2JBJA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with 2-pmpa (2-phosphonomethyl-pentanedioic acid)
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
694
structure length
687
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title Human Glutamate Carboxypeptidase II Inhibition: Structures of Gcpii in Complex with Two Potent Inhibitors, Quisqualate and 2-Pmpa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 253
structure length 687
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2jbjA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2jbjA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2jbjA02
2ZELA 1ZG7A 3CPAA 5CBMA 2JBJA 3V38A 3NH4A 1BPMA 5LRGA 5K8PA 3PBEA 4NGPA 3KHXA 4ZY1A 5HXDA 2C6GA 5I4MA 4PXEA 3MN8A 4UEEA 1UWYA 3WC5A 4WWVA 1KWMA 4UEFA 2PJ7A 2PJBA 2PVWA 2QVPA 5JGFA 4C84A 2XEFA 3B3CA 4OP4A 5F09A 3KHZA 2AFXA 2PJ2A 1RTQA 3BXMA 3WC6A 3SI2A 1CPXA 4OIWA 2V77A 2IJZA 2OOTA 2PCUA 4C9VA 4P10A 4C99A 4IAVA 4C8FA 2CIJA 1PCAA 3KR4A 4NFRA 2O4HA 2ZOFA 1XF1A 2ZOGA 4UIAA 3CT9A 3K2KA 6CPAA 2GREA 4C9EA 3PFEA 1QMUA 4DYOA 3I1UA 3FF3A 3FJUA 3TX8A 2PJ0A 1R43A 1IGBA 1OBRA 3ISXA 4P4JA 4MHPA 4C9UA 3KI9A 2C1CA 3ICUA 3B35A 4F9UA 1YSJA 3QNVA 5HVFA 2PJAA 4IHMA 2PJ8A 4OC5A 1AMPA 4C85A 1TF8A 4YN3A 3VTAA 4H2KA 1Z2LA 3H8GA 4OC1A 4DUKA 2POKA 3FEEA 2ZEHA 1WVMA 1XRYA 1F57A 1F2PA 2IMOA 2AFOA 2V8DA 4X2TA 2PE3A 3D7DA 1TKJA 1ELMP 2Q43A 4OKOA 1BAVA 1ARLA 3D68A 1Y7EA 1Y0YA 2PJ4A 2AFMA 3PB4X 4R6TA 4TNUA 2RB7A 1EE3P 3FECA 4O23A 5HVGA 3SJXA 4P4DA 3IC1A 3I74A 3IFEA 3IWWA 4P4FA 1VHOA 3KL9A 3PB9X 3KR5A 2XEJA 3IO1A 1H8LA 3KQXA 4NGNA 3NH5A 2ABZA 3T8WA 5LYIA 1YMEA 3JRUA 4UEZA 4UIBA 2C6PA 1Z5RA 5JH9A 1ZLHA 3PB7X 3I6SA 2I3CA 5IB9A 3TC8A 5J1QA 1DE4C 1V6CA 4OIDA 4C8AA 3IIBA 3FMCA 3WABA 5K8OA 3MRUA 2PJ6A 4PPZA 4AXVA 2BCOA 2O53A 2GU2A 2PJ9A 4ONWA 3VH9A 4MHZA 2DEAA 4UF4A 2F7VA 1XBUA 2C6CA 1R3NA 4PXBA 5K8NA 3NFZA 4A38A 3GUXA 3KGQA 3PRTA 5HVHA 4Q7AA 3IJ3A 2AFWA 2CTBA 2ZEMA 2PJCA 2V8GA 2ZEDA 1VGYA 4G1PA 3LMSA 3SJFA 1CP7A 3KASA 3FVLA 4CDJA 2PIZA 4FAIA 2Q51A 3RZAA 4R8FA 3LWUA 1ZG9A 3HUVA 1CP6A 4NJQA 3D7GA 2F8HA 4A39A 2HB6A 1TXRA 4CPAA 4OC2A 4W9YA 2AFSA 3B3WA 2BO9A 4KNGE 1XMBA 4B6ZA 2HC9A 3IEHA 4NGTA 3BI1A 5LRJA 2ZENA 1FT7A 1Y0RA 3NH8A 3VARA 1HDUA 3D4UA 4EFDA 3ISZA 3D7HA 4TWEA 4P4IA 4IK2A 1TKHA 3S9NA 2NYQA 1GYTA 4FWUA 4C86A 3PFOA 2CF4A 1QQ9A 4NGRA 3SI0A 3CPXA 3PB8X 3KQZA 4WJBA 2JEWA 4P6YA 4P45A 3SJGA 4NJRA 7CPAA 1XJOA 2PJ1A 1FNOA 4NGSA 5THWA 3S9LA 4MMOA 4EMEA 5D29A 4ZYQA 4MCRA 4MHYA 3BI0A 2RFHA 1ZG8A 1HEEA 5LYFA 2XEIA 1YW6A 2BOAA 4R7MA 1TF9A 2G9DA 4NGMA 4KSIA 4ZX8A 4C8UA 3B3SA 4YU9A 4X3RA 4C8PA 3H8EA 4GM5A 4K3NA 5LYLA 5D8NA 4PXCA 4OC3A 2NSMA 4ZI6A 2XEGA 1F2OA 1LOKA 5JM6A 1LAMA 4Z65A 3RBUA 2ZEEA 4LQGA 3FX6A 4OMEA 1BPNA 3HLPA 1LAPA 1YLOA 4OC4A 4PQAA 1LANA 3SJEA 5ELYA 2ANPA 1ELLP 1Q7LA 2JBKA 2V8VA 1IY7A 4PXDA 3B3VA 4MXUA 3B3TA 8CPAA 1CG2A 4A94A 2ZEFA 4TJVA 3FH4A 4ZY2A 3DGVA 1M4LA 2PIYA 3VATA 1VHEA 2ZEGA 3S9MA 2QJ8A 4MCSA 4MCPA 2ZEPA 4DJLA 2GLJA 2EK9A 3WT4A 3GLJA 2WYRA 2CTCA 4EWTA 3SI1A 4R76A 2ZEOA 1JQGA 4YWYA 4OC0A 2AFZA 3FEDA 2OR4A 1XFOA 3RAMA 4FBEA 2IQ6A 3GB0A 4C8CA 1YW4A 4RUHA 2AFUA 4ZY0A 1BLLE 2EK8A 4P44A 1VIXA 3EIFA 2WZNA 4ZX9A 3L2NA 3V7ZA 4TJXA 4A37A 4F9VA 2PVVA 5LRKA 3D67A 3BHXA 1NSAA 1Z8LA 1HDQA 1ARMA 3PBBA 4X8IA 2V8HA 4JZ0A 1DTDA 4CDKA 3WC7A 4C9RA 1AYEA 5DS0A 4C8TA 1LCPA 1ZLIA 3CDXA 3N5FA 5CPAA 3H8FA 1CPSA 2VL1A 3D66A 4FUUA 4JYWA 1CBXA 4NGQA 4P4BA 1CX8A 2EWBA 4C9AA 3B7IA 5LYDA 4MCQA 1Y9ZA 3D7FA 3K9TA 2PJ5A 2Q4ZA 1TKFA 2J9AA 1PYTB 3NA6A 1LFWA 3B2YA 3PB6X 4MHNA 4P4EA 4BD9A 3DLJA 4MRIA 2PRQA 2PJ3A 5K8MA 3PEIA 3KZWA 2GLFA 2FVGA 2QYVA 4F8ZA
chains in the Genus database with same CATH superfamily
4M6GA 2PSWA 2ZELA 1ZG7A 2BL1A 5G22A 3CPAA 5CBMA 3HPGG 3D8PA 4H89A 3C8OA 2JBJA 4KVME 3V38A 3NH4A 4QUSA 1I21A 1BPMA 5LRGA 5K8PA 1U6MA 3PBEA 4NGPA 2PQ8A 3KHXA 4II9A 4ZY1A 1BXRB 2X0SA 4IIYA 3TOBA 5F47A 1KZFA 5HXDA 1CJWA 2C6GA 2CNTA 2Z3MA 2HQYA 5I4MA 4H6ZA 1M1DA 4PXEA 2B58A 5C88A 5J8CA 2GE3A 3T0TA 3FXTA 3MN8A 2N3AB 2B5GA 2P6EA 2PR1A 1UWYA 4UEEA 3WC5A 4WWVA 4BBHA 1IU8A 2YNDA 1KWMA 2JLMA 4UEFA 1KUVA 4BPWB 2PJ7A 3JVNA 2ZXVA 2B4BA 3GIUA 2PJBA 4MY0A 1IOFA 2J8RA 2PVWA 2QVPA 4OADA 1R57A 3F8KA 3QAHA 4BPXB 4OLLA 4R9MA 3R1KA 4UWJA 2XEFA 2O28A 1XOVA 3B3CA 4OP4A 5CNPA 2G0BA 4IIXA 5F09A 3KHZA 4CYNA 2AFXA 2PJ2A 4H1HA 1RTQA 3OAKA 3BXMA 3WC6A 4Y49C 4ZGYB 3SI2A 4CGNA 3IGRA 5KTCA 4GS4A 1CPXA 1QSRA 4KOYA 4OIWA 3BUWB 1CE8B 2V77A 3W6SA 2IJZA 2FIAA 2OOTA 1TIQA 2PCUA 4C9VA 2ZW5A 4P10A 2YNCA 4C99A 4IAVA 4CGMA 4C8FA 2CIJA 3LACA 4JWPA 3TYXA 4KLWA 1N71A 1PCAA 3KR4A 2HI6A 2VI7A 4QC6A 4NFRA 4CAVA 2O4HA 3BUXB 2ZOFA 1XF1A 2YJVA 4MI1A 4KUBA 2ZOGA 5F5XA 5J3XA 3K4IA 1Y9WA 4M6IA 4Y49B 4UIAA 5C82A 3CT9A 3K2KA 6CPAA 2GREA 4C9EA 2FSRA 1J4JA 2Z11A 3PFEA 3TCVA 1QMUA 5G1ZA 5BY0A 2X7BA 4DYOA 5F48A 3I1UA 2RC4A 3B8GA 3FF3A 4UBRA 3FJUA 1UFHA 3EFAA 4L8AA 4UFWA 2PJ0A 1R43A 3TX8A 1EZBA 1IGBA 1OBRA 2WPWA 4P4JA 3ISXA 4MHPA 1JWQA 1S60A 2C1CA 3KI9A 1RXTA 4UFVA 3R9GA 3ICUA 3TLZA 2MP0A 1AUGA 4KOTA 3B35A 3TO7A 4F9UA 2OZUA 3PFVA 1YSJA 2Q7SA 3S6FA 1VI4A 1VBGA 1MJ9A 5EMIA 4PV6A 3PZJA 1XIXA 3JUWA 5HH1A 5GCNA 2R98A 4KVXA 1X12A 3DSBA 3QNVA 2PJAA 5F49A 5HVFA 3WR7A 3VRQA 2AE6A 4IHMA 4A33A 2PJ8A 4CZ1A 4OC5A 1AMPA 4C85A 1TF8A 4YN3A 1VBHA 3VTAA 4H2KA 1Z2LA 3FNCA 3PGPA 3U1BA 4RI1A 3H8GA 4E0AA 4OC1A 3S6HA 1ON0A 4DUKA 4C84A 4U9ZA 2POKA 3FEEA 2ZEHA 1WVMA 2KCWA 2R7HA 1XRYA 2REFA 1F57A 2CY2A 1F2PA 3EXNA 1L0CA 2B0AA 3V8IA 2IMOA 4EVYA 2AFOA 2V8DA 4F0XA 4R87A 4X2TA 1S7LA 5IB0A 3TLCA 2PE3A 1VHSA 3D7DA 3NOJA 1IIDA 1TKJA 3BLNA 5IR2A 1ELMP 4KS9A 4F6AA 2Q43A 2DIKA 3FBUA 4OKOA 4MFLA 1BAVA 2GIVA 4CYPA 2FE7A 4DNCA 1ARLA 5H86A 4MFPA 2AUMA 3TO6A 3D68A 4BINA 1ZRSA 2DPSA 3H5ZA 3N7ZA 4MI4A 2Q4VA 1Y7EA 1Q2DA 1QSMA 1Y0YA 1Z9UA 2PJ4A 3OWCA 2AFMA 3DDDA 3SHPA 3PB4X 4R6TA 4U9YA 2CBLA 4TNUA 5FVJA 2RB7A 4FD5A 4AG7A 1M4IA 1EE3P 3FECA 2G3AA 4O23A 4NF1A 4B5OA 5HKWA 3SJXA 5HVGA 5JGFA 4KOUA 4P4DA 3IC1A 3CXSA 2Q7BA 3I74A 3IFEA 2EO8A 3U88C 2HV2A 2B4DB 3IWWA 5ISVA 4P4FA 1VHOA 2DXQA 3KL9A 3TFYA 1C30B 3PB9X 2VBQA 5BWAB 3F5BA 3FIXA 2HROA 4INJA 3KR5A 4LQ6A 4ZBGA 2XEJA 3IO1A 3IU1A 4GXHA 2EZCA 2JEVA 1M6VB 1ZO0A 3TLGA 1BOBA 1H8LA 3KQXA 4HNXB 4NGNA 3QB8A 4Q36A 3T90A 1Z8TA 4A4BA 1B6BA 1ZYMA 4XPDC 3TE4A 3NH5A 4HKFA 1YX0A 4JXRA 2F5IA 2ABZA 2C27A 1S3ZA 3GKRA 2Z3LA 3BUOB 1Z4RA 4MHDA 5LYIA 3T8WA 2PR8A 5HKYA 1OZPA 1YMEA 1SQHA 3JRUA 3S6KA 1XEBA 4K30A 2R1IA 1YK3A 4YFJA 2XPPA 4HNWB 4M6HA 4UEZA 1QSTA 2C6PA 3P2HA 4UIBA 1Z5RA 5HMNA 2XPNA 5JH9A 4RS2A 3R95A 1ZLHA 3PB7X 3A9LA 1M44A 3I6SA 3KRVA 3CXPA 3VRPA 1K4JA 5F46A 2B4DA 1WJTA 2CNMA 2I3CA 4NEXA 4XPDB 3SXNA 3TC8A 4CAEA 5IB9A 1DE4C 5AXIA 5J1QA 4B11A 1T36B 4OIDA 1V6CA 4C8AA 3IIBA 3FMCA 1WK4A 2P6FA 3MRUA 3WABA 5K8OA 2PJ6A 4PPZA 4C9UA 4AXVA 2FIWA 3R9FA 3PP9A 4C2YA 1YREA 2BCOA 2O53A 2GU2A 2PJ9A 5E96A 1IYLA 3GYAA 1MJAA 3TO9A 2GFQA 4CAFA 4ONWA 3VH9A 4MHZA 4CO9A 5EBVA 3BJ8A 5F9MA 1IOIA 4B13A 5KTAA 3EZBA 4KOXA 2DEAA 2EVNA 4UF4A 2F7VA 1XBUA 2QMLA 2UV8G 2C6CA 1R3NA 4PXBA 5K8NA 3NFZA 4A38A 4JVOA 4J3GA 2IL4A 2ZW6A 3GUXA 3KGQA 3PRTA 5HVHA 4Q7AA 4R57A 4AB7A 3IJ3A 1Y9KA 4CGLA 3G8WA 2YJTA 3IWGA 2AFWA 5JQ4A 2OLSA 4AVAA 2NMTA 2CTBA 2ZEMA 1IYKA 1YVOA 2REEA 2E28A 4QBJA 1ZL0A 2PJCA 2V8GA 2ZEDA 5AG4A 1VGYA 5H84A 4G1PA 3LMSA 4XNHB 3SJFA 1CP7A 3KASA 3SR3A 3FVLA 4CDJA 4M85A 4IUSA 2Z0ZA 2PIZA 2OU2A 4FAIA 4A32A 2Q51A 4RN7A 4C2ZA 3RZAA 4R8FA 1Z8WA 3LWUA 4MBUA 1ZG9A 3KKWA 1J3LA 2PCNA 3HUVA 1CP6A 4R3KA 4NJQA 1Q5XA 3D7GA 1A9XB 2F8HA 1WWZA 1Q2CA 4A39A 1I12A 4KSFA 5HKZA 2FXFA 2HB6A 1TXRA 3TOAA 4CPAA 2EZBA 4OC2A 4W9YA 2AFSA 2WSAA 5K99A 4FD6A 3D2PA 3BUMB 2BO9A 1YQEA 3B3WA 1DIKA 4KNGE 1XMBA 4B6ZA 3T05A 2PRBA 4JXQA 2B4JC 2HC9A 3IEHA 4NGTA 3DR8A 2PC1A 3RYOA 5J8FA 1M4GA 4ONUA 1Y7RA 3BI1A 5LRJA 2ZENA 3VROA 3VWDA 3I3GA 3FYNA 2BEIA 3GY9A 2VEZA 4UCMA 3T07A 1FT7A 1Y0RA 1YVKA 3NH8A 3VARA 4B5PB 1HDUA 3D4UA 5AG7A 4EFDA 3ISZA 3T9YA 4U5YA 3D7HA 3F9KC 4TWEA 4P4IA 4IK2A 1BO4A 1TKHA 4F0YA 3S9NA 2NYQA 3TLGB 3TLBA 1GYTA 2WPXA 2QECA 3I9SA 4FWUA 2K5TA 2Q4YA 3OB1B 4C86A 3PFOA 2CF4A 4PK2A 4YGOA 1QQ9A 4LX9A 1LRZA 4NGRA 2FM4A 3SI0A 2Z10A 1P0HA 3CPXA 3PB8X 1S7KA 2OB0A 3KQZA 4WJBA 3R9EA 2FL4A 1YLEA 3D3SA 4UWIA 2H5MA 2JEWA 1M4DA 2Z3OA 4KZTA 4P6YA 3PLFB 4P45A 3P2FA 4CYOA 3SJGA 1QSOA 2XPLA 5G21A 4COBA 2VXKA 4FD4A 4NJRA 7CPAA 1XJOA 2PJ1A 5F13A 4CS0B 1FNOA 4NGSA 5THWA 2GANA 5A27A 1XE4A 4UFXA 3S9LA 4MMOA 3W91A 4EMEA 1IB1E 2P0WA 3LD2A 5D29A 4ZYQA 1S7FA 4MCRA 2Y0MA 1Q2YA 4MHYA 4B5PA 4CAXA 2I79A 3BI0A 2RFHA 3ZNIA 4MFQA 1ZG8A 4AVBA 1HEEA 5LYFA 2BSWA 5JPHA 2XEIA 4RR2B 1YW6A 2BOAA 1PU9A 4R7MA 1X10A 1TF9A 1GGOA 3TLEA 4QB9A 2G9DA 4UCPA 4NGMA 1MJBA 4KSIA 2YNEA 2DPTA 3B3SA 4ZX8A 4NCZA 4YU9A 1CS0B 1KEEB 4C8UA 4X3RA 5DWMA 2D0PA 4CRYB 4C8PA 3EO4A 3CZXA 2JDCA 4XPLA 3H8EA 3W6XA 4C7HA 1C3OB 4E94A 1YGHA 1QSNA 4GM5A 4L89A 3MGDA 5AG5A 4E2AA 4C7IA 4K3NA 5LYLA 4HPSA 5D8NA 2ARHA 4B12A 2ZPAA 4B14A 3GJZA 3HMJG 4PXCA 5I0CA 3H4QA 1NXJA 1KBLA 4OC3A 1B87A 4KSAA 2NSMA 4ORFA 4ZI6A 2XEGA 1F2OA 4KOSA 1R61A 4QVTA 2DF5A 4M8DA 3IU2A 4BTFA 1LOKA 4BPUB 2VQYA 4B10A 3RNZA 5JM6A 2C5QA 4CGPA 2B3VA 1LAMA 2EBJA 4Z65A 4JJXA 1FBVA 3LODA 3RBUA 4LQGA 2QYVA 2ZEEA 4MJ8A 4OAEA 3VGOA 4R3LA 4YRHA 4E8OA 3FX6A 4OMEA 3D2MA 3TLYA 2FS5A 2ZW4A 3VRRA 2JDDA 1BPNA 3HLPA 1LAPA 2A4NA 4XNHC 1YLOA 4AG9A 4OC4A 2PDOA 3O8ZA 4CYQA 4PQAA 4E5SA 5IV0A 1LANA 5ELYA 3OB2B 3ZZIA 2ANPA 3PT1A 1ELLP 2EZAA 1Q7LA 2JBKA 4KUAA 4HNYB 2V8VA 1IY7A 4PXDA 3B3VA 4MXUA 3B3TA 8CPAA 2J8NA 1CG2A 4A94A 4C68A 2GP4A 2ZW7A 2B3UA 4KLVA 2ZEFA 4TJVA 3FB3A 3FH4A 2Q0YA 5AG6A 3DGVA 3JTKA 4ZY2A 1M4LA 2Z3KA 3EC4A 4LUAA 5G20A 3S6GA 2G3TA 2PIYA 1KUXA 2AJ6A 3VATA 1VHEA 2ZEGA 4KVOE 3TLAA 3S9MA 2QJ8A 4MCSA 4MCPA 2VZYA 4MJXA 5FD8A 2ZEPA 1RO5A 1Z9EA 4GPLB 3RO0A 3TT2A 4DJLA 2GLJA 2EK9A 3WT4A 1NBWA 1Z4EA 4MFZA 2J8MA 3FRMA 3GLJA 1MK4A 2WYRA 2CTCA 4PSXA 2WUUA 3ZJ0A 1A2ZA 2D0OA 4EWTA 3SI1A 1XF8A 1VKCA 2ZEOA 4R76A 1JQGA 4YWYA 3SXOA 4OC0A 2AFZA 3FEDA 4Q38A 2OR4A 1IICA 4IF5A 1XFOA 3RAMA 4BMHA 4FBEA 2FT0A 3T5MA 2Y1MA 2IQ6A 3GB0A 3OP0A 4C8CA 1YW4A 3G3SA 4RUHA 5IX3A 4X5KA 4J0NA 2ATRA 5KTDA 2AFUA 4ZY0A 2AUNA 3G23A 3R96A 1BLLE 2EK8A 4P44A 1VIXA 2OZHA 4UA3A 2WZNA 4C2XA 3EIFA 4ZX9A 4A31A 3L2NA 3V7ZA 4TJXA 1XMTA 4A37A 4CRZB 4NXYA 2BUEA 1YR0A 2DLAA 4CAWA 4A4CA 2VZZA 4NSQA 4F9VA 2PVVA 1YVHA 3D67A 5LRKA 5AGEA 1GHEA 1I1DA 3BHXA 1NSAA 1Z8LA 1HDQA 2I00A 1ARMA 2CXAA 4A30A 3HPHE 3PBBA 4X8IA 4CGOA 1EZAA 3TTHA 1NMTA 3C26A 2V8HA 4JZ0A 1DTDA 1P4NA 1Z8XA 4XPKA 4H6UA 1NSLA 1JDEA 5F1YA 2Z3NA 4CDKA 2YGWA 4COGA 4A2ZA 4PK3A 3WC7A 4EYSA 1KUYA 1KC7A 2OH1A 2EUIA 3BJ7A 4C9RA 2D4OA 4FD7A 1AYEA 5DS0A 4C8TA 3VRNA 1PUAA 2D4PA 5EC4A 1LCPA 1ZLIA 1NE9A 2HUZA 3CDXA 3N5FA 5CPAA 3H8FA 1CPSA 3EY5A 2VL1A 1FY7A 5DWNA 3UY5A 3D66A 4FUUA 4JYWA 1CBXA 3DR6A 5JVLA 4KOWA 4NGQA 2QIRA 3NE7A 3CXQA 3NFQA 2HWGA 3F0AA 4P4BA 3DNSA 1CX8A 3EZAA 4MFJA 5A28A 4KORA 2EWBA 3EZEA 4JLYA 4PSWA 2ODFA 4UCNA 4I49A 3BUNB 4C9AA 4AVCA 3B7IA 5LYDA 5JYBA 2Q44A 3NE8A 3VWEA 4MCQA 3K9UA 1CM0A 3E0KA 4M3SA 4MY3A 1Y9ZA 1V0CA 3D7FA 3K9TA 2Z3PA 4JD6A 2PJ5A 2OZGA 2Q4ZA 1TKFA 2J9AA 1PYTB 3NA6A 1LFWA 4A95A 3B2YA 3PB6X 1JDBC 2B5GB 4MHNA 4P4EA 3QAYA 4BD9A 3DLJA 4KOVA 4MRIA 2PRQA 1S5KA 2P6GA 2PJ3A 5K8MA 3PEIA 4MFKA 2VKZG 2R82A 2YNCC 2CNSA 1S7NA 2Y1NA 2R8VA 3KZWA 1B47A 3IWEA 1EO0A 2Q04A 2FCKA 2XPOA 2GLFA 2FVGA 3SJEA 4F8ZA
chains in the Genus database with same CATH topology
2ZELA 1ZG7A 3CPAA 5CBMA 2JBJA 3V38A 3NH4A 1BPMA 5LRGA 5K8PA 3PBEA 4NGPA 3KHXA 4ZY1A 5HXDA 2C6GA 5I4MA 4PXEA 3MN8A 4UEEA 1UWYA 3WC5A 4WWVA 1KWMA 4UEFA 2PJ7A 2PJBA 2PVWA 2QVPA 5JGFA 4C84A 2XEFA 3B3CA 4OP4A 5F09A 3KHZA 2AFXA 2PJ2A 1RTQA 3BXMA 3WC6A 3SI2A 1CPXA 4OIWA 2V77A 2IJZA 2OOTA 2PCUA 4C9VA 4P10A 4C99A 4IAVA 4C8FA 2CIJA 1PCAA 3KR4A 4NFRA 2O4HA 2ZOFA 1XF1A 2ZOGA 4UIAA 3CT9A 3K2KA 6CPAA 2GREA 4C9EA 3PFEA 1QMUA 4DYOA 3I1UA 3FF3A 3FJUA 3TX8A 2PJ0A 1R43A 1IGBA 1OBRA 3ISXA 4P4JA 4MHPA 4C9UA 3KI9A 2C1CA 3ICUA 3B35A 4F9UA 1YSJA 3QNVA 5HVFA 2PJAA 4IHMA 2PJ8A 4OC5A 1AMPA 4C85A 1TF8A 4YN3A 3VTAA 4H2KA 1Z2LA 3H8GA 4OC1A 4DUKA 2POKA 3FEEA 2ZEHA 1WVMA 1XRYA 1F57A 1F2PA 2IMOA 2AFOA 2V8DA 4X2TA 2PE3A 3D7DA 1TKJA 5IR2A 1ELMP 2Q43A 4OKOA 1BAVA 1ARLA 3D68A 1Y7EA 1Y0YA 2PJ4A 2AFMA 3PB4X 4R6TA 4TNUA 2RB7A 1EE3P 3FECA 4O23A 5HVGA 3SJXA 4P4DA 3IC1A 3I74A 3IFEA 3IWWA 4P4FA 1VHOA 3KL9A 3PB9X 3KR5A 2XEJA 3IO1A 1H8LA 3KQXA 4NGNA 3NH5A 2ABZA 3T8WA 5LYIA 1YMEA 3JRUA 4UEZA 4UIBA 2C6PA 1Z5RA 5JH9A 1ZLHA 3PB7X 3I6SA 2I3CA 5IB9A 3TC8A 5J1QA 1DE4C 1V6CA 4OIDA 4C8AA 3IIBA 3FMCA 3WABA 5K8OA 3MRUA 2PJ6A 4PPZA 4AXVA 2BCOA 2O53A 2GU2A 2PJ9A 4ONWA 3VH9A 4MHZA 2DEAA 4UF4A 2F7VA 1XBUA 2C6CA 1R3NA 4PXBA 5K8NA 3NFZA 4A38A 3GUXA 3KGQA 3PRTA 5HVHA 4Q7AA 3IJ3A 2AFWA 2CTBA 2ZEMA 2PJCA 2V8GA 2ZEDA 1VGYA 4G1PA 3LMSA 3SJFA 1CP7A 3KASA 3FVLA 4CDJA 2PIZA 4FAIA 2Q51A 3RZAA 4R8FA 3LWUA 1ZG9A 3HUVA 1CP6A 4NJQA 3D7GA 2F8HA 4A39A 2HB6A 1TXRA 4CPAA 4OC2A 4W9YA 2AFSA 3B3WA 2BO9A 4KNGE 1XMBA 4B6ZA 2HC9A 3IEHA 4NGTA 3BI1A 5LRJA 2ZENA 1FT7A 1Y0RA 3NH8A 3VARA 1HDUA 3D4UA 4EFDA 3ISZA 3D7HA 4TWEA 4P4IA 4IK2A 1TKHA 3S9NA 2NYQA 1GYTA 4FWUA 4C86A 3PFOA 2CF4A 1QQ9A 4NGRA 3SI0A 3CPXA 3PB8X 3KQZA 4WJBA 2JEWA 4P6YA 4P45A 3SJGA 4NJRA 7CPAA 1XJOA 2PJ1A 1FNOA 4NGSA 5THWA 3S9LA 4MMOA 4EMEA 5D29A 4ZYQA 4MCRA 4MHYA 3BI0A 2RFHA 1ZG8A 1HEEA 5LYFA 2XEIA 1YW6A 2BOAA 4R7MA 1TF9A 2G9DA 4NGMA 4KSIA 4ZX8A 4C8UA 3B3SA 4YU9A 4X3RA 4C8PA 3H8EA 4GM5A 4K3NA 5LYLA 5D8NA 4PXCA 4OC3A 2NSMA 4ZI6A 2XEGA 1F2OA 1LOKA 5JM6A 2C5QA 1LAMA 4Z65A 3RBUA 2ZEEA 4LQGA 3FX6A 4OMEA 1BPNA 3HLPA 1LAPA 1YLOA 4OC4A 4PQAA 1LANA 3SJEA 5ELYA 2ANPA 1ELLP 1Q7LA 2JBKA 2V8VA 1IY7A 4PXDA 3B3VA 4MXUA 3B3TA 8CPAA 1CG2A 4A94A 2GP4A 2ZEFA 4TJVA 3FH4A 4ZY2A 3DGVA 1M4LA 2PIYA 3VATA 1VHEA 2ZEGA 3S9MA 2QJ8A 4MCSA 4MCPA 2ZEPA 4DJLA 2GLJA 2EK9A 3WT4A 3GLJA 2WYRA 2CTCA 4EWTA 3SI1A 4R76A 2ZEOA 1JQGA 4YWYA 4OC0A 2AFZA 3FEDA 2OR4A 1XFOA 3RAMA 4FBEA 2IQ6A 3GB0A 4C8CA 1YW4A 4RUHA 2AFUA 4ZY0A 1BLLE 2EK8A 4P44A 1VIXA 3EIFA 2WZNA 4ZX9A 3L2NA 3V7ZA 4TJXA 4A37A 4F9VA 2PVVA 5LRKA 3D67A 3BHXA 1NSAA 1Z8LA 1HDQA 1ARMA 3PBBA 4X8IA 2V8HA 4JZ0A 1DTDA 4CDKA 3WC7A 4C9RA 1AYEA 5DS0A 4C8TA 1LCPA 1ZLIA 3CDXA 3N5FA 5CPAA 3H8FA 1CPSA 2VL1A 3D66A 4FUUA 4JYWA 1CBXA 4NGQA 4P4BA 1CX8A 2EWBA 4C9AA 3B7IA 5LYDA 4MCQA 1Y9ZA 3D7FA 3K9TA 2PJ5A 2Q4ZA 1TKFA 2J9AA 1PYTB 3NA6A 1LFWA 3B2YA 3PB6X 4MHNA 4P4EA 4BD9A 3DLJA 4MRIA 2PRQA 2PJ3A 5K8MA 3PEIA 3KZWA 2GLFA 2FVGA 2QYVA 4F8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEL A;  1ZG7 A;  3CPA A;  5CBM A;  2JBJ A;  3V38 A;  3NH4 A;  1BPM A;  5LRG A;  5K8P A;  3PBE A;  4NGP A;  3KHX A;  4ZY1 A;  5HXD A;  2C6G A;  5I4M A;  4PXE A;  3MN8 A;  4UEE A;  1UWY A;  3WC5 A;  4WWV A;  1KWM A;  4UEF A;  2PJ7 A;  2PJB A;  2PVW A;  2QVP A;  5JGF A;  4C84 A;  2XEF A;  3B3C A;  4OP4 A;  5F09 A;  3KHZ A;  2AFX A;  2PJ2 A;  1RTQ A;  3BXM A;  3WC6 A;  3SI2 A;  1CPX A;  4OIW A;  2V77 A;  2IJZ A;  2OOT A;  2PCU A;  4C9V A;  4P10 A;  4C99 A;  4IAV A;  4C8F A;  2CIJ A;  1PCA A;  3KR4 A;  4NFR A;  2O4H A;  2ZOF A;  1XF1 A;  2ZOG A;  4UIA A;  3CT9 A;  3K2K A;  6CPA A;  2GRE A;  4C9E A;  3PFE A;  1QMU A;  4DYO A;  3I1U A;  3FF3 A;  3FJU A;  3TX8 A;  2PJ0 A;  1R43 A;  1IGB A;  1OBR A;  3ISX A;  4P4J A;  4MHP A;  4C9U A;  3KI9 A;  2C1C A;  3ICU A;  3B35 A;  4F9U A;  1YSJ A;  3QNV A;  5HVF A;  2PJA A;  4IHM A;  2PJ8 A;  4OC5 A;  1AMP A;  4C85 A;  1TF8 A;  4YN3 A;  3VTA A;  4H2K A;  1Z2L A;  3H8G A;  4OC1 A;  4DUK A;  2POK A;  3FEE A;  2ZEH A;  1WVM A;  1XRY A;  1F57 A;  1F2P A;  2IMO A;  2AFO A;  2V8D A;  4X2T A;  2PE3 A;  3D7D A;  1TKJ A;  1ELM P;  2Q43 A;  4OKO A;  1BAV A;  1ARL A;  3D68 A;  1Y7E A;  1Y0Y A;  2PJ4 A;  2AFM A;  3PB4 X;  4R6T A;  4TNU A;  2RB7 A;  1EE3 P;  3FEC A;  4O23 A;  5HVG A;  3SJX A;  4P4D A;  3IC1 A;  3I74 A;  3IFE A;  3IWW A;  4P4F A;  1VHO A;  3KL9 A;  3PB9 X;  3KR5 A;  2XEJ A;  3IO1 A;  1H8L A;  3KQX A;  4NGN A;  3NH5 A;  2ABZ A;  3T8W A;  5LYI A;  1YME A;  3JRU A;  4UEZ A;  4UIB A;  2C6P A;  1Z5R A;  5JH9 A;  1ZLH A;  3PB7 X;  3I6S A;  2I3C A;  5IB9 A;  3TC8 A;  5J1Q A;  1DE4 C;  1V6C A;  4OID A;  4C8A A;  3IIB A;  3FMC A;  3WAB A;  5K8O A;  3MRU A;  2PJ6 A;  4PPZ A;  4AXV A;  2BCO A;  2O53 A;  2GU2 A;  2PJ9 A;  4ONW A;  3VH9 A;  4MHZ A;  2DEA A;  4UF4 A;  2F7V A;  1XBU A;  2C6C A;  1R3N A;  4PXB A;  5K8N A;  3NFZ A;  4A38 A;  3GUX A;  3KGQ A;  3PRT A;  5HVH A;  4Q7A A;  3IJ3 A;  2AFW A;  2CTB A;  2ZEM A;  2PJC A;  2V8G A;  2ZED A;  1VGY A;  4G1P A;  3LMS A;  3SJF A;  1CP7 A;  3KAS A;  3FVL A;  4CDJ A;  2PIZ A;  4FAI A;  2Q51 A;  3RZA A;  4R8F A;  3LWU A;  1ZG9 A;  3HUV A;  1CP6 A;  4NJQ A;  3D7G A;  2F8H A;  4A39 A;  2HB6 A;  1TXR A;  4CPA A;  4OC2 A;  4W9Y A;  2AFS A;  3B3W A;  2BO9 A;  4KNG E;  1XMB A;  4B6Z A;  2HC9 A;  3IEH A;  4NGT A;  3BI1 A;  5LRJ A;  2ZEN A;  1FT7 A;  1Y0R A;  3NH8 A;  3VAR A;  1HDU A;  3D4U A;  4EFD A;  3ISZ A;  3D7H A;  4TWE A;  4P4I A;  4IK2 A;  1TKH A;  3S9N A;  2NYQ A;  1GYT A;  4FWU A;  4C86 A;  3PFO A;  2CF4 A;  1QQ9 A;  4NGR A;  3SI0 A;  3CPX A;  3PB8 X;  3KQZ A;  4WJB A;  2JEW A;  4P6Y A;  4P45 A;  3SJG A;  4NJR A;  7CPA A;  1XJO A;  2PJ1 A;  1FNO A;  4NGS A;  5THW A;  3S9L A;  4MMO A;  4EME A;  5D29 A;  4ZYQ A;  4MCR A;  4MHY A;  3BI0 A;  2RFH A;  1ZG8 A;  1HEE A;  5LYF A;  2XEI A;  1YW6 A;  2BOA A;  4R7M A;  1TF9 A;  2G9D A;  4NGM A;  4KSI A;  4ZX8 A;  4C8U A;  3B3S A;  4YU9 A;  4X3R A;  4C8P A;  3H8E A;  4GM5 A;  4K3N A;  5LYL A;  5D8N A;  4PXC A;  4OC3 A;  2NSM A;  4ZI6 A;  2XEG A;  1F2O A;  1LOK A;  5JM6 A;  1LAM A;  4Z65 A;  3RBU A;  2ZEE A;  4LQG A;  3FX6 A;  4OME A;  1BPN A;  3HLP A;  1LAP A;  1YLO A;  4OC4 A;  4PQA A;  1LAN A;  3SJE A;  5ELY A;  2ANP A;  1ELL P;  1Q7L A;  2JBK A;  2V8V A;  1IY7 A;  4PXD A;  3B3V A;  4MXU A;  3B3T A;  8CPA A;  1CG2 A;  4A94 A;  2ZEF A;  4TJV A;  3FH4 A;  4ZY2 A;  3DGV A;  1M4L A;  2PIY A;  3VAT A;  1VHE A;  2ZEG A;  3S9M A;  2QJ8 A;  4MCS A;  4MCP A;  2ZEP A;  4DJL A;  2GLJ A;  2EK9 A;  3WT4 A;  3GLJ A;  2WYR A;  2CTC A;  4EWT A;  3SI1 A;  4R76 A;  2ZEO A;  1JQG A;  4YWY A;  4OC0 A;  2AFZ A;  3FED A;  2OR4 A;  1XFO A;  3RAM A;  4FBE A;  2IQ6 A;  3GB0 A;  4C8C A;  1YW4 A;  4RUH A;  2AFU A;  4ZY0 A;  1BLL E;  2EK8 A;  4P44 A;  1VIX A;  3EIF A;  2WZN A;  4ZX9 A;  3L2N A;  3V7Z A;  4TJX A;  4A37 A;  4F9V A;  2PVV A;  5LRK A;  3D67 A;  3BHX A;  1NSA A;  1Z8L A;  1HDQ A;  1ARM A;  3PBB A;  4X8I A;  2V8H A;  4JZ0 A;  1DTD A;  4CDK A;  3WC7 A;  4C9R A;  1AYE A;  5DS0 A;  4C8T A;  1LCP A;  1ZLI A;  3CDX A;  3N5F A;  5CPA A;  3H8F A;  1CPS A;  2VL1 A;  3D66 A;  4FUU A;  4JYW A;  1CBX A;  4NGQ A;  4P4B A;  1CX8 A;  2EWB A;  4C9A A;  3B7I A;  5LYD A;  4MCQ A;  1Y9Z A;  3D7F A;  3K9T A;  2PJ5 A;  2Q4Z A;  1TKF A;  2J9A A;  1PYT B;  3NA6 A;  1LFW A;  3B2Y A;  3PB6 X;  4MHN A;  4P4E A;  4BD9 A;  3DLJ A;  4MRI A;  2PRQ A;  2PJ3 A;  5K8M A;  3PEI A;  3KZW A;  2GLF A;  2FVG A;  2QYV A;  4F8Z A; 
#chains in the Genus database with same CATH topology
 4M6G A;  2PSW A;  2ZEL A;  1ZG7 A;  2BL1 A;  5G22 A;  3CPA A;  5CBM A;  3HPG G;  3D8P A;  4H89 A;  3C8O A;  2JBJ A;  4KVM E;  3V38 A;  3NH4 A;  4QUS A;  1I21 A;  1BPM A;  5LRG A;  5K8P A;  1U6M A;  3PBE A;  4NGP A;  2PQ8 A;  3KHX A;  4II9 A;  4ZY1 A;  1BXR B;  2X0S A;  4IIY A;  3TOB A;  5F47 A;  1KZF A;  5HXD A;  1CJW A;  2C6G A;  2CNT A;  2Z3M A;  2HQY A;  5I4M A;  4H6Z A;  1M1D A;  4PXE A;  2B58 A;  5C88 A;  5J8C A;  2GE3 A;  3T0T A;  3FXT A;  3MN8 A;  2N3A B;  2B5G A;  2P6E A;  2PR1 A;  1UWY A;  4UEE A;  3WC5 A;  4WWV A;  4BBH A;  1IU8 A;  2YND A;  1KWM A;  2JLM A;  4UEF A;  1KUV A;  4BPW B;  2PJ7 A;  3JVN A;  2ZXV A;  2B4B A;  3GIU A;  2PJB A;  4MY0 A;  1IOF A;  2J8R A;  2PVW A;  2QVP A;  4OAD A;  1R57 A;  3F8K A;  3QAH A;  4BPX B;  4OLL A;  4R9M A;  3R1K A;  4UWJ A;  2XEF A;  2O28 A;  1XOV A;  3B3C A;  4OP4 A;  5CNP A;  2G0B A;  4IIX A;  5F09 A;  3KHZ A;  4CYN A;  2AFX A;  2PJ2 A;  4H1H A;  1RTQ A;  3OAK A;  3BXM A;  3WC6 A;  4Y49 C;  4ZGY B;  3SI2 A;  4CGN A;  3IGR A;  5KTC A;  4GS4 A;  1CPX A;  1QSR A;  4KOY A;  4OIW A;  3BUW B;  1CE8 B;  2V77 A;  3W6S A;  2IJZ A;  2FIA A;  2OOT A;  1TIQ A;  2PCU A;  4C9V A;  2ZW5 A;  4P10 A;  2YNC A;  4C99 A;  4IAV A;  4CGM A;  4C8F A;  2CIJ A;  3LAC A;  4JWP A;  3TYX A;  4KLW A;  1N71 A;  1PCA A;  3KR4 A;  2HI6 A;  2VI7 A;  4QC6 A;  4NFR A;  4CAV A;  2O4H A;  3BUX B;  2ZOF A;  1XF1 A;  2YJV A;  4MI1 A;  4KUB A;  2ZOG A;  5F5X A;  5J3X A;  3K4I A;  1Y9W A;  4M6I A;  4Y49 B;  4UIA A;  5C82 A;  3CT9 A;  3K2K A;  6CPA A;  2GRE A;  4C9E A;  2FSR A;  1J4J A;  2Z11 A;  3PFE A;  3TCV A;  1QMU A;  5G1Z A;  5BY0 A;  2X7B A;  4DYO A;  5F48 A;  3I1U A;  2RC4 A;  3B8G A;  3FF3 A;  4UBR A;  3FJU A;  1UFH A;  3EFA A;  4L8A A;  4UFW A;  2PJ0 A;  1R43 A;  3TX8 A;  1EZB A;  1IGB A;  1OBR A;  2WPW A;  4P4J A;  3ISX A;  4MHP A;  1JWQ A;  1S60 A;  2C1C A;  3KI9 A;  1RXT A;  4UFV A;  3R9G A;  3ICU A;  3TLZ A;  2MP0 A;  1AUG A;  4KOT A;  3B35 A;  3TO7 A;  4F9U A;  2OZU A;  3PFV A;  1YSJ A;  2Q7S A;  3S6F A;  1VI4 A;  1VBG A;  1MJ9 A;  5EMI A;  4PV6 A;  3PZJ A;  1XIX A;  3JUW A;  5HH1 A;  5GCN A;  2R98 A;  4KVX A;  1X12 A;  3DSB A;  3QNV A;  2PJA A;  5F49 A;  5HVF A;  3WR7 A;  3VRQ A;  2AE6 A;  4IHM A;  4A33 A;  2PJ8 A;  4CZ1 A;  4OC5 A;  1AMP A;  4C85 A;  1TF8 A;  4YN3 A;  1VBH A;  3VTA A;  4H2K A;  1Z2L A;  3FNC A;  3PGP A;  3U1B A;  4RI1 A;  3H8G A;  4E0A A;  4OC1 A;  3S6H A;  1ON0 A;  4DUK A;  4C84 A;  4U9Z A;  2POK A;  3FEE A;  2ZEH A;  1WVM A;  2KCW A;  2R7H A;  1XRY A;  2REF A;  1F57 A;  2CY2 A;  1F2P A;  3EXN A;  1L0C A;  2B0A A;  3V8I A;  2IMO A;  4EVY A;  2AFO A;  2V8D A;  4F0X A;  4R87 A;  4X2T A;  1S7L A;  5IB0 A;  3TLC A;  2PE3 A;  1VHS A;  3D7D A;  3NOJ A;  1IID A;  1TKJ A;  3BLN A;  5IR2 A;  1ELM P;  4KS9 A;  4F6A A;  2Q43 A;  2DIK A;  3FBU A;  4OKO A;  4MFL A;  1BAV A;  2GIV A;  4CYP A;  2FE7 A;  4DNC A;  1ARL A;  5H86 A;  4MFP A;  2AUM A;  3TO6 A;  3D68 A;  4BIN A;  1ZRS A;  2DPS A;  3H5Z A;  3N7Z A;  4MI4 A;  2Q4V A;  1Y7E A;  1Q2D A;  1QSM A;  1Y0Y A;  1Z9U A;  2PJ4 A;  3OWC A;  2AFM A;  3DDD A;  3SHP A;  3PB4 X;  4R6T A;  4U9Y A;  2CBL A;  4TNU A;  5FVJ A;  2RB7 A;  4FD5 A;  4AG7 A;  1M4I A;  1EE3 P;  3FEC A;  2G3A A;  4O23 A;  4NF1 A;  4B5O A;  5HKW A;  3SJX A;  5HVG A;  5JGF A;  4KOU A;  4P4D A;  3IC1 A;  3CXS A;  2Q7B A;  3I74 A;  3IFE A;  2EO8 A;  3U88 C;  2HV2 A;  2B4D B;  3IWW A;  5ISV A;  4P4F A;  1VHO A;  2DXQ A;  3KL9 A;  3TFY A;  1C30 B;  3PB9 X;  2VBQ A;  5BWA B;  3F5B A;  3FIX A;  2HRO A;  4INJ A;  3KR5 A;  4LQ6 A;  4ZBG A;  2XEJ A;  3IO1 A;  3IU1 A;  4GXH A;  2EZC A;  2JEV A;  1M6V B;  1ZO0 A;  3TLG A;  1BOB A;  1H8L A;  3KQX A;  4HNX B;  4NGN A;  3QB8 A;  4Q36 A;  3T90 A;  1Z8T A;  4A4B A;  1B6B A;  1ZYM A;  4XPD C;  3TE4 A;  3NH5 A;  4HKF A;  1YX0 A;  4JXR A;  2F5I A;  2ABZ A;  2C27 A;  1S3Z A;  3GKR A;  2Z3L A;  3BUO B;  1Z4R A;  4MHD A;  5LYI A;  3T8W A;  2PR8 A;  5HKY A;  1OZP A;  1YME A;  1SQH A;  3JRU A;  3S6K A;  1XEB A;  4K30 A;  2R1I A;  1YK3 A;  4YFJ A;  2XPP A;  4HNW B;  4M6H A;  4UEZ A;  1QST A;  2C6P A;  3P2H A;  4UIB A;  1Z5R A;  5HMN A;  2XPN A;  5JH9 A;  4RS2 A;  3R95 A;  1ZLH A;  3PB7 X;  3A9L A;  1M44 A;  3I6S A;  3KRV A;  3CXP A;  3VRP A;  1K4J A;  5F46 A;  2B4D A;  1WJT A;  2CNM A;  2I3C A;  4NEX A;  4XPD B;  3SXN A;  3TC8 A;  4CAE A;  5IB9 A;  1DE4 C;  5AXI A;  5J1Q A;  4B11 A;  1T36 B;  4OID A;  1V6C A;  4C8A A;  3IIB A;  3FMC A;  1WK4 A;  2P6F A;  3MRU A;  3WAB A;  5K8O A;  2PJ6 A;  4PPZ A;  4C9U A;  4AXV A;  2FIW A;  3R9F A;  3PP9 A;  4C2Y A;  1YRE A;  2BCO A;  2O53 A;  2GU2 A;  2PJ9 A;  5E96 A;  1IYL A;  3GYA A;  1MJA A;  3TO9 A;  2GFQ A;  4CAF A;  4ONW A;  3VH9 A;  4MHZ A;  4CO9 A;  5EBV A;  3BJ8 A;  5F9M A;  1IOI A;  4B13 A;  5KTA A;  3EZB A;  4KOX A;  2DEA A;  2EVN A;  4UF4 A;  2F7V A;  1XBU A;  2QML A;  2UV8 G;  2C6C A;  1R3N A;  4PXB A;  5K8N A;  3NFZ A;  4A38 A;  4JVO A;  4J3G A;  2IL4 A;  2ZW6 A;  3GUX A;  3KGQ A;  3PRT A;  5HVH A;  4Q7A A;  4R57 A;  4AB7 A;  3IJ3 A;  1Y9K A;  4CGL A;  3G8W A;  2YJT A;  3IWG A;  2AFW A;  5JQ4 A;  2OLS A;  4AVA A;  2NMT A;  2CTB A;  2ZEM A;  1IYK A;  1YVO A;  2REE A;  2E28 A;  4QBJ A;  1ZL0 A;  2PJC A;  2V8G A;  2ZED A;  5AG4 A;  1VGY A;  5H84 A;  4G1P A;  3LMS A;  4XNH B;  3SJF A;  1CP7 A;  3KAS A;  3SR3 A;  3FVL A;  4CDJ A;  4M85 A;  4IUS A;  2Z0Z A;  2PIZ A;  2OU2 A;  4FAI A;  4A32 A;  2Q51 A;  4RN7 A;  4C2Z A;  3RZA A;  4R8F A;  1Z8W A;  3LWU A;  4MBU A;  1ZG9 A;  3KKW A;  1J3L A;  2PCN A;  3HUV A;  1CP6 A;  4R3K A;  4NJQ A;  1Q5X A;  3D7G A;  1A9X B;  2F8H A;  1WWZ A;  1Q2C A;  4A39 A;  1I12 A;  4KSF A;  5HKZ A;  2FXF A;  2HB6 A;  1TXR A;  3TOA A;  4CPA A;  2EZB A;  4OC2 A;  4W9Y A;  2AFS A;  2WSA A;  5K99 A;  4FD6 A;  3D2P A;  3BUM B;  2BO9 A;  1YQE A;  3B3W A;  1DIK A;  4KNG E;  1XMB A;  4B6Z A;  3T05 A;  2PRB A;  4JXQ A;  2B4J C;  2HC9 A;  3IEH A;  4NGT A;  3DR8 A;  2PC1 A;  3RYO A;  5J8F A;  1M4G A;  4ONU A;  1Y7R A;  3BI1 A;  5LRJ A;  2ZEN A;  3VRO A;  3VWD A;  3I3G A;  3FYN A;  2BEI A;  3GY9 A;  2VEZ A;  4UCM A;  3T07 A;  1FT7 A;  1Y0R A;  1YVK A;  3NH8 A;  3VAR A;  4B5P B;  1HDU A;  3D4U A;  5AG7 A;  4EFD A;  3ISZ A;  3T9Y A;  4U5Y A;  3D7H A;  3F9K C;  4TWE A;  4P4I A;  4IK2 A;  1BO4 A;  1TKH A;  4F0Y A;  3S9N A;  2NYQ A;  3TLG B;  3TLB A;  1GYT A;  2WPX A;  2QEC A;  3I9S A;  4FWU A;  2K5T A;  2Q4Y A;  3OB1 B;  4C86 A;  3PFO A;  2CF4 A;  4PK2 A;  4YGO A;  1QQ9 A;  4LX9 A;  1LRZ A;  4NGR A;  2FM4 A;  3SI0 A;  2Z10 A;  1P0H A;  3CPX A;  3PB8 X;  1S7K A;  2OB0 A;  3KQZ A;  4WJB A;  3R9E A;  2FL4 A;  1YLE A;  3D3S A;  4UWI A;  2H5M A;  2JEW A;  1M4D A;  2Z3O A;  4KZT A;  4P6Y A;  3PLF B;  4P45 A;  3P2F A;  4CYO A;  3SJG A;  1QSO A;  2XPL A;  5G21 A;  4COB A;  2VXK A;  4FD4 A;  4NJR A;  7CPA A;  1XJO A;  2PJ1 A;  5F13 A;  4CS0 B;  1FNO A;  4NGS A;  5THW A;  2GAN A;  5A27 A;  1XE4 A;  4UFX A;  3S9L A;  4MMO A;  3W91 A;  4EME A;  1IB1 E;  2P0W A;  3LD2 A;  5D29 A;  4ZYQ A;  1S7F A;  4MCR A;  2Y0M A;  1Q2Y A;  4MHY A;  4B5P A;  4CAX A;  2I79 A;  3BI0 A;  2RFH A;  3ZNI A;  4MFQ A;  1ZG8 A;  4AVB A;  1HEE A;  5LYF A;  2BSW A;  5JPH A;  2XEI A;  4RR2 B;  1YW6 A;  2BOA A;  1PU9 A;  4R7M A;  1X10 A;  1TF9 A;  1GGO A;  3TLE A;  4QB9 A;  2G9D A;  4UCP A;  4NGM A;  1MJB A;  4KSI A;  2YNE A;  2DPT A;  3B3S A;  4ZX8 A;  4NCZ A;  4YU9 A;  1CS0 B;  1KEE B;  4C8U A;  4X3R A;  5DWM A;  2D0P A;  4CRY B;  4C8P A;  3EO4 A;  3CZX A;  2JDC A;  4XPL A;  3H8E A;  3W6X A;  4C7H A;  1C3O B;  4E94 A;  1YGH A;  1QSN A;  4GM5 A;  4L89 A;  3MGD A;  5AG5 A;  4E2A A;  4C7I A;  4K3N A;  5LYL A;  4HPS A;  5D8N A;  2ARH A;  4B12 A;  2ZPA A;  4B14 A;  3GJZ A;  3HMJ G;  4PXC A;  5I0C A;  3H4Q A;  1NXJ A;  1KBL A;  4OC3 A;  1B87 A;  4KSA A;  2NSM A;  4ORF A;  4ZI6 A;  2XEG A;  1F2O A;  4KOS A;  1R61 A;  4QVT A;  2DF5 A;  4M8D A;  3IU2 A;  4BTF A;  1LOK A;  4BPU B;  2VQY A;  4B10 A;  3RNZ A;  5JM6 A;  2C5Q A;  4CGP A;  2B3V A;  1LAM A;  2EBJ A;  4Z65 A;  4JJX A;  1FBV A;  3LOD A;  3RBU A;  4LQG A;  2QYV A;  2ZEE A;  4MJ8 A;  4OAE A;  3VGO A;  4R3L A;  4YRH A;  4E8O A;  3FX6 A;  4OME A;  3D2M A;  3TLY A;  2FS5 A;  2ZW4 A;  3VRR A;  2JDD A;  1BPN A;  3HLP A;  1LAP A;  2A4N A;  4XNH C;  1YLO A;  4AG9 A;  4OC4 A;  2PDO A;  3O8Z A;  4CYQ A;  4PQA A;  4E5S A;  5IV0 A;  1LAN A;  5ELY A;  3OB2 B;  3ZZI A;  2ANP A;  3PT1 A;  1ELL P;  2EZA A;  1Q7L A;  2JBK A;  4KUA A;  4HNY B;  2V8V A;  1IY7 A;  4PXD A;  3B3V A;  4MXU A;  3B3T A;  8CPA A;  2J8N A;  1CG2 A;  4A94 A;  4C68 A;  2GP4 A;  2ZW7 A;  2B3U A;  4KLV A;  2ZEF A;  4TJV A;  3FB3 A;  3FH4 A;  2Q0Y A;  5AG6 A;  3DGV A;  3JTK A;  4ZY2 A;  1M4L A;  2Z3K A;  3EC4 A;  4LUA A;  5G20 A;  3S6G A;  2G3T A;  2PIY A;  1KUX A;  2AJ6 A;  3VAT A;  1VHE A;  2ZEG A;  4KVO E;  3TLA A;  3S9M A;  2QJ8 A;  4MCS A;  4MCP A;  2VZY A;  4MJX A;  5FD8 A;  2ZEP A;  1RO5 A;  1Z9E A;  4GPL B;  3RO0 A;  3TT2 A;  4DJL A;  2GLJ A;  2EK9 A;  3WT4 A;  1NBW A;  1Z4E A;  4MFZ A;  2J8M A;  3FRM A;  3GLJ A;  1MK4 A;  2WYR A;  2CTC A;  4PSX A;  2WUU A;  3ZJ0 A;  1A2Z A;  2D0O A;  4EWT A;  3SI1 A;  1XF8 A;  1VKC A;  2ZEO A;  4R76 A;  1JQG A;  4YWY A;  3SXO A;  4OC0 A;  2AFZ A;  3FED A;  4Q38 A;  2OR4 A;  1IIC A;  4IF5 A;  1XFO A;  3RAM A;  4BMH A;  4FBE A;  2FT0 A;  3T5M A;  2Y1M A;  2IQ6 A;  3GB0 A;  3OP0 A;  4C8C A;  1YW4 A;  3G3S A;  4RUH A;  5IX3 A;  4X5K A;  4J0N A;  2ATR A;  5KTD A;  2AFU A;  4ZY0 A;  2AUN A;  3G23 A;  3R96 A;  1BLL E;  2EK8 A;  4P44 A;  1VIX A;  2OZH A;  4UA3 A;  2WZN A;  4C2X A;  3EIF A;  4ZX9 A;  4A31 A;  3L2N A;  3V7Z A;  4TJX A;  1XMT A;  4A37 A;  4CRZ B;  4NXY A;  2BUE A;  1YR0 A;  2DLA A;  4CAW A;  4A4C A;  2VZZ A;  4NSQ A;  4F9V A;  2PVV A;  1YVH A;  3D67 A;  5LRK A;  5AGE A;  1GHE A;  1I1D A;  3BHX A;  1NSA A;  1Z8L A;  1HDQ A;  2I00 A;  1ARM A;  2CXA A;  4A30 A;  3HPH E;  3PBB A;  4X8I A;  4CGO A;  1EZA A;  3TTH A;  1NMT A;  3C26 A;  2V8H A;  4JZ0 A;  1DTD A;  1P4N A;  1Z8X A;  4XPK A;  4H6U A;  1NSL A;  1JDE A;  5F1Y A;  2Z3N A;  4CDK A;  2YGW A;  4COG A;  4A2Z A;  4PK3 A;  3WC7 A;  4EYS A;  1KUY A;  1KC7 A;  2OH1 A;  2EUI A;  3BJ7 A;  4C9R A;  2D4O A;  4FD7 A;  1AYE A;  5DS0 A;  4C8T A;  3VRN A;  1PUA A;  2D4P A;  5EC4 A;  1LCP A;  1ZLI A;  1NE9 A;  2HUZ A;  3CDX A;  3N5F A;  5CPA A;  3H8F A;  1CPS A;  3EY5 A;  2VL1 A;  1FY7 A;  5DWN A;  3UY5 A;  3D66 A;  4FUU A;  4JYW A;  1CBX A;  3DR6 A;  5JVL A;  4KOW A;  4NGQ A;  2QIR A;  3NE7 A;  3CXQ A;  3NFQ A;  2HWG A;  3F0A A;  4P4B A;  3DNS A;  1CX8 A;  3EZA A;  4MFJ A;  5A28 A;  4KOR A;  2EWB A;  3EZE A;  4JLY A;  4PSW A;  2ODF A;  4UCN A;  4I49 A;  3BUN B;  4C9A A;  4AVC A;  3B7I A;  5LYD A;  5JYB A;  2Q44 A;  3NE8 A;  3VWE A;  4MCQ A;  3K9U A;  1CM0 A;  3E0K A;  4M3S A;  4MY3 A;  1Y9Z A;  1V0C A;  3D7F A;  3K9T A;  2Z3P A;  4JD6 A;  2PJ5 A;  2OZG A;  2Q4Z A;  1TKF A;  2J9A A;  1PYT B;  3NA6 A;  1LFW A;  4A95 A;  3B2Y A;  3PB6 X;  1JDB C;  2B5G B;  4MHN A;  4P4E A;  3QAY A;  4BD9 A;  3DLJ A;  4KOV A;  4MRI A;  2PRQ A;  1S5K A;  2P6G A;  2PJ3 A;  5K8M A;  3PEI A;  4MFK A;  2VKZ G;  2R82 A;  2YNC C;  2CNS A;  1S7N A;  2Y1N A;  2R8V A;  3KZW A;  1B47 A;  3IWE A;  1EO0 A;  2Q04 A;  2FCK A;  2XPO A;  2GLF A;  2FVG A;  3SJE A;  4F8Z A; 
#chains in the Genus database with same CATH homology
 2ZEL A;  1ZG7 A;  3CPA A;  5CBM A;  2JBJ A;  3V38 A;  3NH4 A;  1BPM A;  5LRG A;  5K8P A;  3PBE A;  4NGP A;  3KHX A;  4ZY1 A;  5HXD A;  2C6G A;  5I4M A;  4PXE A;  3MN8 A;  4UEE A;  1UWY A;  3WC5 A;  4WWV A;  1KWM A;  4UEF A;  2PJ7 A;  2PJB A;  2PVW A;  2QVP A;  5JGF A;  4C84 A;  2XEF A;  3B3C A;  4OP4 A;  5F09 A;  3KHZ A;  2AFX A;  2PJ2 A;  1RTQ A;  3BXM A;  3WC6 A;  3SI2 A;  1CPX A;  4OIW A;  2V77 A;  2IJZ A;  2OOT A;  2PCU A;  4C9V A;  4P10 A;  4C99 A;  4IAV A;  4C8F A;  2CIJ A;  1PCA A;  3KR4 A;  4NFR A;  2O4H A;  2ZOF A;  1XF1 A;  2ZOG A;  4UIA A;  3CT9 A;  3K2K A;  6CPA A;  2GRE A;  4C9E A;  3PFE A;  1QMU A;  4DYO A;  3I1U A;  3FF3 A;  3FJU A;  3TX8 A;  2PJ0 A;  1R43 A;  1IGB A;  1OBR A;  3ISX A;  4P4J A;  4MHP A;  4C9U A;  3KI9 A;  2C1C A;  3ICU A;  3B35 A;  4F9U A;  1YSJ A;  3QNV A;  5HVF A;  2PJA A;  4IHM A;  2PJ8 A;  4OC5 A;  1AMP A;  4C85 A;  1TF8 A;  4YN3 A;  3VTA A;  4H2K A;  1Z2L A;  3H8G A;  4OC1 A;  4DUK A;  2POK A;  3FEE A;  2ZEH A;  1WVM A;  1XRY A;  1F57 A;  1F2P A;  2IMO A;  2AFO A;  2V8D A;  4X2T A;  2PE3 A;  3D7D A;  1TKJ A;  5IR2 A;  1ELM P;  2Q43 A;  4OKO A;  1BAV A;  1ARL A;  3D68 A;  1Y7E A;  1Y0Y A;  2PJ4 A;  2AFM A;  3PB4 X;  4R6T A;  4TNU A;  2RB7 A;  1EE3 P;  3FEC A;  4O23 A;  5HVG A;  3SJX A;  4P4D A;  3IC1 A;  3I74 A;  3IFE A;  3IWW A;  4P4F A;  1VHO A;  3KL9 A;  3PB9 X;  3KR5 A;  2XEJ A;  3IO1 A;  1H8L A;  3KQX A;  4NGN A;  3NH5 A;  2ABZ A;  3T8W A;  5LYI A;  1YME A;  3JRU A;  4UEZ A;  4UIB A;  2C6P A;  1Z5R A;  5JH9 A;  1ZLH A;  3PB7 X;  3I6S A;  2I3C A;  5IB9 A;  3TC8 A;  5J1Q A;  1DE4 C;  1V6C A;  4OID A;  4C8A A;  3IIB A;  3FMC A;  3WAB A;  5K8O A;  3MRU A;  2PJ6 A;  4PPZ A;  4AXV A;  2BCO A;  2O53 A;  2GU2 A;  2PJ9 A;  4ONW A;  3VH9 A;  4MHZ A;  2DEA A;  4UF4 A;  2F7V A;  1XBU A;  2C6C A;  1R3N A;  4PXB A;  5K8N A;  3NFZ A;  4A38 A;  3GUX A;  3KGQ A;  3PRT A;  5HVH A;  4Q7A A;  3IJ3 A;  2AFW A;  2CTB A;  2ZEM A;  2PJC A;  2V8G A;  2ZED A;  1VGY A;  4G1P A;  3LMS A;  3SJF A;  1CP7 A;  3KAS A;  3FVL A;  4CDJ A;  2PIZ A;  4FAI A;  2Q51 A;  3RZA A;  4R8F A;  3LWU A;  1ZG9 A;  3HUV A;  1CP6 A;  4NJQ A;  3D7G A;  2F8H A;  4A39 A;  2HB6 A;  1TXR A;  4CPA A;  4OC2 A;  4W9Y A;  2AFS A;  3B3W A;  2BO9 A;  4KNG E;  1XMB A;  4B6Z A;  2HC9 A;  3IEH A;  4NGT A;  3BI1 A;  5LRJ A;  2ZEN A;  1FT7 A;  1Y0R A;  3NH8 A;  3VAR A;  1HDU A;  3D4U A;  4EFD A;  3ISZ A;  3D7H A;  4TWE A;  4P4I A;  4IK2 A;  1TKH A;  3S9N A;  2NYQ A;  1GYT A;  4FWU A;  4C86 A;  3PFO A;  2CF4 A;  1QQ9 A;  4NGR A;  3SI0 A;  3CPX A;  3PB8 X;  3KQZ A;  4WJB A;  2JEW A;  4P6Y A;  4P45 A;  3SJG A;  4NJR A;  7CPA A;  1XJO A;  2PJ1 A;  1FNO A;  4NGS A;  5THW A;  3S9L A;  4MMO A;  4EME A;  5D29 A;  4ZYQ A;  4MCR A;  4MHY A;  3BI0 A;  2RFH A;  1ZG8 A;  1HEE A;  5LYF A;  2XEI A;  1YW6 A;  2BOA A;  4R7M A;  1TF9 A;  2G9D A;  4NGM A;  4KSI A;  4ZX8 A;  4C8U A;  3B3S A;  4YU9 A;  4X3R A;  4C8P A;  3H8E A;  4GM5 A;  4K3N A;  5LYL A;  5D8N A;  4PXC A;  4OC3 A;  2NSM A;  4ZI6 A;  2XEG A;  1F2O A;  1LOK A;  5JM6 A;  2C5Q A;  1LAM A;  4Z65 A;  3RBU A;  2ZEE A;  4LQG A;  3FX6 A;  4OME A;  1BPN A;  3HLP A;  1LAP A;  1YLO A;  4OC4 A;  4PQA A;  1LAN A;  3SJE A;  5ELY A;  2ANP A;  1ELL P;  1Q7L A;  2JBK A;  2V8V A;  1IY7 A;  4PXD A;  3B3V A;  4MXU A;  3B3T A;  8CPA A;  1CG2 A;  4A94 A;  2GP4 A;  2ZEF A;  4TJV A;  3FH4 A;  4ZY2 A;  3DGV A;  1M4L A;  2PIY A;  3VAT A;  1VHE A;  2ZEG A;  3S9M A;  2QJ8 A;  4MCS A;  4MCP A;  2ZEP A;  4DJL A;  2GLJ A;  2EK9 A;  3WT4 A;  3GLJ A;  2WYR A;  2CTC A;  4EWT A;  3SI1 A;  4R76 A;  2ZEO A;  1JQG A;  4YWY A;  4OC0 A;  2AFZ A;  3FED A;  2OR4 A;  1XFO A;  3RAM A;  4FBE A;  2IQ6 A;  3GB0 A;  4C8C A;  1YW4 A;  4RUH A;  2AFU A;  4ZY0 A;  1BLL E;  2EK8 A;  4P44 A;  1VIX A;  3EIF A;  2WZN A;  4ZX9 A;  3L2N A;  3V7Z A;  4TJX A;  4A37 A;  4F9V A;  2PVV A;  5LRK A;  3D67 A;  3BHX A;  1NSA A;  1Z8L A;  1HDQ A;  1ARM A;  3PBB A;  4X8I A;  2V8H A;  4JZ0 A;  1DTD A;  4CDK A;  3WC7 A;  4C9R A;  1AYE A;  5DS0 A;  4C8T A;  1LCP A;  1ZLI A;  3CDX A;  3N5F A;  5CPA A;  3H8F A;  1CPS A;  2VL1 A;  3D66 A;  4FUU A;  4JYW A;  1CBX A;  4NGQ A;  4P4B A;  1CX8 A;  2EWB A;  4C9A A;  3B7I A;  5LYD A;  4MCQ A;  1Y9Z A;  3D7F A;  3K9T A;  2PJ5 A;  2Q4Z A;  1TKF A;  2J9A A;  1PYT B;  3NA6 A;  1LFW A;  3B2Y A;  3PB6 X;  4MHN A;  4P4E A;  4BD9 A;  3DLJ A;  4MRI A;  2PRQ A;  2PJ3 A;  5K8M A;  3PEI A;  3KZW A;  2GLF A;  2FVG A;  2QYV A;  4F8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...