4P4BA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor ctt54
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
total genus 262
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4bA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4bA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4bA02
2ZEMA 3BI0A 3VH9A 2Q51A 1ZLIA 3D4UA 4G1PA 3T8WA 5HVGA 3KHXA 3KQXA 3PEIA 1F2OA 1XBUA 4R7MA 1WVMA 4WJBA 1CPSA 2ANPA 2Q4ZA 3KGQA 4MHYA 4NGSA 6CPAA 2FVGA 2V8HA 2CIJA 3GB0A 3PBBA 3KZWA 4R76A 2XEIA 1ZG9A 2F8HA 3IO1A 8CPAA 2O4HA 1XRYA 4CDKA 2GLJA 3EIFA 4GM5A 3SI2A 4P4JA 4B6ZA 3K9TA 4X3RA 4OKOA 2ZEGA 4TJXA 4C9RA 2J9AA 4OIWA 3KASA 4P45A 2PJ7A 4OC3A 4A94A 2F7VA 3GUXA 3B3SA 1R43A 3KI9A 5LRGA 2CTCA 4C9EA 3IEHA 3B35A 4OP4A 1CPXA 4EWTA 1ARLA 3SJXA 5J1QA 3I1UA 4P4BA 2AFXA 4C9VA 5HXDA 3IJ3A 3NFZA 5LYFA 4IHMA 2PJBA 4LQGA 4PXEA 1V6CA 2XEFA 2ZEDA 1YW4A 4NGNA 2QYVA 3WC6A 2DEAA 2IJZA 2EK9A 4PPZA 5HVFA 1ZG8A 1HDQA 4YU9A 3KQZA 4O23A 2PJ3A 4OC5A 3N5FA 3BXMA 1LCPA 4RUHA 4NFRA 3CDXA 3PB9X 3VATA 2BCOA 3D7GA 3PB6X 2C6GA 3RZAA 4X2TA 5D29A 3KR5A 2AFOA 2ZENA 3IIBA 3PRTA 3B3TA 2PJCA 4C8FA 3ICUA 2PJ5A 2PJ8A 3FECA 1LANA 3GLJA 3TX8A 3IC1A 3K2KA 4ZI6A 3FVLA 3WC7A 1Y0YA 2AFWA 3SJEA 1XF1A 4UEFA 4C8PA 1VHEA 2ABZA 4P4DA 3BHXA 4ZY2A 4OC0A 1GYTA 1OBRA 2BOAA 3PFOA 4KSIA 1H8LA 4TNUA 2PJ1A 4CDJA 3KHZA 3H8GA 3SI1A 3D68A 4C8AA 2JBKA 4ZX9A 3L2NA 1HDUA 3S9LA 2POKA 2O53A 2PIZA 4KNGE 1CX8A 4DJLA 5I4MA 1LOKA 4UF4A 1QMUA 1FT7A 2NSMA 3D7FA 2PJ4A 2RFHA 4MMOA 3WABA 5CBMA 3D66A 4A39A 1LAPA 1XMBA 4ZYQA 3H8EA 3FH4A 3RAMA 5CPAA 2QJ8A 4MHPA 3IFEA 4C8CA 4IAVA 1PCAA 4MRIA 3DLJA 2PJAA 1RTQA 4C86A 2EK8A 3D7HA 5F09A 3JRUA 2NYQA 3NH4A 2PJ2A 3ISXA 1Y0RA 1HEEA 3D67A 4UEEA 4W9YA 2C6PA 4Z65A 2ZOGA 4AXVA 3PFEA 2ZELA 1ZG7A 5IB9A 4IK2A 5K8NA 3LMSA 4DUKA 1NSAA 1TKHA 5LRJA 4CPAA 2GLFA 2PJ6A 4NGQA 5K8PA 4FBEA 2V8DA 3B2YA 4P10A 4TWEA 1UWYA 5LYLA 1ZLHA 3CPXA 1IGBA 3HUVA 4OIDA 5DS0A 5JM6A 4P4IA 4ZX8A 4MCRA 4YWYA 4TJVA 3H8FA 4C99A 3KR4A 1PYTB 4NGTA 1AMPA 1KWMA 3I6SA 2JEWA 2PJ0A 3NH8A 2AFSA 1FNOA 4F8ZA 3VTAA 2HC9A 2ZEFA 1DE4C 3FJUA 2JBJA 2ZEEA 3SJFA 1LAMA 1QQ9A 1AYEA 2V8VA 2PVWA 2OR4A 2V77A 2PIYA 2WYRA 4X8IA 1EE3P 3V38A 2XEJA 1CP7A 1XFOA 4C9UA 1LFWA 1CBXA 2I3CA 3TC8A 3FMCA 4YN3A 4A37A 3B3WA 4PXDA 4OMEA 4P6YA 5LYIA 4JZ0A 1F57A 3PB8X 4MXUA 1TXRA 2PJ9A 1Z8LA 4NGMA 1Y9ZA 3QNVA 4EFDA 1BPMA 3PB7X 3MRUA 3B3VA 2IQ6A 5D8NA 2ZEOA 1DTDA 3FX6A 1BPNA 1YMEA 3B7IA 3BI1A 1VHOA 4F9VA 2V8GA 5ELYA 3FEDA 3SI0A 3S9MA 3B3CA 1CP6A 1F2PA 2PCUA 2ZOFA 3FEEA 3LWUA 4K3NA 1VGYA 4C85A 4EMEA 5JH9A 2CTBA 2ZEPA 2C6CA 3CPAA 4WWVA 3PB4X 2OOTA 7CPAA 4H2KA 3S9NA 3SJGA 2QVPA 3HLPA 4UIAA 2EWBA 1Q7LA 4ONWA 3IWWA 1XJOA 1BLLE 5HVHA 1TF8A 4MCQA 2AFZA 3MN8A 1Z5RA 4C8TA 4NGRA 2AFMA 5JGFA 3PBEA 4UEZA 2VL1A 3FF3A 4C9AA 4OC2A 5THWA 5K8MA 1JQGA 4PXBA 5LRKA 4DYOA 4MCPA 4A38A 4BD9A 1VIXA 4MHZA 4Q7AA 1ELMP 1YW6A 2HB6A 2PVVA 4P4FA 1Y7EA 3I74A 3ISZA 5K8OA 1TKFA 1M4LA 2GU2A 4P4EA 4UIBA 3NH5A 2PRQA 4NJRA 3CT9A 1YSJA 3WT4A 4ZY0A 2Q43A 4ZY1A 3KL9A 3DGVA 4F9UA 1YLOA 1R3NA 4MCSA 2C1CA 1ARMA 1TKJA 4C8UA 1TF9A 4NJQA 3D7DA 3WC5A 2XEGA 4PXCA 1ELLP 5LYDA 4P44A 2IMOA 2GREA 4R6TA 4C84A 4PQAA 2BO9A 1BAVA 1IY7A 4FAIA 2CF4A 4MHNA 4NGPA 1Z2LA 2AFUA 3RBUA 2G9DA 3VARA 2ZEHA 3NA6A 3V7ZA 4FWUA 4JYWA 4OC4A 1CG2A 4R8FA 2RB7A 4FUUA 2PE3A 4OC1A 2WZNA
chains in the Genus database with same CATH superfamily
5JYBA 2AE6A 2ZEMA 3BI0A 3VH9A 1AUGA 3TTHA 1GGOA 1S7NA 4R3KA 2PSWA 2Q51A 1ZLIA 2N3AB 3D4UA 1PUAA 2Q7BA 4G1PA 3T8WA 2VKZG 3JTKA 3BJ8A 3KHXA 5HVGA 4CO9A 3VRQA 3KQXA 3IU2A 3EZBA 5HH1A 3GY9A 4BTFA 1F2OA 3PEIA 1XBUA 3DNSA 4C2YA 2EZBA 4R7MA 4CRZB 4Y49B 4KLVA 5AG6A 5A28A 1IB1E 3IGRA 1WVMA 4WJBA 1CPSA 2FXFA 1YREA 4CAVA 3N7ZA 2CNTA 2ANPA 2D4OA 1BO4A 2D4PA 2Q4ZA 3BJ7A 3H5ZA 3KGQA 5BWAB 5KTCA 4MHYA 4CAEA 5JVLA 2Y1NA 2I79A 1NBWA 3QAHA 2WSAA 5HKYA 4NGSA 1S5KA 1XIXA 2FIAA 3FBUA 3PGPA 4RN7A 4AVBA 4E8OA 6CPAA 2WPXA 2FVGA 2V8HA 4KSFA 4KOXA 3PT1A 4E2AA 4PV6A 2CIJA 5JQ4A 4KUAA 2D0PA 3GB0A 4B12A 3PBBA 3HPHE 4GPLB 3KZWA 4HNYB 4R76A 5I0CA 1CE8B 2XEIA 4ONUA 1X12A 4Y49C 2HWGA 1S3ZA 4Q38A 1ZG9A 4PK2A 1Q2DA 1Q2YA 2F8HA 3IO1A 3CXPA 4XPKA 4AG9A 1VBHA 1CM0A 4KZTA 2Q04A 8CPAA 2O4HA 1KC7A 1XRYA 2AUMA 4BBHA 4KOSA 3KKWA 4MJXA 2GLJA 3LODA 3EIFA 3TLZA 4CDKA 4GM5A 4X5KA 4M6IA 3SI2A 4P4JA 2VQYA 3K9TA 4UBRA 4X3RA 4B6ZA 4MFLA 4OKOA 2ZEGA 2HQYA 4NSQA 4FD6A 2YNEA 4TJXA 4KORA 4C9RA 4L89A 2J9AA 1FY7A 4OIWA 3KASA 4P45A 3HMJG 2PJ7A 4H89A 4UWJA 5F5XA 4OC3A 1RXTA 5IX3A 3LACA 1L0CA 1Z4EA 3BUNB 5GCNA 2BSWA 3FB3A 4A94A 2F7VA 3GUXA 3B3SA 3IWEA 1M4IA 5KTAA 1R43A 1MK4A 3KI9A 5LRGA 3CXQA 1I1DA 2CTCA 3IWGA 5EMIA 4C9EA 4MBUA 4FAIA 3IEHA 3B35A 4NF1A 1CPXA 4OP4A 4EWTA 1ARLA 4RR2B 3SJXA 5G1ZA 5J1QA 3I1UA 1YGHA 2R82A 2WUUA 4P4BA 2AFXA 1C3OB 4C9VA 1V0CA 5HXDA 4ORFA 4UFXA 3IJ3A 2G3AA 3NFZA 3WR7A 4IHMA 5LYFA 2PJBA 3TLYA 4LQGA 4PXEA 3QB8A 4CS0B 1WJTA 5HKZA 1IIDA 2XPPA 3I9SA 3P2HA 1Z4RA 2Q4YA 3SXOA 1V6CA 2XEFA 1M1DA 2ZEDA 2R1IA 2Z11A 4B5PB 3VRRA 2EBJA 2FE7A 4CGMA 1YW4A 4NGNA 3BUXB 2QECA 2REEA 4MFPA 1BOBA 4MI4A 4U5YA 2QYVA 4NXYA 4NCZA 5KTDA 1Z8XA 4MY0A 1Z9UA 3WC6A 2DEAA 2IJZA 2EK9A 2J8NA 2CNSA 2D0OA 1QSMA 4PPZA 5HVFA 1ZG8A 4FD7A 1HDQA 4J3GA 2Z10A 1QSNA 3QAYA 4QVTA 1VHSA 4YU9A 3KQZA 2Z3KA 4O23A 2PJ3A 3VRNA 4A4BA 4OC5A 3EC4A 3F5BA 3N5FA 3VGOA 3BXMA 1LCPA 1TIQA 4RUHA 4NFRA 2WPWA 3CDXA 3PB9X 3VATA 3H4QA 4IUSA 4H6ZA 2BCOA 1FBVA 4FD5A 3D7GA 3BLNA 3PB6X 2C6GA 1Y9KA 4YRHA 4F0XA 4B10A 3RZAA 4X2TA 5D29A 2KCWA 3KR5A 1OZPA 4GXHA 2AFOA 2ZENA 3IIBA 3PRTA 3B3TA 2B5GA 3RNZA 3FXTA 3K4IA 2PJCA 2RC4A 4C8FA 1I12A 4KLWA 4CGPA 3ICUA 4CGLA 2OU2A 1U6MA 2PJ5A 2PJ8A 5F49A 4E0AA 1Z8TA 2G0BA 3FECA 1LANA 2B4BA 2VZYA 3GLJA 3TX8A 4PK3A 1CJWA 3TLAA 1M44A 3IC1A 2YNCC 1A2ZA 3JVNA 3K2KA 3FVLA 4C2ZA 4ZI6A 5F46A 3WC7A 1J4JA 1NSLA 1Y0YA 2AFWA 1XE4A 3RYOA 2R98A 4E94A 2PQ8A 4B14A 4CGOA 3SJEA 5DWNA 2OH1A 3S6HA 1XF1A 4UEFA 4C8PA 3C8OA 1VHEA 2ABZA 1KUYA 4AVCA 2I00A 3DR8A 4P4DA 3BHXA 4ZY2A 4OC0A 1GYTA 1OBRA 3BUOB 2BOAA 2DXQA 2Z0ZA 3PFOA 1H8LA 2Z3NA 4KSIA 4TNUA 1IICA 3TO6A 1KBLA 4HPSA 2PJ1A 5E96A 1VI4A 4CDJA 3KHZA 3H8GA 3SI1A 3D68A 4C8AA 4KVXA 4CAXA 2JBKA 4ZX9A 4ZGYB 3L2NA 1HDUA 2B4JC 3S9LA 1IOIA 3TLGB 2POKA 3DSBA 2E28A 2O53A 2PIZA 3FRMA 4KOWA 4KSAA 4KNGE 4LX9A 1CX8A 4KVME 4DJLA 5I4MA 4R3LA 1LOKA 4UF4A 1QMUA 2R7HA 1FT7A 3FYNA 1R61A 5FD8A 2NSMA 3R1KA 4MFQA 3D7FA 3S6GA 2DLAA 2BL1A 3OB1B 2PJ4A 3PLFB 2RFHA 3F8KA 1ON0A 4MMOA 4UFWA 4YGOA 3WABA 1A9XB 2J8RA 1JDBC 3D66A 1IYKA 4B11A 2F5IA 1DIKA 2P6GA 1RO5A 4M3SA 2P6EA 2Z3OA 4A39A 2CNMA 2HI6A 1MJBA 1K4JA 5IV0A 4R9MA 1M6VB 2B3VA 1S7KA 3W6XA 1LAPA 1XMBA 4ZYQA 1EZBA 3H8EA 3GKRA 4JD6A 4CAFA 1ZYMA 4HNXB 3FH4A 4A32A 2VBQA 4J0NA 3RAMA 1YQEA 2PRBA 4XPDB 5CPAA 2QJ8A 2ZPAA 4MHPA 2JDDA 4BPWB 1ZL0A 4IIXA 1M4GA 2Q0YA 3IFEA 4C8CA 4CRYB 4A2ZA 1XOVA 1YVKA 4IAVA 1PCAA 4MRIA 3DLJA 2PJAA 1IOFA 4MI1A 2C5QA 1YR0A 3EO4A 2PR1A 1EO0A 1RTQA 2DIKA 4C86A 2EK8A 3D7HA 2HV2A 3PZJA 5F47A 4LUAA 5F09A 1MJAA 3BUWB 2BEIA 3JRUA 2NYQA 3NH4A 4NEXA 4XPDC 2PJ2A 3ISXA 4H6UA 2VEZA 3TYXA 4EYSA 1Y0RA 1HEEA 3D67A 4UEEA 4W9YA 2QMLA 4I49A 2C6PA 2Q4VA 4DNCA 4F0YA 4Z65A 2ZOGA 4A4CA 5C82A 1M4DA 2GIVA 4AXVA 3PFEA 2ZELA 1ZG7A 5IB9A 4IK2A 5J8FA 3OAKA 5K8NA 2EZAA 1PU9A 3LMSA 4COGA 3DDDA 4DUKA 1Q5XA 1NSAA 2OB0A 4M8DA 1GHEA 1TKHA 2H5MA 2Z3MA 3UY5A 5LRJA 4KS9A 4CPAA 3I74A 2GLFA 1QSOA 1Z8WA 2PJ6A 3TOAA 3TO7A 5F13A 3T5MA 4A33A 1Z9EA 4NGQA 5K8PA 4FBEA 2V8DA 3B2YA 5AG7A 3OWCA 4JXQA 4U9YA 4P10A 2Q7SA 4XPLA 4II9A 4TWEA 3T0TA 1UWYA 4C7HA 5LYLA 1ZLHA 3CPXA 1IGBA 3HUVA 4OIDA 5G22A 3V8IA 4C7IA 5DS0A 5JM6A 4P4IA 4ZX8A 4MCRA 4YWYA 5AG4A 4TJVA 2DPSA 2IL4A 3H8FA 5J8CA 3KR4A 4C99A 1PYTB 3NFQA 2NMTA 5EC4A 1YLEA 4NGTA 1AMPA 1KWMA 2B5GB 2JEWA 4CYQA 2PJ0A 3NH8A 3I6SA 4UCPA 2AFSA 2YJTA 1FNOA 1NE9A 5F9MA 4UCMA 4F8ZA 4CAWA 1MJ9A 2HC9A 3OP0A 2ZEFA 1DE4C 2GE3A 1B47A 4YFJA 4JXRA 2VZZA 2JBJA 3FJUA 1ZO0A 2ZEEA 4MFKA 4MHDA 3S6FA 3SJFA 1LAMA 1QQ9A 3DR6A 4BMHA 4MJ8A 5LRKA 4L8AA 1AYEA 2V8VA 4MY3A 3KRVA 4UFVA 2PVWA 2PDOA 1WK4A 4OAEA 2OR4A 2V77A 2PIYA 1Y9WA 2WYRA 2OZHA 4HNWB 4JJXA 2YNDA 3CZXA 4U9ZA 2VXKA 1JDEA 2FL4A 3T90A 3ZNIA 1KUXA 4X8IA 4CZ1A 1EE3P 1B87A 2XEJA 3V38A 1T36B 1CP7A 4JWPA 2Y0MA 3JUWA 1XFOA 2QIRA 1LFWA 1WWZA 3GIUA 1CBXA 4C9UA 2J8MA 2I3CA 4R57A 3TC8A 3FNCA 3FMCA 4YN3A 2FIWA 2AJ6A 4KOYA 4QUSA 4A37A 2B58A 3B3WA 4PXDA 3TFYA 3HPGG 4OMEA 1Q2CA 4P6YA 5LYIA 4A30A 3A9LA 3TE4A 2FM4A 4JZ0A 1B6BA 4M6GA 1F57A 3PB8X 3TLGA 4MXUA 1TXRA 2PJ9A 5C88A 2FCKA 2AUNA 1Z8LA 3TLCA 3OB2B 4MFZA 2X0SA 1YVOA 3D2MA 5K99A 3I3GA 2PC1A 4NGMA 3F0AA 3R95A 1NXJA 1Y9ZA 3QNVA 3F9KC 4EFDA 3C26A 3S6KA 2YJVA 2GFQA 1XF8A 1BPMA 3PB7X 4C2XA 3R9GA 3TO9A 3MRUA 3B3VA 2IQ6A 5D8NA 3ZJ0A 1X10A 2CBLA 4BPXB 2Z3LA 2ZEOA 3EXNA 1DTDA 5EBVA 5CBMA 3E0KA 2ZW5A 2CXAA 2ZW7A 4CGNA 3G8WA 3FX6A 1BPNA 2FT0A 3TCVA 1YMEA 5IR2A 3T05A 3SHPA 5JPHA 3VWDA 4KOVA 3B7IA 1S60A 3BI1A 1C30B 2MP0A 4MFJA 3TT2A 1VHOA 4F9VA 5ELYA 3FEDA 2V8GA 3SI0A 3S9MA 3B3CA 1CP6A 4COBA 1F2PA 2C27A 2PCUA 3FEEA 2ZOFA 3LWUA 1VGYA 4K3NA 2XPLA 5AG5A 3R9FA 4EMEA 5CNPA 5IB0A 3EZEA 2EUIA 1J3LA 3EFAA 3G3SA 2Y1MA 3MGDA 5FVJA 2X7BA 4K30A 5AGEA 5JH9A 2CTBA 2ZEPA 1IU8A 2C6CA 3CPAA 3IU1A 3VRPA 3PB4X 2OOTA 1UFHA 3D2PA 4WWVA 7CPAA 4JLYA 4H2KA 4PSXA 3U1BA 4QBJA 2OZUA 3S9NA 3SJGA 4HKFA 4KOTA 2QVPA 1VBGA 3HLPA 4UIAA 3FIXA 2REFA 4EVYA 2EWBA 1Q7LA 3VTAA 4ONWA 2HUZA 3IWWA 1QSTA 1XJOA 1BLLE 1Y7RA 3GYAA 2O28A 1S7FA 1ZRSA 2OLSA 3U88C 4XNHB 5HVHA 1KUVA 1TF8A 4C68A 4M85A 5ISVA 4Q36A 3D3SA 3D8PA 4OLLA 2B3UA 1XEBA 2EZCA 4MCQA 3VROA 2AFZA 3PFVA 2GP4A 4UA3A 3MN8A 1Z5RA 1R57A 4C8TA 4NGRA 3LD2A 4LQ6A 2AFMA 5JGFA 3PBEA 1KZFA 3CXSA 4C85A 4CYOA 4E5SA 4UEZA 2VL1A 3FF3A 4RI1A 4C9AA 4OC2A 5THWA 5K8MA 1JWQA 2JDCA 1JQGA 5F48A 4B13A 2DPTA 2EO8A 3RO0A 1BXRB 2PR8A 4XNHC 4BINA 2ODFA 2ZXVA 1P4NA 4MCPA 4PXBA 5H86A 5DWMA 3ZZIA 2XPOA 2UV8G 4A38A 4DYOA 1XMTA 4ZBGA 4A31A 3BUMB 4BD9A 1VIXA 4BPUB 2BUEA 3R96A 2G3TA 4MHZA 1ELMP 4Q7AA 3G23A 5AXIA 2ATRA 2Q44A 3SR3A 1EZAA 1YW6A 1YVHA 2HB6A 2PVVA 4P4FA 1Y7EA 3PP9A 2B4DB 4F6AA 1CS0B 5HKWA 4R87A 4UCNA 3ISZA 5K8OA 1TKFA 4AG7A 1M4LA 3W91A 2GU2A 4AB7A 4P4EA 5H84A 2XPNA 2P6FA 4UIBA 3B8GA 3EZAA 2DF5A 2B4DA 3NH5A 3P2FA 2CY2A 3GJZA 2PRQA 4NJRA 3O8ZA 3CT9A 1YSJA 3WT4A 4ZY0A 2Q43A 4ZY1A 3KL9A 3T07A 3DGVA 5G20A 4OADA 1YLOA 4CYPA 4F9UA 1R3NA 2ARHA 2OZGA 1S7LA 4H1HA 1LRZA 1YX0A 4B5PA 4MCSA 4UWIA 4GS4A 1I21A 2C1CA 1N71A 1ARMA 1TKJA 2FSRA 4A95A 2PCNA 4JVOA 4CYNA 4C8UA 5BY0A 1TF9A 2Z3PA 4KUBA 4NJQA 5F1YA 2VI7A 3D7DA 4AVAA 3TLBA 3WC5A 2XEGA 1QSRA 1ELLP 2EVNA 4PXCA 5A27A 2ZW6A 3NOJA 1IYLA 4QC6A 5LYDA 4P44A 2IMOA 4FD4A 2GREA 4PSWA 4R6TA 3TOBA 2HROA 4IIYA 4M6HA 2R8VA 3NE7A 4C84A 5G21A 3R9EA 3SXNA 4PQAA 2BO9A 2P0WA 1VKCA 1BAVA 3K9UA 4B5OA 1IY7A 3W6SA 1NMTA 2CF4A 2GANA 2YGWA 4MHNA 2K5TA 2A4NA 4RS2A 5HMNA 4NGPA 3EY5A 4KVOE 4QB9A 3TLEA 1Z2LA 5J3XA 1P0HA 2AFUA 3RBUA 2YNCA 2G9DA 3VARA 2JLMA 2ZEHA 1YK3A 2JEVA 3NA6A 2ZW4A 3V7ZA 4KOUA 1KEEB 4FWUA 2B0AA 4JYWA 4OC4A 1CG2A 4IF5A 4R8FA 3T9YA 3NE8A 2RB7A 4FUUA 4INJA 1SQHA 2PE3A 4OC1A 3VWEA 2WZNA 2FS5A
chains in the Genus database with same CATH topology
2ZEMA 3BI0A 3VH9A 2Q51A 1ZLIA 3D4UA 4G1PA 3T8WA 5HVGA 3KHXA 3KQXA 3PEIA 1F2OA 1XBUA 4R7MA 1WVMA 4WJBA 1CPSA 2ANPA 2Q4ZA 3KGQA 4MHYA 4NGSA 6CPAA 2FVGA 2V8HA 2CIJA 3GB0A 3PBBA 3KZWA 4R76A 2XEIA 1ZG9A 2F8HA 3IO1A 8CPAA 2O4HA 1XRYA 4CDKA 2GLJA 3EIFA 4GM5A 3SI2A 4P4JA 4B6ZA 3K9TA 4X3RA 4OKOA 2ZEGA 4TJXA 4C9RA 2J9AA 4OIWA 3KASA 4P45A 2PJ7A 4OC3A 4A94A 2F7VA 3GUXA 3B3SA 1R43A 3KI9A 5LRGA 2CTCA 4C9EA 3IEHA 3B35A 4OP4A 1CPXA 4EWTA 1ARLA 3SJXA 5J1QA 3I1UA 4P4BA 2AFXA 4C9VA 5HXDA 3IJ3A 3NFZA 5LYFA 4IHMA 2PJBA 4LQGA 4PXEA 1V6CA 2XEFA 2ZEDA 1YW4A 4NGNA 2QYVA 3WC6A 2DEAA 2IJZA 2EK9A 4PPZA 5HVFA 1ZG8A 1HDQA 4YU9A 3KQZA 4O23A 2PJ3A 4OC5A 3N5FA 3BXMA 1LCPA 4RUHA 4NFRA 3CDXA 3PB9X 3VATA 2BCOA 3D7GA 3PB6X 2C6GA 3RZAA 4X2TA 5D29A 3KR5A 2AFOA 2ZENA 3IIBA 3PRTA 3B3TA 2PJCA 4C8FA 3ICUA 2PJ5A 2PJ8A 3FECA 1LANA 3GLJA 3TX8A 3IC1A 3K2KA 4ZI6A 3FVLA 3WC7A 1Y0YA 2AFWA 3SJEA 1XF1A 4UEFA 4C8PA 1VHEA 2ABZA 4P4DA 3BHXA 4ZY2A 4OC0A 1GYTA 1OBRA 2BOAA 3PFOA 4KSIA 1H8LA 4TNUA 2PJ1A 4CDJA 3KHZA 3H8GA 3SI1A 3D68A 4C8AA 2JBKA 4ZX9A 3L2NA 1HDUA 3S9LA 2POKA 2O53A 2PIZA 4KNGE 1CX8A 4DJLA 5I4MA 1LOKA 4UF4A 1QMUA 1FT7A 2NSMA 3D7FA 2PJ4A 2RFHA 4MMOA 3WABA 5CBMA 3D66A 4A39A 1LAPA 1XMBA 4ZYQA 3H8EA 3FH4A 3RAMA 5CPAA 2QJ8A 4MHPA 3IFEA 4C8CA 4IAVA 1PCAA 4MRIA 3DLJA 2PJAA 2C5QA 1RTQA 4C86A 2EK8A 3D7HA 5F09A 3JRUA 2NYQA 3NH4A 2PJ2A 3ISXA 1Y0RA 1HEEA 3D67A 4UEEA 4W9YA 2C6PA 4Z65A 2ZOGA 4AXVA 3PFEA 2ZELA 1ZG7A 5IB9A 4IK2A 5K8NA 3LMSA 4DUKA 1NSAA 1TKHA 5LRJA 4CPAA 2GLFA 2PJ6A 4NGQA 5K8PA 4FBEA 2V8DA 3B2YA 4P10A 4TWEA 1UWYA 5LYLA 1ZLHA 3CPXA 1IGBA 3HUVA 4OIDA 5DS0A 5JM6A 4P4IA 4ZX8A 4MCRA 4YWYA 4TJVA 3H8FA 4C99A 3KR4A 1PYTB 4NGTA 1AMPA 1KWMA 3I6SA 2JEWA 2PJ0A 3NH8A 2AFSA 1FNOA 4F8ZA 3VTAA 2HC9A 2ZEFA 1DE4C 3FJUA 2JBJA 2ZEEA 3SJFA 1LAMA 1QQ9A 1AYEA 2V8VA 2PVWA 2OR4A 2V77A 2PIYA 2WYRA 4X8IA 1EE3P 3V38A 2XEJA 1CP7A 1XFOA 4C9UA 1LFWA 1CBXA 2I3CA 3TC8A 3FMCA 4YN3A 4A37A 3B3WA 4PXDA 4OMEA 4P6YA 5LYIA 4JZ0A 1F57A 3PB8X 4MXUA 1TXRA 2PJ9A 1Z8LA 4NGMA 1Y9ZA 3QNVA 4EFDA 1BPMA 3PB7X 3MRUA 3B3VA 2IQ6A 5D8NA 2ZEOA 1DTDA 3FX6A 1BPNA 1YMEA 5IR2A 3B7IA 3BI1A 1VHOA 4F9VA 2V8GA 5ELYA 3FEDA 3SI0A 3S9MA 3B3CA 1CP6A 1F2PA 2PCUA 2ZOFA 3FEEA 3LWUA 4K3NA 1VGYA 4C85A 4EMEA 5JH9A 2CTBA 2ZEPA 2C6CA 3CPAA 4WWVA 3PB4X 2OOTA 7CPAA 4H2KA 3S9NA 3SJGA 2QVPA 3HLPA 4UIAA 2EWBA 1Q7LA 4ONWA 3IWWA 1XJOA 1BLLE 5HVHA 1TF8A 4MCQA 2AFZA 2GP4A 3MN8A 1Z5RA 4C8TA 4NGRA 2AFMA 5JGFA 3PBEA 4UEZA 2VL1A 3FF3A 4C9AA 4OC2A 5THWA 5K8MA 1JQGA 4PXBA 5LRKA 4DYOA 4MCPA 4A38A 4BD9A 1VIXA 4MHZA 4Q7AA 1ELMP 1YW6A 2HB6A 2PVVA 4P4FA 1Y7EA 3I74A 3ISZA 5K8OA 1TKFA 1M4LA 2GU2A 4P4EA 4UIBA 3NH5A 2PRQA 4NJRA 3CT9A 1YSJA 3WT4A 4ZY0A 2Q43A 4ZY1A 3KL9A 3DGVA 4F9UA 1YLOA 1R3NA 4MCSA 2C1CA 1ARMA 1TKJA 4C8UA 1TF9A 4NJQA 3D7DA 3WC5A 2XEGA 4PXCA 1ELLP 5LYDA 4P44A 2IMOA 2GREA 4R6TA 4C84A 4PQAA 2BO9A 1BAVA 1IY7A 4FAIA 2CF4A 4MHNA 4NGPA 1Z2LA 2AFUA 3RBUA 2G9DA 3VARA 2ZEHA 3NA6A 3V7ZA 4FWUA 4JYWA 4OC4A 1CG2A 4R8FA 2RB7A 4FUUA 2PE3A 4OC1A 2WZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEM A;  3BI0 A;  3VH9 A;  2Q51 A;  1ZLI A;  3D4U A;  4G1P A;  3T8W A;  5HVG A;  3KHX A;  3KQX A;  3PEI A;  1F2O A;  1XBU A;  4R7M A;  1WVM A;  4WJB A;  1CPS A;  2ANP A;  2Q4Z A;  3KGQ A;  4MHY A;  4NGS A;  6CPA A;  2FVG A;  2V8H A;  2CIJ A;  3GB0 A;  3PBB A;  3KZW A;  4R76 A;  2XEI A;  1ZG9 A;  2F8H A;  3IO1 A;  8CPA A;  2O4H A;  1XRY A;  4CDK A;  2GLJ A;  3EIF A;  4GM5 A;  3SI2 A;  4P4J A;  4B6Z A;  3K9T A;  4X3R A;  4OKO A;  2ZEG A;  4TJX A;  4C9R A;  2J9A A;  4OIW A;  3KAS A;  4P45 A;  2PJ7 A;  4OC3 A;  4A94 A;  2F7V A;  3GUX A;  3B3S A;  1R43 A;  3KI9 A;  5LRG A;  2CTC A;  4C9E A;  3IEH A;  3B35 A;  4OP4 A;  1CPX A;  4EWT A;  1ARL A;  3SJX A;  5J1Q A;  3I1U A;  4P4B A;  2AFX A;  4C9V A;  5HXD A;  3IJ3 A;  3NFZ A;  5LYF A;  4IHM A;  2PJB A;  4LQG A;  4PXE A;  1V6C A;  2XEF A;  2ZED A;  1YW4 A;  4NGN A;  2QYV A;  3WC6 A;  2DEA A;  2IJZ A;  2EK9 A;  4PPZ A;  5HVF A;  1ZG8 A;  1HDQ A;  4YU9 A;  3KQZ A;  4O23 A;  2PJ3 A;  4OC5 A;  3N5F A;  3BXM A;  1LCP A;  4RUH A;  4NFR A;  3CDX A;  3PB9 X;  3VAT A;  2BCO A;  3D7G A;  3PB6 X;  2C6G A;  3RZA A;  4X2T A;  5D29 A;  3KR5 A;  2AFO A;  2ZEN A;  3IIB A;  3PRT A;  3B3T A;  2PJC A;  4C8F A;  3ICU A;  2PJ5 A;  2PJ8 A;  3FEC A;  1LAN A;  3GLJ A;  3TX8 A;  3IC1 A;  3K2K A;  4ZI6 A;  3FVL A;  3WC7 A;  1Y0Y A;  2AFW A;  3SJE A;  1XF1 A;  4UEF A;  4C8P A;  1VHE A;  2ABZ A;  4P4D A;  3BHX A;  4ZY2 A;  4OC0 A;  1GYT A;  1OBR A;  2BOA A;  3PFO A;  4KSI A;  1H8L A;  4TNU A;  2PJ1 A;  4CDJ A;  3KHZ A;  3H8G A;  3SI1 A;  3D68 A;  4C8A A;  2JBK A;  4ZX9 A;  3L2N A;  1HDU A;  3S9L A;  2POK A;  2O53 A;  2PIZ A;  4KNG E;  1CX8 A;  4DJL A;  5I4M A;  1LOK A;  4UF4 A;  1QMU A;  1FT7 A;  2NSM A;  3D7F A;  2PJ4 A;  2RFH A;  4MMO A;  3WAB A;  5CBM A;  3D66 A;  4A39 A;  1LAP A;  1XMB A;  4ZYQ A;  3H8E A;  3FH4 A;  3RAM A;  5CPA A;  2QJ8 A;  4MHP A;  3IFE A;  4C8C A;  4IAV A;  1PCA A;  4MRI A;  3DLJ A;  2PJA A;  1RTQ A;  4C86 A;  2EK8 A;  3D7H A;  5F09 A;  3JRU A;  2NYQ A;  3NH4 A;  2PJ2 A;  3ISX A;  1Y0R A;  1HEE A;  3D67 A;  4UEE A;  4W9Y A;  2C6P A;  4Z65 A;  2ZOG A;  4AXV A;  3PFE A;  2ZEL A;  1ZG7 A;  5IB9 A;  4IK2 A;  5K8N A;  3LMS A;  4DUK A;  1NSA A;  1TKH A;  5LRJ A;  4CPA A;  2GLF A;  2PJ6 A;  4NGQ A;  5K8P A;  4FBE A;  2V8D A;  3B2Y A;  4P10 A;  4TWE A;  1UWY A;  5LYL A;  1ZLH A;  3CPX A;  1IGB A;  3HUV A;  4OID A;  5DS0 A;  5JM6 A;  4P4I A;  4ZX8 A;  4MCR A;  4YWY A;  4TJV A;  3H8F A;  4C99 A;  3KR4 A;  1PYT B;  4NGT A;  1AMP A;  1KWM A;  3I6S A;  2JEW A;  2PJ0 A;  3NH8 A;  2AFS A;  1FNO A;  4F8Z A;  3VTA A;  2HC9 A;  2ZEF A;  1DE4 C;  3FJU A;  2JBJ A;  2ZEE A;  3SJF A;  1LAM A;  1QQ9 A;  1AYE A;  2V8V A;  2PVW A;  2OR4 A;  2V77 A;  2PIY A;  2WYR A;  4X8I A;  1EE3 P;  3V38 A;  2XEJ A;  1CP7 A;  1XFO A;  4C9U A;  1LFW A;  1CBX A;  2I3C A;  3TC8 A;  3FMC A;  4YN3 A;  4A37 A;  3B3W A;  4PXD A;  4OME A;  4P6Y A;  5LYI A;  4JZ0 A;  1F57 A;  3PB8 X;  4MXU A;  1TXR A;  2PJ9 A;  1Z8L A;  4NGM A;  1Y9Z A;  3QNV A;  4EFD A;  1BPM A;  3PB7 X;  3MRU A;  3B3V A;  2IQ6 A;  5D8N A;  2ZEO A;  1DTD A;  3FX6 A;  1BPN A;  1YME A;  3B7I A;  3BI1 A;  1VHO A;  4F9V A;  2V8G A;  5ELY A;  3FED A;  3SI0 A;  3S9M A;  3B3C A;  1CP6 A;  1F2P A;  2PCU A;  2ZOF A;  3FEE A;  3LWU A;  4K3N A;  1VGY A;  4C85 A;  4EME A;  5JH9 A;  2CTB A;  2ZEP A;  2C6C A;  3CPA A;  4WWV A;  3PB4 X;  2OOT A;  7CPA A;  4H2K A;  3S9N A;  3SJG A;  2QVP A;  3HLP A;  4UIA A;  2EWB A;  1Q7L A;  4ONW A;  3IWW A;  1XJO A;  1BLL E;  5HVH A;  1TF8 A;  4MCQ A;  2AFZ A;  3MN8 A;  1Z5R A;  4C8T A;  4NGR A;  2AFM A;  5JGF A;  3PBE A;  4UEZ A;  2VL1 A;  3FF3 A;  4C9A A;  4OC2 A;  5THW A;  5K8M A;  1JQG A;  4PXB A;  5LRK A;  4DYO A;  4MCP A;  4A38 A;  4BD9 A;  1VIX A;  4MHZ A;  4Q7A A;  1ELM P;  1YW6 A;  2HB6 A;  2PVV A;  4P4F A;  1Y7E A;  3I74 A;  3ISZ A;  5K8O A;  1TKF A;  1M4L A;  2GU2 A;  4P4E A;  4UIB A;  3NH5 A;  2PRQ A;  4NJR A;  3CT9 A;  1YSJ A;  3WT4 A;  4ZY0 A;  2Q43 A;  4ZY1 A;  3KL9 A;  3DGV A;  4F9U A;  1YLO A;  1R3N A;  4MCS A;  2C1C A;  1ARM A;  1TKJ A;  4C8U A;  1TF9 A;  4NJQ A;  3D7D A;  3WC5 A;  2XEG A;  4PXC A;  1ELL P;  5LYD A;  4P44 A;  2IMO A;  2GRE A;  4R6T A;  4C84 A;  4PQA A;  2BO9 A;  1BAV A;  1IY7 A;  4FAI A;  2CF4 A;  4MHN A;  4NGP A;  1Z2L A;  2AFU A;  3RBU A;  2G9D A;  3VAR A;  2ZEH A;  3NA6 A;  3V7Z A;  4FWU A;  4JYW A;  4OC4 A;  1CG2 A;  4R8F A;  2RB7 A;  4FUU A;  2PE3 A;  4OC1 A;  2WZN A; 
#chains in the Genus database with same CATH topology
 5JYB A;  2AE6 A;  2ZEM A;  3BI0 A;  3VH9 A;  1AUG A;  3TTH A;  1GGO A;  1S7N A;  4R3K A;  2PSW A;  2Q51 A;  1ZLI A;  2N3A B;  3D4U A;  1PUA A;  2Q7B A;  4G1P A;  3T8W A;  2VKZ G;  3JTK A;  3BJ8 A;  3KHX A;  5HVG A;  4CO9 A;  3VRQ A;  3KQX A;  3IU2 A;  3EZB A;  5HH1 A;  3GY9 A;  4BTF A;  1F2O A;  3PEI A;  1XBU A;  3DNS A;  4C2Y A;  2EZB A;  4R7M A;  4CRZ B;  4Y49 B;  4KLV A;  5AG6 A;  5A28 A;  1IB1 E;  3IGR A;  1WVM A;  4WJB A;  1CPS A;  2FXF A;  1YRE A;  4CAV A;  3N7Z A;  2CNT A;  2ANP A;  2D4O A;  1BO4 A;  2D4P A;  2Q4Z A;  3BJ7 A;  3H5Z A;  3KGQ A;  5BWA B;  5KTC A;  4MHY A;  4CAE A;  5JVL A;  2Y1N A;  2I79 A;  1NBW A;  3QAH A;  2WSA A;  5HKY A;  4NGS A;  1S5K A;  1XIX A;  2FIA A;  3FBU A;  3PGP A;  4RN7 A;  4AVB A;  4E8O A;  6CPA A;  2WPX A;  2FVG A;  2V8H A;  4KSF A;  4KOX A;  3PT1 A;  4E2A A;  4PV6 A;  2CIJ A;  5JQ4 A;  4KUA A;  2D0P A;  3GB0 A;  4B12 A;  3PBB A;  3HPH E;  4GPL B;  3KZW A;  4HNY B;  4R76 A;  5I0C A;  1CE8 B;  2XEI A;  4ONU A;  1X12 A;  4Y49 C;  2HWG A;  1S3Z A;  4Q38 A;  1ZG9 A;  4PK2 A;  1Q2D A;  1Q2Y A;  2F8H A;  3IO1 A;  3CXP A;  4XPK A;  4AG9 A;  1VBH A;  1CM0 A;  4KZT A;  2Q04 A;  8CPA A;  2O4H A;  1KC7 A;  1XRY A;  2AUM A;  4BBH A;  4KOS A;  3KKW A;  4MJX A;  2GLJ A;  3LOD A;  3EIF A;  3TLZ A;  4CDK A;  4GM5 A;  4X5K A;  4M6I A;  3SI2 A;  4P4J A;  2VQY A;  3K9T A;  4UBR A;  4X3R A;  4B6Z A;  4MFL A;  4OKO A;  2ZEG A;  2HQY A;  4NSQ A;  4FD6 A;  2YNE A;  4TJX A;  4KOR A;  4C9R A;  4L89 A;  2J9A A;  1FY7 A;  4OIW A;  3KAS A;  4P45 A;  3HMJ G;  2PJ7 A;  4H89 A;  4UWJ A;  5F5X A;  4OC3 A;  1RXT A;  5IX3 A;  3LAC A;  1L0C A;  1Z4E A;  3BUN B;  5GCN A;  2BSW A;  3FB3 A;  4A94 A;  2F7V A;  3GUX A;  3B3S A;  3IWE A;  1M4I A;  5KTA A;  1R43 A;  1MK4 A;  3KI9 A;  5LRG A;  3CXQ A;  1I1D A;  2CTC A;  3IWG A;  5EMI A;  4C9E A;  4MBU A;  4FAI A;  3IEH A;  3B35 A;  4NF1 A;  1CPX A;  4OP4 A;  4EWT A;  1ARL A;  4RR2 B;  3SJX A;  5G1Z A;  5J1Q A;  3I1U A;  1YGH A;  2R82 A;  2WUU A;  4P4B A;  2AFX A;  1C3O B;  4C9V A;  1V0C A;  5HXD A;  4ORF A;  4UFX A;  3IJ3 A;  2G3A A;  3NFZ A;  3WR7 A;  4IHM A;  5LYF A;  2PJB A;  3TLY A;  4LQG A;  4PXE A;  3QB8 A;  4CS0 B;  1WJT A;  5HKZ A;  1IID A;  2XPP A;  3I9S A;  3P2H A;  1Z4R A;  2Q4Y A;  3SXO A;  1V6C A;  2XEF A;  1M1D A;  2ZED A;  2R1I A;  2Z11 A;  4B5P B;  3VRR A;  2EBJ A;  2FE7 A;  4CGM A;  1YW4 A;  4NGN A;  3BUX B;  2QEC A;  2REE A;  4MFP A;  1BOB A;  4MI4 A;  4U5Y A;  2QYV A;  4NXY A;  4NCZ A;  5KTD A;  1Z8X A;  4MY0 A;  1Z9U A;  3WC6 A;  2DEA A;  2IJZ A;  2EK9 A;  2J8N A;  2CNS A;  2D0O A;  1QSM A;  4PPZ A;  5HVF A;  1ZG8 A;  4FD7 A;  1HDQ A;  4J3G A;  2Z10 A;  1QSN A;  3QAY A;  4QVT A;  1VHS A;  4YU9 A;  3KQZ A;  2Z3K A;  4O23 A;  2PJ3 A;  3VRN A;  4A4B A;  4OC5 A;  3EC4 A;  3F5B A;  3N5F A;  3VGO A;  3BXM A;  1LCP A;  1TIQ A;  4RUH A;  4NFR A;  2WPW A;  3CDX A;  3PB9 X;  3VAT A;  3H4Q A;  4IUS A;  4H6Z A;  2BCO A;  1FBV A;  4FD5 A;  3D7G A;  3BLN A;  3PB6 X;  2C6G A;  1Y9K A;  4YRH A;  4F0X A;  4B10 A;  3RZA A;  4X2T A;  5D29 A;  2KCW A;  3KR5 A;  1OZP A;  4GXH A;  2AFO A;  2ZEN A;  3IIB A;  3PRT A;  3B3T A;  2B5G A;  3RNZ A;  3FXT A;  3K4I A;  2PJC A;  2RC4 A;  4C8F A;  1I12 A;  4KLW A;  4CGP A;  3ICU A;  4CGL A;  2OU2 A;  1U6M A;  2PJ5 A;  2PJ8 A;  5F49 A;  4E0A A;  1Z8T A;  2G0B A;  3FEC A;  1LAN A;  2B4B A;  2VZY A;  3GLJ A;  3TX8 A;  4PK3 A;  1CJW A;  3TLA A;  1M44 A;  3IC1 A;  2YNC C;  1A2Z A;  3JVN A;  3K2K A;  3FVL A;  4C2Z A;  4ZI6 A;  5F46 A;  3WC7 A;  1J4J A;  1NSL A;  1Y0Y A;  2AFW A;  1XE4 A;  3RYO A;  2R98 A;  4E94 A;  2PQ8 A;  4B14 A;  4CGO A;  3SJE A;  5DWN A;  2OH1 A;  3S6H A;  1XF1 A;  4UEF A;  4C8P A;  3C8O A;  1VHE A;  2ABZ A;  1KUY A;  4AVC A;  2I00 A;  3DR8 A;  4P4D A;  3BHX A;  4ZY2 A;  4OC0 A;  1GYT A;  1OBR A;  3BUO B;  2BOA A;  2DXQ A;  2Z0Z A;  3PFO A;  1H8L A;  2Z3N A;  4KSI A;  4TNU A;  1IIC A;  3TO6 A;  1KBL A;  4HPS A;  2PJ1 A;  5E96 A;  1VI4 A;  4CDJ A;  3KHZ A;  3H8G A;  3SI1 A;  3D68 A;  4C8A A;  4KVX A;  4CAX A;  2JBK A;  4ZX9 A;  4ZGY B;  3L2N A;  1HDU A;  2B4J C;  3S9L A;  1IOI A;  3TLG B;  2POK A;  3DSB A;  2E28 A;  2O53 A;  2PIZ A;  3FRM A;  4KOW A;  4KSA A;  4KNG E;  4LX9 A;  1CX8 A;  4KVM E;  4DJL A;  5I4M A;  4R3L A;  1LOK A;  4UF4 A;  1QMU A;  2R7H A;  1FT7 A;  3FYN A;  1R61 A;  5FD8 A;  2NSM A;  3R1K A;  4MFQ A;  3D7F A;  3S6G A;  2DLA A;  2BL1 A;  3OB1 B;  2PJ4 A;  3PLF B;  2RFH A;  3F8K A;  1ON0 A;  4MMO A;  4UFW A;  4YGO A;  3WAB A;  1A9X B;  2J8R A;  1JDB C;  3D66 A;  1IYK A;  4B11 A;  2F5I A;  1DIK A;  2P6G A;  1RO5 A;  4M3S A;  2P6E A;  2Z3O A;  4A39 A;  2CNM A;  2HI6 A;  1MJB A;  1K4J A;  5IV0 A;  4R9M A;  1M6V B;  2B3V A;  1S7K A;  3W6X A;  1LAP A;  1XMB A;  4ZYQ A;  1EZB A;  3H8E A;  3GKR A;  4JD6 A;  4CAF A;  1ZYM A;  4HNX B;  3FH4 A;  4A32 A;  2VBQ A;  4J0N A;  3RAM A;  1YQE A;  2PRB A;  4XPD B;  5CPA A;  2QJ8 A;  2ZPA A;  4MHP A;  2JDD A;  4BPW B;  1ZL0 A;  4IIX A;  1M4G A;  2Q0Y A;  3IFE A;  4C8C A;  4CRY B;  4A2Z A;  1XOV A;  1YVK A;  4IAV A;  1PCA A;  4MRI A;  3DLJ A;  2PJA A;  1IOF A;  4MI1 A;  2C5Q A;  1YR0 A;  3EO4 A;  2PR1 A;  1EO0 A;  1RTQ A;  2DIK A;  4C86 A;  2EK8 A;  3D7H A;  2HV2 A;  3PZJ A;  5F47 A;  4LUA A;  5F09 A;  1MJA A;  3BUW B;  2BEI A;  3JRU A;  2NYQ A;  3NH4 A;  4NEX A;  4XPD C;  2PJ2 A;  3ISX A;  4H6U A;  2VEZ A;  3TYX A;  4EYS A;  1Y0R A;  1HEE A;  3D67 A;  4UEE A;  4W9Y A;  2QML A;  4I49 A;  2C6P A;  2Q4V A;  4DNC A;  4F0Y A;  4Z65 A;  2ZOG A;  4A4C A;  5C82 A;  1M4D A;  2GIV A;  4AXV A;  3PFE A;  2ZEL A;  1ZG7 A;  5IB9 A;  4IK2 A;  5J8F A;  3OAK A;  5K8N A;  2EZA A;  1PU9 A;  3LMS A;  4COG A;  3DDD A;  4DUK A;  1Q5X A;  1NSA A;  2OB0 A;  4M8D A;  1GHE A;  1TKH A;  2H5M A;  2Z3M A;  3UY5 A;  5LRJ A;  4KS9 A;  4CPA A;  3I74 A;  2GLF A;  1QSO A;  1Z8W A;  2PJ6 A;  3TOA A;  3TO7 A;  5F13 A;  3T5M A;  4A33 A;  1Z9E A;  4NGQ A;  5K8P A;  4FBE A;  2V8D A;  3B2Y A;  5AG7 A;  3OWC A;  4JXQ A;  4U9Y A;  4P10 A;  2Q7S A;  4XPL A;  4II9 A;  4TWE A;  3T0T A;  1UWY A;  4C7H A;  5LYL A;  1ZLH A;  3CPX A;  1IGB A;  3HUV A;  4OID A;  5G22 A;  3V8I A;  4C7I A;  5DS0 A;  5JM6 A;  4P4I A;  4ZX8 A;  4MCR A;  4YWY A;  5AG4 A;  4TJV A;  2DPS A;  2IL4 A;  3H8F A;  5J8C A;  3KR4 A;  4C99 A;  1PYT B;  3NFQ A;  2NMT A;  5EC4 A;  1YLE A;  4NGT A;  1AMP A;  1KWM A;  2B5G B;  2JEW A;  4CYQ A;  2PJ0 A;  3NH8 A;  3I6S A;  4UCP A;  2AFS A;  2YJT A;  1FNO A;  1NE9 A;  5F9M A;  4UCM A;  4F8Z A;  4CAW A;  1MJ9 A;  2HC9 A;  3OP0 A;  2ZEF A;  1DE4 C;  2GE3 A;  1B47 A;  4YFJ A;  4JXR A;  2VZZ A;  2JBJ A;  3FJU A;  1ZO0 A;  2ZEE A;  4MFK A;  4MHD A;  3S6F A;  3SJF A;  1LAM A;  1QQ9 A;  3DR6 A;  4BMH A;  4MJ8 A;  5LRK A;  4L8A A;  1AYE A;  2V8V A;  4MY3 A;  3KRV A;  4UFV A;  2PVW A;  2PDO A;  1WK4 A;  4OAE A;  2OR4 A;  2V77 A;  2PIY A;  1Y9W A;  2WYR A;  2OZH A;  4HNW B;  4JJX A;  2YND A;  3CZX A;  4U9Z A;  2VXK A;  1JDE A;  2FL4 A;  3T90 A;  3ZNI A;  1KUX A;  4X8I A;  4CZ1 A;  1EE3 P;  1B87 A;  2XEJ A;  3V38 A;  1T36 B;  1CP7 A;  4JWP A;  2Y0M A;  3JUW A;  1XFO A;  2QIR A;  1LFW A;  1WWZ A;  3GIU A;  1CBX A;  4C9U A;  2J8M A;  2I3C A;  4R57 A;  3TC8 A;  3FNC A;  3FMC A;  4YN3 A;  2FIW A;  2AJ6 A;  4KOY A;  4QUS A;  4A37 A;  2B58 A;  3B3W A;  4PXD A;  3TFY A;  3HPG G;  4OME A;  1Q2C A;  4P6Y A;  5LYI A;  4A30 A;  3A9L A;  3TE4 A;  2FM4 A;  4JZ0 A;  1B6B A;  4M6G A;  1F57 A;  3PB8 X;  3TLG A;  4MXU A;  1TXR A;  2PJ9 A;  5C88 A;  2FCK A;  2AUN A;  1Z8L A;  3TLC A;  3OB2 B;  4MFZ A;  2X0S A;  1YVO A;  3D2M A;  5K99 A;  3I3G A;  2PC1 A;  4NGM A;  3F0A A;  3R95 A;  1NXJ A;  1Y9Z A;  3QNV A;  3F9K C;  4EFD A;  3C26 A;  3S6K A;  2YJV A;  2GFQ A;  1XF8 A;  1BPM A;  3PB7 X;  4C2X A;  3R9G A;  3TO9 A;  3MRU A;  3B3V A;  2IQ6 A;  5D8N A;  3ZJ0 A;  1X10 A;  2CBL A;  4BPX B;  2Z3L A;  2ZEO A;  3EXN A;  1DTD A;  5EBV A;  5CBM A;  3E0K A;  2ZW5 A;  2CXA A;  2ZW7 A;  4CGN A;  3G8W A;  3FX6 A;  1BPN A;  2FT0 A;  3TCV A;  1YME A;  5IR2 A;  3T05 A;  3SHP A;  5JPH A;  3VWD A;  4KOV A;  3B7I A;  1S60 A;  3BI1 A;  1C30 B;  2MP0 A;  4MFJ A;  3TT2 A;  1VHO A;  4F9V A;  5ELY A;  3FED A;  2V8G A;  3SI0 A;  3S9M A;  3B3C A;  1CP6 A;  4COB A;  1F2P A;  2C27 A;  2PCU A;  3FEE A;  2ZOF A;  3LWU A;  1VGY A;  4K3N A;  2XPL A;  5AG5 A;  3R9F A;  4EME A;  5CNP A;  5IB0 A;  3EZE A;  2EUI A;  1J3L A;  3EFA A;  3G3S A;  2Y1M A;  3MGD A;  5FVJ A;  2X7B A;  4K30 A;  5AGE A;  5JH9 A;  2CTB A;  2ZEP A;  1IU8 A;  2C6C A;  3CPA A;  3IU1 A;  3VRP A;  3PB4 X;  2OOT A;  1UFH A;  3D2P A;  4WWV A;  7CPA A;  4JLY A;  4H2K A;  4PSX A;  3U1B A;  4QBJ A;  2OZU A;  3S9N A;  3SJG A;  4HKF A;  4KOT A;  2QVP A;  1VBG A;  3HLP A;  4UIA A;  3FIX A;  2REF A;  4EVY A;  2EWB A;  1Q7L A;  3VTA A;  4ONW A;  2HUZ A;  3IWW A;  1QST A;  1XJO A;  1BLL E;  1Y7R A;  3GYA A;  2O28 A;  1S7F A;  1ZRS A;  2OLS A;  3U88 C;  4XNH B;  5HVH A;  1KUV A;  1TF8 A;  4C68 A;  4M85 A;  5ISV A;  4Q36 A;  3D3S A;  3D8P A;  4OLL A;  2B3U A;  1XEB A;  2EZC A;  4MCQ A;  3VRO A;  2AFZ A;  3PFV A;  2GP4 A;  4UA3 A;  3MN8 A;  1Z5R A;  1R57 A;  4C8T A;  4NGR A;  3LD2 A;  4LQ6 A;  2AFM A;  5JGF A;  3PBE A;  1KZF A;  3CXS A;  4C85 A;  4CYO A;  4E5S A;  4UEZ A;  2VL1 A;  3FF3 A;  4RI1 A;  4C9A A;  4OC2 A;  5THW A;  5K8M A;  1JWQ A;  2JDC A;  1JQG A;  5F48 A;  4B13 A;  2DPT A;  2EO8 A;  3RO0 A;  1BXR B;  2PR8 A;  4XNH C;  4BIN A;  2ODF A;  2ZXV A;  1P4N A;  4MCP A;  4PXB A;  5H86 A;  5DWM A;  3ZZI A;  2XPO A;  2UV8 G;  4A38 A;  4DYO A;  1XMT A;  4ZBG A;  4A31 A;  3BUM B;  4BD9 A;  1VIX A;  4BPU B;  2BUE A;  3R96 A;  2G3T A;  4MHZ A;  1ELM P;  4Q7A A;  3G23 A;  5AXI A;  2ATR A;  2Q44 A;  3SR3 A;  1EZA A;  1YW6 A;  1YVH A;  2HB6 A;  2PVV A;  4P4F A;  1Y7E A;  3PP9 A;  2B4D B;  4F6A A;  1CS0 B;  5HKW A;  4R87 A;  4UCN A;  3ISZ A;  5K8O A;  1TKF A;  4AG7 A;  1M4L A;  3W91 A;  2GU2 A;  4AB7 A;  4P4E A;  5H84 A;  2XPN A;  2P6F A;  4UIB A;  3B8G A;  3EZA A;  2DF5 A;  2B4D A;  3NH5 A;  3P2F A;  2CY2 A;  3GJZ A;  2PRQ A;  4NJR A;  3O8Z A;  3CT9 A;  1YSJ A;  3WT4 A;  4ZY0 A;  2Q43 A;  4ZY1 A;  3KL9 A;  3T07 A;  3DGV A;  5G20 A;  4OAD A;  1YLO A;  4CYP A;  4F9U A;  1R3N A;  2ARH A;  2OZG A;  1S7L A;  4H1H A;  1LRZ A;  1YX0 A;  4B5P A;  4MCS A;  4UWI A;  4GS4 A;  1I21 A;  2C1C A;  1N71 A;  1ARM A;  1TKJ A;  2FSR A;  4A95 A;  2PCN A;  4JVO A;  4CYN A;  4C8U A;  5BY0 A;  1TF9 A;  2Z3P A;  4KUB A;  4NJQ A;  5F1Y A;  2VI7 A;  3D7D A;  4AVA A;  3TLB A;  3WC5 A;  2XEG A;  1QSR A;  1ELL P;  2EVN A;  4PXC A;  5A27 A;  2ZW6 A;  3NOJ A;  1IYL A;  4QC6 A;  5LYD A;  4P44 A;  2IMO A;  4FD4 A;  2GRE A;  4PSW A;  4R6T A;  3TOB A;  2HRO A;  4IIY A;  4M6H A;  2R8V A;  3NE7 A;  4C84 A;  5G21 A;  3R9E A;  3SXN A;  4PQA A;  2BO9 A;  2P0W A;  1VKC A;  1BAV A;  3K9U A;  4B5O A;  1IY7 A;  3W6S A;  1NMT A;  2CF4 A;  2GAN A;  2YGW A;  4MHN A;  2K5T A;  2A4N A;  4RS2 A;  5HMN A;  4NGP A;  3EY5 A;  4KVO E;  4QB9 A;  3TLE A;  1Z2L A;  5J3X A;  1P0H A;  2AFU A;  3RBU A;  2YNC A;  2G9D A;  3VAR A;  2JLM A;  2ZEH A;  1YK3 A;  2JEV A;  3NA6 A;  2ZW4 A;  3V7Z A;  4KOU A;  1KEE B;  4FWU A;  2B0A A;  4JYW A;  4OC4 A;  1CG2 A;  4IF5 A;  4R8F A;  3T9Y A;  3NE8 A;  2RB7 A;  4FUU A;  4INJ A;  1SQH A;  2PE3 A;  4OC1 A;  3VWE A;  2WZN A;  2FS5 A; 
#chains in the Genus database with same CATH homology
 2ZEM A;  3BI0 A;  3VH9 A;  2Q51 A;  1ZLI A;  3D4U A;  4G1P A;  3T8W A;  5HVG A;  3KHX A;  3KQX A;  3PEI A;  1F2O A;  1XBU A;  4R7M A;  1WVM A;  4WJB A;  1CPS A;  2ANP A;  2Q4Z A;  3KGQ A;  4MHY A;  4NGS A;  6CPA A;  2FVG A;  2V8H A;  2CIJ A;  3GB0 A;  3PBB A;  3KZW A;  4R76 A;  2XEI A;  1ZG9 A;  2F8H A;  3IO1 A;  8CPA A;  2O4H A;  1XRY A;  4CDK A;  2GLJ A;  3EIF A;  4GM5 A;  3SI2 A;  4P4J A;  4B6Z A;  3K9T A;  4X3R A;  4OKO A;  2ZEG A;  4TJX A;  4C9R A;  2J9A A;  4OIW A;  3KAS A;  4P45 A;  2PJ7 A;  4OC3 A;  4A94 A;  2F7V A;  3GUX A;  3B3S A;  1R43 A;  3KI9 A;  5LRG A;  2CTC A;  4C9E A;  3IEH A;  3B35 A;  4OP4 A;  1CPX A;  4EWT A;  1ARL A;  3SJX A;  5J1Q A;  3I1U A;  4P4B A;  2AFX A;  4C9V A;  5HXD A;  3IJ3 A;  3NFZ A;  5LYF A;  4IHM A;  2PJB A;  4LQG A;  4PXE A;  1V6C A;  2XEF A;  2ZED A;  1YW4 A;  4NGN A;  2QYV A;  3WC6 A;  2DEA A;  2IJZ A;  2EK9 A;  4PPZ A;  5HVF A;  1ZG8 A;  1HDQ A;  4YU9 A;  3KQZ A;  4O23 A;  2PJ3 A;  4OC5 A;  3N5F A;  3BXM A;  1LCP A;  4RUH A;  4NFR A;  3CDX A;  3PB9 X;  3VAT A;  2BCO A;  3D7G A;  3PB6 X;  2C6G A;  3RZA A;  4X2T A;  5D29 A;  3KR5 A;  2AFO A;  2ZEN A;  3IIB A;  3PRT A;  3B3T A;  2PJC A;  4C8F A;  3ICU A;  2PJ5 A;  2PJ8 A;  3FEC A;  1LAN A;  3GLJ A;  3TX8 A;  3IC1 A;  3K2K A;  4ZI6 A;  3FVL A;  3WC7 A;  1Y0Y A;  2AFW A;  3SJE A;  1XF1 A;  4UEF A;  4C8P A;  1VHE A;  2ABZ A;  4P4D A;  3BHX A;  4ZY2 A;  4OC0 A;  1GYT A;  1OBR A;  2BOA A;  3PFO A;  4KSI A;  1H8L A;  4TNU A;  2PJ1 A;  4CDJ A;  3KHZ A;  3H8G A;  3SI1 A;  3D68 A;  4C8A A;  2JBK A;  4ZX9 A;  3L2N A;  1HDU A;  3S9L A;  2POK A;  2O53 A;  2PIZ A;  4KNG E;  1CX8 A;  4DJL A;  5I4M A;  1LOK A;  4UF4 A;  1QMU A;  1FT7 A;  2NSM A;  3D7F A;  2PJ4 A;  2RFH A;  4MMO A;  3WAB A;  5CBM A;  3D66 A;  4A39 A;  1LAP A;  1XMB A;  4ZYQ A;  3H8E A;  3FH4 A;  3RAM A;  5CPA A;  2QJ8 A;  4MHP A;  3IFE A;  4C8C A;  4IAV A;  1PCA A;  4MRI A;  3DLJ A;  2PJA A;  2C5Q A;  1RTQ A;  4C86 A;  2EK8 A;  3D7H A;  5F09 A;  3JRU A;  2NYQ A;  3NH4 A;  2PJ2 A;  3ISX A;  1Y0R A;  1HEE A;  3D67 A;  4UEE A;  4W9Y A;  2C6P A;  4Z65 A;  2ZOG A;  4AXV A;  3PFE A;  2ZEL A;  1ZG7 A;  5IB9 A;  4IK2 A;  5K8N A;  3LMS A;  4DUK A;  1NSA A;  1TKH A;  5LRJ A;  4CPA A;  2GLF A;  2PJ6 A;  4NGQ A;  5K8P A;  4FBE A;  2V8D A;  3B2Y A;  4P10 A;  4TWE A;  1UWY A;  5LYL A;  1ZLH A;  3CPX A;  1IGB A;  3HUV A;  4OID A;  5DS0 A;  5JM6 A;  4P4I A;  4ZX8 A;  4MCR A;  4YWY A;  4TJV A;  3H8F A;  4C99 A;  3KR4 A;  1PYT B;  4NGT A;  1AMP A;  1KWM A;  3I6S A;  2JEW A;  2PJ0 A;  3NH8 A;  2AFS A;  1FNO A;  4F8Z A;  3VTA A;  2HC9 A;  2ZEF A;  1DE4 C;  3FJU A;  2JBJ A;  2ZEE A;  3SJF A;  1LAM A;  1QQ9 A;  1AYE A;  2V8V A;  2PVW A;  2OR4 A;  2V77 A;  2PIY A;  2WYR A;  4X8I A;  1EE3 P;  3V38 A;  2XEJ A;  1CP7 A;  1XFO A;  4C9U A;  1LFW A;  1CBX A;  2I3C A;  3TC8 A;  3FMC A;  4YN3 A;  4A37 A;  3B3W A;  4PXD A;  4OME A;  4P6Y A;  5LYI A;  4JZ0 A;  1F57 A;  3PB8 X;  4MXU A;  1TXR A;  2PJ9 A;  1Z8L A;  4NGM A;  1Y9Z A;  3QNV A;  4EFD A;  1BPM A;  3PB7 X;  3MRU A;  3B3V A;  2IQ6 A;  5D8N A;  2ZEO A;  1DTD A;  3FX6 A;  1BPN A;  1YME A;  5IR2 A;  3B7I A;  3BI1 A;  1VHO A;  4F9V A;  2V8G A;  5ELY A;  3FED A;  3SI0 A;  3S9M A;  3B3C A;  1CP6 A;  1F2P A;  2PCU A;  2ZOF A;  3FEE A;  3LWU A;  4K3N A;  1VGY A;  4C85 A;  4EME A;  5JH9 A;  2CTB A;  2ZEP A;  2C6C A;  3CPA A;  4WWV A;  3PB4 X;  2OOT A;  7CPA A;  4H2K A;  3S9N A;  3SJG A;  2QVP A;  3HLP A;  4UIA A;  2EWB A;  1Q7L A;  4ONW A;  3IWW A;  1XJO A;  1BLL E;  5HVH A;  1TF8 A;  4MCQ A;  2AFZ A;  2GP4 A;  3MN8 A;  1Z5R A;  4C8T A;  4NGR A;  2AFM A;  5JGF A;  3PBE A;  4UEZ A;  2VL1 A;  3FF3 A;  4C9A A;  4OC2 A;  5THW A;  5K8M A;  1JQG A;  4PXB A;  5LRK A;  4DYO A;  4MCP A;  4A38 A;  4BD9 A;  1VIX A;  4MHZ A;  4Q7A A;  1ELM P;  1YW6 A;  2HB6 A;  2PVV A;  4P4F A;  1Y7E A;  3I74 A;  3ISZ A;  5K8O A;  1TKF A;  1M4L A;  2GU2 A;  4P4E A;  4UIB A;  3NH5 A;  2PRQ A;  4NJR A;  3CT9 A;  1YSJ A;  3WT4 A;  4ZY0 A;  2Q43 A;  4ZY1 A;  3KL9 A;  3DGV A;  4F9U A;  1YLO A;  1R3N A;  4MCS A;  2C1C A;  1ARM A;  1TKJ A;  4C8U A;  1TF9 A;  4NJQ A;  3D7D A;  3WC5 A;  2XEG A;  4PXC A;  1ELL P;  5LYD A;  4P44 A;  2IMO A;  2GRE A;  4R6T A;  4C84 A;  4PQA A;  2BO9 A;  1BAV A;  1IY7 A;  4FAI A;  2CF4 A;  4MHN A;  4NGP A;  1Z2L A;  2AFU A;  3RBU A;  2G9D A;  3VAR A;  2ZEH A;  3NA6 A;  3V7Z A;  4FWU A;  4JYW A;  4OC4 A;  1CG2 A;  4R8F A;  2RB7 A;  4FUU A;  2PE3 A;  4OC1 A;  2WZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...