4P4BA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor ctt54
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 262
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4bA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4bA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4bA02
1TKHA 2XEIA 2C6PA 4OC4A 4PXDA 2OOTA 2ZEGA 3CT9A 1Y9ZA 4PXBA 2PJBA 4MMOA 4NJRA 1ZLIA 4MCSA 2C1CA 3RBUA 4F9UA 3WC7A 3VTAA 5F09A 5D29A 1ARLA 1XFOA 3KR5A 3D7DA 4A38A 4ZI6A 3S9MA 3MN8A 2AFUA 3B3TA 4O23A 2DEAA 1NSAA 2CTCA 3D68A 4NGMA 4G1PA 4KSIA 1UWYA 4GM5A 3I74A 2BO9A 1XBUA 5K8PA 2PIYA 3NA6A 2QYVA 1LCPA 2ZEHA 2WYRA 2EK8A 1EE3P 1TXRA 4R8FA 4P4IA 4JZ0A 1VIXA 2ANPA 1F2OA 2O4HA 5HVGA 5JH9A 4UEZA 4FUUA 3DLJA 1LAMA 3DGVA 1VHEA 4X3RA 4MHNA 3IWWA 2GLFA 5LRJA 4UEFA 4NGPA 3B3SA 5HXDA 3WC5A 3FEEA 4NGRA 4ONWA 4MCQA 3PB9X 4RUHA 4MCPA 5LYFA 1M4LA 3BXMA 2IMOA 4C8FA 1GYTA 1ARMA 4JYWA 3RAMA 2AFSA 4OKOA 5HVHA 5K8NA 5CPAA 2PE3A 5HVFA 4YWYA 5LRGA 1BAVA 4W9YA 1FT7A 2XEJA 3B2YA 5ELYA 2PVWA 1CPXA 4ZY1A 4X2TA 2BCOA 1CG2A 4PXEA 4P4JA 3FX6A 4R76A 5LYLA 5LRKA 3KZWA 1ZG7A 1Y0YA 2V77A 3PB4X 3NFZA 5JM6A 4AXVA 2XEGA 4OIDA 1YSJA 4PPZA 4OC3A 1ZG8A 3GLJA 1XRYA 4C8TA 3FEDA 2PJ4A 4H2KA 2VL1A 4NFRA 3B3WA 3NH4A 3PB8X 3EIFA 3S9NA 1CBXA 1HDQA 4LQGA 5LYIA 2PJ3A 7CPAA 3KQZA 3HLPA 3VARA 2ZEFA 5LYDA 1RTQA 2PJ5A 2ZELA 3D7FA 4Z65A 1VGYA 5IB9A 1YW6A 4IAVA 3KQXA 4A37A 3KASA 4OMEA 1ELLP 3NH5A 2CTBA 4UIBA 1HDUA 2NSMA 4CDJA 4NGTA 2Q4ZA 3MRUA 4R7MA 3N5FA 4UF4A 3IFEA 3I1UA 4NGQA 3LWUA 4PXCA 2PJ7A 2IJZA 1Q7LA 1CP6A 4NJQA 1ELMP 4C84A 3CDXA 2PJ6A 3FMCA 3FH4A 1TF8A 3WABA 2JEWA 3HUVA 3WT4A 1BPNA 3KL9A 1LFWA 4UIAA 3SI0A 1BLLE 4P4EA 2F7VA 2AFXA 1LANA 4PQAA 4P45A 1CX8A 1ZG9A 2AFOA 3SI1A 4CPAA 4TWEA 5K8MA 4C8PA 2V8GA 2ZEMA 4YU9A 1ZLHA 2JBJA 4WWVA 1AMPA 2ZENA 5J1QA 5THWA 1QMUA 4IHMA 4ZX8A 3IIBA 1TKFA 3D7HA 4C9UA 2PJAA 4OIWA 1YMEA 2BOAA 5JGFA 2POKA 1DTDA 2Q51A 3KR4A 4C8UA 2PVVA 4C8AA 5I4MA 3KHZA 4A94A 4DYOA 1KWMA 4P4DA 3RZAA 4FAIA 3IJ3A 2F8HA 3H8FA 4MCRA 1IGBA 3SJEA 4ZY2A 2PJ2A 2V8DA 3TC8A 4F9VA 3FF3A 4C9EA 1F57A 1JQGA 2G9DA 3PFOA 1TF9A 4OC2A 1XJOA 3NH8A 2ZEOA 4P44A 1FNOA 4DUKA 3PEIA 1AYEA 2PRQA 4CDKA 3PB7X 3GUXA 2QJ8A 3B7IA 3SI2A 2ZOGA 3V38A 3ISZA 4TJVA 3PRTA 4K3NA 3D67A 1LAPA 2Q43A 5D8NA 3KHXA 3BHXA 2ZEPA 1R3NA 3T8WA 2V8VA 3JRUA 4C8CA 4ZYQA 4ZY0A 2HC9A 2FVGA 2PJ9A 2O53A 1XF1A 4C9AA 3SJXA 4DJLA 2PJ0A 1V6CA 4EMEA 3H8EA 3L2NA 3D66A 2CIJA 1R43A 2RFHA 4P10A 4OC5A 4YN3A 2RB7A 2IQ6A 3B35A 1BPMA 3IC1A 6CPAA 1WVMA 4C9VA 4R6TA 4C86A 2WZNA 2PJ8A 4X8IA 1OBRA 3K9TA 4EWTA 2QVPA 4FBEA 3FECA 4TJXA 1PCAA 5DS0A 2V8HA 3B3VA 3SJGA 3TX8A 3ISXA 2JBKA 3LMSA 3SJFA 1CP7A 2AFWA 4C99A 4MHYA 2AFZA 1TKJA 3S9LA 1HEEA 2C6CA 2C6GA 4IK2A 4NGNA 4P4FA 3ICUA 3PBEA 3WC6A 4OC0A 1Y0RA 4A39A 3IO1A 2GLJA 2GREA 2ZEDA 2EK9A 2EWBA 3PFEA 2PCUA 2ZEEA 1YW4A 4KNGE 4NGSA 3KI9A 4ZX9A 3K2KA 1Z8LA 1IY7A 4MHPA 4C9RA 4P6YA 2ZOFA 3KGQA 1XMBA 2PJCA 1DE4C 1Y7EA 3H8GA 1CPSA 3FJUA 4EFDA 4BD9A 3PB6X 1PYTB 4OC1A 1F2PA 1YLOA 3GB0A 3D4UA 4MXUA 4TNUA 5K8OA 2I3CA 4F8ZA 4UEEA 3BI1A 5CBMA 2ABZA 2CF4A 2PIZA 3FVLA 8CPAA 4B6ZA 3BI0A 4P4BA 4MHZA 3I6SA 2OR4A 3CPXA 3B3CA 4MRIA 2PJ1A 3IEHA 3CPAA 3V7ZA 3QNVA 4WJBA 4Q7AA 3VATA 3D7GA 4OP4A 4C85A 2J9AA 1Z5RA 1VHOA 2XEFA 3PBBA 2HB6A 3VH9A 1LOKA 1H8LA 2AFMA 1Z2LA 4FWUA 2NYQA 1QQ9A 2GU2A
chains in the Genus database with same CATH superfamily
1TKHA 1XE4A 2XEIA 1ZYMA 3W6SA 5HKYA 5AG6A 2C6PA 4OC4A 3A9LA 2OOTA 4I49A 4PXDA 2ZEGA 3CT9A 4PV6A 1Y9ZA 3BJ8A 3TO6A 4PXBA 4BPUB 2I79A 1S5KA 2PJBA 4A32A 4OLLA 2EO8A 1A2ZA 4MMOA 2CBLA 4NJRA 2Y1MA 4XNHB 1K4JA 1ZLIA 5G22A 5F1YA 4B5PB 4MCSA 3R1KA 2C1CA 3RBUA 3QAHA 2ZW4A 3PP9A 4F9UA 4OAEA 2ODFA 3GIUA 3BLNA 3WC7A 3JTKA 4A30A 3VTAA 5F09A 2B58A 5D29A 1ARLA 1XFOA 2WUUA 4A4CA 3KR5A 5EC4A 5F49A 3TLAA 3VRPA 2PR1A 4HNYB 1GHEA 1IB1E 1M1DA 3D7DA 4PSXA 4A38A 4ZI6A 1NMTA 4KOYA 3OB1B 4MI4A 3S9MA 1I1DA 3MN8A 4HNXB 3R95A 2AFUA 2GE3A 3S6KA 4CGLA 2DXQA 3B3TA 1R61A 3R9GA 2DIKA 1IICA 4A4BA 4O23A 3HPHE 4XPDB 2D0PA 2E28A 3NE8A 4M85A 2DEAA 1NSAA 2CTCA 2GIVA 4Y49C 3BUWB 5F46A 3D68A 2N3AB 4NGMA 2FSRA 4MFZA 4G1PA 3BUMB 4KSIA 1UWYA 4GM5A 4M3SA 3SXNA 2MP0A 3I74A 2BO9A 1Z8TA 1XBUA 2HUZA 4M6HA 4MHDA 5K8PA 3PT1A 2PIYA 3NA6A 3G8WA 1YREA 1EO0A 1LCPA 2QYVA 1FY7A 5FVJA 3TO7A 2ZEHA 2WYRA 2EK8A 1EE3P 3FNCA 1R57A 3TLGB 2XPPA 3R96A 1TXRA 4R8FA 4P4IA 4JZ0A 3P2HA 1VIXA 2ANPA 2B3UA 2JLMA 1F2OA 1X10A 4AG9A 4MJ8A 2XPNA 1BOBA 2R8VA 2O4HA 5HVGA 5JH9A 4H6UA 4UEZA 2DPSA 2KCWA 4FUUA 3DLJA 1LAMA 4A95A 3DGVA 2VZZA 3PGPA 1VHEA 5HH1A 3PLFB 4X3RA 1Z9UA 4MHNA 2YNCA 1S7NA 3IWWA 2EUIA 2YNDA 2ZW7A 4R3KA 4UCPA 3E0KA 1IOIA 2GLFA 4UWJA 5LRJA 2EZAA 4OADA 3ZZIA 4UEFA 4NGPA 1LRZA 3B3SA 2PQ8A 1Z8XA 2ARHA 3FBUA 4MY3A 3FEEA 4NGRA 5DWMA 3WC5A 3TLBA 4BPXB 4ONWA 3T90A 4E94A 4MCQA 3ZNIA 3PB9X 5A27A 4RUHA 4MCPA 5LYFA 2P6EA 1M4LA 4AB7A 4Y49B 3BXMA 2IMOA 4KOVA 4B5PA 4C8FA 2D4OA 1GYTA 1Q2YA 2Z3OA 4KSFA 4UWIA 2UV8G 4KUAA 3CXPA 2P6GA 3D3SA 1ARMA 2F5IA 1XF8A 4RR2B 2R82A 4JYWA 3RAMA 2AFSA 4OKOA 4QB9A 2HI6A 1M4DA 5HVHA 4KOWA 4KLWA 4A2ZA 5K8NA 1CS0B 5CPAA 3V8IA 4QVTA 4UCNA 2PE3A 3G3SA 5HVFA 4YWYA 5LRGA 4A31A 2CY2A 5BWAB 1BAVA 3EFAA 3KKWA 4KZTA 4W9YA 2Q04A 1FT7A 1QSNA 4CGOA 3SR3A 2XEJA 3B2YA 3TOAA 5ELYA 3IU1A 2PVWA 1CPXA 4ZY1A 4X2TA 3G23A 1MJAA 1SQHA 1Q2CA 2BCOA 3RNZA 4E0AA 1CG2A 2AJ6A 2K5TA 2Y0MA 4PXEA 4P4JA 4B12A 5IV0A 3FX6A 4KSAA 4IUSA 1J4JA 4R76A 5LYLA 5LRKA 2EBJA 2J8MA 3KZWA 4UA3A 1ZG7A 3TLGA 2JEVA 1Y0YA 2V77A 2C27A 3PB4X 3F8KA 3NFZA 2B4DB 4INJA 5JM6A 4AXVA 4R3LA 2XEGA 1IU8A 4RS2A 4OIDA 1YSJA 4PPZA 1S7KA 4OC3A 5J8FA 2GANA 1ZG8A 3GLJA 5AG5A 1XRYA 2FL4A 4CAWA 3KRVA 4C8TA 2XPOA 1MJBA 4XPLA 3FEDA 4Q38A 3IGRA 2C5QA 4GPLB 2BUEA 5J8CA 2Z0ZA 3T0TA 1TIQA 2PJ4A 4H2KA 2WPWA 2VL1A 1M4IA 4NFRA 5HMNA 3B3WA 3NH4A 3PB8X 3EIFA 3S9NA 4C2ZA 4Q36A 2VBQA 1CBXA 1HDQA 4JXQA 4YGOA 1X12A 4ZGYB 4LQGA 2Q4VA 4CO9A 3VRNA 2DPTA 2Z3LA 1Z8WA 2PJ3A 2VQYA 5LYIA 7CPAA 1VI4A 1XMTA 3KQZA 5IX3A 3HLPA 4MFPA 3VARA 2ZEFA 4AVAA 4UFWA 4BTFA 5LYDA 4KVME 3ZJ0A 2R7HA 4A33A 2Y1NA 1RTQA 4LX9A 2PJ5A 2ZELA 3D7FA 4FD4A 1M4GA 5EBVA 4Z65A 1VGYA 4U9ZA 5IB9A 4KORA 1YGHA 1QSRA 4JD6A 1EZBA 2WPXA 1S3ZA 1YW6A 3KQXA 2JDCA 4IAVA 4KLVA 4A37A 3KASA 4FD6A 4OMEA 1ELLP 4PK2A 2RC4A 3NH5A 2CTBA 3LACA 5F13A 1HDUA 4UIBA 2NSMA 5H86A 4CDJA 5A28A 4NGTA 2Q4ZA 3TTHA 1YVOA 3MRUA 4R7MA 1IYKA 5E96A 3VWDA 2YJTA 3N5FA 4BMHA 1C3OB 4BPWB 4CYPA 2D4PA 2REEA 3I9SA 4UF4A 1KBLA 3EO4A 3IFEA 5EMIA 4IF5A 5GCNA 1JDBC 1BXRB 3I1UA 1Z9EA 2ZW5A 4KUBA 4B14A 4NGQA 3LWUA 2XPLA 2IL4A 3CXSA 4PXCA 5ISVA 4CAEA 2X0SA 2HV2A 2PJ7A 4RN7A 2IJZA 1N71A 1CJWA 1Q7LA 3D8PA 1CP6A 2FIWA 2CNMA 3IWEA 3TO9A 4CAXA 4NJQA 1NXJA 1ELMP 4C84A 3CDXA 2PJ6A 3FMCA 2QMLA 2OZHA 1VKCA 2Q44A 1JWQA 3DR8A 5HXDA 3VRRA 3FH4A 3MGDA 1ZO0A 4L8AA 4PK3A 4RI1A 1TF8A 4YRHA 3WABA 2JEWA 4CRYB 3HUVA 4II9A 2B0AA 3WT4A 3EZBA 1BPNA 3KL9A 3P2FA 1M44A 4JVOA 1LFWA 2B4DA 3TLYA 4UIAA 3VGOA 2Z10A 1T36B 4HNWB 2OH1A 3SI0A 1BLLE 4P4EA 2F7VA 4QUSA 2AFXA 5C88A 1YQEA 4NF1A 3T07A 1LANA 1WWZA 1XEBA 4CGPA 3EC4A 1MK4A 4JLYA 4PQAA 5C82A 4P45A 4KVXA 1CX8A 1ZG9A 3FIXA 2AFOA 3SI1A 3LODA 3D2MA 1B87A 1J3LA 3GY9A 4CPAA 1Q2DA 4TWEA 5K8MA 1C30B 4K30A 3OP0A 4C8PA 2V8GA 2ZEMA 4YU9A 5BY0A 1ZLHA 2JBJA 3W91A 4WWVA 1AMPA 2ZENA 4GXHA 4BBHA 3TE4A 5J1QA 5THWA 5HKWA 1NSLA 1QMUA 4IHMA 4FD7A 1S60A 4MJXA 4ZX8A 3IIBA 1TKFA 3D7HA 1V0CA 4R9MA 4C9UA 3DNSA 2PJAA 4OIWA 2FM4A 4B5OA 4UFVA 1YMEA 2BOAA 4PSWA 1XIXA 3T05A 5JGFA 3S6HA 2EZBA 3OAKA 3QB8A 2POKA 1DTDA 2Q51A 3KR4A 3TCVA 3C8OA 4C8UA 2PVVA 1VBGA 4C8AA 4U9YA 2G3AA 3CXQA 1PU9A 5I4MA 5F47A 3KHZA 4A94A 4JXRA 1A9XB 3VROA 4AVCA 4DYOA 2BSWA 1KWMA 4P4DA 4GS4A 3S6FA 3T5MA 3RZAA 4C7IA 1P4NA 1Z4EA 3IJ3A 4FAIA 2F8HA 3H8FA 4JJXA 4L89A 4MCRA 1IGBA 5AG4A 4DNCA 3SJEA 4C68A 4ZY2A 1YVKA 2FS5A 2OB0A 2PRBA 3K9UA 3PZJA 3S6GA 2PJ2A 3D2PA 4KS9A 2V8DA 1B6BA 3TC8A 4F9VA 3FF3A 4EVYA 2AE6A 2I00A 3GJZA 4C9EA 1F57A 1JQGA 2G9DA 3DDDA 3PFOA 1TF9A 1VHSA 1GGOA 4OC2A 4J3GA 4M6GA 1OZPA 5F5XA 1XJOA 3NH8A 2Z3MA 4P44A 1FNOA 2ZEOA 4DUKA 3PEIA 3NOJA 1AYEA 2PRQA 3RYOA 4CDKA 3T9YA 4HPSA 4QBJA 1XOVA 3GUXA 1WJTA 2QJ8A 3B7IA 3DR6A 2ZOGA 3PB7X 4KOTA 3SI2A 4C2YA 3V38A 3ISZA 2YGWA 4MY0A 3PRTA 4CYOA 4IIYA 4XNHC 4TJVA 2CNTA 1CM0A 3FXTA 4FD5A 4K3NA 2Z3KA 1YR0A 3D67A 4NSQA 4CGMA 1LAPA 1MJ9A 2Q43A 5D8NA 3KHXA 3HPGG 3BHXA 1VBHA 5AGEA 2ZEPA 4M8DA 2VZYA 1R3NA 4CZ1A 4AG7A 2BEIA 3CZXA 1Y9KA 2PR8A 3T8WA 2V8VA 3QAYA 2D0OA 3JRUA 5IB0A 1I12A 4C8CA 2PC1A 4ZYQA 5F9MA 3U88C 4ZY0A 2B4BA 2HC9A 2PSWA 1NE9A 2FVGA 2P6FA 2PJ9A 3GYAA 2O53A 3VWEA 3TLCA 1XF1A 4C9AA 3SJXA 4DJLA 3F9KC 2FCKA 1ZL0A 3FB3A 3H5ZA 1Q5XA 4M6IA 2R1IA 4H1HA 3DSBA 3RO0A 2PJ0A 1V6CA 1AUGA 4H89A 3FRMA 3BUOB 1KUVA 4ONUA 3H8EA 2ATRA 4EMEA 5DWNA 1WK4A 3F5BA 3L2NA 3D66A 4B10A 2VXKA 2CIJA 1I21A 1R43A 4CGNA 3BUXB 4F6AA 5KTAA 2RFHA 4P10A 4OC5A 1QSOA 4YN3A 3R9FA 2Z3PA 4B11A 5JYBA 2RB7A 3NFQA 2WSAA 4KOSA 3TYXA 2IQ6A 4H6ZA 5HKZA 3B35A 1BPMA 3IC1A 2FT0A 6CPAA 1WVMA 4C9VA 2QIRA 3B8GA 4R6TA 2J8NA 2JDDA 2GP4A 4MI1A 4F0YA 2WZNA 2PJ8A 4X8IA 4C86A 1OBRA 3H4QA 3K9TA 4EWTA 2QVPA 4E2AA 2B5GB 4FBEA 1CE8B 2A4NA 3FECA 4TJXA 1PCAA 4MFQA 2Q0YA 2Z11A 2ZPAA 1YLEA 5K99A 3IWGA 3UY5A 2Z3NA 5DS0A 2OU2A 2AUMA 2V8HA 2OZGA 3B3VA 5F48A 2OZUA 3SJGA 2G3TA 1B47A 3TX8A 4NXYA 4MFLA 2Q7BA 3ISXA 5I0CA 2JBKA 4HKFA 3LMSA 3SJFA 3O8ZA 1CP7A 2ZXVA 4LUAA 2AFWA 3OB2B 2B4JC 4C99A 2R98A 1S7FA 4MHYA 2O28A 3U1BA 2AFZA 2BL1A 3K4IA 1TKJA 1Y7RA 3S9LA 1HEEA 2C6CA 2C6GA 2G0BA 4IK2A 2AUNA 4MFJA 4CRZB 4NGNA 4P4FA 3SHPA 3ICUA 1P0HA 3PBEA 1KUYA 3WC6A 4OC0A 1Y0RA 2REFA 4MBUA 4A39A 3EY5A 3IO1A 1U6MA 2GLJA 2GREA 4BINA 1YK3A 3TLEA 2ZEDA 2EK9A 2EWBA 3GKRA 3IU2A 2FIAA 1DIKA 3PFEA 2PCUA 4CAVA 3N7ZA 1KEEB 1IYLA 2ZEEA 1YW4A 4KNGE 5G20A 1PUAA 1KZFA 4YFJA 1Z4RA 4NEXA 2X7BA 4NGSA 2FXFA 3EXNA 3OWCA 3I3GA 4CYNA 1NBWA 3SXOA 3KI9A 4CS0B 2NMTA 3K2KA 4ZX9A 1M6VB 2EZCA 2CXAA 1Z8LA 1IY7A 2HQYA 1L0CA 4MHPA 4CYQA 4C9RA 4KVOE 4MFKA 2VEZA 4P6YA 3JVNA 2Q4YA 4C2XA 2FE7A 5CNPA 2VI7A 2ZOFA 1XMBA 3BUNB 2PDOA 3KGQA 2PJCA 4JWPA 5FD8A 3TLZA 4C7HA 1KUXA 4ORFA 1DE4C 4EYSA 1Y7EA 3H8GA 5AG7A 5G21A 1CPSA 3FJUA 4B13A 2CNSA 4EFDA 4BD9A 5J3XA 3PB6X 1PYTB 2DF5A 4OC1A 1KC7A 1YLOA 1F2PA 2B5GA 3R9EA 2OLSA 3GB0A 2HROA 3D4UA 1ON0A 4MXUA 2EVNA 4TNUA 3TT2A 5K8OA 4UBRA 3EZAA 2I3CA 4F8ZA 2H5MA 4KOXA 4ZBGA 1S7LA 1YX0A 2QECA 4COBA 4UEEA 3BI1A 2YJVA 4COGA 5CBMA 2YNCC 2VKZG 2ABZA 5G1ZA 2B3VA 4X5KA 1BO4A 1UFHA 3BJ7A 2J8RA 2CF4A 2PIZA 3HMJG 3NE7A 3FVLA 2GFQA 8CPAA 4B6ZA 1ZRSA 3BI0A 4P4BA 5JVLA 4MHZA 4NCZA 3I6SA 2OR4A 3CPXA 3B3CA 4E5SA 2YNEA 4MRIA 4E8OA 2PJ1A 4R57A 5KTDA 1EZAA 3IEHA 3CPAA 2PCNA 3V7ZA 3QNVA 3C26A 4WJBA 4Q7AA 3VATA 3FYNA 3D7GA 4KOUA 4OP4A 5JQ4A 5IR2A 4C85A 2DLAA 4U5YA 4UFXA 2J9AA 1JDEA 3W6XA 1Z5RA 4QC6A 3TFYA 3PFVA 1QSMA 4IIXA 5AXIA 1VHOA 2ZW6A 5KTCA 4XPKA 2Q7SA 2XEFA 1FBVA 5H84A 5JPHA 1QSTA 2HWGA 3PBBA 4XPDC 3JUWA 2HB6A 3F0AA 4UCMA 1RXTA 1LOKA 1H8LA 4LQ6A 3VH9A 4AVBA 4J0NA 1YVHA 3WR7A 1IOFA 1Y9WA 3VRQA 4R87A 2AFMA 1Z2LA 3LD2A 3TOBA 4FWUA 4F0XA 2P0WA 1IIDA 2NYQA 1QQ9A 1RO5A 4CAFA 3EZEA 2GU2A
chains in the Genus database with same CATH topology
1TKHA 2XEIA 2C6PA 4OC4A 4PXDA 2OOTA 2ZEGA 3CT9A 1Y9ZA 4PXBA 2PJBA 4MMOA 4NJRA 1ZLIA 4MCSA 2C1CA 3RBUA 4F9UA 3WC7A 3VTAA 5F09A 5D29A 1ARLA 1XFOA 3KR5A 3D7DA 4A38A 4ZI6A 3S9MA 3MN8A 2AFUA 3B3TA 4O23A 2DEAA 1NSAA 2CTCA 3D68A 4NGMA 4G1PA 4KSIA 1UWYA 4GM5A 3I74A 2BO9A 1XBUA 5K8PA 2PIYA 3NA6A 2QYVA 1LCPA 2ZEHA 2WYRA 2EK8A 1EE3P 1TXRA 4R8FA 4P4IA 4JZ0A 1VIXA 2ANPA 1F2OA 2O4HA 5HVGA 5JH9A 4UEZA 4FUUA 3DLJA 1LAMA 3DGVA 1VHEA 4X3RA 4MHNA 3IWWA 2GLFA 5LRJA 4UEFA 4NGPA 3B3SA 5HXDA 3WC5A 3FEEA 4NGRA 4ONWA 4MCQA 3PB9X 4RUHA 4MCPA 5LYFA 1M4LA 3BXMA 2IMOA 4C8FA 1GYTA 1ARMA 4JYWA 3RAMA 2AFSA 4OKOA 5HVHA 5K8NA 5CPAA 2PE3A 5HVFA 4YWYA 5LRGA 1BAVA 4W9YA 1FT7A 2XEJA 3B2YA 5ELYA 2PVWA 1CPXA 4ZY1A 4X2TA 2BCOA 1CG2A 4PXEA 4P4JA 3FX6A 4R76A 5LYLA 5LRKA 3KZWA 1ZG7A 1Y0YA 2V77A 3PB4X 3NFZA 5JM6A 4AXVA 2XEGA 4OIDA 1YSJA 4PPZA 4OC3A 1ZG8A 3GLJA 1XRYA 4C8TA 2C5QA 3FEDA 2PJ4A 4H2KA 2VL1A 4NFRA 3B3WA 3NH4A 3PB8X 3EIFA 3S9NA 1CBXA 1HDQA 4LQGA 5LYIA 2PJ3A 7CPAA 3KQZA 3HLPA 3VARA 2ZEFA 5LYDA 1RTQA 2PJ5A 2ZELA 3D7FA 4Z65A 1VGYA 5IB9A 1YW6A 4IAVA 3KQXA 4A37A 3KASA 4OMEA 1ELLP 3NH5A 2CTBA 4UIBA 1HDUA 2NSMA 4CDJA 4NGTA 2Q4ZA 3MRUA 4R7MA 3N5FA 4UF4A 3IFEA 3I1UA 4NGQA 3LWUA 4PXCA 2PJ7A 2IJZA 1Q7LA 1CP6A 4NJQA 1ELMP 4C84A 3CDXA 2PJ6A 3FMCA 3FH4A 1TF8A 3WABA 2JEWA 3HUVA 3WT4A 1BPNA 3KL9A 1LFWA 4UIAA 3SI0A 1BLLE 4P4EA 2F7VA 2AFXA 1LANA 4PQAA 4P45A 1CX8A 1ZG9A 2AFOA 3SI1A 4CPAA 4TWEA 5K8MA 4C8PA 2V8GA 2ZEMA 4YU9A 1ZLHA 2JBJA 4WWVA 1AMPA 2ZENA 5J1QA 5THWA 1QMUA 4IHMA 4ZX8A 3IIBA 1TKFA 3D7HA 4C9UA 2PJAA 4OIWA 1YMEA 2BOAA 5JGFA 2POKA 1DTDA 2Q51A 3KR4A 4C8UA 2PVVA 4C8AA 5I4MA 3KHZA 4A94A 4DYOA 1KWMA 4P4DA 3RZAA 4FAIA 3IJ3A 2F8HA 3H8FA 4MCRA 1IGBA 3SJEA 4ZY2A 2PJ2A 2V8DA 3TC8A 4F9VA 3FF3A 4C9EA 1F57A 1JQGA 2G9DA 3PFOA 1TF9A 4OC2A 1XJOA 3NH8A 2ZEOA 4P44A 1FNOA 4DUKA 3PEIA 1AYEA 2PRQA 4CDKA 3PB7X 3GUXA 2QJ8A 3B7IA 3SI2A 2ZOGA 3V38A 3ISZA 4TJVA 3PRTA 4K3NA 3D67A 1LAPA 2Q43A 5D8NA 3KHXA 3BHXA 2ZEPA 1R3NA 3T8WA 2V8VA 3JRUA 4C8CA 4ZYQA 4ZY0A 2HC9A 2FVGA 2PJ9A 2O53A 1XF1A 4C9AA 3SJXA 4DJLA 2PJ0A 1V6CA 4EMEA 3H8EA 3L2NA 3D66A 2CIJA 1R43A 2RFHA 4P10A 4OC5A 4YN3A 2RB7A 2IQ6A 3B35A 1BPMA 3IC1A 6CPAA 1WVMA 4C9VA 4R6TA 2GP4A 4C86A 2WZNA 2PJ8A 4X8IA 1OBRA 3K9TA 4EWTA 2QVPA 4FBEA 3FECA 4TJXA 1PCAA 5DS0A 2V8HA 3B3VA 3SJGA 3TX8A 3ISXA 2JBKA 3LMSA 3SJFA 1CP7A 2AFWA 4C99A 4MHYA 2AFZA 1TKJA 3S9LA 1HEEA 2C6CA 2C6GA 4IK2A 4NGNA 4P4FA 3ICUA 3PBEA 3WC6A 4OC0A 1Y0RA 4A39A 3IO1A 2GLJA 2GREA 2ZEDA 2EK9A 2EWBA 3PFEA 2PCUA 2ZEEA 1YW4A 4KNGE 4NGSA 3KI9A 4ZX9A 3K2KA 1Z8LA 1IY7A 4MHPA 4C9RA 4P6YA 2ZOFA 3KGQA 1XMBA 2PJCA 1DE4C 1Y7EA 3H8GA 1CPSA 3FJUA 4EFDA 4BD9A 3PB6X 1PYTB 4OC1A 1F2PA 1YLOA 3GB0A 3D4UA 4MXUA 4TNUA 5K8OA 2I3CA 4F8ZA 4UEEA 3BI1A 5CBMA 2ABZA 2CF4A 2PIZA 3FVLA 8CPAA 4B6ZA 3BI0A 4P4BA 4MHZA 3I6SA 2OR4A 3CPXA 3B3CA 4MRIA 2PJ1A 3IEHA 3CPAA 3V7ZA 3QNVA 4WJBA 4Q7AA 3VATA 5IR2A 3D7GA 4OP4A 4C85A 2J9AA 1Z5RA 1VHOA 2XEFA 3PBBA 2HB6A 3VH9A 1LOKA 1H8LA 2AFMA 1Z2LA 4FWUA 2NYQA 1QQ9A 2GU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKH A;  2XEI A;  2C6P A;  4OC4 A;  4PXD A;  2OOT A;  2ZEG A;  3CT9 A;  1Y9Z A;  4PXB A;  2PJB A;  4MMO A;  4NJR A;  1ZLI A;  4MCS A;  2C1C A;  3RBU A;  4F9U A;  3WC7 A;  3VTA A;  5F09 A;  5D29 A;  1ARL A;  1XFO A;  3KR5 A;  3D7D A;  4A38 A;  4ZI6 A;  3S9M A;  3MN8 A;  2AFU A;  3B3T A;  4O23 A;  2DEA A;  1NSA A;  2CTC A;  3D68 A;  4NGM A;  4G1P A;  4KSI A;  1UWY A;  4GM5 A;  3I74 A;  2BO9 A;  1XBU A;  5K8P A;  2PIY A;  3NA6 A;  2QYV A;  1LCP A;  2ZEH A;  2WYR A;  2EK8 A;  1EE3 P;  1TXR A;  4R8F A;  4P4I A;  4JZ0 A;  1VIX A;  2ANP A;  1F2O A;  2O4H A;  5HVG A;  5JH9 A;  4UEZ A;  4FUU A;  3DLJ A;  1LAM A;  3DGV A;  1VHE A;  4X3R A;  4MHN A;  3IWW A;  2GLF A;  5LRJ A;  4UEF A;  4NGP A;  3B3S A;  5HXD A;  3WC5 A;  3FEE A;  4NGR A;  4ONW A;  4MCQ A;  3PB9 X;  4RUH A;  4MCP A;  5LYF A;  1M4L A;  3BXM A;  2IMO A;  4C8F A;  1GYT A;  1ARM A;  4JYW A;  3RAM A;  2AFS A;  4OKO A;  5HVH A;  5K8N A;  5CPA A;  2PE3 A;  5HVF A;  4YWY A;  5LRG A;  1BAV A;  4W9Y A;  1FT7 A;  2XEJ A;  3B2Y A;  5ELY A;  2PVW A;  1CPX A;  4ZY1 A;  4X2T A;  2BCO A;  1CG2 A;  4PXE A;  4P4J A;  3FX6 A;  4R76 A;  5LYL A;  5LRK A;  3KZW A;  1ZG7 A;  1Y0Y A;  2V77 A;  3PB4 X;  3NFZ A;  5JM6 A;  4AXV A;  2XEG A;  4OID A;  1YSJ A;  4PPZ A;  4OC3 A;  1ZG8 A;  3GLJ A;  1XRY A;  4C8T A;  3FED A;  2PJ4 A;  4H2K A;  2VL1 A;  4NFR A;  3B3W A;  3NH4 A;  3PB8 X;  3EIF A;  3S9N A;  1CBX A;  1HDQ A;  4LQG A;  5LYI A;  2PJ3 A;  7CPA A;  3KQZ A;  3HLP A;  3VAR A;  2ZEF A;  5LYD A;  1RTQ A;  2PJ5 A;  2ZEL A;  3D7F A;  4Z65 A;  1VGY A;  5IB9 A;  1YW6 A;  4IAV A;  3KQX A;  4A37 A;  3KAS A;  4OME A;  1ELL P;  3NH5 A;  2CTB A;  4UIB A;  1HDU A;  2NSM A;  4CDJ A;  4NGT A;  2Q4Z A;  3MRU A;  4R7M A;  3N5F A;  4UF4 A;  3IFE A;  3I1U A;  4NGQ A;  3LWU A;  4PXC A;  2PJ7 A;  2IJZ A;  1Q7L A;  1CP6 A;  4NJQ A;  1ELM P;  4C84 A;  3CDX A;  2PJ6 A;  3FMC A;  3FH4 A;  1TF8 A;  3WAB A;  2JEW A;  3HUV A;  3WT4 A;  1BPN A;  3KL9 A;  1LFW A;  4UIA A;  3SI0 A;  1BLL E;  4P4E A;  2F7V A;  2AFX A;  1LAN A;  4PQA A;  4P45 A;  1CX8 A;  1ZG9 A;  2AFO A;  3SI1 A;  4CPA A;  4TWE A;  5K8M A;  4C8P A;  2V8G A;  2ZEM A;  4YU9 A;  1ZLH A;  2JBJ A;  4WWV A;  1AMP A;  2ZEN A;  5J1Q A;  5THW A;  1QMU A;  4IHM A;  4ZX8 A;  3IIB A;  1TKF A;  3D7H A;  4C9U A;  2PJA A;  4OIW A;  1YME A;  2BOA A;  5JGF A;  2POK A;  1DTD A;  2Q51 A;  3KR4 A;  4C8U A;  2PVV A;  4C8A A;  5I4M A;  3KHZ A;  4A94 A;  4DYO A;  1KWM A;  4P4D A;  3RZA A;  4FAI A;  3IJ3 A;  2F8H A;  3H8F A;  4MCR A;  1IGB A;  3SJE A;  4ZY2 A;  2PJ2 A;  2V8D A;  3TC8 A;  4F9V A;  3FF3 A;  4C9E A;  1F57 A;  1JQG A;  2G9D A;  3PFO A;  1TF9 A;  4OC2 A;  1XJO A;  3NH8 A;  2ZEO A;  4P44 A;  1FNO A;  4DUK A;  3PEI A;  1AYE A;  2PRQ A;  4CDK A;  3PB7 X;  3GUX A;  2QJ8 A;  3B7I A;  3SI2 A;  2ZOG A;  3V38 A;  3ISZ A;  4TJV A;  3PRT A;  4K3N A;  3D67 A;  1LAP A;  2Q43 A;  5D8N A;  3KHX A;  3BHX A;  2ZEP A;  1R3N A;  3T8W A;  2V8V A;  3JRU A;  4C8C A;  4ZYQ A;  4ZY0 A;  2HC9 A;  2FVG A;  2PJ9 A;  2O53 A;  1XF1 A;  4C9A A;  3SJX A;  4DJL A;  2PJ0 A;  1V6C A;  4EME A;  3H8E A;  3L2N A;  3D66 A;  2CIJ A;  1R43 A;  2RFH A;  4P10 A;  4OC5 A;  4YN3 A;  2RB7 A;  2IQ6 A;  3B35 A;  1BPM A;  3IC1 A;  6CPA A;  1WVM A;  4C9V A;  4R6T A;  4C86 A;  2WZN A;  2PJ8 A;  4X8I A;  1OBR A;  3K9T A;  4EWT A;  2QVP A;  4FBE A;  3FEC A;  4TJX A;  1PCA A;  5DS0 A;  2V8H A;  3B3V A;  3SJG A;  3TX8 A;  3ISX A;  2JBK A;  3LMS A;  3SJF A;  1CP7 A;  2AFW A;  4C99 A;  4MHY A;  2AFZ A;  1TKJ A;  3S9L A;  1HEE A;  2C6C A;  2C6G A;  4IK2 A;  4NGN A;  4P4F A;  3ICU A;  3PBE A;  3WC6 A;  4OC0 A;  1Y0R A;  4A39 A;  3IO1 A;  2GLJ A;  2GRE A;  2ZED A;  2EK9 A;  2EWB A;  3PFE A;  2PCU A;  2ZEE A;  1YW4 A;  4KNG E;  4NGS A;  3KI9 A;  4ZX9 A;  3K2K A;  1Z8L A;  1IY7 A;  4MHP A;  4C9R A;  4P6Y A;  2ZOF A;  3KGQ A;  1XMB A;  2PJC A;  1DE4 C;  1Y7E A;  3H8G A;  1CPS A;  3FJU A;  4EFD A;  4BD9 A;  3PB6 X;  1PYT B;  4OC1 A;  1F2P A;  1YLO A;  3GB0 A;  3D4U A;  4MXU A;  4TNU A;  5K8O A;  2I3C A;  4F8Z A;  4UEE A;  3BI1 A;  5CBM A;  2ABZ A;  2CF4 A;  2PIZ A;  3FVL A;  8CPA A;  4B6Z A;  3BI0 A;  4P4B A;  4MHZ A;  3I6S A;  2OR4 A;  3CPX A;  3B3C A;  4MRI A;  2PJ1 A;  3IEH A;  3CPA A;  3V7Z A;  3QNV A;  4WJB A;  4Q7A A;  3VAT A;  3D7G A;  4OP4 A;  4C85 A;  2J9A A;  1Z5R A;  1VHO A;  2XEF A;  3PBB A;  2HB6 A;  3VH9 A;  1LOK A;  1H8L A;  2AFM A;  1Z2L A;  4FWU A;  2NYQ A;  1QQ9 A;  2GU2 A; 
#chains in the Genus database with same CATH topology
 1TKH A;  1XE4 A;  2XEI A;  1ZYM A;  3W6S A;  5HKY A;  5AG6 A;  2C6P A;  4OC4 A;  3A9L A;  2OOT A;  4I49 A;  4PXD A;  2ZEG A;  3CT9 A;  4PV6 A;  1Y9Z A;  3BJ8 A;  3TO6 A;  4PXB A;  4BPU B;  2I79 A;  1S5K A;  2PJB A;  4A32 A;  4OLL A;  2EO8 A;  1A2Z A;  4MMO A;  2CBL A;  4NJR A;  2Y1M A;  4XNH B;  1K4J A;  1ZLI A;  5G22 A;  5F1Y A;  4B5P B;  4MCS A;  3R1K A;  2C1C A;  3RBU A;  3QAH A;  2ZW4 A;  3PP9 A;  4F9U A;  4OAE A;  2ODF A;  3GIU A;  3BLN A;  3WC7 A;  3JTK A;  4A30 A;  3VTA A;  5F09 A;  2B58 A;  5D29 A;  1ARL A;  1XFO A;  2WUU A;  4A4C A;  3KR5 A;  5EC4 A;  5F49 A;  3TLA A;  3VRP A;  2PR1 A;  4HNY B;  1GHE A;  1IB1 E;  1M1D A;  3D7D A;  4PSX A;  4A38 A;  4ZI6 A;  1NMT A;  4KOY A;  3OB1 B;  4MI4 A;  3S9M A;  1I1D A;  3MN8 A;  4HNX B;  3R95 A;  2AFU A;  2GE3 A;  3S6K A;  4CGL A;  2DXQ A;  3B3T A;  1R61 A;  3R9G A;  2DIK A;  1IIC A;  4A4B A;  4O23 A;  3HPH E;  4XPD B;  2D0P A;  2E28 A;  3NE8 A;  4M85 A;  2DEA A;  1NSA A;  2CTC A;  2GIV A;  4Y49 C;  3BUW B;  5F46 A;  3D68 A;  2N3A B;  4NGM A;  2FSR A;  4MFZ A;  4G1P A;  3BUM B;  4KSI A;  1UWY A;  4GM5 A;  4M3S A;  3SXN A;  2MP0 A;  3I74 A;  2BO9 A;  1Z8T A;  1XBU A;  2HUZ A;  4M6H A;  4MHD A;  5K8P A;  3PT1 A;  2PIY A;  3NA6 A;  3G8W A;  1YRE A;  1EO0 A;  1LCP A;  2QYV A;  1FY7 A;  5FVJ A;  3TO7 A;  2ZEH A;  2WYR A;  2EK8 A;  1EE3 P;  3FNC A;  1R57 A;  3TLG B;  2XPP A;  3R96 A;  1TXR A;  4R8F A;  4P4I A;  4JZ0 A;  3P2H A;  1VIX A;  2ANP A;  2B3U A;  2JLM A;  1F2O A;  1X10 A;  4AG9 A;  4MJ8 A;  2XPN A;  1BOB A;  2R8V A;  2O4H A;  5HVG A;  5JH9 A;  4H6U A;  4UEZ A;  2DPS A;  2KCW A;  4FUU A;  3DLJ A;  1LAM A;  4A95 A;  3DGV A;  2VZZ A;  3PGP A;  1VHE A;  5HH1 A;  3PLF B;  4X3R A;  1Z9U A;  4MHN A;  2YNC A;  1S7N A;  3IWW A;  2EUI A;  2YND A;  2ZW7 A;  4R3K A;  4UCP A;  3E0K A;  1IOI A;  2GLF A;  4UWJ A;  5LRJ A;  2EZA A;  4OAD A;  3ZZI A;  4UEF A;  4NGP A;  1LRZ A;  3B3S A;  2PQ8 A;  1Z8X A;  2ARH A;  3FBU A;  4MY3 A;  3FEE A;  4NGR A;  5DWM A;  3WC5 A;  3TLB A;  4BPX B;  4ONW A;  3T90 A;  4E94 A;  4MCQ A;  3ZNI A;  3PB9 X;  5A27 A;  4RUH A;  4MCP A;  5LYF A;  2P6E A;  1M4L A;  4AB7 A;  4Y49 B;  3BXM A;  2IMO A;  4KOV A;  4B5P A;  4C8F A;  2D4O A;  1GYT A;  1Q2Y A;  2Z3O A;  4KSF A;  4UWI A;  2UV8 G;  4KUA A;  3CXP A;  2P6G A;  3D3S A;  1ARM A;  2F5I A;  1XF8 A;  4RR2 B;  2R82 A;  4JYW A;  3RAM A;  2AFS A;  4OKO A;  4QB9 A;  2HI6 A;  1M4D A;  5HVH A;  4KOW A;  4KLW A;  4A2Z A;  5K8N A;  1CS0 B;  5CPA A;  3V8I A;  4QVT A;  4UCN A;  2PE3 A;  3G3S A;  5HVF A;  4YWY A;  5LRG A;  4A31 A;  2CY2 A;  5BWA B;  1BAV A;  3EFA A;  3KKW A;  4KZT A;  4W9Y A;  2Q04 A;  1FT7 A;  1QSN A;  4CGO A;  3SR3 A;  2XEJ A;  3B2Y A;  3TOA A;  5ELY A;  3IU1 A;  2PVW A;  1CPX A;  4ZY1 A;  4X2T A;  3G23 A;  1MJA A;  1SQH A;  1Q2C A;  2BCO A;  3RNZ A;  4E0A A;  1CG2 A;  2AJ6 A;  2K5T A;  2Y0M A;  4PXE A;  4P4J A;  4B12 A;  5IV0 A;  3FX6 A;  4KSA A;  4IUS A;  1J4J A;  4R76 A;  5LYL A;  5LRK A;  2EBJ A;  2J8M A;  3KZW A;  4UA3 A;  1ZG7 A;  3TLG A;  2JEV A;  1Y0Y A;  2V77 A;  2C27 A;  3PB4 X;  3F8K A;  3NFZ A;  2B4D B;  4INJ A;  5JM6 A;  4AXV A;  4R3L A;  2XEG A;  1IU8 A;  4RS2 A;  4OID A;  1YSJ A;  4PPZ A;  1S7K A;  4OC3 A;  5J8F A;  2GAN A;  1ZG8 A;  3GLJ A;  5AG5 A;  1XRY A;  2FL4 A;  4CAW A;  3KRV A;  4C8T A;  2XPO A;  1MJB A;  4XPL A;  3FED A;  4Q38 A;  3IGR A;  2C5Q A;  4GPL B;  2BUE A;  5J8C A;  2Z0Z A;  3T0T A;  1TIQ A;  2PJ4 A;  4H2K A;  2WPW A;  2VL1 A;  1M4I A;  4NFR A;  5HMN A;  3B3W A;  3NH4 A;  3PB8 X;  3EIF A;  3S9N A;  4C2Z A;  4Q36 A;  2VBQ A;  1CBX A;  1HDQ A;  4JXQ A;  4YGO A;  1X12 A;  4ZGY B;  4LQG A;  2Q4V A;  4CO9 A;  3VRN A;  2DPT A;  2Z3L A;  1Z8W A;  2PJ3 A;  2VQY A;  5LYI A;  7CPA A;  1VI4 A;  1XMT A;  3KQZ A;  5IX3 A;  3HLP A;  4MFP A;  3VAR A;  2ZEF A;  4AVA A;  4UFW A;  4BTF A;  5LYD A;  4KVM E;  3ZJ0 A;  2R7H A;  4A33 A;  2Y1N A;  1RTQ A;  4LX9 A;  2PJ5 A;  2ZEL A;  3D7F A;  4FD4 A;  1M4G A;  5EBV A;  4Z65 A;  1VGY A;  4U9Z A;  5IB9 A;  4KOR A;  1YGH A;  1QSR A;  4JD6 A;  1EZB A;  2WPX A;  1S3Z A;  1YW6 A;  3KQX A;  2JDC A;  4IAV A;  4KLV A;  4A37 A;  3KAS A;  4FD6 A;  4OME A;  1ELL P;  4PK2 A;  2RC4 A;  3NH5 A;  2CTB A;  3LAC A;  5F13 A;  1HDU A;  4UIB A;  2NSM A;  5H86 A;  4CDJ A;  5A28 A;  4NGT A;  2Q4Z A;  3TTH A;  1YVO A;  3MRU A;  4R7M A;  1IYK A;  5E96 A;  3VWD A;  2YJT A;  3N5F A;  4BMH A;  1C3O B;  4BPW B;  4CYP A;  2D4P A;  2REE A;  3I9S A;  4UF4 A;  1KBL A;  3EO4 A;  3IFE A;  5EMI A;  4IF5 A;  5GCN A;  1JDB C;  1BXR B;  3I1U A;  1Z9E A;  2ZW5 A;  4KUB A;  4B14 A;  4NGQ A;  3LWU A;  2XPL A;  2IL4 A;  3CXS A;  4PXC A;  5ISV A;  4CAE A;  2X0S A;  2HV2 A;  2PJ7 A;  4RN7 A;  2IJZ A;  1N71 A;  1CJW A;  1Q7L A;  3D8P A;  1CP6 A;  2FIW A;  2CNM A;  3IWE A;  3TO9 A;  4CAX A;  4NJQ A;  1NXJ A;  1ELM P;  4C84 A;  3CDX A;  2PJ6 A;  3FMC A;  2QML A;  2OZH A;  1VKC A;  2Q44 A;  1JWQ A;  3DR8 A;  5HXD A;  3VRR A;  3FH4 A;  3MGD A;  1ZO0 A;  4L8A A;  4PK3 A;  4RI1 A;  1TF8 A;  4YRH A;  3WAB A;  2JEW A;  4CRY B;  3HUV A;  4II9 A;  2B0A A;  3WT4 A;  3EZB A;  1BPN A;  3KL9 A;  3P2F A;  1M44 A;  4JVO A;  1LFW A;  2B4D A;  3TLY A;  4UIA A;  3VGO A;  2Z10 A;  1T36 B;  4HNW B;  2OH1 A;  3SI0 A;  1BLL E;  4P4E A;  2F7V A;  4QUS A;  2AFX A;  5C88 A;  1YQE A;  4NF1 A;  3T07 A;  1LAN A;  1WWZ A;  1XEB A;  4CGP A;  3EC4 A;  1MK4 A;  4JLY A;  4PQA A;  5C82 A;  4P45 A;  4KVX A;  1CX8 A;  1ZG9 A;  3FIX A;  2AFO A;  3SI1 A;  3LOD A;  3D2M A;  1B87 A;  1J3L A;  3GY9 A;  4CPA A;  1Q2D A;  4TWE A;  5K8M A;  1C30 B;  4K30 A;  3OP0 A;  4C8P A;  2V8G A;  2ZEM A;  4YU9 A;  5BY0 A;  1ZLH A;  2JBJ A;  3W91 A;  4WWV A;  1AMP A;  2ZEN A;  4GXH A;  4BBH A;  3TE4 A;  5J1Q A;  5THW A;  5HKW A;  1NSL A;  1QMU A;  4IHM A;  4FD7 A;  1S60 A;  4MJX A;  4ZX8 A;  3IIB A;  1TKF A;  3D7H A;  1V0C A;  4R9M A;  4C9U A;  3DNS A;  2PJA A;  4OIW A;  2FM4 A;  4B5O A;  4UFV A;  1YME A;  2BOA A;  4PSW A;  1XIX A;  3T05 A;  5JGF A;  3S6H A;  2EZB A;  3OAK A;  3QB8 A;  2POK A;  1DTD A;  2Q51 A;  3KR4 A;  3TCV A;  3C8O A;  4C8U A;  2PVV A;  1VBG A;  4C8A A;  4U9Y A;  2G3A A;  3CXQ A;  1PU9 A;  5I4M A;  5F47 A;  3KHZ A;  4A94 A;  4JXR A;  1A9X B;  3VRO A;  4AVC A;  4DYO A;  2BSW A;  1KWM A;  4P4D A;  4GS4 A;  3S6F A;  3T5M A;  3RZA A;  4C7I A;  1P4N A;  1Z4E A;  3IJ3 A;  4FAI A;  2F8H A;  3H8F A;  4JJX A;  4L89 A;  4MCR A;  1IGB A;  5AG4 A;  4DNC A;  3SJE A;  4C68 A;  4ZY2 A;  1YVK A;  2FS5 A;  2OB0 A;  2PRB A;  3K9U A;  3PZJ A;  3S6G A;  2PJ2 A;  3D2P A;  4KS9 A;  2V8D A;  1B6B A;  3TC8 A;  4F9V A;  3FF3 A;  4EVY A;  2AE6 A;  2I00 A;  3GJZ A;  4C9E A;  1F57 A;  1JQG A;  2G9D A;  3DDD A;  3PFO A;  1TF9 A;  1VHS A;  1GGO A;  4OC2 A;  4J3G A;  4M6G A;  1OZP A;  5F5X A;  1XJO A;  3NH8 A;  2Z3M A;  4P44 A;  1FNO A;  2ZEO A;  4DUK A;  3PEI A;  3NOJ A;  1AYE A;  2PRQ A;  3RYO A;  4CDK A;  3T9Y A;  4HPS A;  4QBJ A;  1XOV A;  3GUX A;  1WJT A;  2QJ8 A;  3B7I A;  3DR6 A;  2ZOG A;  3PB7 X;  4KOT A;  3SI2 A;  4C2Y A;  3V38 A;  3ISZ A;  2YGW A;  4MY0 A;  3PRT A;  4CYO A;  4IIY A;  4XNH C;  4TJV A;  2CNT A;  1CM0 A;  3FXT A;  4FD5 A;  4K3N A;  2Z3K A;  1YR0 A;  3D67 A;  4NSQ A;  4CGM A;  1LAP A;  1MJ9 A;  2Q43 A;  5D8N A;  3KHX A;  3HPG G;  3BHX A;  1VBH A;  5AGE A;  2ZEP A;  4M8D A;  2VZY A;  1R3N A;  4CZ1 A;  4AG7 A;  2BEI A;  3CZX A;  1Y9K A;  2PR8 A;  3T8W A;  2V8V A;  3QAY A;  2D0O A;  3JRU A;  5IB0 A;  1I12 A;  4C8C A;  2PC1 A;  4ZYQ A;  5F9M A;  3U88 C;  4ZY0 A;  2B4B A;  2HC9 A;  2PSW A;  1NE9 A;  2FVG A;  2P6F A;  2PJ9 A;  3GYA A;  2O53 A;  3VWE A;  3TLC A;  1XF1 A;  4C9A A;  3SJX A;  4DJL A;  3F9K C;  2FCK A;  1ZL0 A;  3FB3 A;  3H5Z A;  1Q5X A;  4M6I A;  2R1I A;  4H1H A;  3DSB A;  3RO0 A;  2PJ0 A;  1V6C A;  1AUG A;  4H89 A;  3FRM A;  3BUO B;  1KUV A;  4ONU A;  3H8E A;  2ATR A;  4EME A;  5DWN A;  1WK4 A;  3F5B A;  3L2N A;  3D66 A;  4B10 A;  2VXK A;  2CIJ A;  1I21 A;  1R43 A;  4CGN A;  3BUX B;  4F6A A;  5KTA A;  2RFH A;  4P10 A;  4OC5 A;  1QSO A;  4YN3 A;  3R9F A;  2Z3P A;  4B11 A;  5JYB A;  2RB7 A;  3NFQ A;  2WSA A;  4KOS A;  3TYX A;  2IQ6 A;  4H6Z A;  5HKZ A;  3B35 A;  1BPM A;  3IC1 A;  2FT0 A;  6CPA A;  1WVM A;  4C9V A;  2QIR A;  3B8G A;  4R6T A;  2J8N A;  2JDD A;  2GP4 A;  4MI1 A;  4F0Y A;  2WZN A;  2PJ8 A;  4X8I A;  4C86 A;  1OBR A;  3H4Q A;  3K9T A;  4EWT A;  2QVP A;  4E2A A;  2B5G B;  4FBE A;  1CE8 B;  2A4N A;  3FEC A;  4TJX A;  1PCA A;  4MFQ A;  2Q0Y A;  2Z11 A;  2ZPA A;  1YLE A;  5K99 A;  3IWG A;  3UY5 A;  2Z3N A;  5DS0 A;  2OU2 A;  2AUM A;  2V8H A;  2OZG A;  3B3V A;  5F48 A;  2OZU A;  3SJG A;  2G3T A;  1B47 A;  3TX8 A;  4NXY A;  4MFL A;  2Q7B A;  3ISX A;  5I0C A;  2JBK A;  4HKF A;  3LMS A;  3SJF A;  3O8Z A;  1CP7 A;  2ZXV A;  4LUA A;  2AFW A;  3OB2 B;  2B4J C;  4C99 A;  2R98 A;  1S7F A;  4MHY A;  2O28 A;  3U1B A;  2AFZ A;  2BL1 A;  3K4I A;  1TKJ A;  1Y7R A;  3S9L A;  1HEE A;  2C6C A;  2C6G A;  2G0B A;  4IK2 A;  2AUN A;  4MFJ A;  4CRZ B;  4NGN A;  4P4F A;  3SHP A;  3ICU A;  1P0H A;  3PBE A;  1KUY A;  3WC6 A;  4OC0 A;  1Y0R A;  2REF A;  4MBU A;  4A39 A;  3EY5 A;  3IO1 A;  1U6M A;  2GLJ A;  2GRE A;  4BIN A;  1YK3 A;  3TLE A;  2ZED A;  2EK9 A;  2EWB A;  3GKR A;  3IU2 A;  2FIA A;  1DIK A;  3PFE A;  2PCU A;  4CAV A;  3N7Z A;  1KEE B;  1IYL A;  2ZEE A;  1YW4 A;  4KNG E;  5G20 A;  1PUA A;  1KZF A;  4YFJ A;  1Z4R A;  4NEX A;  2X7B A;  4NGS A;  2FXF A;  3EXN A;  3OWC A;  3I3G A;  4CYN A;  1NBW A;  3SXO A;  3KI9 A;  4CS0 B;  2NMT A;  3K2K A;  4ZX9 A;  1M6V B;  2EZC A;  2CXA A;  1Z8L A;  1IY7 A;  2HQY A;  1L0C A;  4MHP A;  4CYQ A;  4C9R A;  4KVO E;  4MFK A;  2VEZ A;  4P6Y A;  3JVN A;  2Q4Y A;  4C2X A;  2FE7 A;  5CNP A;  2VI7 A;  2ZOF A;  1XMB A;  3BUN B;  2PDO A;  3KGQ A;  2PJC A;  4JWP A;  5FD8 A;  3TLZ A;  4C7H A;  1KUX A;  4ORF A;  1DE4 C;  4EYS A;  1Y7E A;  3H8G A;  5AG7 A;  5G21 A;  1CPS A;  3FJU A;  4B13 A;  2CNS A;  4EFD A;  4BD9 A;  5J3X A;  3PB6 X;  1PYT B;  2DF5 A;  4OC1 A;  1KC7 A;  1YLO A;  1F2P A;  2B5G A;  3R9E A;  2OLS A;  3GB0 A;  2HRO A;  3D4U A;  1ON0 A;  4MXU A;  2EVN A;  4TNU A;  3TT2 A;  5K8O A;  4UBR A;  3EZA A;  2I3C A;  4F8Z A;  2H5M A;  4KOX A;  4ZBG A;  1S7L A;  1YX0 A;  2QEC A;  4COB A;  4UEE A;  3BI1 A;  2YJV A;  4COG A;  5CBM A;  2YNC C;  2VKZ G;  2ABZ A;  5G1Z A;  2B3V A;  4X5K A;  1BO4 A;  1UFH A;  3BJ7 A;  2J8R A;  2CF4 A;  2PIZ A;  3HMJ G;  3NE7 A;  3FVL A;  2GFQ A;  8CPA A;  4B6Z A;  1ZRS A;  3BI0 A;  4P4B A;  5JVL A;  4MHZ A;  4NCZ A;  3I6S A;  2OR4 A;  3CPX A;  3B3C A;  4E5S A;  2YNE A;  4MRI A;  4E8O A;  2PJ1 A;  4R57 A;  5KTD A;  1EZA A;  3IEH A;  3CPA A;  2PCN A;  3V7Z A;  3QNV A;  3C26 A;  4WJB A;  4Q7A A;  3VAT A;  3FYN A;  3D7G A;  4KOU A;  4OP4 A;  5JQ4 A;  5IR2 A;  4C85 A;  2DLA A;  4U5Y A;  4UFX A;  2J9A A;  1JDE A;  3W6X A;  1Z5R A;  4QC6 A;  3TFY A;  3PFV A;  1QSM A;  4IIX A;  5AXI A;  1VHO A;  2ZW6 A;  5KTC A;  4XPK A;  2Q7S A;  2XEF A;  1FBV A;  5H84 A;  5JPH A;  1QST A;  2HWG A;  3PBB A;  4XPD C;  3JUW A;  2HB6 A;  3F0A A;  4UCM A;  1RXT A;  1LOK A;  1H8L A;  4LQ6 A;  3VH9 A;  4AVB A;  4J0N A;  1YVH A;  3WR7 A;  1IOF A;  1Y9W A;  3VRQ A;  4R87 A;  2AFM A;  1Z2L A;  3LD2 A;  3TOB A;  4FWU A;  4F0X A;  2P0W A;  1IID A;  2NYQ A;  1QQ9 A;  1RO5 A;  4CAF A;  3EZE A;  2GU2 A; 
#chains in the Genus database with same CATH homology
 1TKH A;  2XEI A;  2C6P A;  4OC4 A;  4PXD A;  2OOT A;  2ZEG A;  3CT9 A;  1Y9Z A;  4PXB A;  2PJB A;  4MMO A;  4NJR A;  1ZLI A;  4MCS A;  2C1C A;  3RBU A;  4F9U A;  3WC7 A;  3VTA A;  5F09 A;  5D29 A;  1ARL A;  1XFO A;  3KR5 A;  3D7D A;  4A38 A;  4ZI6 A;  3S9M A;  3MN8 A;  2AFU A;  3B3T A;  4O23 A;  2DEA A;  1NSA A;  2CTC A;  3D68 A;  4NGM A;  4G1P A;  4KSI A;  1UWY A;  4GM5 A;  3I74 A;  2BO9 A;  1XBU A;  5K8P A;  2PIY A;  3NA6 A;  2QYV A;  1LCP A;  2ZEH A;  2WYR A;  2EK8 A;  1EE3 P;  1TXR A;  4R8F A;  4P4I A;  4JZ0 A;  1VIX A;  2ANP A;  1F2O A;  2O4H A;  5HVG A;  5JH9 A;  4UEZ A;  4FUU A;  3DLJ A;  1LAM A;  3DGV A;  1VHE A;  4X3R A;  4MHN A;  3IWW A;  2GLF A;  5LRJ A;  4UEF A;  4NGP A;  3B3S A;  5HXD A;  3WC5 A;  3FEE A;  4NGR A;  4ONW A;  4MCQ A;  3PB9 X;  4RUH A;  4MCP A;  5LYF A;  1M4L A;  3BXM A;  2IMO A;  4C8F A;  1GYT A;  1ARM A;  4JYW A;  3RAM A;  2AFS A;  4OKO A;  5HVH A;  5K8N A;  5CPA A;  2PE3 A;  5HVF A;  4YWY A;  5LRG A;  1BAV A;  4W9Y A;  1FT7 A;  2XEJ A;  3B2Y A;  5ELY A;  2PVW A;  1CPX A;  4ZY1 A;  4X2T A;  2BCO A;  1CG2 A;  4PXE A;  4P4J A;  3FX6 A;  4R76 A;  5LYL A;  5LRK A;  3KZW A;  1ZG7 A;  1Y0Y A;  2V77 A;  3PB4 X;  3NFZ A;  5JM6 A;  4AXV A;  2XEG A;  4OID A;  1YSJ A;  4PPZ A;  4OC3 A;  1ZG8 A;  3GLJ A;  1XRY A;  4C8T A;  2C5Q A;  3FED A;  2PJ4 A;  4H2K A;  2VL1 A;  4NFR A;  3B3W A;  3NH4 A;  3PB8 X;  3EIF A;  3S9N A;  1CBX A;  1HDQ A;  4LQG A;  5LYI A;  2PJ3 A;  7CPA A;  3KQZ A;  3HLP A;  3VAR A;  2ZEF A;  5LYD A;  1RTQ A;  2PJ5 A;  2ZEL A;  3D7F A;  4Z65 A;  1VGY A;  5IB9 A;  1YW6 A;  4IAV A;  3KQX A;  4A37 A;  3KAS A;  4OME A;  1ELL P;  3NH5 A;  2CTB A;  4UIB A;  1HDU A;  2NSM A;  4CDJ A;  4NGT A;  2Q4Z A;  3MRU A;  4R7M A;  3N5F A;  4UF4 A;  3IFE A;  3I1U A;  4NGQ A;  3LWU A;  4PXC A;  2PJ7 A;  2IJZ A;  1Q7L A;  1CP6 A;  4NJQ A;  1ELM P;  4C84 A;  3CDX A;  2PJ6 A;  3FMC A;  3FH4 A;  1TF8 A;  3WAB A;  2JEW A;  3HUV A;  3WT4 A;  1BPN A;  3KL9 A;  1LFW A;  4UIA A;  3SI0 A;  1BLL E;  4P4E A;  2F7V A;  2AFX A;  1LAN A;  4PQA A;  4P45 A;  1CX8 A;  1ZG9 A;  2AFO A;  3SI1 A;  4CPA A;  4TWE A;  5K8M A;  4C8P A;  2V8G A;  2ZEM A;  4YU9 A;  1ZLH A;  2JBJ A;  4WWV A;  1AMP A;  2ZEN A;  5J1Q A;  5THW A;  1QMU A;  4IHM A;  4ZX8 A;  3IIB A;  1TKF A;  3D7H A;  4C9U A;  2PJA A;  4OIW A;  1YME A;  2BOA A;  5JGF A;  2POK A;  1DTD A;  2Q51 A;  3KR4 A;  4C8U A;  2PVV A;  4C8A A;  5I4M A;  3KHZ A;  4A94 A;  4DYO A;  1KWM A;  4P4D A;  3RZA A;  4FAI A;  3IJ3 A;  2F8H A;  3H8F A;  4MCR A;  1IGB A;  3SJE A;  4ZY2 A;  2PJ2 A;  2V8D A;  3TC8 A;  4F9V A;  3FF3 A;  4C9E A;  1F57 A;  1JQG A;  2G9D A;  3PFO A;  1TF9 A;  4OC2 A;  1XJO A;  3NH8 A;  2ZEO A;  4P44 A;  1FNO A;  4DUK A;  3PEI A;  1AYE A;  2PRQ A;  4CDK A;  3PB7 X;  3GUX A;  2QJ8 A;  3B7I A;  3SI2 A;  2ZOG A;  3V38 A;  3ISZ A;  4TJV A;  3PRT A;  4K3N A;  3D67 A;  1LAP A;  2Q43 A;  5D8N A;  3KHX A;  3BHX A;  2ZEP A;  1R3N A;  3T8W A;  2V8V A;  3JRU A;  4C8C A;  4ZYQ A;  4ZY0 A;  2HC9 A;  2FVG A;  2PJ9 A;  2O53 A;  1XF1 A;  4C9A A;  3SJX A;  4DJL A;  2PJ0 A;  1V6C A;  4EME A;  3H8E A;  3L2N A;  3D66 A;  2CIJ A;  1R43 A;  2RFH A;  4P10 A;  4OC5 A;  4YN3 A;  2RB7 A;  2IQ6 A;  3B35 A;  1BPM A;  3IC1 A;  6CPA A;  1WVM A;  4C9V A;  4R6T A;  2GP4 A;  4C86 A;  2WZN A;  2PJ8 A;  4X8I A;  1OBR A;  3K9T A;  4EWT A;  2QVP A;  4FBE A;  3FEC A;  4TJX A;  1PCA A;  5DS0 A;  2V8H A;  3B3V A;  3SJG A;  3TX8 A;  3ISX A;  2JBK A;  3LMS A;  3SJF A;  1CP7 A;  2AFW A;  4C99 A;  4MHY A;  2AFZ A;  1TKJ A;  3S9L A;  1HEE A;  2C6C A;  2C6G A;  4IK2 A;  4NGN A;  4P4F A;  3ICU A;  3PBE A;  3WC6 A;  4OC0 A;  1Y0R A;  4A39 A;  3IO1 A;  2GLJ A;  2GRE A;  2ZED A;  2EK9 A;  2EWB A;  3PFE A;  2PCU A;  2ZEE A;  1YW4 A;  4KNG E;  4NGS A;  3KI9 A;  4ZX9 A;  3K2K A;  1Z8L A;  1IY7 A;  4MHP A;  4C9R A;  4P6Y A;  2ZOF A;  3KGQ A;  1XMB A;  2PJC A;  1DE4 C;  1Y7E A;  3H8G A;  1CPS A;  3FJU A;  4EFD A;  4BD9 A;  3PB6 X;  1PYT B;  4OC1 A;  1F2P A;  1YLO A;  3GB0 A;  3D4U A;  4MXU A;  4TNU A;  5K8O A;  2I3C A;  4F8Z A;  4UEE A;  3BI1 A;  5CBM A;  2ABZ A;  2CF4 A;  2PIZ A;  3FVL A;  8CPA A;  4B6Z A;  3BI0 A;  4P4B A;  4MHZ A;  3I6S A;  2OR4 A;  3CPX A;  3B3C A;  4MRI A;  2PJ1 A;  3IEH A;  3CPA A;  3V7Z A;  3QNV A;  4WJB A;  4Q7A A;  3VAT A;  5IR2 A;  3D7G A;  4OP4 A;  4C85 A;  2J9A A;  1Z5R A;  1VHO A;  2XEF A;  3PBB A;  2HB6 A;  3VH9 A;  1LOK A;  1H8L A;  2AFM A;  1Z2L A;  4FWU A;  2NYQ A;  1QQ9 A;  2GU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...