2JBJA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with 2-pmpa (2-phosphonomethyl-pentanedioic acid)
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
694
structure length
687
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human Glutamate Carboxypeptidase II Inhibition: Structures of Gcpii in Complex with Two Potent Inhibitors, Quisqualate and 2-Pmpa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
total genus 253
structure length 687
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2jbjA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2jbjA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2jbjA02
3FF3A 4FWUA 4OC1A 2J9AA 3KGQA 1LAMA 4TNUA 4YWYA 2PJ9A 4P4DA 2ZEPA 3SJGA 4OIWA 4PXEA 2PRQA 2V77A 3IWWA 3KHXA 3D4UA 3MRUA 4MMOA 4NJQA 4ZY0A 5LYFA 4MRIA 2ZEGA 3NH8A 3FEDA 4OC0A 3KL9A 2F7VA 2F8HA 4C9VA 2C6PA 1LFWA 1TKJA 3D67A 2NSMA 2EK8A 1LANA 2XEIA 1ZLIA 3D68A 3S9MA 3IFEA 3LMSA 1Q7LA 3FEEA 2O4HA 4P45A 2BOAA 3FECA 3PB9X 2V8DA 2ZENA 2ZELA 1BLLE 2C6GA 5HXDA 5J1QA 1RTQA 4GM5A 4P6YA 1XBUA 4F9UA 1ZG8A 2BCOA 5K8NA 4C99A 3BI1A 5JGFA 1CPXA 2PJ4A 1LOKA 1TF9A 2RB7A 4F8ZA 2JBKA 4MCRA 2PIZA 3NH5A 4MHNA 1ARMA 2AFOA 4PXDA 4JYWA 1HDQA 3D7FA 4JZ0A 4R6TA 4NGTA 4FUUA 2PJ0A 2JBJA 2V8HA 4NGMA 4P4JA 1F57A 4C84A 3RBUA 2PJAA 3S9LA 4UEFA 3PRTA 4MCQA 2G9DA 4EMEA 4NGPA 4TWEA 5LYIA 2CTCA 5LRKA 5THWA 1ARLA 2PE3A 2C6CA 1TKHA 3GUXA 4C9EA 1LCPA 3S9NA 4C86A 4C8AA 4G1PA 3GLJA 3HUVA 4AXVA 3N5FA 3IO1A 1BPMA 4PPZA 4P10A 1F2OA 4MXUA 1YLOA 4A39A 1QMUA 3SI0A 1VHOA 3KQXA 3PEIA 3KR5A 4IAVA 1Z5RA 3WC6A 2EK9A 4NGRA 1YMEA 4C85A 4NFRA 5HVHA 2CTBA 1ELMP 1OBRA 1FT7A 2JEWA 1XFOA 4ZY2A 4C8PA 4NGSA 4P4BA 4RUHA 3DLJA 2HC9A 3CT9A 4FBEA 2ZEEA 2Q4ZA 4YU9A 1IY7A 1WVMA 2C1CA 2PIYA 1AYEA 1Z2LA 3L2NA 1UWYA 4PXBA 5HVGA 4IK2A 1Y0RA 2CF4A 5CPAA 2GLFA 4NJRA 2PVVA 3PFOA 3PBBA 4B6ZA 1XJOA 4MHZA 3B3VA 3FH4A 2NYQA 3PB7X 5D29A 5LRGA 2V8VA 3KI9A 1TKFA 2AFMA 5DS0A 2BO9A 4CPAA 5ELYA 4ZI6A 4X8IA 2HB6A 3B3TA 3D7GA 4P44A 3IIBA 3LWUA 1YW4A 4W9YA 4ZX8A 1YSJA 2EWBA 2IMOA 5K8MA 3H8EA 2WYRA 2ZOGA 4OIDA 1BAVA 1CX8A 4BD9A 4X3RA 3CPAA 4UIAA 3B3CA 4OC4A 3KZWA 4KSIA 3BHXA 1LAPA 3I6SA 2ZEHA 2ZEMA 4NGQA 4C8TA 4C8FA 3SJXA 1M4LA 3WABA 5F09A 1VIXA 2PJ6A 4A37A 4C9UA 4EWTA 3NA6A 4R8FA 4EFDA 4NGNA 2GU2A 1NSAA 3T8WA 4WJBA 2PVWA 2ZEOA 4A38A 2ABZA 4MHPA 4UEEA 3TC8A 2PJCA 1CP7A 3ISZA 1TF8A 1Z8LA 4P4FA 3I1UA 3NFZA 3FVLA 2FVGA 3B7IA 4FAIA 4C9RA 4PQAA 2POKA 2IJZA 2Q51A 5K8PA 4OP4A 5IB9A 2OR4A 1ELLP 5I4MA 1PCAA 1XRYA 5HVFA 1CP6A 2ZEDA 1BPNA 8CPAA 3PB8X 5LYLA 1ZG7A 3I74A 4P4IA 3B35A 2V8GA 3HLPA 3IJ3A 4LQGA 4DUKA 1R3NA 3NH4A 2GLJA 1IGBA 1TXRA 4OMEA 4P4EA 3WC7A 2XEJA 4MCPA 4ZY1A 1XF1A 2Q43A 1CG2A 5LRJA 4R76A 3D7DA 3RAMA 3SI1A 4TJXA 1CBXA 2ZEFA 1V6CA 1DE4C 3SJEA 4TJVA 1AMPA 5JH9A 1ZG9A 3EIFA 2AFXA 3WT4A 5CBMA 1KWMA 2GREA 4OC5A 3PBEA 3B3SA 4Q7AA 3VTAA 1ZLHA 2QYVA 1GYTA 4DJLA 2RFHA 2I3CA 3H8FA 3BI0A 3IC1A 2AFZA 3FJUA 2AFSA 1YW6A 2AFWA 3V7ZA 4ZYQA 1R43A 3FX6A 5LYDA 4C9AA 3K2KA 3K9TA 4DYOA 3PB6X 1HEEA 4UIBA 3SI2A 4CDJA 4YN3A 4OC2A 3RZAA 2PJ1A 3SJFA 2ZOFA 4OC3A 2PJ8A 1Y0YA 3ICUA 2QVPA 3KQZA 4MCSA 7CPAA 4OKOA 2QJ8A 4ONWA 3CPXA 3D7HA 4K3NA 3KHZA 3BXMA 1DTDA 3JRUA 1CPSA 4ZX9A 2WZNA 2AFUA 2O53A 4PXCA 4C8CA 3WC5A 1VHEA 1Y9ZA 3B2YA 1JQGA 1XMBA 3TX8A 2PJ2A 1EE3P 2OOTA 2ANPA 4C8UA 1Y7EA 4R7MA 2PCUA 3FMCA 6CPAA 3QNVA 4MHYA 1H8LA 2VL1A 3KR4A 2PJBA 3GB0A 1QQ9A 5K8OA 4A94A 4UEZA 3DGVA 1FNOA 2PJ5A 2CIJA 4UF4A 3VH9A 3KASA 4X2TA 4F9VA 5JM6A 4H2KA 1VGYA 3D66A 1PYTB 2PJ7A 5D8NA 3ISXA 2XEGA 3PFEA 3PB4X 1HDUA 3H8GA 3IEHA 3VARA 4O23A 1F2PA 3V38A 4IHMA 4Z65A 2XEFA 4KNGE 2DEAA 4WWVA 2IQ6A 2PJ3A 3VATA 3MN8A 3B3WA 3CDXA 4CDKA
chains in the Genus database with same CATH superfamily
3JVNA 1A9XB 3IWEA 4MFJA 3FF3A 4FWUA 4NEXA 4AB7A 4OC1A 5HH1A 2J9AA 3KGQA 2B4JC 4JJXA 1LAMA 4TNUA 4EVYA 4YWYA 2PJ9A 4PK2A 5IV0A 5FD8A 4P4DA 2ZEPA 3SJGA 3BUXB 1GGOA 1IYKA 5F47A 4OIWA 5J8FA 5GCNA 1FY7A 4B5PA 4M3SA 4PXEA 1KC7A 2PRQA 2V77A 2YNEA 5CNPA 3IWWA 4XPLA 4CAFA 4QVTA 3R9GA 1FBVA 3D4UA 3KHXA 3MRUA 4MMOA 1X12A 4NJQA 3TOAA 4ZY0A 5LYFA 3BJ8A 3P2FA 4MRIA 4PSWA 2ZEGA 3NH8A 4B5OA 3FEDA 4OC0A 1XOVA 2ZW5A 3KL9A 4UCNA 1YGHA 4UWJA 3PZJA 2F7VA 4X5KA 1VKCA 4LX9A 2F8HA 3NFQA 3FXTA 4II9A 2HROA 1IIDA 2B4DB 2C6PA 5G1ZA 4C9VA 1YVHA 1LFWA 5AGEA 2B3UA 1V0CA 1TKJA 2UV8G 4BBHA 3GKRA 3H4QA 3D3SA 3I3GA 3D67A 2OB0A 2NSMA 1Y9KA 2EK8A 1LANA 2XEIA 1ZLIA 4COGA 3D68A 4COBA 3S9MA 4C8FA 4XPDC 3IFEA 3LMSA 2QECA 4MJXA 2XPOA 4XPDB 1Q7LA 5EMIA 3FEEA 2O28A 2O4HA 3DDDA 4P45A 2BOAA 3FECA 4MBUA 3SXOA 3ZZIA 3PB9X 4HKFA 2V8DA 2Z3MA 3V8IA 1KZFA 2YJTA 2ZENA 1PU9A 1Y7RA 2ZELA 2XPNA 2AJ6A 1S5KA 2FIWA 3FNCA 1BLLE 4NCZA 3R9FA 2EZBA 2C6GA 1NBWA 5HXDA 1IICA 1CJWA 3MGDA 1EZAA 5J1QA 4KVME 1RTQA 4GM5A 3NOJA 4P6YA 3FYNA 1XBUA 4F9UA 1Q2YA 3R9EA 4H6ZA 1ZG8A 2BCOA 3DR6A 1NSLA 5K8NA 2A4NA 5BY0A 1AUGA 2XPPA 3JTKA 1S7KA 4JXRA 3TLGA 4C99A 3BI1A 4CGPA 5JGFA 3R95A 1CPXA 1YX0A 2KCWA 2PJ4A 4CZ1A 2Z3PA 1LOKA 1TF9A 2RB7A 3SXNA 4F8ZA 2JBKA 4MCRA 3O8ZA 2PIZA 3GY9A 3NH5A 3TO7A 4A30A 4MHNA 1ARMA 2AFOA 2OU2A 3EY5A 4PXDA 4BPWB 4C2XA 4JYWA 1HDQA 3D7FA 4JZ0A 1Z8WA 2R98A 3EFAA 4MFPA 4MFZA 4NGTA 4R6TA 4FUUA 2PJ0A 4KORA 3EZEA 2Q0YA 2JBJA 2V8HA 4NGMA 2XPLA 1B87A 4P4JA 1F57A 5JVLA 4C84A 3RBUA 2PJAA 3S9LA 4UEFA 4A4CA 2I79A 3PRTA 5K99A 4EYSA 2Q04A 4MCQA 2YJVA 2FS5A 2G9DA 1OZPA 4EMEA 1ZO0A 4NGPA 4TWEA 5LYIA 2P6EA 4MJ8A 2CTCA 5C88A 5LRKA 5THWA 4BMHA 1ARLA 1YR0A 5J3XA 2K5TA 2PE3A 5EC4A 2C6CA 1TKHA 4LUAA 1NXJA 3GUXA 3TFYA 4C9EA 1J3LA 3VWEA 3FB3A 1LCPA 3S9NA 2N3AB 2D0PA 4IIXA 4C86A 3KRVA 4JWPA 4C8AA 4G1PA 3ZNIA 3VRRA 2VQYA 1Q2CA 3GLJA 3HUVA 4AXVA 3N5FA 3WR7A 4U5YA 2FXFA 3IO1A 4R3KA 1BPMA 1DIKA 1MK4A 4E8OA 4PPZA 4P10A 1CM0A 1F2OA 3GIUA 4MXUA 2OZUA 4BINA 2J8RA 4CS0B 1LRZA 1YLOA 4A39A 1BO4A 4KOUA 2EBJA 2VKZG 2OH1A 3W6XA 1QMUA 1NE9A 3SI0A 4HNWB 3TLCA 1VHOA 4MFKA 3T5MA 1UFHA 4XNHB 3KQXA 4FD7A 4KLWA 3PEIA 3KR5A 4IAVA 1Z5RA 3WC6A 1M4DA 3VRNA 4UFVA 2Z3OA 1Q2DA 2EK9A 2YNCA 4GS4A 4NGRA 3S6GA 1YMEA 3G3SA 4C2ZA 4QBJA 4C85A 2G0BA 4NFRA 4A95A 4IF5A 5HVHA 5HKZA 2JLMA 2CTBA 1ELMP 3QAYA 4KSAA 4KOXA 1OBRA 3OP0A 1FT7A 3ZJ0A 3PFVA 2OLSA 2JEWA 5H84A 2BUEA 3TLAA 4BPUB 1XFOA 4KOTA 4KS9A 4ZY2A 1XE4A 5FVJA 5AG7A 4NGSA 3RO0A 4C8PA 4Q38A 4JXQA 4HNXB 4P4BA 3VGOA 4UCMA 4RUHA 3DLJA 1Z4RA 2J8NA 2HC9A 2R1IA 4J3GA 3N7ZA 3CT9A 3UY5A 5AG6A 2ZEEA 4XPKA 4FBEA 2Q4ZA 1I12A 4B14A 1T36B 4YU9A 3TOBA 4PK3A 1IY7A 4H6UA 3HPHE 1WVMA 2C1CA 5KTCA 4YFJA 2DPTA 1AYEA 2PIYA 4KOWA 1Z2LA 3L2NA 1UWYA 2IL4A 4PXBA 4R9MA 4CYOA 5A27A 4IK2A 3BUNB 4NSQA 4A2ZA 5HVGA 4E2AA 5HKWA 1Y0RA 2FL4A 2GFQA 5E96A 1Z8XA 2BSWA 2CF4A 1VBHA 5CPAA 3T05A 2AUMA 2GLFA 4NJRA 2PVVA 2PC1A 2Z3NA 3PFOA 3BLNA 3OB1B 4OLLA 3PBBA 2OZHA 4KOYA 4CYPA 4F0XA 4B6ZA 1XJOA 4MHZA 1WJTA 2B5GA 2R7HA 3B3VA 3FH4A 4BPXB 2NYQA 3PB7X 5D29A 5LRGA 3R1KA 1VBGA 2V8VA 3F9KC 2FT0A 3CZXA 3PP9A 1ZRSA 3KI9A 2HWGA 1M4GA 1TKFA 2AFMA 3OWCA 2BO9A 5DS0A 4CPAA 5ELYA 3RYOA 3PGPA 2Z3KA 3VRQA 4A32A 3BUOB 2JDCA 5JQ4A 2R82A 4ZI6A 2EVNA 5F9MA 4X8IA 2HB6A 3D2PA 4M6HA 3B3TA 3D7GA 4P44A 2GIVA 3SR3A 1SQHA 3IIBA 3LWUA 1N71A 1QSRA 1YW4A 2YNCC 3F8KA 4MY0A 3CXSA 5IX3A 4W9YA 4ZX8A 2G3AA 4R3LA 1XIXA 4CGMA 1YSJA 2Q44A 2Q4YA 1M4IA 2EWBA 1BOBA 1L0CA 2REFA 2IMOA 4Y49C 3TO9A 1R61A 5K8MA 2C5QA 4E5SA 3H8EA 2WYRA 3QB8A 2ZOGA 5JPHA 4OIDA 1BAVA 1ZL0A 2ARHA 2GANA 2P6FA 1CX8A 4MI4A 1TIQA 2P0WA 4BD9A 4X3RA 3CPAA 4UIAA 2VBQA 4F6AA 4MI1A 5G21A 1EZBA 1M6VB 3B3CA 4OC4A 1IOIA 4CAVA 3KZWA 4KSIA 3K9UA 3K4IA 2EZCA 3BHXA 1LAPA 2BEIA 1A2ZA 3EZAA 3I6SA 2Q7SA 1MJ9A 3BJ7A 4FD4A 4AVAA 3PLFB 3TYXA 2Z0ZA 5C82A 2ZEHA 2ZEMA 5JYBA 2CNMA 4NGQA 1C30B 1B6BA 4QB9A 4BTFA 4C8TA 2ZPAA 2P6GA 3SJXA 1M4LA 4KOSA 5F09A 4UFXA 3WABA 1VIXA 2PJ6A 1IB1E 4A37A 4C9UA 4EWTA 3NA6A 4R8FA 2JEVA 4EFDA 2GE3A 4ZBGA 4NGNA 3HPGG 5G22A 4B10A 4HPSA 3NE7A 2ZXVA 2GU2A 1NSAA 5AG4A 1BXRB 3FBUA 1VHSA 1Q5XA 3T8WA 4WJBA 2PVWA 2C27A 4CAEA 4RR2B 2ZEOA 4A38A 1QSMA 4M6GA 2ABZA 4MHPA 4UEEA 3TC8A 2PJCA 1CP7A 2OZGA 3ISZA 1I1DA 2AE6A 4UCPA 5EBVA 1TF8A 3H5ZA 4ONUA 4AG7A 1Z8LA 1S7NA 4P4FA 3HMJG 1IU8A 3I1UA 3NFZA 1YLEA 3FVLA 3VWDA 3GYAA 1YQEA 4U9ZA 1JWQA 3BUWB 2RC4A 2FVGA 2QIRA 2VEZA 4JLYA 4K30A 2B5GB 1S7LA 3G8WA 3R96A 2HI6A 3B7IA 2HV2A 4FAIA 4UA3A 4C9RA 4PQAA 3JUWA 5KTAA 2ZW7A 4L8AA 2POKA 4R87A 4DNCA 1YVOA 4PSXA 1I21A 2IJZA 4INJA 2Q51A 5K8PA 4OP4A 2DLAA 4CGLA 4NXYA 2CBLA 2OR4A 1ELLP 2VZYA 4QUSA 2CNTA 4YGOA 5I4MA 1PCAA 2I00A 2Q4VA 3TE4A 2B4DA 1XRYA 5HVFA 1CP6A 2ZEDA 2D4PA 1BPNA 8CPAA 3PT1A 4CYNA 2PR1A 3PB8X 5BWAB 2D0OA 5LYLA 2X0SA 5IB9A 3TLEA 2REEA 4KZTA 3IWGA 4KUBA 1ZG7A 3I74A 4P4IA 3B35A 5AG5A 1MJAA 5F1YA 1KUYA 2V8GA 5H86A 3HLPA 3IJ3A 4LQGA 3EXNA 2B4BA 4A31A 2DPSA 3TCVA 4QC6A 1GHEA 4DUKA 4AG9A 3TLYA 1R3NA 4CAXA 3NH4A 2GLJA 2D4OA 4JD6A 4F0YA 1IYLA 4C7IA 2H5MA 1IGBA 1TXRA 5G20A 1X10A 4OMEA 4P4EA 5HKYA 4FD6A 3LODA 2XEJA 3A9LA 4KVOE 4MCPA 3S6FA 3WC7A 2ATRA 4LQ6A 4UBRA 1Y9WA 4B11A 4ZY1A 2Q43A 1XF1A 2DIKA 3CXQA 1CG2A 5LRJA 2PDOA 4KVXA 4R76A 4CGNA 3D7DA 1QSTA 3RAMA 3SI1A 4TJXA 1CBXA 1MJBA 2ODFA 2Y1NA 5F5XA 2ZEFA 2ZW6A 1V6CA 3TLZA 4OAEA 3LACA 2WPXA 4C2YA 2PCNA 1DE4C 5F49A 3S6HA 3SJEA 3I9SA 3C26A 4Q36A 2EUIA 3LD2A 4TJVA 1AMPA 2PR8A 2VXKA 3IGRA 3T90A 5JH9A 1ZG9A 2EZAA 4B12A 3EIFA 2AFXA 3WT4A 3GJZA 4AVBA 1KWMA 5CBMA 2GREA 1KEEB 4OC5A 2X7BA 2Y0MA 3D2MA 3PBEA 4GPLB 3B3SA 4Q7AA 2AUNA 1ZLHA 3VTAA 3KKWA 2QYVA 1CS0B 2PSWA 1GYTA 4DJLA 1VI4A 2RFHA 2I3CA 3H8FA 4RN7A 3BI0A 3IC1A 2DF5A 4UWIA 3U88C 4MFLA 3CXPA 2B58A 5ISVA 4KUAA 2AFZA 5HMNA 4CRZB 3F5BA 3TLGB 3FJUA 2AFSA 3TT2A 1JDEA 1YW6A 2AFWA 1QSOA 1YVKA 3SHPA 3V7ZA 4ZYQA 1R43A 3FX6A 4RS2A 4Y49B 3EC4A 5LYDA 4H89A 3DSBA 4H1HA 2HQYA 3K2KA 4C9AA 3OB2B 2HUZA 4AVCA 4YRHA 2DXQA 3K9TA 3T9YA 3PB6X 4DYOA 2R8VA 4IUSA 3TTHA 1HEEA 4UIBA 3SI2A 4IIYA 5DWMA 1Z9UA 4GXHA 5IR2A 2CNSA 4C68A 3TO6A 4YN3A 3TLBA 4CDJA 4OC2A 1IOFA 3RZAA 2PJ1A 3QAHA 3SJFA 2ZOFA 4PV6A 2B3VA 3T07A 1WWZA 1JDBC 2B0AA 4OC3A 1RO5A 2ZW4A 1XEBA 2PJ8A 1KUXA 3NE8A 1Y0YA 2J8MA 3W91A 3ICUA 3U1BA 2QVPA 3VROA 4M8DA 3KQZA 4MCSA 4MHDA 7CPAA 1R57A 3EO4A 4OKOA 2QJ8A 4MY3A 4ONWA 2FM4A 2VI7A 3CPXA 3D7HA 4K3NA 3KHZA 3BXMA 1DTDA 3JRUA 1CPSA 2F5IA 4C7HA 1B47A 2WSAA 4ZX9A 2WZNA 2CY2A 1WK4A 4XNHC 3S6KA 1C3OB 2AFUA 2O53A 3G23A 4PXCA 1Z8TA 2NMTA 4C8CA 1YREA 3WC5A 1VHEA 2QMLA 1Y9ZA 3F0AA 2Z3LA 3B2YA 4E94A 1KUVA 4U9YA 1JQGA 4KOVA 5F46A 1XMBA 3TX8A 1J4JA 4I49A 4CO9A 2PJ2A 4R57A 1K4JA 1KBLA 1EE3P 2OOTA 1P0HA 1PUAA 2ANPA 2FCKA 3DNSA 4C8UA 1Y7EA 3E0KA 4R7MA 2PCUA 1M1DA 4M85A 4UFWA 4ZGYB 2PQ8A 1Z9EA 3FMCA 2E28A 6CPAA 4J0NA 2BL1A 3QNVA 4MHYA 2WUUA 1H8LA 2GP4A 2VL1A 1S60A 3KR4A 2PJBA 3GB0A 1QQ9A 4CGOA 2FSRA 5K8OA 2Y1MA 3VRPA 4A94A 2YGWA 4UEZA 3DGVA 1FNOA 2PJ5A 3FRMA 2CIJA 1S7FA 4A33A 4HNYB 4CRYB 4UF4A 2FIAA 1Z4EA 5F48A 3VH9A 3KASA 2EO8A 3RNZA 5AXIA 4M6IA 4CAWA 4E0AA 5J8CA 2CXAA 5KTDA 1YK3A 4X2TA 1ZYMA 4KSFA 4MFQA 4F9VA 5JM6A 3OAKA 1P4NA 2VZZA 2YNDA 1VGYA 3D66A 4FD5A 4H2KA 4B13A 1M44A 5IB0A 1PYTB 1QSNA 2PJ7A 5D8NA 3EZBA 3DR8A 3IU2A 2Z11A 4A4BA 2WPWA 2XEGA 3ISXA 4NF1A 3BUMB 1RXTA 2JDDA 2PRBA 3PFEA 3PB4X 1HDUA 1ON0A 3H8GA 3IEHA 3IU1A 2Q7BA 3P2HA 3VARA 4B5PB 5A28A 1EO0A 2Z10A 1XMTA 4CYQA 4O23A 1F2PA 2G3TA 1CE8B 1NMTA 3B8GA 4IHMA 2FE7A 4ORFA 3V38A 5I0CA 4Z65A 4JVOA 1S3ZA 1XF8A 3W6SA 3FIXA 5DWNA 2XEFA 4KNGE 5F13A 2DEAA 4WWVA 2MP0A 2IQ6A 2PJ3A 1U6MA 4RI1A 3T0TA 3C8OA 3VATA 3MN8A 4KLVA 4OADA 3B3WA 3CDXA 3D8PA 4L89A 4CDKA
chains in the Genus database with same CATH topology
3FF3A 4FWUA 4OC1A 2J9AA 3KGQA 1LAMA 4TNUA 4YWYA 2PJ9A 4P4DA 2ZEPA 3SJGA 4OIWA 4PXEA 2PRQA 2V77A 3IWWA 3KHXA 3D4UA 3MRUA 4MMOA 4NJQA 4ZY0A 5LYFA 4MRIA 2ZEGA 3NH8A 3FEDA 4OC0A 3KL9A 2F7VA 2F8HA 4C9VA 2C6PA 1LFWA 1TKJA 3D67A 2NSMA 2EK8A 1LANA 2XEIA 1ZLIA 3D68A 3S9MA 3IFEA 3LMSA 1Q7LA 3FEEA 2O4HA 4P45A 2BOAA 3FECA 3PB9X 2V8DA 2ZENA 2ZELA 1BLLE 2C6GA 5HXDA 5J1QA 1RTQA 4GM5A 4P6YA 1XBUA 4F9UA 1ZG8A 2BCOA 5K8NA 4C99A 3BI1A 5JGFA 1CPXA 2PJ4A 1LOKA 1TF9A 2RB7A 4F8ZA 2JBKA 4MCRA 2PIZA 3NH5A 4MHNA 1ARMA 2AFOA 4PXDA 4JYWA 1HDQA 3D7FA 4JZ0A 4R6TA 4NGTA 4FUUA 2PJ0A 2JBJA 2V8HA 4NGMA 4P4JA 1F57A 4C84A 3RBUA 2PJAA 3S9LA 4UEFA 3PRTA 4MCQA 2G9DA 4EMEA 4NGPA 4TWEA 5LYIA 2CTCA 5LRKA 5THWA 1ARLA 2PE3A 2C6CA 1TKHA 3GUXA 4C9EA 1LCPA 3S9NA 4C86A 4C8AA 4G1PA 3GLJA 3HUVA 4AXVA 3N5FA 3IO1A 1BPMA 4PPZA 4P10A 1F2OA 4MXUA 1YLOA 4A39A 1QMUA 3SI0A 1VHOA 3KQXA 3PEIA 3KR5A 4IAVA 1Z5RA 3WC6A 2EK9A 4NGRA 1YMEA 4C85A 4NFRA 5HVHA 2CTBA 1ELMP 1OBRA 1FT7A 2JEWA 1XFOA 4ZY2A 4C8PA 4NGSA 4P4BA 4RUHA 3DLJA 2HC9A 3CT9A 4FBEA 2ZEEA 2Q4ZA 4YU9A 1IY7A 1WVMA 2C1CA 2PIYA 1AYEA 1Z2LA 3L2NA 1UWYA 4PXBA 5HVGA 4IK2A 1Y0RA 2CF4A 5CPAA 2GLFA 4NJRA 2PVVA 3PFOA 3PBBA 4B6ZA 1XJOA 4MHZA 3B3VA 3FH4A 2NYQA 3PB7X 5D29A 5LRGA 2V8VA 3KI9A 1TKFA 2AFMA 5DS0A 2BO9A 4CPAA 5ELYA 4ZI6A 4X8IA 2HB6A 3B3TA 3D7GA 4P44A 3IIBA 3LWUA 1YW4A 4W9YA 4ZX8A 1YSJA 2EWBA 2IMOA 5K8MA 2C5QA 3H8EA 2WYRA 2ZOGA 4OIDA 1BAVA 1CX8A 4BD9A 4X3RA 3CPAA 4UIAA 3B3CA 4OC4A 3KZWA 4KSIA 3BHXA 1LAPA 3I6SA 2ZEHA 2ZEMA 4NGQA 4C8TA 4C8FA 3SJXA 1M4LA 3WABA 5F09A 1VIXA 2PJ6A 4A37A 4C9UA 4EWTA 3NA6A 4R8FA 4EFDA 4NGNA 2GU2A 1NSAA 3T8WA 4WJBA 2PVWA 2ZEOA 4A38A 2ABZA 4MHPA 4UEEA 3TC8A 2PJCA 1CP7A 3ISZA 1TF8A 1Z8LA 4P4FA 3I1UA 3NFZA 3FVLA 2FVGA 3B7IA 4FAIA 4C9RA 4PQAA 2POKA 2IJZA 2Q51A 5K8PA 4OP4A 5IB9A 2OR4A 1ELLP 5I4MA 1PCAA 1XRYA 5HVFA 1CP6A 2ZEDA 1BPNA 8CPAA 3PB8X 5LYLA 1ZG7A 3I74A 4P4IA 3B35A 2V8GA 3HLPA 3IJ3A 4LQGA 4DUKA 1R3NA 3NH4A 2GLJA 1IGBA 1TXRA 4OMEA 4P4EA 3WC7A 2XEJA 4MCPA 4ZY1A 1XF1A 2Q43A 1CG2A 5LRJA 4R76A 3D7DA 3RAMA 3SI1A 4TJXA 1CBXA 2ZEFA 1V6CA 1DE4C 3SJEA 4TJVA 1AMPA 5JH9A 1ZG9A 3EIFA 2AFXA 3WT4A 5CBMA 1KWMA 2GREA 4OC5A 3PBEA 3B3SA 4Q7AA 3VTAA 1ZLHA 2QYVA 1GYTA 4DJLA 2RFHA 2I3CA 3H8FA 3BI0A 3IC1A 2AFZA 3FJUA 2AFSA 1YW6A 2AFWA 3V7ZA 4ZYQA 1R43A 3FX6A 5LYDA 4C9AA 3K2KA 3K9TA 4DYOA 3PB6X 1HEEA 4UIBA 3SI2A 5IR2A 4CDJA 4YN3A 4OC2A 3RZAA 2PJ1A 3SJFA 2ZOFA 4OC3A 2PJ8A 1Y0YA 3ICUA 2QVPA 3KQZA 4MCSA 7CPAA 4OKOA 2QJ8A 4ONWA 3CPXA 3D7HA 4K3NA 3KHZA 3BXMA 1DTDA 3JRUA 1CPSA 4ZX9A 2WZNA 2AFUA 2O53A 4PXCA 4C8CA 3WC5A 1VHEA 1Y9ZA 3B2YA 1JQGA 1XMBA 3TX8A 2PJ2A 1EE3P 2OOTA 2ANPA 4C8UA 1Y7EA 4R7MA 2PCUA 3FMCA 6CPAA 3QNVA 4MHYA 2GP4A 1H8LA 2VL1A 3KR4A 2PJBA 3GB0A 1QQ9A 5K8OA 4A94A 4UEZA 3DGVA 1FNOA 2PJ5A 2CIJA 4UF4A 3VH9A 3KASA 4X2TA 4F9VA 5JM6A 4H2KA 1VGYA 3D66A 1PYTB 2PJ7A 5D8NA 3ISXA 2XEGA 3PFEA 3PB4X 1HDUA 3H8GA 3IEHA 3VARA 4O23A 1F2PA 3V38A 4IHMA 4Z65A 2XEFA 4KNGE 2DEAA 4WWVA 2IQ6A 2PJ3A 3VATA 3MN8A 3B3WA 3CDXA 4CDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF3 A;  4FWU A;  4OC1 A;  2J9A A;  3KGQ A;  1LAM A;  4TNU A;  4YWY A;  2PJ9 A;  4P4D A;  2ZEP A;  3SJG A;  4OIW A;  4PXE A;  2PRQ A;  2V77 A;  3IWW A;  3KHX A;  3D4U A;  3MRU A;  4MMO A;  4NJQ A;  4ZY0 A;  5LYF A;  4MRI A;  2ZEG A;  3NH8 A;  3FED A;  4OC0 A;  3KL9 A;  2F7V A;  2F8H A;  4C9V A;  2C6P A;  1LFW A;  1TKJ A;  3D67 A;  2NSM A;  2EK8 A;  1LAN A;  2XEI A;  1ZLI A;  3D68 A;  3S9M A;  3IFE A;  3LMS A;  1Q7L A;  3FEE A;  2O4H A;  4P45 A;  2BOA A;  3FEC A;  3PB9 X;  2V8D A;  2ZEN A;  2ZEL A;  1BLL E;  2C6G A;  5HXD A;  5J1Q A;  1RTQ A;  4GM5 A;  4P6Y A;  1XBU A;  4F9U A;  1ZG8 A;  2BCO A;  5K8N A;  4C99 A;  3BI1 A;  5JGF A;  1CPX A;  2PJ4 A;  1LOK A;  1TF9 A;  2RB7 A;  4F8Z A;  2JBK A;  4MCR A;  2PIZ A;  3NH5 A;  4MHN A;  1ARM A;  2AFO A;  4PXD A;  4JYW A;  1HDQ A;  3D7F A;  4JZ0 A;  4R6T A;  4NGT A;  4FUU A;  2PJ0 A;  2JBJ A;  2V8H A;  4NGM A;  4P4J A;  1F57 A;  4C84 A;  3RBU A;  2PJA A;  3S9L A;  4UEF A;  3PRT A;  4MCQ A;  2G9D A;  4EME A;  4NGP A;  4TWE A;  5LYI A;  2CTC A;  5LRK A;  5THW A;  1ARL A;  2PE3 A;  2C6C A;  1TKH A;  3GUX A;  4C9E A;  1LCP A;  3S9N A;  4C86 A;  4C8A A;  4G1P A;  3GLJ A;  3HUV A;  4AXV A;  3N5F A;  3IO1 A;  1BPM A;  4PPZ A;  4P10 A;  1F2O A;  4MXU A;  1YLO A;  4A39 A;  1QMU A;  3SI0 A;  1VHO A;  3KQX A;  3PEI A;  3KR5 A;  4IAV A;  1Z5R A;  3WC6 A;  2EK9 A;  4NGR A;  1YME A;  4C85 A;  4NFR A;  5HVH A;  2CTB A;  1ELM P;  1OBR A;  1FT7 A;  2JEW A;  1XFO A;  4ZY2 A;  4C8P A;  4NGS A;  4P4B A;  4RUH A;  3DLJ A;  2HC9 A;  3CT9 A;  4FBE A;  2ZEE A;  2Q4Z A;  4YU9 A;  1IY7 A;  1WVM A;  2C1C A;  2PIY A;  1AYE A;  1Z2L A;  3L2N A;  1UWY A;  4PXB A;  5HVG A;  4IK2 A;  1Y0R A;  2CF4 A;  5CPA A;  2GLF A;  4NJR A;  2PVV A;  3PFO A;  3PBB A;  4B6Z A;  1XJO A;  4MHZ A;  3B3V A;  3FH4 A;  2NYQ A;  3PB7 X;  5D29 A;  5LRG A;  2V8V A;  3KI9 A;  1TKF A;  2AFM A;  5DS0 A;  2BO9 A;  4CPA A;  5ELY A;  4ZI6 A;  4X8I A;  2HB6 A;  3B3T A;  3D7G A;  4P44 A;  3IIB A;  3LWU A;  1YW4 A;  4W9Y A;  4ZX8 A;  1YSJ A;  2EWB A;  2IMO A;  5K8M A;  3H8E A;  2WYR A;  2ZOG A;  4OID A;  1BAV A;  1CX8 A;  4BD9 A;  4X3R A;  3CPA A;  4UIA A;  3B3C A;  4OC4 A;  3KZW A;  4KSI A;  3BHX A;  1LAP A;  3I6S A;  2ZEH A;  2ZEM A;  4NGQ A;  4C8T A;  4C8F A;  3SJX A;  1M4L A;  3WAB A;  5F09 A;  1VIX A;  2PJ6 A;  4A37 A;  4C9U A;  4EWT A;  3NA6 A;  4R8F A;  4EFD A;  4NGN A;  2GU2 A;  1NSA A;  3T8W A;  4WJB A;  2PVW A;  2ZEO A;  4A38 A;  2ABZ A;  4MHP A;  4UEE A;  3TC8 A;  2PJC A;  1CP7 A;  3ISZ A;  1TF8 A;  1Z8L A;  4P4F A;  3I1U A;  3NFZ A;  3FVL A;  2FVG A;  3B7I A;  4FAI A;  4C9R A;  4PQA A;  2POK A;  2IJZ A;  2Q51 A;  5K8P A;  4OP4 A;  5IB9 A;  2OR4 A;  1ELL P;  5I4M A;  1PCA A;  1XRY A;  5HVF A;  1CP6 A;  2ZED A;  1BPN A;  8CPA A;  3PB8 X;  5LYL A;  1ZG7 A;  3I74 A;  4P4I A;  3B35 A;  2V8G A;  3HLP A;  3IJ3 A;  4LQG A;  4DUK A;  1R3N A;  3NH4 A;  2GLJ A;  1IGB A;  1TXR A;  4OME A;  4P4E A;  3WC7 A;  2XEJ A;  4MCP A;  4ZY1 A;  1XF1 A;  2Q43 A;  1CG2 A;  5LRJ A;  4R76 A;  3D7D A;  3RAM A;  3SI1 A;  4TJX A;  1CBX A;  2ZEF A;  1V6C A;  1DE4 C;  3SJE A;  4TJV A;  1AMP A;  5JH9 A;  1ZG9 A;  3EIF A;  2AFX A;  3WT4 A;  5CBM A;  1KWM A;  2GRE A;  4OC5 A;  3PBE A;  3B3S A;  4Q7A A;  3VTA A;  1ZLH A;  2QYV A;  1GYT A;  4DJL A;  2RFH A;  2I3C A;  3H8F A;  3BI0 A;  3IC1 A;  2AFZ A;  3FJU A;  2AFS A;  1YW6 A;  2AFW A;  3V7Z A;  4ZYQ A;  1R43 A;  3FX6 A;  5LYD A;  4C9A A;  3K2K A;  3K9T A;  4DYO A;  3PB6 X;  1HEE A;  4UIB A;  3SI2 A;  4CDJ A;  4YN3 A;  4OC2 A;  3RZA A;  2PJ1 A;  3SJF A;  2ZOF A;  4OC3 A;  2PJ8 A;  1Y0Y A;  3ICU A;  2QVP A;  3KQZ A;  4MCS A;  7CPA A;  4OKO A;  2QJ8 A;  4ONW A;  3CPX A;  3D7H A;  4K3N A;  3KHZ A;  3BXM A;  1DTD A;  3JRU A;  1CPS A;  4ZX9 A;  2WZN A;  2AFU A;  2O53 A;  4PXC A;  4C8C A;  3WC5 A;  1VHE A;  1Y9Z A;  3B2Y A;  1JQG A;  1XMB A;  3TX8 A;  2PJ2 A;  1EE3 P;  2OOT A;  2ANP A;  4C8U A;  1Y7E A;  4R7M A;  2PCU A;  3FMC A;  6CPA A;  3QNV A;  4MHY A;  1H8L A;  2VL1 A;  3KR4 A;  2PJB A;  3GB0 A;  1QQ9 A;  5K8O A;  4A94 A;  4UEZ A;  3DGV A;  1FNO A;  2PJ5 A;  2CIJ A;  4UF4 A;  3VH9 A;  3KAS A;  4X2T A;  4F9V A;  5JM6 A;  4H2K A;  1VGY A;  3D66 A;  1PYT B;  2PJ7 A;  5D8N A;  3ISX A;  2XEG A;  3PFE A;  3PB4 X;  1HDU A;  3H8G A;  3IEH A;  3VAR A;  4O23 A;  1F2P A;  3V38 A;  4IHM A;  4Z65 A;  2XEF A;  4KNG E;  2DEA A;  4WWV A;  2IQ6 A;  2PJ3 A;  3VAT A;  3MN8 A;  3B3W A;  3CDX A;  4CDK A; 
#chains in the Genus database with same CATH topology
 3JVN A;  1A9X B;  3IWE A;  4MFJ A;  3FF3 A;  4FWU A;  4NEX A;  4AB7 A;  4OC1 A;  5HH1 A;  2J9A A;  3KGQ A;  2B4J C;  4JJX A;  1LAM A;  4TNU A;  4EVY A;  4YWY A;  2PJ9 A;  4PK2 A;  5IV0 A;  5FD8 A;  4P4D A;  2ZEP A;  3SJG A;  3BUX B;  1GGO A;  1IYK A;  5F47 A;  4OIW A;  5J8F A;  5GCN A;  1FY7 A;  4B5P A;  4M3S A;  4PXE A;  1KC7 A;  2PRQ A;  2V77 A;  2YNE A;  5CNP A;  3IWW A;  4XPL A;  4CAF A;  4QVT A;  3R9G A;  1FBV A;  3D4U A;  3KHX A;  3MRU A;  4MMO A;  1X12 A;  4NJQ A;  3TOA A;  4ZY0 A;  5LYF A;  3BJ8 A;  3P2F A;  4MRI A;  4PSW A;  2ZEG A;  3NH8 A;  4B5O A;  3FED A;  4OC0 A;  1XOV A;  2ZW5 A;  3KL9 A;  4UCN A;  1YGH A;  4UWJ A;  3PZJ A;  2F7V A;  4X5K A;  1VKC A;  4LX9 A;  2F8H A;  3NFQ A;  3FXT A;  4II9 A;  2HRO A;  1IID A;  2B4D B;  2C6P A;  5G1Z A;  4C9V A;  1YVH A;  1LFW A;  5AGE A;  2B3U A;  1V0C A;  1TKJ A;  2UV8 G;  4BBH A;  3GKR A;  3H4Q A;  3D3S A;  3I3G A;  3D67 A;  2OB0 A;  2NSM A;  1Y9K A;  2EK8 A;  1LAN A;  2XEI A;  1ZLI A;  4COG A;  3D68 A;  4COB A;  3S9M A;  4C8F A;  4XPD C;  3IFE A;  3LMS A;  2QEC A;  4MJX A;  2XPO A;  4XPD B;  1Q7L A;  5EMI A;  3FEE A;  2O28 A;  2O4H A;  3DDD A;  4P45 A;  2BOA A;  3FEC A;  4MBU A;  3SXO A;  3ZZI A;  3PB9 X;  4HKF A;  2V8D A;  2Z3M A;  3V8I A;  1KZF A;  2YJT A;  2ZEN A;  1PU9 A;  1Y7R A;  2ZEL A;  2XPN A;  2AJ6 A;  1S5K A;  2FIW A;  3FNC A;  1BLL E;  4NCZ A;  3R9F A;  2EZB A;  2C6G A;  1NBW A;  5HXD A;  1IIC A;  1CJW A;  3MGD A;  1EZA A;  5J1Q A;  4KVM E;  1RTQ A;  4GM5 A;  3NOJ A;  4P6Y A;  3FYN A;  1XBU A;  4F9U A;  1Q2Y A;  3R9E A;  4H6Z A;  1ZG8 A;  2BCO A;  3DR6 A;  1NSL A;  5K8N A;  2A4N A;  5BY0 A;  1AUG A;  2XPP A;  3JTK A;  1S7K A;  4JXR A;  3TLG A;  4C99 A;  3BI1 A;  4CGP A;  5JGF A;  3R95 A;  1CPX A;  1YX0 A;  2KCW A;  2PJ4 A;  4CZ1 A;  2Z3P A;  1LOK A;  1TF9 A;  2RB7 A;  3SXN A;  4F8Z A;  2JBK A;  4MCR A;  3O8Z A;  2PIZ A;  3GY9 A;  3NH5 A;  3TO7 A;  4A30 A;  4MHN A;  1ARM A;  2AFO A;  2OU2 A;  3EY5 A;  4PXD A;  4BPW B;  4C2X A;  4JYW A;  1HDQ A;  3D7F A;  4JZ0 A;  1Z8W A;  2R98 A;  3EFA A;  4MFP A;  4MFZ A;  4NGT A;  4R6T A;  4FUU A;  2PJ0 A;  4KOR A;  3EZE A;  2Q0Y A;  2JBJ A;  2V8H A;  4NGM A;  2XPL A;  1B87 A;  4P4J A;  1F57 A;  5JVL A;  4C84 A;  3RBU A;  2PJA A;  3S9L A;  4UEF A;  4A4C A;  2I79 A;  3PRT A;  5K99 A;  4EYS A;  2Q04 A;  4MCQ A;  2YJV A;  2FS5 A;  2G9D A;  1OZP A;  4EME A;  1ZO0 A;  4NGP A;  4TWE A;  5LYI A;  2P6E A;  4MJ8 A;  2CTC A;  5C88 A;  5LRK A;  5THW A;  4BMH A;  1ARL A;  1YR0 A;  5J3X A;  2K5T A;  2PE3 A;  5EC4 A;  2C6C A;  1TKH A;  4LUA A;  1NXJ A;  3GUX A;  3TFY A;  4C9E A;  1J3L A;  3VWE A;  3FB3 A;  1LCP A;  3S9N A;  2N3A B;  2D0P A;  4IIX A;  4C86 A;  3KRV A;  4JWP A;  4C8A A;  4G1P A;  3ZNI A;  3VRR A;  2VQY A;  1Q2C A;  3GLJ A;  3HUV A;  4AXV A;  3N5F A;  3WR7 A;  4U5Y A;  2FXF A;  3IO1 A;  4R3K A;  1BPM A;  1DIK A;  1MK4 A;  4E8O A;  4PPZ A;  4P10 A;  1CM0 A;  1F2O A;  3GIU A;  4MXU A;  2OZU A;  4BIN A;  2J8R A;  4CS0 B;  1LRZ A;  1YLO A;  4A39 A;  1BO4 A;  4KOU A;  2EBJ A;  2VKZ G;  2OH1 A;  3W6X A;  1QMU A;  1NE9 A;  3SI0 A;  4HNW B;  3TLC A;  1VHO A;  4MFK A;  3T5M A;  1UFH A;  4XNH B;  3KQX A;  4FD7 A;  4KLW A;  3PEI A;  3KR5 A;  4IAV A;  1Z5R A;  3WC6 A;  1M4D A;  3VRN A;  4UFV A;  2Z3O A;  1Q2D A;  2EK9 A;  2YNC A;  4GS4 A;  4NGR A;  3S6G A;  1YME A;  3G3S A;  4C2Z A;  4QBJ A;  4C85 A;  2G0B A;  4NFR A;  4A95 A;  4IF5 A;  5HVH A;  5HKZ A;  2JLM A;  2CTB A;  1ELM P;  3QAY A;  4KSA A;  4KOX A;  1OBR A;  3OP0 A;  1FT7 A;  3ZJ0 A;  3PFV A;  2OLS A;  2JEW A;  5H84 A;  2BUE A;  3TLA A;  4BPU B;  1XFO A;  4KOT A;  4KS9 A;  4ZY2 A;  1XE4 A;  5FVJ A;  5AG7 A;  4NGS A;  3RO0 A;  4C8P A;  4Q38 A;  4JXQ A;  4HNX B;  4P4B A;  3VGO A;  4UCM A;  4RUH A;  3DLJ A;  1Z4R A;  2J8N A;  2HC9 A;  2R1I A;  4J3G A;  3N7Z A;  3CT9 A;  3UY5 A;  5AG6 A;  2ZEE A;  4XPK A;  4FBE A;  2Q4Z A;  1I12 A;  4B14 A;  1T36 B;  4YU9 A;  3TOB A;  4PK3 A;  1IY7 A;  4H6U A;  3HPH E;  1WVM A;  2C1C A;  5KTC A;  4YFJ A;  2DPT A;  1AYE A;  2PIY A;  4KOW A;  1Z2L A;  3L2N A;  1UWY A;  2IL4 A;  4PXB A;  4R9M A;  4CYO A;  5A27 A;  4IK2 A;  3BUN B;  4NSQ A;  4A2Z A;  5HVG A;  4E2A A;  5HKW A;  1Y0R A;  2FL4 A;  2GFQ A;  5E96 A;  1Z8X A;  2BSW A;  2CF4 A;  1VBH A;  5CPA A;  3T05 A;  2AUM A;  2GLF A;  4NJR A;  2PVV A;  2PC1 A;  2Z3N A;  3PFO A;  3BLN A;  3OB1 B;  4OLL A;  3PBB A;  2OZH A;  4KOY A;  4CYP A;  4F0X A;  4B6Z A;  1XJO A;  4MHZ A;  1WJT A;  2B5G A;  2R7H A;  3B3V A;  3FH4 A;  4BPX B;  2NYQ A;  3PB7 X;  5D29 A;  5LRG A;  3R1K A;  1VBG A;  2V8V A;  3F9K C;  2FT0 A;  3CZX A;  3PP9 A;  1ZRS A;  3KI9 A;  2HWG A;  1M4G A;  1TKF A;  2AFM A;  3OWC A;  2BO9 A;  5DS0 A;  4CPA A;  5ELY A;  3RYO A;  3PGP A;  2Z3K A;  3VRQ A;  4A32 A;  3BUO B;  2JDC A;  5JQ4 A;  2R82 A;  4ZI6 A;  2EVN A;  5F9M A;  4X8I A;  2HB6 A;  3D2P A;  4M6H A;  3B3T A;  3D7G A;  4P44 A;  2GIV A;  3SR3 A;  1SQH A;  3IIB A;  3LWU A;  1N71 A;  1QSR A;  1YW4 A;  2YNC C;  3F8K A;  4MY0 A;  3CXS A;  5IX3 A;  4W9Y A;  4ZX8 A;  2G3A A;  4R3L A;  1XIX A;  4CGM A;  1YSJ A;  2Q44 A;  2Q4Y A;  1M4I A;  2EWB A;  1BOB A;  1L0C A;  2REF A;  2IMO A;  4Y49 C;  3TO9 A;  1R61 A;  5K8M A;  2C5Q A;  4E5S A;  3H8E A;  2WYR A;  3QB8 A;  2ZOG A;  5JPH A;  4OID A;  1BAV A;  1ZL0 A;  2ARH A;  2GAN A;  2P6F A;  1CX8 A;  4MI4 A;  1TIQ A;  2P0W A;  4BD9 A;  4X3R A;  3CPA A;  4UIA A;  2VBQ A;  4F6A A;  4MI1 A;  5G21 A;  1EZB A;  1M6V B;  3B3C A;  4OC4 A;  1IOI A;  4CAV A;  3KZW A;  4KSI A;  3K9U A;  3K4I A;  2EZC A;  3BHX A;  1LAP A;  2BEI A;  1A2Z A;  3EZA A;  3I6S A;  2Q7S A;  1MJ9 A;  3BJ7 A;  4FD4 A;  4AVA A;  3PLF B;  3TYX A;  2Z0Z A;  5C82 A;  2ZEH A;  2ZEM A;  5JYB A;  2CNM A;  4NGQ A;  1C30 B;  1B6B A;  4QB9 A;  4BTF A;  4C8T A;  2ZPA A;  2P6G A;  3SJX A;  1M4L A;  4KOS A;  5F09 A;  4UFX A;  3WAB A;  1VIX A;  2PJ6 A;  1IB1 E;  4A37 A;  4C9U A;  4EWT A;  3NA6 A;  4R8F A;  2JEV A;  4EFD A;  2GE3 A;  4ZBG A;  4NGN A;  3HPG G;  5G22 A;  4B10 A;  4HPS A;  3NE7 A;  2ZXV A;  2GU2 A;  1NSA A;  5AG4 A;  1BXR B;  3FBU A;  1VHS A;  1Q5X A;  3T8W A;  4WJB A;  2PVW A;  2C27 A;  4CAE A;  4RR2 B;  2ZEO A;  4A38 A;  1QSM A;  4M6G A;  2ABZ A;  4MHP A;  4UEE A;  3TC8 A;  2PJC A;  1CP7 A;  2OZG A;  3ISZ A;  1I1D A;  2AE6 A;  4UCP A;  5EBV A;  1TF8 A;  3H5Z A;  4ONU A;  4AG7 A;  1Z8L A;  1S7N A;  4P4F A;  3HMJ G;  1IU8 A;  3I1U A;  3NFZ A;  1YLE A;  3FVL A;  3VWD A;  3GYA A;  1YQE A;  4U9Z A;  1JWQ A;  3BUW B;  2RC4 A;  2FVG A;  2QIR A;  2VEZ A;  4JLY A;  4K30 A;  2B5G B;  1S7L A;  3G8W A;  3R96 A;  2HI6 A;  3B7I A;  2HV2 A;  4FAI A;  4UA3 A;  4C9R A;  4PQA A;  3JUW A;  5KTA A;  2ZW7 A;  4L8A A;  2POK A;  4R87 A;  4DNC A;  1YVO A;  4PSX A;  1I21 A;  2IJZ A;  4INJ A;  2Q51 A;  5K8P A;  4OP4 A;  2DLA A;  4CGL A;  4NXY A;  2CBL A;  2OR4 A;  1ELL P;  2VZY A;  4QUS A;  2CNT A;  4YGO A;  5I4M A;  1PCA A;  2I00 A;  2Q4V A;  3TE4 A;  2B4D A;  1XRY A;  5HVF A;  1CP6 A;  2ZED A;  2D4P A;  1BPN A;  8CPA A;  3PT1 A;  4CYN A;  2PR1 A;  3PB8 X;  5BWA B;  2D0O A;  5LYL A;  2X0S A;  5IB9 A;  3TLE A;  2REE A;  4KZT A;  3IWG A;  4KUB A;  1ZG7 A;  3I74 A;  4P4I A;  3B35 A;  5AG5 A;  1MJA A;  5F1Y A;  1KUY A;  2V8G A;  5H86 A;  3HLP A;  3IJ3 A;  4LQG A;  3EXN A;  2B4B A;  4A31 A;  2DPS A;  3TCV A;  4QC6 A;  1GHE A;  4DUK A;  4AG9 A;  3TLY A;  1R3N A;  4CAX A;  3NH4 A;  2GLJ A;  2D4O A;  4JD6 A;  4F0Y A;  1IYL A;  4C7I A;  2H5M A;  1IGB A;  1TXR A;  5G20 A;  1X10 A;  4OME A;  4P4E A;  5HKY A;  4FD6 A;  3LOD A;  2XEJ A;  3A9L A;  4KVO E;  4MCP A;  3S6F A;  3WC7 A;  2ATR A;  4LQ6 A;  4UBR A;  1Y9W A;  4B11 A;  4ZY1 A;  2Q43 A;  1XF1 A;  2DIK A;  3CXQ A;  1CG2 A;  5LRJ A;  2PDO A;  4KVX A;  4R76 A;  4CGN A;  3D7D A;  1QST A;  3RAM A;  3SI1 A;  4TJX A;  1CBX A;  1MJB A;  2ODF A;  2Y1N A;  5F5X A;  2ZEF A;  2ZW6 A;  1V6C A;  3TLZ A;  4OAE A;  3LAC A;  2WPX A;  4C2Y A;  2PCN A;  1DE4 C;  5F49 A;  3S6H A;  3SJE A;  3I9S A;  3C26 A;  4Q36 A;  2EUI A;  3LD2 A;  4TJV A;  1AMP A;  2PR8 A;  2VXK A;  3IGR A;  3T90 A;  5JH9 A;  1ZG9 A;  2EZA A;  4B12 A;  3EIF A;  2AFX A;  3WT4 A;  3GJZ A;  4AVB A;  1KWM A;  5CBM A;  2GRE A;  1KEE B;  4OC5 A;  2X7B A;  2Y0M A;  3D2M A;  3PBE A;  4GPL B;  3B3S A;  4Q7A A;  2AUN A;  1ZLH A;  3VTA A;  3KKW A;  2QYV A;  1CS0 B;  2PSW A;  1GYT A;  4DJL A;  1VI4 A;  2RFH A;  2I3C A;  3H8F A;  4RN7 A;  3BI0 A;  3IC1 A;  2DF5 A;  4UWI A;  3U88 C;  4MFL A;  3CXP A;  2B58 A;  5ISV A;  4KUA A;  2AFZ A;  5HMN A;  4CRZ B;  3F5B A;  3TLG B;  3FJU A;  2AFS A;  3TT2 A;  1JDE A;  1YW6 A;  2AFW A;  1QSO A;  1YVK A;  3SHP A;  3V7Z A;  4ZYQ A;  1R43 A;  3FX6 A;  4RS2 A;  4Y49 B;  3EC4 A;  5LYD A;  4H89 A;  3DSB A;  4H1H A;  2HQY A;  3K2K A;  4C9A A;  3OB2 B;  2HUZ A;  4AVC A;  4YRH A;  2DXQ A;  3K9T A;  3T9Y A;  3PB6 X;  4DYO A;  2R8V A;  4IUS A;  3TTH A;  1HEE A;  4UIB A;  3SI2 A;  4IIY A;  5DWM A;  1Z9U A;  4GXH A;  5IR2 A;  2CNS A;  4C68 A;  3TO6 A;  4YN3 A;  3TLB A;  4CDJ A;  4OC2 A;  1IOF A;  3RZA A;  2PJ1 A;  3QAH A;  3SJF A;  2ZOF A;  4PV6 A;  2B3V A;  3T07 A;  1WWZ A;  1JDB C;  2B0A A;  4OC3 A;  1RO5 A;  2ZW4 A;  1XEB A;  2PJ8 A;  1KUX A;  3NE8 A;  1Y0Y A;  2J8M A;  3W91 A;  3ICU A;  3U1B A;  2QVP A;  3VRO A;  4M8D A;  3KQZ A;  4MCS A;  4MHD A;  7CPA A;  1R57 A;  3EO4 A;  4OKO A;  2QJ8 A;  4MY3 A;  4ONW A;  2FM4 A;  2VI7 A;  3CPX A;  3D7H A;  4K3N A;  3KHZ A;  3BXM A;  1DTD A;  3JRU A;  1CPS A;  2F5I A;  4C7H A;  1B47 A;  2WSA A;  4ZX9 A;  2WZN A;  2CY2 A;  1WK4 A;  4XNH C;  3S6K A;  1C3O B;  2AFU A;  2O53 A;  3G23 A;  4PXC A;  1Z8T A;  2NMT A;  4C8C A;  1YRE A;  3WC5 A;  1VHE A;  2QML A;  1Y9Z A;  3F0A A;  2Z3L A;  3B2Y A;  4E94 A;  1KUV A;  4U9Y A;  1JQG A;  4KOV A;  5F46 A;  1XMB A;  3TX8 A;  1J4J A;  4I49 A;  4CO9 A;  2PJ2 A;  4R57 A;  1K4J A;  1KBL A;  1EE3 P;  2OOT A;  1P0H A;  1PUA A;  2ANP A;  2FCK A;  3DNS A;  4C8U A;  1Y7E A;  3E0K A;  4R7M A;  2PCU A;  1M1D A;  4M85 A;  4UFW A;  4ZGY B;  2PQ8 A;  1Z9E A;  3FMC A;  2E28 A;  6CPA A;  4J0N A;  2BL1 A;  3QNV A;  4MHY A;  2WUU A;  1H8L A;  2GP4 A;  2VL1 A;  1S60 A;  3KR4 A;  2PJB A;  3GB0 A;  1QQ9 A;  4CGO A;  2FSR A;  5K8O A;  2Y1M A;  3VRP A;  4A94 A;  2YGW A;  4UEZ A;  3DGV A;  1FNO A;  2PJ5 A;  3FRM A;  2CIJ A;  1S7F A;  4A33 A;  4HNY B;  4CRY B;  4UF4 A;  2FIA A;  1Z4E A;  5F48 A;  3VH9 A;  3KAS A;  2EO8 A;  3RNZ A;  5AXI A;  4M6I A;  4CAW A;  4E0A A;  5J8C A;  2CXA A;  5KTD A;  1YK3 A;  4X2T A;  1ZYM A;  4KSF A;  4MFQ A;  4F9V A;  5JM6 A;  3OAK A;  1P4N A;  2VZZ A;  2YND A;  1VGY A;  3D66 A;  4FD5 A;  4H2K A;  4B13 A;  1M44 A;  5IB0 A;  1PYT B;  1QSN A;  2PJ7 A;  5D8N A;  3EZB A;  3DR8 A;  3IU2 A;  2Z11 A;  4A4B A;  2WPW A;  2XEG A;  3ISX A;  4NF1 A;  3BUM B;  1RXT A;  2JDD A;  2PRB A;  3PFE A;  3PB4 X;  1HDU A;  1ON0 A;  3H8G A;  3IEH A;  3IU1 A;  2Q7B A;  3P2H A;  3VAR A;  4B5P B;  5A28 A;  1EO0 A;  2Z10 A;  1XMT A;  4CYQ A;  4O23 A;  1F2P A;  2G3T A;  1CE8 B;  1NMT A;  3B8G A;  4IHM A;  2FE7 A;  4ORF A;  3V38 A;  5I0C A;  4Z65 A;  4JVO A;  1S3Z A;  1XF8 A;  3W6S A;  3FIX A;  5DWN A;  2XEF A;  4KNG E;  5F13 A;  2DEA A;  4WWV A;  2MP0 A;  2IQ6 A;  2PJ3 A;  1U6M A;  4RI1 A;  3T0T A;  3C8O A;  3VAT A;  3MN8 A;  4KLV A;  4OAD A;  3B3W A;  3CDX A;  3D8P A;  4L89 A;  4CDK A; 
#chains in the Genus database with same CATH homology
 3FF3 A;  4FWU A;  4OC1 A;  2J9A A;  3KGQ A;  1LAM A;  4TNU A;  4YWY A;  2PJ9 A;  4P4D A;  2ZEP A;  3SJG A;  4OIW A;  4PXE A;  2PRQ A;  2V77 A;  3IWW A;  3KHX A;  3D4U A;  3MRU A;  4MMO A;  4NJQ A;  4ZY0 A;  5LYF A;  4MRI A;  2ZEG A;  3NH8 A;  3FED A;  4OC0 A;  3KL9 A;  2F7V A;  2F8H A;  4C9V A;  2C6P A;  1LFW A;  1TKJ A;  3D67 A;  2NSM A;  2EK8 A;  1LAN A;  2XEI A;  1ZLI A;  3D68 A;  3S9M A;  3IFE A;  3LMS A;  1Q7L A;  3FEE A;  2O4H A;  4P45 A;  2BOA A;  3FEC A;  3PB9 X;  2V8D A;  2ZEN A;  2ZEL A;  1BLL E;  2C6G A;  5HXD A;  5J1Q A;  1RTQ A;  4GM5 A;  4P6Y A;  1XBU A;  4F9U A;  1ZG8 A;  2BCO A;  5K8N A;  4C99 A;  3BI1 A;  5JGF A;  1CPX A;  2PJ4 A;  1LOK A;  1TF9 A;  2RB7 A;  4F8Z A;  2JBK A;  4MCR A;  2PIZ A;  3NH5 A;  4MHN A;  1ARM A;  2AFO A;  4PXD A;  4JYW A;  1HDQ A;  3D7F A;  4JZ0 A;  4R6T A;  4NGT A;  4FUU A;  2PJ0 A;  2JBJ A;  2V8H A;  4NGM A;  4P4J A;  1F57 A;  4C84 A;  3RBU A;  2PJA A;  3S9L A;  4UEF A;  3PRT A;  4MCQ A;  2G9D A;  4EME A;  4NGP A;  4TWE A;  5LYI A;  2CTC A;  5LRK A;  5THW A;  1ARL A;  2PE3 A;  2C6C A;  1TKH A;  3GUX A;  4C9E A;  1LCP A;  3S9N A;  4C86 A;  4C8A A;  4G1P A;  3GLJ A;  3HUV A;  4AXV A;  3N5F A;  3IO1 A;  1BPM A;  4PPZ A;  4P10 A;  1F2O A;  4MXU A;  1YLO A;  4A39 A;  1QMU A;  3SI0 A;  1VHO A;  3KQX A;  3PEI A;  3KR5 A;  4IAV A;  1Z5R A;  3WC6 A;  2EK9 A;  4NGR A;  1YME A;  4C85 A;  4NFR A;  5HVH A;  2CTB A;  1ELM P;  1OBR A;  1FT7 A;  2JEW A;  1XFO A;  4ZY2 A;  4C8P A;  4NGS A;  4P4B A;  4RUH A;  3DLJ A;  2HC9 A;  3CT9 A;  4FBE A;  2ZEE A;  2Q4Z A;  4YU9 A;  1IY7 A;  1WVM A;  2C1C A;  2PIY A;  1AYE A;  1Z2L A;  3L2N A;  1UWY A;  4PXB A;  5HVG A;  4IK2 A;  1Y0R A;  2CF4 A;  5CPA A;  2GLF A;  4NJR A;  2PVV A;  3PFO A;  3PBB A;  4B6Z A;  1XJO A;  4MHZ A;  3B3V A;  3FH4 A;  2NYQ A;  3PB7 X;  5D29 A;  5LRG A;  2V8V A;  3KI9 A;  1TKF A;  2AFM A;  5DS0 A;  2BO9 A;  4CPA A;  5ELY A;  4ZI6 A;  4X8I A;  2HB6 A;  3B3T A;  3D7G A;  4P44 A;  3IIB A;  3LWU A;  1YW4 A;  4W9Y A;  4ZX8 A;  1YSJ A;  2EWB A;  2IMO A;  5K8M A;  2C5Q A;  3H8E A;  2WYR A;  2ZOG A;  4OID A;  1BAV A;  1CX8 A;  4BD9 A;  4X3R A;  3CPA A;  4UIA A;  3B3C A;  4OC4 A;  3KZW A;  4KSI A;  3BHX A;  1LAP A;  3I6S A;  2ZEH A;  2ZEM A;  4NGQ A;  4C8T A;  4C8F A;  3SJX A;  1M4L A;  3WAB A;  5F09 A;  1VIX A;  2PJ6 A;  4A37 A;  4C9U A;  4EWT A;  3NA6 A;  4R8F A;  4EFD A;  4NGN A;  2GU2 A;  1NSA A;  3T8W A;  4WJB A;  2PVW A;  2ZEO A;  4A38 A;  2ABZ A;  4MHP A;  4UEE A;  3TC8 A;  2PJC A;  1CP7 A;  3ISZ A;  1TF8 A;  1Z8L A;  4P4F A;  3I1U A;  3NFZ A;  3FVL A;  2FVG A;  3B7I A;  4FAI A;  4C9R A;  4PQA A;  2POK A;  2IJZ A;  2Q51 A;  5K8P A;  4OP4 A;  5IB9 A;  2OR4 A;  1ELL P;  5I4M A;  1PCA A;  1XRY A;  5HVF A;  1CP6 A;  2ZED A;  1BPN A;  8CPA A;  3PB8 X;  5LYL A;  1ZG7 A;  3I74 A;  4P4I A;  3B35 A;  2V8G A;  3HLP A;  3IJ3 A;  4LQG A;  4DUK A;  1R3N A;  3NH4 A;  2GLJ A;  1IGB A;  1TXR A;  4OME A;  4P4E A;  3WC7 A;  2XEJ A;  4MCP A;  4ZY1 A;  1XF1 A;  2Q43 A;  1CG2 A;  5LRJ A;  4R76 A;  3D7D A;  3RAM A;  3SI1 A;  4TJX A;  1CBX A;  2ZEF A;  1V6C A;  1DE4 C;  3SJE A;  4TJV A;  1AMP A;  5JH9 A;  1ZG9 A;  3EIF A;  2AFX A;  3WT4 A;  5CBM A;  1KWM A;  2GRE A;  4OC5 A;  3PBE A;  3B3S A;  4Q7A A;  3VTA A;  1ZLH A;  2QYV A;  1GYT A;  4DJL A;  2RFH A;  2I3C A;  3H8F A;  3BI0 A;  3IC1 A;  2AFZ A;  3FJU A;  2AFS A;  1YW6 A;  2AFW A;  3V7Z A;  4ZYQ A;  1R43 A;  3FX6 A;  5LYD A;  4C9A A;  3K2K A;  3K9T A;  4DYO A;  3PB6 X;  1HEE A;  4UIB A;  3SI2 A;  5IR2 A;  4CDJ A;  4YN3 A;  4OC2 A;  3RZA A;  2PJ1 A;  3SJF A;  2ZOF A;  4OC3 A;  2PJ8 A;  1Y0Y A;  3ICU A;  2QVP A;  3KQZ A;  4MCS A;  7CPA A;  4OKO A;  2QJ8 A;  4ONW A;  3CPX A;  3D7H A;  4K3N A;  3KHZ A;  3BXM A;  1DTD A;  3JRU A;  1CPS A;  4ZX9 A;  2WZN A;  2AFU A;  2O53 A;  4PXC A;  4C8C A;  3WC5 A;  1VHE A;  1Y9Z A;  3B2Y A;  1JQG A;  1XMB A;  3TX8 A;  2PJ2 A;  1EE3 P;  2OOT A;  2ANP A;  4C8U A;  1Y7E A;  4R7M A;  2PCU A;  3FMC A;  6CPA A;  3QNV A;  4MHY A;  2GP4 A;  1H8L A;  2VL1 A;  3KR4 A;  2PJB A;  3GB0 A;  1QQ9 A;  5K8O A;  4A94 A;  4UEZ A;  3DGV A;  1FNO A;  2PJ5 A;  2CIJ A;  4UF4 A;  3VH9 A;  3KAS A;  4X2T A;  4F9V A;  5JM6 A;  4H2K A;  1VGY A;  3D66 A;  1PYT B;  2PJ7 A;  5D8N A;  3ISX A;  2XEG A;  3PFE A;  3PB4 X;  1HDU A;  3H8G A;  3IEH A;  3VAR A;  4O23 A;  1F2P A;  3V38 A;  4IHM A;  4Z65 A;  2XEF A;  4KNG E;  2DEA A;  4WWV A;  2IQ6 A;  2PJ3 A;  3VAT A;  3MN8 A;  3B3W A;  3CDX A;  4CDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...