF A;  1BAV A;  4CYN A;  5AXI A;  4NCZ A;  2HI6 A;  1JDE A;  3P2H A;  4YGO A;  3D2P A;  2AUM A;  3PFV A;  3IC1 A;  4OC2 A;  3QAY A;  4GXH A;  5IB9 A;  2AFU A;  2R7H A;  2WSA A;  3F8K A;  4X8I A;  2V8G A;  2BO9 A;  1WWZ A;  5C82 A;  4R7M A;  4JD6 A;  4AVA A;  4DJL A;  3BJ8 A;  4H6U A;  1EE3 P;  2ZOF A;  2Y0M A;  4I49 A;  4R6T A;  3TLE A;  4C8P A;  4BPW B;  2B4D B;  4AVC A;  2O4H A;  2PJ6 A;  3GIU A;  3R96 A;  4C7H A;  4M8D A;  2CNT A;  2CTB A;  2O28 A;  3TO6 A;  1Q2Y A;  4XPD C;  1Z4E A;  1QSN A;  3V38 A;  1RO5 A;  1YX0 A;  3V8I A;  3TLG B;  3TCV A;  1KEE B;  2Y1N A;  4C2Z A;  4BPX B;  2QVP A;  4INJ A;  4CAF A;  3RBU A;  2Z3M A;  3H5Z A;  1HEE A;  2JDC A;  3PB9 X;  2JLM A;  4X3R A;  3NA6 A;  1FY7 A;  4A38 A;  3D7D A;  2J9A A;  2PJ2 A;  4OAE A;  4ZY2 A;  4MFQ A;  5HH1 A;  3GKR A;  5F9M A;  1NE9 A;  2FT0 A;  4ONW A;  2D0O A;  3D7H A;  5I0C A;  4UFW A;  4B5P B;  5JM6 A;  3D4U A;  1M4G A;  2YND A;  2A4N A;  1KUY A;  1Z8T A;  1ZLH A;  2P6F A;  3IGR A;  4W9Y A;  3T90 A;  1TKJ A;  4QBJ A;  1IOF A;  3D7F A;  4JZ0 A;  3WT4 A;  3IFE A;  2G0B A;  3D7G A;  3S9N A;  2HUZ A;  2PQ8 A;  3CT9 A;  3D8P A;  5D8N A;  3RNZ A;  3B3T A;  4BPU B;  4MHZ A;  1J4J A;  3FXT A;  1B87 A;  1JDB C;  2DPS A;  2R8V A;  3PLF B;  3PEI A;  4XPD B;  4JVO A;  3IWG A;  4Y49 B;  3OAK A;  1QSO A;  2ARH A;  2BL1 A;  3DR8 A;  4F9U A;  3SR3 A;  4KUB A;  4YU9 A;  4K30 A;  2PDO A;  4J0N A;  2FM4 A;  5F49 A;  3TLG A;  2GRE A;  1LAM A;  4LX9 A;  4GPL B;  2K5T A;  2OU2 A;  3R9G A;  1V0C A;  2OR4 A;  2N3A B;  1S7K A;  3TX8 A;  8CPA A;  4CDJ A;  5J8C A;  2BUE A;  3LMS A;  2OH1 A;  1XMB A;  2Z3N A;  2VBQ A;  5LYI A;  3DDD A;  4B13 A;  5J1Q A;  4C86 A;  2CNM A;  5EBV A;  1NBW A;  4U5Y A;  4C2Y A;  1B47 A;  1U6M A;  2C1C A;  2QYV A;  3H8G A;  4NGT A;  3KKW A;  3IU1 A;  2P6E A;  2PR1 A;  5F48 A;  4MY3 A;  2B3V A;  4G1P A;  3NOJ A;  3BUO B;  5ELY A;  1KZF A;  2DXQ A;  4P10 A;  4P44 A;  2BEI A;  1Q5X A;  5IV0 A;  1EZB A;  1R43 A;  3RZA A;  1ZL0 A;  2V8D A;  4LQG A;  1LRZ A;  2G3T A;  3K2K A;  1S60 A;  2JBJ A;  4CO9 A;  5AG6 A;  3VGO A;  2R98 A;  2VZY A;  2B4J C;  1XIX A;  3DNS A;  5IX3 A;  1CJW A;  3FRM A;  1WJT A;  4NGM A;  1I1D A;  1ZG9 A;  4AB7 A;  4UFX A;  3EZA A;  4KOT A;  1AMP A;  4XNH C;  3PT1 A;  4RR2 B;  2CF4 A;  1TF8 A;  2PJA A;  2RC4 A;  3FYN A;  4KZT A;  5AG4 A;  4CGL A;  4KSI A;  5HMN A;  1ZRS A;  4Q38 A;  3I6S A;  2GLJ A;  3CZX A;  4UA3 A;  4UCN A;  2GFQ A;  4X2T A;  5FVJ A;  4NGQ A;  3FX6 A;  4NEX A;  2ODF A;  3CPX A;  1Y7R A;  3B2Y A;  2RFH A;  3VWD A;  3BJ7 A;  4QB9 A;  4DYO A;  4KOY A;  4CZ1 A;  1YVH A;  4F0Y A;  1QSM A;  2Q0Y A;  4IF5 A;  4KOV A;  1PU9 A;  3BI0 A;  3SI2 A;  4A37 A;  2OOT A;  1PCA A;  2IMO A;  2V8V A;  1Y0Y A;  3GB0 A;  3TC8 A;  3DR6 A;  1A9X B;  3KR4 A;  4Q7A A;  4TNU A;  2WZN A;  3E0K A;  5K8M A;  1YSJ A;  2CXA A;  4ORF A;  5JH9 A;  3WR7 A;  3QNV A;  3W6S A;  1F2O A;  3C8O A;  3FJU A;  4KVO E;  1I12 A;  1C3O B;  5DWN A;  4OC1 A;  4MMO A;  4P45 A;  1J3L A;  4FD4 A;  3B35 A;  1YW4 A;  4CAW A;  4C9E A;  2FIW A;  4UCM A;  4QVT A;  4PXB A;  4NSQ A;  3KQX A;  1PUA A;  1HDU A;  3S6H A;  4NFR A;  2PJ9 A;  4R9M A;  4ZGY B;  3GLJ A;  4HNX B;  4C7I A;  4MHD A;  5IR2 A;  3SHP A;  3RO0 A;  1CS0 B;  1LAP A;  3JTK A;  4AXV A;  3TLY A;  3FED A;  2F8H A;  3VRP A;  2ZW4 A;  5A28 A;  2CNS A;  2REE A;  3ZJ0 A;  4C85 A;  5F1Y A;  3G3S A;  5K8N A;  2EO8 A;  3P2F A;  2ZEE A;  3CPA A;  2OLS A;  1Q2D A;  2FL4 A;  4HPS A;  3PB4 X;  2WUU A;  3QB8 A;  3R95 A;  3EXN A;  2X0S A;  4B10 A;  3CDX A;  1IOI A;  3EFA A;  3W6X A;  5ISV A;  2XPN A;  4R3K A;  2VZZ A;  4MHN A;  4FUU A;  4IK2 A;  3B3S A;  4ZY1 A;  3H4Q A;  4ZX9 A;  4A4B A;  5LRK A;  3I9S A;  4KSF A;  5J3X A;  4E94 A;  2AUN A;  1P4N A;  1IGB A;  2GE3 A;  1Z5R A;  1P0H A;  3EC4 A;  4XPL A;  2Q4Y A;  2AFW A;  3PB7 X;  4QC6 A;  3S6K A;  3H8F A;  1Z9U A;  1DIK A;  4L89 A;  4KOW A;  3PB8 X;  3D67 A;  4B14 A;  2EZA A;  4F6A A;  4C99 A;  3IO1 A;  3NE7 A;  4JXQ A;  4A33 A;  4MJX A;  2I00 A;  3SXO A;  4KOR A;  2VKZ G;  4AVB A;  4JXR A;  3U1B A;  1S7L A;  4NGR A;  4EYS A;  4DNC A;  2PE3 A;  2B5G B;  3VRR A;  4QUS A;  1CBX A;  4ZY0 A;  4TJX A;  4B6Z A;  3HUV A;  2EVN A;  2ZED A;  4EVY A;  4E0A A;  5JVL A;  1BPM A;  4NGS A;  2GIV A;  4BIN A;  3SJE A;  3KQZ A;  2HQY A;  5J8F A;  1QSR A;  1XF8 A;  3VRN A;  1VHE A;  2DEA A;  3LAC A;  3RAM A;  2IJZ A;  2C5Q A;  2PRQ A;  3FVL A;  4BBH A;  4GM5 A;  4IHM A;  5D29 A;  4NGN A;  2OB0 A;  4HKF A;  3HMJ G;  3PZJ A;  3NH8 A;  2PRB A;  2EUI A;  2GP4 A;  4M85 A;  1Z8L A;  2DLA A;  1Y9W A;  2B4D A;  3T5M A;  3LWU A;  4YN3 A;  4F9V A;  4WWV A;  3KI9 A;  4FAI A;  3TLB A;  2JEW A;  3SXN A;  4R8F A;  4O23 A;  1BXR B;  3OWC A;  2EZC A;  4C9R A;  3ZZI A;  4RS2 A;  2V8H A;  3VAT A;  2Q7S A;  4RI1 A;  3OP0 A;  3SJG A;  1TKH A;  2B5G A;  3IIB A;  4M3S A;  4PSW A;  3GJZ A;  3VWE A;  3K4I A;  4MFL A;  3KRV A;  1RXT A;  3T07 A;  1VBG A;  1CPX A;  3A9L A;  2DIK A;  1N71 A;  2PJC A;  1QMU A;  4BTF A;  3S6F A;  4BMH A;  5JQ4 A;  3HPH E;  3BUM B;  4PSX A;  3EZB A;  1F2P A;  4H89 A;  2Q04 A;  2YNC C;  1YR0 A;  1UWY A;  2FSR A;  4YRH A;  2VQY A;  4UF4 A;  3WC5 A;  4B5P A;  1M4D A;  2XEJ A;  4M6I A;  5A27 A;  2F5I A;  1Q2C A;  2Q4V A;  2ZEM A;  4Q36 A;  1RTQ A;  3U88 C;  4UBR A;  2C6C A;  2EWB A;  5DWM A;  4JWP A;  2D0P A;  2XPO A;  1KC7 A;  1Y0R A;  4U9Y A;  1IU8 A;  1ON0 A;  2PC1 A;  4CDK A;  1TF9 A;  1NSA A;  3F9K C;  3R9F A;  3BUX B;  4COG A; 
#chains in the Genus database with same CATH homology
 1M4L A;  4UIA A;  1ELM P;  2F7V A;  2XEG A;  4UEZ A;  4ZYQ A;  2GU2 A;  4DUK A;  1YW6 A;  2HC9 A;  1FNO A;  5THW A;  4MXU A;  2PJ4 A;  4P4F A;  1OBR A;  2PIY A;  4ZX8 A;  2Q51 A;  3SI1 A;  1ELL P;  3KGQ A;  4OC3 A;  5CBM A;  4RUH A;  4MCS A;  3VAR A;  2PJ0 A;  1HDQ A;  4UEE A;  1DTD A;  2CIJ A;  5HVH A;  2C6G A;  2PVW A;  2CTC A;  4A94 A;  4OC5 A;  2ZEG A;  2O53 A;  4WJB A;  2ZEN A;  5JGF A;  3KAS A;  3SJX A;  3WAB A;  2GLF A;  4NJR A;  3K9T A;  2Q4Z A;  3SJF A;  4C9U A;  2PJ1 A;  4PPZ A;  2EK9 A;  3ISX A;  1ZG8 A;  3VTA A;  1Y7E A;  4P4D A;  3FF3 A;  4OC0 A;  3GUX A;  1LOK A;  4OKO A;  1TXR A;  5I4M A;  3FMC A;  6CPA A;  1VIX A;  2AFZ A;  3IJ3 A;  1PYT B;  2VL1 A;  4F8Z A;  3EIF A;  4MRI A;  5K8O A;  3NH4 A;  1CX8 A;  1YLO A;  3D66 A;  4C8U A;  1Y9Z A;  5K8P A;  1TKF A;  5DS0 A;  5LRJ A;  3S9L A;  1H8L A;  2V77 A;  3ISZ A;  2ABZ A;  3KHZ A;  2PJ3 A;  2ZEL A;  3DLJ A;  3WC6 A;  3S9M A;  1ARL A;  2POK A;  4PXE A;  2PVV A;  4K3N A;  2ANP A;  3PB6 X;  3NFZ A;  4P4I A;  1YME A;  2XEI A;  3NH5 A;  3SI0 A;  2PCU A;  1CPS A;  3PRT A;  4IAV A;  3B3W A;  4TJV A;  1F57 A;  4P4B A;  2WYR A;  3PFE A;  5LYL A;  2ZEF A;  1DE4 C;  3VH9 A;  1XJO A;  2BCO A;  3FH4 A;  1LCP A;  4MHP A;  1KWM A;  3L2N A;  3BI1 A;  4H2K A;  4MCR A;  1CG2 A;  3B3C A;  2RB7 A;  4BD9 A;  4C8T A;  1ZLI A;  3D68 A;  1XFO A;  2Q43 A;  3I1U A;  4EWT A;  1BLL E;  4PQA A;  4OME A;  1XBU A;  2PJB A;  3N5F A;  4UEF A;  4C8A A;  1JQG A;  2IQ6 A;  2AFM A;  2AFO A;  3BXM A;  1FT7 A;  1CP6 A;  1VHO A;  4C8F A;  2PJ5 A;  3IWW A;  4OID A;  4C9V A;  2QJ8 A;  4ZI6 A;  3V7Z A;  1R3N A;  2AFS A;  1AYE A;  3IEH A;  3KHX A;  3PBE A;  4PXD A;  4TWE A;  4FBE A;  4MCQ A;  4FWU A;  3KR5 A;  4OC4 A;  4P6Y A;  5LYD A;  2XEF A;  2PJ8 A;  4EME A;  1XF1 A;  4P4J A;  2PIZ A;  4NJQ A;  3I74 A;  1ZG7 A;  3KZW A;  1BPN A;  1WVM A;  4PXC A;  3JRU A;  4KNG E;  2ZEO A;  2ZEH A;  1XRY A;  2ZEP A;  1ARM A;  1Z2L A;  3FEC A;  2G9D A;  2HB6 A;  4P4E A;  1QQ9 A;  3DGV A;  7CPA A;  5HVG A;  3BHX A;  2C6P A;  4OP4 A;  5CPA A;  2PJ7 A;  4MHY A;  5LRG A;  1IY7 A;  4YWY A;  3KL9 A;  4C9A A;  2ZOG A;  4NGP A;  3PBB A;  1CP7 A;  3HLP A;  2NYQ A;  3B3V A;  4C8C A;  2AFX A;  3T8W A;  4C84 A;  2JBK A;  1GYT A;  2EK8 A;  4OIW A;  4R76 A;  2BOA A;  1LAN A;  4CPA A;  3B7I A;  5LYF A;  3PFO A;  3MN8 A;  4JYW A;  4MCP A;  4EFD A;  3WC7 A;  3H8E A;  1VGY A;  1Q7L A;  2NSM A;  4A39 A;  1V6C A;  4Z65 A;  2I3C A;  3FEE A;  5F09 A;  4UIB A;  3ICU A;  3MRU A;  2FVG A;  1LFW A;  5HVF A;  1BAV A;  3IC1 A;  4OC2 A;  5IB9 A;  2AFU A;  4X8I A;  2V8G A;  2BO9 A;  4R7M A;  4DJL A;  1EE3 P;  2ZOF A;  4C8P A;  4R6T A;  2O4H A;  2PJ6 A;  2CTB A;  3V38 A;  2QVP A;  3RBU A;  1HEE A;  3PB9 X;  3NA6 A;  4X3R A;  4A38 A;  3D7D A;  2J9A A;  2PJ2 A;  4ZY2 A;  4ONW A;  3D7H A;  5JM6 A;  3D4U A;  1ZLH A;  4W9Y A;  1TKJ A;  3D7F A;  4JZ0 A;  3WT4 A;  3IFE A;  5D8N A;  3D7G A;  3S9N A;  3CT9 A;  3B3T A;  4MHZ A;  3PEI A;  4F9U A;  4YU9 A;  2GRE A;  1LAM A;  2OR4 A;  3TX8 A;  8CPA A;  4CDJ A;  3LMS A;  1XMB A;  5LYI A;  4C86 A;  5J1Q A;  2C1C A;  3H8G A;  2QYV A;  4NGT A;  4G1P A;  5ELY A;  4P10 A;  4P44 A;  1R43 A;  3RZA A;  2V8D A;  4LQG A;  3K2K A;  2JBJ A;  4NGM A;  1ZG9 A;  1AMP A;  2CF4 A;  2PJA A;  1TF8 A;  4KSI A;  3I6S A;  2GLJ A;  4X2T A;  4NGQ A;  3FX6 A;  3CPX A;  3B2Y A;  2RFH A;  4DYO A;  3SI2 A;  3BI0 A;  4A37 A;  2OOT A;  3GB0 A;  1PCA A;  2V8V A;  1Y0Y A;  2IMO A;  3TC8 A;  3KR4 A;  4Q7A A;  4TNU A;  2WZN A;  5K8M A;  1YSJ A;  5JH9 A;  3QNV A;  1F2O A;  3FJU A;  4OC1 A;  4MMO A;  4P45 A;  3B35 A;  1YW4 A;  4C9E A;  4PXB A;  3KQX A;  1HDU A;  4NFR A;  2PJ9 A;  3GLJ A;  5IR2 A;  1LAP A;  4AXV A;  3FED A;  2F8H A;  4C85 A;  5K8N A;  2ZEE A;  3CPA A;  3PB4 X;  3CDX A;  4MHN A;  4FUU A;  4IK2 A;  3B3S A;  4ZY1 A;  4ZX9 A;  5LRK A;  1IGB A;  1Z5R A;  2AFW A;  3PB7 X;  3H8F A;  3PB8 X;  3D67 A;  4C99 A;  3IO1 A;  4NGR A;  2PE3 A;  1CBX A;  4ZY0 A;  4TJX A;  4B6Z A;  3HUV A;  2ZED A;  1BPM A;  4NGS A;  3SJE A;  3KQZ A;  1VHE A;  3RAM A;  2DEA A;  2IJZ A;  2C5Q A;  2PRQ A;  3FVL A;  4GM5 A;  4IHM A;  5D29 A;  4NGN A;  3NH8 A;  2GP4 A;  1Z8L A;  3LWU A;  4YN3 A;  4F9V A;  4WWV A;  3KI9 A;  4FAI A;  2JEW A;  4R8F A;  4O23 A;  4C9R A;  2V8H A;  3VAT A;  3SJG A;  1TKH A;  3IIB A;  1CPX A;  2PJC A;  1QMU A;  1F2P A;  3WC5 A;  1UWY A;  4UF4 A;  2XEJ A;  2ZEM A;  1RTQ A;  2C6C A;  2EWB A;  1Y0R A;  4CDK A;  1TF9 A;  1NSA A;  5HXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...