4NGMA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 263
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngmA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngmA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngmA02
4P4FA 3MN8A 2OR4A 3H8GA 3HUVA 2OOTA 2BOAA 3B3CA 3IJ3A 2V8VA 3LMSA 4O23A 3WC7A 3FEDA 4IK2A 4TWEA 3D66A 3SJXA 4PXDA 4F8ZA 2PJCA 4OC2A 5LRJA 5JH9A 2ZEOA 4YWYA 1ARMA 4MHPA 3B35A 2PJ0A 4NGMA 1V6CA 2JEWA 1ELMP 2RFHA 5K8OA 1HDQA 4X8IA 2ZEPA 4P4DA 3NH5A 2Q51A 3SI1A 3S9LA 3IWWA 4X2TA 3FF3A 1RTQA 4BD9A 2V77A 5K8NA 2GREA 4Z65A 5D29A 4H2KA 4C84A 1NSAA 1IGBA 2PJ6A 2Q4ZA 3ISXA 2PJ3A 2PIZA 3FVLA 6CPAA 1TXRA 2QYVA 4ZX9A 4C8CA 3KHZA 2PJ8A 2IQ6A 4ZY2A 3SI2A 4TJXA 5LYLA 1R43A 1ZG7A 2PJAA 5LRKA 3SJGA 3ISZA 2BCOA 1UWYA 3V7ZA 1YW4A 3KR4A 3WC6A 3GB0A 5IB9A 2ANPA 4PQAA 4OC4A 2ZENA 3B3SA 3PB7X 4YU9A 1PYTB 2PCUA 4NGSA 1YSJA 4NGNA 1ZLHA 3LWUA 5HVFA 3JRUA 3K9TA 2AFSA 4OC0A 4MCQA 2GU2A 3V38A 4CDKA 4FWUA 5JGFA 4OP4A 7CPAA 3H8FA 2ZEHA 4R8FA 4CPAA 1Y0RA 4F9UA 4WJBA 8CPAA 4R6TA 2C6GA 4F9VA 1VGYA 4C9AA 4MXUA 2ZEDA 3DGVA 4C8TA 4IAVA 3RAMA 2ZOFA 3T8WA 4K3NA 4AXVA 4C86A 3PFEA 3QNVA 4EFDA 3S9NA 4OIDA 2C1CA 4PXBA 4FUUA 5ELYA 3VH9A 4P45A 4A38A 5LYIA 2PJ9A 1YLOA 2CTCA 4OC3A 4C8PA 4NGPA 2EWBA 2PJ4A 2PJBA 2ZEMA 3CT9A 1XMBA 2NYQA 2V8GA 3S9MA 5K8MA 2J9AA 1ZG9A 1CG2A 3PRTA 2BO9A 4C9VA 1TF9A 3BXMA 4EMEA 4P4JA 3FECA 3B2YA 4RUHA 3PBBA 1ZG8A 4A39A 1H8LA 1AYEA 3TX8A 4JZ0A 1LAMA 4IHMA 3KI9A 4MHYA 2JBKA 4W9YA 4OC5A 1VIXA 1HEEA 2PJ2A 2AFXA 2PJ7A 4UF4A 4P6YA 4DYOA 4ZYQA 1TKFA 2QJ8A 1YW6A 2O53A 4OC1A 1FNOA 2CTBA 2AFUA 4PXEA 1Z8LA 4ONWA 1XJOA 3NH8A 4WWVA 3RZAA 4NGTA 4NJQA 4YN3A 3D7DA 3WC5A 1QQ9A 4C9RA 3I74A 2IMOA 3KZWA 2Q43A 4P10A 4DJLA 3CPAA 3D7GA 2FVGA 1XF1A 1XRYA 3MRUA 4MMOA 3IEHA 5JM6A 1WVMA 1R3NA 5DS0A 4FAIA 4KSIA 3BI1A 3WABA 4PXCA 1Y0YA 4A37A 1TKJA 4MRIA 3HLPA 1BAVA 1FT7A 3D7HA 1AMPA 2V8DA 2EK8A 2NSMA 2PRQA 4CDJA 4G1PA 4B6ZA 3D7FA 4R76A 2ZEEA 3SI0A 2XEFA 2ZEGA 3PBEA 1CPSA 1XFOA 1CP6A 3NA6A 3KL9A 4P4BA 3ICUA 4OIWA 3BHXA 5HVHA 4PPZA 3B3WA 1F57A 2XEGA 1BPMA 2EK9A 1LAPA 3KQZA 2POKA 2AFMA 1Y9ZA 3L2NA 3KQXA 4MCRA 3PB8X 3TC8A 4P4IA 3WT4A 4TJVA 5I4MA 1KWMA 2AFOA 5J1QA 4P44A 4C9UA 2O4HA 4Q7AA 3NH4A 2AFZA 1M4LA 4NGQA 4NGRA 2PJ5A 2PJ1A 4MCPA 1CBXA 1BLLE 2PVVA 4OKOA 3PB9X 3GLJA 3IC1A 1OBRA 3KHXA 4ZY0A 1CPXA 4DUKA 2CIJA 2PVWA 3CPXA 1PCAA 1DE4C 3DLJA 3KASA 2F8HA 4UEEA 1F2PA 2G9DA 2V8HA 5LYDA 5CPAA 3VATA 1TF8A 3I1UA 3FMCA 3PB6X 5HVGA 1IY7A 3D4UA 2C6PA 5LYFA 4LQGA 2ZEFA 4MCSA 1JQGA 4UIBA 1LANA 3H8EA 4C99A 1YMEA 4UEFA 2GLJA 3VARA 4A94A 2HC9A 3N5FA 1GYTA 2I3CA 4C9EA 4C85A 3FJUA 3IFEA 1Z5RA 1Q7LA 3D67A 4UEZA 4NJRA 1BPNA 4EWTA 5HXDA 3VTAA 1EE3P 5THWA 2RB7A 4C8UA 5D8NA 1F2OA 3B3TA 3KGQA 3K2KA 3EIFA 2IJZA 4TNUA 3D68A 1LCPA 4FBEA 2XEIA 3CDXA 2XEJA 3FX6A 2HB6A 2ZELA 4ZY1A 1TKHA 1HDUA 4NFRA 5K8PA 2JBJA 1Y7EA 4C8FA 4MHZA 1VHEA 5LRGA 3GUXA 1DTDA 4KNGE 2WYRA 2PE3A 4ZX8A 1XBUA 3B3VA 2GLFA 3PB4X 2QVPA 1CP7A 2F7VA 2ZOGA 2AFWA 4OMEA 3PFOA 3BI0A 3NFZA 2VL1A 3FH4A 3IIBA 2DEAA 5CBMA 4GM5A 4R7MA 1VHOA 4JYWA 4C8AA 3SJEA 3IO1A 2WZNA 4X3RA 1QMUA 4P4EA 3I6SA 1ELLP 2CF4A 3KR5A 1ZLIA 3RBUA 1CX8A 4ZI6A 2PIYA 3FEEA 4UIAA 2ABZA 5F09A 1LFWA 3B7IA 3SJFA 1LOKA 4MHNA 2C6CA 3PEIA 1Z2LA 1ARLA
chains in the Genus database with same CATH superfamily
4P4FA 3QAHA 3MN8A 4CGLA 4UCNA 4UFXA 4MJXA 2OR4A 2FSRA 2VXKA 3H8GA 4MI1A 3HUVA 5I0CA 4M6IA 2AJ6A 1A9XB 2P6FA 2OOTA 4ZBGA 2BOAA 4KVME 3B3CA 5AG6A 1M1DA 3VROA 1XE4A 2V8VA 3IJ3A 3LMSA 4O23A 1XEBA 3WC7A 3FEDA 1FBVA 4IK2A 3HMJG 3A9LA 3D66A 3E0KA 4FD6A 4TWEA 2YJVA 2VEZA 3BUXB 3SJXA 4PXDA 4F8ZA 3TFYA 3VRRA 2PJCA 4OC2A 5LRJA 2D0OA 2RC4A 3F9KC 1P0HA 5JH9A 4A4CA 3F8KA 2EZCA 2MP0A 5G20A 1KEEB 1XOVA 2ZEOA 4YWYA 1ARMA 4GPLB 4BPUB 3TLGB 4MHPA 4KOUA 3B35A 2PJ0A 4B5OA 4NGMA 1XMTA 1V6CA 4E94A 2JEWA 1ELMP 2KCWA 2RFHA 2Q7SA 3WR7A 4KSFA 5J8CA 5K8OA 5HKZA 3JVNA 4UFWA 3D3SA 1Z9EA 1HDQA 2J8NA 1KUVA 2B5GA 2ZEPA 4L89A 4X8IA 4P4DA 3BUMB 2REEA 5IV0A 3EZEA 3HPHE 4U9YA 1L0CA 3BUNB 1KUYA 4MBUA 3KKWA 3TOBA 3NH5A 2Q51A 4AG7A 3K9UA 5ISVA 1Z4RA 3HPGG 2R1IA 3UY5A 3SI1A 1M4IA 2BUEA 4YFJA 2I79A 2FS5A 2PR8A 3S9LA 1BXRB 3IWWA 1Z8TA 3FF3A 1RTQA 4X2TA 2ZW7A 4BD9A 3SR3A 2EZBA 1UFHA 2V77A 5K8NA 3T90A 2GREA 4QC6A 4Z65A 3KRVA 4H6UA 5D29A 4H2KA 1IOFA 4C84A 4B5PA 3BJ8A 1NSAA 3NE7A 4HNWB 4YGOA 1IGBA 2PJ6A 2Q4ZA 4M3SA 5JPHA 3ISXA 3DR6A 2PJ3A 1J3LA 2PIZA 2B3UA 3FVLA 4XNHC 3VRQA 3R1KA 3RNZA 5AG5A 3VGOA 2Y0MA 6CPAA 4BTFA 1TXRA 2QYVA 4ZX9A 4CYNA 1Y9KA 3B8GA 4C8CA 3KHZA 3GKRA 3IWEA 4B11A 2PJ8A 3C8OA 2IQ6A 4ZY2A 3SI2A 4TJXA 5FD8A 2Y1MA 5LYLA 4CZ1A 1R43A 1ZG7A 3W6SA 2PJAA 1YX0A 4DNCA 3EFAA 5LRKA 4OLLA 3SJGA 4HKFA 4ZGYB 3ISZA 2BCOA 1IIDA 1K4JA 1AUGA 5H84A 1UWYA 3NFQA 2P0WA 1BOBA 3V7ZA 2Q4YA 1YW4A 4UA3A 3KR4A 4XPLA 3WC6A 3D2MA 3ZZIA 3GB0A 5IB9A 2OLSA 2YNCC 2ANPA 4PQAA 4OC4A 1ZO0A 1S7NA 2ZENA 3B3SA 3PB7X 4YU9A 1YQEA 5F13A 1PYTB 2PCUA 5GCNA 4NGSA 3S6GA 1YSJA 4NGNA 1ZLHA 3LWUA 3P2FA 4KSAA 3PT1A 3IU1A 3JRUA 3I9SA 3K9TA 3G8WA 3PFVA 1M44A 5DWNA 2AFSA 4F0XA 4OC0A 5A28A 4MCQA 2CNTA 2GU2A 3CXSA 2R98A 3V38A 3TLAA 4CDKA 4FWUA 4KOYA 4OP4A 7CPAA 5JGFA 3H8FA 2QECA 3VRPA 4CGPA 2VZZA 3BUOB 2JLMA 2ZEHA 3FNCA 4R8FA 4CPAA 1Y0RA 4KZTA 4F9UA 4WJBA 4KOXA 8CPAA 4C8UA 2Y1NA 1FY7A 2BL1A 3EXNA 4R6TA 3OWCA 3NOJA 2C6GA 5J3XA 1VGYA 4FD7A 4MXUA 4ONUA 4R3KA 4F9VA 4C9AA 2ZEDA 3DGVA 4YRHA 4XPDB 4C8TA 4IAVA 5HKWA 3RAMA 4C7IA 2ZOFA 3T8WA 4K3NA 4AXVA 4E2AA 4C86A 3BLNA 3PFEA 3QNVA 4EFDA 3S9NA 1X10A 4M6GA 3TLEA 1NMTA 4OIDA 2P6GA 4A33A 2C1CA 3TE4A 4PXBA 4R87A 1JDEA 4FUUA 5ELYA 3VH9A 4P45A 4A38A 2B58A 4JVOA 5LYIA 3U1BA 4H89A 5F47A 4HPSA 5BY0A 2Z0ZA 4CAEA 2XPNA 2HV2A 4KOVA 4BPWB 1TIQA 1QSNA 1YLOA 1ON0A 2PJ9A 2PR1A 2CTCA 3OB1B 4OC3A 1YVOA 2XPPA 4NGPA 1QSRA 2ZW4A 5G21A 5F46A 4C8PA 2EWBA 4MY0A 2GIVA 2PJ4A 3TO9A 2PJBA 2ZEMA 3CT9A 1XMBA 2NYQA 4CAVA 4C2ZA 2V8GA 2WSAA 3TO7A 5EMIA 2AUNA 4I49A 3S9MA 3BUWB 3R96A 3T0TA 5K8MA 4II9A 2J9AA 3T07A 4RI1A 3H5ZA 2AE6A 2ZW6A 1ZG9A 1CG2A 2BSWA 2N3AB 2BO9A 1I12A 3PRTA 4MHDA 4PK3A 1TF9A 4C9VA 2NMTA 3BXMA 4EMEA 4AVBA 4P4JA 3FECA 3B2YA 1YVHA 4A2ZA 1YR0A 3S6FA 4RUHA 4PV6A 1EZAA 1Q5XA 1VI4A 3PBBA 1ZG8A 4A39A 1C3OB 1H8LA 5JQ4A 1AYEA 1YK3A 5FVJA 3VRNA 1KC7A 4UBRA 2CNMA 3TX8A 3VWDA 1GHEA 3S6KA 4CYPA 1PU9A 2Z3PA 3F0AA 4JZ0A 1LAMA 1S7FA 2PDOA 4KOTA 2B0AA 3O8ZA 4IHMA 3PP9A 1CJWA 3KI9A 4MHYA 2B3VA 1XIXA 4MI4A 4C68A 2JBKA 3H4QA 4W9YA 4FD4A 1CE8B 3DNSA 4OC5A 3CXPA 1VIXA 1HEEA 2PJ2A 3ZNIA 2AFXA 2B4DB 4QB9A 3ZJ0A 2PJ7A 4UF4A 1IOIA 5AG4A 2FIAA 4Y49B 2Z3LA 4P6YA 4DYOA 2FE7A 4ZYQA 5BWAB 4J3GA 1CS0B 1DIKA 1T36B 1ZRSA 5JYBA 1TKFA 3SHPA 2D4OA 5HKYA 2QJ8A 1YW6A 2O53A 4OC1A 1FNOA 2CTBA 4MFQA 5C82A 4E5SA 2AFUA 4PXEA 1Z8LA 2OH1A 4LUAA 4ONWA 1XJOA 1NSLA 4CGOA 1R57A 2YNDA 2A4NA 3NH8A 4WWVA 2YNEA 3FRMA 4J0NA 3RZAA 4NGTA 3R9GA 1NE9A 4NJQA 2ZPAA 2Z3OA 2Z10A 2Z3KA 4YN3A 3D7DA 3WC5A 1QQ9A 4C9RA 4NSQA 5AG7A 4GXHA 3I74A 2IMOA 2OZHA 3KZWA 5F48A 1J4JA 2Q43A 4P10A 4DJLA 3U88C 1YVKA 3CPAA 4CYQA 3D7GA 2FVGA 1XF1A 2J8MA 2AUMA 1XRYA 2QMLA 5EC4A 4RS2A 3MRUA 3N7ZA 4QVTA 1EO0A 3CZXA 2EZAA 2Q44A 4MMOA 4C2XA 3IEHA 3RYOA 4CAWA 5JM6A 1WVMA 4KUBA 3NE8A 1R3NA 1EZBA 4QUSA 5DS0A 4FAIA 1SQHA 5K99A 4KSIA 1JWQA 3PGPA 1I21A 1S5KA 4KUAA 4NF1A 4UWIA 3BI1A 1M6VB 3WABA 3EC4A 3LODA 4IUSA 2YJTA 3OB2B 1MK4A 4PXCA 1Y9WA 1Y0YA 2G3TA 3D8PA 4A37A 3TLGA 4JLYA 2CNSA 1TKJA 4MRIA 2PC1A 3DDDA 3HLPA 1VBGA 5AXIA 1BAVA 3TTHA 1FT7A 1PUAA 1WWZA 4NCZA 3D7HA 3GYAA 1AMPA 3RO0A 2V8DA 1Q2DA 2EK8A 2NSMA 2B4DA 2Z3NA 2PRQA 2ATRA 5A27A 4CDJA 2JDDA 4G1PA 1R61A 4B6ZA 4M6HA 4C7HA 4PSXA 1I1DA 3D7FA 4R76A 2GP4A 2ZEEA 4MY3A 3SI0A 2XEFA 5HH1A 3TOAA 2ZEGA 3DR8A 4B10A 3PBEA 1S60A 1CPSA 2FL4A 1XFOA 1M4DA 4F6AA 2FM4A 3T5MA 3VWEA 2Q0YA 3V8IA 5DWMA 1CP6A 3D2PA 4KVOE 3NA6A 3KL9A 1KZFA 4P4BA 3ICUA 4OIWA 3BHXA 4CAXA 3QAYA 1KBLA 2HROA 2B4BA 5HVHA 1RO5A 3PZJA 4PPZA 3B3WA 1F57A 2F5IA 2XEGA 3FIXA 1BPMA 2EK9A 4B13A 1LAPA 3KQZA 2P6EA 3LD2A 3T05A 3QB8A 4MFKA 3SXNA 5HVFA 2POKA 4BPXB 2HQYA 2AFMA 2GFQA 4A31A 1B47A 4JWPA 1MJBA 1Y9ZA 3R9FA 3L2NA 4B12A 1RXTA 3KQXA 4COGA 1S7KA 4EVYA 2WPWA 4MCRA 2B5GB 2CXAA 3PB8X 2FXFA 4KLVA 3TC8A 4E0AA 4P4IA 3WT4A 3PLFB 5C88A 2HUZA 1P4NA 4TJVA 5I4MA 1KWMA 2AFOA 3CXQA 4P44A 4CGNA 5J1QA 4C9UA 3S6HA 1IB1E 2O4HA 4NXYA 4Q7AA 3NH4A 4H1HA 2AFZA 4JD6A 2JEVA 4JXRA 3OAKA 1M4LA 1U6MA 2O28A 4NGQA 2EO8A 2Z3MA 4NGRA 1IU8A 2Q04A 2PJ5A 3TT2A 4B5PB 4L8AA 2PJ1A 3I3GA 4XPDC 4MCPA 1CBXA 2WUUA 3JTKA 5KTDA 1QSMA 1BLLE 2OZGA 2PVVA 2OZUA 4OKOA 3PB9X 4HNXB 3TCVA 2HI6A 1YREA 2CY2A 3GLJA 4A4BA 3IC1A 3G3SA 1Z8WA 4PK2A 1OBRA 3KHXA 1B6BA 4ZY0A 2VKZG 1CPXA 3FBUA 4KLWA 4DUKA 2CIJA 2PVWA 3CPXA 1LRZA 1PCAA 3IU2A 1DE4C 3DLJA 5J8FA 3KASA 2F8HA 4UEEA 1F2PA 2G9DA 2V8HA 4K30A 5CPAA 5LYDA 1CM0A 3VATA 1ZYMA 5F1YA 1TF8A 4JJXA 3I1UA 5IB0A 2EUIA 4FD5A 3FMCA 4IIXA 1XF8A 3PB6X 4Q36A 1IY7A 3W6XA 3D4UA 2C6PA 5HMNA 5HVGA 3F5BA 5LYFA 4LQGA 4XNHB 2C5QA 2ZEFA 5JVLA 4CGMA 4MCSA 4MFZA 1JQGA 5F9MA 4UIBA 4Q38A 4KOSA 5IR2A 4R9MA 3W91A 1LANA 4BBHA 3H8EA 3EZBA 4GS4A 3TO6A 1NXJA 4C99A 1V0CA 4B14A 1YMEA 4CS0B 2GE3A 2GLJA 2H5MA 4UEFA 3VARA 1NBWA 1A2ZA 2XPOA 3TLZA 4IF5A 4A94A 2HC9A 4NEXA 3N5FA 1GYTA 4CRYB 2I3CA 4UFVA 4EYSA 4C9EA 4C8AA 4C85A 5EBVA 3EY5A 3FJUA 2EVNA 3IFEA 5F49A 4A30A 4AVCA 1Z5RA 2QIRA 2ZW5A 3MGDA 1Q7LA 3D67A 4UEZA 4NJRA 1BPNA 3C26A 4EWTA 2B4JC 5HXDA 3VTAA 1EE3P 5THWA 2RB7A 1IYLA 3IGRA 4A32A 3OP0A 4M85A 4MFLA 1Y7RA 3TLBA 2D0PA 1KUXA 5D8NA 4U5YA 5KTAA 1VKCA 1F2OA 3B3TA 3FYNA 3K2KA 3KGQA 4UCMA 2IJZA 4Y49C 3EIFA 2C27A 3IWGA 4TNUA 2DXQA 3D68A 4KVXA 1LCPA 1Z4EA 4ORFA 4FBEA 3BJ7A 2VQYA 2XEIA 3CDXA 4KS9A 2DIKA 2PQ8A 2DPSA 5CNPA 1Q2CA 2XEJA 2BEIA 2HB6A 3FX6A 2ZELA 3T9YA 4ZY1A 1TKHA 2PCNA 4MFPA 4LX9A 1HDUA 4NFRA 5K8PA 2JBJA 2ARHA 1GGOA 1Y7EA 4C8FA 3LACA 4F0YA 4MHZA 3FB3A 1VHEA 2ODFA 5LRGA 3GUXA 1DTDA 4KNGE 3DSBA 1VBHA 3P2HA 4AB7A 1ZL0A 4CO9A 5G1ZA 2WYRA 2PE3A 2E28A 1IYKA 4ZX8A 1XBUA 4M8DA 3GIUA 3K4IA 2FCKA 1MJAA 3B3VA 2GLFA 4RN7A 2JDCA 2X7BA 2R82A 2VI7A 4H6ZA 3PB4X 4OADA 3SXOA 1YGHA 2Z11A 1IICA 1Z8XA 4AVAA 4PSWA 2QVPA 4HNYB 4BMHA 4CAFA 1OZPA 2UV8G 2VZYA 1MJ9A 1CP7A 1B87A 4MFJA 2WPXA 1JDBC 2F7VA 4JXQA 2GANA 4C2YA 2D4PA 4COBA 4AG9A 1N71A 2ZOGA 1QSTA 1WJTA 1VHSA 2AFWA 2CBLA 4OMEA 3BI0A 1YLEA 2FT0A 3NFZA 3PFOA 4XPKA 2OU2A 4QBJA 4MJ8A 2DPTA 2VL1A 2YNCA 4LQ6A 3TLYA 1X12A 3FH4A 5F5XA 2I00A 2DLAA 3IIBA 1C30B 4A95A 2DEAA 1Q2YA 2DF5A 2R8VA 4U9ZA 5CBMA 4BINA 4GM5A 4R7MA 2X0SA 1VHOA 4JYWA 5H86A 3SJEA 4X5KA 3IO1A 1M4GA 2EBJA 4R57A 2WZNA 5AGEA 4X3RA 1QMUA 5E96A 4P4EA 4KOWA 3I6SA 2OB0A 1ELLP 2CF4A 4UWJA 4OAEA 3R95A 3KR5A 1ZLIA 2XPLA 4IIYA 4CYOA 3RBUA 4RR2B 2PRBA 1CX8A 2REFA 4ZI6A 2FIWA 4R3LA 3EZAA 2PSWA 3TLCA 4INJA 2PIYA 4KORA 5G22A 2R7HA 4CRZB 4E8OA 3FEEA 3G23A 2J8RA 1S3ZA 3GY9A 2ZXVA 1QSOA 4UIAA 1S7LA 2ABZA 5F09A 2K5TA 1LFWA 2VBQA 5IX3A 3B7IA 1WK4A 5KTCA 3GJZA 3SJFA 2G0BA 3FXTA 2G3AA 2Q7BA 1LOKA 1Z9UA 1BO4A 4MHNA 2C6CA 4UCPA 2IL4A 3EO4A 3R9EA 3PEIA 2Q4VA 3JUWA 2HWGA 3TYXA 1Z2LA 1ARLA 2YGWA
chains in the Genus database with same CATH topology
4P4FA 3MN8A 2OR4A 3H8GA 3HUVA 2OOTA 2BOAA 3B3CA 3IJ3A 2V8VA 3LMSA 4O23A 3WC7A 3FEDA 4IK2A 4TWEA 3D66A 3SJXA 4PXDA 4F8ZA 2PJCA 4OC2A 5LRJA 5JH9A 2ZEOA 4YWYA 1ARMA 4MHPA 3B35A 2PJ0A 4NGMA 1V6CA 2JEWA 1ELMP 2RFHA 5K8OA 1HDQA 4X8IA 2ZEPA 4P4DA 3NH5A 2Q51A 3SI1A 3S9LA 3IWWA 4X2TA 3FF3A 1RTQA 4BD9A 2V77A 5K8NA 2GREA 4Z65A 5D29A 4H2KA 4C84A 1NSAA 1IGBA 2PJ6A 2Q4ZA 3ISXA 2PJ3A 2PIZA 3FVLA 6CPAA 1TXRA 2QYVA 4ZX9A 4C8CA 3KHZA 2PJ8A 2IQ6A 4ZY2A 3SI2A 4TJXA 5LYLA 1R43A 1ZG7A 2PJAA 5LRKA 3SJGA 3ISZA 2BCOA 1UWYA 3V7ZA 1YW4A 3KR4A 3WC6A 3GB0A 5IB9A 2ANPA 4PQAA 4OC4A 2ZENA 3B3SA 3PB7X 4YU9A 1PYTB 2PCUA 4NGSA 1YSJA 4NGNA 1ZLHA 3LWUA 5HVFA 3JRUA 3K9TA 2AFSA 4OC0A 4MCQA 2GU2A 3V38A 4CDKA 4FWUA 5JGFA 4OP4A 7CPAA 3H8FA 2ZEHA 4R8FA 4CPAA 1Y0RA 4F9UA 4WJBA 8CPAA 4R6TA 2C6GA 4F9VA 1VGYA 4C9AA 4MXUA 2ZEDA 3DGVA 4C8TA 4IAVA 3RAMA 2ZOFA 3T8WA 4K3NA 4AXVA 4C86A 3PFEA 3QNVA 4EFDA 3S9NA 4OIDA 2C1CA 4PXBA 4FUUA 5ELYA 3VH9A 4P45A 4A38A 5LYIA 2PJ9A 1YLOA 2CTCA 4OC3A 4C8PA 4NGPA 2EWBA 2PJ4A 2PJBA 2ZEMA 3CT9A 1XMBA 2NYQA 2V8GA 3S9MA 5K8MA 2J9AA 1ZG9A 1CG2A 3PRTA 2BO9A 4C9VA 1TF9A 3BXMA 4EMEA 4P4JA 3FECA 3B2YA 4RUHA 3PBBA 1ZG8A 4A39A 1H8LA 1AYEA 3TX8A 4JZ0A 1LAMA 4IHMA 3KI9A 4MHYA 2JBKA 4W9YA 4OC5A 1VIXA 1HEEA 2PJ2A 2AFXA 2PJ7A 4UF4A 4P6YA 4DYOA 4ZYQA 1TKFA 2QJ8A 1YW6A 2O53A 4OC1A 1FNOA 2CTBA 2AFUA 4PXEA 1Z8LA 4ONWA 1XJOA 3NH8A 4WWVA 3RZAA 4NGTA 4NJQA 4YN3A 3D7DA 3WC5A 1QQ9A 4C9RA 3I74A 2IMOA 3KZWA 2Q43A 4P10A 4DJLA 3CPAA 3D7GA 2FVGA 1XF1A 1XRYA 3MRUA 4MMOA 3IEHA 5JM6A 1WVMA 1R3NA 5DS0A 4FAIA 4KSIA 3BI1A 3WABA 4PXCA 1Y0YA 4A37A 1TKJA 4MRIA 3HLPA 1BAVA 1FT7A 3D7HA 1AMPA 2V8DA 2EK8A 2NSMA 2PRQA 4CDJA 4G1PA 4B6ZA 3D7FA 4R76A 2GP4A 2ZEEA 3SI0A 2XEFA 2ZEGA 3PBEA 1CPSA 1XFOA 1CP6A 3NA6A 3KL9A 4P4BA 3ICUA 4OIWA 3BHXA 5HVHA 4PPZA 3B3WA 1F57A 2XEGA 1BPMA 2EK9A 1LAPA 3KQZA 2POKA 2AFMA 1Y9ZA 3L2NA 3KQXA 4MCRA 3PB8X 3TC8A 4P4IA 3WT4A 4TJVA 5I4MA 1KWMA 2AFOA 5J1QA 4P44A 4C9UA 2O4HA 4Q7AA 3NH4A 2AFZA 1M4LA 4NGQA 4NGRA 2PJ5A 2PJ1A 4MCPA 1CBXA 1BLLE 2PVVA 4OKOA 3PB9X 3GLJA 3IC1A 1OBRA 3KHXA 4ZY0A 1CPXA 4DUKA 2CIJA 2PVWA 3CPXA 1PCAA 1DE4C 3DLJA 3KASA 2F8HA 4UEEA 1F2PA 2G9DA 2V8HA 5LYDA 5CPAA 3VATA 1TF8A 3I1UA 3FMCA 3PB6X 5HVGA 1IY7A 3D4UA 2C6PA 5LYFA 4LQGA 2C5QA 2ZEFA 4MCSA 1JQGA 4UIBA 5IR2A 1LANA 3H8EA 4C99A 1YMEA 4UEFA 2GLJA 3VARA 4A94A 2HC9A 3N5FA 1GYTA 2I3CA 4C9EA 4C85A 3FJUA 3IFEA 1Z5RA 1Q7LA 3D67A 4UEZA 4NJRA 1BPNA 4EWTA 5HXDA 3VTAA 1EE3P 5THWA 2RB7A 4C8UA 5D8NA 1F2OA 3B3TA 3KGQA 3K2KA 3EIFA 2IJZA 4TNUA 3D68A 1LCPA 4FBEA 2XEIA 3CDXA 2XEJA 3FX6A 2HB6A 2ZELA 4ZY1A 1TKHA 1HDUA 4NFRA 5K8PA 2JBJA 1Y7EA 4C8FA 4MHZA 1VHEA 5LRGA 3GUXA 1DTDA 4KNGE 2WYRA 2PE3A 4ZX8A 1XBUA 3B3VA 2GLFA 3PB4X 2QVPA 1CP7A 2F7VA 2ZOGA 2AFWA 4OMEA 3PFOA 3BI0A 3NFZA 2VL1A 3FH4A 3IIBA 2DEAA 5CBMA 4GM5A 4R7MA 1VHOA 4JYWA 4C8AA 3SJEA 3IO1A 2WZNA 4X3RA 1QMUA 4P4EA 3I6SA 1ELLP 2CF4A 3KR5A 1ZLIA 3RBUA 1CX8A 4ZI6A 2PIYA 3FEEA 4UIAA 2ABZA 5F09A 1LFWA 3B7IA 3SJFA 1LOKA 4MHNA 2C6CA 3PEIA 1Z2LA 1ARLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4F A;  3MN8 A;  2OR4 A;  3H8G A;  3HUV A;  2OOT A;  2BOA A;  3B3C A;  3IJ3 A;  2V8V A;  3LMS A;  4O23 A;  3WC7 A;  3FED A;  4IK2 A;  4TWE A;  3D66 A;  3SJX A;  4PXD A;  4F8Z A;  2PJC A;  4OC2 A;  5LRJ A;  5JH9 A;  2ZEO A;  4YWY A;  1ARM A;  4MHP A;  3B35 A;  2PJ0 A;  4NGM A;  1V6C A;  2JEW A;  1ELM P;  2RFH A;  5K8O A;  1HDQ A;  4X8I A;  2ZEP A;  4P4D A;  3NH5 A;  2Q51 A;  3SI1 A;  3S9L A;  3IWW A;  4X2T A;  3FF3 A;  1RTQ A;  4BD9 A;  2V77 A;  5K8N A;  2GRE A;  4Z65 A;  5D29 A;  4H2K A;  4C84 A;  1NSA A;  1IGB A;  2PJ6 A;  2Q4Z A;  3ISX A;  2PJ3 A;  2PIZ A;  3FVL A;  6CPA A;  1TXR A;  2QYV A;  4ZX9 A;  4C8C A;  3KHZ A;  2PJ8 A;  2IQ6 A;  4ZY2 A;  3SI2 A;  4TJX A;  5LYL A;  1R43 A;  1ZG7 A;  2PJA A;  5LRK A;  3SJG A;  3ISZ A;  2BCO A;  1UWY A;  3V7Z A;  1YW4 A;  3KR4 A;  3WC6 A;  3GB0 A;  5IB9 A;  2ANP A;  4PQA A;  4OC4 A;  2ZEN A;  3B3S A;  3PB7 X;  4YU9 A;  1PYT B;  2PCU A;  4NGS A;  1YSJ A;  4NGN A;  1ZLH A;  3LWU A;  5HVF A;  3JRU A;  3K9T A;  2AFS A;  4OC0 A;  4MCQ A;  2GU2 A;  3V38 A;  4CDK A;  4FWU A;  5JGF A;  4OP4 A;  7CPA A;  3H8F A;  2ZEH A;  4R8F A;  4CPA A;  1Y0R A;  4F9U A;  4WJB A;  8CPA A;  4R6T A;  2C6G A;  4F9V A;  1VGY A;  4C9A A;  4MXU A;  2ZED A;  3DGV A;  4C8T A;  4IAV A;  3RAM A;  2ZOF A;  3T8W A;  4K3N A;  4AXV A;  4C86 A;  3PFE A;  3QNV A;  4EFD A;  3S9N A;  4OID A;  2C1C A;  4PXB A;  4FUU A;  5ELY A;  3VH9 A;  4P45 A;  4A38 A;  5LYI A;  2PJ9 A;  1YLO A;  2CTC A;  4OC3 A;  4C8P A;  4NGP A;  2EWB A;  2PJ4 A;  2PJB A;  2ZEM A;  3CT9 A;  1XMB A;  2NYQ A;  2V8G A;  3S9M A;  5K8M A;  2J9A A;  1ZG9 A;  1CG2 A;  3PRT A;  2BO9 A;  4C9V A;  1TF9 A;  3BXM A;  4EME A;  4P4J A;  3FEC A;  3B2Y A;  4RUH A;  3PBB A;  1ZG8 A;  4A39 A;  1H8L A;  1AYE A;  3TX8 A;  4JZ0 A;  1LAM A;  4IHM A;  3KI9 A;  4MHY A;  2JBK A;  4W9Y A;  4OC5 A;  1VIX A;  1HEE A;  2PJ2 A;  2AFX A;  2PJ7 A;  4UF4 A;  4P6Y A;  4DYO A;  4ZYQ A;  1TKF A;  2QJ8 A;  1YW6 A;  2O53 A;  4OC1 A;  1FNO A;  2CTB A;  2AFU A;  4PXE A;  1Z8L A;  4ONW A;  1XJO A;  3NH8 A;  4WWV A;  3RZA A;  4NGT A;  4NJQ A;  4YN3 A;  3D7D A;  3WC5 A;  1QQ9 A;  4C9R A;  3I74 A;  2IMO A;  3KZW A;  2Q43 A;  4P10 A;  4DJL A;  3CPA A;  3D7G A;  2FVG A;  1XF1 A;  1XRY A;  3MRU A;  4MMO A;  3IEH A;  5JM6 A;  1WVM A;  1R3N A;  5DS0 A;  4FAI A;  4KSI A;  3BI1 A;  3WAB A;  4PXC A;  1Y0Y A;  4A37 A;  1TKJ A;  4MRI A;  3HLP A;  1BAV A;  1FT7 A;  3D7H A;  1AMP A;  2V8D A;  2EK8 A;  2NSM A;  2PRQ A;  4CDJ A;  4G1P A;  4B6Z A;  3D7F A;  4R76 A;  2ZEE A;  3SI0 A;  2XEF A;  2ZEG A;  3PBE A;  1CPS A;  1XFO A;  1CP6 A;  3NA6 A;  3KL9 A;  4P4B A;  3ICU A;  4OIW A;  3BHX A;  5HVH A;  4PPZ A;  3B3W A;  1F57 A;  2XEG A;  1BPM A;  2EK9 A;  1LAP A;  3KQZ A;  2POK A;  2AFM A;  1Y9Z A;  3L2N A;  3KQX A;  4MCR A;  3PB8 X;  3TC8 A;  4P4I A;  3WT4 A;  4TJV A;  5I4M A;  1KWM A;  2AFO A;  5J1Q A;  4P44 A;  4C9U A;  2O4H A;  4Q7A A;  3NH4 A;  2AFZ A;  1M4L A;  4NGQ A;  4NGR A;  2PJ5 A;  2PJ1 A;  4MCP A;  1CBX A;  1BLL E;  2PVV A;  4OKO A;  3PB9 X;  3GLJ A;  3IC1 A;  1OBR A;  3KHX A;  4ZY0 A;  1CPX A;  4DUK A;  2CIJ A;  2PVW A;  3CPX A;  1PCA A;  1DE4 C;  3DLJ A;  3KAS A;  2F8H A;  4UEE A;  1F2P A;  2G9D A;  2V8H A;  5LYD A;  5CPA A;  3VAT A;  1TF8 A;  3I1U A;  3FMC A;  3PB6 X;  5HVG A;  1IY7 A;  3D4U A;  2C6P A;  5LYF A;  4LQG A;  2ZEF A;  4MCS A;  1JQG A;  4UIB A;  1LAN A;  3H8E A;  4C99 A;  1YME A;  4UEF A;  2GLJ A;  3VAR A;  4A94 A;  2HC9 A;  3N5F A;  1GYT A;  2I3C A;  4C9E A;  4C85 A;  3FJU A;  3IFE A;  1Z5R A;  1Q7L A;  3D67 A;  4UEZ A;  4NJR A;  1BPN A;  4EWT A;  5HXD A;  3VTA A;  1EE3 P;  5THW A;  2RB7 A;  4C8U A;  5D8N A;  1F2O A;  3B3T A;  3KGQ A;  3K2K A;  3EIF A;  2IJZ A;  4TNU A;  3D68 A;  1LCP A;  4FBE A;  2XEI A;  3CDX A;  2XEJ A;  3FX6 A;  2HB6 A;  2ZEL A;  4ZY1 A;  1TKH A;  1HDU A;  4NFR A;  5K8P A;  2JBJ A;  1Y7E A;  4C8F A;  4MHZ A;  1VHE A;  5LRG A;  3GUX A;  1DTD A;  4KNG E;  2WYR A;  2PE3 A;  4ZX8 A;  1XBU A;  3B3V A;  2GLF A;  3PB4 X;  2QVP A;  1CP7 A;  2F7V A;  2ZOG A;  2AFW A;  4OME A;  3PFO A;  3BI0 A;  3NFZ A;  2VL1 A;  3FH4 A;  3IIB A;  2DEA A;  5CBM A;  4GM5 A;  4R7M A;  1VHO A;  4JYW A;  4C8A A;  3SJE A;  3IO1 A;  2WZN A;  4X3R A;  1QMU A;  4P4E A;  3I6S A;  1ELL P;  2CF4 A;  3KR5 A;  1ZLI A;  3RBU A;  1CX8 A;  4ZI6 A;  2PIY A;  3FEE A;  4UIA A;  2ABZ A;  5F09 A;  1LFW A;  3B7I A;  3SJF A;  1LOK A;  4MHN A;  2C6C A;  3PEI A;  1Z2L A;  1ARL A; 
#chains in the Genus database with same CATH topology
 4P4F A;  3QAH A;  3MN8 A;  4CGL A;  4UCN A;  4UFX A;  4MJX A;  2OR4 A;  2FSR A;  2VXK A;  3H8G A;  4MI1 A;  3HUV A;  5I0C A;  4M6I A;  2AJ6 A;  1A9X B;  2P6F A;  2OOT A;  4ZBG A;  2BOA A;  4KVM E;  3B3C A;  5AG6 A;  1M1D A;  3VRO A;  1XE4 A;  2V8V A;  3IJ3 A;  3LMS A;  4O23 A;  1XEB A;  3WC7 A;  3FED A;  1FBV A;  4IK2 A;  3HMJ G;  3A9L A;  3D66 A;  3E0K A;  4FD6 A;  4TWE A;  2YJV A;  2VEZ A;  3BUX B;  3SJX A;  4PXD A;  4F8Z A;  3TFY A;  3VRR A;  2PJC A;  4OC2 A;  5LRJ A;  2D0O A;  2RC4 A;  3F9K C;  1P0H A;  5JH9 A;  4A4C A;  3F8K A;  2EZC A;  2MP0 A;  5G20 A;  1KEE B;  1XOV A;  2ZEO A;  4YWY A;  1ARM A;  4GPL B;  4BPU B;  3TLG B;  4MHP A;  4KOU A;  3B35 A;  2PJ0 A;  4B5O A;  4NGM A;  1XMT A;  1V6C A;  4E94 A;  2JEW A;  1ELM P;  2KCW A;  2RFH A;  2Q7S A;  3WR7 A;  4KSF A;  5J8C A;  5K8O A;  5HKZ A;  3JVN A;  4UFW A;  3D3S A;  1Z9E A;  1HDQ A;  2J8N A;  1KUV A;  2B5G A;  2ZEP A;  4L89 A;  4X8I A;  4P4D A;  3BUM B;  2REE A;  5IV0 A;  3EZE A;  3HPH E;  4U9Y A;  1L0C A;  3BUN B;  1KUY A;  4MBU A;  3KKW A;  3TOB A;  3NH5 A;  2Q51 A;  4AG7 A;  3K9U A;  5ISV A;  1Z4R A;  3HPG G;  2R1I A;  3UY5 A;  3SI1 A;  1M4I A;  2BUE A;  4YFJ A;  2I79 A;  2FS5 A;  2PR8 A;  3S9L A;  1BXR B;  3IWW A;  1Z8T A;  3FF3 A;  1RTQ A;  4X2T A;  2ZW7 A;  4BD9 A;  3SR3 A;  2EZB A;  1UFH A;  2V77 A;  5K8N A;  3T90 A;  2GRE A;  4QC6 A;  4Z65 A;  3KRV A;  4H6U A;  5D29 A;  4H2K A;  1IOF A;  4C84 A;  4B5P A;  3BJ8 A;  1NSA A;  3NE7 A;  4HNW B;  4YGO A;  1IGB A;  2PJ6 A;  2Q4Z A;  4M3S A;  5JPH A;  3ISX A;  3DR6 A;  2PJ3 A;  1J3L A;  2PIZ A;  2B3U A;  3FVL A;  4XNH C;  3VRQ A;  3R1K A;  3RNZ A;  5AG5 A;  3VGO A;  2Y0M A;  6CPA A;  4BTF A;  1TXR A;  2QYV A;  4ZX9 A;  4CYN A;  1Y9K A;  3B8G A;  4C8C A;  3KHZ A;  3GKR A;  3IWE A;  4B11 A;  2PJ8 A;  3C8O A;  2IQ6 A;  4ZY2 A;  3SI2 A;  4TJX A;  5FD8 A;  2Y1M A;  5LYL A;  4CZ1 A;  1R43 A;  1ZG7 A;  3W6S A;  2PJA A;  1YX0 A;  4DNC A;  3EFA A;  5LRK A;  4OLL A;  3SJG A;  4HKF A;  4ZGY B;  3ISZ A;  2BCO A;  1IID A;  1K4J A;  1AUG A;  5H84 A;  1UWY A;  3NFQ A;  2P0W A;  1BOB A;  3V7Z A;  2Q4Y A;  1YW4 A;  4UA3 A;  3KR4 A;  4XPL A;  3WC6 A;  3D2M A;  3ZZI A;  3GB0 A;  5IB9 A;  2OLS A;  2YNC C;  2ANP A;  4PQA A;  4OC4 A;  1ZO0 A;  1S7N A;  2ZEN A;  3B3S A;  3PB7 X;  4YU9 A;  1YQE A;  5F13 A;  1PYT B;  2PCU A;  5GCN A;  4NGS A;  3S6G A;  1YSJ A;  4NGN A;  1ZLH A;  3LWU A;  3P2F A;  4KSA A;  3PT1 A;  3IU1 A;  3JRU A;  3I9S A;  3K9T A;  3G8W A;  3PFV A;  1M44 A;  5DWN A;  2AFS A;  4F0X A;  4OC0 A;  5A28 A;  4MCQ A;  2CNT A;  2GU2 A;  3CXS A;  2R98 A;  3V38 A;  3TLA A;  4CDK A;  4FWU A;  4KOY A;  4OP4 A;  7CPA A;  5JGF A;  3H8F A;  2QEC A;  3VRP A;  4CGP A;  2VZZ A;  3BUO B;  2JLM A;  2ZEH A;  3FNC A;  4R8F A;  4CPA A;  1Y0R A;  4KZT A;  4F9U A;  4WJB A;  4KOX A;  8CPA A;  4C8U A;  2Y1N A;  1FY7 A;  2BL1 A;  3EXN A;  4R6T A;  3OWC A;  3NOJ A;  2C6G A;  5J3X A;  1VGY A;  4FD7 A;  4MXU A;  4ONU A;  4R3K A;  4F9V A;  4C9A A;  2ZED A;  3DGV A;  4YRH A;  4XPD B;  4C8T A;  4IAV A;  5HKW A;  3RAM A;  4C7I A;  2ZOF A;  3T8W A;  4K3N A;  4AXV A;  4E2A A;  4C86 A;  3BLN A;  3PFE A;  3QNV A;  4EFD A;  3S9N A;  1X10 A;  4M6G A;  3TLE A;  1NMT A;  4OID A;  2P6G A;  4A33 A;  2C1C A;  3TE4 A;  4PXB A;  4R87 A;  1JDE A;  4FUU A;  5ELY A;  3VH9 A;  4P45 A;  4A38 A;  2B58 A;  4JVO A;  5LYI A;  3U1B A;  4H89 A;  5F47 A;  4HPS A;  5BY0 A;  2Z0Z A;  4CAE A;  2XPN A;  2HV2 A;  4KOV A;  4BPW B;  1TIQ A;  1QSN A;  1YLO A;  1ON0 A;  2PJ9 A;  2PR1 A;  2CTC A;  3OB1 B;  4OC3 A;  1YVO A;  2XPP A;  4NGP A;  1QSR A;  2ZW4 A;  5G21 A;  5F46 A;  4C8P A;  2EWB A;  4MY0 A;  2GIV A;  2PJ4 A;  3TO9 A;  2PJB A;  2ZEM A;  3CT9 A;  1XMB A;  2NYQ A;  4CAV A;  4C2Z A;  2V8G A;  2WSA A;  3TO7 A;  5EMI A;  2AUN A;  4I49 A;  3S9M A;  3BUW B;  3R96 A;  3T0T A;  5K8M A;  4II9 A;  2J9A A;  3T07 A;  4RI1 A;  3H5Z A;  2AE6 A;  2ZW6 A;  1ZG9 A;  1CG2 A;  2BSW A;  2N3A B;  2BO9 A;  1I12 A;  3PRT A;  4MHD A;  4PK3 A;  1TF9 A;  4C9V A;  2NMT A;  3BXM A;  4EME A;  4AVB A;  4P4J A;  3FEC A;  3B2Y A;  1YVH A;  4A2Z A;  1YR0 A;  3S6F A;  4RUH A;  4PV6 A;  1EZA A;  1Q5X A;  1VI4 A;  3PBB A;  1ZG8 A;  4A39 A;  1C3O B;  1H8L A;  5JQ4 A;  1AYE A;  1YK3 A;  5FVJ A;  3VRN A;  1KC7 A;  4UBR A;  2CNM A;  3TX8 A;  3VWD A;  1GHE A;  3S6K A;  4CYP A;  1PU9 A;  2Z3P A;  3F0A A;  4JZ0 A;  1LAM A;  1S7F A;  2PDO A;  4KOT A;  2B0A A;  3O8Z A;  4IHM A;  3PP9 A;  1CJW A;  3KI9 A;  4MHY A;  2B3V A;  1XIX A;  4MI4 A;  4C68 A;  2JBK A;  3H4Q A;  4W9Y A;  4FD4 A;  1CE8 B;  3DNS A;  4OC5 A;  3CXP A;  1VIX A;  1HEE A;  2PJ2 A;  3ZNI A;  2AFX A;  2B4D B;  4QB9 A;  3ZJ0 A;  2PJ7 A;  4UF4 A;  1IOI A;  5AG4 A;  2FIA A;  4Y49 B;  2Z3L A;  4P6Y A;  4DYO A;  2FE7 A;  4ZYQ A;  5BWA B;  4J3G A;  1CS0 B;  1DIK A;  1T36 B;  1ZRS A;  5JYB A;  1TKF A;  3SHP A;  2D4O A;  5HKY A;  2QJ8 A;  1YW6 A;  2O53 A;  4OC1 A;  1FNO A;  2CTB A;  4MFQ A;  5C82 A;  4E5S A;  2AFU A;  4PXE A;  1Z8L A;  2OH1 A;  4LUA A;  4ONW A;  1XJO A;  1NSL A;  4CGO A;  1R57 A;  2YND A;  2A4N A;  3NH8 A;  4WWV A;  2YNE A;  3FRM A;  4J0N A;  3RZA A;  4NGT A;  3R9G A;  1NE9 A;  4NJQ A;  2ZPA A;  2Z3O A;  2Z10 A;  2Z3K A;  4YN3 A;  3D7D A;  3WC5 A;  1QQ9 A;  4C9R A;  4NSQ A;  5AG7 A;  4GXH A;  3I74 A;  2IMO A;  2OZH A;  3KZW A;  5F48 A;  1J4J A;  2Q43 A;  4P10 A;  4DJL A;  3U88 C;  1YVK A;  3CPA A;  4CYQ A;  3D7G A;  2FVG A;  1XF1 A;  2J8M A;  2AUM A;  1XRY A;  2QML A;  5EC4 A;  4RS2 A;  3MRU A;  3N7Z A;  4QVT A;  1EO0 A;  3CZX A;  2EZA A;  2Q44 A;  4MMO A;  4C2X A;  3IEH A;  3RYO A;  4CAW A;  5JM6 A;  1WVM A;  4KUB A;  3NE8 A;  1R3N A;  1EZB A;  4QUS A;  5DS0 A;  4FAI A;  1SQH A;  5K99 A;  4KSI A;  1JWQ A;  3PGP A;  1I21 A;  1S5K A;  4KUA A;  4NF1 A;  4UWI A;  3BI1 A;  1M6V B;  3WAB A;  3EC4 A;  3LOD A;  4IUS A;  2YJT A;  3OB2 B;  1MK4 A;  4PXC A;  1Y9W A;  1Y0Y A;  2G3T A;  3D8P A;  4A37 A;  3TLG A;  4JLY A;  2CNS A;  1TKJ A;  4MRI A;  2PC1 A;  3DDD A;  3HLP A;  1VBG A;  5AXI A;  1BAV A;  3TTH A;  1FT7 A;  1PUA A;  1WWZ A;  4NCZ A;  3D7H A;  3GYA A;  1AMP A;  3RO0 A;  2V8D A;  1Q2D A;  2EK8 A;  2NSM A;  2B4D A;  2Z3N A;  2PRQ A;  2ATR A;  5A27 A;  4CDJ A;  2JDD A;  4G1P A;  1R61 A;  4B6Z A;  4M6H A;  4C7H A;  4PSX A;  1I1D A;  3D7F A;  4R76 A;  2GP4 A;  2ZEE A;  4MY3 A;  3SI0 A;  2XEF A;  5HH1 A;  3TOA A;  2ZEG A;  3DR8 A;  4B10 A;  3PBE A;  1S60 A;  1CPS A;  2FL4 A;  1XFO A;  1M4D A;  4F6A A;  2FM4 A;  3T5M A;  3VWE A;  2Q0Y A;  3V8I A;  5DWM A;  1CP6 A;  3D2P A;  4KVO E;  3NA6 A;  3KL9 A;  1KZF A;  4P4B A;  3ICU A;  4OIW A;  3BHX A;  4CAX A;  3QAY A;  1KBL A;  2HRO A;  2B4B A;  5HVH A;  1RO5 A;  3PZJ A;  4PPZ A;  3B3W A;  1F57 A;  2F5I A;  2XEG A;  3FIX A;  1BPM A;  2EK9 A;  4B13 A;  1LAP A;  3KQZ A;  2P6E A;  3LD2 A;  3T05 A;  3QB8 A;  4MFK A;  3SXN A;  5HVF A;  2POK A;  4BPX B;  2HQY A;  2AFM A;  2GFQ A;  4A31 A;  1B47 A;  4JWP A;  1MJB A;  1Y9Z A;  3R9F A;  3L2N A;  4B12 A;  1RXT A;  3KQX A;  4COG A;  1S7K A;  4EVY A;  2WPW A;  4MCR A;  2B5G B;  2CXA A;  3PB8 X;  2FXF A;  4KLV A;  3TC8 A;  4E0A A;  4P4I A;  3WT4 A;  3PLF B;  5C88 A;  2HUZ A;  1P4N A;  4TJV A;  5I4M A;  1KWM A;  2AFO A;  3CXQ A;  4P44 A;  4CGN A;  5J1Q A;  4C9U A;  3S6H A;  1IB1 E;  2O4H A;  4NXY A;  4Q7A A;  3NH4 A;  4H1H A;  2AFZ A;  4JD6 A;  2JEV A;  4JXR A;  3OAK A;  1M4L A;  1U6M A;  2O28 A;  4NGQ A;  2EO8 A;  2Z3M A;  4NGR A;  1IU8 A;  2Q04 A;  2PJ5 A;  3TT2 A;  4B5P B;  4L8A A;  2PJ1 A;  3I3G A;  4XPD C;  4MCP A;  1CBX A;  2WUU A;  3JTK A;  5KTD A;  1QSM A;  1BLL E;  2OZG A;  2PVV A;  2OZU A;  4OKO A;  3PB9 X;  4HNX B;  3TCV A;  2HI6 A;  1YRE A;  2CY2 A;  3GLJ A;  4A4B A;  3IC1 A;  3G3S A;  1Z8W A;  4PK2 A;  1OBR A;  3KHX A;  1B6B A;  4ZY0 A;  2VKZ G;  1CPX A;  3FBU A;  4KLW A;  4DUK A;  2CIJ A;  2PVW A;  3CPX A;  1LRZ A;  1PCA A;  3IU2 A;  1DE4 C;  3DLJ A;  5J8F A;  3KAS A;  2F8H A;  4UEE A;  1F2P A;  2G9D A;  2V8H A;  4K30 A;  5CPA A;  5LYD A;  1CM0 A;  3VAT A;  1ZYM A;  5F1Y A;  1TF8 A;  4JJX A;  3I1U A;  5IB0 A;  2EUI A;  4FD5 A;  3FMC A;  4IIX A;  1XF8 A;  3PB6 X;  4Q36 A;  1IY7 A;  3W6X A;  3D4U A;  2C6P A;  5HMN A;  5HVG A;  3F5B A;  5LYF A;  4LQG A;  4XNH B;  2C5Q A;  2ZEF A;  5JVL A;  4CGM A;  4MCS A;  4MFZ A;  1JQG A;  5F9M A;  4UIB A;  4Q38 A;  4KOS A;  5IR2 A;  4R9M A;  3W91 A;  1LAN A;  4BBH A;  3H8E A;  3EZB A;  4GS4 A;  3TO6 A;  1NXJ A;  4C99 A;  1V0C A;  4B14 A;  1YME A;  4CS0 B;  2GE3 A;  2GLJ A;  2H5M A;  4UEF A;  3VAR A;  1NBW A;  1A2Z A;  2XPO A;  3TLZ A;  4IF5 A;  4A94 A;  2HC9 A;  4NEX A;  3N5F A;  1GYT A;  4CRY B;  2I3C A;  4UFV A;  4EYS A;  4C9E A;  4C8A A;  4C85 A;  5EBV A;  3EY5 A;  3FJU A;  2EVN A;  3IFE A;  5F49 A;  4A30 A;  4AVC A;  1Z5R A;  2QIR A;  2ZW5 A;  3MGD A;  1Q7L A;  3D67 A;  4UEZ A;  4NJR A;  1BPN A;  3C26 A;  4EWT A;  2B4J C;  5HXD A;  3VTA A;  1EE3 P;  5THW A;  2RB7 A;  1IYL A;  3IGR A;  4A32 A;  3OP0 A;  4M85 A;  4MFL A;  1Y7R A;  3TLB A;  2D0P A;  1KUX A;  5D8N A;  4U5Y A;  5KTA A;  1VKC A;  1F2O A;  3B3T A;  3FYN A;  3K2K A;  3KGQ A;  4UCM A;  2IJZ A;  4Y49 C;  3EIF A;  2C27 A;  3IWG A;  4TNU A;  2DXQ A;  3D68 A;  4KVX A;  1LCP A;  1Z4E A;  4ORF A;  4FBE A;  3BJ7 A;  2VQY A;  2XEI A;  3CDX A;  4KS9 A;  2DIK A;  2PQ8 A;  2DPS A;  5CNP A;  1Q2C A;  2XEJ A;  2BEI A;  2HB6 A;  3FX6 A;  2ZEL A;  3T9Y A;  4ZY1 A;  1TKH A;  2PCN A;  4MFP A;  4LX9 A;  1HDU A;  4NFR A;  5K8P A;  2JBJ A;  2ARH A;  1GGO A;  1Y7E A;  4C8F A;  3LAC A;  4F0Y A;  4MHZ A;  3FB3 A;  1VHE A;  2ODF A;  5LRG A;  3GUX A;  1DTD A;  4KNG E;  3DSB A;  1VBH A;  3P2H A;  4AB7 A;  1ZL0 A;  4CO9 A;  5G1Z A;  2WYR A;  2PE3 A;  2E28 A;  1IYK A;  4ZX8 A;  1XBU A;  4M8D A;  3GIU A;  3K4I A;  2FCK A;  1MJA A;  3B3V A;  2GLF A;  4RN7 A;  2JDC A;  2X7B A;  2R82 A;  2VI7 A;  4H6Z A;  3PB4 X;  4OAD A;  3SXO A;  1YGH A;  2Z11 A;  1IIC A;  1Z8X A;  4AVA A;  4PSW A;  2QVP A;  4HNY B;  4BMH A;  4CAF A;  1OZP A;  2UV8 G;  2VZY A;  1MJ9 A;  1CP7 A;  1B87 A;  4MFJ A;  2WPX A;  1JDB C;  2F7V A;  4JXQ A;  2GAN A;  4C2Y A;  2D4P A;  4COB A;  4AG9 A;  1N71 A;  2ZOG A;  1QST A;  1WJT A;  1VHS A;  2AFW A;  2CBL A;  4OME A;  3BI0 A;  1YLE A;  2FT0 A;  3NFZ A;  3PFO A;  4XPK A;  2OU2 A;  4QBJ A;  4MJ8 A;  2DPT A;  2VL1 A;  2YNC A;  4LQ6 A;  3TLY A;  1X12 A;  3FH4 A;  5F5X A;  2I00 A;  2DLA A;  3IIB A;  1C30 B;  4A95 A;  2DEA A;  1Q2Y A;  2DF5 A;  2R8V A;  4U9Z A;  5CBM A;  4BIN A;  4GM5 A;  4R7M A;  2X0S A;  1VHO A;  4JYW A;  5H86 A;  3SJE A;  4X5K A;  3IO1 A;  1M4G A;  2EBJ A;  4R57 A;  2WZN A;  5AGE A;  4X3R A;  1QMU A;  5E96 A;  4P4E A;  4KOW A;  3I6S A;  2OB0 A;  1ELL P;  2CF4 A;  4UWJ A;  4OAE A;  3R95 A;  3KR5 A;  1ZLI A;  2XPL A;  4IIY A;  4CYO A;  3RBU A;  4RR2 B;  2PRB A;  1CX8 A;  2REF A;  4ZI6 A;  2FIW A;  4R3L A;  3EZA A;  2PSW A;  3TLC A;  4INJ A;  2PIY A;  4KOR A;  5G22 A;  2R7H A;  4CRZ B;  4E8O A;  3FEE A;  3G23 A;  2J8R A;  1S3Z A;  3GY9 A;  2ZXV A;  1QSO A;  4UIA A;  1S7L A;  2ABZ A;  5F09 A;  2K5T A;  1LFW A;  2VBQ A;  5IX3 A;  3B7I A;  1WK4 A;  5KTC A;  3GJZ A;  3SJF A;  2G0B A;  3FXT A;  2G3A A;  2Q7B A;  1LOK A;  1Z9U A;  1BO4 A;  4MHN A;  2C6C A;  4UCP A;  2IL4 A;  3EO4 A;  3R9E A;  3PEI A;  2Q4V A;  3JUW A;  2HWG A;  3TYX A;  1Z2L A;  1ARL A;  2YGW A; 
#chains in the Genus database with same CATH homology
 4P4F A;  3MN8 A;  2OR4 A;  3H8G A;  3HUV A;  2OOT A;  2BOA A;  3B3C A;  3IJ3 A;  2V8V A;  3LMS A;  4O23 A;  3WC7 A;  3FED A;  4IK2 A;  4TWE A;  3D66 A;  3SJX A;  4PXD A;  4F8Z A;  2PJC A;  4OC2 A;  5LRJ A;  5JH9 A;  2ZEO A;  4YWY A;  1ARM A;  4MHP A;  3B35 A;  2PJ0 A;  4NGM A;  1V6C A;  2JEW A;  1ELM P;  2RFH A;  5K8O A;  1HDQ A;  4X8I A;  2ZEP A;  4P4D A;  3NH5 A;  2Q51 A;  3SI1 A;  3S9L A;  3IWW A;  4X2T A;  3FF3 A;  1RTQ A;  4BD9 A;  2V77 A;  5K8N A;  2GRE A;  4Z65 A;  5D29 A;  4H2K A;  4C84 A;  1NSA A;  1IGB A;  2PJ6 A;  2Q4Z A;  3ISX A;  2PJ3 A;  2PIZ A;  3FVL A;  6CPA A;  1TXR A;  2QYV A;  4ZX9 A;  4C8C A;  3KHZ A;  2PJ8 A;  2IQ6 A;  4ZY2 A;  3SI2 A;  4TJX A;  5LYL A;  1R43 A;  1ZG7 A;  2PJA A;  5LRK A;  3SJG A;  3ISZ A;  2BCO A;  1UWY A;  3V7Z A;  1YW4 A;  3KR4 A;  3WC6 A;  3GB0 A;  5IB9 A;  2ANP A;  4PQA A;  4OC4 A;  2ZEN A;  3B3S A;  3PB7 X;  4YU9 A;  1PYT B;  2PCU A;  4NGS A;  1YSJ A;  4NGN A;  1ZLH A;  3LWU A;  5HVF A;  3JRU A;  3K9T A;  2AFS A;  4OC0 A;  4MCQ A;  2GU2 A;  3V38 A;  4CDK A;  4FWU A;  5JGF A;  4OP4 A;  7CPA A;  3H8F A;  2ZEH A;  4R8F A;  4CPA A;  1Y0R A;  4F9U A;  4WJB A;  8CPA A;  4R6T A;  2C6G A;  4F9V A;  1VGY A;  4C9A A;  4MXU A;  2ZED A;  3DGV A;  4C8T A;  4IAV A;  3RAM A;  2ZOF A;  3T8W A;  4K3N A;  4AXV A;  4C86 A;  3PFE A;  3QNV A;  4EFD A;  3S9N A;  4OID A;  2C1C A;  4PXB A;  4FUU A;  5ELY A;  3VH9 A;  4P45 A;  4A38 A;  5LYI A;  2PJ9 A;  1YLO A;  2CTC A;  4OC3 A;  4C8P A;  4NGP A;  2EWB A;  2PJ4 A;  2PJB A;  2ZEM A;  3CT9 A;  1XMB A;  2NYQ A;  2V8G A;  3S9M A;  5K8M A;  2J9A A;  1ZG9 A;  1CG2 A;  3PRT A;  2BO9 A;  4C9V A;  1TF9 A;  3BXM A;  4EME A;  4P4J A;  3FEC A;  3B2Y A;  4RUH A;  3PBB A;  1ZG8 A;  4A39 A;  1H8L A;  1AYE A;  3TX8 A;  4JZ0 A;  1LAM A;  4IHM A;  3KI9 A;  4MHY A;  2JBK A;  4W9Y A;  4OC5 A;  1VIX A;  1HEE A;  2PJ2 A;  2AFX A;  2PJ7 A;  4UF4 A;  4P6Y A;  4DYO A;  4ZYQ A;  1TKF A;  2QJ8 A;  1YW6 A;  2O53 A;  4OC1 A;  1FNO A;  2CTB A;  2AFU A;  4PXE A;  1Z8L A;  4ONW A;  1XJO A;  3NH8 A;  4WWV A;  3RZA A;  4NGT A;  4NJQ A;  4YN3 A;  3D7D A;  3WC5 A;  1QQ9 A;  4C9R A;  3I74 A;  2IMO A;  3KZW A;  2Q43 A;  4P10 A;  4DJL A;  3CPA A;  3D7G A;  2FVG A;  1XF1 A;  1XRY A;  3MRU A;  4MMO A;  3IEH A;  5JM6 A;  1WVM A;  1R3N A;  5DS0 A;  4FAI A;  4KSI A;  3BI1 A;  3WAB A;  4PXC A;  1Y0Y A;  4A37 A;  1TKJ A;  4MRI A;  3HLP A;  1BAV A;  1FT7 A;  3D7H A;  1AMP A;  2V8D A;  2EK8 A;  2NSM A;  2PRQ A;  4CDJ A;  4G1P A;  4B6Z A;  3D7F A;  4R76 A;  2GP4 A;  2ZEE A;  3SI0 A;  2XEF A;  2ZEG A;  3PBE A;  1CPS A;  1XFO A;  1CP6 A;  3NA6 A;  3KL9 A;  4P4B A;  3ICU A;  4OIW A;  3BHX A;  5HVH A;  4PPZ A;  3B3W A;  1F57 A;  2XEG A;  1BPM A;  2EK9 A;  1LAP A;  3KQZ A;  2POK A;  2AFM A;  1Y9Z A;  3L2N A;  3KQX A;  4MCR A;  3PB8 X;  3TC8 A;  4P4I A;  3WT4 A;  4TJV A;  5I4M A;  1KWM A;  2AFO A;  5J1Q A;  4P44 A;  4C9U A;  2O4H A;  4Q7A A;  3NH4 A;  2AFZ A;  1M4L A;  4NGQ A;  4NGR A;  2PJ5 A;  2PJ1 A;  4MCP A;  1CBX A;  1BLL E;  2PVV A;  4OKO A;  3PB9 X;  3GLJ A;  3IC1 A;  1OBR A;  3KHX A;  4ZY0 A;  1CPX A;  4DUK A;  2CIJ A;  2PVW A;  3CPX A;  1PCA A;  1DE4 C;  3DLJ A;  3KAS A;  2F8H A;  4UEE A;  1F2P A;  2G9D A;  2V8H A;  5LYD A;  5CPA A;  3VAT A;  1TF8 A;  3I1U A;  3FMC A;  3PB6 X;  5HVG A;  1IY7 A;  3D4U A;  2C6P A;  5LYF A;  4LQG A;  2C5Q A;  2ZEF A;  4MCS A;  1JQG A;  4UIB A;  5IR2 A;  1LAN A;  3H8E A;  4C99 A;  1YME A;  4UEF A;  2GLJ A;  3VAR A;  4A94 A;  2HC9 A;  3N5F A;  1GYT A;  2I3C A;  4C9E A;  4C85 A;  3FJU A;  3IFE A;  1Z5R A;  1Q7L A;  3D67 A;  4UEZ A;  4NJR A;  1BPN A;  4EWT A;  5HXD A;  3VTA A;  1EE3 P;  5THW A;  2RB7 A;  4C8U A;  5D8N A;  1F2O A;  3B3T A;  3KGQ A;  3K2K A;  3EIF A;  2IJZ A;  4TNU A;  3D68 A;  1LCP A;  4FBE A;  2XEI A;  3CDX A;  2XEJ A;  3FX6 A;  2HB6 A;  2ZEL A;  4ZY1 A;  1TKH A;  1HDU A;  4NFR A;  5K8P A;  2JBJ A;  1Y7E A;  4C8F A;  4MHZ A;  1VHE A;  5LRG A;  3GUX A;  1DTD A;  4KNG E;  2WYR A;  2PE3 A;  4ZX8 A;  1XBU A;  3B3V A;  2GLF A;  3PB4 X;  2QVP A;  1CP7 A;  2F7V A;  2ZOG A;  2AFW A;  4OME A;  3PFO A;  3BI0 A;  3NFZ A;  2VL1 A;  3FH4 A;  3IIB A;  2DEA A;  5CBM A;  4GM5 A;  4R7M A;  1VHO A;  4JYW A;  4C8A A;  3SJE A;  3IO1 A;  2WZN A;  4X3R A;  1QMU A;  4P4E A;  3I6S A;  1ELL P;  2CF4 A;  3KR5 A;  1ZLI A;  3RBU A;  1CX8 A;  4ZI6 A;  2PIY A;  3FEE A;  4UIA A;  2ABZ A;  5F09 A;  1LFW A;  3B7I A;  3SJF A;  1LOK A;  4MHN A;  2C6C A;  3PEI A;  1Z2L A;  1ARL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...