4NGMA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
total genus 263
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngmA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngmA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngmA02
4RUHA 2ZOGA 1IGBA 4PXCA 5LYIA 2GU2A 4NGPA 2PJAA 1V6CA 1JQGA 4OC1A 5I4MA 2V77A 4ZYQA 4UEEA 3IEHA 2PJ7A 2QJ8A 4PXEA 3N5FA 4P6YA 3DLJA 4UEZA 4TJVA 2BOAA 1CPXA 4KNGE 4NJQA 2O53A 4OIWA 2EWBA 1XF1A 5JM6A 3WT4A 3NA6A 2ANPA 1LANA 5F09A 1LAPA 2F7VA 6CPAA 2PJ3A 3RBUA 3FEEA 2PIYA 3I1UA 1AMPA 4X8IA 5HVHA 4C8FA 3ICUA 1DE4C 3FEDA 1ARMA 1OBRA 4C9AA 2PRQA 2OR4A 1XBUA 3CPAA 4UIBA 2CTBA 4X2TA 2ZEHA 3TX8A 4NGSA 1HEEA 2CIJA 1DTDA 2O4HA 5IB9A 1F57A 2G9DA 3FX6A 3D7GA 4FBEA 4LQGA 3GB0A 4DUKA 1ZG8A 1QMUA 2AFMA 2ZOFA 3K9TA 4PQAA 2C6PA 2EK9A 3B3VA 1TF9A 4MCPA 2ZENA 4MXUA 5JH9A 4OC3A 3VH9A 5DS0A 3D68A 7CPAA 4R6TA 3SI1A 5LYFA 2PE3A 4YWYA 4PXBA 2BO9A 2C6CA 2VL1A 2RFHA 4NGRA 4C9EA 4OC4A 3B35A 1CG2A 1YSJA 4EMEA 2PVVA 4MCSA 1IY7A 2WYRA 4A94A 1RTQA 4C8AA 1PYTB 4GM5A 1ARLA 3KR4A 1EE3P 3ISXA 1ELMP 4P4IA 5LYDA 4C86A 3CDXA 4JZ0A 3D7DA 3T8WA 4PPZA 2PJ9A 2JBKA 4Q7AA 2V8VA 4MCRA 3FJUA 4NGTA 3SJXA 4X3RA 2JEWA 1YW4A 3D7HA 3PRTA 1ELLP 2J9AA 4CDKA 4DYOA 5D29A 3BHXA 3S9MA 5ELYA 1TKJA 3IIBA 4IAVA 2ZEPA 2PIZA 2PJBA 4EFDA 3FVLA 3LMSA 3H8GA 3H8FA 1FT7A 3KQXA 4OC5A 1ZLHA 4G1PA 2I3CA 3FH4A 3EIFA 1H8LA 1Z8LA 2IMOA 3MRUA 4FWUA 4F9UA 4AXVA 3WC7A 3MN8A 4C84A 1TF8A 4NGQA 2NSMA 3NH4A 3PB4X 4ZX8A 1CP6A 8CPAA 2ZELA 3FECA 3D4UA 4A38A 1BAVA 4ONWA 4C8PA 4NGMA 5K8NA 1XFOA 4P4DA 3BXMA 2ZEMA 3KL9A 3V7ZA 2FVGA 4Z65A 1YMEA 4OKOA 1F2PA 4P44A 2WZNA 2Q43A 2CTCA 3IO1A 2AFOA 5CPAA 3SJFA 2ZEFA 1VGYA 2POKA 3B2YA 2QVPA 3BI0A 2NYQA 4R7MA 1BPNA 3S9LA 4UIAA 3JRUA 3TC8A 3PFOA 2AFSA 3KASA 4K3NA 1CP7A 1CBXA 1LOKA 1KWMA 5CBMA 4H2KA 4ZY0A 2AFZA 2C1CA 2PJ6A 1TKFA 1XRYA 4F8ZA 3NFZA 2C6GA 4A39A 5D8NA 3IJ3A 3NH8A 2PJ4A 3SJGA 4MHYA 4OP4A 4IHMA 1Y0RA 4MRIA 3PBBA 4C9RA 3SI2A 4ZY2A 3KHXA 1Q7LA 4P45A 4DJLA 2PJ1A 1TXRA 2XEJA 3DGVA 2Q4ZA 2GREA 2PVWA 3GUXA 3B3TA 3IC1A 2BCOA 5K8MA 1VHEA 3CT9A 4MHZA 1XJOA 2ZEOA 3SI0A 3VARA 1AYEA 4UF4A 1YLOA 1Y0YA 4UEFA 3BI1A 3CPXA 1PCAA 2PJ2A 3V38A 4A37A 1VHOA 1YW6A 2JBJA 2PJ5A 4CDJA 5HVGA 5K8OA 1TKHA 1VIXA 1ZLIA 4P4JA 3FMCA 4MMOA 1LFWA 2ZEEA 3HUVA 3FF3A 4YU9A 3PEIA 4CPAA 3SJEA 5LRGA 4C8CA 5LYLA 4FUUA 4O23A 2CF4A 3B3CA 2GLJA 4EWTA 4OC0A 3H8EA 4WJBA 3I6SA 2V8GA 5J1QA 3NH5A 5LRKA 3GLJA 4C8TA 3PBEA 4YN3A 3RAMA 2ZEDA 4C99A 2PJ0A 5K8PA 3KQZA 4NJRA 4TJXA 3B3WA 1Y9ZA 3D67A 3KHZA 5HXDA 4C9VA 1Z2LA 3LWUA 3S9NA 4PXDA 4R8FA 4P4BA 4P10A 4MHNA 4IK2A 1CX8A 1R43A 2V8DA 2EK8A 2DEAA 3D66A 4OMEA 5THWA 1Z5RA 1ZG9A 4P4FA 1ZG7A 1HDQA 4OC2A 2OOTA 3PB8X 4MHPA 4JYWA 2RB7A 1FNOA 4C85A 1Y7EA 1LCPA 3KI9A 1HDUA 3WC6A 4MCQA 4P4EA 2HC9A 1GYTA 3L2NA 3KZWA 2AFWA 3K2KA 1LAMA 4FAIA 2XEGA 4WWVA 2Q51A 2ABZA 4W9YA 3PB6X 2IJZA 4KSIA 3PB9X 1CPSA 2GLFA 3PFEA 1R3NA 4NFRA 4NGNA 2HB6A 4BD9A 5HVFA 4C9UA 2QYVA 3D7FA 1BLLE 2XEIA 1F2OA 1WVMA 2AFXA 3IWWA 4C8UA 3VTAA 3KGQA 2XEFA 4F9VA 3ISZA 3B7IA 4ZX9A 3QNVA 1M4LA 2ZEGA 4TNUA 5JGFA 3WC5A 2AFUA 1BPMA 2PCUA 3KR5A 3B3SA 3WABA 3I74A 3HLPA 4OIDA 5LRJA 1NSAA 3IFEA 4ZY1A 4TWEA 3PB7X 1UWYA 3RZAA 2PJ8A 4B6ZA 1XMBA 2F8HA 2V8HA 3VATA 4ZI6A 2PJCA 4R76A 1QQ9A 2IQ6A
chains in the Genus database with same CATH superfamily
1TIQA 4M6HA 4B5OA 4UCNA 4RUHA 2ZW7A 1YVHA 2ZOGA 2PDOA 4RR2B 1IGBA 4J3GA 4PXCA 1JDBC 5LYIA 2Q4YA 1Z8WA 4NGPA 2GU2A 2Z3KA 2OLSA 4COBA 2HQYA 2PJAA 3TLGA 1V6CA 2VEZA 1JQGA 1KEEB 4OC1A 4A32A 5I4MA 1GHEA 2V77A 3FNCA 4ZYQA 1MJBA 1IIDA 2J8RA 2Q04A 1S60A 2PJ7A 2QJ8A 3IEHA 3N5FA 4P6YA 4PXEA 3D8PA 3DLJA 4UEZA 3MGDA 4TJVA 3FYNA 2B3UA 3GYAA 2BOAA 1CPXA 3F0AA 1X10A 4NJQA 4KNGE 1VBGA 3DNSA 1MJ9A 4R87A 2O53A 4CRYB 4OIWA 2EWBA 1XF1A 4NEXA 3VGOA 4R9MA 3S6GA 5JM6A 1I1DA 4C7IA 3PGPA 2FIAA 2EO8A 4KOTA 3SXOA 2DPTA 1IOIA 2AE6A 4LQ6A 3WT4A 3TLYA 3NA6A 1XE4A 2ANPA 3GIUA 3KRVA 3P2FA 1LANA 3R95A 5F09A 2EUIA 5F5XA 4C2YA 4CZ1A 1LAPA 5IR2A 2F7VA 4CGMA 4KOYA 6CPAA 2G0BA 1Y9KA 4FD5A 4MFQA 2PJ3A 3RBUA 1OZPA 2Z3MA 2GP4A 2GANA 2I00A 1KZFA 2ZW5A 3FEEA 3BJ8A 4RS2A 5H86A 2PIYA 3I1UA 1A2ZA 4MHDA 2OU2A 1AMPA 2ATRA 3A9LA 4X8IA 5HVHA 1ZRSA 4C8FA 3ICUA 1DE4C 3D2MA 3FEDA 1ARMA 1OBRA 4XPDC 4C9AA 2PRQA 4U9ZA 2OR4A 5KTAA 1XBUA 4KUAA 3CPAA 3H5ZA 1N71A 2Q44A 4UIBA 1WWZA 2CTBA 4CAEA 2FM4A 4X2TA 5F9MA 3TO9A 3TFYA 2ZEHA 3WR7A 1M44A 4UFXA 3TX8A 4NGSA 2EVNA 1HEEA 4M6IA 3QAHA 2YJVA 2CIJA 1VKCA 4BTFA 2XPPA 2O4HA 1FY7A 4MJ8A 4XNHB 4BINA 1F57A 1Z8XA 2G9DA 3FX6A 3TO7A 3D7GA 3NFQA 4FBEA 1CM0A 4LQGA 3GB0A 3EFAA 4DUKA 1CE8B 1ZG8A 1QMUA 2AFMA 2ZOFA 3K9TA 4PQAA 3S6KA 4OADA 3D2PA 1BXRB 3GJZA 5JVLA 1Z8TA 1IYLA 2VKZG 5HKZA 1QSRA 5IB9A 2C6PA 2EK9A 3B3VA 1B47A 1TF9A 5KTDA 2B5GA 2CXAA 4MCPA 2ZENA 4MXUA 2VZZA 4B12A 5JH9A 4OC3A 4A30A 2FIWA 4KZTA 2ARHA 3VH9A 5DS0A 1Y7RA 5FD8A 3D68A 7CPAA 4MFLA 3HPGG 2JLMA 4R6TA 1DIKA 3SI1A 2R1IA 5LYFA 2PE3A 4B13A 2Y0MA 4YWYA 3R9EA 4PXBA 4QB9A 2BO9A 2C6CA 3PZJA 2VL1A 4IIYA 4CGNA 2RFHA 4NGRA 2ZW6A 3WABA 4C9EA 4C2XA 4OC4A 3B35A 3I3GA 1CG2A 5HH1A 1YQEA 1YSJA 2OZUA 3EZAA 4EMEA 2PVVA 2YJTA 4KOUA 1KC7A 4MCSA 1XF8A 1IY7A 2WYRA 1KUYA 4A94A 1RTQA 3G3SA 4C8AA 1MJAA 5AG6A 1PYTB 1K4JA 1ARLA 4GM5A 4EVYA 3KR4A 1EE3P 3NE7A 1Q2DA 1ELMP 1IICA 3ISXA 3TOAA 3GKRA 4HPSA 3SHPA 4UWIA 1Q2CA 3FRMA 5CNPA 4H6ZA 4P4IA 2FXFA 2Z3LA 2HUZA 3CDXA 4UCPA 5LYDA 4JZ0A 4BBHA 4C86A 2DXQA 1KUVA 2QIRA 3D7DA 3EY5A 3T8WA 4E2AA 3E0KA 3GY9A 4PPZA 2HI6A 1WK4A 2PJ9A 4R57A 2JBKA 4Q7AA 4ZGYB 5A27A 2V8VA 4MCRA 3FJUA 4NGTA 3SJXA 4CYQA 4X3RA 2JEWA 4KVXA 1YW4A 4C2ZA 4Y49C 1YLEA 3T9YA 1QSTA 3D7HA 2REEA 2YNCA 2X7BA 2ZW4A 3PRTA 1ELLP 2J9AA 4PK3A 4CDKA 2YNEA 4DYOA 5D29A 3BHXA 1Q5XA 3T5MA 2CY2A 3S9MA 2DLAA 5ELYA 1TKJA 3JUWA 2MP0A 5IX3A 4A4BA 3PP9A 3IIBA 4E5SA 4IAVA 3G8WA 2Z11A 3VWDA 3BUMB 2CBLA 2ZEPA 3CXPA 4JXRA 4CGPA 2PIZA 3FIXA 2PJBA 1FBVA 4B6ZA 5JYBA 4EFDA 3FVLA 3NE8A 4KLVA 4YGOA 1Q2YA 3LMSA 3EXNA 2JDCA 3H8GA 3H8FA 1FT7A 3KQXA 4OC5A 1ZLHA 4G1PA 2I3CA 3FH4A 3EIFA 1H8LA 4KORA 1EZBA 4CAVA 1Z8LA 2IMOA 1LRZA 3IGRA 4JJXA 3MRUA 4FWUA 4F9UA 4AXVA 4OLLA 3EC4A 3WC7A 4A4CA 1VHSA 1J4JA 1YVKA 3MN8A 4C84A 5G21A 1TF8A 2DF5A 4NGQA 1NMTA 1PUAA 2NSMA 4ONUA 1T36B 1CJWA 5ISVA 3NH4A 3PB4X 4ZX8A 2Z10A 1CP6A 8CPAA 2ZELA 3R1KA 2P6GA 1P0HA 3FECA 3D4UA 5DWNA 5G20A 4A38A 1BAVA 2OB0A 4H6UA 1JWQA 4ONWA 4X5KA 4A31A 4CGLA 4NGMA 4C8PA 5K8NA 3JTKA 1XFOA 1RXTA 4B5PA 4P4DA 2EBJA 3BXMA 5H84A 2ZEMA 3S6FA 3U1BA 1NSLA 3KL9A 2OZHA 4KOXA 3V7ZA 2FVGA 4Z65A 1YMEA 4K30A 4OKOA 4A95A 2C27A 1F2PA 5I0CA 4MY3A 2B4DB 3TLCA 3SR3A 3G23A 4CAWA 4P44A 1IU8A 2D4PA 2PSWA 2PQ8A 2WZNA 2FT0A 2Q43A 2CTCA 3IO1A 3TTHA 4MI4A 4CGOA 3FBUA 2RC4A 2AFOA 4FD4A 5CPAA 3SJFA 3KKWA 4BPXB 1R57A 2ZEFA 1VGYA 1S7FA 2POKA 3VRPA 3B2YA 5GCNA 2XPLA 2QVPA 3BI0A 2NYQA 5KTCA 2HWGA 2B4BA 3I9SA 4R7MA 1BPNA 3S9LA 4UIAA 1P4NA 3JRUA 3TC8A 4GXHA 5FVJA 3PFOA 4E8OA 1QSMA 3BUOB 2AFSA 4ZBGA 2UV8G 2ODFA 3KASA 5AG4A 4K3NA 1CP7A 3VRNA 1CBXA 3BUXB 1LOKA 3T90A 1KWMA 5F13A 5CBMA 2E28A 2NMTA 4H2KA 1XEBA 4HNXB 2PRBA 4FD6A 4ZY0A 3OB2B 2D0PA 1ON0A 3D3SA 5A28A 1IYKA 2FL4A 2I79A 4NCZA 3VRRA 3EO4A 2AFZA 2C1CA 2XPNA 2PJ6A 1TKFA 4M6GA 3TYXA 2Q7SA 3TCVA 4CRZB 1XRYA 4JXQA 1YR0A 2Z0ZA 4F8ZA 2QMLA 3T07A 2B0AA 5F46A 3NFZA 1VBHA 2C6GA 1ZYMA 4A39A 1M4DA 1WJTA 4H89A 4I49A 2DIKA 5D8NA 2PR1A 3IJ3A 3JVNA 3NH8A 2Q7BA 2PJ4A 5DWMA 3SJGA 5J3XA 4MHYA 4AG7A 5IV0A 4OP4A 1S3ZA 4IHMA 1Z9EA 3OWCA 4QC6A 3NOJA 1Y0RA 4XPKA 5K8MA 4E94A 2R8VA 4MRIA 3OAKA 1YVOA 3PBBA 3N7ZA 2X0SA 4C9RA 3SI2A 1I21A 3R9FA 3T0TA 2O28A 4ZY2A 3KHXA 3R96A 3TLBA 4MY0A 2B4JC 2VI7A 4XNHC 3EZEA 4IUSA 1Q7LA 4UCMA 4UFVA 2FSRA 4P45A 2BSWA 2GIVA 4DJLA 1Z4EA 2PJ1A 1TXRA 2XEJA 3DGVA 1Z4RA 4BMHA 4RI1A 2Q4ZA 3TLGB 2GREA 2PVWA 3CZXA 4BPUB 5HKYA 3O8ZA 3B3TA 3GUXA 2BCOA 3IC1A 4UBRA 5BWAB 4KS9A 1Z9UA 2VBQA 3VWEA 1VHEA 4JLYA 4MFJA 4UFWA 2G3TA 3CT9A 4CYNA 2P6FA 4UA3A 3C8OA 5EC4A 3EZBA 2HROA 4MHZA 3OP0A 2BEIA 4Q36A 1XJOA 4M3SA 2ZEOA 3SI0A 4E0AA 1RO5A 3VARA 1U6MA 2IL4A 1AYEA 4UF4A 4B14A 1YLOA 1Y0YA 1XOVA 4UEFA 3BI1A 5HMNA 4AG9A 2EZBA 2Y1NA 3CPXA 3DR8A 4C7HA 4RN7A 3ZZIA 3PLFB 1PCAA 3W91A 5K99A 4PSWA 2PJ2A 2Z3PA 2VQYA 4KVME 1X12A 2BUEA 2J8MA 3V38A 3BUNB 2K5TA 2Z3OA 4Q38A 5F47A 3FB3A 3S6HA 4A33A 1VHOA 4NSQA 1YW6A 3VROA 2REFA 3DR6A 2R82A 4HNWB 2JBJA 2PJ5A 4CDJA 5HVGA 5K8OA 1TKHA 1VIXA 1ZLIA 4P4JA 2P0WA 1QSNA 3FMCA 3IWGA 4FD7A 4KOSA 1LFWA 4MMOA 4HNYB 4A2ZA 1ZL0A 3BJ7A 2ZEEA 3HUVA 3FF3A 5AGEA 4II9A 4YU9A 3PEIA 4CPAA 2CNTA 1M6VB 2A4NA 4IIXA 1S7LA 1CS0B 2H5MA 4F0YA 5JQ4A 3SJEA 4KSAA 5LRGA 4C8CA 5LYLA 2B58A 2EZAA 4FUUA 4KOWA 1B87A 4O23A 2CF4A 3B3CA 4L89A 4C68A 2AJ6A 2VZYA 3R9GA 3SXNA 4CAFA 1B6BA 2BL1A 1C3OB 2JDDA 4MFKA 2GLJA 4EWTA 4OC0A 3H8EA 4WJBA 3F8KA 3I6SA 4XPLA 2V8GA 5J1QA 1A9XB 3VRQA 4GPLB 4H1HA 3DDDA 4MFPA 3NH5A 4GS4A 2XPOA 3GLJA 4QUSA 4QBJA 5LRKA 3LACA 3PBEA 4INJA 4YN3A 1JDEA 2Y1MA 4C8TA 4AVCA 4XPDB 2FS5A 3RAMA 2ZEDA 1R61A 4C99A 1M1DA 1S7KA 2PJ0A 4MI1A 5K8PA 3KQZA 4NJRA 1UFHA 4TJXA 3IU1A 3ZJ0A 2B5GB 4CYOA 3B3WA 1Y9ZA 4DNCA 2D0OA 1KBLA 3D67A 3K9UA 4NXYA 1YX0A 3KHZA 5HXDA 4C9VA 2VXKA 1Z2LA 4KVOE 2OH1A 4AB7A 3LWUA 2WUUA 3S9NA 2ZXVA 4PXDA 4R8FA 4P4BA 2GE3A 4U9YA 5C88A 2R98A 4P10A 3BUWB 4MHNA 2WPXA 4IK2A 4MJXA 4EYSA 3DSBA 3BLNA 1CX8A 1R43A 2V8DA 1NBWA 2EK8A 2DEAA 1I12A 1M4IA 1S5KA 2B3VA 2FCKA 2EZCA 3D66A 5J8FA 5G1ZA 4HKFA 3C26A 4QVTA 4OMEA 5THWA 5BY0A 1Z5RA 4R3KA 2AUMA 5AXIA 1ZG9A 3TOBA 3CXQA 1J3LA 4P4FA 1ZG7A 2P6EA 4KLWA 3HMJG 1HDQA 4OAEA 4MFZA 2F5IA 4OC2A 2OOTA 4IF5A 1SQHA 3PB8X 2PR8A 2DPSA 4L8AA 1L0CA 2CNSA 4MHPA 2PC1A 4F6AA 1NE9A 2WSAA 4JYWA 1AUGA 4BPWB 2RB7A 1FNOA 1NXJA 4C85A 4JVOA 1BO4A 4ORFA 1Y7EA 3UY5A 5HKWA 1LCPA 3RO0A 3KI9A 1HDUA 2WPWA 4U5YA 5F49A 3WC6A 4CYPA 4MCQA 1GGOA 4P4EA 1M4GA 4LX9A 1S7NA 3K4IA 4PSXA 2HC9A 3OB1B 1GYTA 5AG5A 1ZO0A 2D4OA 3CXSA 3KZWA 3L2NA 3TLAA 2AFWA 3K2KA 2B4DA 2N3AB 5IB0A 1LAMA 4FAIA 4CO9A 3QB8A 1V0CA 3T05A 3TLZA 4M8DA 1Y9WA 3U88C 4NF1A 2XEGA 4LUAA 4WWVA 3TE4A 1C30B 4JWPA 2Q51A 2ABZA 4W9YA 3PB6X 3IWEA 2Q0YA 2IJZA 4KSIA 1QSOA 1CPSA 2GLFA 2IQ6A 3PB9X 3PFEA 3TT2A 4AVBA 3F9KC 2PCNA 4B11A 1R3NA 3IU2A 4NFRA 5F48A 3FXTA 2JEVA 3TLEA 4NGNA 2HB6A 4BD9A 4JD6A 5HVFA 4UWJA 4C9UA 1YGHA 2CNMA 2QYVA 5E96A 4A37A 3D7FA 1BLLE 4PK2A 2J8NA 2XEIA 2G3AA 1F2OA 4YRHA 4Y49B 2YGWA 3W6SA 5J8CA 1WVMA 2AFXA 4AVAA 3PFVA 1BOBA 4KUBA 3IWWA 4CAXA 5JPHA 3PT1A 4C8UA 3VTAA 3KGQA 2XEFA 4F9VA 3ISZA 3B7IA 2OZGA 1YREA 4COGA 1XMTA 2GFQA 3QAYA 5AG7A 4UEEA 3QNVA 4ZX9A 2Q4VA 2HV2A 3B8GA 3F5BA 3V8IA 1M4LA 2ZEGA 4TNUA 1VI4A 4R3LA 5JGFA 3HPHE 2AFUA 3WC5A 1IOFA 1BPMA 2PCUA 1EZAA 2YNCC 4J0NA 3KR5A 3LD2A 2C5QA 2Z3NA 4PV6A 3LODA 3B3SA 3P2HA 1XIXA 4MBUA 1MK4A 3H4QA 3HLPA 5EMIA 5G22A 3W6XA 3RYOA 4OIDA 3I74A 5LRJA 2R7HA 1NSAA 1KUXA 1YK3A 2QECA 4F0XA 3IFEA 4CS0B 4TWEA 4B5PB 4YFJA 4ZY1A 4KOVA 2AUNA 4M85A 3TO6A 3PB7X 1UWYA 4KSFA 2PJ8A 3RZAA 2FE7A 1XMBA 1PU9A 2F8HA 1EO0A 2V8HA 3VATA 2KCWA 3RNZA 2YNDA 4B10A 5F1YA 4ZI6A 2PJCA 3ZNIA 4R76A 5C82A 1QQ9A 1DTDA 5EBVA 1IB1E 2ZPAA
chains in the Genus database with same CATH topology
4RUHA 2ZOGA 1IGBA 4PXCA 5LYIA 2GU2A 4NGPA 2PJAA 1V6CA 1JQGA 4OC1A 5I4MA 2V77A 4ZYQA 4UEEA 3IEHA 2PJ7A 2QJ8A 4PXEA 3N5FA 4P6YA 3DLJA 4UEZA 4TJVA 2BOAA 1CPXA 4KNGE 4NJQA 2O53A 4OIWA 2EWBA 1XF1A 5JM6A 3WT4A 3NA6A 2ANPA 1LANA 5F09A 1LAPA 5IR2A 2F7VA 6CPAA 2GP4A 2PJ3A 3RBUA 3FEEA 2PIYA 3I1UA 1AMPA 4X8IA 5HVHA 4C8FA 3ICUA 1DE4C 3FEDA 1ARMA 1OBRA 4C9AA 2PRQA 2OR4A 1XBUA 3CPAA 4UIBA 2CTBA 4X2TA 2ZEHA 3TX8A 4NGSA 1HEEA 2CIJA 1DTDA 2O4HA 5IB9A 1F57A 2G9DA 3FX6A 3D7GA 4FBEA 4LQGA 3GB0A 4DUKA 1ZG8A 1QMUA 2AFMA 2ZOFA 3K9TA 4PQAA 2C6PA 2EK9A 3B3VA 1TF9A 4MCPA 2ZENA 4MXUA 5JH9A 4OC3A 3VH9A 5DS0A 3D68A 7CPAA 4R6TA 3SI1A 5LYFA 2PE3A 4YWYA 4PXBA 2BO9A 2C6CA 2VL1A 2RFHA 4NGRA 4C9EA 4OC4A 3B35A 1CG2A 1YSJA 4EMEA 2PVVA 4MCSA 1IY7A 2WYRA 4A94A 1RTQA 4C8AA 1PYTB 4GM5A 1ARLA 3KR4A 1EE3P 3ISXA 1ELMP 4P4IA 5LYDA 4C86A 3CDXA 4JZ0A 3D7DA 3T8WA 4PPZA 2PJ9A 2JBKA 4Q7AA 2V8VA 4MCRA 3FJUA 4NGTA 3SJXA 4X3RA 2JEWA 1YW4A 3D7HA 3PRTA 1ELLP 2J9AA 4CDKA 4DYOA 5D29A 3BHXA 3S9MA 5ELYA 1TKJA 3IIBA 4IAVA 2ZEPA 2PIZA 2PJBA 4EFDA 3FVLA 3LMSA 3H8GA 3H8FA 1FT7A 3KQXA 4OC5A 1ZLHA 4G1PA 2I3CA 3FH4A 3EIFA 1H8LA 1Z8LA 2IMOA 3MRUA 4FWUA 4F9UA 4AXVA 3WC7A 3MN8A 4C84A 1TF8A 4NGQA 2NSMA 3NH4A 3PB4X 4ZX8A 1CP6A 8CPAA 2ZELA 3FECA 3D4UA 4A38A 1BAVA 4ONWA 4C8PA 4NGMA 5K8NA 1XFOA 4P4DA 3BXMA 2ZEMA 3KL9A 3V7ZA 2FVGA 4Z65A 1YMEA 4OKOA 1F2PA 4P44A 2WZNA 2Q43A 2CTCA 3IO1A 2AFOA 5CPAA 3SJFA 2ZEFA 1VGYA 2POKA 3B2YA 2QVPA 3BI0A 2NYQA 4R7MA 1BPNA 3S9LA 4UIAA 3JRUA 3TC8A 3PFOA 2AFSA 3KASA 4K3NA 1CP7A 1CBXA 1LOKA 1KWMA 5CBMA 4H2KA 4ZY0A 2AFZA 2C1CA 2PJ6A 1TKFA 1XRYA 4F8ZA 3NFZA 2C6GA 4A39A 5D8NA 3IJ3A 3NH8A 2PJ4A 3SJGA 4MHYA 4OP4A 4IHMA 1Y0RA 4MRIA 3PBBA 4C9RA 3SI2A 4ZY2A 3KHXA 1Q7LA 4P45A 4DJLA 2PJ1A 1TXRA 2XEJA 3DGVA 2Q4ZA 2GREA 2PVWA 3GUXA 3B3TA 3IC1A 2BCOA 5K8MA 1VHEA 3CT9A 4MHZA 1XJOA 2ZEOA 3SI0A 3VARA 1AYEA 4UF4A 1YLOA 1Y0YA 4UEFA 3BI1A 3CPXA 1PCAA 2PJ2A 3V38A 4A37A 1VHOA 1YW6A 2JBJA 2PJ5A 4CDJA 5HVGA 5K8OA 1TKHA 1VIXA 1ZLIA 4P4JA 3FMCA 4MMOA 1LFWA 2ZEEA 3HUVA 3FF3A 4YU9A 3PEIA 4CPAA 3SJEA 5LRGA 4C8CA 5LYLA 4FUUA 4O23A 2CF4A 3B3CA 2GLJA 4EWTA 4OC0A 3H8EA 4WJBA 3I6SA 2V8GA 5J1QA 3NH5A 5LRKA 3GLJA 4C8TA 3PBEA 4YN3A 3RAMA 2ZEDA 4C99A 2PJ0A 5K8PA 3KQZA 4NJRA 4TJXA 3B3WA 1Y9ZA 3D67A 3KHZA 5HXDA 4C9VA 1Z2LA 3LWUA 3S9NA 4PXDA 4R8FA 4P4BA 4P10A 4MHNA 4IK2A 1CX8A 1R43A 2V8DA 2EK8A 2DEAA 3D66A 4OMEA 5THWA 1Z5RA 1ZG9A 4P4FA 1ZG7A 1HDQA 4OC2A 2OOTA 3PB8X 4MHPA 4JYWA 2RB7A 1FNOA 4C85A 1Y7EA 1LCPA 3KI9A 1HDUA 3WC6A 4MCQA 4P4EA 2HC9A 1GYTA 3L2NA 3KZWA 2AFWA 3K2KA 1LAMA 4FAIA 2XEGA 4WWVA 2Q51A 2ABZA 4W9YA 3PB6X 2IJZA 4KSIA 3PB9X 1CPSA 2GLFA 3PFEA 1R3NA 4NFRA 4NGNA 2HB6A 4BD9A 5HVFA 4C9UA 2QYVA 3D7FA 1BLLE 2XEIA 1F2OA 1WVMA 2AFXA 3IWWA 4C8UA 3VTAA 3KGQA 2XEFA 4F9VA 3ISZA 3B7IA 4ZX9A 3QNVA 1M4LA 2ZEGA 4TNUA 5JGFA 3WC5A 2AFUA 1BPMA 2PCUA 3KR5A 2C5QA 3B3SA 3WABA 3I74A 3HLPA 4OIDA 5LRJA 1NSAA 3IFEA 4ZY1A 4TWEA 3PB7X 1UWYA 3RZAA 2PJ8A 4B6ZA 1XMBA 2F8HA 2V8HA 3VATA 4ZI6A 2PJCA 4R76A 1QQ9A 2IQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RUH A;  2ZOG A;  1IGB A;  4PXC A;  5LYI A;  2GU2 A;  4NGP A;  2PJA A;  1V6C A;  1JQG A;  4OC1 A;  5I4M A;  2V77 A;  4ZYQ A;  4UEE A;  3IEH A;  2PJ7 A;  2QJ8 A;  4PXE A;  3N5F A;  4P6Y A;  3DLJ A;  4UEZ A;  4TJV A;  2BOA A;  1CPX A;  4KNG E;  4NJQ A;  2O53 A;  4OIW A;  2EWB A;  1XF1 A;  5JM6 A;  3WT4 A;  3NA6 A;  2ANP A;  1LAN A;  5F09 A;  1LAP A;  2F7V A;  6CPA A;  2PJ3 A;  3RBU A;  3FEE A;  2PIY A;  3I1U A;  1AMP A;  4X8I A;  5HVH A;  4C8F A;  3ICU A;  1DE4 C;  3FED A;  1ARM A;  1OBR A;  4C9A A;  2PRQ A;  2OR4 A;  1XBU A;  3CPA A;  4UIB A;  2CTB A;  4X2T A;  2ZEH A;  3TX8 A;  4NGS A;  1HEE A;  2CIJ A;  1DTD A;  2O4H A;  5IB9 A;  1F57 A;  2G9D A;  3FX6 A;  3D7G A;  4FBE A;  4LQG A;  3GB0 A;  4DUK A;  1ZG8 A;  1QMU A;  2AFM A;  2ZOF A;  3K9T A;  4PQA A;  2C6P A;  2EK9 A;  3B3V A;  1TF9 A;  4MCP A;  2ZEN A;  4MXU A;  5JH9 A;  4OC3 A;  3VH9 A;  5DS0 A;  3D68 A;  7CPA A;  4R6T A;  3SI1 A;  5LYF A;  2PE3 A;  4YWY A;  4PXB A;  2BO9 A;  2C6C A;  2VL1 A;  2RFH A;  4NGR A;  4C9E A;  4OC4 A;  3B35 A;  1CG2 A;  1YSJ A;  4EME A;  2PVV A;  4MCS A;  1IY7 A;  2WYR A;  4A94 A;  1RTQ A;  4C8A A;  1PYT B;  4GM5 A;  1ARL A;  3KR4 A;  1EE3 P;  3ISX A;  1ELM P;  4P4I A;  5LYD A;  4C86 A;  3CDX A;  4JZ0 A;  3D7D A;  3T8W A;  4PPZ A;  2PJ9 A;  2JBK A;  4Q7A A;  2V8V A;  4MCR A;  3FJU A;  4NGT A;  3SJX A;  4X3R A;  2JEW A;  1YW4 A;  3D7H A;  3PRT A;  1ELL P;  2J9A A;  4CDK A;  4DYO A;  5D29 A;  3BHX A;  3S9M A;  5ELY A;  1TKJ A;  3IIB A;  4IAV A;  2ZEP A;  2PIZ A;  2PJB A;  4EFD A;  3FVL A;  3LMS A;  3H8G A;  3H8F A;  1FT7 A;  3KQX A;  4OC5 A;  1ZLH A;  4G1P A;  2I3C A;  3FH4 A;  3EIF A;  1H8L A;  1Z8L A;  2IMO A;  3MRU A;  4FWU A;  4F9U A;  4AXV A;  3WC7 A;  3MN8 A;  4C84 A;  1TF8 A;  4NGQ A;  2NSM A;  3NH4 A;  3PB4 X;  4ZX8 A;  1CP6 A;  8CPA A;  2ZEL A;  3FEC A;  3D4U A;  4A38 A;  1BAV A;  4ONW A;  4C8P A;  4NGM A;  5K8N A;  1XFO A;  4P4D A;  3BXM A;  2ZEM A;  3KL9 A;  3V7Z A;  2FVG A;  4Z65 A;  1YME A;  4OKO A;  1F2P A;  4P44 A;  2WZN A;  2Q43 A;  2CTC A;  3IO1 A;  2AFO A;  5CPA A;  3SJF A;  2ZEF A;  1VGY A;  2POK A;  3B2Y A;  2QVP A;  3BI0 A;  2NYQ A;  4R7M A;  1BPN A;  3S9L A;  4UIA A;  3JRU A;  3TC8 A;  3PFO A;  2AFS A;  3KAS A;  4K3N A;  1CP7 A;  1CBX A;  1LOK A;  1KWM A;  5CBM A;  4H2K A;  4ZY0 A;  2AFZ A;  2C1C A;  2PJ6 A;  1TKF A;  1XRY A;  4F8Z A;  3NFZ A;  2C6G A;  4A39 A;  5D8N A;  3IJ3 A;  3NH8 A;  2PJ4 A;  3SJG A;  4MHY A;  4OP4 A;  4IHM A;  1Y0R A;  4MRI A;  3PBB A;  4C9R A;  3SI2 A;  4ZY2 A;  3KHX A;  1Q7L A;  4P45 A;  4DJL A;  2PJ1 A;  1TXR A;  2XEJ A;  3DGV A;  2Q4Z A;  2GRE A;  2PVW A;  3GUX A;  3B3T A;  3IC1 A;  2BCO A;  5K8M A;  1VHE A;  3CT9 A;  4MHZ A;  1XJO A;  2ZEO A;  3SI0 A;  3VAR A;  1AYE A;  4UF4 A;  1YLO A;  1Y0Y A;  4UEF A;  3BI1 A;  3CPX A;  1PCA A;  2PJ2 A;  3V38 A;  4A37 A;  1VHO A;  1YW6 A;  2JBJ A;  2PJ5 A;  4CDJ A;  5HVG A;  5K8O A;  1TKH A;  1VIX A;  1ZLI A;  4P4J A;  3FMC A;  4MMO A;  1LFW A;  2ZEE A;  3HUV A;  3FF3 A;  4YU9 A;  3PEI A;  4CPA A;  3SJE A;  5LRG A;  4C8C A;  5LYL A;  4FUU A;  4O23 A;  2CF4 A;  3B3C A;  2GLJ A;  4EWT A;  4OC0 A;  3H8E A;  4WJB A;  3I6S A;  2V8G A;  5J1Q A;  3NH5 A;  5LRK A;  3GLJ A;  4C8T A;  3PBE A;  4YN3 A;  3RAM A;  2ZED A;  4C99 A;  2PJ0 A;  5K8P A;  3KQZ A;  4NJR A;  4TJX A;  3B3W A;  1Y9Z A;  3D67 A;  3KHZ A;  5HXD A;  4C9V A;  1Z2L A;  3LWU A;  3S9N A;  4PXD A;  4R8F A;  4P4B A;  4P10 A;  4MHN A;  4IK2 A;  1CX8 A;  1R43 A;  2V8D A;  2EK8 A;  2DEA A;  3D66 A;  4OME A;  5THW A;  1Z5R A;  1ZG9 A;  4P4F A;  1ZG7 A;  1HDQ A;  4OC2 A;  2OOT A;  3PB8 X;  4MHP A;  4JYW A;  2RB7 A;  1FNO A;  4C85 A;  1Y7E A;  1LCP A;  3KI9 A;  1HDU A;  3WC6 A;  4MCQ A;  4P4E A;  2HC9 A;  1GYT A;  3L2N A;  3KZW A;  2AFW A;  3K2K A;  1LAM A;  4FAI A;  2XEG A;  4WWV A;  2Q51 A;  2ABZ A;  4W9Y A;  3PB6 X;  2IJZ A;  4KSI A;  3PB9 X;  1CPS A;  2GLF A;  3PFE A;  1R3N A;  4NFR A;  4NGN A;  2HB6 A;  4BD9 A;  5HVF A;  4C9U A;  2QYV A;  3D7F A;  1BLL E;  2XEI A;  1F2O A;  1WVM A;  2AFX A;  3IWW A;  4C8U A;  3VTA A;  3KGQ A;  2XEF A;  4F9V A;  3ISZ A;  3B7I A;  4ZX9 A;  3QNV A;  1M4L A;  2ZEG A;  4TNU A;  5JGF A;  3WC5 A;  2AFU A;  1BPM A;  2PCU A;  3KR5 A;  3B3S A;  3WAB A;  3I74 A;  3HLP A;  4OID A;  5LRJ A;  1NSA A;  3IFE A;  4ZY1 A;  4TWE A;  3PB7 X;  1UWY A;  3RZA A;  2PJ8 A;  4B6Z A;  1XMB A;  2F8H A;  2V8H A;  3VAT A;  4ZI6 A;  2PJC A;  4R76 A;  1QQ9 A;  2IQ6 A; 
#chains in the Genus database with same CATH topology
 1TIQ A;  4M6H A;  4B5O A;  4UCN A;  4RUH A;  2ZW7 A;  1YVH A;  2ZOG A;  2PDO A;  4RR2 B;  1IGB A;  4J3G A;  4PXC A;  1JDB C;  5LYI A;  2Q4Y A;  1Z8W A;  4NGP A;  2GU2 A;  2Z3K A;  2OLS A;  4COB A;  2HQY A;  2PJA A;  3TLG A;  1V6C A;  2VEZ A;  1JQG A;  1KEE B;  4OC1 A;  4A32 A;  5I4M A;  1GHE A;  2V77 A;  3FNC A;  4ZYQ A;  1MJB A;  1IID A;  2J8R A;  2Q04 A;  1S60 A;  2PJ7 A;  2QJ8 A;  3IEH A;  3N5F A;  4P6Y A;  4PXE A;  3D8P A;  3DLJ A;  4UEZ A;  3MGD A;  4TJV A;  3FYN A;  2B3U A;  3GYA A;  2BOA A;  1CPX A;  3F0A A;  1X10 A;  4NJQ A;  4KNG E;  1VBG A;  3DNS A;  1MJ9 A;  4R87 A;  2O53 A;  4CRY B;  4OIW A;  2EWB A;  1XF1 A;  4NEX A;  3VGO A;  4R9M A;  3S6G A;  5JM6 A;  1I1D A;  4C7I A;  3PGP A;  2FIA A;  2EO8 A;  4KOT A;  3SXO A;  2DPT A;  1IOI A;  2AE6 A;  4LQ6 A;  3WT4 A;  3TLY A;  3NA6 A;  1XE4 A;  2ANP A;  3GIU A;  3KRV A;  3P2F A;  1LAN A;  3R95 A;  5F09 A;  2EUI A;  5F5X A;  4C2Y A;  4CZ1 A;  1LAP A;  5IR2 A;  2F7V A;  4CGM A;  4KOY A;  6CPA A;  2G0B A;  1Y9K A;  4FD5 A;  4MFQ A;  2PJ3 A;  3RBU A;  1OZP A;  2Z3M A;  2GP4 A;  2GAN A;  2I00 A;  1KZF A;  2ZW5 A;  3FEE A;  3BJ8 A;  4RS2 A;  5H86 A;  2PIY A;  3I1U A;  1A2Z A;  4MHD A;  2OU2 A;  1AMP A;  2ATR A;  3A9L A;  4X8I A;  5HVH A;  1ZRS A;  4C8F A;  3ICU A;  1DE4 C;  3D2M A;  3FED A;  1ARM A;  1OBR A;  4XPD C;  4C9A A;  2PRQ A;  4U9Z A;  2OR4 A;  5KTA A;  1XBU A;  4KUA A;  3CPA A;  3H5Z A;  1N71 A;  2Q44 A;  4UIB A;  1WWZ A;  2CTB A;  4CAE A;  2FM4 A;  4X2T A;  5F9M A;  3TO9 A;  3TFY A;  2ZEH A;  3WR7 A;  1M44 A;  4UFX A;  3TX8 A;  4NGS A;  2EVN A;  1HEE A;  4M6I A;  3QAH A;  2YJV A;  2CIJ A;  1VKC A;  4BTF A;  2XPP A;  2O4H A;  1FY7 A;  4MJ8 A;  4XNH B;  4BIN A;  1F57 A;  1Z8X A;  2G9D A;  3FX6 A;  3TO7 A;  3D7G A;  3NFQ A;  4FBE A;  1CM0 A;  4LQG A;  3GB0 A;  3EFA A;  4DUK A;  1CE8 B;  1ZG8 A;  1QMU A;  2AFM A;  2ZOF A;  3K9T A;  4PQA A;  3S6K A;  4OAD A;  3D2P A;  1BXR B;  3GJZ A;  5JVL A;  1Z8T A;  1IYL A;  2VKZ G;  5HKZ A;  1QSR A;  5IB9 A;  2C6P A;  2EK9 A;  3B3V A;  1B47 A;  1TF9 A;  5KTD A;  2B5G A;  2CXA A;  4MCP A;  2ZEN A;  4MXU A;  2VZZ A;  4B12 A;  5JH9 A;  4OC3 A;  4A30 A;  2FIW A;  4KZT A;  2ARH A;  3VH9 A;  5DS0 A;  1Y7R A;  5FD8 A;  3D68 A;  7CPA A;  4MFL A;  3HPG G;  2JLM A;  4R6T A;  1DIK A;  3SI1 A;  2R1I A;  5LYF A;  2PE3 A;  4B13 A;  2Y0M A;  4YWY A;  3R9E A;  4PXB A;  4QB9 A;  2BO9 A;  2C6C A;  3PZJ A;  2VL1 A;  4IIY A;  4CGN A;  2RFH A;  4NGR A;  2ZW6 A;  3WAB A;  4C9E A;  4C2X A;  4OC4 A;  3B35 A;  3I3G A;  1CG2 A;  5HH1 A;  1YQE A;  1YSJ A;  2OZU A;  3EZA A;  4EME A;  2PVV A;  2YJT A;  4KOU A;  1KC7 A;  4MCS A;  1XF8 A;  1IY7 A;  2WYR A;  1KUY A;  4A94 A;  1RTQ A;  3G3S A;  4C8A A;  1MJA A;  5AG6 A;  1PYT B;  1K4J A;  1ARL A;  4GM5 A;  4EVY A;  3KR4 A;  1EE3 P;  3NE7 A;  1Q2D A;  1ELM P;  1IIC A;  3ISX A;  3TOA A;  3GKR A;  4HPS A;  3SHP A;  4UWI A;  1Q2C A;  3FRM A;  5CNP A;  4H6Z A;  4P4I A;  2FXF A;  2Z3L A;  2HUZ A;  3CDX A;  4UCP A;  5LYD A;  4JZ0 A;  4BBH A;  4C86 A;  2DXQ A;  1KUV A;  2QIR A;  3D7D A;  3EY5 A;  3T8W A;  4E2A A;  3E0K A;  3GY9 A;  4PPZ A;  2HI6 A;  1WK4 A;  2PJ9 A;  4R57 A;  2JBK A;  4Q7A A;  4ZGY B;  5A27 A;  2V8V A;  4MCR A;  3FJU A;  4NGT A;  3SJX A;  4CYQ A;  4X3R A;  2JEW A;  4KVX A;  1YW4 A;  4C2Z A;  4Y49 C;  1YLE A;  3T9Y A;  1QST A;  3D7H A;  2REE A;  2YNC A;  2X7B A;  2ZW4 A;  3PRT A;  1ELL P;  2J9A A;  4PK3 A;  4CDK A;  2YNE A;  4DYO A;  5D29 A;  3BHX A;  1Q5X A;  3T5M A;  2CY2 A;  3S9M A;  2DLA A;  5ELY A;  1TKJ A;  3JUW A;  2MP0 A;  5IX3 A;  4A4B A;  3PP9 A;  3IIB A;  4E5S A;  4IAV A;  3G8W A;  2Z11 A;  3VWD A;  3BUM B;  2CBL A;  2ZEP A;  3CXP A;  4JXR A;  4CGP A;  2PIZ A;  3FIX A;  2PJB A;  1FBV A;  4B6Z A;  5JYB A;  4EFD A;  3FVL A;  3NE8 A;  4KLV A;  4YGO A;  1Q2Y A;  3LMS A;  3EXN A;  2JDC A;  3H8G A;  3H8F A;  1FT7 A;  3KQX A;  4OC5 A;  1ZLH A;  4G1P A;  2I3C A;  3FH4 A;  3EIF A;  1H8L A;  4KOR A;  1EZB A;  4CAV A;  1Z8L A;  2IMO A;  1LRZ A;  3IGR A;  4JJX A;  3MRU A;  4FWU A;  4F9U A;  4AXV A;  4OLL A;  3EC4 A;  3WC7 A;  4A4C A;  1VHS A;  1J4J A;  1YVK A;  3MN8 A;  4C84 A;  5G21 A;  1TF8 A;  2DF5 A;  4NGQ A;  1NMT A;  1PUA A;  2NSM A;  4ONU A;  1T36 B;  1CJW A;  5ISV A;  3NH4 A;  3PB4 X;  4ZX8 A;  2Z10 A;  1CP6 A;  8CPA A;  2ZEL A;  3R1K A;  2P6G A;  1P0H A;  3FEC A;  3D4U A;  5DWN A;  5G20 A;  4A38 A;  1BAV A;  2OB0 A;  4H6U A;  1JWQ A;  4ONW A;  4X5K A;  4A31 A;  4CGL A;  4NGM A;  4C8P A;  5K8N A;  3JTK A;  1XFO A;  1RXT A;  4B5P A;  4P4D A;  2EBJ A;  3BXM A;  5H84 A;  2ZEM A;  3S6F A;  3U1B A;  1NSL A;  3KL9 A;  2OZH A;  4KOX A;  3V7Z A;  2FVG A;  4Z65 A;  1YME A;  4K30 A;  4OKO A;  4A95 A;  2C27 A;  1F2P A;  5I0C A;  4MY3 A;  2B4D B;  3TLC A;  3SR3 A;  3G23 A;  4CAW A;  4P44 A;  1IU8 A;  2D4P A;  2PSW A;  2PQ8 A;  2WZN A;  2FT0 A;  2Q43 A;  2CTC A;  3IO1 A;  3TTH A;  4MI4 A;  4CGO A;  3FBU A;  2RC4 A;  2AFO A;  4FD4 A;  5CPA A;  3SJF A;  3KKW A;  4BPX B;  1R57 A;  2ZEF A;  1VGY A;  1S7F A;  2POK A;  3VRP A;  3B2Y A;  5GCN A;  2XPL A;  2QVP A;  3BI0 A;  2NYQ A;  5KTC A;  2HWG A;  2B4B A;  3I9S A;  4R7M A;  1BPN A;  3S9L A;  4UIA A;  1P4N A;  3JRU A;  3TC8 A;  4GXH A;  5FVJ A;  3PFO A;  4E8O A;  1QSM A;  3BUO B;  2AFS A;  4ZBG A;  2UV8 G;  2ODF A;  3KAS A;  5AG4 A;  4K3N A;  1CP7 A;  3VRN A;  1CBX A;  3BUX B;  1LOK A;  3T90 A;  1KWM A;  5F13 A;  5CBM A;  2E28 A;  2NMT A;  4H2K A;  1XEB A;  4HNX B;  2PRB A;  4FD6 A;  4ZY0 A;  3OB2 B;  2D0P A;  1ON0 A;  3D3S A;  5A28 A;  1IYK A;  2FL4 A;  2I79 A;  4NCZ A;  3VRR A;  3EO4 A;  2AFZ A;  2C1C A;  2XPN A;  2PJ6 A;  1TKF A;  4M6G A;  3TYX A;  2Q7S A;  3TCV A;  4CRZ B;  1XRY A;  4JXQ A;  1YR0 A;  2Z0Z A;  4F8Z A;  2QML A;  3T07 A;  2B0A A;  5F46 A;  3NFZ A;  1VBH A;  2C6G A;  1ZYM A;  4A39 A;  1M4D A;  1WJT A;  4H89 A;  4I49 A;  2DIK A;  5D8N A;  2PR1 A;  3IJ3 A;  3JVN A;  3NH8 A;  2Q7B A;  2PJ4 A;  5DWM A;  3SJG A;  5J3X A;  4MHY A;  4AG7 A;  5IV0 A;  4OP4 A;  1S3Z A;  4IHM A;  1Z9E A;  3OWC A;  4QC6 A;  3NOJ A;  1Y0R A;  4XPK A;  5K8M A;  4E94 A;  2R8V A;  4MRI A;  3OAK A;  1YVO A;  3PBB A;  3N7Z A;  2X0S A;  4C9R A;  3SI2 A;  1I21 A;  3R9F A;  3T0T A;  2O28 A;  4ZY2 A;  3KHX A;  3R96 A;  3TLB A;  4MY0 A;  2B4J C;  2VI7 A;  4XNH C;  3EZE A;  4IUS A;  1Q7L A;  4UCM A;  4UFV A;  2FSR A;  4P45 A;  2BSW A;  2GIV A;  4DJL A;  1Z4E A;  2PJ1 A;  1TXR A;  2XEJ A;  3DGV A;  1Z4R A;  4BMH A;  4RI1 A;  2Q4Z A;  3TLG B;  2GRE A;  2PVW A;  3CZX A;  4BPU B;  5HKY A;  3O8Z A;  3B3T A;  3GUX A;  2BCO A;  3IC1 A;  4UBR A;  5BWA B;  4KS9 A;  1Z9U A;  2VBQ A;  3VWE A;  1VHE A;  4JLY A;  4MFJ A;  4UFW A;  2G3T A;  3CT9 A;  4CYN A;  2P6F A;  4UA3 A;  3C8O A;  5EC4 A;  3EZB A;  2HRO A;  4MHZ A;  3OP0 A;  2BEI A;  4Q36 A;  1XJO A;  4M3S A;  2ZEO A;  3SI0 A;  4E0A A;  1RO5 A;  3VAR A;  1U6M A;  2IL4 A;  1AYE A;  4UF4 A;  4B14 A;  1YLO A;  1Y0Y A;  1XOV A;  4UEF A;  3BI1 A;  5HMN A;  4AG9 A;  2EZB A;  2Y1N A;  3CPX A;  3DR8 A;  4C7H A;  4RN7 A;  3ZZI A;  3PLF B;  1PCA A;  3W91 A;  5K99 A;  4PSW A;  2PJ2 A;  2Z3P A;  2VQY A;  4KVM E;  1X12 A;  2BUE A;  2J8M A;  3V38 A;  3BUN B;  2K5T A;  2Z3O A;  4Q38 A;  5F47 A;  3FB3 A;  3S6H A;  4A33 A;  1VHO A;  4NSQ A;  1YW6 A;  3VRO A;  2REF A;  3DR6 A;  2R82 A;  4HNW B;  2JBJ A;  2PJ5 A;  4CDJ A;  5HVG A;  5K8O A;  1TKH A;  1VIX A;  1ZLI A;  4P4J A;  2P0W A;  1QSN A;  3FMC A;  3IWG A;  4FD7 A;  4KOS A;  1LFW A;  4MMO A;  4HNY B;  4A2Z A;  1ZL0 A;  3BJ7 A;  2ZEE A;  3HUV A;  3FF3 A;  5AGE A;  4II9 A;  4YU9 A;  3PEI A;  4CPA A;  2CNT A;  1M6V B;  2A4N A;  4IIX A;  1S7L A;  1CS0 B;  2H5M A;  4F0Y A;  5JQ4 A;  3SJE A;  4KSA A;  5LRG A;  4C8C A;  5LYL A;  2B58 A;  2EZA A;  4FUU A;  4KOW A;  1B87 A;  4O23 A;  2CF4 A;  3B3C A;  4L89 A;  4C68 A;  2AJ6 A;  2VZY A;  3R9G A;  3SXN A;  4CAF A;  1B6B A;  2BL1 A;  1C3O B;  2JDD A;  4MFK A;  2GLJ A;  4EWT A;  4OC0 A;  3H8E A;  4WJB A;  3F8K A;  3I6S A;  4XPL A;  2V8G A;  5J1Q A;  1A9X B;  3VRQ A;  4GPL B;  4H1H A;  3DDD A;  4MFP A;  3NH5 A;  4GS4 A;  2XPO A;  3GLJ A;  4QUS A;  4QBJ A;  5LRK A;  3LAC A;  3PBE A;  4INJ A;  4YN3 A;  1JDE A;  2Y1M A;  4C8T A;  4AVC A;  4XPD B;  2FS5 A;  3RAM A;  2ZED A;  1R61 A;  4C99 A;  1M1D A;  1S7K A;  2PJ0 A;  4MI1 A;  5K8P A;  3KQZ A;  4NJR A;  1UFH A;  4TJX A;  3IU1 A;  3ZJ0 A;  2B5G B;  4CYO A;  3B3W A;  1Y9Z A;  4DNC A;  2D0O A;  1KBL A;  3D67 A;  3K9U A;  4NXY A;  1YX0 A;  3KHZ A;  5HXD A;  4C9V A;  2VXK A;  1Z2L A;  4KVO E;  2OH1 A;  4AB7 A;  3LWU A;  2WUU A;  3S9N A;  2ZXV A;  4PXD A;  4R8F A;  4P4B A;  2GE3 A;  4U9Y A;  5C88 A;  2R98 A;  4P10 A;  3BUW B;  4MHN A;  2WPX A;  4IK2 A;  4MJX A;  4EYS A;  3DSB A;  3BLN A;  1CX8 A;  1R43 A;  2V8D A;  1NBW A;  2EK8 A;  2DEA A;  1I12 A;  1M4I A;  1S5K A;  2B3V A;  2FCK A;  2EZC A;  3D66 A;  5J8F A;  5G1Z A;  4HKF A;  3C26 A;  4QVT A;  4OME A;  5THW A;  5BY0 A;  1Z5R A;  4R3K A;  2AUM A;  5AXI A;  1ZG9 A;  3TOB A;  3CXQ A;  1J3L A;  4P4F A;  1ZG7 A;  2P6E A;  4KLW A;  3HMJ G;  1HDQ A;  4OAE A;  4MFZ A;  2F5I A;  4OC2 A;  2OOT A;  4IF5 A;  1SQH A;  3PB8 X;  2PR8 A;  2DPS A;  4L8A A;  1L0C A;  2CNS A;  4MHP A;  2PC1 A;  4F6A A;  1NE9 A;  2WSA A;  4JYW A;  1AUG A;  4BPW B;  2RB7 A;  1FNO A;  1NXJ A;  4C85 A;  4JVO A;  1BO4 A;  4ORF A;  1Y7E A;  3UY5 A;  5HKW A;  1LCP A;  3RO0 A;  3KI9 A;  1HDU A;  2WPW A;  4U5Y A;  5F49 A;  3WC6 A;  4CYP A;  4MCQ A;  1GGO A;  4P4E A;  1M4G A;  4LX9 A;  1S7N A;  3K4I A;  4PSX A;  2HC9 A;  3OB1 B;  1GYT A;  5AG5 A;  1ZO0 A;  2D4O A;  3CXS A;  3KZW A;  3L2N A;  3TLA A;  2AFW A;  3K2K A;  2B4D A;  2N3A B;  5IB0 A;  1LAM A;  4FAI A;  4CO9 A;  3QB8 A;  1V0C A;  3T05 A;  3TLZ A;  4M8D A;  1Y9W A;  3U88 C;  4NF1 A;  2XEG A;  4LUA A;  4WWV A;  3TE4 A;  1C30 B;  4JWP A;  2Q51 A;  2ABZ A;  4W9Y A;  3PB6 X;  3IWE A;  2Q0Y A;  2IJZ A;  4KSI A;  1QSO A;  1CPS A;  2GLF A;  2IQ6 A;  3PB9 X;  3PFE A;  3TT2 A;  4AVB A;  3F9K C;  2PCN A;  4B11 A;  1R3N A;  3IU2 A;  4NFR A;  5F48 A;  3FXT A;  2JEV A;  3TLE A;  4NGN A;  2HB6 A;  4BD9 A;  4JD6 A;  5HVF A;  4UWJ A;  4C9U A;  1YGH A;  2CNM A;  2QYV A;  5E96 A;  4A37 A;  3D7F A;  1BLL E;  4PK2 A;  2J8N A;  2XEI A;  2G3A A;  1F2O A;  4YRH A;  4Y49 B;  2YGW A;  3W6S A;  5J8C A;  1WVM A;  2AFX A;  4AVA A;  3PFV A;  1BOB A;  4KUB A;  3IWW A;  4CAX A;  5JPH A;  3PT1 A;  4C8U A;  3VTA A;  3KGQ A;  2XEF A;  4F9V A;  3ISZ A;  3B7I A;  2OZG A;  1YRE A;  4COG A;  1XMT A;  2GFQ A;  3QAY A;  5AG7 A;  4UEE A;  3QNV A;  4ZX9 A;  2Q4V A;  2HV2 A;  3B8G A;  3F5B A;  3V8I A;  1M4L A;  2ZEG A;  4TNU A;  1VI4 A;  4R3L A;  5JGF A;  3HPH E;  2AFU A;  3WC5 A;  1IOF A;  1BPM A;  2PCU A;  1EZA A;  2YNC C;  4J0N A;  3KR5 A;  3LD2 A;  2C5Q A;  2Z3N A;  4PV6 A;  3LOD A;  3B3S A;  3P2H A;  1XIX A;  4MBU A;  1MK4 A;  3H4Q A;  3HLP A;  5EMI A;  5G22 A;  3W6X A;  3RYO A;  4OID A;  3I74 A;  5LRJ A;  2R7H A;  1NSA A;  1KUX A;  1YK3 A;  2QEC A;  4F0X A;  3IFE A;  4CS0 B;  4TWE A;  4B5P B;  4YFJ A;  4ZY1 A;  4KOV A;  2AUN A;  4M85 A;  3TO6 A;  3PB7 X;  1UWY A;  4KSF A;  2PJ8 A;  3RZA A;  2FE7 A;  1XMB A;  1PU9 A;  2F8H A;  1EO0 A;  2V8H A;  3VAT A;  2KCW A;  3RNZ A;  2YND A;  4B10 A;  5F1Y A;  4ZI6 A;  2PJC A;  3ZNI A;  4R76 A;  5C82 A;  1QQ9 A;  1DTD A;  5EBV A;  1IB1 E;  2ZPA A; 
#chains in the Genus database with same CATH homology
 4RUH A;  2ZOG A;  1IGB A;  4PXC A;  5LYI A;  2GU2 A;  4NGP A;  2PJA A;  1V6C A;  1JQG A;  4OC1 A;  5I4M A;  2V77 A;  4ZYQ A;  4UEE A;  3IEH A;  2PJ7 A;  2QJ8 A;  4PXE A;  3N5F A;  4P6Y A;  3DLJ A;  4UEZ A;  4TJV A;  2BOA A;  1CPX A;  4KNG E;  4NJQ A;  2O53 A;  4OIW A;  2EWB A;  1XF1 A;  5JM6 A;  3WT4 A;  3NA6 A;  2ANP A;  1LAN A;  5F09 A;  1LAP A;  5IR2 A;  2F7V A;  6CPA A;  2GP4 A;  2PJ3 A;  3RBU A;  3FEE A;  2PIY A;  3I1U A;  1AMP A;  4X8I A;  5HVH A;  4C8F A;  3ICU A;  1DE4 C;  3FED A;  1ARM A;  1OBR A;  4C9A A;  2PRQ A;  2OR4 A;  1XBU A;  3CPA A;  4UIB A;  2CTB A;  4X2T A;  2ZEH A;  3TX8 A;  4NGS A;  1HEE A;  2CIJ A;  1DTD A;  2O4H A;  5IB9 A;  1F57 A;  2G9D A;  3FX6 A;  3D7G A;  4FBE A;  4LQG A;  3GB0 A;  4DUK A;  1ZG8 A;  1QMU A;  2AFM A;  2ZOF A;  3K9T A;  4PQA A;  2C6P A;  2EK9 A;  3B3V A;  1TF9 A;  4MCP A;  2ZEN A;  4MXU A;  5JH9 A;  4OC3 A;  3VH9 A;  5DS0 A;  3D68 A;  7CPA A;  4R6T A;  3SI1 A;  5LYF A;  2PE3 A;  4YWY A;  4PXB A;  2BO9 A;  2C6C A;  2VL1 A;  2RFH A;  4NGR A;  4C9E A;  4OC4 A;  3B35 A;  1CG2 A;  1YSJ A;  4EME A;  2PVV A;  4MCS A;  1IY7 A;  2WYR A;  4A94 A;  1RTQ A;  4C8A A;  1PYT B;  4GM5 A;  1ARL A;  3KR4 A;  1EE3 P;  3ISX A;  1ELM P;  4P4I A;  5LYD A;  4C86 A;  3CDX A;  4JZ0 A;  3D7D A;  3T8W A;  4PPZ A;  2PJ9 A;  2JBK A;  4Q7A A;  2V8V A;  4MCR A;  3FJU A;  4NGT A;  3SJX A;  4X3R A;  2JEW A;  1YW4 A;  3D7H A;  3PRT A;  1ELL P;  2J9A A;  4CDK A;  4DYO A;  5D29 A;  3BHX A;  3S9M A;  5ELY A;  1TKJ A;  3IIB A;  4IAV A;  2ZEP A;  2PIZ A;  2PJB A;  4EFD A;  3FVL A;  3LMS A;  3H8G A;  3H8F A;  1FT7 A;  3KQX A;  4OC5 A;  1ZLH A;  4G1P A;  2I3C A;  3FH4 A;  3EIF A;  1H8L A;  1Z8L A;  2IMO A;  3MRU A;  4FWU A;  4F9U A;  4AXV A;  3WC7 A;  3MN8 A;  4C84 A;  1TF8 A;  4NGQ A;  2NSM A;  3NH4 A;  3PB4 X;  4ZX8 A;  1CP6 A;  8CPA A;  2ZEL A;  3FEC A;  3D4U A;  4A38 A;  1BAV A;  4ONW A;  4C8P A;  4NGM A;  5K8N A;  1XFO A;  4P4D A;  3BXM A;  2ZEM A;  3KL9 A;  3V7Z A;  2FVG A;  4Z65 A;  1YME A;  4OKO A;  1F2P A;  4P44 A;  2WZN A;  2Q43 A;  2CTC A;  3IO1 A;  2AFO A;  5CPA A;  3SJF A;  2ZEF A;  1VGY A;  2POK A;  3B2Y A;  2QVP A;  3BI0 A;  2NYQ A;  4R7M A;  1BPN A;  3S9L A;  4UIA A;  3JRU A;  3TC8 A;  3PFO A;  2AFS A;  3KAS A;  4K3N A;  1CP7 A;  1CBX A;  1LOK A;  1KWM A;  5CBM A;  4H2K A;  4ZY0 A;  2AFZ A;  2C1C A;  2PJ6 A;  1TKF A;  1XRY A;  4F8Z A;  3NFZ A;  2C6G A;  4A39 A;  5D8N A;  3IJ3 A;  3NH8 A;  2PJ4 A;  3SJG A;  4MHY A;  4OP4 A;  4IHM A;  1Y0R A;  4MRI A;  3PBB A;  4C9R A;  3SI2 A;  4ZY2 A;  3KHX A;  1Q7L A;  4P45 A;  4DJL A;  2PJ1 A;  1TXR A;  2XEJ A;  3DGV A;  2Q4Z A;  2GRE A;  2PVW A;  3GUX A;  3B3T A;  3IC1 A;  2BCO A;  5K8M A;  1VHE A;  3CT9 A;  4MHZ A;  1XJO A;  2ZEO A;  3SI0 A;  3VAR A;  1AYE A;  4UF4 A;  1YLO A;  1Y0Y A;  4UEF A;  3BI1 A;  3CPX A;  1PCA A;  2PJ2 A;  3V38 A;  4A37 A;  1VHO A;  1YW6 A;  2JBJ A;  2PJ5 A;  4CDJ A;  5HVG A;  5K8O A;  1TKH A;  1VIX A;  1ZLI A;  4P4J A;  3FMC A;  4MMO A;  1LFW A;  2ZEE A;  3HUV A;  3FF3 A;  4YU9 A;  3PEI A;  4CPA A;  3SJE A;  5LRG A;  4C8C A;  5LYL A;  4FUU A;  4O23 A;  2CF4 A;  3B3C A;  2GLJ A;  4EWT A;  4OC0 A;  3H8E A;  4WJB A;  3I6S A;  2V8G A;  5J1Q A;  3NH5 A;  5LRK A;  3GLJ A;  4C8T A;  3PBE A;  4YN3 A;  3RAM A;  2ZED A;  4C99 A;  2PJ0 A;  5K8P A;  3KQZ A;  4NJR A;  4TJX A;  3B3W A;  1Y9Z A;  3D67 A;  3KHZ A;  5HXD A;  4C9V A;  1Z2L A;  3LWU A;  3S9N A;  4PXD A;  4R8F A;  4P4B A;  4P10 A;  4MHN A;  4IK2 A;  1CX8 A;  1R43 A;  2V8D A;  2EK8 A;  2DEA A;  3D66 A;  4OME A;  5THW A;  1Z5R A;  1ZG9 A;  4P4F A;  1ZG7 A;  1HDQ A;  4OC2 A;  2OOT A;  3PB8 X;  4MHP A;  4JYW A;  2RB7 A;  1FNO A;  4C85 A;  1Y7E A;  1LCP A;  3KI9 A;  1HDU A;  3WC6 A;  4MCQ A;  4P4E A;  2HC9 A;  1GYT A;  3L2N A;  3KZW A;  2AFW A;  3K2K A;  1LAM A;  4FAI A;  2XEG A;  4WWV A;  2Q51 A;  2ABZ A;  4W9Y A;  3PB6 X;  2IJZ A;  4KSI A;  3PB9 X;  1CPS A;  2GLF A;  3PFE A;  1R3N A;  4NFR A;  4NGN A;  2HB6 A;  4BD9 A;  5HVF A;  4C9U A;  2QYV A;  3D7F A;  1BLL E;  2XEI A;  1F2O A;  1WVM A;  2AFX A;  3IWW A;  4C8U A;  3VTA A;  3KGQ A;  2XEF A;  4F9V A;  3ISZ A;  3B7I A;  4ZX9 A;  3QNV A;  1M4L A;  2ZEG A;  4TNU A;  5JGF A;  3WC5 A;  2AFU A;  1BPM A;  2PCU A;  3KR5 A;  2C5Q A;  3B3S A;  3WAB A;  3I74 A;  3HLP A;  4OID A;  5LRJ A;  1NSA A;  3IFE A;  4ZY1 A;  4TWE A;  3PB7 X;  1UWY A;  3RZA A;  2PJ8 A;  4B6Z A;  1XMB A;  2F8H A;  2V8H A;  3VAT A;  4ZI6 A;  2PJC A;  4R76 A;  1QQ9 A;  2IQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...