2JBJA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with 2-pmpa (2-phosphonomethyl-pentanedioic acid)
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
694
structure length
687
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human Glutamate Carboxypeptidase II Inhibition: Structures of Gcpii in Complex with Two Potent Inhibitors, Quisqualate and 2-Pmpa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
total genus 253
structure length 687
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2jbjA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2jbjA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2jbjA02
4R6TA 4MCPA 3WC5A 2CTBA 4NGPA 1V6CA 2AFXA 2EK8A 3CT9A 1UWYA 5HXDA 5LYFA 3D66A 4MMOA 1Y0RA 1XFOA 2JEWA 5HVGA 3MN8A 3KHXA 2ABZA 2ZEHA 4G1PA 3KQZA 3PBBA 5HVHA 4YU9A 2XEGA 2O4HA 2PJCA 3L2NA 3FMCA 1XMBA 3ICUA 4O23A 1ZLHA 1CPSA 4EFDA 1Z2LA 2V8DA 1ZG8A 2GLJA 1ZG9A 5JGFA 4FBEA 1XBUA 2AFMA 1HDUA 1TF9A 2CIJA 5I4MA 2PCUA 5JM6A 5LYIA 2C6GA 4ZYQA 1EE3P 4MCQA 1FNOA 4EMEA 4PXEA 4IHMA 3K9TA 3DLJA 4C8UA 3RBUA 2V8VA 3K2KA 2ZOGA 3BXMA 4ZY1A 3SJGA 2PRQA 4JZ0A 1TKJA 3I1UA 1ELMP 4C9EA 4IAVA 2PJ7A 3H8FA 4FUUA 5DS0A 4C8AA 5F09A 1XF1A 1DE4C 3SJEA 4CDJA 1ZG7A 3D4UA 4BD9A 2F7VA 1TXRA 1BPNA 1M4LA 4A94A 1AYEA 1KWMA 4B6ZA 8CPAA 3GUXA 1Z5RA 5LRGA 3BHXA 3SJXA 4CPAA 4PQAA 4C8PA 4RUHA 5IB9A 1LANA 4OIDA 3B35A 4H2KA 3CPAA 5J1QA 1ELLP 3CDXA 4OP4A 1XRYA 4PXCA 3BI1A 2DEAA 2PVWA 3PFEA 4TWEA 4W9YA 4P4JA 4OIWA 4NJQA 3V38A 4P4DA 3CPXA 4R76A 3T8WA 4NGTA 5LYDA 4NGSA 1YMEA 3IFEA 4C86A 1LAMA 3SI1A 4MXUA 2WZNA 2JBKA 1BLLE 2CTCA 4C8TA 1BPMA 4MRIA 4UEFA 5K8NA 3KI9A 2XEJA 4UIBA 3RZAA 5K8PA 2AFZA 4A39A 3B2YA 2IMOA 4NJRA 3PB4X 3MRUA 3FH4A 3GLJA 2PJ1A 2C6CA 4P10A 4WWVA 3VH9A 2XEFA 1CP7A 2ZEEA 3N5FA 3D68A 2OOTA 5D29A 2QYVA 4CDKA 2ZEFA 4IK2A 3IJ3A 2V8HA 2ZEGA 4OC2A 1TF8A 4EWTA 4MCRA 3V7ZA 4GM5A 2PJBA 4NGRA 1TKFA 2POKA 3PEIA 5CBMA 4Q7AA 3KL9A 2PIZA 3I6SA 3FEEA 2RB7A 3D67A 1VHEA 4ZI6A 4P4IA 2PJ0A 1AMPA 1Y0YA 2CF4A 6CPAA 1QMUA 4X8IA 3D7HA 2ZOFA 2EK9A 4ZX8A 3IEHA 3WC7A 1Y7EA 3FECA 4OC5A 4NGMA 1FT7A 1YW6A 4MHNA 2WYRA 2C1CA 1PCAA 3B3CA 5D8NA 3VTAA 2XEIA 5LRKA 3S9NA 4MHZA 3WC6A 2HB6A 1HDQA 3PBEA 3WT4A 2PJ4A 4NFRA 4UEZA 1LOKA 3B3VA 3VARA 4KNGE 5ELYA 4C9VA 2ANPA 1CPXA 4C9RA 2HC9A 3IIBA 1F57A 3WABA 2AFWA 1ARLA 5LYLA 4TJVA 2OR4A 2Q43A 4P4EA 4ZY0A 3H8GA 4C99A 3NH8A 3KHZA 3SJFA 4F8ZA 3IC1A 3SI0A 4KSIA 4ZX9A 3B3SA 4TNUA 2PIYA 2J9AA 1WVMA 3HLPA 3EIFA 3NA6A 3KZWA 4MCSA 2BCOA 3PB8X 5JH9A 1YSJA 1CP6A 4UEEA 5K8MA 1F2OA 3KR5A 2ZELA 4A38A 1XJOA 1VIXA 4P6YA 3S9LA 3FX6A 1VHOA 5THWA 2VL1A 4P45A 3IO1A 1YLOA 2PJ8A 4X2TA 3NFZA 4A37A 2IJZA 4OC4A 4JYWA 1ZLIA 5CPAA 4C84A 3FVLA 4NGQA 3RAMA 4AXVA 4DUKA 3SI2A 2V77A 4ZY2A 2PJ5A 2BOAA 5HVFA 2GU2A 3PRTA 2AFSA 4YN3A 3FJUA 2AFOA 1CBXA 3H8EA 2Q51A 2JBJA 1R3NA 4OKOA 4UIAA 4YWYA 3LWUA 2C6PA 3KQXA 3ISXA 2RFHA 3KASA 2PJ6A 4C8CA 1H8LA 3B3TA 2I3CA 2F8HA 1F2PA 1BAVA 1GYTA 4OC3A 2PJAA 2QJ8A 4F9VA 1R43A 1Y9ZA 2G9DA 3PB6X 1VGYA 1TKHA 4OC0A 2GLFA 2QVPA 4NGNA 4MHPA 3BI0A 2PJ9A 4FAIA 2O53A 3JRUA 5K8OA 7CPAA 3VATA 4ONWA 4OC1A 3S9MA 4X3RA 4WJBA 3PB7X 2PJ3A 4DYOA 1Q7LA 4PXBA 3NH4A 4C9UA 2IQ6A 4MHYA 1DTDA 3FF3A 2PE3A 1YW4A 2FVGA 3D7DA 4K3NA 3KGQA 4F9UA 2NSMA 2PVVA 1QQ9A 3GB0A 1JQGA 3FEDA 3D7FA 2ZEMA 4R8FA 4P44A 4PXDA 3LMSA 1LFWA 3PFOA 3B3WA 2GREA 1CX8A 5LRJA 1Z8LA 1NSAA 2BO9A 2V8GA 3IWWA 3DGVA 3PB9X 1LCPA 4PPZA 4FWUA 3TC8A 1RTQA 2ZEDA 4C9AA 1IY7A 4LQGA 4P4FA 4P4BA 2PJ2A 2ZENA 4C85A 1HEEA 4TJXA 1IGBA 3HUVA 2EWBA 3KR4A 3D7GA 1PYTB 3TX8A 4C8FA 4Z65A 1LAPA 4OMEA 2Q4ZA 3QNVA 1CG2A 2AFUA 2ZEOA 4UF4A 3I74A 1OBRA 2ZEPA 4DJLA 2NYQA 3NH5A 3ISZA 1ARMA 4R7MA 3B7IA
chains in the Genus database with same CATH superfamily
4R6TA 3PGPA 3G3SA 4MCPA 3WC5A 3S6HA 2FSRA 2CTBA 4GXHA 4NGPA 5HKYA 1V6CA 3PT1A 2AFXA 2EK8A 3CT9A 1UWYA 5HXDA 5LYFA 1S7NA 3D66A 2ZW4A 3T05A 4MJ8A 1IIDA 4I49A 4MMOA 4UCPA 5JPHA 3O8ZA 1Y0RA 1VHSA 4A2ZA 1XFOA 4C68A 5JQ4A 4Y49B 1XOVA 2JEWA 3DSBA 3SHPA 1CM0A 2BUEA 4CYQA 5HVGA 3MN8A 2HWGA 2MP0A 3KHXA 4DUKA 2ABZA 1U6MA 2CXAA 3EZEA 2D4PA 1RO5A 2OZHA 2Q7BA 4CAXA 2ZEHA 2OU2A 2B5GB 4F6AA 4G1PA 3KQZA 4A4BA 4L89A 3PBBA 5HVHA 1OZPA 3DR8A 3H5ZA 1ZRSA 4YU9A 2XEGA 2O4HA 2PJCA 1PUAA 3F0AA 2Z10A 4LX9A 3L2NA 3FMCA 4BPXB 3PLFB 1XMBA 5GCNA 3KKWA 3ICUA 4O23A 4UWIA 4CS0B 1ZLHA 1EZAA 1CPSA 4EFDA 1Z2LA 2V8DA 4U5YA 4A32A 4AVAA 1ZG8A 4GPLB 1IB1E 2GLJA 4J0NA 4A31A 1ZG9A 5JGFA 4E5SA 3BUWB 4FBEA 1XBUA 2AFMA 5KTAA 2Z3PA 1HDUA 1TF9A 2CIJA 4CGPA 5I4MA 3PFVA 2FT0A 2K5TA 2PCUA 1S3ZA 4E2AA 4F0XA 5JM6A 4MY0A 5LYIA 2P0WA 2REEA 2C6GA 4ZYQA 1EE3P 4MCQA 1FNOA 1YVOA 4PXEA 4EMEA 4IHMA 3BJ7A 4KOWA 3K9TA 4BMHA 4JWPA 3DLJA 4C8UA 5G22A 3RBUA 2ZXVA 2GP4A 1N71A 3V8IA 2V8VA 4UA3A 4UCNA 2QECA 2ZOGA 3K2KA 3BXMA 4ZY1A 3S6GA 4C2YA 4C2XA 1B6BA 3SJGA 2PRQA 3CXSA 2CY2A 4JZ0A 4MBUA 1TKJA 3I1UA 5K99A 1ELMP 1YQEA 2VQYA 4H89A 2VZYA 4C9EA 4IAVA 2PJ7A 2B4JC 3H8FA 4RS2A 4IIYA 2XPNA 3JVNA 4OAEA 3GJZA 2OZGA 4FUUA 5DS0A 1KUXA 4C8AA 5F09A 2YJVA 1XF1A 1DE4C 3SJEA 2VBQA 1IU8A 4XNHB 1IYKA 1ZG7A 5FD8A 3D4UA 4CDJA 4BD9A 2F7VA 3F9KC 1TXRA 1BPNA 1M4LA 4A94A 2R7HA 1AYEA 1KWMA 3H4QA 4B6ZA 8CPAA 3GUXA 1V0CA 1Z5RA 2P6FA 5LRGA 5FVJA 3BHXA 5AG6A 2PCNA 3SJXA 4R57A 4CPAA 2B5GA 4KUAA 4PQAA 4RUHA 4C8PA 5IB9A 3S6KA 4R7MA 1LANA 4NSQA 3RO0A 3W6SA 4OIDA 2VI7A 4COGA 2Q44A 4R3LA 5KTCA 3B35A 2FS5A 4H2KA 1NMTA 3CPAA 4ONUA 4UCMA 1Z8WA 5J1QA 1ELLP 3OB2B 3CDXA 4OP4A 4CGLA 1XRYA 3B8GA 3DDDA 1I1DA 4PXCA 3BI1A 2DEAA 2PVWA 3BUOB 2N3AB 2B4BA 3PFEA 3PZJA 4Q38A 4TWEA 3CZXA 1T36B 5AG4A 4W9YA 2XPOA 1I12A 4P4JA 4OIWA 1NSLA 4YFJA 2G0BA 1ON0A 3R9GA 3TLZA 3TE4A 1Y9KA 1JDEA 2PR1A 4NJQA 4NF1A 2Q7SA 3V38A 4IIXA 4P4DA 2GE3A 4HNWB 4MFZA 3FIXA 4E94A 2C27A 3CPXA 2B0AA 2DIKA 4M3SA 4R76A 3T8WA 4NGTA 1CJWA 5LYDA 1IOFA 2VKZG 2EO8A 2REFA 4NGSA 4KSAA 3EO4A 1YMEA 3IFEA 3R9FA 1LAMA 3SI1A 4C86A 4MXUA 1X12A 5C88A 3VGOA 1GHEA 4XPKA 2WZNA 2JBKA 1JDBC 2OZUA 2Q04A 2EZBA 1BLLE 3CXPA 2CTCA 2NMTA 1YVHA 4JJXA 2EZAA 1BPMA 4MRIA 3JUWA 4UEFA 5J8FA 5K8NA 2HROA 4C8TA 2FIAA 4B11A 3EXNA 1LRZA 3KI9A 4BINA 2XEJA 3P2HA 4UIBA 3RZAA 4B13A 2QIRA 3NE8A 2BSWA 2ZW6A 4CRYB 2AFZA 3QAHA 5K8PA 4EYSA 5F49A 1EZBA 1XF8A 2YNDA 4ORFA 4A39A 1RXTA 3B2YA 2IMOA 2OLSA 2WUUA 4BBHA 4NJRA 4A95A 3GIUA 4H6UA 3EZAA 4MFPA 4R3KA 5IB0A 3PB4X 3MRUA 3FH4A 3GLJA 2CBLA 2X0SA 4NCZA 2PJ1A 2C6CA 4P10A 2EVNA 3K4IA 2GFQA 4WWVA 2C5QA 2G3AA 3VH9A 2XEFA 2J8RA 2HQYA 5AGEA 1CP7A 2ZEEA 3N5FA 5KTDA 1KC7A 3D68A 2OOTA 5D29A 2GANA 5HKZA 2QYVA 3JTKA 2ZEFA 4IK2A 3TOAA 2ODFA 3IJ3A 4AB7A 2D0OA 2Z0ZA 5H84A 3TOBA 5G20A 3T5MA 2HUZA 2V8HA 2ZEGA 4MI1A 3EIFA 2XPPA 2RC4A 3TYXA 4OC2A 1TF8A 4F0YA 4EWTA 1WJTA 2B3VA 3R1KA 4MCRA 3V7ZA 1M4GA 1Z9UA 2Q0YA 3RYOA 4GM5A 1XEBA 2PJBA 1Q5XA 1GGOA 4NGRA 4AG7A 1AUGA 1WK4A 4CAWA 2AUMA 1TKFA 1P0HA 2POKA 2Z3LA 4BTFA 3PEIA 1UFHA 4M6IA 5CBMA 2AUNA 4Q7AA 3KL9A 3D3SA 5DWMA 2PIZA 3I6SA 4M85A 1MK4A 3GYAA 3FEEA 1J3LA 2RB7A 3D67A 1BO4A 2WPXA 3ZNIA 1VHEA 1YR0A 4HNXB 3SXNA 4A33A 4B10A 4P4IA 4ZI6A 3TO9A 4NXYA 4CYPA 2PJ0A 5A28A 3BUMB 1AMPA 4J3GA 4MHDA 1Y0YA 3ZJ0A 1YX0A 1Y7RA 3FXTA 3VROA 3HMJG 1XIXA 2CF4A 4B5PB 2D0PA 6CPAA 4KLWA 1QMUA 4X8IA 2P6GA 3D7HA 2BL1A 2EK9A 2ZOFA 3RNZA 4MJXA 3TLCA 4ZX8A 3IEHA 3UY5A 1ZL0A 1KEEB 2X7BA 3WC7A 4YGOA 4CYOA 1Y7EA 1M4DA 3OP0A 3TO6A 1Z4EA 5F5XA 4CZ1A 3FECA 2PDOA 1YK3A 4CDKA 5IX3A 4GS4A 1SQHA 4BPWB 4OC5A 4PK2A 4XPLA 4NGMA 1FT7A 3IGRA 1YW6A 4KOTA 1BOBA 3R96A 3KRVA 4CGNA 4MHNA 3LODA 5I0CA 2VZZA 4M6HA 4MFQA 5C82A 5IV0A 5HKWA 2YNEA 2Z3NA 3OB1B 4AVBA 2WYRA 1ZO0A 4UFXA 1VI4A 2Z3MA 2C1CA 3TLEA 1PCAA 3B3CA 5D8NA 2FIWA 4MI4A 1NXJA 2XEIA 2Y1NA 5BY0A 3S9NA 5LRKA 4KOUA 4MHZA 2HB6A 1HDQA 3PBEA 2IL4A 2PJ4A 4NFRA 3VWDA 3WC6A 3WT4A 4KVOE 4UEZA 3F8KA 1LOKA 3B3VA 3GY9A 3VARA 2CNSA 4RN7A 1DIKA 2WSAA 2FE7A 2CNTA 4KNGE 2HV2A 5ELYA 4C9VA 2ANPA 5J3XA 1CPXA 4C9RA 2JDDA 4C2ZA 4CRZB 2HC9A 1VBGA 3IIBA 1F57A 1Z8XA 3WABA 5F47A 3VRNA 3U88C 2JLMA 4KOYA 2Z11A 3F5BA 2AFWA 4CYNA 4KLVA 1ARLA 1QSNA 1Q2CA 5LYLA 3IWEA 1NE9A 4C7IA 4TJVA 2OR4A 5A27A 4OLLA 3T07A 2Q43A 1R57A 3K9UA 4P4EA 4ZY0A 1Y9WA 3H8GA 4C99A 3NH8A 3KHZA 1IYLA 3SJFA 4F8ZA 2R8VA 3IC1A 4KORA 4U9YA 3SI0A 4KSIA 3HPHE 4ZX9A 4B5PA 3B3SA 2AE6A 4TNUA 4AG9A 4RI1A 2D4OA 2OB0A 1B47A 2Y1MA 2PIYA 4XNHC 2J9AA 1Z4RA 3HLPA 4Q36A 3NA6A 1C3OB 1WVMA 1S60A 2BEIA 2O28A 3KZWA 4R9MA 4LQ6A 4H1HA 4MCSA 2BCOA 3PB8X 5JH9A 5EC4A 4KVME 1YSJA 1Z8TA 1ZYMA 1CP6A 4IUSA 4UEEA 5K8MA 3NFQA 4QC6A 1F2OA 1S5KA 4QVTA 3KR5A 2ZELA 3FYNA 5EBVA 4A38A 1XJOA 1VIXA 1MJAA 4P6YA 3S9LA 4HKFA 3SR3A 4QUSA 2ZPAA 2B3UA 4QB9A 4MFKA 5AG7A 3FX6A 2Z3KA 1VHOA 5THWA 1R61A 2VL1A 3I9SA 4R87A 4P45A 3IO1A 1KZFA 3OAKA 4KVXA 1YLOA 3R9EA 2WPWA 3A9LA 3VRPA 2FCKA 2J8NA 3R95A 2P6EA 1FY7A 1K4JA 2PJ8A 4NEXA 5F13A 3VRQA 4HNYB 3NFZA 4X2TA 4A37A 1P4NA 2IJZA 4OC4A 4JYWA 1ZLIA 5CPAA 4C84A 4NGQA 3FVLA 2OH1A 3RAMA 4AXVA 1YLEA 3BUXB 2CNMA 2R1IA 4YRHA 3IU1A 5DWNA 3SI2A 1B87A 2V77A 1KUYA 4JXRA 5BWAB 3NE7A 4ZY2A 2PJ5A 4A30A 2BOAA 3VRRA 5HVFA 5IR2A 2B4DB 4XPDB 2GU2A 2PR8A 3PRTA 2AFSA 4YN3A 4PSWA 3E0KA 4Y49C 3FJUA 1YREA 2PRBA 4PK3A 1YVKA 2AFOA 1CBXA 3H8EA 4H6ZA 1J4JA 1YGHA 2DPTA 2Q51A 2Q4YA 4IF5A 4U9ZA 1Q2DA 2JBJA 3IWGA 1R3NA 4OKOA 4UIAA 2FM4A 4JD6A 3LWUA 4YWYA 2C6PA 1KUVA 1X10A 2J8MA 2AJ6A 1A9XB 1S7KA 2PQ8A 3KQXA 3ISXA 3TTHA 2RFHA 4KS9A 2R82A 3KASA 5ISVA 2DLAA 4XPDC 2PJ6A 4COBA 4PSXA 3C8OA 4C8CA 3G8WA 1H8LA 3TLAA 5J8CA 3B3TA 2I3CA 3LD2A 1QSMA 2F8HA 4QBJA 1F2PA 1BAVA 3PP9A 3VTAA 4E8OA 2R98A 1XMTA 1GYTA 4UBRA 3W91A 4OC3A 1M44A 4CO9A 3GKRA 1S7FA 2PJAA 2YNCA 4JLYA 4B5OA 2QJ8A 2ARHA 4F9VA 1R43A 3LACA 5CNPA 4MFJA 4M6GA 1BXRB 2G9DA 1Y9ZA 3PB6X 1VGYA 2EBJA 2FL4A 1TKHA 3MGDA 4OC0A 2GLFA 4UFWA 3TFYA 2PSWA 4NGNA 2QVPA 4FD5A 4FD7A 4MHPA 4KOVA 3BI0A 2PJ9A 4C7HA 4FAIA 2O53A 3JRUA 1I21A 5K8OA 4CAFA 1S7LA 1QSTA 3VATA 7CPAA 5F1YA 2DXQA 3TO7A 4ONWA 4JVOA 4OC1A 3S9MA 3QB8A 4MFLA 4UFVA 1EO0A 4B12A 4X3RA 4WJBA 1CE8B 3PB7X 2PJ3A 4DYOA 1Q7LA 4PXBA 4ZGYB 1M6VB 1PU9A 3NH4A 4C9UA 3TCVA 2QMLA 2A4NA 5JVLA 2IQ6A 2PC1A 2JEVA 3TLBA 4MHYA 1MJ9A 1M1DA 1DTDA 3FF3A 2DF5A 2F5IA 2EZCA 2PE3A 3SXOA 1YW4A 2FVGA 2H5MA 3D7DA 1L0CA 2Q4VA 4K3NA 2XPLA 3KGQA 4F9UA 2NSMA 1IOIA 3TLYA 2PVVA 3N7ZA 4KOSA 1QQ9A 4PV6A 3EC4A 1MJBA 3GB0A 1JQGA 3T90A 3FEDA 2GIVA 4X5KA 2DPSA 4KOXA 4KUBA 4CAVA 3D7FA 3EY5A 4UWJA 3EZBA 3S6FA 4FD6A 4K30A 2ZEMA 4R8FA 1QSRA 4M8DA 4ZBGA 3OWCA 4AVCA 4P44A 4KZTA 1CS0B 3QAYA 4PXDA 2KCWA 3LMSA 1LFWA 3DR6A 3T0TA 1TIQA 2ZW5A 3PFOA 1M4IA 3U1BA 3B3WA 2GREA 2VEZA 3HPGG 1CX8A 4OADA 4HPSA 5G21A 3I3GA 1JWQA 5LRJA 1NBWA 4CGOA 1Z8LA 1NSAA 2BO9A 3D2MA 4KSFA 2V8GA 5F48A 2YJTA 3IWWA 5AXIA 1IICA 3FNCA 4FD4A 4JXQA 3DGVA 3TT2A 3PB9X 2VXKA 1LCPA 3BUNB 4PPZA 4FWUA 5H86A 3TC8A 4II9A 1RTQA 2B4DA 5EMIA 1VBHA 3T9YA 3P2FA 2ZEDA 4C9AA 4MY3A 1IY7A 4LQGA 3BJ8A 4P4FA 2EUIA 4P4BA 4CGMA 2PJ2A 2ZENA 3VWEA 4C85A 5HMNA 3NOJA 1HEEA 4RR2B 2ZW7A 4TJXA 5JYBA 1IGBA 3HUVA 2EWBA 4L8AA 3KR4A 2UV8G 4A4CA 2YNCC 3D7GA 3EFAA 4DNCA 2Z3OA 1C30B 2HI6A 2FXFA 2Y0MA 3G23A 3FBUA 3ZZIA 1PYTB 2I00A 3TX8A 5F9MA 4C8FA 5HH1A 5G1ZA 3BLNA 2JDCA 1A2ZA 4Z65A 3TLGB 1VKCA 5F46A 4E0AA 3TLGA 4EVYA 1LAPA 3DNSA 2I79A 1KBLA 4B14A 4OMEA 2B58A 2Q4ZA 3QNVA 2YGWA 1CG2A 2AFUA 4INJA 2ZEOA 3W6XA 4UF4A 3I74A 1OBRA 3FB3A 2ZEPA 4DJLA 1Z9EA 5E96A 3IU2A 1Q2YA 1QSOA 3CXQA 2ATRA 4BPUB 2NYQA 3D2PA 3NH5A 2G3TA 5AG5A 3ISZA 3C26A 4CAEA 1XE4A 1ARMA 3FRMA 1FBVA 4LUAA 1WWZA 3B7IA 2E28A 3WR7A 3D8PA
chains in the Genus database with same CATH topology
4R6TA 4MCPA 3WC5A 2CTBA 4NGPA 1V6CA 2AFXA 2EK8A 3CT9A 1UWYA 5HXDA 5LYFA 3D66A 4MMOA 1Y0RA 1XFOA 2JEWA 5HVGA 3MN8A 3KHXA 2ABZA 2ZEHA 4G1PA 3KQZA 3PBBA 5HVHA 4YU9A 2XEGA 2O4HA 2PJCA 3L2NA 3FMCA 1XMBA 3ICUA 4O23A 1ZLHA 1CPSA 4EFDA 1Z2LA 2V8DA 1ZG8A 2GLJA 1ZG9A 5JGFA 4FBEA 1XBUA 2AFMA 1HDUA 1TF9A 2CIJA 5I4MA 2PCUA 5JM6A 5LYIA 2C6GA 4ZYQA 1EE3P 4MCQA 1FNOA 4EMEA 4PXEA 4IHMA 3K9TA 3DLJA 4C8UA 3RBUA 2GP4A 2V8VA 3K2KA 2ZOGA 3BXMA 4ZY1A 3SJGA 2PRQA 4JZ0A 1TKJA 3I1UA 1ELMP 4C9EA 4IAVA 2PJ7A 3H8FA 4FUUA 5DS0A 4C8AA 5F09A 1XF1A 1DE4C 3SJEA 4CDJA 1ZG7A 3D4UA 4BD9A 2F7VA 1TXRA 1BPNA 1M4LA 4A94A 1AYEA 1KWMA 4B6ZA 8CPAA 3GUXA 1Z5RA 5LRGA 3BHXA 3SJXA 4CPAA 4PQAA 4C8PA 4RUHA 5IB9A 1LANA 4OIDA 3B35A 4H2KA 3CPAA 5J1QA 1ELLP 3CDXA 4OP4A 1XRYA 4PXCA 3BI1A 2DEAA 2PVWA 3PFEA 4TWEA 4W9YA 4P4JA 4OIWA 4NJQA 3V38A 4P4DA 3CPXA 4R76A 3T8WA 4NGTA 5LYDA 4NGSA 1YMEA 3IFEA 4C86A 1LAMA 3SI1A 4MXUA 2WZNA 2JBKA 1BLLE 2CTCA 4C8TA 1BPMA 4MRIA 4UEFA 5K8NA 3KI9A 2XEJA 4UIBA 3RZAA 5K8PA 2AFZA 4A39A 3B2YA 2IMOA 4NJRA 3PB4X 3MRUA 3FH4A 3GLJA 2PJ1A 2C6CA 4P10A 4WWVA 2C5QA 3VH9A 2XEFA 1CP7A 2ZEEA 3N5FA 3D68A 2OOTA 5D29A 2QYVA 4CDKA 2ZEFA 4IK2A 3IJ3A 2V8HA 2ZEGA 4OC2A 1TF8A 4EWTA 4MCRA 3V7ZA 4GM5A 2PJBA 4NGRA 1TKFA 2POKA 3PEIA 5CBMA 4Q7AA 3KL9A 2PIZA 3I6SA 3FEEA 2RB7A 3D67A 1VHEA 4ZI6A 4P4IA 2PJ0A 1AMPA 1Y0YA 2CF4A 6CPAA 1QMUA 4X8IA 3D7HA 2ZOFA 2EK9A 4ZX8A 3IEHA 3WC7A 1Y7EA 3FECA 4OC5A 4NGMA 1FT7A 1YW6A 4MHNA 2WYRA 2C1CA 1PCAA 3B3CA 5D8NA 3VTAA 2XEIA 5LRKA 3S9NA 4MHZA 3WC6A 2HB6A 1HDQA 3PBEA 3WT4A 2PJ4A 4NFRA 4UEZA 1LOKA 3B3VA 3VARA 4KNGE 5ELYA 4C9VA 2ANPA 1CPXA 4C9RA 2HC9A 3IIBA 1F57A 3WABA 2AFWA 1ARLA 5LYLA 4TJVA 2OR4A 2Q43A 4P4EA 4ZY0A 3H8GA 4C99A 3NH8A 3KHZA 3SJFA 4F8ZA 3IC1A 3SI0A 4KSIA 4ZX9A 3B3SA 4TNUA 2PIYA 2J9AA 1WVMA 3HLPA 3EIFA 3NA6A 3KZWA 4MCSA 2BCOA 3PB8X 5JH9A 1YSJA 1CP6A 4UEEA 5K8MA 1F2OA 3KR5A 2ZELA 4A38A 1XJOA 1VIXA 4P6YA 3S9LA 3FX6A 1VHOA 5THWA 2VL1A 4P45A 3IO1A 1YLOA 2PJ8A 4X2TA 3NFZA 4A37A 2IJZA 4OC4A 4JYWA 1ZLIA 5CPAA 4C84A 3FVLA 4NGQA 3RAMA 4AXVA 4DUKA 3SI2A 2V77A 4ZY2A 2PJ5A 2BOAA 5HVFA 5IR2A 2GU2A 3PRTA 2AFSA 4YN3A 3FJUA 2AFOA 1CBXA 3H8EA 2Q51A 2JBJA 1R3NA 4OKOA 4UIAA 4YWYA 3LWUA 2C6PA 3KQXA 3ISXA 2RFHA 3KASA 2PJ6A 4C8CA 1H8LA 3B3TA 2I3CA 2F8HA 1F2PA 1BAVA 1GYTA 4OC3A 2PJAA 2QJ8A 4F9VA 1R43A 1Y9ZA 2G9DA 3PB6X 1VGYA 1TKHA 4OC0A 2GLFA 2QVPA 4NGNA 4MHPA 3BI0A 2PJ9A 4FAIA 2O53A 3JRUA 5K8OA 7CPAA 3VATA 4ONWA 4OC1A 3S9MA 4X3RA 4WJBA 3PB7X 2PJ3A 4DYOA 1Q7LA 4PXBA 3NH4A 4C9UA 2IQ6A 4MHYA 1DTDA 3FF3A 2PE3A 1YW4A 2FVGA 3D7DA 4K3NA 3KGQA 4F9UA 2NSMA 2PVVA 1QQ9A 3GB0A 1JQGA 3FEDA 3D7FA 2ZEMA 4R8FA 4P44A 4PXDA 3LMSA 1LFWA 3PFOA 3B3WA 2GREA 1CX8A 5LRJA 1Z8LA 1NSAA 2BO9A 2V8GA 3IWWA 3DGVA 3PB9X 1LCPA 4PPZA 4FWUA 3TC8A 1RTQA 2ZEDA 4C9AA 1IY7A 4LQGA 4P4FA 4P4BA 2PJ2A 2ZENA 4C85A 1HEEA 4TJXA 1IGBA 3HUVA 2EWBA 3KR4A 3D7GA 1PYTB 3TX8A 4C8FA 4Z65A 1LAPA 4OMEA 2Q4ZA 3QNVA 1CG2A 2AFUA 2ZEOA 4UF4A 3I74A 1OBRA 2ZEPA 4DJLA 2NYQA 3NH5A 3ISZA 1ARMA 4R7MA 3B7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6T A;  4MCP A;  3WC5 A;  2CTB A;  4NGP A;  1V6C A;  2AFX A;  2EK8 A;  3CT9 A;  1UWY A;  5HXD A;  5LYF A;  3D66 A;  4MMO A;  1Y0R A;  1XFO A;  2JEW A;  5HVG A;  3MN8 A;  3KHX A;  2ABZ A;  2ZEH A;  4G1P A;  3KQZ A;  3PBB A;  5HVH A;  4YU9 A;  2XEG A;  2O4H A;  2PJC A;  3L2N A;  3FMC A;  1XMB A;  3ICU A;  4O23 A;  1ZLH A;  1CPS A;  4EFD A;  1Z2L A;  2V8D A;  1ZG8 A;  2GLJ A;  1ZG9 A;  5JGF A;  4FBE A;  1XBU A;  2AFM A;  1HDU A;  1TF9 A;  2CIJ A;  5I4M A;  2PCU A;  5JM6 A;  5LYI A;  2C6G A;  4ZYQ A;  1EE3 P;  4MCQ A;  1FNO A;  4EME A;  4PXE A;  4IHM A;  3K9T A;  3DLJ A;  4C8U A;  3RBU A;  2V8V A;  3K2K A;  2ZOG A;  3BXM A;  4ZY1 A;  3SJG A;  2PRQ A;  4JZ0 A;  1TKJ A;  3I1U A;  1ELM P;  4C9E A;  4IAV A;  2PJ7 A;  3H8F A;  4FUU A;  5DS0 A;  4C8A A;  5F09 A;  1XF1 A;  1DE4 C;  3SJE A;  4CDJ A;  1ZG7 A;  3D4U A;  4BD9 A;  2F7V A;  1TXR A;  1BPN A;  1M4L A;  4A94 A;  1AYE A;  1KWM A;  4B6Z A;  8CPA A;  3GUX A;  1Z5R A;  5LRG A;  3BHX A;  3SJX A;  4CPA A;  4PQA A;  4C8P A;  4RUH A;  5IB9 A;  1LAN A;  4OID A;  3B35 A;  4H2K A;  3CPA A;  5J1Q A;  1ELL P;  3CDX A;  4OP4 A;  1XRY A;  4PXC A;  3BI1 A;  2DEA A;  2PVW A;  3PFE A;  4TWE A;  4W9Y A;  4P4J A;  4OIW A;  4NJQ A;  3V38 A;  4P4D A;  3CPX A;  4R76 A;  3T8W A;  4NGT A;  5LYD A;  4NGS A;  1YME A;  3IFE A;  4C86 A;  1LAM A;  3SI1 A;  4MXU A;  2WZN A;  2JBK A;  1BLL E;  2CTC A;  4C8T A;  1BPM A;  4MRI A;  4UEF A;  5K8N A;  3KI9 A;  2XEJ A;  4UIB A;  3RZA A;  5K8P A;  2AFZ A;  4A39 A;  3B2Y A;  2IMO A;  4NJR A;  3PB4 X;  3MRU A;  3FH4 A;  3GLJ A;  2PJ1 A;  2C6C A;  4P10 A;  4WWV A;  3VH9 A;  2XEF A;  1CP7 A;  2ZEE A;  3N5F A;  3D68 A;  2OOT A;  5D29 A;  2QYV A;  4CDK A;  2ZEF A;  4IK2 A;  3IJ3 A;  2V8H A;  2ZEG A;  4OC2 A;  1TF8 A;  4EWT A;  4MCR A;  3V7Z A;  4GM5 A;  2PJB A;  4NGR A;  1TKF A;  2POK A;  3PEI A;  5CBM A;  4Q7A A;  3KL9 A;  2PIZ A;  3I6S A;  3FEE A;  2RB7 A;  3D67 A;  1VHE A;  4ZI6 A;  4P4I A;  2PJ0 A;  1AMP A;  1Y0Y A;  2CF4 A;  6CPA A;  1QMU A;  4X8I A;  3D7H A;  2ZOF A;  2EK9 A;  4ZX8 A;  3IEH A;  3WC7 A;  1Y7E A;  3FEC A;  4OC5 A;  4NGM A;  1FT7 A;  1YW6 A;  4MHN A;  2WYR A;  2C1C A;  1PCA A;  3B3C A;  5D8N A;  3VTA A;  2XEI A;  5LRK A;  3S9N A;  4MHZ A;  3WC6 A;  2HB6 A;  1HDQ A;  3PBE A;  3WT4 A;  2PJ4 A;  4NFR A;  4UEZ A;  1LOK A;  3B3V A;  3VAR A;  4KNG E;  5ELY A;  4C9V A;  2ANP A;  1CPX A;  4C9R A;  2HC9 A;  3IIB A;  1F57 A;  3WAB A;  2AFW A;  1ARL A;  5LYL A;  4TJV A;  2OR4 A;  2Q43 A;  4P4E A;  4ZY0 A;  3H8G A;  4C99 A;  3NH8 A;  3KHZ A;  3SJF A;  4F8Z A;  3IC1 A;  3SI0 A;  4KSI A;  4ZX9 A;  3B3S A;  4TNU A;  2PIY A;  2J9A A;  1WVM A;  3HLP A;  3EIF A;  3NA6 A;  3KZW A;  4MCS A;  2BCO A;  3PB8 X;  5JH9 A;  1YSJ A;  1CP6 A;  4UEE A;  5K8M A;  1F2O A;  3KR5 A;  2ZEL A;  4A38 A;  1XJO A;  1VIX A;  4P6Y A;  3S9L A;  3FX6 A;  1VHO A;  5THW A;  2VL1 A;  4P45 A;  3IO1 A;  1YLO A;  2PJ8 A;  4X2T A;  3NFZ A;  4A37 A;  2IJZ A;  4OC4 A;  4JYW A;  1ZLI A;  5CPA A;  4C84 A;  3FVL A;  4NGQ A;  3RAM A;  4AXV A;  4DUK A;  3SI2 A;  2V77 A;  4ZY2 A;  2PJ5 A;  2BOA A;  5HVF A;  2GU2 A;  3PRT A;  2AFS A;  4YN3 A;  3FJU A;  2AFO A;  1CBX A;  3H8E A;  2Q51 A;  2JBJ A;  1R3N A;  4OKO A;  4UIA A;  4YWY A;  3LWU A;  2C6P A;  3KQX A;  3ISX A;  2RFH A;  3KAS A;  2PJ6 A;  4C8C A;  1H8L A;  3B3T A;  2I3C A;  2F8H A;  1F2P A;  1BAV A;  1GYT A;  4OC3 A;  2PJA A;  2QJ8 A;  4F9V A;  1R43 A;  1Y9Z A;  2G9D A;  3PB6 X;  1VGY A;  1TKH A;  4OC0 A;  2GLF A;  2QVP A;  4NGN A;  4MHP A;  3BI0 A;  2PJ9 A;  4FAI A;  2O53 A;  3JRU A;  5K8O A;  7CPA A;  3VAT A;  4ONW A;  4OC1 A;  3S9M A;  4X3R A;  4WJB A;  3PB7 X;  2PJ3 A;  4DYO A;  1Q7L A;  4PXB A;  3NH4 A;  4C9U A;  2IQ6 A;  4MHY A;  1DTD A;  3FF3 A;  2PE3 A;  1YW4 A;  2FVG A;  3D7D A;  4K3N A;  3KGQ A;  4F9U A;  2NSM A;  2PVV A;  1QQ9 A;  3GB0 A;  1JQG A;  3FED A;  3D7F A;  2ZEM A;  4R8F A;  4P44 A;  4PXD A;  3LMS A;  1LFW A;  3PFO A;  3B3W A;  2GRE A;  1CX8 A;  5LRJ A;  1Z8L A;  1NSA A;  2BO9 A;  2V8G A;  3IWW A;  3DGV A;  3PB9 X;  1LCP A;  4PPZ A;  4FWU A;  3TC8 A;  1RTQ A;  2ZED A;  4C9A A;  1IY7 A;  4LQG A;  4P4F A;  4P4B A;  2PJ2 A;  2ZEN A;  4C85 A;  1HEE A;  4TJX A;  1IGB A;  3HUV A;  2EWB A;  3KR4 A;  3D7G A;  1PYT B;  3TX8 A;  4C8F A;  4Z65 A;  1LAP A;  4OME A;  2Q4Z A;  3QNV A;  1CG2 A;  2AFU A;  2ZEO A;  4UF4 A;  3I74 A;  1OBR A;  2ZEP A;  4DJL A;  2NYQ A;  3NH5 A;  3ISZ A;  1ARM A;  4R7M A;  3B7I A; 
#chains in the Genus database with same CATH topology
 4R6T A;  3PGP A;  3G3S A;  4MCP A;  3WC5 A;  3S6H A;  2FSR A;  2CTB A;  4GXH A;  4NGP A;  5HKY A;  1V6C A;  3PT1 A;  2AFX A;  2EK8 A;  3CT9 A;  1UWY A;  5HXD A;  5LYF A;  1S7N A;  3D66 A;  2ZW4 A;  3T05 A;  4MJ8 A;  1IID A;  4I49 A;  4MMO A;  4UCP A;  5JPH A;  3O8Z A;  1Y0R A;  1VHS A;  4A2Z A;  1XFO A;  4C68 A;  5JQ4 A;  4Y49 B;  1XOV A;  2JEW A;  3DSB A;  3SHP A;  1CM0 A;  2BUE A;  4CYQ A;  5HVG A;  3MN8 A;  2HWG A;  2MP0 A;  3KHX A;  4DUK A;  2ABZ A;  1U6M A;  2CXA A;  3EZE A;  2D4P A;  1RO5 A;  2OZH A;  2Q7B A;  4CAX A;  2ZEH A;  2OU2 A;  2B5G B;  4F6A A;  4G1P A;  3KQZ A;  4A4B A;  4L89 A;  3PBB A;  5HVH A;  1OZP A;  3DR8 A;  3H5Z A;  1ZRS A;  4YU9 A;  2XEG A;  2O4H A;  2PJC A;  1PUA A;  3F0A A;  2Z10 A;  4LX9 A;  3L2N A;  3FMC A;  4BPX B;  3PLF B;  1XMB A;  5GCN A;  3KKW A;  3ICU A;  4O23 A;  4UWI A;  4CS0 B;  1ZLH A;  1EZA A;  1CPS A;  4EFD A;  1Z2L A;  2V8D A;  4U5Y A;  4A32 A;  4AVA A;  1ZG8 A;  4GPL B;  1IB1 E;  2GLJ A;  4J0N A;  4A31 A;  1ZG9 A;  5JGF A;  4E5S A;  3BUW B;  4FBE A;  1XBU A;  2AFM A;  5KTA A;  2Z3P A;  1HDU A;  1TF9 A;  2CIJ A;  4CGP A;  5I4M A;  3PFV A;  2FT0 A;  2K5T A;  2PCU A;  1S3Z A;  4E2A A;  4F0X A;  5JM6 A;  4MY0 A;  5LYI A;  2P0W A;  2REE A;  2C6G A;  4ZYQ A;  1EE3 P;  4MCQ A;  1FNO A;  1YVO A;  4PXE A;  4EME A;  4IHM A;  3BJ7 A;  4KOW A;  3K9T A;  4BMH A;  4JWP A;  3DLJ A;  4C8U A;  5G22 A;  3RBU A;  2ZXV A;  2GP4 A;  1N71 A;  3V8I A;  2V8V A;  4UA3 A;  4UCN A;  2QEC A;  2ZOG A;  3K2K A;  3BXM A;  4ZY1 A;  3S6G A;  4C2Y A;  4C2X A;  1B6B A;  3SJG A;  2PRQ A;  3CXS A;  2CY2 A;  4JZ0 A;  4MBU A;  1TKJ A;  3I1U A;  5K99 A;  1ELM P;  1YQE A;  2VQY A;  4H89 A;  2VZY A;  4C9E A;  4IAV A;  2PJ7 A;  2B4J C;  3H8F A;  4RS2 A;  4IIY A;  2XPN A;  3JVN A;  4OAE A;  3GJZ A;  2OZG A;  4FUU A;  5DS0 A;  1KUX A;  4C8A A;  5F09 A;  2YJV A;  1XF1 A;  1DE4 C;  3SJE A;  2VBQ A;  1IU8 A;  4XNH B;  1IYK A;  1ZG7 A;  5FD8 A;  3D4U A;  4CDJ A;  4BD9 A;  2F7V A;  3F9K C;  1TXR A;  1BPN A;  1M4L A;  4A94 A;  2R7H A;  1AYE A;  1KWM A;  3H4Q A;  4B6Z A;  8CPA A;  3GUX A;  1V0C A;  1Z5R A;  2P6F A;  5LRG A;  5FVJ A;  3BHX A;  5AG6 A;  2PCN A;  3SJX A;  4R57 A;  4CPA A;  2B5G A;  4KUA A;  4PQA A;  4RUH A;  4C8P A;  5IB9 A;  3S6K A;  4R7M A;  1LAN A;  4NSQ A;  3RO0 A;  3W6S A;  4OID A;  2VI7 A;  4COG A;  2Q44 A;  4R3L A;  5KTC A;  3B35 A;  2FS5 A;  4H2K A;  1NMT A;  3CPA A;  4ONU A;  4UCM A;  1Z8W A;  5J1Q A;  1ELL P;  3OB2 B;  3CDX A;  4OP4 A;  4CGL A;  1XRY A;  3B8G A;  3DDD A;  1I1D A;  4PXC A;  3BI1 A;  2DEA A;  2PVW A;  3BUO B;  2N3A B;  2B4B A;  3PFE A;  3PZJ A;  4Q38 A;  4TWE A;  3CZX A;  1T36 B;  5AG4 A;  4W9Y A;  2XPO A;  1I12 A;  4P4J A;  4OIW A;  1NSL A;  4YFJ A;  2G0B A;  1ON0 A;  3R9G A;  3TLZ A;  3TE4 A;  1Y9K A;  1JDE A;  2PR1 A;  4NJQ A;  4NF1 A;  2Q7S A;  3V38 A;  4IIX A;  4P4D A;  2GE3 A;  4HNW B;  4MFZ A;  3FIX A;  4E94 A;  2C27 A;  3CPX A;  2B0A A;  2DIK A;  4M3S A;  4R76 A;  3T8W A;  4NGT A;  1CJW A;  5LYD A;  1IOF A;  2VKZ G;  2EO8 A;  2REF A;  4NGS A;  4KSA A;  3EO4 A;  1YME A;  3IFE A;  3R9F A;  1LAM A;  3SI1 A;  4C86 A;  4MXU A;  1X12 A;  5C88 A;  3VGO A;  1GHE A;  4XPK A;  2WZN A;  2JBK A;  1JDB C;  2OZU A;  2Q04 A;  2EZB A;  1BLL E;  3CXP A;  2CTC A;  2NMT A;  1YVH A;  4JJX A;  2EZA A;  1BPM A;  4MRI A;  3JUW A;  4UEF A;  5J8F A;  5K8N A;  2HRO A;  4C8T A;  2FIA A;  4B11 A;  3EXN A;  1LRZ A;  3KI9 A;  4BIN A;  2XEJ A;  3P2H A;  4UIB A;  3RZA A;  4B13 A;  2QIR A;  3NE8 A;  2BSW A;  2ZW6 A;  4CRY B;  2AFZ A;  3QAH A;  5K8P A;  4EYS A;  5F49 A;  1EZB A;  1XF8 A;  2YND A;  4ORF A;  4A39 A;  1RXT A;  3B2Y A;  2IMO A;  2OLS A;  2WUU A;  4BBH A;  4NJR A;  4A95 A;  3GIU A;  4H6U A;  3EZA A;  4MFP A;  4R3K A;  5IB0 A;  3PB4 X;  3MRU A;  3FH4 A;  3GLJ A;  2CBL A;  2X0S A;  4NCZ A;  2PJ1 A;  2C6C A;  4P10 A;  2EVN A;  3K4I A;  2GFQ A;  4WWV A;  2C5Q A;  2G3A A;  3VH9 A;  2XEF A;  2J8R A;  2HQY A;  5AGE A;  1CP7 A;  2ZEE A;  3N5F A;  5KTD A;  1KC7 A;  3D68 A;  2OOT A;  5D29 A;  2GAN A;  5HKZ A;  2QYV A;  3JTK A;  2ZEF A;  4IK2 A;  3TOA A;  2ODF A;  3IJ3 A;  4AB7 A;  2D0O A;  2Z0Z A;  5H84 A;  3TOB A;  5G20 A;  3T5M A;  2HUZ A;  2V8H A;  2ZEG A;  4MI1 A;  3EIF A;  2XPP A;  2RC4 A;  3TYX A;  4OC2 A;  1TF8 A;  4F0Y A;  4EWT A;  1WJT A;  2B3V A;  3R1K A;  4MCR A;  3V7Z A;  1M4G A;  1Z9U A;  2Q0Y A;  3RYO A;  4GM5 A;  1XEB A;  2PJB A;  1Q5X A;  1GGO A;  4NGR A;  4AG7 A;  1AUG A;  1WK4 A;  4CAW A;  2AUM A;  1TKF A;  1P0H A;  2POK A;  2Z3L A;  4BTF A;  3PEI A;  1UFH A;  4M6I A;  5CBM A;  2AUN A;  4Q7A A;  3KL9 A;  3D3S A;  5DWM A;  2PIZ A;  3I6S A;  4M85 A;  1MK4 A;  3GYA A;  3FEE A;  1J3L A;  2RB7 A;  3D67 A;  1BO4 A;  2WPX A;  3ZNI A;  1VHE A;  1YR0 A;  4HNX B;  3SXN A;  4A33 A;  4B10 A;  4P4I A;  4ZI6 A;  3TO9 A;  4NXY A;  4CYP A;  2PJ0 A;  5A28 A;  3BUM B;  1AMP A;  4J3G A;  4MHD A;  1Y0Y A;  3ZJ0 A;  1YX0 A;  1Y7R A;  3FXT A;  3VRO A;  3HMJ G;  1XIX A;  2CF4 A;  4B5P B;  2D0P A;  6CPA A;  4KLW A;  1QMU A;  4X8I A;  2P6G A;  3D7H A;  2BL1 A;  2EK9 A;  2ZOF A;  3RNZ A;  4MJX A;  3TLC A;  4ZX8 A;  3IEH A;  3UY5 A;  1ZL0 A;  1KEE B;  2X7B A;  3WC7 A;  4YGO A;  4CYO A;  1Y7E A;  1M4D A;  3OP0 A;  3TO6 A;  1Z4E A;  5F5X A;  4CZ1 A;  3FEC A;  2PDO A;  1YK3 A;  4CDK A;  5IX3 A;  4GS4 A;  1SQH A;  4BPW B;  4OC5 A;  4PK2 A;  4XPL A;  4NGM A;  1FT7 A;  3IGR A;  1YW6 A;  4KOT A;  1BOB A;  3R96 A;  3KRV A;  4CGN A;  4MHN A;  3LOD A;  5I0C A;  2VZZ A;  4M6H A;  4MFQ A;  5C82 A;  5IV0 A;  5HKW A;  2YNE A;  2Z3N A;  3OB1 B;  4AVB A;  2WYR A;  1ZO0 A;  4UFX A;  1VI4 A;  2Z3M A;  2C1C A;  3TLE A;  1PCA A;  3B3C A;  5D8N A;  2FIW A;  4MI4 A;  1NXJ A;  2XEI A;  2Y1N A;  5BY0 A;  3S9N A;  5LRK A;  4KOU A;  4MHZ A;  2HB6 A;  1HDQ A;  3PBE A;  2IL4 A;  2PJ4 A;  4NFR A;  3VWD A;  3WC6 A;  3WT4 A;  4KVO E;  4UEZ A;  3F8K A;  1LOK A;  3B3V A;  3GY9 A;  3VAR A;  2CNS A;  4RN7 A;  1DIK A;  2WSA A;  2FE7 A;  2CNT A;  4KNG E;  2HV2 A;  5ELY A;  4C9V A;  2ANP A;  5J3X A;  1CPX A;  4C9R A;  2JDD A;  4C2Z A;  4CRZ B;  2HC9 A;  1VBG A;  3IIB A;  1F57 A;  1Z8X A;  3WAB A;  5F47 A;  3VRN A;  3U88 C;  2JLM A;  4KOY A;  2Z11 A;  3F5B A;  2AFW A;  4CYN A;  4KLV A;  1ARL A;  1QSN A;  1Q2C A;  5LYL A;  3IWE A;  1NE9 A;  4C7I A;  4TJV A;  2OR4 A;  5A27 A;  4OLL A;  3T07 A;  2Q43 A;  1R57 A;  3K9U A;  4P4E A;  4ZY0 A;  1Y9W A;  3H8G A;  4C99 A;  3NH8 A;  3KHZ A;  1IYL A;  3SJF A;  4F8Z A;  2R8V A;  3IC1 A;  4KOR A;  4U9Y A;  3SI0 A;  4KSI A;  3HPH E;  4ZX9 A;  4B5P A;  3B3S A;  2AE6 A;  4TNU A;  4AG9 A;  4RI1 A;  2D4O A;  2OB0 A;  1B47 A;  2Y1M A;  2PIY A;  4XNH C;  2J9A A;  1Z4R A;  3HLP A;  4Q36 A;  3NA6 A;  1C3O B;  1WVM A;  1S60 A;  2BEI A;  2O28 A;  3KZW A;  4R9M A;  4LQ6 A;  4H1H A;  4MCS A;  2BCO A;  3PB8 X;  5JH9 A;  5EC4 A;  4KVM E;  1YSJ A;  1Z8T A;  1ZYM A;  1CP6 A;  4IUS A;  4UEE A;  5K8M A;  3NFQ A;  4QC6 A;  1F2O A;  1S5K A;  4QVT A;  3KR5 A;  2ZEL A;  3FYN A;  5EBV A;  4A38 A;  1XJO A;  1VIX A;  1MJA A;  4P6Y A;  3S9L A;  4HKF A;  3SR3 A;  4QUS A;  2ZPA A;  2B3U A;  4QB9 A;  4MFK A;  5AG7 A;  3FX6 A;  2Z3K A;  1VHO A;  5THW A;  1R61 A;  2VL1 A;  3I9S A;  4R87 A;  4P45 A;  3IO1 A;  1KZF A;  3OAK A;  4KVX A;  1YLO A;  3R9E A;  2WPW A;  3A9L A;  3VRP A;  2FCK A;  2J8N A;  3R95 A;  2P6E A;  1FY7 A;  1K4J A;  2PJ8 A;  4NEX A;  5F13 A;  3VRQ A;  4HNY B;  3NFZ A;  4X2T A;  4A37 A;  1P4N A;  2IJZ A;  4OC4 A;  4JYW A;  1ZLI A;  5CPA A;  4C84 A;  4NGQ A;  3FVL A;  2OH1 A;  3RAM A;  4AXV A;  1YLE A;  3BUX B;  2CNM A;  2R1I A;  4YRH A;  3IU1 A;  5DWN A;  3SI2 A;  1B87 A;  2V77 A;  1KUY A;  4JXR A;  5BWA B;  3NE7 A;  4ZY2 A;  2PJ5 A;  4A30 A;  2BOA A;  3VRR A;  5HVF A;  5IR2 A;  2B4D B;  4XPD B;  2GU2 A;  2PR8 A;  3PRT A;  2AFS A;  4YN3 A;  4PSW A;  3E0K A;  4Y49 C;  3FJU A;  1YRE A;  2PRB A;  4PK3 A;  1YVK A;  2AFO A;  1CBX A;  3H8E A;  4H6Z A;  1J4J A;  1YGH A;  2DPT A;  2Q51 A;  2Q4Y A;  4IF5 A;  4U9Z A;  1Q2D A;  2JBJ A;  3IWG A;  1R3N A;  4OKO A;  4UIA A;  2FM4 A;  4JD6 A;  3LWU A;  4YWY A;  2C6P A;  1KUV A;  1X10 A;  2J8M A;  2AJ6 A;  1A9X B;  1S7K A;  2PQ8 A;  3KQX A;  3ISX A;  3TTH A;  2RFH A;  4KS9 A;  2R82 A;  3KAS A;  5ISV A;  2DLA A;  4XPD C;  2PJ6 A;  4COB A;  4PSX A;  3C8O A;  4C8C A;  3G8W A;  1H8L A;  3TLA A;  5J8C A;  3B3T A;  2I3C A;  3LD2 A;  1QSM A;  2F8H A;  4QBJ A;  1F2P A;  1BAV A;  3PP9 A;  3VTA A;  4E8O A;  2R98 A;  1XMT A;  1GYT A;  4UBR A;  3W91 A;  4OC3 A;  1M44 A;  4CO9 A;  3GKR A;  1S7F A;  2PJA A;  2YNC A;  4JLY A;  4B5O A;  2QJ8 A;  2ARH A;  4F9V A;  1R43 A;  3LAC A;  5CNP A;  4MFJ A;  4M6G A;  1BXR B;  2G9D A;  1Y9Z A;  3PB6 X;  1VGY A;  2EBJ A;  2FL4 A;  1TKH A;  3MGD A;  4OC0 A;  2GLF A;  4UFW A;  3TFY A;  2PSW A;  4NGN A;  2QVP A;  4FD5 A;  4FD7 A;  4MHP A;  4KOV A;  3BI0 A;  2PJ9 A;  4C7H A;  4FAI A;  2O53 A;  3JRU A;  1I21 A;  5K8O A;  4CAF A;  1S7L A;  1QST A;  3VAT A;  7CPA A;  5F1Y A;  2DXQ A;  3TO7 A;  4ONW A;  4JVO A;  4OC1 A;  3S9M A;  3QB8 A;  4MFL A;  4UFV A;  1EO0 A;  4B12 A;  4X3R A;  4WJB A;  1CE8 B;  3PB7 X;  2PJ3 A;  4DYO A;  1Q7L A;  4PXB A;  4ZGY B;  1M6V B;  1PU9 A;  3NH4 A;  4C9U A;  3TCV A;  2QML A;  2A4N A;  5JVL A;  2IQ6 A;  2PC1 A;  2JEV A;  3TLB A;  4MHY A;  1MJ9 A;  1M1D A;  1DTD A;  3FF3 A;  2DF5 A;  2F5I A;  2EZC A;  2PE3 A;  3SXO A;  1YW4 A;  2FVG A;  2H5M A;  3D7D A;  1L0C A;  2Q4V A;  4K3N A;  2XPL A;  3KGQ A;  4F9U A;  2NSM A;  1IOI A;  3TLY A;  2PVV A;  3N7Z A;  4KOS A;  1QQ9 A;  4PV6 A;  3EC4 A;  1MJB A;  3GB0 A;  1JQG A;  3T90 A;  3FED A;  2GIV A;  4X5K A;  2DPS A;  4KOX A;  4KUB A;  4CAV A;  3D7F A;  3EY5 A;  4UWJ A;  3EZB A;  3S6F A;  4FD6 A;  4K30 A;  2ZEM A;  4R8F A;  1QSR A;  4M8D A;  4ZBG A;  3OWC A;  4AVC A;  4P44 A;  4KZT A;  1CS0 B;  3QAY A;  4PXD A;  2KCW A;  3LMS A;  1LFW A;  3DR6 A;  3T0T A;  1TIQ A;  2ZW5 A;  3PFO A;  1M4I A;  3U1B A;  3B3W A;  2GRE A;  2VEZ A;  3HPG G;  1CX8 A;  4OAD A;  4HPS A;  5G21 A;  3I3G A;  1JWQ A;  5LRJ A;  1NBW A;  4CGO A;  1Z8L A;  1NSA A;  2BO9 A;  3D2M A;  4KSF A;  2V8G A;  5F48 A;  2YJT A;  3IWW A;  5AXI A;  1IIC A;  3FNC A;  4FD4 A;  4JXQ A;  3DGV A;  3TT2 A;  3PB9 X;  2VXK A;  1LCP A;  3BUN B;  4PPZ A;  4FWU A;  5H86 A;  3TC8 A;  4II9 A;  1RTQ A;  2B4D A;  5EMI A;  1VBH A;  3T9Y A;  3P2F A;  2ZED A;  4C9A A;  4MY3 A;  1IY7 A;  4LQG A;  3BJ8 A;  4P4F A;  2EUI A;  4P4B A;  4CGM A;  2PJ2 A;  2ZEN A;  3VWE A;  4C85 A;  5HMN A;  3NOJ A;  1HEE A;  4RR2 B;  2ZW7 A;  4TJX A;  5JYB A;  1IGB A;  3HUV A;  2EWB A;  4L8A A;  3KR4 A;  2UV8 G;  4A4C A;  2YNC C;  3D7G A;  3EFA A;  4DNC A;  2Z3O A;  1C30 B;  2HI6 A;  2FXF A;  2Y0M A;  3G23 A;  3FBU A;  3ZZI A;  1PYT B;  2I00 A;  3TX8 A;  5F9M A;  4C8F A;  5HH1 A;  5G1Z A;  3BLN A;  2JDC A;  1A2Z A;  4Z65 A;  3TLG B;  1VKC A;  5F46 A;  4E0A A;  3TLG A;  4EVY A;  1LAP A;  3DNS A;  2I79 A;  1KBL A;  4B14 A;  4OME A;  2B58 A;  2Q4Z A;  3QNV A;  2YGW A;  1CG2 A;  2AFU A;  4INJ A;  2ZEO A;  3W6X A;  4UF4 A;  3I74 A;  1OBR A;  3FB3 A;  2ZEP A;  4DJL A;  1Z9E A;  5E96 A;  3IU2 A;  1Q2Y A;  1QSO A;  3CXQ A;  2ATR A;  4BPU B;  2NYQ A;  3D2P A;  3NH5 A;  2G3T A;  5AG5 A;  3ISZ A;  3C26 A;  4CAE A;  1XE4 A;  1ARM A;  3FRM A;  1FBV A;  4LUA A;  1WWZ A;  3B7I A;  2E28 A;  3WR7 A;  3D8P A; 
#chains in the Genus database with same CATH homology
 4R6T A;  4MCP A;  3WC5 A;  2CTB A;  4NGP A;  1V6C A;  2AFX A;  2EK8 A;  3CT9 A;  1UWY A;  5HXD A;  5LYF A;  3D66 A;  4MMO A;  1Y0R A;  1XFO A;  2JEW A;  5HVG A;  3MN8 A;  3KHX A;  2ABZ A;  2ZEH A;  4G1P A;  3KQZ A;  3PBB A;  5HVH A;  4YU9 A;  2XEG A;  2O4H A;  2PJC A;  3L2N A;  3FMC A;  1XMB A;  3ICU A;  4O23 A;  1ZLH A;  1CPS A;  4EFD A;  1Z2L A;  2V8D A;  1ZG8 A;  2GLJ A;  1ZG9 A;  5JGF A;  4FBE A;  1XBU A;  2AFM A;  1HDU A;  1TF9 A;  2CIJ A;  5I4M A;  2PCU A;  5JM6 A;  5LYI A;  2C6G A;  4ZYQ A;  1EE3 P;  4MCQ A;  1FNO A;  4EME A;  4PXE A;  4IHM A;  3K9T A;  3DLJ A;  4C8U A;  3RBU A;  2GP4 A;  2V8V A;  3K2K A;  2ZOG A;  3BXM A;  4ZY1 A;  3SJG A;  2PRQ A;  4JZ0 A;  1TKJ A;  3I1U A;  1ELM P;  4C9E A;  4IAV A;  2PJ7 A;  3H8F A;  4FUU A;  5DS0 A;  4C8A A;  5F09 A;  1XF1 A;  1DE4 C;  3SJE A;  4CDJ A;  1ZG7 A;  3D4U A;  4BD9 A;  2F7V A;  1TXR A;  1BPN A;  1M4L A;  4A94 A;  1AYE A;  1KWM A;  4B6Z A;  8CPA A;  3GUX A;  1Z5R A;  5LRG A;  3BHX A;  3SJX A;  4CPA A;  4PQA A;  4C8P A;  4RUH A;  5IB9 A;  1LAN A;  4OID A;  3B35 A;  4H2K A;  3CPA A;  5J1Q A;  1ELL P;  3CDX A;  4OP4 A;  1XRY A;  4PXC A;  3BI1 A;  2DEA A;  2PVW A;  3PFE A;  4TWE A;  4W9Y A;  4P4J A;  4OIW A;  4NJQ A;  3V38 A;  4P4D A;  3CPX A;  4R76 A;  3T8W A;  4NGT A;  5LYD A;  4NGS A;  1YME A;  3IFE A;  4C86 A;  1LAM A;  3SI1 A;  4MXU A;  2WZN A;  2JBK A;  1BLL E;  2CTC A;  4C8T A;  1BPM A;  4MRI A;  4UEF A;  5K8N A;  3KI9 A;  2XEJ A;  4UIB A;  3RZA A;  5K8P A;  2AFZ A;  4A39 A;  3B2Y A;  2IMO A;  4NJR A;  3PB4 X;  3MRU A;  3FH4 A;  3GLJ A;  2PJ1 A;  2C6C A;  4P10 A;  4WWV A;  2C5Q A;  3VH9 A;  2XEF A;  1CP7 A;  2ZEE A;  3N5F A;  3D68 A;  2OOT A;  5D29 A;  2QYV A;  4CDK A;  2ZEF A;  4IK2 A;  3IJ3 A;  2V8H A;  2ZEG A;  4OC2 A;  1TF8 A;  4EWT A;  4MCR A;  3V7Z A;  4GM5 A;  2PJB A;  4NGR A;  1TKF A;  2POK A;  3PEI A;  5CBM A;  4Q7A A;  3KL9 A;  2PIZ A;  3I6S A;  3FEE A;  2RB7 A;  3D67 A;  1VHE A;  4ZI6 A;  4P4I A;  2PJ0 A;  1AMP A;  1Y0Y A;  2CF4 A;  6CPA A;  1QMU A;  4X8I A;  3D7H A;  2ZOF A;  2EK9 A;  4ZX8 A;  3IEH A;  3WC7 A;  1Y7E A;  3FEC A;  4OC5 A;  4NGM A;  1FT7 A;  1YW6 A;  4MHN A;  2WYR A;  2C1C A;  1PCA A;  3B3C A;  5D8N A;  3VTA A;  2XEI A;  5LRK A;  3S9N A;  4MHZ A;  3WC6 A;  2HB6 A;  1HDQ A;  3PBE A;  3WT4 A;  2PJ4 A;  4NFR A;  4UEZ A;  1LOK A;  3B3V A;  3VAR A;  4KNG E;  5ELY A;  4C9V A;  2ANP A;  1CPX A;  4C9R A;  2HC9 A;  3IIB A;  1F57 A;  3WAB A;  2AFW A;  1ARL A;  5LYL A;  4TJV A;  2OR4 A;  2Q43 A;  4P4E A;  4ZY0 A;  3H8G A;  4C99 A;  3NH8 A;  3KHZ A;  3SJF A;  4F8Z A;  3IC1 A;  3SI0 A;  4KSI A;  4ZX9 A;  3B3S A;  4TNU A;  2PIY A;  2J9A A;  1WVM A;  3HLP A;  3EIF A;  3NA6 A;  3KZW A;  4MCS A;  2BCO A;  3PB8 X;  5JH9 A;  1YSJ A;  1CP6 A;  4UEE A;  5K8M A;  1F2O A;  3KR5 A;  2ZEL A;  4A38 A;  1XJO A;  1VIX A;  4P6Y A;  3S9L A;  3FX6 A;  1VHO A;  5THW A;  2VL1 A;  4P45 A;  3IO1 A;  1YLO A;  2PJ8 A;  4X2T A;  3NFZ A;  4A37 A;  2IJZ A;  4OC4 A;  4JYW A;  1ZLI A;  5CPA A;  4C84 A;  3FVL A;  4NGQ A;  3RAM A;  4AXV A;  4DUK A;  3SI2 A;  2V77 A;  4ZY2 A;  2PJ5 A;  2BOA A;  5HVF A;  5IR2 A;  2GU2 A;  3PRT A;  2AFS A;  4YN3 A;  3FJU A;  2AFO A;  1CBX A;  3H8E A;  2Q51 A;  2JBJ A;  1R3N A;  4OKO A;  4UIA A;  4YWY A;  3LWU A;  2C6P A;  3KQX A;  3ISX A;  2RFH A;  3KAS A;  2PJ6 A;  4C8C A;  1H8L A;  3B3T A;  2I3C A;  2F8H A;  1F2P A;  1BAV A;  1GYT A;  4OC3 A;  2PJA A;  2QJ8 A;  4F9V A;  1R43 A;  1Y9Z A;  2G9D A;  3PB6 X;  1VGY A;  1TKH A;  4OC0 A;  2GLF A;  2QVP A;  4NGN A;  4MHP A;  3BI0 A;  2PJ9 A;  4FAI A;  2O53 A;  3JRU A;  5K8O A;  7CPA A;  3VAT A;  4ONW A;  4OC1 A;  3S9M A;  4X3R A;  4WJB A;  3PB7 X;  2PJ3 A;  4DYO A;  1Q7L A;  4PXB A;  3NH4 A;  4C9U A;  2IQ6 A;  4MHY A;  1DTD A;  3FF3 A;  2PE3 A;  1YW4 A;  2FVG A;  3D7D A;  4K3N A;  3KGQ A;  4F9U A;  2NSM A;  2PVV A;  1QQ9 A;  3GB0 A;  1JQG A;  3FED A;  3D7F A;  2ZEM A;  4R8F A;  4P44 A;  4PXD A;  3LMS A;  1LFW A;  3PFO A;  3B3W A;  2GRE A;  1CX8 A;  5LRJ A;  1Z8L A;  1NSA A;  2BO9 A;  2V8G A;  3IWW A;  3DGV A;  3PB9 X;  1LCP A;  4PPZ A;  4FWU A;  3TC8 A;  1RTQ A;  2ZED A;  4C9A A;  1IY7 A;  4LQG A;  4P4F A;  4P4B A;  2PJ2 A;  2ZEN A;  4C85 A;  1HEE A;  4TJX A;  1IGB A;  3HUV A;  2EWB A;  3KR4 A;  3D7G A;  1PYT B;  3TX8 A;  4C8F A;  4Z65 A;  1LAP A;  4OME A;  2Q4Z A;  3QNV A;  1CG2 A;  2AFU A;  2ZEO A;  4UF4 A;  3I74 A;  1OBR A;  2ZEP A;  4DJL A;  2NYQ A;  3NH5 A;  3ISZ A;  1ARM A;  4R7M A;  3B7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...