2JBJA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with 2-pmpa (2-phosphonomethyl-pentanedioic acid)
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
694
structure length
687
Chain Sequence
b'NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title Human Glutamate Carboxypeptidase II Inhibition: Structures of Gcpii in Complex with Two Potent Inhibitors, Quisqualate and 2-Pmpa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 253
structure length 687
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2jbjA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2jbjA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2jbjA02
4TJVA 2XEFA 2POKA 2V8DA 5CBMA 3HLPA 4X3RA 4OP4A 3KZWA 2IQ6A 3S9NA 3K2KA 2EK9A 3S9MA 2O4HA 5DS0A 5LYIA 4W9YA 1YW6A 3KQXA 2CF4A 4MCRA 2O53A 3PB6X 3ISZA 1LFWA 2PJ8A 3PB9X 4ZI6A 3H8EA 2V77A 4JZ0A 2ZOFA 2ZEGA 1HDQA 2PJ7A 3DLJA 2NYQA 2C1CA 4F8ZA 2PRQA 2PJAA 2ZEDA 4C8UA 2C6GA 3FJUA 2PJ0A 3D66A 3NH5A 2JBJA 4C86A 3GLJA 4A37A 4C9EA 4UIAA 2V8HA 5D29A 3D67A 1LAPA 1VGYA 1PYTB 1AYEA 5LYDA 3PFOA 2PCUA 4C99A 4DJLA 3GUXA 4KNGE 2BO9A 3KGQA 2PJ3A 3FEEA 1LOKA 3BXMA 2XEIA 1NSAA 2GU2A 3LMSA 5HVHA 2EWBA 3PEIA 5CPAA 3RBUA 3PBBA 3IIBA 3KL9A 4P4FA 5I4MA 1ARMA 3VH9A 5HVGA 4MCPA 1ZG8A 2FVGA 4UEFA 3WC6A 2C6PA 2HC9A 4K3NA 2AFZA 3IJ3A 2JBKA 3KHZA 5D8NA 3EIFA 4NGQA 3PB7X 2ZELA 1Y0YA 4NGNA 3WABA 1HEEA 4EWTA 4KSIA 3VATA 2I3CA 3H8GA 1TKFA 3IFEA 4DUKA 2J9AA 2XEGA 3B3WA 1ELLP 1XFOA 3LWUA 2RB7A 8CPAA 4A39A 4P4DA 3BHXA 4C9AA 3NH8A 4P4IA 1ZLIA 5LYFA 4NFRA 1IY7A 2GLJA 4CDKA 3PBEA 4UF4A 3KI9A 1QMUA 4C84A 5K8OA 3SJFA 6CPAA 3I74A 4FAIA 4Q7AA 3SJXA 3NFZA 1F2PA 4UIBA 4WWVA 3KHXA 3CPXA 3KR4A 4F9VA 4RUHA 3TX8A 4YN3A 3WT4A 1WVMA 1YSJA 2AFSA 2DEAA 4C8FA 3TC8A 3NA6A 1CBXA 1Y7EA 4IHMA 1V6CA 4CPAA 2AFMA 4TNUA 4F9UA 3I6SA 4G1PA 4NGMA 2JEWA 4OKOA 4R6TA 5LYLA 3B2YA 1EE3P 3BI0A 2Q43A 4MMOA 1FNOA 1BAVA 2QVPA 1CP7A 4P6YA 2WZNA 4R7MA 2CTBA 4B6ZA 2PIYA 4NGRA 2ZEFA 4OC0A 4IK2A 3B7IA 1CPXA 3MN8A 3V7ZA 3ICUA 1DE4C 4PXCA 4H2KA 4DYOA 1UWYA 4R8FA 3N5FA 1Z2LA 4OC4A 3B3CA 3BI1A 4P4EA 3FEDA 3FECA 1ELMP 4WJBA 4C9RA 2ZOGA 1DTDA 3ISXA 3KQZA 4PXDA 3WC7A 2PJ1A 4A38A 4R76A 1TXRA 1TKHA 2G9DA 2AFWA 5HXDA 1R3NA 2ABZA 2V8VA 3B35A 4ZY1A 2PIZA 3MRUA 4MHYA 4MXUA 4MCSA 1AMPA 1VHEA 1CPSA 3NH4A 4MHZA 3SI1A 1OBRA 1HDUA 1F2OA 2PJBA 4P10A 4P45A 1YMEA 1PCAA 1XBUA 4OIWA 2OOTA 4OC5A 2QYVA 2PVVA 2ZEEA 2CTCA 3D7GA 4ZX9A 3FX6A 1VHOA 4ONWA 1ZG9A 5JGFA 4ZY0A 2F8HA 2EK8A 1M4LA 4YU9A 1ZG7A 2C6CA 4PXBA 3D7HA 1XMBA 1Q7LA 2IJZA 2ZEPA 2OR4A 1BPNA 5K8PA 4IAVA 4NGTA 3S9LA 4NJRA 2PE3A 2ZENA 1XJOA 1LCPA 3RAMA 4C9VA 4ZY2A 1QQ9A 1TF9A 3QNVA 3IC1A 1LAMA 4OMEA 2AFXA 2BOAA 2PJCA 3I1UA 3B3VA 2Q4ZA 3V38A 3PB4X 4C8TA 4NGPA 5ELYA 3CDXA 4O23A 4BD9A 1VIXA 2BCOA 3KASA 1TF8A 5F09A 1RTQA 1JQGA 4PPZA 3RZAA 2PJ2A 5J1QA 1YLOA 4JYWA 3DGVA 2HB6A 2PJ5A 5K8NA 3JRUA 2XEJA 5HVFA 4LQGA 4OC3A 1H8LA 3D7DA 3FMCA 4X8IA 1Z5RA 1ZLHA 3B3SA 2AFUA 1F57A 1YW4A 4FBEA 2ZEHA 4GM5A 1LANA 4OC2A 3B3TA 3SI2A 2WYRA 2GREA 5JM6A 1BPMA 2GLFA 1FT7A 4YWYA 2ZEMA 2PJ6A 3CT9A 1CP6A 3FF3A 2QJ8A 5LRKA 3L2NA 4C85A 5LRJA 1Y0RA 4PQAA 1KWMA 3SJGA 3K9TA 5LRGA 4OC1A 2PJ9A 3VARA 3IEHA 1ARLA 4FWUA 4Z65A 4UEZA 3IWWA 3SJEA 3PRTA 4TWEA 5JH9A 1TKJA 1XF1A 4C8PA 2RFHA 3PB8X 4ZX8A 4CDJA 1CX8A 7CPAA 3CPAA 2ANPA 4TJXA 3FH4A 1IGBA 3T8WA 4C9UA 4OIDA 4X2TA 3D7FA 2Q51A 3D68A 3GB0A 1Y9ZA 4C8AA 4ZYQA 3IO1A 4AXVA 3H8FA 4NGSA 1R43A 4P4JA 2NSMA 4PXEA 4P4BA 3FVLA 3VTAA 4MCQA 3PFEA 2CIJA 3KR5A 1XRYA 2V8GA 3SI0A 3HUVA 4MHPA 2AFOA 4C8CA 4FUUA 2F7VA 2VL1A 5THWA 3WC5A 4EMEA 5K8MA 1BLLE 4P44A 4NJQA 4MHNA 2ZEOA 3D4UA 2IMOA 1CG2A 1GYTA 4UEEA 4A94A 4EFDA 2PVWA 1Z8LA 5IB9A 4MRIA 2PJ4A
chains in the Genus database with same CATH superfamily
4TJVA 2XEFA 2POKA 2V8DA 5CBMA 4CGMA 1XF8A 3HLPA 4X3RA 4OP4A 3KZWA 4R9MA 2IQ6A 3S9NA 1T36B 4CZ1A 3K2KA 2EK9A 2YNCC 3S9MA 2REFA 2B4BA 2FM4A 2O4HA 5DS0A 4LQ6A 5LYIA 2ARHA 4W9YA 4PK3A 1YW6A 3KQXA 4H89A 3TOAA 1A2ZA 4A32A 3W6XA 4CRZB 2CF4A 4MCRA 2O53A 2Z3PA 3ISZA 1LFWA 2PJ8A 1ON0A 3PB9X 3H8EA 2AJ6A 2V77A 4ZI6A 3ZJ0A 3VGOA 2OU2A 3ZNIA 4JZ0A 2ZOFA 5A27A 2WUUA 2ZEGA 1HDQA 4PK2A 4B10A 1WJTA 4MY3A 4MFLA 4F0YA 5A28A 1IICA 2DPTA 2PJ7A 3PB6X 4CYNA 3DLJA 1B87A 2NYQA 3BUMB 4E2AA 2C1CA 4F8ZA 2B4JC 2PRQA 4JXQA 3GKRA 2VZZA 5FD8A 2PJAA 2ZEDA 3BUNB 3NE8A 4B12A 4C8UA 2C6GA 4AVAA 1EZAA 3FJUA 4CGPA 2PJ0A 3C26A 3D66A 2PR1A 4MBUA 2HQYA 1I21A 3NH5A 1B6BA 4U9YA 2JBJA 1QSOA 2I00A 4M85A 4C86A 3GLJA 2CXAA 4NF1A 4A37A 4UIAA 4C9EA 5IB0A 2V8HA 1CM0A 5D29A 1S5KA 4KVXA 3D67A 4KOSA 4E5SA 4J0NA 3G8WA 4HKFA 1LAPA 2PDOA 4MI4A 4YFJA 1VGYA 1PYTB 1AYEA 5LYDA 3PFOA 5HMNA 3EZAA 3F0AA 4L89A 2B3VA 2PCUA 4BMHA 4DJLA 4C99A 1XEBA 2FE7A 3GUXA 4KNGE 2BO9A 1FY7A 3KGQA 1CS0B 2PJ3A 3FEEA 1LOKA 2H5MA 4C2ZA 3BXMA 1M4IA 3D2MA 4MI1A 1KEEB 1XMTA 2XEIA 4Y49C 1NSAA 1S7NA 5J8FA 2F5IA 5G20A 2GU2A 4R57A 3LMSA 3VRNA 2XPOA 5HVHA 2GP4A 1YK3A 3T0TA 2EWBA 4YGOA 4U9ZA 3PEIA 4PSXA 5KTCA 2REEA 3JUWA 3RBUA 3PBBA 3IIBA 1Q2CA 3KL9A 4UFVA 5CPAA 4BBHA 4P4FA 1IOIA 2CBLA 1Y9KA 4CYOA 1ARMA 4B14A 5I4MA 5DWMA 1UFHA 2XPPA 4KS9A 3VH9A 4A33A 5HVGA 4MCPA 3BLNA 1ZG8A 4C68A 3EZBA 4HNXB 5K99A 2OLSA 5KTAA 4XPLA 3IWEA 2FVGA 1U6MA 4UEFA 4A95A 2HUZA 2QECA 5F13A 2C6PA 2HC9A 3LD2A 4K3NA 2AFZA 3S6GA 3WC6A 3PZJA 3IJ3A 2JBKA 2VI7A 3KHZA 5D8NA 3EIFA 2FSRA 4NGQA 1L0CA 4MJ8A 3PB7X 5JYBA 5JVLA 2ZELA 1Y0YA 4NGNA 5JPHA 4XNHC 3WABA 1HEEA 4M6IA 4EWTA 4KSIA 3VATA 1ZL0A 4B11A 4KLVA 3DR6A 2DIKA 3F5BA 3TT2A 4F6AA 2WSAA 1IYKA 2I3CA 2J8RA 1TKFA 3H8GA 3IFEA 4NEXA 4DUKA 3OP0A 2J9AA 3I9SA 4UFWA 5F9MA 2Z0ZA 3TYXA 3FXTA 3G3SA 4L8AA 1S3ZA 3TLYA 3TOBA 1NSLA 4B13A 1C3OB 2XEGA 3BUXB 3B3WA 2EBJA 2B4DA 1ELLP 1XFOA 3GY9A 3LWUA 4Y49B 3IU1A 2RB7A 1QSMA 4A39A 8CPAA 4FD4A 3N7ZA 1KC7A 4P4DA 1Z8TA 4COGA 4KUAA 1QSRA 3BHXA 5HKZA 3DDDA 4C9AA 4MFJA 2Q4YA 3NH8A 5J3XA 3PT1A 5G1ZA 4P4IA 1ZLIA 4CAXA 1KUVA 4BTFA 5LYFA 4NFRA 1IY7A 5AG4A 3U88C 1YVHA 2GLJA 4CDKA 2CY2A 5AGEA 5EC4A 3VWEA 3PBEA 1GGOA 5F48A 4RS2A 4UF4A 1M4GA 1CE8B 4EYSA 2VKZG 4HNYB 2J8NA 2Z11A 3KI9A 4UCMA 1QMUA 1Q5XA 4C84A 5K8OA 3RNZA 2B4DB 4XNHB 3SJFA 1RXTA 2A4NA 1M44A 1EZBA 6CPAA 1AUGA 3I74A 3T05A 2DPSA 4B5PA 4Q7AA 4FAIA 3SJXA 4A2ZA 1YR0A 3NFZA 4KZTA 1F2PA 2BUEA 3FYNA 3OWCA 4UIBA 4WWVA 3ZZIA 3KHXA 1MK4A 5F49A 4AB7A 3CPXA 3KR4A 4NXYA 4AVCA 4F9VA 4RUHA 3T5MA 3TX8A 4YN3A 2BSWA 3WT4A 1WVMA 1YSJA 2AFSA 2DEAA 4C8FA 1YLEA 3TC8A 3NA6A 2WPXA 1CBXA 3LODA 1Y7EA 3BJ7A 4IHMA 1V6CA 3T07A 4CPAA 2G3TA 4MFZA 4KOWA 3OAKA 4YRHA 3ICUA 2AFMA 4TNUA 3EY5A 3CXPA 4R87A 4F0XA 5ISVA 1ZRSA 2FT0A 4F9UA 2P6FA 4MY0A 3I6SA 5AG5A 3GIUA 4G1PA 4NGMA 2JEWA 4OKOA 1LRZA 4R6TA 2X0SA 3QB8A 5LYLA 4UCNA 3B2YA 4UWJA 4CS0B 4DNCA 1EE3P 3VRQA 3P2FA 4KSAA 2B58A 3BI0A 2Q43A 4MMOA 1N71A 1FNOA 1BAVA 3U1BA 4CYQA 5F47A 2QVPA 1CP7A 2Q0YA 5F46A 3KKWA 4P6YA 4M6HA 5FVJA 2PR8A 2WZNA 4PV6A 1XE4A 2C27A 4KOXA 4R7MA 2CTBA 3R9FA 4B6ZA 2PIYA 4NGRA 2ZEFA 3E0KA 4OC0A 4IK2A 4KOUA 4BINA 2GFQA 3B7IA 1CPXA 3MN8A 3V7ZA 2D4PA 2EZCA 4E94A 2VXKA 3K9UA 4HNWB 1DE4C 2P6GA 3IU2A 4H6ZA 4JJXA 4KORA 4PXCA 4ZGYB 4H2KA 4DYOA 1UWYA 1P4NA 1EO0A 4HPSA 4R8FA 4H6UA 2YJVA 3N5FA 3C8OA 4BPUB 4CGLA 1J3LA 1Z2LA 1Q2DA 4OC4A 3B3CA 3JVNA 3G23A 3SR3A 3FBUA 2OH1A 3BI1A 4P4EA 3S6HA 1S7FA 3FEDA 1X10A 3DSBA 3T90A 4IIXA 3FECA 4RI1A 5KTDA 1IYLA 2J8MA 4QC6A 1ELMP 4Q38A 4WJBA 4C9RA 4MFKA 2ZOGA 1DTDA 1Z4EA 2JEVA 4B5OA 3ISXA 2OZGA 5HKYA 1YVOA 4EVYA 3KQZA 4PXDA 1QSTA 2N3AB 2R98A 3WC7A 2PJ1A 2G0BA 4M3SA 4A38A 2HWGA 4R76A 4C7HA 2OB0A 3BUOB 3F8KA 3TTHA 1TXRA 3TO9A 1TKHA 2G9DA 2AFWA 5HXDA 3TE4A 4AG7A 2ZXVA 4GPLB 1R3NA 4C2XA 1Y7RA 2ABZA 2V8VA 3B35A 4ZY1A 2PIZA 3FNCA 4FD5A 3SHPA 3VRRA 4JD6A 4BPXB 2FXFA 3MRUA 4MHYA 3S6FA 4MXUA 4MFQA 4MCSA 1DIKA 3W6SA 1AMPA 1S60A 1NE9A 1VHEA 4CO9A 1CPSA 3BJ8A 3NH4A 4MHZA 3SI1A 3NFQA 1OBRA 3TCVA 2FS5A 1HDUA 2QIRA 1F2OA 2PSWA 2PJBA 4P10A 4P45A 1YMEA 2FIAA 4MJXA 1PCAA 1YX0A 2Y0MA 1XBUA 1ZO0A 4OIWA 2Q44A 3PGPA 3OB2B 2IL4A 2XPLA 3HPGG 2OOTA 4OC5A 2QYVA 5EBVA 2PVVA 1SQHA 2ZEEA 2YNEA 2CTCA 1V0CA 3D7GA 4ZX9A 2HI6A 4PSWA 2D0OA 2VEZA 3K4IA 4CGOA 3FX6A 1Z9EA 3P2HA 1A9XB 1YVKA 1P0HA 1VHOA 4ONWA 3EC4A 1ZG9A 5JGFA 2JLMA 4X5KA 3R9EA 4ZY0A 3GJZA 1BXRB 1Z8XA 1WK4A 4QB9A 2F8HA 2FL4A 2EK8A 1M4LA 4YU9A 4A4CA 1VHSA 1ZG7A 1JDBC 1MJAA 4II9A 5CNPA 1KBLA 3EZEA 4UWIA 3W91A 2C6CA 4KUBA 4PXBA 3D7HA 1XMBA 1Q7LA 2IJZA 4U5YA 5C82A 2ZEPA 2OR4A 2G3AA 4J3GA 1OZPA 1BPNA 2DXQA 2Z3OA 3O8ZA 1BO4A 4IAVA 5K8PA 4NGTA 4A4BA 2JDCA 3DNSA 4UA3A 2GANA 3B8GA 3S9LA 4NJRA 2PE3A 2ODFA 2MP0A 2ZENA 5HH1A 4CAVA 3EO4A 1XJOA 5GCNA 1LCPA 3RAMA 4C9VA 3D3SA 5G22A 4ZY2A 1QQ9A 5I0CA 1NMTA 4QBJA 4M8DA 1TF9A 1M6VB 3FB3A 4IF5A 3QNVA 3IC1A 4R3KA 3RYOA 2E28A 3D8PA 4H1HA 1YQEA 1X12A 4OMEA 1LAMA 1FBVA 2AFXA 1JWQA 4GS4A 2BOAA 4KVME 3VRPA 4COBA 1Z8WA 2PJCA 3I1UA 4IUSA 4KOYA 5DWNA 3QAHA 4IIYA 3B3VA 1YGHA 3R9GA 4RR2B 2Q4ZA 3H5ZA 3V38A 3PB4X 3TLGA 3PLFB 2Z3LA 3JTKA 4C8TA 4NGPA 2P6EA 1KUYA 2ZW7A 4NSQA 5ELYA 3RO0A 3CDXA 4O23A 1C30B 2K5TA 2Z3MA 3PP9A 1VIXA 2BCOA 4BD9A 5HKWA 3S6KA 2EVNA 3KASA 1TF8A 4B5PB 5F09A 2D4OA 1RTQA 2OZUA 1JQGA 4PPZA 3H4QA 4KSFA 4M6GA 3CZXA 1R57A 4E0AA 2P0WA 2FCKA 3RZAA 2HV2A 4LX9A 2C5QA 4I49A 2PJ2A 2CNSA 1CJWA 5J1QA 5BWAB 1YLOA 4JYWA 3DGVA 2HB6A 2PJ5A 4KOVA 5K8NA 5BY0A 4OAEA 3IGRA 3JRUA 5H84A 2XEJA 3NE7A 5HVFA 3TLGB 2UV8G 4LQGA 3CXQA 5G21A 2I79A 2PQ8A 2YNCA 3LACA 4JXRA 4XPDB 5IV0A 4OC3A 1H8LA 3D7DA 2ZPAA 3FMCA 4RN7A 4X8IA 3R96A 4CAEA 1Z5RA 2AE6A 1ZLHA 2Q7SA 5F5XA 2B5GA 3B3SA 4MFPA 2AFUA 1F57A 1PUAA 1YW4A 4LUAA 2ZEHA 4AVBA 4CYPA 4GM5A 1LANA 4FBEA 4OC2A 4QUSA 3B3TA 2WPWA 3SI2A 2PC1A 1IOFA 2WYRA 4QVTA 3WR7A 3TLBA 2GREA 3TLZA 1S7KA 2QMLA 4BPWB 4OLLA 1XIXA 5JQ4A 5JM6A 2HROA 1BPMA 1IU8A 2GLFA 1FT7A 3I3GA 4KVOE 4YWYA 3TLCA 2PRBA 2ZEMA 2PJ6A 1R61A 1IIDA 5EMIA 4OADA 4JLYA 3DR8A 2EUIA 3CT9A 4ONUA 1CP6A 3FF3A 1KZFA 2EZBA 2Z3KA 5IX3A 2QJ8A 2Z10A 4C2YA 2FIWA 2AUMA 2VZYA 1IB1E 1RO5A 1Y9WA 3L2NA 5LRKA 1NXJA 4C85A 5LRJA 3GYAA 5H86A 1Y0RA 4PQAA 1KUXA 3IWGA 4CAFA 2B5GB 1GHEA 2VQYA 1KWMA 4JWPA 3SJGA 3K9TA 5LRGA 3A9LA 1MJ9A 3OB1B 1Q2YA 4UCPA 4OC1A 2PJ9A 3VARA 2Z3NA 3IEHA 1ARLA 2YJTA 4FWUA 3UY5A 2JDDA 2EZAA 2R82A 2Q04A 1B47A 4Z65A 4KLWA 4FD7A 2B0AA 4UEZA 5C88A 3IWWA 3SJEA 1TIQA 2OZHA 2R7HA 3PRTA 1ZYMA 1VBGA 3HMJG 4ORFA 4TWEA 5JH9A 1TKJA 2EO8A 3PFVA 2Y1MA 4A31A 4C8AA 2O28A 2XPNA 4A30A 2BL1A 1XF1A 4C8PA 2RFHA 3TO7A 3FIXA 3TLEA 2B3UA 3PB8X 2DF5A 4FD6A 4ZX8A 1I12A 1CX8A 3V8IA 7CPAA 4CDJA 3QAYA 4MHDA 3CPAA 2YNDA 3R1KA 3TO6A 2Q7BA 3VROA 2ANPA 4TJXA 3FH4A 1JDEA 3HPHE 5IR2A 4UBRA 1IGBA 4NCZA 3T8WA 2CNTA 4JVOA 4C9UA 4OIDA 4X2TA 4GXHA 3D7FA 3FRMA 5E96A 4CAWA 2Q51A 3D68A 3GB0A 1VBHA 1Y9ZA 1PU9A 1S7LA 2DLAA 3IO1A 2R1IA 4AXVA 4ZYQA 3H8FA 3BUWB 3SXNA 4NGSA 4ZBGA 3SXOA 1R43A 1J4JA 1XOVA 1M1DA 4P4JA 2NSMA 4PXEA 4P4BA 1QSNA 3FVLA 1VI4A 1Z9UA 5F1YA 3VTAA 5AXIA 4AG9A 4XPKA 4MCQA 3PFEA 2VBQA 4KOTA 2CIJA 3CXSA 1XRYA 1K4JA 3KR5A 2RC4A 3D2PA 4R3LA 3MGDA 2V8GA 3NOJA 3SI0A 3HUVA 4K30A 4MHPA 4UFXA 2AFOA 4Q36A 3EFAA 1Z4RA 3TFYA 1NBWA 4C8CA 1M4DA 1VKCA 4FUUA 2NMTA 2F7VA 4E8OA 2AUNA 2YGWA 2BEIA 3EXNA 2CNMA 2R8VA 2PCNA 2KCWA 3F9KC 5AG6A 2VL1A 4CGNA 5THWA 3WC5A 4EMEA 5K8MA 2X7BA 1BLLE 2ATRA 4P44A 1BOBA 4XPDC 3R95A 4NJQA 4MHNA 2ZEOA 5J8CA 3D4UA 4INJA 2ZW4A 2IMOA 1CG2A 2Y1NA 2GIVA 4CRYB 1YREA 1GYTA 2GE3A 5AG7A 2Q4VA 2ZW6A 4UEEA 3T9YA 3VWDA 1MJBA 4A94A 4EFDA 4C7IA 2PVWA 1Z8LA 3KRVA 5IB9A 4MRIA 2D0PA 2PJ4A 3TLAA 1WWZA 2ZW5A 1I1DA
chains in the Genus database with same CATH topology
4TJVA 2XEFA 2POKA 2V8DA 5CBMA 3HLPA 4X3RA 4OP4A 3KZWA 2IQ6A 3S9NA 3K2KA 2EK9A 3S9MA 2O4HA 5DS0A 5LYIA 4W9YA 1YW6A 3KQXA 2CF4A 4MCRA 2O53A 3PB6X 3ISZA 1LFWA 2PJ8A 3PB9X 4ZI6A 3H8EA 2V77A 4JZ0A 2ZOFA 2ZEGA 1HDQA 2PJ7A 3DLJA 2NYQA 2C1CA 4F8ZA 2PRQA 2PJAA 2ZEDA 4C8UA 2C6GA 3FJUA 2PJ0A 3D66A 3NH5A 2JBJA 4C86A 3GLJA 4A37A 4C9EA 4UIAA 2V8HA 5D29A 3D67A 1LAPA 1VGYA 1PYTB 1AYEA 5LYDA 3PFOA 2PCUA 4C99A 4DJLA 3GUXA 4KNGE 2BO9A 3KGQA 2PJ3A 3FEEA 1LOKA 3BXMA 2XEIA 1NSAA 2GU2A 3LMSA 5HVHA 2GP4A 2EWBA 3PEIA 5CPAA 3RBUA 3PBBA 3IIBA 3KL9A 4P4FA 5I4MA 1ARMA 3VH9A 5HVGA 4MCPA 1ZG8A 2FVGA 4UEFA 3WC6A 2C6PA 2HC9A 4K3NA 2AFZA 3IJ3A 2JBKA 3KHZA 5D8NA 3EIFA 4NGQA 3PB7X 2ZELA 1Y0YA 4NGNA 3WABA 1HEEA 4EWTA 4KSIA 3VATA 2I3CA 3H8GA 1TKFA 3IFEA 4DUKA 2J9AA 2XEGA 3B3WA 1ELLP 1XFOA 3LWUA 2RB7A 8CPAA 4A39A 4P4DA 3BHXA 4C9AA 3NH8A 4P4IA 1ZLIA 5LYFA 4NFRA 1IY7A 2GLJA 4CDKA 3PBEA 4UF4A 3KI9A 1QMUA 4C84A 5K8OA 3SJFA 6CPAA 3I74A 4FAIA 4Q7AA 3SJXA 3NFZA 1F2PA 4UIBA 4WWVA 3KHXA 3CPXA 3KR4A 4F9VA 4RUHA 3TX8A 4YN3A 3WT4A 1WVMA 1YSJA 2AFSA 2DEAA 4C8FA 3TC8A 3NA6A 1CBXA 1Y7EA 4IHMA 1V6CA 4CPAA 2AFMA 4TNUA 4F9UA 3I6SA 4G1PA 4NGMA 2JEWA 4OKOA 4R6TA 5LYLA 3B2YA 1EE3P 3BI0A 2Q43A 4MMOA 1FNOA 1BAVA 2QVPA 1CP7A 4P6YA 2WZNA 4R7MA 2CTBA 4B6ZA 2PIYA 4NGRA 2ZEFA 4OC0A 4IK2A 3B7IA 1CPXA 3MN8A 3V7ZA 3ICUA 1DE4C 4PXCA 4H2KA 4DYOA 1UWYA 4R8FA 3N5FA 1Z2LA 4OC4A 3B3CA 3BI1A 4P4EA 3FEDA 3FECA 1ELMP 4WJBA 4C9RA 2ZOGA 1DTDA 3ISXA 3KQZA 4PXDA 3WC7A 2PJ1A 4A38A 4R76A 1TXRA 1TKHA 2G9DA 2AFWA 5HXDA 1R3NA 2ABZA 2V8VA 3B35A 4ZY1A 2PIZA 3MRUA 4MHYA 4MXUA 4MCSA 1AMPA 1VHEA 1CPSA 3NH4A 4MHZA 3SI1A 1OBRA 1HDUA 1F2OA 2PJBA 4P10A 4P45A 1YMEA 1PCAA 1XBUA 4OIWA 2OOTA 4OC5A 2QYVA 2PVVA 2ZEEA 2CTCA 3D7GA 4ZX9A 3FX6A 1VHOA 4ONWA 1ZG9A 5JGFA 4ZY0A 2F8HA 2EK8A 1M4LA 4YU9A 1ZG7A 2C6CA 4PXBA 3D7HA 1XMBA 1Q7LA 2IJZA 2ZEPA 2OR4A 1BPNA 5K8PA 4IAVA 4NGTA 3S9LA 4NJRA 2PE3A 2ZENA 1XJOA 1LCPA 3RAMA 4C9VA 4ZY2A 1QQ9A 1TF9A 3QNVA 3IC1A 1LAMA 4OMEA 2AFXA 2BOAA 2PJCA 3I1UA 3B3VA 2Q4ZA 3V38A 3PB4X 4C8TA 4NGPA 5ELYA 3CDXA 4O23A 4BD9A 1VIXA 2BCOA 3KASA 1TF8A 5F09A 1RTQA 1JQGA 4PPZA 3RZAA 2C5QA 2PJ2A 5J1QA 1YLOA 4JYWA 3DGVA 2HB6A 2PJ5A 5K8NA 3JRUA 2XEJA 5HVFA 4LQGA 4OC3A 1H8LA 3D7DA 3FMCA 4X8IA 1Z5RA 1ZLHA 3B3SA 2AFUA 1F57A 1YW4A 4FBEA 2ZEHA 4GM5A 1LANA 4OC2A 3B3TA 3SI2A 2WYRA 2GREA 5JM6A 1BPMA 2GLFA 1FT7A 4YWYA 2ZEMA 2PJ6A 3CT9A 1CP6A 3FF3A 2QJ8A 5LRKA 3L2NA 4C85A 5LRJA 1Y0RA 4PQAA 1KWMA 3SJGA 3K9TA 5LRGA 4OC1A 2PJ9A 3VARA 3IEHA 1ARLA 4FWUA 4Z65A 4UEZA 3IWWA 3SJEA 3PRTA 4TWEA 5JH9A 1TKJA 1XF1A 4C8PA 2RFHA 3PB8X 4ZX8A 4CDJA 1CX8A 7CPAA 3CPAA 2ANPA 4TJXA 3FH4A 5IR2A 1IGBA 3T8WA 4C9UA 4OIDA 4X2TA 3D7FA 2Q51A 3D68A 3GB0A 1Y9ZA 4C8AA 4ZYQA 3IO1A 4AXVA 3H8FA 4NGSA 1R43A 4P4JA 2NSMA 4PXEA 4P4BA 3FVLA 3VTAA 4MCQA 3PFEA 2CIJA 3KR5A 1XRYA 2V8GA 3SI0A 3HUVA 4MHPA 2AFOA 4C8CA 4FUUA 2F7VA 2VL1A 5THWA 3WC5A 4EMEA 5K8MA 1BLLE 4P44A 4NJQA 4MHNA 2ZEOA 3D4UA 2IMOA 1CG2A 1GYTA 4UEEA 4A94A 4EFDA 2PVWA 1Z8LA 5IB9A 4MRIA 2PJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TJV A;  2XEF A;  2POK A;  2V8D A;  5CBM A;  3HLP A;  4X3R A;  4OP4 A;  3KZW A;  2IQ6 A;  3S9N A;  3K2K A;  2EK9 A;  3S9M A;  2O4H A;  5DS0 A;  5LYI A;  4W9Y A;  1YW6 A;  3KQX A;  2CF4 A;  4MCR A;  2O53 A;  3PB6 X;  3ISZ A;  1LFW A;  2PJ8 A;  3PB9 X;  4ZI6 A;  3H8E A;  2V77 A;  4JZ0 A;  2ZOF A;  2ZEG A;  1HDQ A;  2PJ7 A;  3DLJ A;  2NYQ A;  2C1C A;  4F8Z A;  2PRQ A;  2PJA A;  2ZED A;  4C8U A;  2C6G A;  3FJU A;  2PJ0 A;  3D66 A;  3NH5 A;  2JBJ A;  4C86 A;  3GLJ A;  4A37 A;  4C9E A;  4UIA A;  2V8H A;  5D29 A;  3D67 A;  1LAP A;  1VGY A;  1PYT B;  1AYE A;  5LYD A;  3PFO A;  2PCU A;  4C99 A;  4DJL A;  3GUX A;  4KNG E;  2BO9 A;  3KGQ A;  2PJ3 A;  3FEE A;  1LOK A;  3BXM A;  2XEI A;  1NSA A;  2GU2 A;  3LMS A;  5HVH A;  2EWB A;  3PEI A;  5CPA A;  3RBU A;  3PBB A;  3IIB A;  3KL9 A;  4P4F A;  5I4M A;  1ARM A;  3VH9 A;  5HVG A;  4MCP A;  1ZG8 A;  2FVG A;  4UEF A;  3WC6 A;  2C6P A;  2HC9 A;  4K3N A;  2AFZ A;  3IJ3 A;  2JBK A;  3KHZ A;  5D8N A;  3EIF A;  4NGQ A;  3PB7 X;  2ZEL A;  1Y0Y A;  4NGN A;  3WAB A;  1HEE A;  4EWT A;  4KSI A;  3VAT A;  2I3C A;  3H8G A;  1TKF A;  3IFE A;  4DUK A;  2J9A A;  2XEG A;  3B3W A;  1ELL P;  1XFO A;  3LWU A;  2RB7 A;  8CPA A;  4A39 A;  4P4D A;  3BHX A;  4C9A A;  3NH8 A;  4P4I A;  1ZLI A;  5LYF A;  4NFR A;  1IY7 A;  2GLJ A;  4CDK A;  3PBE A;  4UF4 A;  3KI9 A;  1QMU A;  4C84 A;  5K8O A;  3SJF A;  6CPA A;  3I74 A;  4FAI A;  4Q7A A;  3SJX A;  3NFZ A;  1F2P A;  4UIB A;  4WWV A;  3KHX A;  3CPX A;  3KR4 A;  4F9V A;  4RUH A;  3TX8 A;  4YN3 A;  3WT4 A;  1WVM A;  1YSJ A;  2AFS A;  2DEA A;  4C8F A;  3TC8 A;  3NA6 A;  1CBX A;  1Y7E A;  4IHM A;  1V6C A;  4CPA A;  2AFM A;  4TNU A;  4F9U A;  3I6S A;  4G1P A;  4NGM A;  2JEW A;  4OKO A;  4R6T A;  5LYL A;  3B2Y A;  1EE3 P;  3BI0 A;  2Q43 A;  4MMO A;  1FNO A;  1BAV A;  2QVP A;  1CP7 A;  4P6Y A;  2WZN A;  4R7M A;  2CTB A;  4B6Z A;  2PIY A;  4NGR A;  2ZEF A;  4OC0 A;  4IK2 A;  3B7I A;  1CPX A;  3MN8 A;  3V7Z A;  3ICU A;  1DE4 C;  4PXC A;  4H2K A;  4DYO A;  1UWY A;  4R8F A;  3N5F A;  1Z2L A;  4OC4 A;  3B3C A;  3BI1 A;  4P4E A;  3FED A;  3FEC A;  1ELM P;  4WJB A;  4C9R A;  2ZOG A;  1DTD A;  3ISX A;  3KQZ A;  4PXD A;  3WC7 A;  2PJ1 A;  4A38 A;  4R76 A;  1TXR A;  1TKH A;  2G9D A;  2AFW A;  5HXD A;  1R3N A;  2ABZ A;  2V8V A;  3B35 A;  4ZY1 A;  2PIZ A;  3MRU A;  4MHY A;  4MXU A;  4MCS A;  1AMP A;  1VHE A;  1CPS A;  3NH4 A;  4MHZ A;  3SI1 A;  1OBR A;  1HDU A;  1F2O A;  2PJB A;  4P10 A;  4P45 A;  1YME A;  1PCA A;  1XBU A;  4OIW A;  2OOT A;  4OC5 A;  2QYV A;  2PVV A;  2ZEE A;  2CTC A;  3D7G A;  4ZX9 A;  3FX6 A;  1VHO A;  4ONW A;  1ZG9 A;  5JGF A;  4ZY0 A;  2F8H A;  2EK8 A;  1M4L A;  4YU9 A;  1ZG7 A;  2C6C A;  4PXB A;  3D7H A;  1XMB A;  1Q7L A;  2IJZ A;  2ZEP A;  2OR4 A;  1BPN A;  5K8P A;  4IAV A;  4NGT A;  3S9L A;  4NJR A;  2PE3 A;  2ZEN A;  1XJO A;  1LCP A;  3RAM A;  4C9V A;  4ZY2 A;  1QQ9 A;  1TF9 A;  3QNV A;  3IC1 A;  1LAM A;  4OME A;  2AFX A;  2BOA A;  2PJC A;  3I1U A;  3B3V A;  2Q4Z A;  3V38 A;  3PB4 X;  4C8T A;  4NGP A;  5ELY A;  3CDX A;  4O23 A;  4BD9 A;  1VIX A;  2BCO A;  3KAS A;  1TF8 A;  5F09 A;  1RTQ A;  1JQG A;  4PPZ A;  3RZA A;  2PJ2 A;  5J1Q A;  1YLO A;  4JYW A;  3DGV A;  2HB6 A;  2PJ5 A;  5K8N A;  3JRU A;  2XEJ A;  5HVF A;  4LQG A;  4OC3 A;  1H8L A;  3D7D A;  3FMC A;  4X8I A;  1Z5R A;  1ZLH A;  3B3S A;  2AFU A;  1F57 A;  1YW4 A;  4FBE A;  2ZEH A;  4GM5 A;  1LAN A;  4OC2 A;  3B3T A;  3SI2 A;  2WYR A;  2GRE A;  5JM6 A;  1BPM A;  2GLF A;  1FT7 A;  4YWY A;  2ZEM A;  2PJ6 A;  3CT9 A;  1CP6 A;  3FF3 A;  2QJ8 A;  5LRK A;  3L2N A;  4C85 A;  5LRJ A;  1Y0R A;  4PQA A;  1KWM A;  3SJG A;  3K9T A;  5LRG A;  4OC1 A;  2PJ9 A;  3VAR A;  3IEH A;  1ARL A;  4FWU A;  4Z65 A;  4UEZ A;  3IWW A;  3SJE A;  3PRT A;  4TWE A;  5JH9 A;  1TKJ A;  1XF1 A;  4C8P A;  2RFH A;  3PB8 X;  4ZX8 A;  4CDJ A;  1CX8 A;  7CPA A;  3CPA A;  2ANP A;  4TJX A;  3FH4 A;  1IGB A;  3T8W A;  4C9U A;  4OID A;  4X2T A;  3D7F A;  2Q51 A;  3D68 A;  3GB0 A;  1Y9Z A;  4C8A A;  4ZYQ A;  3IO1 A;  4AXV A;  3H8F A;  4NGS A;  1R43 A;  4P4J A;  2NSM A;  4PXE A;  4P4B A;  3FVL A;  3VTA A;  4MCQ A;  3PFE A;  2CIJ A;  3KR5 A;  1XRY A;  2V8G A;  3SI0 A;  3HUV A;  4MHP A;  2AFO A;  4C8C A;  4FUU A;  2F7V A;  2VL1 A;  5THW A;  3WC5 A;  4EME A;  5K8M A;  1BLL E;  4P44 A;  4NJQ A;  4MHN A;  2ZEO A;  3D4U A;  2IMO A;  1CG2 A;  1GYT A;  4UEE A;  4A94 A;  4EFD A;  2PVW A;  1Z8L A;  5IB9 A;  4MRI A;  2PJ4 A; 
#chains in the Genus database with same CATH topology
 4TJV A;  2XEF A;  2POK A;  2V8D A;  5CBM A;  4CGM A;  1XF8 A;  3HLP A;  4X3R A;  4OP4 A;  3KZW A;  4R9M A;  2IQ6 A;  3S9N A;  1T36 B;  4CZ1 A;  3K2K A;  2EK9 A;  2YNC C;  3S9M A;  2REF A;  2B4B A;  2FM4 A;  2O4H A;  5DS0 A;  4LQ6 A;  5LYI A;  2ARH A;  4W9Y A;  4PK3 A;  1YW6 A;  3KQX A;  4H89 A;  3TOA A;  1A2Z A;  4A32 A;  3W6X A;  4CRZ B;  2CF4 A;  4MCR A;  2O53 A;  2Z3P A;  3ISZ A;  1LFW A;  2PJ8 A;  1ON0 A;  3PB9 X;  3H8E A;  2AJ6 A;  2V77 A;  4ZI6 A;  3ZJ0 A;  3VGO A;  2OU2 A;  3ZNI A;  4JZ0 A;  2ZOF A;  5A27 A;  2WUU A;  2ZEG A;  1HDQ A;  4PK2 A;  4B10 A;  1WJT A;  4MY3 A;  4MFL A;  4F0Y A;  5A28 A;  1IIC A;  2DPT A;  2PJ7 A;  3PB6 X;  4CYN A;  3DLJ A;  1B87 A;  2NYQ A;  3BUM B;  4E2A A;  2C1C A;  4F8Z A;  2B4J C;  2PRQ A;  4JXQ A;  3GKR A;  2VZZ A;  5FD8 A;  2PJA A;  2ZED A;  3BUN B;  3NE8 A;  4B12 A;  4C8U A;  2C6G A;  4AVA A;  1EZA A;  3FJU A;  4CGP A;  2PJ0 A;  3C26 A;  3D66 A;  2PR1 A;  4MBU A;  2HQY A;  1I21 A;  3NH5 A;  1B6B A;  4U9Y A;  2JBJ A;  1QSO A;  2I00 A;  4M85 A;  4C86 A;  3GLJ A;  2CXA A;  4NF1 A;  4A37 A;  4UIA A;  4C9E A;  5IB0 A;  2V8H A;  1CM0 A;  5D29 A;  1S5K A;  4KVX A;  3D67 A;  4KOS A;  4E5S A;  4J0N A;  3G8W A;  4HKF A;  1LAP A;  2PDO A;  4MI4 A;  4YFJ A;  1VGY A;  1PYT B;  1AYE A;  5LYD A;  3PFO A;  5HMN A;  3EZA A;  3F0A A;  4L89 A;  2B3V A;  2PCU A;  4BMH A;  4DJL A;  4C99 A;  1XEB A;  2FE7 A;  3GUX A;  4KNG E;  2BO9 A;  1FY7 A;  3KGQ A;  1CS0 B;  2PJ3 A;  3FEE A;  1LOK A;  2H5M A;  4C2Z A;  3BXM A;  1M4I A;  3D2M A;  4MI1 A;  1KEE B;  1XMT A;  2XEI A;  4Y49 C;  1NSA A;  1S7N A;  5J8F A;  2F5I A;  5G20 A;  2GU2 A;  4R57 A;  3LMS A;  3VRN A;  2XPO A;  5HVH A;  2GP4 A;  1YK3 A;  3T0T A;  2EWB A;  4YGO A;  4U9Z A;  3PEI A;  4PSX A;  5KTC A;  2REE A;  3JUW A;  3RBU A;  3PBB A;  3IIB A;  1Q2C A;  3KL9 A;  4UFV A;  5CPA A;  4BBH A;  4P4F A;  1IOI A;  2CBL A;  1Y9K A;  4CYO A;  1ARM A;  4B14 A;  5I4M A;  5DWM A;  1UFH A;  2XPP A;  4KS9 A;  3VH9 A;  4A33 A;  5HVG A;  4MCP A;  3BLN A;  1ZG8 A;  4C68 A;  3EZB A;  4HNX B;  5K99 A;  2OLS A;  5KTA A;  4XPL A;  3IWE A;  2FVG A;  1U6M A;  4UEF A;  4A95 A;  2HUZ A;  2QEC A;  5F13 A;  2C6P A;  2HC9 A;  3LD2 A;  4K3N A;  2AFZ A;  3S6G A;  3WC6 A;  3PZJ A;  3IJ3 A;  2JBK A;  2VI7 A;  3KHZ A;  5D8N A;  3EIF A;  2FSR A;  4NGQ A;  1L0C A;  4MJ8 A;  3PB7 X;  5JYB A;  5JVL A;  2ZEL A;  1Y0Y A;  4NGN A;  5JPH A;  4XNH C;  3WAB A;  1HEE A;  4M6I A;  4EWT A;  4KSI A;  3VAT A;  1ZL0 A;  4B11 A;  4KLV A;  3DR6 A;  2DIK A;  3F5B A;  3TT2 A;  4F6A A;  2WSA A;  1IYK A;  2I3C A;  2J8R A;  1TKF A;  3H8G A;  3IFE A;  4NEX A;  4DUK A;  3OP0 A;  2J9A A;  3I9S A;  4UFW A;  5F9M A;  2Z0Z A;  3TYX A;  3FXT A;  3G3S A;  4L8A A;  1S3Z A;  3TLY A;  3TOB A;  1NSL A;  4B13 A;  1C3O B;  2XEG A;  3BUX B;  3B3W A;  2EBJ A;  2B4D A;  1ELL P;  1XFO A;  3GY9 A;  3LWU A;  4Y49 B;  3IU1 A;  2RB7 A;  1QSM A;  4A39 A;  8CPA A;  4FD4 A;  3N7Z A;  1KC7 A;  4P4D A;  1Z8T A;  4COG A;  4KUA A;  1QSR A;  3BHX A;  5HKZ A;  3DDD A;  4C9A A;  4MFJ A;  2Q4Y A;  3NH8 A;  5J3X A;  3PT1 A;  5G1Z A;  4P4I A;  1ZLI A;  4CAX A;  1KUV A;  4BTF A;  5LYF A;  4NFR A;  1IY7 A;  5AG4 A;  3U88 C;  1YVH A;  2GLJ A;  4CDK A;  2CY2 A;  5AGE A;  5EC4 A;  3VWE A;  3PBE A;  1GGO A;  5F48 A;  4RS2 A;  4UF4 A;  1M4G A;  1CE8 B;  4EYS A;  2VKZ G;  4HNY B;  2J8N A;  2Z11 A;  3KI9 A;  4UCM A;  1QMU A;  1Q5X A;  4C84 A;  5K8O A;  3RNZ A;  2B4D B;  4XNH B;  3SJF A;  1RXT A;  2A4N A;  1M44 A;  1EZB A;  6CPA A;  1AUG A;  3I74 A;  3T05 A;  2DPS A;  4B5P A;  4Q7A A;  4FAI A;  3SJX A;  4A2Z A;  1YR0 A;  3NFZ A;  4KZT A;  1F2P A;  2BUE A;  3FYN A;  3OWC A;  4UIB A;  4WWV A;  3ZZI A;  3KHX A;  1MK4 A;  5F49 A;  4AB7 A;  3CPX A;  3KR4 A;  4NXY A;  4AVC A;  4F9V A;  4RUH A;  3T5M A;  3TX8 A;  4YN3 A;  2BSW A;  3WT4 A;  1WVM A;  1YSJ A;  2AFS A;  2DEA A;  4C8F A;  1YLE A;  3TC8 A;  3NA6 A;  2WPX A;  1CBX A;  3LOD A;  1Y7E A;  3BJ7 A;  4IHM A;  1V6C A;  3T07 A;  4CPA A;  2G3T A;  4MFZ A;  4KOW A;  3OAK A;  4YRH A;  3ICU A;  2AFM A;  4TNU A;  3EY5 A;  3CXP A;  4R87 A;  4F0X A;  5ISV A;  1ZRS A;  2FT0 A;  4F9U A;  2P6F A;  4MY0 A;  3I6S A;  5AG5 A;  3GIU A;  4G1P A;  4NGM A;  2JEW A;  4OKO A;  1LRZ A;  4R6T A;  2X0S A;  3QB8 A;  5LYL A;  4UCN A;  3B2Y A;  4UWJ A;  4CS0 B;  4DNC A;  1EE3 P;  3VRQ A;  3P2F A;  4KSA A;  2B58 A;  3BI0 A;  2Q43 A;  4MMO A;  1N71 A;  1FNO A;  1BAV A;  3U1B A;  4CYQ A;  5F47 A;  2QVP A;  1CP7 A;  2Q0Y A;  5F46 A;  3KKW A;  4P6Y A;  4M6H A;  5FVJ A;  2PR8 A;  2WZN A;  4PV6 A;  1XE4 A;  2C27 A;  4KOX A;  4R7M A;  2CTB A;  3R9F A;  4B6Z A;  2PIY A;  4NGR A;  2ZEF A;  3E0K A;  4OC0 A;  4IK2 A;  4KOU A;  4BIN A;  2GFQ A;  3B7I A;  1CPX A;  3MN8 A;  3V7Z A;  2D4P A;  2EZC A;  4E94 A;  2VXK A;  3K9U A;  4HNW B;  1DE4 C;  2P6G A;  3IU2 A;  4H6Z A;  4JJX A;  4KOR A;  4PXC A;  4ZGY B;  4H2K A;  4DYO A;  1UWY A;  1P4N A;  1EO0 A;  4HPS A;  4R8F A;  4H6U A;  2YJV A;  3N5F A;  3C8O A;  4BPU B;  4CGL A;  1J3L A;  1Z2L A;  1Q2D A;  4OC4 A;  3B3C A;  3JVN A;  3G23 A;  3SR3 A;  3FBU A;  2OH1 A;  3BI1 A;  4P4E A;  3S6H A;  1S7F A;  3FED A;  1X10 A;  3DSB A;  3T90 A;  4IIX A;  3FEC A;  4RI1 A;  5KTD A;  1IYL A;  2J8M A;  4QC6 A;  1ELM P;  4Q38 A;  4WJB A;  4C9R A;  4MFK A;  2ZOG A;  1DTD A;  1Z4E A;  2JEV A;  4B5O A;  3ISX A;  2OZG A;  5HKY A;  1YVO A;  4EVY A;  3KQZ A;  4PXD A;  1QST A;  2N3A B;  2R98 A;  3WC7 A;  2PJ1 A;  2G0B A;  4M3S A;  4A38 A;  2HWG A;  4R76 A;  4C7H A;  2OB0 A;  3BUO B;  3F8K A;  3TTH A;  1TXR A;  3TO9 A;  1TKH A;  2G9D A;  2AFW A;  5HXD A;  3TE4 A;  4AG7 A;  2ZXV A;  4GPL B;  1R3N A;  4C2X A;  1Y7R A;  2ABZ A;  2V8V A;  3B35 A;  4ZY1 A;  2PIZ A;  3FNC A;  4FD5 A;  3SHP A;  3VRR A;  4JD6 A;  4BPX B;  2FXF A;  3MRU A;  4MHY A;  3S6F A;  4MXU A;  4MFQ A;  4MCS A;  1DIK A;  3W6S A;  1AMP A;  1S60 A;  1NE9 A;  1VHE A;  4CO9 A;  1CPS A;  3BJ8 A;  3NH4 A;  4MHZ A;  3SI1 A;  3NFQ A;  1OBR A;  3TCV A;  2FS5 A;  1HDU A;  2QIR A;  1F2O A;  2PSW A;  2PJB A;  4P10 A;  4P45 A;  1YME A;  2FIA A;  4MJX A;  1PCA A;  1YX0 A;  2Y0M A;  1XBU A;  1ZO0 A;  4OIW A;  2Q44 A;  3PGP A;  3OB2 B;  2IL4 A;  2XPL A;  3HPG G;  2OOT A;  4OC5 A;  2QYV A;  5EBV A;  2PVV A;  1SQH A;  2ZEE A;  2YNE A;  2CTC A;  1V0C A;  3D7G A;  4ZX9 A;  2HI6 A;  4PSW A;  2D0O A;  2VEZ A;  3K4I A;  4CGO A;  3FX6 A;  1Z9E A;  3P2H A;  1A9X B;  1YVK A;  1P0H A;  1VHO A;  4ONW A;  3EC4 A;  1ZG9 A;  5JGF A;  2JLM A;  4X5K A;  3R9E A;  4ZY0 A;  3GJZ A;  1BXR B;  1Z8X A;  1WK4 A;  4QB9 A;  2F8H A;  2FL4 A;  2EK8 A;  1M4L A;  4YU9 A;  4A4C A;  1VHS A;  1ZG7 A;  1JDB C;  1MJA A;  4II9 A;  5CNP A;  1KBL A;  3EZE A;  4UWI A;  3W91 A;  2C6C A;  4KUB A;  4PXB A;  3D7H A;  1XMB A;  1Q7L A;  2IJZ A;  4U5Y A;  5C82 A;  2ZEP A;  2OR4 A;  2G3A A;  4J3G A;  1OZP A;  1BPN A;  2DXQ A;  2Z3O A;  3O8Z A;  1BO4 A;  4IAV A;  5K8P A;  4NGT A;  4A4B A;  2JDC A;  3DNS A;  4UA3 A;  2GAN A;  3B8G A;  3S9L A;  4NJR A;  2PE3 A;  2ODF A;  2MP0 A;  2ZEN A;  5HH1 A;  4CAV A;  3EO4 A;  1XJO A;  5GCN A;  1LCP A;  3RAM A;  4C9V A;  3D3S A;  5G22 A;  4ZY2 A;  1QQ9 A;  5I0C A;  1NMT A;  4QBJ A;  4M8D A;  1TF9 A;  1M6V B;  3FB3 A;  4IF5 A;  3QNV A;  3IC1 A;  4R3K A;  3RYO A;  2E28 A;  3D8P A;  4H1H A;  1YQE A;  1X12 A;  4OME A;  1LAM A;  1FBV A;  2AFX A;  1JWQ A;  4GS4 A;  2BOA A;  4KVM E;  3VRP A;  4COB A;  1Z8W A;  2PJC A;  3I1U A;  4IUS A;  4KOY A;  5DWN A;  3QAH A;  4IIY A;  3B3V A;  1YGH A;  3R9G A;  4RR2 B;  2Q4Z A;  3H5Z A;  3V38 A;  3PB4 X;  3TLG A;  3PLF B;  2Z3L A;  3JTK A;  4C8T A;  4NGP A;  2P6E A;  1KUY A;  2ZW7 A;  4NSQ A;  5ELY A;  3RO0 A;  3CDX A;  4O23 A;  1C30 B;  2K5T A;  2Z3M A;  3PP9 A;  1VIX A;  2BCO A;  4BD9 A;  5HKW A;  3S6K A;  2EVN A;  3KAS A;  1TF8 A;  4B5P B;  5F09 A;  2D4O A;  1RTQ A;  2OZU A;  1JQG A;  4PPZ A;  3H4Q A;  4KSF A;  4M6G A;  3CZX A;  1R57 A;  4E0A A;  2P0W A;  2FCK A;  3RZA A;  2HV2 A;  4LX9 A;  2C5Q A;  4I49 A;  2PJ2 A;  2CNS A;  1CJW A;  5J1Q A;  5BWA B;  1YLO A;  4JYW A;  3DGV A;  2HB6 A;  2PJ5 A;  4KOV A;  5K8N A;  5BY0 A;  4OAE A;  3IGR A;  3JRU A;  5H84 A;  2XEJ A;  3NE7 A;  5HVF A;  3TLG B;  2UV8 G;  4LQG A;  3CXQ A;  5G21 A;  2I79 A;  2PQ8 A;  2YNC A;  3LAC A;  4JXR A;  4XPD B;  5IV0 A;  4OC3 A;  1H8L A;  3D7D A;  2ZPA A;  3FMC A;  4RN7 A;  4X8I A;  3R96 A;  4CAE A;  1Z5R A;  2AE6 A;  1ZLH A;  2Q7S A;  5F5X A;  2B5G A;  3B3S A;  4MFP A;  2AFU A;  1F57 A;  1PUA A;  1YW4 A;  4LUA A;  2ZEH A;  4AVB A;  4CYP A;  4GM5 A;  1LAN A;  4FBE A;  4OC2 A;  4QUS A;  3B3T A;  2WPW A;  3SI2 A;  2PC1 A;  1IOF A;  2WYR A;  4QVT A;  3WR7 A;  3TLB A;  2GRE A;  3TLZ A;  1S7K A;  2QML A;  4BPW B;  4OLL A;  1XIX A;  5JQ4 A;  5JM6 A;  2HRO A;  1BPM A;  1IU8 A;  2GLF A;  1FT7 A;  3I3G A;  4KVO E;  4YWY A;  3TLC A;  2PRB A;  2ZEM A;  2PJ6 A;  1R61 A;  1IID A;  5EMI A;  4OAD A;  4JLY A;  3DR8 A;  2EUI A;  3CT9 A;  4ONU A;  1CP6 A;  3FF3 A;  1KZF A;  2EZB A;  2Z3K A;  5IX3 A;  2QJ8 A;  2Z10 A;  4C2Y A;  2FIW A;  2AUM A;  2VZY A;  1IB1 E;  1RO5 A;  1Y9W A;  3L2N A;  5LRK A;  1NXJ A;  4C85 A;  5LRJ A;  3GYA A;  5H86 A;  1Y0R A;  4PQA A;  1KUX A;  3IWG A;  4CAF A;  2B5G B;  1GHE A;  2VQY A;  1KWM A;  4JWP A;  3SJG A;  3K9T A;  5LRG A;  3A9L A;  1MJ9 A;  3OB1 B;  1Q2Y A;  4UCP A;  4OC1 A;  2PJ9 A;  3VAR A;  2Z3N A;  3IEH A;  1ARL A;  2YJT A;  4FWU A;  3UY5 A;  2JDD A;  2EZA A;  2R82 A;  2Q04 A;  1B47 A;  4Z65 A;  4KLW A;  4FD7 A;  2B0A A;  4UEZ A;  5C88 A;  3IWW A;  3SJE A;  1TIQ A;  2OZH A;  2R7H A;  3PRT A;  1ZYM A;  1VBG A;  3HMJ G;  4ORF A;  4TWE A;  5JH9 A;  1TKJ A;  2EO8 A;  3PFV A;  2Y1M A;  4A31 A;  4C8A A;  2O28 A;  2XPN A;  4A30 A;  2BL1 A;  1XF1 A;  4C8P A;  2RFH A;  3TO7 A;  3FIX A;  3TLE A;  2B3U A;  3PB8 X;  2DF5 A;  4FD6 A;  4ZX8 A;  1I12 A;  1CX8 A;  3V8I A;  7CPA A;  4CDJ A;  3QAY A;  4MHD A;  3CPA A;  2YND A;  3R1K A;  3TO6 A;  2Q7B A;  3VRO A;  2ANP A;  4TJX A;  3FH4 A;  1JDE A;  3HPH E;  5IR2 A;  4UBR A;  1IGB A;  4NCZ A;  3T8W A;  2CNT A;  4JVO A;  4C9U A;  4OID A;  4X2T A;  4GXH A;  3D7F A;  3FRM A;  5E96 A;  4CAW A;  2Q51 A;  3D68 A;  3GB0 A;  1VBH A;  1Y9Z A;  1PU9 A;  1S7L A;  2DLA A;  3IO1 A;  2R1I A;  4AXV A;  4ZYQ A;  3H8F A;  3BUW B;  3SXN A;  4NGS A;  4ZBG A;  3SXO A;  1R43 A;  1J4J A;  1XOV A;  1M1D A;  4P4J A;  2NSM A;  4PXE A;  4P4B A;  1QSN A;  3FVL A;  1VI4 A;  1Z9U A;  5F1Y A;  3VTA A;  5AXI A;  4AG9 A;  4XPK A;  4MCQ A;  3PFE A;  2VBQ A;  4KOT A;  2CIJ A;  3CXS A;  1XRY A;  1K4J A;  3KR5 A;  2RC4 A;  3D2P A;  4R3L A;  3MGD A;  2V8G A;  3NOJ A;  3SI0 A;  3HUV A;  4K30 A;  4MHP A;  4UFX A;  2AFO A;  4Q36 A;  3EFA A;  1Z4R A;  3TFY A;  1NBW A;  4C8C A;  1M4D A;  1VKC A;  4FUU A;  2NMT A;  2F7V A;  4E8O A;  2AUN A;  2YGW A;  2BEI A;  3EXN A;  2CNM A;  2R8V A;  2PCN A;  2KCW A;  3F9K C;  5AG6 A;  2VL1 A;  4CGN A;  5THW A;  3WC5 A;  4EME A;  5K8M A;  2X7B A;  1BLL E;  2ATR A;  4P44 A;  1BOB A;  4XPD C;  3R95 A;  4NJQ A;  4MHN A;  2ZEO A;  5J8C A;  3D4U A;  4INJ A;  2ZW4 A;  2IMO A;  1CG2 A;  2Y1N A;  2GIV A;  4CRY B;  1YRE A;  1GYT A;  2GE3 A;  5AG7 A;  2Q4V A;  2ZW6 A;  4UEE A;  3T9Y A;  3VWD A;  1MJB A;  4A94 A;  4EFD A;  4C7I A;  2PVW A;  1Z8L A;  3KRV A;  5IB9 A;  4MRI A;  2D0P A;  2PJ4 A;  3TLA A;  1WWZ A;  2ZW5 A;  1I1D A; 
#chains in the Genus database with same CATH homology
 4TJV A;  2XEF A;  2POK A;  2V8D A;  5CBM A;  3HLP A;  4X3R A;  4OP4 A;  3KZW A;  2IQ6 A;  3S9N A;  3K2K A;  2EK9 A;  3S9M A;  2O4H A;  5DS0 A;  5LYI A;  4W9Y A;  1YW6 A;  3KQX A;  2CF4 A;  4MCR A;  2O53 A;  3PB6 X;  3ISZ A;  1LFW A;  2PJ8 A;  3PB9 X;  4ZI6 A;  3H8E A;  2V77 A;  4JZ0 A;  2ZOF A;  2ZEG A;  1HDQ A;  2PJ7 A;  3DLJ A;  2NYQ A;  2C1C A;  4F8Z A;  2PRQ A;  2PJA A;  2ZED A;  4C8U A;  2C6G A;  3FJU A;  2PJ0 A;  3D66 A;  3NH5 A;  2JBJ A;  4C86 A;  3GLJ A;  4A37 A;  4C9E A;  4UIA A;  2V8H A;  5D29 A;  3D67 A;  1LAP A;  1VGY A;  1PYT B;  1AYE A;  5LYD A;  3PFO A;  2PCU A;  4C99 A;  4DJL A;  3GUX A;  4KNG E;  2BO9 A;  3KGQ A;  2PJ3 A;  3FEE A;  1LOK A;  3BXM A;  2XEI A;  1NSA A;  2GU2 A;  3LMS A;  5HVH A;  2GP4 A;  2EWB A;  3PEI A;  5CPA A;  3RBU A;  3PBB A;  3IIB A;  3KL9 A;  4P4F A;  5I4M A;  1ARM A;  3VH9 A;  5HVG A;  4MCP A;  1ZG8 A;  2FVG A;  4UEF A;  3WC6 A;  2C6P A;  2HC9 A;  4K3N A;  2AFZ A;  3IJ3 A;  2JBK A;  3KHZ A;  5D8N A;  3EIF A;  4NGQ A;  3PB7 X;  2ZEL A;  1Y0Y A;  4NGN A;  3WAB A;  1HEE A;  4EWT A;  4KSI A;  3VAT A;  2I3C A;  3H8G A;  1TKF A;  3IFE A;  4DUK A;  2J9A A;  2XEG A;  3B3W A;  1ELL P;  1XFO A;  3LWU A;  2RB7 A;  8CPA A;  4A39 A;  4P4D A;  3BHX A;  4C9A A;  3NH8 A;  4P4I A;  1ZLI A;  5LYF A;  4NFR A;  1IY7 A;  2GLJ A;  4CDK A;  3PBE A;  4UF4 A;  3KI9 A;  1QMU A;  4C84 A;  5K8O A;  3SJF A;  6CPA A;  3I74 A;  4FAI A;  4Q7A A;  3SJX A;  3NFZ A;  1F2P A;  4UIB A;  4WWV A;  3KHX A;  3CPX A;  3KR4 A;  4F9V A;  4RUH A;  3TX8 A;  4YN3 A;  3WT4 A;  1WVM A;  1YSJ A;  2AFS A;  2DEA A;  4C8F A;  3TC8 A;  3NA6 A;  1CBX A;  1Y7E A;  4IHM A;  1V6C A;  4CPA A;  2AFM A;  4TNU A;  4F9U A;  3I6S A;  4G1P A;  4NGM A;  2JEW A;  4OKO A;  4R6T A;  5LYL A;  3B2Y A;  1EE3 P;  3BI0 A;  2Q43 A;  4MMO A;  1FNO A;  1BAV A;  2QVP A;  1CP7 A;  4P6Y A;  2WZN A;  4R7M A;  2CTB A;  4B6Z A;  2PIY A;  4NGR A;  2ZEF A;  4OC0 A;  4IK2 A;  3B7I A;  1CPX A;  3MN8 A;  3V7Z A;  3ICU A;  1DE4 C;  4PXC A;  4H2K A;  4DYO A;  1UWY A;  4R8F A;  3N5F A;  1Z2L A;  4OC4 A;  3B3C A;  3BI1 A;  4P4E A;  3FED A;  3FEC A;  1ELM P;  4WJB A;  4C9R A;  2ZOG A;  1DTD A;  3ISX A;  3KQZ A;  4PXD A;  3WC7 A;  2PJ1 A;  4A38 A;  4R76 A;  1TXR A;  1TKH A;  2G9D A;  2AFW A;  5HXD A;  1R3N A;  2ABZ A;  2V8V A;  3B35 A;  4ZY1 A;  2PIZ A;  3MRU A;  4MHY A;  4MXU A;  4MCS A;  1AMP A;  1VHE A;  1CPS A;  3NH4 A;  4MHZ A;  3SI1 A;  1OBR A;  1HDU A;  1F2O A;  2PJB A;  4P10 A;  4P45 A;  1YME A;  1PCA A;  1XBU A;  4OIW A;  2OOT A;  4OC5 A;  2QYV A;  2PVV A;  2ZEE A;  2CTC A;  3D7G A;  4ZX9 A;  3FX6 A;  1VHO A;  4ONW A;  1ZG9 A;  5JGF A;  4ZY0 A;  2F8H A;  2EK8 A;  1M4L A;  4YU9 A;  1ZG7 A;  2C6C A;  4PXB A;  3D7H A;  1XMB A;  1Q7L A;  2IJZ A;  2ZEP A;  2OR4 A;  1BPN A;  5K8P A;  4IAV A;  4NGT A;  3S9L A;  4NJR A;  2PE3 A;  2ZEN A;  1XJO A;  1LCP A;  3RAM A;  4C9V A;  4ZY2 A;  1QQ9 A;  1TF9 A;  3QNV A;  3IC1 A;  1LAM A;  4OME A;  2AFX A;  2BOA A;  2PJC A;  3I1U A;  3B3V A;  2Q4Z A;  3V38 A;  3PB4 X;  4C8T A;  4NGP A;  5ELY A;  3CDX A;  4O23 A;  4BD9 A;  1VIX A;  2BCO A;  3KAS A;  1TF8 A;  5F09 A;  1RTQ A;  1JQG A;  4PPZ A;  3RZA A;  2C5Q A;  2PJ2 A;  5J1Q A;  1YLO A;  4JYW A;  3DGV A;  2HB6 A;  2PJ5 A;  5K8N A;  3JRU A;  2XEJ A;  5HVF A;  4LQG A;  4OC3 A;  1H8L A;  3D7D A;  3FMC A;  4X8I A;  1Z5R A;  1ZLH A;  3B3S A;  2AFU A;  1F57 A;  1YW4 A;  4FBE A;  2ZEH A;  4GM5 A;  1LAN A;  4OC2 A;  3B3T A;  3SI2 A;  2WYR A;  2GRE A;  5JM6 A;  1BPM A;  2GLF A;  1FT7 A;  4YWY A;  2ZEM A;  2PJ6 A;  3CT9 A;  1CP6 A;  3FF3 A;  2QJ8 A;  5LRK A;  3L2N A;  4C85 A;  5LRJ A;  1Y0R A;  4PQA A;  1KWM A;  3SJG A;  3K9T A;  5LRG A;  4OC1 A;  2PJ9 A;  3VAR A;  3IEH A;  1ARL A;  4FWU A;  4Z65 A;  4UEZ A;  3IWW A;  3SJE A;  3PRT A;  4TWE A;  5JH9 A;  1TKJ A;  1XF1 A;  4C8P A;  2RFH A;  3PB8 X;  4ZX8 A;  4CDJ A;  1CX8 A;  7CPA A;  3CPA A;  2ANP A;  4TJX A;  3FH4 A;  5IR2 A;  1IGB A;  3T8W A;  4C9U A;  4OID A;  4X2T A;  3D7F A;  2Q51 A;  3D68 A;  3GB0 A;  1Y9Z A;  4C8A A;  4ZYQ A;  3IO1 A;  4AXV A;  3H8F A;  4NGS A;  1R43 A;  4P4J A;  2NSM A;  4PXE A;  4P4B A;  3FVL A;  3VTA A;  4MCQ A;  3PFE A;  2CIJ A;  3KR5 A;  1XRY A;  2V8G A;  3SI0 A;  3HUV A;  4MHP A;  2AFO A;  4C8C A;  4FUU A;  2F7V A;  2VL1 A;  5THW A;  3WC5 A;  4EME A;  5K8M A;  1BLL E;  4P44 A;  4NJQ A;  4MHN A;  2ZEO A;  3D4U A;  2IMO A;  1CG2 A;  1GYT A;  4UEE A;  4A94 A;  4EFD A;  2PVW A;  1Z8L A;  5IB9 A;  4MRI A;  2PJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...