4P4BA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor ctt54
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 262
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4bA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4bA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4bA02
2PIZA 5HVHA 1ZG7A 2ZELA 1Y0RA 3V38A 3VATA 1PCAA 5LYDA 3IJ3A 3TC8A 1BLLE 4F9VA 4A94A 3SI1A 3FEEA 2AFSA 1F2PA 4PXCA 3FMCA 1XMBA 4F8ZA 4ZY2A 4Q7AA 1AMPA 4MMOA 4C9VA 4P45A 3VH9A 1BPNA 3RZAA 5IB9A 4OC1A 2POKA 4MXUA 2JBKA 3SJEA 1PYTB 3PRTA 1QQ9A 1CG2A 1VHEA 1HDQA 1RTQA 4NJRA 4PXDA 2FVGA 3SI2A 5K8NA 2EK8A 3DLJA 4G1PA 2ZEMA 4PQAA 2VL1A 4UEEA 4YN3A 4IHMA 1ZG9A 1YW4A 3CT9A 2PVVA 4YWYA 3MRUA 4NGRA 4P4IA 2CTBA 4KNGE 4OC0A 4OMEA 1YMEA 3PBBA 4OC5A 4P4DA 3KR5A 3K2KA 3CDXA 1LOKA 4X8IA 6CPAA 2WYRA 2BOAA 3BHXA 3D67A 2O53A 3IO1A 1YSJA 2AFOA 4X2TA 5DS0A 2HB6A 5LYLA 2ANPA 3KGQA 4OC4A 3B3TA 1ELMP 4R76A 1TXRA 3NFZA 3FX6A 2ZEHA 1LAPA 2PIYA 2ZEEA 1V6CA 5THWA 4OC2A 5JH9A 2GLJA 1QMUA 2ZEDA 4P4JA 3BI0A 3GB0A 4FBEA 4IAVA 2I3CA 2AFXA 4ZY0A 3QNVA 2PJ6A 3BI1A 1Z2LA 2V8VA 3PB8X 4ZYQA 2QJ8A 2ZOGA 1Z8LA 3TX8A 1TKJA 3NA6A 4C8UA 3FF3A 4MCSA 5K8OA 2Q43A 1JQGA 3B3VA 5LYFA 1XF1A 4NJQA 1Q7LA 4KSIA 3PB9X 3FEDA 4W9YA 5LYIA 2ZEGA 3KZWA 4ONWA 4MHZA 4UEZA 2PJ4A 3KQXA 4C8FA 3KL9A 4OIDA 2V8DA 5CPAA 4CDJA 2OOTA 2JEWA 4ZI6A 1VGYA 4TJVA 2AFWA 2JBJA 1LCPA 2Q51A 3IFEA 1R43A 4FWUA 4UIBA 5J1QA 5LRGA 2QYVA 4FUUA 3D7DA 2QVPA 4UIAA 4WWVA 2WZNA 1R3NA 3D7HA 3WC6A 3KHXA 3PBEA 4MCRA 5LRKA 2C6PA 4BD9A 4EFDA 3KR4A 1WVMA 4C9AA 4IK2A 2GLFA 1CPXA 8CPAA 4A39A 4P10A 3IEHA 4A37A 2PJ8A 3ISZA 1YLOA 5CBMA 3D68A 4YU9A 7CPAA 2PJAA 5K8PA 4C86A 5JM6A 1H8LA 5LRJA 4C9UA 4UF4A 3IC1A 3WC5A 1HEEA 2XEFA 3PB4X 4DJLA 3FH4A 2ZEPA 3DGVA 1FT7A 5F09A 1OBRA 2EK9A 3PFOA 2PJBA 2NYQA 3PB6X 1DE4C 4PPZA 4CPAA 3V7ZA 3N5FA 2CTCA 3I74A 1F57A 5HXDA 2IMOA 3LWUA 2PJ9A 3H8FA 3RAMA 2V8HA 2ZOFA 2PJCA 4OC3A 4OIWA 3EIFA 2RB7A 1KWMA 2ZEOA 2AFZA 3KI9A 3PEIA 4WJBA 1VHOA 4P4EA 4TJXA 3S9NA 4MHNA 1LFWA 4GM5A 3PB7X 4C8PA 2F7VA 2CIJA 4C85A 3WABA 4NGSA 3PFEA 4NGPA 5I4MA 3SJXA 3B2YA 4C9EA 4MCPA 4MRIA 4C8CA 1DTDA 3H8GA 1IGBA 1ARMA 3IWWA 4LQGA 4B6ZA 1XBUA 4P6YA 4FAIA 4C84A 4JZ0A 4R7MA 3FECA 2ZENA 3I6SA 4R6TA 4C8TA 4Z65A 1XRYA 4TWEA 2PRQA 2V8GA 1BAVA 4MCQA 2V77A 3CPAA 3SJFA 4UEFA 4RUHA 1Y7EA 2PE3A 1TF9A 2O4HA 3ISXA 1ARLA 1CX8A 4F9UA 4P44A 3D4UA 1Y0YA 1XFOA 4OKOA 1AYEA 1F2OA 2XEGA 1LAMA 4AXVA 3D7FA 4NGNA 4H2KA 4R8FA 1ELLP 2ZEFA 3K9TA 3BXMA 1CBXA 2PJ2A 3VTAA 4NGMA 5HVGA 3LMSA 4O23A 4DUKA 4EWTA 2F8HA 1YW6A 1NSAA 1Y9ZA 3B7IA 4MHPA 2C1CA 1FNOA 5HVFA 3D66A 4DYOA 2OR4A 1BPMA 4MHYA 3FVLA 1ZLIA 5K8MA 2PVWA 4TNUA 4P4FA 1CPSA 2J9AA 2G9DA 3L2NA 3HLPA 2XEIA 3KASA 3B3WA 1TF8A 4A38A 1ZLHA 3JRUA 1LANA 3B3CA 3NH5A 4C99A 2NSMA 3WT4A 1XJOA 4C8AA 1CP6A 3B3SA 4NGTA 1Z5RA 2PJ5A 2DEAA 3SI0A 4CDKA 3KQZA 3RBUA 3GLJA 2PJ1A 3MN8A 4X3RA 4EMEA 2BO9A 1IY7A 5ELYA 1HDUA 2GREA 2AFUA 1UWYA 3S9MA 3H8EA 2PCUA 3KHZA 5D8NA 2PJ7A 4PXBA 4C9RA 2C6GA 2EWBA 1VIXA 3B35A 2AFMA 4PXEA 4OP4A 3FJUA 4ZX9A 3T8WA 1TKFA 3ICUA 2PJ3A 2IQ6A 3NH4A 4JYWA 2GU2A 2IJZA 2Q4ZA 3SJGA 2ABZA 3HUVA 4ZY1A 2XEJA 4NGQA 1EE3P 4ZX8A 5D29A 1ZG8A 1CP7A 5JGFA 3IIBA 2BCOA 1GYTA 1M4LA 2RFHA 3D7GA 3GUXA 4K3NA 3S9LA 1TKHA 3WC7A 2HC9A 3I1UA 2CF4A 4NFRA 3NH8A 3VARA 4P4BA 3CPXA 2PJ0A 2C6CA
chains in the Genus database with same CATH superfamily
4MJ8A 3W6XA 2PIZA 5HVHA 1ZG7A 2P6GA 2ZELA 4J0NA 2FT0A 4OLLA 1Y0RA 1S5KA 5E96A 3R9EA 4BPXB 1M1DA 5EMIA 3S6HA 2FS5A 3T90A 3V38A 1PCAA 3NE7A 4KZTA 3VATA 1I12A 3IJ3A 5LYDA 4CYOA 3TC8A 5KTDA 5JVLA 3OB2B 1BLLE 4F9VA 3T07A 3DNSA 4A94A 3BUNB 3FEEA 1L0CA 1KZFA 1S60A 2AFSA 1F2PA 2G3AA 4IUSA 4PXCA 1MJ9A 4A30A 5I0CA 1GHEA 4AVBA 3FMCA 4ZGYB 1XMBA 2WPXA 4AVAA 4AG7A 4Y49C 4ZY2A 4CAWA 4Q7AA 2DPSA 4F8ZA 2VBQA 2VEZA 3U1BA 3GYAA 4XPDB 1AMPA 4MMOA 3S6FA 2PC1A 4C9VA 4COBA 1IIDA 4P45A 3BJ8A 3VH9A 2OU2A 2EZBA 5F9MA 1KUXA 1BPNA 2FE7A 2Z0ZA 3RZAA 4KOYA 4OC1A 5IB9A 4C8AA 4MHDA 3PP9A 2POKA 4MXUA 2JDDA 4QBJA 1Z4EA 5HH1A 2JBKA 2B5GB 2EZAA 3TLBA 3SJEA 5AG7A 2NMTA 1PYTB 1FY7A 2OZGA 3PRTA 1QQ9A 1CJWA 3IGRA 4U9ZA 1CG2A 1VHEA 1HDQA 4CGMA 1BOBA 4FD5A 4CYNA 1RTQA 4B5PA 4NJRA 4PXDA 2EUIA 2FVGA 4M6GA 3SI2A 5K8NA 4EYSA 2EK8A 3DLJA 3DR6A 4G1PA 2ZEMA 4PQAA 2VL1A 4HKFA 4UEEA 2AJ6A 1JWQA 1LRZA 5IX3A 4YN3A 4IHMA 1ZG9A 1A9XB 1YW4A 3H5ZA 2E28A 3PFVA 3CT9A 2PDOA 2PVVA 4HNYB 2H5MA 4NGRA 4P4IA 3MRUA 2CTBA 4YWYA 4KNGE 2Q7BA 3V8IA 4OC0A 4OMEA 2QIRA 3LODA 3P2FA 5JPHA 1YMEA 1S7KA 4KSAA 1IYLA 3B8GA 3PBBA 4OC5A 4P4DA 3KR5A 3K2KA 3CDXA 1LOKA 2PRBA 2Q04A 4COGA 4CS0B 4A2ZA 5A27A 4X8IA 3IWEA 6CPAA 2WYRA 2FIWA 2HROA 2BOAA 4F0YA 1EZAA 3EC4A 4EVYA 4XPLA 3BHXA 3D67A 2O53A 4RS2A 3IO1A 1YSJA 2AFOA 4X2TA 3TOBA 4C2ZA 5DS0A 4B12A 2HB6A 4KOXA 4BINA 4KOWA 5LYLA 1XE4A 5FVJA 2ANPA 3KGQA 3QB8A 4OC4A 4A95A 4C68A 5IV0A 2XPLA 1C3OB 3EZAA 1KC7A 3B3TA 3TLZA 1ELMP 3JUWA 2Q7SA 4R76A 3TLGB 1TXRA 3NFZA 3FX6A 1IB1E 2ZEHA 2FXFA 1LAPA 2PIYA 1WWZA 2ZEEA 1VI4A 3K4IA 1V6CA 3HPGG 5HKWA 2WPWA 3RO0A 4C2XA 2YJTA 3TLYA 2VZYA 4NSQA 5THWA 2IL4A 4OC2A 5JH9A 2GLJA 1QMUA 1QSMA 2ZEDA 4KVME 4P4JA 1B47A 3BI0A 3GB0A 2DXQA 5G20A 4FBEA 3C8OA 4IAVA 4PSWA 2X7BA 4E94A 1Q2DA 2I3CA 2CNSA 2OZUA 1WJTA 4FD6A 4I49A 2AFXA 2EO8A 4ZY0A 3QNVA 4F6AA 3DDDA 2PJ6A 4R3KA 2HWGA 1K4JA 3BI1A 2R7HA 1Z2LA 4QVTA 5C88A 2V8VA 3PB8X 4BPUB 5K99A 4ZYQA 2QJ8A 3BUMB 1Z8LA 2ZOGA 4Y49B 2Z3KA 3TX8A 3TLEA 1TKJA 1YX0A 3P2HA 3NA6A 5H86A 4C8UA 2GFQA 1YK3A 3FF3A 2J8RA 2Z11A 5C82A 4MCSA 1KBLA 5K8OA 3T9YA 4AG9A 5FD8A 2Q43A 1JQGA 2EVNA 3B3VA 4KVXA 4KSFA 1I21A 5BY0A 5LYFA 1XF1A 4JXQA 2EZCA 4NJQA 1Q7LA 3HPHE 3NFQA 5JYBA 3VWEA 4KSIA 3HMJG 3PB9X 4MFLA 3TLCA 3FEDA 4W9YA 4KLVA 2ZEGA 4QC6A 3KZWA 3F9KC 5G22A 5LYIA 5J8FA 4ONWA 4MHZA 3SXOA 3SR3A 4UEZA 2PJ4A 1U6MA 5AXIA 3KQXA 5AG6A 1IICA 1ZRSA 4C8FA 2B4DA 4JWPA 1DIKA 3KL9A 2D4PA 4OIDA 4H89A 2YNCC 2V8DA 5CPAA 3R96A 4B11A 3FBUA 4CDJA 2OOTA 4CO9A 3H4QA 3G23A 2JEWA 4ZI6A 3CXSA 2JDCA 1VGYA 4KUAA 1OZPA 4TJVA 2AFWA 2JBJA 1LCPA 1XEBA 2Q51A 3LACA 2B4JC 3EXNA 4L8AA 3IFEA 1Y9WA 1R43A 2KCWA 4FWUA 2J8NA 4AB7A 4UIBA 2OH1A 3S6GA 1QSNA 5J1QA 4CGOA 5DWMA 1RXTA 4Q38A 5LRGA 2QYVA 4FUUA 4II9A 2FCKA 3D7DA 3JVNA 2QVPA 1VBGA 4MFZA 4UIAA 3BJ7A 3GY9A 2Z3NA 4WWVA 1P4NA 3TCVA 2WZNA 1CS0B 1R3NA 2B0AA 5KTCA 2UV8G 4ZBGA 2C5QA 2ZW6A 3D7HA 1VKCA 1YREA 3WC6A 3KHXA 1R61A 1Z8WA 3PBEA 4MCRA 4PSXA 2R98A 2Z3OA 3OP0A 2PQ8A 2ZW4A 5LRKA 2C6PA 4BD9A 1S7LA 4EFDA 1XF8A 3KR4A 5EBVA 1WVMA 3W91A 3FNCA 2QECA 4IK2A 2GLFA 4C9AA 1CPXA 4NEXA 5H84A 2B4BA 4U9YA 2D4OA 4R3LA 8CPAA 2HQYA 1Z8XA 4A39A 4LUAA 4P10A 2Y1NA 3IEHA 2O28A 4CYQA 4F0XA 4A37A 4R87A 2PJ8A 3ISZA 1YLOA 4M3SA 3W6SA 5CBMA 1PU9A 2A4NA 4MI1A 1I1DA 3C26A 1XOVA 3D68A 3VGOA 4YU9A 7CPAA 3TLAA 2PJAA 1ZO0A 3VRRA 4GS4A 4YRHA 4CAXA 5K8PA 4C86A 1IU8A 1Y7RA 2I79A 2RC4A 5F49A 1JDEA 4B14A 2Z3LA 1H8LA 5LRJA 4BMHA 4YFJA 5JM6A 2DIKA 2R82A 3S6KA 4C9UA 5HMNA 4M6HA 2Q44A 4B13A 2FSRA 4UF4A 3IC1A 2B58A 5BWAB 4DNCA 4B5OA 3WC5A 1HEEA 2BSWA 2XEFA 3PB4X 4GXHA 4JXRA 4DJLA 2QMLA 3F5BA 3FH4A 2ZEPA 2VZZA 3DGVA 1FT7A 5F09A 1OBRA 3TO7A 2EK9A 4AVCA 4CAEA 3PFOA 2VI7A 2PJBA 4NF1A 2CBLA 2PR8A 4KLWA 1M44A 2NYQA 4ONUA 5F47A 3TO6A 2Z3PA 4XNHB 3FIXA 3E0KA 3PB6X 1DE4C 5J3XA 4PPZA 4CPAA 1ZYMA 5AG5A 2K5TA 2FIAA 3I9SA 3N5FA 2CTCA 3V7ZA 3I74A 3TLGA 1F57A 5HXDA 2IMOA 1QSTA 3R95A 3LWUA 2PJ9A 4LX9A 3ZJ0A 1J4JA 2BL1A 3H8FA 4RI1A 4MJXA 3MGDA 3RAMA 2V8HA 2ZW7A 2ZOFA 2PJCA 4OC3A 3FB3A 3KRVA 1WK4A 4OIWA 4CGLA 1X10A 3KKWA 2PR1A 3EIFA 3OAKA 4KOSA 3GKRA 1S7FA 2ODFA 2RB7A 1KWMA 3TO9A 2ZEOA 2AFZA 3KI9A 3PEIA 4WJBA 1P0HA 3R9GA 2DPTA 1VHOA 2B3VA 3IU1A 4MBUA 4MY3A 4P4EA 2CY2A 4TJXA 3S9NA 4MHNA 5IB0A 3NOJA 2YNEA 3EY5A 1LFWA 4PK2A 3T5MA 2R1IA 4GM5A 2ATRA 2D0OA 1M4IA 3PB7X 4C8PA 2XPOA 2F7VA 3IWGA 2CIJA 2G0BA 4C85A 3SHPA 3NE8A 3OB1B 2G3TA 4NGSA 1QSOA 3WABA 4MFPA 4IIYA 1UFHA 3DR8A 4H6ZA 1YLEA 3PFEA 4NGPA 2CNMA 3SJXA 5I4MA 3B2YA 4HNWB 4A4BA 3D2PA 4C9EA 3PT1A 4JVOA 4MCPA 4MRIA 3VRNA 4YGOA 4C8CA 1DTDA 3H8GA 2GIVA 3PGPA 1IGBA 3UY5A 5IR2A 4C2YA 2F5IA 1ARMA 2OB0A 3EO4A 3IWWA 4XNHC 4CRYB 4IIXA 3PLFB 4OAEA 3T05A 4LQGA 3TTHA 4B6ZA 4E5SA 2JLMA 4R9MA 2XPNA 1XBUA 4P6YA 4A32A 3GIUA 5A28A 4FAIA 4C84A 3BLNA 4C7HA 4JZ0A 4R7MA 3FECA 2Q0YA 2ZENA 3I6SA 3VROA 3DSBA 4CGPA 1PUAA 4R6TA 2MP0A 4C8TA 3PZJA 3GJZA 4BPWB 4Z65A 1XRYA 4E8OA 4TWEA 2GANA 2PRQA 2V8GA 1BAVA 4MCQA 2I00A 2V77A 3SJFA 3CPAA 4RN7A 4UEFA 4CAFA 1JDBC 2AE6A 2ZPAA 4RUHA 1Z9EA 1Y7EA 2P0WA 2PE3A 1TF9A 2O4HA 4MFKA 4UBRA 4UWIA 1ZL0A 3ISXA 1ARLA 1CX8A 4FD4A 5KTAA 4XPKA 1M6VB 2Y1MA 4F9UA 4P44A 3WR7A 3T0TA 3D4UA 2OLSA 1GGOA 2HV2A 2VQYA 2Q4YA 2AUNA 3U88C 1Y0YA 1XFOA 4MY0A 4OKOA 1AYEA 1F2OA 2XEGA 2HI6A 1MK4A 1KEEB 4OADA 1LAMA 4AXVA 4C7IA 3D7FA 3IU2A 2D0PA 4NGNA 1IOIA 2R8VA 4H2KA 1ELLP 2ZEFA 4JD6A 4KS9A 3K9TA 4R8FA 1Q2CA 3JTKA 4J3GA 2JEVA 2PSWA 2B5GA 3OWCA 3BXMA 1CBXA 3VRQA 2PJ2A 5F13A 1Q2YA 4A33A 1Q5XA 3VTAA 4NGMA 3CXPA 1RO5A 5HVGA 3LMSA 3BUOB 4O23A 2REFA 5HKYA 4DUKA 4EWTA 4A4CA 1NSLA 1M4GA 2F8HA 2GE3A 1YW6A 4KVOE 4UCMA 4KOTA 1NSAA 1Y9ZA 4NCZA 2P6FA 3B7IA 1B87A 4HNXB 4MHPA 2OZHA 4JLYA 2C1CA 4M8DA 3FRMA 1FNOA 1MJAA 4BTFA 3VRPA 3D66A 5HVFA 4L89A 4CYPA 4KOVA 2OR4A 1BPMA 4MHYA 4DYOA 1N71A 2YNDA 4MI4A 1ZLIA 3FVLA 5J8CA 5K8MA 3CZXA 5HKZA 2PVWA 4QUSA 5G1ZA 2PCNA 4INJA 4TNUA 1J3LA 2VKZG 4X5KA 4P4FA 2DLAA 4BBHA 1CPSA 3K9UA 4UCPA 1CE8B 4M6IA 4B5PB 1SQHA 2J9AA 2G9DA 3EZBA 3L2NA 3HLPA 3EZEA 2YJVA 3SI0A 2DF5A 3EFAA 2XEIA 3R1KA 4NXYA 3KASA 3B3WA 1TF8A 3D8PA 4A38A 4H6UA 1B6BA 1BO4A 4E0AA 1ZLHA 2VXKA 3JRUA 3D3SA 1LANA 3B3CA 3NH5A 3R9FA 2NSMA 4A31A 2XPPA 1BXRB 4C99A 4QB9A 3WT4A 1XJOA 1Z4RA 4CZ1A 5EC4A 1CP6A 1NMTA 1Y9KA 2B3UA 1TIQA 2Y0MA 3B3SA 4NGTA 1Z5RA 2PJ5A 2WUUA 3I3GA 2DEAA 3N7ZA 1M4DA 4UWJA 1AUGA 3ZNIA 3KQZA 3BUXB 3RBUA 1EO0A 4KUBA 4CDKA 4U5YA 3D2MA 3GLJA 2PJ1A 3MN8A 4JJXA 2YNCA 1S7NA 4X3RA 4GPLB 3F0AA 4EMEA 1C30B 5F48A 4CGNA 4HPSA 2Z10A 2BO9A 1IY7A 5ELYA 1HDUA 1KUVA 2GREA 1T36B 2AFUA 1CM0A 4XPDC 5F1YA 1NE9A 2FM4A 1ON0A 1UWYA 4H1HA 3S9MA 2PJ0A 1IYKA 3VWDA 1YVOA 3TT2A 3H8EA 2PCUA 3QAYA 3KHZA 2BEIA 5D8NA 5DWNA 2PJ7A 2YGWA 1FBVA 2C27A 4PXBA 5AG4A 5F46A 4CRZB 1NXJA 4KORA 2EBJA 3SXNA 1V0CA 1A2ZA 4ORFA 2GP4A 1QSRA 2ZW5A 1NBWA 2Q4VA 2ZXVA 2P6EA 3A9LA 4C9RA 2C6GA 2EWBA 4UCNA 1VBHA 1VIXA 2BUEA 3FXTA 3O8ZA 3B35A 4FD7A 4Q36A 4UFVA 2AFMA 4PXEA 4OP4A 3ZZIA 1MJBA 3FJUA 1YVHA 1YVKA 4R57A 4UFXA 5G21A 4ZX9A 3T8WA 1TKFA 2WSAA 3ICUA 2PJ3A 2IQ6A 3NH4A 4LQ6A 4JYWA 2CXAA 2GU2A 3RNZA 2IJZA 2CNTA 2Q4ZA 3SJGA 2ABZA 1VHSA 3HUVA 1XIXA 2AUMA 4ZY1A 1KUYA 2FL4A 2XEJA 1EZBA 2X0SA 1IOFA 4M85A 4NGQA 1YQEA 4KOUA 5ISVA 4IF5A 4UA3A 1EE3P 3TYXA 2N3AB 3F8KA 5D29A 4ZX8A 1Z9UA 3TOAA 1ZG8A 3TFYA 3G8WA 4PV6A 2J8MA 3G3SA 1CP7A 5JGFA 3RYOA 3CXQA 1XMTA 1S3ZA 2BCOA 3IIBA 1GYTA 4CAVA 1Z8TA 1M4LA 2RFHA 3FYNA 3QAHA 4K30A 3D7GA 2Z3MA 1R57A 3GUXA 3S9LA 4K3NA 1TKHA 5AGEA 1X12A 3WC7A 2HC9A 3TE4A 1YR0A 3SI1A 2B4DB 4B10A 5CNPA 1YGHA 3I1UA 2HUZA 4E2AA 2ARHA 2CF4A 2REEA 4NFRA 3LD2A 5F5XA 3NH8A 4UFWA 4P4BA 5GCNA 4MFJA 3VARA 3CPXA 4MFQA 3BUWB 4RR2B 2C6CA 5JQ4A 4PK3A
chains in the Genus database with same CATH topology
2PIZA 5HVHA 1ZG7A 2ZELA 1Y0RA 3V38A 3VATA 1PCAA 5LYDA 3IJ3A 3TC8A 1BLLE 4F9VA 4A94A 3SI1A 3FEEA 2AFSA 1F2PA 4PXCA 3FMCA 1XMBA 4F8ZA 4ZY2A 4Q7AA 1AMPA 4MMOA 4C9VA 4P45A 3VH9A 1BPNA 3RZAA 5IB9A 4OC1A 2POKA 4MXUA 2JBKA 3SJEA 1PYTB 3PRTA 1QQ9A 1CG2A 1VHEA 1HDQA 1RTQA 4NJRA 4PXDA 2FVGA 3SI2A 5K8NA 2EK8A 3DLJA 4G1PA 2ZEMA 4PQAA 2VL1A 4UEEA 4YN3A 4IHMA 1ZG9A 1YW4A 3CT9A 2PVVA 4YWYA 3MRUA 4NGRA 4P4IA 2CTBA 4KNGE 4OC0A 4OMEA 1YMEA 3PBBA 4OC5A 4P4DA 3KR5A 3K2KA 3CDXA 1LOKA 4X8IA 6CPAA 2WYRA 2BOAA 3BHXA 3D67A 2O53A 3IO1A 1YSJA 2AFOA 4X2TA 5DS0A 2HB6A 5LYLA 2ANPA 3KGQA 4OC4A 3B3TA 1ELMP 4R76A 1TXRA 3NFZA 3FX6A 2ZEHA 1LAPA 2PIYA 2ZEEA 1V6CA 5THWA 4OC2A 5JH9A 2GLJA 1QMUA 2ZEDA 4P4JA 3BI0A 3GB0A 4FBEA 4IAVA 2I3CA 2AFXA 4ZY0A 3QNVA 2PJ6A 3BI1A 1Z2LA 2V8VA 3PB8X 4ZYQA 2QJ8A 2ZOGA 1Z8LA 3TX8A 1TKJA 3NA6A 4C8UA 3FF3A 4MCSA 5K8OA 2Q43A 1JQGA 3B3VA 5LYFA 1XF1A 4NJQA 1Q7LA 4KSIA 3PB9X 3FEDA 4W9YA 5LYIA 2ZEGA 3KZWA 4ONWA 4MHZA 4UEZA 2PJ4A 3KQXA 4C8FA 3KL9A 4OIDA 2V8DA 5CPAA 4CDJA 2OOTA 2JEWA 4ZI6A 1VGYA 4TJVA 2AFWA 2JBJA 1LCPA 2Q51A 3IFEA 1R43A 4FWUA 4UIBA 5J1QA 5LRGA 2QYVA 4FUUA 3D7DA 2QVPA 4UIAA 4WWVA 2WZNA 1R3NA 2C5QA 3D7HA 3WC6A 3KHXA 3PBEA 4MCRA 5LRKA 2C6PA 4BD9A 4EFDA 3KR4A 1WVMA 4C9AA 4IK2A 2GLFA 1CPXA 8CPAA 4A39A 4P10A 3IEHA 4A37A 2PJ8A 3ISZA 1YLOA 5CBMA 3D68A 4YU9A 7CPAA 2PJAA 5K8PA 4C86A 5JM6A 1H8LA 5LRJA 4C9UA 4UF4A 3IC1A 3WC5A 1HEEA 2XEFA 3PB4X 4DJLA 3FH4A 2ZEPA 3DGVA 1FT7A 5F09A 1OBRA 2EK9A 3PFOA 2PJBA 2NYQA 3PB6X 1DE4C 4PPZA 4CPAA 3V7ZA 3N5FA 2CTCA 3I74A 1F57A 5HXDA 2IMOA 3LWUA 2PJ9A 3H8FA 3RAMA 2V8HA 2ZOFA 2PJCA 4OC3A 4OIWA 3EIFA 2RB7A 1KWMA 2ZEOA 2AFZA 3KI9A 3PEIA 4WJBA 1VHOA 4P4EA 4TJXA 3S9NA 4MHNA 1LFWA 4GM5A 3PB7X 4C8PA 2F7VA 2CIJA 4C85A 3WABA 4NGSA 3PFEA 4NGPA 5I4MA 3SJXA 3B2YA 4C9EA 4MCPA 4MRIA 4C8CA 1DTDA 3H8GA 1IGBA 5IR2A 1ARMA 3IWWA 4LQGA 4B6ZA 1XBUA 4P6YA 4FAIA 4C84A 4JZ0A 4R7MA 3FECA 2ZENA 3I6SA 4R6TA 4C8TA 4Z65A 1XRYA 4TWEA 2PRQA 2V8GA 1BAVA 4MCQA 2V77A 3CPAA 3SJFA 4UEFA 4RUHA 1Y7EA 2PE3A 1TF9A 2O4HA 3ISXA 1ARLA 1CX8A 4F9UA 4P44A 3D4UA 1Y0YA 1XFOA 4OKOA 1AYEA 1F2OA 2XEGA 1LAMA 4AXVA 3D7FA 4NGNA 4H2KA 4R8FA 1ELLP 2ZEFA 3K9TA 3BXMA 1CBXA 2PJ2A 3VTAA 4NGMA 5HVGA 3LMSA 4O23A 4DUKA 4EWTA 2F8HA 1YW6A 1NSAA 1Y9ZA 3B7IA 4MHPA 2C1CA 1FNOA 5HVFA 3D66A 4DYOA 2OR4A 1BPMA 4MHYA 3FVLA 1ZLIA 5K8MA 2PVWA 4TNUA 4P4FA 1CPSA 2J9AA 2G9DA 3L2NA 3HLPA 2XEIA 3KASA 3B3WA 1TF8A 4A38A 1ZLHA 3JRUA 1LANA 3B3CA 3NH5A 4C99A 2NSMA 3WT4A 1XJOA 4C8AA 1CP6A 3B3SA 4NGTA 1Z5RA 2PJ5A 2DEAA 3SI0A 4CDKA 3KQZA 3RBUA 3GLJA 2PJ1A 3MN8A 4X3RA 4EMEA 2BO9A 1IY7A 5ELYA 1HDUA 2GREA 2AFUA 1UWYA 3S9MA 3H8EA 2PCUA 3KHZA 5D8NA 2PJ7A 4PXBA 2GP4A 4C9RA 2C6GA 2EWBA 1VIXA 3B35A 2AFMA 4PXEA 4OP4A 3FJUA 4ZX9A 3T8WA 1TKFA 3ICUA 2PJ3A 2IQ6A 3NH4A 4JYWA 2GU2A 2IJZA 2Q4ZA 3SJGA 2ABZA 3HUVA 4ZY1A 2XEJA 4NGQA 1EE3P 4ZX8A 5D29A 1ZG8A 1CP7A 5JGFA 3IIBA 2BCOA 1GYTA 1M4LA 2RFHA 3D7GA 3GUXA 4K3NA 3S9LA 1TKHA 3WC7A 2HC9A 3I1UA 2CF4A 4NFRA 3NH8A 3VARA 4P4BA 3CPXA 2PJ0A 2C6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PIZ A;  5HVH A;  1ZG7 A;  2ZEL A;  1Y0R A;  3V38 A;  3VAT A;  1PCA A;  5LYD A;  3IJ3 A;  3TC8 A;  1BLL E;  4F9V A;  4A94 A;  3SI1 A;  3FEE A;  2AFS A;  1F2P A;  4PXC A;  3FMC A;  1XMB A;  4F8Z A;  4ZY2 A;  4Q7A A;  1AMP A;  4MMO A;  4C9V A;  4P45 A;  3VH9 A;  1BPN A;  3RZA A;  5IB9 A;  4OC1 A;  2POK A;  4MXU A;  2JBK A;  3SJE A;  1PYT B;  3PRT A;  1QQ9 A;  1CG2 A;  1VHE A;  1HDQ A;  1RTQ A;  4NJR A;  4PXD A;  2FVG A;  3SI2 A;  5K8N A;  2EK8 A;  3DLJ A;  4G1P A;  2ZEM A;  4PQA A;  2VL1 A;  4UEE A;  4YN3 A;  4IHM A;  1ZG9 A;  1YW4 A;  3CT9 A;  2PVV A;  4YWY A;  3MRU A;  4NGR A;  4P4I A;  2CTB A;  4KNG E;  4OC0 A;  4OME A;  1YME A;  3PBB A;  4OC5 A;  4P4D A;  3KR5 A;  3K2K A;  3CDX A;  1LOK A;  4X8I A;  6CPA A;  2WYR A;  2BOA A;  3BHX A;  3D67 A;  2O53 A;  3IO1 A;  1YSJ A;  2AFO A;  4X2T A;  5DS0 A;  2HB6 A;  5LYL A;  2ANP A;  3KGQ A;  4OC4 A;  3B3T A;  1ELM P;  4R76 A;  1TXR A;  3NFZ A;  3FX6 A;  2ZEH A;  1LAP A;  2PIY A;  2ZEE A;  1V6C A;  5THW A;  4OC2 A;  5JH9 A;  2GLJ A;  1QMU A;  2ZED A;  4P4J A;  3BI0 A;  3GB0 A;  4FBE A;  4IAV A;  2I3C A;  2AFX A;  4ZY0 A;  3QNV A;  2PJ6 A;  3BI1 A;  1Z2L A;  2V8V A;  3PB8 X;  4ZYQ A;  2QJ8 A;  2ZOG A;  1Z8L A;  3TX8 A;  1TKJ A;  3NA6 A;  4C8U A;  3FF3 A;  4MCS A;  5K8O A;  2Q43 A;  1JQG A;  3B3V A;  5LYF A;  1XF1 A;  4NJQ A;  1Q7L A;  4KSI A;  3PB9 X;  3FED A;  4W9Y A;  5LYI A;  2ZEG A;  3KZW A;  4ONW A;  4MHZ A;  4UEZ A;  2PJ4 A;  3KQX A;  4C8F A;  3KL9 A;  4OID A;  2V8D A;  5CPA A;  4CDJ A;  2OOT A;  2JEW A;  4ZI6 A;  1VGY A;  4TJV A;  2AFW A;  2JBJ A;  1LCP A;  2Q51 A;  3IFE A;  1R43 A;  4FWU A;  4UIB A;  5J1Q A;  5LRG A;  2QYV A;  4FUU A;  3D7D A;  2QVP A;  4UIA A;  4WWV A;  2WZN A;  1R3N A;  3D7H A;  3WC6 A;  3KHX A;  3PBE A;  4MCR A;  5LRK A;  2C6P A;  4BD9 A;  4EFD A;  3KR4 A;  1WVM A;  4C9A A;  4IK2 A;  2GLF A;  1CPX A;  8CPA A;  4A39 A;  4P10 A;  3IEH A;  4A37 A;  2PJ8 A;  3ISZ A;  1YLO A;  5CBM A;  3D68 A;  4YU9 A;  7CPA A;  2PJA A;  5K8P A;  4C86 A;  5JM6 A;  1H8L A;  5LRJ A;  4C9U A;  4UF4 A;  3IC1 A;  3WC5 A;  1HEE A;  2XEF A;  3PB4 X;  4DJL A;  3FH4 A;  2ZEP A;  3DGV A;  1FT7 A;  5F09 A;  1OBR A;  2EK9 A;  3PFO A;  2PJB A;  2NYQ A;  3PB6 X;  1DE4 C;  4PPZ A;  4CPA A;  3V7Z A;  3N5F A;  2CTC A;  3I74 A;  1F57 A;  5HXD A;  2IMO A;  3LWU A;  2PJ9 A;  3H8F A;  3RAM A;  2V8H A;  2ZOF A;  2PJC A;  4OC3 A;  4OIW A;  3EIF A;  2RB7 A;  1KWM A;  2ZEO A;  2AFZ A;  3KI9 A;  3PEI A;  4WJB A;  1VHO A;  4P4E A;  4TJX A;  3S9N A;  4MHN A;  1LFW A;  4GM5 A;  3PB7 X;  4C8P A;  2F7V A;  2CIJ A;  4C85 A;  3WAB A;  4NGS A;  3PFE A;  4NGP A;  5I4M A;  3SJX A;  3B2Y A;  4C9E A;  4MCP A;  4MRI A;  4C8C A;  1DTD A;  3H8G A;  1IGB A;  1ARM A;  3IWW A;  4LQG A;  4B6Z A;  1XBU A;  4P6Y A;  4FAI A;  4C84 A;  4JZ0 A;  4R7M A;  3FEC A;  2ZEN A;  3I6S A;  4R6T A;  4C8T A;  4Z65 A;  1XRY A;  4TWE A;  2PRQ A;  2V8G A;  1BAV A;  4MCQ A;  2V77 A;  3CPA A;  3SJF A;  4UEF A;  4RUH A;  1Y7E A;  2PE3 A;  1TF9 A;  2O4H A;  3ISX A;  1ARL A;  1CX8 A;  4F9U A;  4P44 A;  3D4U A;  1Y0Y A;  1XFO A;  4OKO A;  1AYE A;  1F2O A;  2XEG A;  1LAM A;  4AXV A;  3D7F A;  4NGN A;  4H2K A;  4R8F A;  1ELL P;  2ZEF A;  3K9T A;  3BXM A;  1CBX A;  2PJ2 A;  3VTA A;  4NGM A;  5HVG A;  3LMS A;  4O23 A;  4DUK A;  4EWT A;  2F8H A;  1YW6 A;  1NSA A;  1Y9Z A;  3B7I A;  4MHP A;  2C1C A;  1FNO A;  5HVF A;  3D66 A;  4DYO A;  2OR4 A;  1BPM A;  4MHY A;  3FVL A;  1ZLI A;  5K8M A;  2PVW A;  4TNU A;  4P4F A;  1CPS A;  2J9A A;  2G9D A;  3L2N A;  3HLP A;  2XEI A;  3KAS A;  3B3W A;  1TF8 A;  4A38 A;  1ZLH A;  3JRU A;  1LAN A;  3B3C A;  3NH5 A;  4C99 A;  2NSM A;  3WT4 A;  1XJO A;  4C8A A;  1CP6 A;  3B3S A;  4NGT A;  1Z5R A;  2PJ5 A;  2DEA A;  3SI0 A;  4CDK A;  3KQZ A;  3RBU A;  3GLJ A;  2PJ1 A;  3MN8 A;  4X3R A;  4EME A;  2BO9 A;  1IY7 A;  5ELY A;  1HDU A;  2GRE A;  2AFU A;  1UWY A;  3S9M A;  3H8E A;  2PCU A;  3KHZ A;  5D8N A;  2PJ7 A;  4PXB A;  4C9R A;  2C6G A;  2EWB A;  1VIX A;  3B35 A;  2AFM A;  4PXE A;  4OP4 A;  3FJU A;  4ZX9 A;  3T8W A;  1TKF A;  3ICU A;  2PJ3 A;  2IQ6 A;  3NH4 A;  4JYW A;  2GU2 A;  2IJZ A;  2Q4Z A;  3SJG A;  2ABZ A;  3HUV A;  4ZY1 A;  2XEJ A;  4NGQ A;  1EE3 P;  4ZX8 A;  5D29 A;  1ZG8 A;  1CP7 A;  5JGF A;  3IIB A;  2BCO A;  1GYT A;  1M4L A;  2RFH A;  3D7G A;  3GUX A;  4K3N A;  3S9L A;  1TKH A;  3WC7 A;  2HC9 A;  3I1U A;  2CF4 A;  4NFR A;  3NH8 A;  3VAR A;  4P4B A;  3CPX A;  2PJ0 A;  2C6C A; 
#chains in the Genus database with same CATH topology
 4MJ8 A;  3W6X A;  2PIZ A;  5HVH A;  1ZG7 A;  2P6G A;  2ZEL A;  4J0N A;  2FT0 A;  4OLL A;  1Y0R A;  1S5K A;  5E96 A;  3R9E A;  4BPX B;  1M1D A;  5EMI A;  3S6H A;  2FS5 A;  3T90 A;  3V38 A;  1PCA A;  3NE7 A;  4KZT A;  3VAT A;  1I12 A;  3IJ3 A;  5LYD A;  4CYO A;  3TC8 A;  5KTD A;  5JVL A;  3OB2 B;  1BLL E;  4F9V A;  3T07 A;  3DNS A;  4A94 A;  3BUN B;  3FEE A;  1L0C A;  1KZF A;  1S60 A;  2AFS A;  1F2P A;  2G3A A;  4IUS A;  4PXC A;  1MJ9 A;  4A30 A;  5I0C A;  1GHE A;  4AVB A;  3FMC A;  4ZGY B;  1XMB A;  2WPX A;  4AVA A;  4AG7 A;  4Y49 C;  4ZY2 A;  4CAW A;  4Q7A A;  2DPS A;  4F8Z A;  2VBQ A;  2VEZ A;  3U1B A;  3GYA A;  4XPD B;  1AMP A;  4MMO A;  3S6F A;  2PC1 A;  4C9V A;  4COB A;  1IID A;  4P45 A;  3BJ8 A;  3VH9 A;  2OU2 A;  2EZB A;  5F9M A;  1KUX A;  1BPN A;  2FE7 A;  2Z0Z A;  3RZA A;  4KOY A;  4OC1 A;  5IB9 A;  4C8A A;  4MHD A;  3PP9 A;  2POK A;  4MXU A;  2JDD A;  4QBJ A;  1Z4E A;  5HH1 A;  2JBK A;  2B5G B;  2EZA A;  3TLB A;  3SJE A;  5AG7 A;  2NMT A;  1PYT B;  1FY7 A;  2OZG A;  3PRT A;  1QQ9 A;  1CJW A;  3IGR A;  4U9Z A;  1CG2 A;  1VHE A;  1HDQ A;  4CGM A;  1BOB A;  4FD5 A;  4CYN A;  1RTQ A;  4B5P A;  4NJR A;  4PXD A;  2EUI A;  2FVG A;  4M6G A;  3SI2 A;  5K8N A;  4EYS A;  2EK8 A;  3DLJ A;  3DR6 A;  4G1P A;  2ZEM A;  4PQA A;  2VL1 A;  4HKF A;  4UEE A;  2AJ6 A;  1JWQ A;  1LRZ A;  5IX3 A;  4YN3 A;  4IHM A;  1ZG9 A;  1A9X B;  1YW4 A;  3H5Z A;  2E28 A;  3PFV A;  3CT9 A;  2PDO A;  2PVV A;  4HNY B;  2H5M A;  4NGR A;  4P4I A;  3MRU A;  2CTB A;  4YWY A;  4KNG E;  2Q7B A;  3V8I A;  4OC0 A;  4OME A;  2QIR A;  3LOD A;  3P2F A;  5JPH A;  1YME A;  1S7K A;  4KSA A;  1IYL A;  3B8G A;  3PBB A;  4OC5 A;  4P4D A;  3KR5 A;  3K2K A;  3CDX A;  1LOK A;  2PRB A;  2Q04 A;  4COG A;  4CS0 B;  4A2Z A;  5A27 A;  4X8I A;  3IWE A;  6CPA A;  2WYR A;  2FIW A;  2HRO A;  2BOA A;  4F0Y A;  1EZA A;  3EC4 A;  4EVY A;  4XPL A;  3BHX A;  3D67 A;  2O53 A;  4RS2 A;  3IO1 A;  1YSJ A;  2AFO A;  4X2T A;  3TOB A;  4C2Z A;  5DS0 A;  4B12 A;  2HB6 A;  4KOX A;  4BIN A;  4KOW A;  5LYL A;  1XE4 A;  5FVJ A;  2ANP A;  3KGQ A;  3QB8 A;  4OC4 A;  4A95 A;  4C68 A;  5IV0 A;  2XPL A;  1C3O B;  3EZA A;  1KC7 A;  3B3T A;  3TLZ A;  1ELM P;  3JUW A;  2Q7S A;  4R76 A;  3TLG B;  1TXR A;  3NFZ A;  3FX6 A;  1IB1 E;  2ZEH A;  2FXF A;  1LAP A;  2PIY A;  1WWZ A;  2ZEE A;  1VI4 A;  3K4I A;  1V6C A;  3HPG G;  5HKW A;  2WPW A;  3RO0 A;  4C2X A;  2YJT A;  3TLY A;  2VZY A;  4NSQ A;  5THW A;  2IL4 A;  4OC2 A;  5JH9 A;  2GLJ A;  1QMU A;  1QSM A;  2ZED A;  4KVM E;  4P4J A;  1B47 A;  3BI0 A;  3GB0 A;  2DXQ A;  5G20 A;  4FBE A;  3C8O A;  4IAV A;  4PSW A;  2X7B A;  4E94 A;  1Q2D A;  2I3C A;  2CNS A;  2OZU A;  1WJT A;  4FD6 A;  4I49 A;  2AFX A;  2EO8 A;  4ZY0 A;  3QNV A;  4F6A A;  3DDD A;  2PJ6 A;  4R3K A;  2HWG A;  1K4J A;  3BI1 A;  2R7H A;  1Z2L A;  4QVT A;  5C88 A;  2V8V A;  3PB8 X;  4BPU B;  5K99 A;  4ZYQ A;  2QJ8 A;  3BUM B;  1Z8L A;  2ZOG A;  4Y49 B;  2Z3K A;  3TX8 A;  3TLE A;  1TKJ A;  1YX0 A;  3P2H A;  3NA6 A;  5H86 A;  4C8U A;  2GFQ A;  1YK3 A;  3FF3 A;  2J8R A;  2Z11 A;  5C82 A;  4MCS A;  1KBL A;  5K8O A;  3T9Y A;  4AG9 A;  5FD8 A;  2Q43 A;  1JQG A;  2EVN A;  3B3V A;  4KVX A;  4KSF A;  1I21 A;  5BY0 A;  5LYF A;  1XF1 A;  4JXQ A;  2EZC A;  4NJQ A;  1Q7L A;  3HPH E;  3NFQ A;  5JYB A;  3VWE A;  4KSI A;  3HMJ G;  3PB9 X;  4MFL A;  3TLC A;  3FED A;  4W9Y A;  4KLV A;  2ZEG A;  4QC6 A;  3KZW A;  3F9K C;  5G22 A;  5LYI A;  5J8F A;  4ONW A;  4MHZ A;  3SXO A;  3SR3 A;  4UEZ A;  2PJ4 A;  1U6M A;  5AXI A;  3KQX A;  5AG6 A;  1IIC A;  1ZRS A;  4C8F A;  2B4D A;  4JWP A;  1DIK A;  3KL9 A;  2D4P A;  4OID A;  4H89 A;  2YNC C;  2V8D A;  5CPA A;  3R96 A;  4B11 A;  3FBU A;  4CDJ A;  2OOT A;  4CO9 A;  3H4Q A;  3G23 A;  2JEW A;  4ZI6 A;  3CXS A;  2JDC A;  1VGY A;  4KUA A;  1OZP A;  4TJV A;  2AFW A;  2JBJ A;  1LCP A;  1XEB A;  2Q51 A;  3LAC A;  2B4J C;  3EXN A;  4L8A A;  3IFE A;  1Y9W A;  1R43 A;  2KCW A;  4FWU A;  2J8N A;  4AB7 A;  4UIB A;  2OH1 A;  3S6G A;  1QSN A;  5J1Q A;  4CGO A;  5DWM A;  1RXT A;  4Q38 A;  5LRG A;  2QYV A;  4FUU A;  4II9 A;  2FCK A;  3D7D A;  3JVN A;  2QVP A;  1VBG A;  4MFZ A;  4UIA A;  3BJ7 A;  3GY9 A;  2Z3N A;  4WWV A;  1P4N A;  3TCV A;  2WZN A;  1CS0 B;  1R3N A;  2B0A A;  5KTC A;  2UV8 G;  4ZBG A;  2C5Q A;  2ZW6 A;  3D7H A;  1VKC A;  1YRE A;  3WC6 A;  3KHX A;  1R61 A;  1Z8W A;  3PBE A;  4MCR A;  4PSX A;  2R98 A;  2Z3O A;  3OP0 A;  2PQ8 A;  2ZW4 A;  5LRK A;  2C6P A;  4BD9 A;  1S7L A;  4EFD A;  1XF8 A;  3KR4 A;  5EBV A;  1WVM A;  3W91 A;  3FNC A;  2QEC A;  4IK2 A;  2GLF A;  4C9A A;  1CPX A;  4NEX A;  5H84 A;  2B4B A;  4U9Y A;  2D4O A;  4R3L A;  8CPA A;  2HQY A;  1Z8X A;  4A39 A;  4LUA A;  4P10 A;  2Y1N A;  3IEH A;  2O28 A;  4CYQ A;  4F0X A;  4A37 A;  4R87 A;  2PJ8 A;  3ISZ A;  1YLO A;  4M3S A;  3W6S A;  5CBM A;  1PU9 A;  2A4N A;  4MI1 A;  1I1D A;  3C26 A;  1XOV A;  3D68 A;  3VGO A;  4YU9 A;  7CPA A;  3TLA A;  2PJA A;  1ZO0 A;  3VRR A;  4GS4 A;  4YRH A;  4CAX A;  5K8P A;  4C86 A;  1IU8 A;  1Y7R A;  2I79 A;  2RC4 A;  5F49 A;  1JDE A;  4B14 A;  2Z3L A;  1H8L A;  5LRJ A;  4BMH A;  4YFJ A;  5JM6 A;  2DIK A;  2R82 A;  3S6K A;  4C9U A;  5HMN A;  4M6H A;  2Q44 A;  4B13 A;  2FSR A;  4UF4 A;  3IC1 A;  2B58 A;  5BWA B;  4DNC A;  4B5O A;  3WC5 A;  1HEE A;  2BSW A;  2XEF A;  3PB4 X;  4GXH A;  4JXR A;  4DJL A;  2QML A;  3F5B A;  3FH4 A;  2ZEP A;  2VZZ A;  3DGV A;  1FT7 A;  5F09 A;  1OBR A;  3TO7 A;  2EK9 A;  4AVC A;  4CAE A;  3PFO A;  2VI7 A;  2PJB A;  4NF1 A;  2CBL A;  2PR8 A;  4KLW A;  1M44 A;  2NYQ A;  4ONU A;  5F47 A;  3TO6 A;  2Z3P A;  4XNH B;  3FIX A;  3E0K A;  3PB6 X;  1DE4 C;  5J3X A;  4PPZ A;  4CPA A;  1ZYM A;  5AG5 A;  2K5T A;  2FIA A;  3I9S A;  3N5F A;  2CTC A;  3V7Z A;  3I74 A;  3TLG A;  1F57 A;  5HXD A;  2IMO A;  1QST A;  3R95 A;  3LWU A;  2PJ9 A;  4LX9 A;  3ZJ0 A;  1J4J A;  2BL1 A;  3H8F A;  4RI1 A;  4MJX A;  3MGD A;  3RAM A;  2V8H A;  2ZW7 A;  2ZOF A;  2PJC A;  4OC3 A;  3FB3 A;  3KRV A;  1WK4 A;  4OIW A;  4CGL A;  1X10 A;  3KKW A;  2PR1 A;  3EIF A;  3OAK A;  4KOS A;  3GKR A;  1S7F A;  2ODF A;  2RB7 A;  1KWM A;  3TO9 A;  2ZEO A;  2AFZ A;  3KI9 A;  3PEI A;  4WJB A;  1P0H A;  3R9G A;  2DPT A;  1VHO A;  2B3V A;  3IU1 A;  4MBU A;  4MY3 A;  4P4E A;  2CY2 A;  4TJX A;  3S9N A;  4MHN A;  5IB0 A;  3NOJ A;  2YNE A;  3EY5 A;  1LFW A;  4PK2 A;  3T5M A;  2R1I A;  4GM5 A;  2ATR A;  2D0O A;  1M4I A;  3PB7 X;  4C8P A;  2XPO A;  2F7V A;  3IWG A;  2CIJ A;  2G0B A;  4C85 A;  3SHP A;  3NE8 A;  3OB1 B;  2G3T A;  4NGS A;  1QSO A;  3WAB A;  4MFP A;  4IIY A;  1UFH A;  3DR8 A;  4H6Z A;  1YLE A;  3PFE A;  4NGP A;  2CNM A;  3SJX A;  5I4M A;  3B2Y A;  4HNW B;  4A4B A;  3D2P A;  4C9E A;  3PT1 A;  4JVO A;  4MCP A;  4MRI A;  3VRN A;  4YGO A;  4C8C A;  1DTD A;  3H8G A;  2GIV A;  3PGP A;  1IGB A;  3UY5 A;  5IR2 A;  4C2Y A;  2F5I A;  1ARM A;  2OB0 A;  3EO4 A;  3IWW A;  4XNH C;  4CRY B;  4IIX A;  3PLF B;  4OAE A;  3T05 A;  4LQG A;  3TTH A;  4B6Z A;  4E5S A;  2JLM A;  4R9M A;  2XPN A;  1XBU A;  4P6Y A;  4A32 A;  3GIU A;  5A28 A;  4FAI A;  4C84 A;  3BLN A;  4C7H A;  4JZ0 A;  4R7M A;  3FEC A;  2Q0Y A;  2ZEN A;  3I6S A;  3VRO A;  3DSB A;  4CGP A;  1PUA A;  4R6T A;  2MP0 A;  4C8T A;  3PZJ A;  3GJZ A;  4BPW B;  4Z65 A;  1XRY A;  4E8O A;  4TWE A;  2GAN A;  2PRQ A;  2V8G A;  1BAV A;  4MCQ A;  2I00 A;  2V77 A;  3SJF A;  3CPA A;  4RN7 A;  4UEF A;  4CAF A;  1JDB C;  2AE6 A;  2ZPA A;  4RUH A;  1Z9E A;  1Y7E A;  2P0W A;  2PE3 A;  1TF9 A;  2O4H A;  4MFK A;  4UBR A;  4UWI A;  1ZL0 A;  3ISX A;  1ARL A;  1CX8 A;  4FD4 A;  5KTA A;  4XPK A;  1M6V B;  2Y1M A;  4F9U A;  4P44 A;  3WR7 A;  3T0T A;  3D4U A;  2OLS A;  1GGO A;  2HV2 A;  2VQY A;  2Q4Y A;  2AUN A;  3U88 C;  1Y0Y A;  1XFO A;  4MY0 A;  4OKO A;  1AYE A;  1F2O A;  2XEG A;  2HI6 A;  1MK4 A;  1KEE B;  4OAD A;  1LAM A;  4AXV A;  4C7I A;  3D7F A;  3IU2 A;  2D0P A;  4NGN A;  1IOI A;  2R8V A;  4H2K A;  1ELL P;  2ZEF A;  4JD6 A;  4KS9 A;  3K9T A;  4R8F A;  1Q2C A;  3JTK A;  4J3G A;  2JEV A;  2PSW A;  2B5G A;  3OWC A;  3BXM A;  1CBX A;  3VRQ A;  2PJ2 A;  5F13 A;  1Q2Y A;  4A33 A;  1Q5X A;  3VTA A;  4NGM A;  3CXP A;  1RO5 A;  5HVG A;  3LMS A;  3BUO B;  4O23 A;  2REF A;  5HKY A;  4DUK A;  4EWT A;  4A4C A;  1NSL A;  1M4G A;  2F8H A;  2GE3 A;  1YW6 A;  4KVO E;  4UCM A;  4KOT A;  1NSA A;  1Y9Z A;  4NCZ A;  2P6F A;  3B7I A;  1B87 A;  4HNX B;  4MHP A;  2OZH A;  4JLY A;  2C1C A;  4M8D A;  3FRM A;  1FNO A;  1MJA A;  4BTF A;  3VRP A;  3D66 A;  5HVF A;  4L89 A;  4CYP A;  4KOV A;  2OR4 A;  1BPM A;  4MHY A;  4DYO A;  1N71 A;  2YND A;  4MI4 A;  1ZLI A;  3FVL A;  5J8C A;  5K8M A;  3CZX A;  5HKZ A;  2PVW A;  4QUS A;  5G1Z A;  2PCN A;  4INJ A;  4TNU A;  1J3L A;  2VKZ G;  4X5K A;  4P4F A;  2DLA A;  4BBH A;  1CPS A;  3K9U A;  4UCP A;  1CE8 B;  4M6I A;  4B5P B;  1SQH A;  2J9A A;  2G9D A;  3EZB A;  3L2N A;  3HLP A;  3EZE A;  2YJV A;  3SI0 A;  2DF5 A;  3EFA A;  2XEI A;  3R1K A;  4NXY A;  3KAS A;  3B3W A;  1TF8 A;  3D8P A;  4A38 A;  4H6U A;  1B6B A;  1BO4 A;  4E0A A;  1ZLH A;  2VXK A;  3JRU A;  3D3S A;  1LAN A;  3B3C A;  3NH5 A;  3R9F A;  2NSM A;  4A31 A;  2XPP A;  1BXR B;  4C99 A;  4QB9 A;  3WT4 A;  1XJO A;  1Z4R A;  4CZ1 A;  5EC4 A;  1CP6 A;  1NMT A;  1Y9K A;  2B3U A;  1TIQ A;  2Y0M A;  3B3S A;  4NGT A;  1Z5R A;  2PJ5 A;  2WUU A;  3I3G A;  2DEA A;  3N7Z A;  1M4D A;  4UWJ A;  1AUG A;  3ZNI A;  3KQZ A;  3BUX B;  3RBU A;  1EO0 A;  4KUB A;  4CDK A;  4U5Y A;  3D2M A;  3GLJ A;  2PJ1 A;  3MN8 A;  4JJX A;  2YNC A;  1S7N A;  4X3R A;  4GPL B;  3F0A A;  4EME A;  1C30 B;  5F48 A;  4CGN A;  4HPS A;  2Z10 A;  2BO9 A;  1IY7 A;  5ELY A;  1HDU A;  1KUV A;  2GRE A;  1T36 B;  2AFU A;  1CM0 A;  4XPD C;  5F1Y A;  1NE9 A;  2FM4 A;  1ON0 A;  1UWY A;  4H1H A;  3S9M A;  2PJ0 A;  1IYK A;  3VWD A;  1YVO A;  3TT2 A;  3H8E A;  2PCU A;  3QAY A;  3KHZ A;  2BEI A;  5D8N A;  5DWN A;  2PJ7 A;  2YGW A;  1FBV A;  2C27 A;  4PXB A;  5AG4 A;  5F46 A;  4CRZ B;  1NXJ A;  4KOR A;  2EBJ A;  3SXN A;  1V0C A;  1A2Z A;  4ORF A;  2GP4 A;  1QSR A;  2ZW5 A;  1NBW A;  2Q4V A;  2ZXV A;  2P6E A;  3A9L A;  4C9R A;  2C6G A;  2EWB A;  4UCN A;  1VBH A;  1VIX A;  2BUE A;  3FXT A;  3O8Z A;  3B35 A;  4FD7 A;  4Q36 A;  4UFV A;  2AFM A;  4PXE A;  4OP4 A;  3ZZI A;  1MJB A;  3FJU A;  1YVH A;  1YVK A;  4R57 A;  4UFX A;  5G21 A;  4ZX9 A;  3T8W A;  1TKF A;  2WSA A;  3ICU A;  2PJ3 A;  2IQ6 A;  3NH4 A;  4LQ6 A;  4JYW A;  2CXA A;  2GU2 A;  3RNZ A;  2IJZ A;  2CNT A;  2Q4Z A;  3SJG A;  2ABZ A;  1VHS A;  3HUV A;  1XIX A;  2AUM A;  4ZY1 A;  1KUY A;  2FL4 A;  2XEJ A;  1EZB A;  2X0S A;  1IOF A;  4M85 A;  4NGQ A;  1YQE A;  4KOU A;  5ISV A;  4IF5 A;  4UA3 A;  1EE3 P;  3TYX A;  2N3A B;  3F8K A;  5D29 A;  4ZX8 A;  1Z9U A;  3TOA A;  1ZG8 A;  3TFY A;  3G8W A;  4PV6 A;  2J8M A;  3G3S A;  1CP7 A;  5JGF A;  3RYO A;  3CXQ A;  1XMT A;  1S3Z A;  2BCO A;  3IIB A;  1GYT A;  4CAV A;  1Z8T A;  1M4L A;  2RFH A;  3FYN A;  3QAH A;  4K30 A;  3D7G A;  2Z3M A;  1R57 A;  3GUX A;  3S9L A;  4K3N A;  1TKH A;  5AGE A;  1X12 A;  3WC7 A;  2HC9 A;  3TE4 A;  1YR0 A;  3SI1 A;  2B4D B;  4B10 A;  5CNP A;  1YGH A;  3I1U A;  2HUZ A;  4E2A A;  2ARH A;  2CF4 A;  2REE A;  4NFR A;  3LD2 A;  5F5X A;  3NH8 A;  4UFW A;  4P4B A;  5GCN A;  4MFJ A;  3VAR A;  3CPX A;  4MFQ A;  3BUW B;  4RR2 B;  2C6C A;  5JQ4 A;  4PK3 A; 
#chains in the Genus database with same CATH homology
 2PIZ A;  5HVH A;  1ZG7 A;  2ZEL A;  1Y0R A;  3V38 A;  3VAT A;  1PCA A;  5LYD A;  3IJ3 A;  3TC8 A;  1BLL E;  4F9V A;  4A94 A;  3SI1 A;  3FEE A;  2AFS A;  1F2P A;  4PXC A;  3FMC A;  1XMB A;  4F8Z A;  4ZY2 A;  4Q7A A;  1AMP A;  4MMO A;  4C9V A;  4P45 A;  3VH9 A;  1BPN A;  3RZA A;  5IB9 A;  4OC1 A;  2POK A;  4MXU A;  2JBK A;  3SJE A;  1PYT B;  3PRT A;  1QQ9 A;  1CG2 A;  1VHE A;  1HDQ A;  1RTQ A;  4NJR A;  4PXD A;  2FVG A;  3SI2 A;  5K8N A;  2EK8 A;  3DLJ A;  4G1P A;  2ZEM A;  4PQA A;  2VL1 A;  4UEE A;  4YN3 A;  4IHM A;  1ZG9 A;  1YW4 A;  3CT9 A;  2PVV A;  4YWY A;  3MRU A;  4NGR A;  4P4I A;  2CTB A;  4KNG E;  4OC0 A;  4OME A;  1YME A;  3PBB A;  4OC5 A;  4P4D A;  3KR5 A;  3K2K A;  3CDX A;  1LOK A;  4X8I A;  6CPA A;  2WYR A;  2BOA A;  3BHX A;  3D67 A;  2O53 A;  3IO1 A;  1YSJ A;  2AFO A;  4X2T A;  5DS0 A;  2HB6 A;  5LYL A;  2ANP A;  3KGQ A;  4OC4 A;  3B3T A;  1ELM P;  4R76 A;  1TXR A;  3NFZ A;  3FX6 A;  2ZEH A;  1LAP A;  2PIY A;  2ZEE A;  1V6C A;  5THW A;  4OC2 A;  5JH9 A;  2GLJ A;  1QMU A;  2ZED A;  4P4J A;  3BI0 A;  3GB0 A;  4FBE A;  4IAV A;  2I3C A;  2AFX A;  4ZY0 A;  3QNV A;  2PJ6 A;  3BI1 A;  1Z2L A;  2V8V A;  3PB8 X;  4ZYQ A;  2QJ8 A;  2ZOG A;  1Z8L A;  3TX8 A;  1TKJ A;  3NA6 A;  4C8U A;  3FF3 A;  4MCS A;  5K8O A;  2Q43 A;  1JQG A;  3B3V A;  5LYF A;  1XF1 A;  4NJQ A;  1Q7L A;  4KSI A;  3PB9 X;  3FED A;  4W9Y A;  5LYI A;  2ZEG A;  3KZW A;  4ONW A;  4MHZ A;  4UEZ A;  2PJ4 A;  3KQX A;  4C8F A;  3KL9 A;  4OID A;  2V8D A;  5CPA A;  4CDJ A;  2OOT A;  2JEW A;  4ZI6 A;  1VGY A;  4TJV A;  2AFW A;  2JBJ A;  1LCP A;  2Q51 A;  3IFE A;  1R43 A;  4FWU A;  4UIB A;  5J1Q A;  5LRG A;  2QYV A;  4FUU A;  3D7D A;  2QVP A;  4UIA A;  4WWV A;  2WZN A;  1R3N A;  2C5Q A;  3D7H A;  3WC6 A;  3KHX A;  3PBE A;  4MCR A;  5LRK A;  2C6P A;  4BD9 A;  4EFD A;  3KR4 A;  1WVM A;  4C9A A;  4IK2 A;  2GLF A;  1CPX A;  8CPA A;  4A39 A;  4P10 A;  3IEH A;  4A37 A;  2PJ8 A;  3ISZ A;  1YLO A;  5CBM A;  3D68 A;  4YU9 A;  7CPA A;  2PJA A;  5K8P A;  4C86 A;  5JM6 A;  1H8L A;  5LRJ A;  4C9U A;  4UF4 A;  3IC1 A;  3WC5 A;  1HEE A;  2XEF A;  3PB4 X;  4DJL A;  3FH4 A;  2ZEP A;  3DGV A;  1FT7 A;  5F09 A;  1OBR A;  2EK9 A;  3PFO A;  2PJB A;  2NYQ A;  3PB6 X;  1DE4 C;  4PPZ A;  4CPA A;  3V7Z A;  3N5F A;  2CTC A;  3I74 A;  1F57 A;  5HXD A;  2IMO A;  3LWU A;  2PJ9 A;  3H8F A;  3RAM A;  2V8H A;  2ZOF A;  2PJC A;  4OC3 A;  4OIW A;  3EIF A;  2RB7 A;  1KWM A;  2ZEO A;  2AFZ A;  3KI9 A;  3PEI A;  4WJB A;  1VHO A;  4P4E A;  4TJX A;  3S9N A;  4MHN A;  1LFW A;  4GM5 A;  3PB7 X;  4C8P A;  2F7V A;  2CIJ A;  4C85 A;  3WAB A;  4NGS A;  3PFE A;  4NGP A;  5I4M A;  3SJX A;  3B2Y A;  4C9E A;  4MCP A;  4MRI A;  4C8C A;  1DTD A;  3H8G A;  1IGB A;  5IR2 A;  1ARM A;  3IWW A;  4LQG A;  4B6Z A;  1XBU A;  4P6Y A;  4FAI A;  4C84 A;  4JZ0 A;  4R7M A;  3FEC A;  2ZEN A;  3I6S A;  4R6T A;  4C8T A;  4Z65 A;  1XRY A;  4TWE A;  2PRQ A;  2V8G A;  1BAV A;  4MCQ A;  2V77 A;  3CPA A;  3SJF A;  4UEF A;  4RUH A;  1Y7E A;  2PE3 A;  1TF9 A;  2O4H A;  3ISX A;  1ARL A;  1CX8 A;  4F9U A;  4P44 A;  3D4U A;  1Y0Y A;  1XFO A;  4OKO A;  1AYE A;  1F2O A;  2XEG A;  1LAM A;  4AXV A;  3D7F A;  4NGN A;  4H2K A;  4R8F A;  1ELL P;  2ZEF A;  3K9T A;  3BXM A;  1CBX A;  2PJ2 A;  3VTA A;  4NGM A;  5HVG A;  3LMS A;  4O23 A;  4DUK A;  4EWT A;  2F8H A;  1YW6 A;  1NSA A;  1Y9Z A;  3B7I A;  4MHP A;  2C1C A;  1FNO A;  5HVF A;  3D66 A;  4DYO A;  2OR4 A;  1BPM A;  4MHY A;  3FVL A;  1ZLI A;  5K8M A;  2PVW A;  4TNU A;  4P4F A;  1CPS A;  2J9A A;  2G9D A;  3L2N A;  3HLP A;  2XEI A;  3KAS A;  3B3W A;  1TF8 A;  4A38 A;  1ZLH A;  3JRU A;  1LAN A;  3B3C A;  3NH5 A;  4C99 A;  2NSM A;  3WT4 A;  1XJO A;  4C8A A;  1CP6 A;  3B3S A;  4NGT A;  1Z5R A;  2PJ5 A;  2DEA A;  3SI0 A;  4CDK A;  3KQZ A;  3RBU A;  3GLJ A;  2PJ1 A;  3MN8 A;  4X3R A;  4EME A;  2BO9 A;  1IY7 A;  5ELY A;  1HDU A;  2GRE A;  2AFU A;  1UWY A;  3S9M A;  3H8E A;  2PCU A;  3KHZ A;  5D8N A;  2PJ7 A;  4PXB A;  2GP4 A;  4C9R A;  2C6G A;  2EWB A;  1VIX A;  3B35 A;  2AFM A;  4PXE A;  4OP4 A;  3FJU A;  4ZX9 A;  3T8W A;  1TKF A;  3ICU A;  2PJ3 A;  2IQ6 A;  3NH4 A;  4JYW A;  2GU2 A;  2IJZ A;  2Q4Z A;  3SJG A;  2ABZ A;  3HUV A;  4ZY1 A;  2XEJ A;  4NGQ A;  1EE3 P;  4ZX8 A;  5D29 A;  1ZG8 A;  1CP7 A;  5JGF A;  3IIB A;  2BCO A;  1GYT A;  1M4L A;  2RFH A;  3D7G A;  3GUX A;  4K3N A;  3S9L A;  1TKH A;  3WC7 A;  2HC9 A;  3I1U A;  2CF4 A;  4NFR A;  3NH8 A;  3VAR A;  4P4B A;  3CPX A;  2PJ0 A;  2C6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...