3HPGG

Visna virus integrase (residues 1-219) in complex with ledgf ibd: examples of open integrase dimer-dimer interfaces
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
73
Chain Sequence
MDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrase
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
total genus 16
structure length 73
sequence length 76
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3hpgG00
2B4JC 3NFQA 2N3AB 2XPNA 3HPHE 1EO0A 1WJTA 3U88C 3O8ZA 1Z9EA 3HPGG 2XPOA 3OAKA 2XPPA 3F9KC 2XPLA
chains in the Genus database with same CATH superfamily
2PVWA 4NGNA 3SJFA 4NGMA 3FECA 3NFQA 5D29A 2JBJA 2C6PA 5F09A 1WJTA 4P4JA 3FEDA 5BY0A 2XPPA 3VRPA 3D7DA 1Z8LA 2XPNA 2OOTA 3VGOA 4OC2A 4RR2B 2CIJA 3PLFB 3BHXA 2B4JC 3D7HA 4OC1A 3BXMA 4BPXB 4MCQA 1CX8A 3SJEA 4LQGA 1FBVA 2XEGA 3KASA 2JBKA 3IWWA 4P44A 3BI1A 3ZNIA 2XPLA 3VRNA 3HPHE 5AXIA 4NGTA 3FF3A 3OB2B 2UV8G 4MCSA 3SJGA 3RBUA 4MCPA 1EO0A 4P45A 4X3RA 3S9MA 2XPOA 3OP0A 3D7GA 2OR4A 2PVVA 3BI0A 2VKZG 5F13A 1YVHA 3VRRA 5J3XA 3SJXA 4BPUB 2C6GA 2CBLA 5HKWA 1Z9EA 4A4BA 4NGRA 4MCRA 3PT1A 2XEFA 1DE4C 5ELYA 4NGQA 4NGPA 2Y1NA 3FEEA 4BTFA 3VRQA 3BUNB 2Y1MA 2XEIA 3OAKA 4A4CA 4OC4A 4JYWA 4W9YA 5HKYA 3BUMB 5HKZA 3PFVA 3U88C 4P4FA 3BUOB 4NGSA 2C6CA 3BUXB 4OC0A 4P4IA 3HPGG 2DLAA 4OC3A 4OMEA 3O8ZA 3OB1B 4P4EA 3BUWB 3F9KC 4BPWB 4P4BA 3VROA 2N3AB 1B47A 3S9LA 3D7FA 2XEJA 4OC5A 4GPLB 4JZ0A 3S9NA 3HMJG 4P4DA
chains in the Genus database with same CATH topology
2B4JC 3NFQA 2N3AB 2XPNA 3HPHE 1EO0A 1WJTA 3U88C 3O8ZA 1Z9EA 3HPGG 2XPOA 3OAKA 2XPPA 3F9KC 2XPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4J C;  3NFQ A;  2N3A B;  2XPN A;  3HPH E;  1EO0 A;  1WJT A;  3U88 C;  3O8Z A;  1Z9E A;  3HPG G;  2XPO A;  3OAK A;  2XPP A;  3F9K C;  2XPL A; 
#chains in the Genus database with same CATH topology
 2PVW A;  4NGN A;  3SJF A;  4NGM A;  3FEC A;  3NFQ A;  5D29 A;  2JBJ A;  2C6P A;  5F09 A;  1WJT A;  4P4J A;  3FED A;  5BY0 A;  2XPP A;  3VRP A;  3D7D A;  1Z8L A;  2XPN A;  2OOT A;  3VGO A;  4OC2 A;  4RR2 B;  2CIJ A;  3PLF B;  3BHX A;  2B4J C;  3D7H A;  4OC1 A;  3BXM A;  4BPX B;  4MCQ A;  1CX8 A;  3SJE A;  4LQG A;  1FBV A;  2XEG A;  3KAS A;  2JBK A;  3IWW A;  4P44 A;  3BI1 A;  3ZNI A;  2XPL A;  3VRN A;  3HPH E;  5AXI A;  4NGT A;  3FF3 A;  3OB2 B;  2UV8 G;  4MCS A;  3SJG A;  3RBU A;  4MCP A;  1EO0 A;  4P45 A;  4X3R A;  3S9M A;  2XPO A;  3OP0 A;  3D7G A;  2OR4 A;  2PVV A;  3BI0 A;  2VKZ G;  5F13 A;  1YVH A;  3VRR A;  5J3X A;  3SJX A;  4BPU B;  2C6G A;  2CBL A;  5HKW A;  1Z9E A;  4A4B A;  4NGR A;  4MCR A;  3PT1 A;  2XEF A;  1DE4 C;  5ELY A;  4NGQ A;  4NGP A;  2Y1N A;  3FEE A;  4BTF A;  3VRQ A;  3BUN B;  2Y1M A;  2XEI A;  3OAK A;  4A4C A;  4OC4 A;  4JYW A;  4W9Y A;  5HKY A;  3BUM B;  5HKZ A;  3PFV A;  3U88 C;  4P4F A;  3BUO B;  4NGS A;  2C6C A;  3BUX B;  4OC0 A;  4P4I A;  3HPG G;  2DLA A;  4OC3 A;  4OME A;  3O8Z A;  3OB1 B;  4P4E A;  3BUW B;  3F9K C;  4BPW B;  4P4B A;  3VRO A;  2N3A B;  1B47 A;  3S9L A;  3D7F A;  2XEJ A;  4OC5 A;  4GPL B;  4JZ0 A;  3S9N A;  3HMJ G;  4P4D A; 
#chains in the Genus database with same CATH homology
 2B4J C;  3NFQ A;  2N3A B;  2XPN A;  3HPH E;  1EO0 A;  1WJT A;  3U88 C;  3O8Z A;  1Z9E A;  3HPG G;  2XPO A;  3OAK A;  2XPP A;  3F9K C;  2XPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...