3HPGG

Visna virus integrase (residues 1-219) in complex with ledgf ibd: examples of open integrase dimer-dimer interfaces
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
73
Chain Sequence
b'MDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrase
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
total genus 16
structure length 73
sequence length 76
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3hpgG00
3O8ZA 2XPLA 1EO0A 3HPGG 1WJTA 2XPOA 1Z9EA 2B4JC 2N3AB 2XPNA 3F9KC 3HPHE 3U88C 3OAKA 2XPPA 3NFQA
chains in the Genus database with same CATH superfamily
3BI0A 3RBUA 2XPLA 2UV8G 2OR4A 4P4IA 2XPOA 4MCSA 3VRQA 4NGTA 3U88C 4P4DA 4OC4A 4W9YA 4LQGA 2XPPA 2CBLA 2DLAA 2JBJA 4MCQA 2B4JC 3OAKA 2PVVA 3O8ZA 1EO0A 3FF3A 4P4EA 2JBKA 3S9MA 4MCPA 3KASA 3BI1A 3NFQA 4BPWB 5AXIA 4OC0A 2N3AB 2XPNA 4GPLB 3IWWA 4JZ0A 4JYWA 3VGOA 1DE4C 3FEDA 4NGRA 3FECA 2CIJA 4NGQA 3S9LA 4P4JA 5D29A 4P4FA 4MCRA 3VRPA 2VKZG 3HMJG 4RR2B 2Y1MA 2OOTA 4P45A 3D7DA 2C6PA 1B47A 3D7HA 3BUWB 4P4BA 1WJTA 1YVHA 4A4BA 5BY0A 3VROA 4BPUB 3BUMB 5HKYA 4OC2A 5HKZA 3HPHE 3BHXA 1CX8A 2C6CA 2XEGA 3F9KC 5F13A 3PFVA 3FEEA 5J3XA 3BUOB 4NGNA 2XEJA 1Z9EA 3BUNB 2C6GA 2XEIA 3SJGA 4OC3A 3D7GA 3S9NA 3OB1B 4BPXB 3D7FA 4NGSA 2PVWA 4NGPA 5F09A 3SJXA 4NGMA 4OC5A 4OMEA 4BTFA 3SJEA 4OC1A 4A4CA 4P44A 1Z8LA 5HKWA 3BUXB 3ZNIA 3BXMA 3VRRA 4X3RA 3SJFA 3OP0A 5ELYA 3HPGG 2XEFA 3VRNA 3PT1A 2Y1NA 3OB2B 1FBVA 3PLFB
chains in the Genus database with same CATH topology
3O8ZA 2XPLA 1EO0A 3HPGG 1WJTA 2XPOA 1Z9EA 2B4JC 2N3AB 2XPNA 3F9KC 3HPHE 3U88C 3OAKA 2XPPA 3NFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O8Z A;  2XPL A;  1EO0 A;  3HPG G;  1WJT A;  2XPO A;  1Z9E A;  2B4J C;  2N3A B;  2XPN A;  3F9K C;  3HPH E;  3U88 C;  3OAK A;  2XPP A;  3NFQ A; 
#chains in the Genus database with same CATH topology
 3BI0 A;  3RBU A;  2XPL A;  2UV8 G;  2OR4 A;  4P4I A;  2XPO A;  4MCS A;  3VRQ A;  4NGT A;  3U88 C;  4P4D A;  4OC4 A;  4W9Y A;  4LQG A;  2XPP A;  2CBL A;  2DLA A;  2JBJ A;  4MCQ A;  2B4J C;  3OAK A;  2PVV A;  3O8Z A;  1EO0 A;  3FF3 A;  4P4E A;  2JBK A;  3S9M A;  4MCP A;  3KAS A;  3BI1 A;  3NFQ A;  4BPW B;  5AXI A;  4OC0 A;  2N3A B;  2XPN A;  4GPL B;  3IWW A;  4JZ0 A;  4JYW A;  3VGO A;  1DE4 C;  3FED A;  4NGR A;  3FEC A;  2CIJ A;  4NGQ A;  3S9L A;  4P4J A;  5D29 A;  4P4F A;  4MCR A;  3VRP A;  2VKZ G;  3HMJ G;  4RR2 B;  2Y1M A;  2OOT A;  4P45 A;  3D7D A;  2C6P A;  1B47 A;  3D7H A;  3BUW B;  4P4B A;  1WJT A;  1YVH A;  4A4B A;  5BY0 A;  3VRO A;  4BPU B;  3BUM B;  5HKY A;  4OC2 A;  5HKZ A;  3HPH E;  3BHX A;  1CX8 A;  2C6C A;  2XEG A;  3F9K C;  5F13 A;  3PFV A;  3FEE A;  5J3X A;  3BUO B;  4NGN A;  2XEJ A;  1Z9E A;  3BUN B;  2C6G A;  2XEI A;  3SJG A;  4OC3 A;  3D7G A;  3S9N A;  3OB1 B;  4BPX B;  3D7F A;  4NGS A;  2PVW A;  4NGP A;  5F09 A;  3SJX A;  4NGM A;  4OC5 A;  4OME A;  4BTF A;  3SJE A;  4OC1 A;  4A4C A;  4P44 A;  1Z8L A;  5HKW A;  3BUX B;  3ZNI A;  3BXM A;  3VRR A;  4X3R A;  3SJF A;  3OP0 A;  5ELY A;  3HPG G;  2XEF A;  3VRN A;  3PT1 A;  2Y1N A;  3OB2 B;  1FBV A;  3PLF B; 
#chains in the Genus database with same CATH homology
 3O8Z A;  2XPL A;  1EO0 A;  3HPG G;  1WJT A;  2XPO A;  1Z9E A;  2B4J C;  2N3A B;  2XPN A;  3F9K C;  3HPH E;  3U88 C;  3OAK A;  2XPP A;  3NFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...