2JBJA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with 2-pmpa (2-phosphonomethyl-pentanedioic acid)
Total Genus 253
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
253
sequence length
694
structure length
687
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title Human Glutamate Carboxypeptidase II Inhibition: Structures of Gcpii in Complex with Two Potent Inhibitors, Quisqualate and 2-Pmpa.
pubmed doi rcsb
source organism Homo sapiens
total genus 253
structure length 687
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2jbjA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2jbjA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2jbjA02
3PB9X 3FMCA 2NYQA 1R3NA 2EWBA 1TXRA 1LAPA 3FX6A 2BCOA 3IC1A 1XMBA 2XEIA 1LCPA 4LQGA 2PIZA 2QVPA 2C6CA 3D7FA 3JRUA 3B2YA 4UIAA 5I4MA 3BXMA 1F2PA 2IJZA 2CF4A 3KR4A 3VTAA 1WVMA 1LAMA 4OC5A 2PJ1A 7CPAA 2DEAA 4PXDA 4A39A 2PJCA 1IGBA 3N5FA 2PIYA 4P6YA 1TKFA 4TWEA 4Z65A 4ZYQA 1Z8LA 2WZNA 2ZEMA 3IEHA 4C86A 4OC1A 3BHXA 1VGYA 4IHMA 5CPAA 1YW6A 3SJXA 3HLPA 4NGSA 1BLLE 4MMOA 3FEDA 1ARMA 3DLJA 3V38A 5CBMA 2ZEEA 2WYRA 1VHEA 4P45A 4FBEA 4C9RA 3K2KA 1LFWA 2ABZA 2ZELA 1YMEA 3HUVA 3D7DA 3NH8A 3PEIA 3FEEA 1Y0YA 4ZY1A 3IIBA 4C84A 2AFZA 4OKOA 4PPZA 1CPXA 1ELLP 3KL9A 1M4LA 1ZG8A 5JH9A 1HDQA 3FH4A 3B3TA 3QNVA 2PJ5A 4KNGE 3KHXA 5K8NA 2C6GA 4YN3A 3PB7X 3FECA 4DJLA 2G9DA 2PE3A 3KGQA 3B3CA 4JYWA 5HVFA 1QMUA 3SI0A 2AFWA 4PXEA 3D66A 2POKA 3D7GA 4C8PA 3BI1A 1ELMP 3CT9A 4YU9A 8CPAA 5K8OA 4MHZA 2OOTA 2GLFA 5LYIA 1VHOA 5JGFA 1IY7A 1XJOA 4MCPA 2AFUA 2V8DA 2BO9A 4KSIA 5JM6A 3IO1A 2C6PA 2ZEFA 3LMSA 2PRQA 4NGMA 4X3RA 3PB8X 4OIWA 4P4BA 4F9UA 3TC8A 1CP7A 1YSJA 3VH9A 1RTQA 1AYEA 2PCUA 3CPAA 4C8TA 3PB4X 1ARLA 4F9VA 1BPMA 4DYOA 1F2OA 1CPSA 4EFDA 2JBKA 2NSMA 4FWUA 4C9EA 2Q51A 4R8FA 4C8FA 3H8GA 2AFMA 4RUHA 1CP6A 3B3WA 3FF3A 4P4FA 3GB0A 4C8CA 3SI2A 4OC2A 4MHNA 5IB9A 4P4JA 2AFSA 5LYDA 5K8PA 4NGPA 4ZX9A 3SJFA 1XFOA 4C9AA 2ZEDA 4A94A 3RBUA 5K8MA 1YW4A 1AMPA 4P44A 2GLJA 3KQXA 3SI1A 3ISXA 4AXVA 3D7HA 1TKHA 2EK8A 3NFZA 4PXBA 1TF9A 4P4DA 2PJ3A 1LANA 3D4UA 4CPAA 4A37A 2CTCA 5LRJA 3KHZA 2PJ9A 1ZLIA 1BAVA 2V8VA 2CIJA 5ELYA 2Q4ZA 2GREA 2C1CA 4X2TA 2J9AA 2O4HA 2ZEGA 4IAVA 4UEZA 1KWMA 2XEJA 4ONWA 4MRIA 4C9UA 3PRTA 4UF4A 3V7ZA 4C9VA 1NSAA 3L2NA 3NA6A 4EMEA 4W9YA 4F8ZA 3ICUA 1EE3P 3FVLA 5D29A 5LYFA 5HXDA 2ZENA 2ZEHA 1VIXA 4K3NA 2O53A 4MCSA 4OC3A 4C8UA 3ISZA 3K9TA 5DS0A 4R6TA 3I1UA 4R7MA 1DE4C 3LWUA 2IQ6A 5J1QA 4NGRA 1GYTA 1Z5RA 5F09A 4DUKA 3WABA 4MCRA 4OMEA 3S9MA 1JQGA 1ZLHA 2F7VA 4C8AA 3CDXA 4FAIA 3MRUA 3B3SA 2I3CA 6CPAA 1FT7A 4P4EA 3SJGA 3KASA 2ANPA 1Y9ZA 2Q43A 1QQ9A 5THWA 4MXUA 4OIDA 3I74A 4TJVA 3SJEA 4G1PA 2BOAA 4O23A 2GU2A 4MHYA 2QJ8A 3I6SA 1PYTB 1FNOA 1XRYA 1YLOA 1Y0RA 2IMOA 3B7IA 3RAMA 1ZG7A 3WT4A 4B6ZA 1PCAA 3B35A 3H8EA 2RFHA 4ZX8A 2V8HA 1DTDA 4OP4A 2PJ7A 2PJAA 1XBUA 3S9LA 2AFXA 2JEWA 1CX8A 4GM5A 3NH4A 2EK9A 5LRGA 4R76A 2PJ8A 4C99A 2FVGA 2ZOGA 1UWYA 5LRKA 1CG2A 2F8HA 3B3VA 3WC7A 3VARA 2CTBA 4P4IA 4MHPA 4NFRA 1XF1A 4EWTA 4Q7AA 2ZOFA 3GUXA 5HVGA 1HEEA 3MN8A 5HVHA 4UIBA 1TF8A 4A38A 1HDUA 3S9NA 3BI0A 1Q7LA 4UEEA 2V8GA 3WC5A 2PJ6A 3PBBA 4OC4A 3PBEA 3TX8A 3RZAA 2VL1A 2RB7A 4IK2A 2PJ2A 4ZI6A 4YWYA 3H8FA 4BD9A 1Z2LA 3PB6X 4NJRA 4C85A 2AFOA 2V77A 3D68A 4PXCA 1LOKA 3IJ3A 3VATA 2HB6A 1F57A 2ZEOA 3EIFA 2ZEPA 4CDKA 3PFEA 4UEFA 4NGTA 3T8WA 1V6CA 4OC0A 4FUUA 2XEFA 2HC9A 4WJBA 1H8LA 1CBXA 4TNUA 3WC6A 2PVWA 3IFEA 3D67A 3KR5A 1OBRA 3DGVA 5LYLA 1TKJA 5D8NA 3PFOA 3KI9A 4TJXA 1Y7EA 4NGQA 4H2KA 3GLJA 4ZY2A 3IWWA 2PJ0A 4CDJA 1R43A 3FJUA 4NGNA 4P10A 1ZG9A 4JZ0A 4MCQA 2PVVA 4ZY0A 3KZWA 3NH5A 4PQAA 2PJ4A 4NJQA 2OR4A 4X8IA 4WWVA 2JBJA 2XEGA 3CPXA 1BPNA 2QYVA 3KQZA 2PJBA
chains in the Genus database with same CATH superfamily
1SQHA 4QC6A 4MI1A 3TLGB 2GE3A 3PB9X 3FMCA 2NYQA 4KORA 3IU1A 4AVCA 1X10A 3QAHA 4PK3A 1M6VB 1KZFA 3CXPA 1R3NA 1YQEA 2NMTA 1JWQA 2EWBA 1XE4A 2I79A 3TE4A 2D0OA 1TXRA 1LAPA 1M1DA 3FX6A 4JD6A 3OB1B 2BCOA 2DPSA 3HPGG 2VZZA 1XMBA 3IC1A 2EZAA 2B4DB 2XEIA 1LCPA 4LQGA 2OZHA 2PIZA 2C6CA 3D7FA 2QVPA 3B2YA 3JRUA 4UIAA 3SXOA 5BY0A 5I4MA 3BXMA 1F2PA 2IJZA 4B14A 2CF4A 3KR4A 4YFJA 4NSQA 1YVOA 1Q2YA 3VTAA 4AB7A 1WVMA 1LAMA 2ZW6A 4OC5A 4II9A 3D2PA 2PJ1A 4KOVA 5G21A 2PQ8A 7CPAA 2FL4A 2DEAA 4PXDA 4A39A 2EUIA 4M85A 4CGLA 2PJCA 1IGBA 3EC4A 3N5FA 3BUWB 2PIYA 4P6YA 1TKFA 2QMLA 4TWEA 2Z3KA 4Z65A 4ZYQA 1Z8LA 1IU8A 2IL4A 5IB0A 2WZNA 2ZEMA 4A2ZA 3IEHA 4C86A 4OC1A 3BHXA 3DNSA 1VGYA 1MK4A 1CJWA 5EC4A 5KTDA 5F5XA 4JLYA 4IHMA 5CPAA 4MFPA 2FSRA 1YW6A 1S7KA 1BXRB 4GS4A 3SJXA 3HLPA 4NGSA 4C68A 1BLLE 2D0PA 3D2MA 3TO6A 4MFLA 1YVHA 5AGEA 5A27A 4BTFA 4MMOA 3FEDA 4JXQA 2YJVA 1ARMA 1KUYA 4B12A 3DLJA 3V38A 3FYNA 2FCKA 3VROA 2DXQA 3H4QA 4LQ6A 3LACA 4R9MA 2Q7BA 4BPXB 2WYRA 2ZEEA 5A28A 1VHEA 4P45A 4FBEA 4MJXA 5FD8A 2ARHA 2QECA 5G20A 4C9RA 1LFWA 2ABZA 1IOFA 2ZELA 1YMEA 1N71A 1Z8XA 2EVNA 3HUVA 3D7DA 4UCPA 3I3GA 4HNXB 4E0AA 2Z3OA 3JUWA 4U9ZA 3NH8A 3PEIA 3FEEA 1Y0YA 4ZY1A 2PR1A 3IIBA 4C84A 4MHDA 2AFZA 4OKOA 1EO0A 1CPXA 1ELLP 4PPZA 5G22A 1L0CA 3KL9A 1M4LA 1Z9UA 1ZG8A 3EO4A 4B11A 1P0HA 2YJTA 3OB2B 2JEVA 5JH9A 3G8WA 2FIAA 1HDQA 4JWPA 4B13A 3FH4A 3B3TA 4UFVA 3QNVA 1CE8B 4AVBA 3TLYA 1AUGA 2PJ5A 3FXTA 4KNGE 3KHXA 2BEIA 3FBUA 4ONUA 3HMJG 5K8NA 2C6GA 4YN3A 3PB7X 4H89A 2Q7SA 3FECA 2Z3MA 1B6BA 4DJLA 2G9DA 3T0TA 1IIDA 1XF8A 2PE3A 3KGQA 4NCZA 3B3CA 1VHSA 4C7HA 4JYWA 3N7ZA 4H6ZA 5HVFA 4KOTA 4H6UA 1QMUA 3VWEA 2FIWA 2Q44A 2AFWA 2XPOA 2BSWA 3SI0A 3VWDA 3DR6A 3D66A 2POKA 4PXEA 3W91A 4KOYA 3D7GA 1M4IA 4C8PA 3BI1A 1ELMP 3TYXA 3CT9A 4COGA 5K99A 4KSAA 4YU9A 2B3VA 5ISVA 8CPAA 3TT2A 1NSLA 5K8OA 4MHZA 2OOTA 3DR8A 3ZZIA 2GLFA 5LYIA 1VHOA 5JGFA 3VGOA 1VKCA 1IY7A 3LD2A 1XJOA 4MCPA 2AFUA 2V8DA 3PZJA 5DWMA 4C2ZA 5JQ4A 2BO9A 4KSIA 4MI4A 3ZJ0A 4CYQA 2ZPAA 5JM6A 4UA3A 2R8VA 2C6PA 3IO1A 4KS9A 1S7FA 5AG4A 2ZEFA 3LMSA 2PRQA 4FD4A 4NGMA 1A2ZA 4X3RA 3PB8X 4JJXA 4OIWA 4U5YA 4P4BA 3K2KA 2EBJA 4F9UA 3IWEA 5AG5A 2C27A 5IX3A 5C82A 1J3LA 1GGOA 4H1HA 3TC8A 1Z9EA 3T05A 1CP7A 2J8RA 4M6HA 4BMHA 1YSJA 4BBHA 3U1BA 4UWJA 3VH9A 3ZNIA 1RTQA 3PT1A 1AYEA 2PCUA 2VI7A 3CPAA 4C8TA 4QVTA 3PB4X 3NFQA 3U88C 4U9YA 3EY5A 1ARLA 2CNSA 1FBVA 4F9VA 2AUNA 4NXYA 4CGPA 1Y7RA 4KLVA 1BPMA 4DYOA 4IUSA 1F2OA 4BINA 2XPNA 4KOXA 4HNWB 4A4CA 3NOJA 1IB1E 3F5BA 2R1IA 4FD6A 5F48A 4JVOA 3R9EA 4CS0B 1CPSA 3FNCA 5KTCA 1QSMA 4EFDA 2JBKA 2NSMA 4FWUA 4B10A 4C9EA 1Z8TA 2Q51A 4R8FA 2CBLA 4C8FA 4HPSA 3H8GA 4NEXA 2AFMA 3VRRA 2Q04A 4KZTA 4RUHA 2BUEA 5C88A 1CP6A 3I9SA 3B3WA 3FF3A 4P4FA 3GB0A 4R57A 4C8CA 3R96A 5H86A 1Q5XA 2GIVA 3IU2A 2Z10A 1Z4RA 2ZXVA 4Q38A 3SI2A 4OC2A 4MHNA 3CZXA 3BJ8A 4MY0A 5IB9A 3DSBA 4P4JA 1WK4A 2AFSA 2HUZA 2WSAA 5LYDA 5K8PA 3R1KA 4UFXA 1FY7A 5AG7A 4QBJA 1R57A 4NGPA 1EZAA 2EZBA 4ZX9A 4KVME 3SJFA 3GYAA 4INJA 1XFOA 4OAEA 4C9AA 1OZPA 2ZEDA 4LX9A 3RBUA 4R3KA 4A94A 3BUMB 5K8MA 5F9MA 5EMIA 4KOWA 1K4JA 1AMPA 1YW4A 5JPHA 4P44A 3BUNB 2GLJA 3VRPA 3KQXA 5AG6A 3SI1A 3TFYA 1QSOA 3ISXA 4KVOE 4CO9A 1DIKA 4AXVA 1XOVA 3D7HA 1TKHA 2EK8A 3NFZA 4PXBA 4A95A 4EVYA 1TF9A 4P4DA 4OLLA 4ZGYB 2HROA 4X5KA 1EZBA 2PJ3A 2YNEA 1LANA 3D4UA 4CPAA 4A37A 3GY9A 2CTCA 5LRJA 4ZBGA 4B5PA 4UCMA 2EO8A 4XPDC 2K5TA 3KHZA 2P6EA 5F49A 2PJ9A 1QSTA 3F0AA 1V0CA 3T5MA 3R9FA 3MGDA 1Z4EA 4COBA 4E5SA 2R98A 4PK2A 1ZLIA 2G0BA 5AXIA 1BAVA 2OZGA 2V8VA 4CAVA 2CIJA 2DPTA 4J3GA 1YVKA 5ELYA 1M4DA 3TLAA 2CNMA 1NE9A 1S3ZA 2Q4ZA 2GREA 4CYPA 4A31A 3TLEA 2C1CA 4UFWA 2J9AA 4X2TA 2O4HA 2KCWA 2PC1A 2ZEGA 4QUSA 4XPDB 4CRZB 3K4IA 4IAVA 1LRZA 3NE8A 4C2YA 1UFHA 3QAYA 4KSFA 4UEZA 1KWMA 2XEJA 3OP0A 4F6AA 4ONWA 3KKWA 4GXHA 4MFZA 4MRIA 3EZBA 3C26A 1YX0A 2FXFA 3F8KA 3PRTA 3TCVA 4AVAA 3GJZA 1Q2DA 4UF4A 5F13A 3V7ZA 4C9VA 1NSAA 4C9UA 1T36B 3L2NA 3NA6A 4EMEA 4W9YA 4F8ZA 2B0AA 3ICUA 2VKZG 4CZ1A 4MBUA 2Y1NA 1EE3P 5D29A 2ODFA 1I21A 2YNDA 2ZENA 3FVLA 2ZEHA 3NE7A 4CGNA 5HXDA 1VIXA 1JDEA 1VBGA 4KUAA 2VEZA 2P6FA 3W6SA 5JVLA 4K3NA 1I1DA 2WUUA 3OAKA 2O53A 4MCSA 4CYNA 4OC3A 3D3SA 1J4JA 1KUXA 5BWAB 2B4BA 4PV6A 4C8UA 4F0YA 2PRBA 4MFJA 3EZEA 2D4PA 5IR2A 3ISZA 4C2XA 3A9LA 3K9TA 5DS0A 4R6TA 3G3SA 5E96A 3I1UA 4R7MA 1DE4C 1MJBA 1YGHA 4HKFA 3LWUA 1MJ9A 2IQ6A 2DLAA 2PDOA 2RC4A 3K9UA 4NGRA 1GYTA 5DWNA 5J1QA 3TLCA 1Z5RA 5F09A 4DUKA 3WABA 1A9XB 3GIUA 4MCRA 4OMEA 3W6XA 5F47A 3S9MA 3JTKA 3RYOA 5HKWA 3F9KC 1B87A 1JQGA 1ZLHA 2F7VA 2G3AA 5J3XA 4C8AA 4GPLB 3CDXA 4FAIA 3S6KA 2G3TA 3MRUA 2HQYA 2Z0ZA 4DNCA 3B3SA 4CYOA 2I3CA 3FIXA 4UWIA 6CPAA 5IV0A 2EZCA 1FT7A 4Y49C 4P4EA 2REEA 5HKZA 4XPLA 4PSXA 3SJGA 2Q4YA 2BL1A 2X7BA 2C5QA 3KASA 2ANPA 4AG9A 1Y9ZA 2Q43A 1QQ9A 5THWA 4MXUA 3E0KA 2OZUA 4OIDA 3I74A 1VI4A 4TJVA 2MP0A 1S5KA 1VBHA 4MFKA 3SJEA 4G1PA 4CAEA 2XPPA 1U6MA 2BOAA 2QIRA 2GU2A 4MHYA 4O23A 5HMNA 2QJ8A 2VBQA 3I6SA 5CNPA 4QB9A 4MJ8A 1PYTB 1FNOA 1KUVA 4CAXA 1XRYA 2VXKA 4JXRA 2HI6A 3EXNA 3R95A 1YLOA 1NMTA 1Y0RA 2IMOA 2YGWA 3B7IA 2B5GA 2Y1MA 1ZG7A 2CNTA 3RAMA 3TO7A 2WPXA 4XNHC 4MY3A 1ZL0A 3WT4A 3PGPA 1M4GA 4B6ZA 1PCAA 4CAWA 4CRYB 4EYSA 1WJTA 2OU2A 3B35A 1WWZA 2FE7A 3H8EA 3TTHA 1NXJA 2GP4A 2RFHA 1IYLA 4PSWA 4ZX8A 2V8HA 4L8AA 3TOAA 2Y0MA 4CGOA 4Q36A 1ZYMA 4KLWA 1DTDA 4OP4A 3EFAA 2PJ7A 2PJAA 1XBUA 4CAFA 2JDCA 3S9LA 1QSRA 2AFXA 5EBVA 1ZO0A 2JEWA 5HH1A 4IIXA 3LODA 1CX8A 4GM5A 3NH4A 1XEBA 2EK9A 4XNHB 5G1ZA 5LRGA 4R76A 3SXNA 1BOBA 4A32A 2DIKA 2PJ8A 2ZW4A 4M8DA 4C99A 4YGOA 2FVGA 2Q4VA 2HV2A 1UWYA 2ZOGA 2HWGA 2GANA 3RNZA 5LRKA 4KUBA 1CG2A 2F8HA 1KEEB 3B3VA 2PCNA 1Q2CA 1JDBC 2P6GA 3WC7A 3VARA 4P4IA 1X12A 2B3UA 2CTBA 1Z8WA 2O28A 5I0CA 4MHPA 4NFRA 2JLMA 2VQYA 4KOUA 5F1YA 3JVNA 4XPKA 3T90A 1XF1A 2YNCA 4EWTA 2WPWA 2R82A 4Q7AA 2ZOFA 3GUXA 4C7IA 2FS5A 4K30A 4A30A 3DDDA 5HVGA 1HEEA 3MN8A 4HNYB 1RXTA 3WR7A 4RN7A 4UIBA 4B5OA 4E8OA 5HVHA 4J0NA 1TF8A 4A38A 4RS2A 2X0SA 1HDUA 3H5ZA 1CM0A 3G23A 3S9NA 2XPLA 2VZYA 3BI0A 1Q7LA 4UEEA 3S6FA 1C30B 2N3AB 2V8GA 1YK3A 3WC5A 2PJ6A 4A4BA 1B47A 3PBBA 4OC4A 2GFQA 4ORFA 1RO5A 4LUAA 2JDDA 3PBEA 3TX8A 2UV8G 4CGMA 5J8FA 3T07A 1PU9A 3RZAA 2VL1A 2AJ6A 1GHEA 2OB0A 2RB7A 1CS0B 2Z3NA 2ZW7A 3BUXB 1ZRSA 4IK2A 2PJ2A 1S60A 4YWYA 4ZI6A 2I00A 2AUMA 4R3LA 4MFQA 3H8FA 3BJ7A 2B5GB 2ZW5A 4BD9A 1Z2LA 3PB6X 4M6IA 4NJRA 4C85A 2Z11A 2PR8A 4F0XA 2DF5A 1YR0A 3KRVA 2AFOA 4IF5A 2V77A 1YLEA 2E28A 3D68A 3TLZA 4PXCA 2OLSA 1LOKA 3IJ3A 3VATA 4KVXA 3RO0A 5F46A 1IYKA 2HB6A 2PSWA 3QB8A 2FM4A 3TLBA 3O8ZA 1F57A 2ZEOA 3EIFA 5J8CA 2ZEPA 5KTAA 4CDKA 3PFEA 4BPUB 4UEFA 4NGTA 2ATRA 3PLFB 4FD5A 4BPWB 4I49A 1S7LA 3TLGA 1S7NA 4OADA 2YNCC 3T8WA 1XMTA 1ON0A 4OC0A 1Y9WA 1PUAA 4FUUA 3R9GA 1V6CA 5HKYA 3EZAA 3BUOB 2XEFA 2HC9A 4WJBA 1H8LA 3PP9A 3CXQA 3FB3A 1CBXA 5CBMA 1I12A 2OH1A 3VRQA 1IICA 1Y9KA 4TNUA 3V8IA 4M3SA 1M44A 3S6GA 4R87A 3WC6A 1KC7A 2PVWA 3CXSA 2A4NA 3D8PA 2B4DA 3IFEA 3OWCA 3D67A 4L89A 3BLNA 3KR5A 1OBRA 3DGVA 3T9YA 1IOIA 5LYLA 5LYFA 1TKJA 2B4JC 5D8NA 3PFOA 3KI9A 2B58A 4TJXA 1MJAA 1Y7EA 3B8GA 2P0WA 4E2AA 4NGQA 4NF1A 4RI1A 2CY2A 1C3OB 4H2KA 1YREA 3GKRA 3GLJA 3IWWA 3VRNA 2PJ0A 4ZY2A 4CDJA 3P2FA 5JYBA 5GCNA 1R43A 3FRMA 3SR3A 3FJUA 2Q0YA 4UCNA 2Z3PA 3IGRA 4NGNA 5H84A 1P4NA 4P10A 3S6HA 2J8MA 1ZG9A 4M6GA 2AE6A 2F5IA 4IIYA 4A33A 4JZ0A 4MCQA 2PVVA 4E94A 4ZY0A 1BO4A 3KZWA 2H5MA 3NH5A 2J8NA 1TIQA 4PQAA 3TO9A 3PFVA 2PJ4A 4NJQA 1R61A 2OR4A 3P2HA 4X8IA 4WWVA 4B5PB 1KBLA 2JBJA 3SHPA 2CXAA 2Z3LA 4Y49B 2REFA 4UBRA 2XEGA 3CPXA 1BPNA 3C8OA 2D4OA 3TOBA 3IWGA 4RR2B 4FD7A 5FVJA 4KOSA 1NBWA 2QYVA 3HPHE 2R7HA 1QSNA 4YRHA 2FT0A 1XIXA 3KQZA 4AG7A 2PJBA 3UY5A
chains in the Genus database with same CATH topology
3PB9X 3FMCA 2NYQA 1R3NA 2EWBA 1TXRA 1LAPA 3FX6A 2BCOA 3IC1A 1XMBA 2XEIA 1LCPA 4LQGA 2PIZA 2QVPA 2C6CA 3D7FA 3JRUA 3B2YA 4UIAA 5I4MA 3BXMA 1F2PA 2IJZA 2CF4A 3KR4A 3VTAA 1WVMA 1LAMA 4OC5A 2PJ1A 7CPAA 2DEAA 4PXDA 4A39A 2PJCA 1IGBA 3N5FA 2PIYA 4P6YA 1TKFA 4TWEA 4Z65A 4ZYQA 1Z8LA 2WZNA 2ZEMA 3IEHA 4C86A 4OC1A 3BHXA 1VGYA 4IHMA 5CPAA 1YW6A 3SJXA 3HLPA 4NGSA 1BLLE 4MMOA 3FEDA 1ARMA 3DLJA 3V38A 5CBMA 2ZEEA 2WYRA 1VHEA 4P45A 4FBEA 4C9RA 3K2KA 1LFWA 2ABZA 2ZELA 1YMEA 3HUVA 3D7DA 3NH8A 3PEIA 3FEEA 1Y0YA 4ZY1A 3IIBA 4C84A 2AFZA 4OKOA 4PPZA 1CPXA 1ELLP 3KL9A 1M4LA 1ZG8A 5JH9A 1HDQA 3FH4A 3B3TA 3QNVA 2PJ5A 4KNGE 3KHXA 5K8NA 2C6GA 4YN3A 3PB7X 3FECA 4DJLA 2G9DA 2PE3A 3KGQA 3B3CA 4JYWA 5HVFA 1QMUA 3SI0A 2AFWA 4PXEA 3D66A 2POKA 3D7GA 4C8PA 3BI1A 1ELMP 3CT9A 4YU9A 8CPAA 5K8OA 4MHZA 2OOTA 2GLFA 5LYIA 1VHOA 5JGFA 1IY7A 1XJOA 4MCPA 2AFUA 2V8DA 2BO9A 4KSIA 5JM6A 3IO1A 2C6PA 2ZEFA 3LMSA 2PRQA 4NGMA 4X3RA 3PB8X 4OIWA 4P4BA 4F9UA 3TC8A 1CP7A 1YSJA 3VH9A 1RTQA 1AYEA 2PCUA 3CPAA 4C8TA 3PB4X 1ARLA 4F9VA 1BPMA 4DYOA 1F2OA 1CPSA 4EFDA 2JBKA 2NSMA 4FWUA 4C9EA 2Q51A 4R8FA 4C8FA 3H8GA 2AFMA 4RUHA 1CP6A 3B3WA 3FF3A 4P4FA 3GB0A 4C8CA 3SI2A 4OC2A 4MHNA 5IB9A 4P4JA 2AFSA 5LYDA 5K8PA 4NGPA 4ZX9A 3SJFA 1XFOA 4C9AA 2ZEDA 4A94A 3RBUA 5K8MA 1YW4A 1AMPA 4P44A 2GLJA 3KQXA 3SI1A 3ISXA 4AXVA 3D7HA 1TKHA 2EK8A 3NFZA 4PXBA 1TF9A 4P4DA 2PJ3A 1LANA 3D4UA 4CPAA 4A37A 2CTCA 5LRJA 3KHZA 2PJ9A 1ZLIA 1BAVA 2V8VA 2CIJA 5ELYA 2Q4ZA 2GREA 2C1CA 4X2TA 2J9AA 2O4HA 2ZEGA 4IAVA 4UEZA 1KWMA 2XEJA 4ONWA 4MRIA 4C9UA 3PRTA 4UF4A 3V7ZA 4C9VA 1NSAA 3L2NA 3NA6A 4EMEA 4W9YA 4F8ZA 3ICUA 1EE3P 3FVLA 5D29A 5LYFA 5HXDA 2ZENA 2ZEHA 1VIXA 4K3NA 2O53A 4MCSA 4OC3A 4C8UA 5IR2A 3ISZA 3K9TA 5DS0A 4R6TA 3I1UA 4R7MA 1DE4C 3LWUA 2IQ6A 5J1QA 4NGRA 1GYTA 1Z5RA 5F09A 4DUKA 3WABA 4MCRA 4OMEA 3S9MA 1JQGA 1ZLHA 2F7VA 4C8AA 3CDXA 4FAIA 3MRUA 3B3SA 2I3CA 6CPAA 1FT7A 4P4EA 3SJGA 2C5QA 3KASA 2ANPA 1Y9ZA 2Q43A 1QQ9A 5THWA 4MXUA 4OIDA 3I74A 4TJVA 3SJEA 4G1PA 2BOAA 4O23A 2GU2A 4MHYA 2QJ8A 3I6SA 1PYTB 1FNOA 1XRYA 1YLOA 1Y0RA 2IMOA 3B7IA 3RAMA 1ZG7A 3WT4A 4B6ZA 1PCAA 3B35A 3H8EA 2GP4A 2RFHA 4ZX8A 2V8HA 1DTDA 4OP4A 2PJ7A 2PJAA 1XBUA 3S9LA 2AFXA 2JEWA 1CX8A 4GM5A 3NH4A 2EK9A 5LRGA 4R76A 2PJ8A 4C99A 2FVGA 2ZOGA 1UWYA 5LRKA 1CG2A 2F8HA 3B3VA 3WC7A 3VARA 2CTBA 4P4IA 4MHPA 4NFRA 1XF1A 4EWTA 4Q7AA 2ZOFA 3GUXA 5HVGA 1HEEA 3MN8A 5HVHA 4UIBA 1TF8A 4A38A 1HDUA 3S9NA 3BI0A 1Q7LA 4UEEA 2V8GA 3WC5A 2PJ6A 3PBBA 4OC4A 3PBEA 3TX8A 3RZAA 2VL1A 2RB7A 4IK2A 2PJ2A 4ZI6A 4YWYA 3H8FA 4BD9A 1Z2LA 3PB6X 4NJRA 4C85A 2AFOA 2V77A 3D68A 4PXCA 1LOKA 3IJ3A 3VATA 2HB6A 1F57A 2ZEOA 3EIFA 2ZEPA 4CDKA 3PFEA 4UEFA 4NGTA 3T8WA 1V6CA 4OC0A 4FUUA 2XEFA 2HC9A 4WJBA 1H8LA 1CBXA 4TNUA 3WC6A 2PVWA 3IFEA 3D67A 3KR5A 1OBRA 3DGVA 5LYLA 1TKJA 5D8NA 3PFOA 3KI9A 4TJXA 1Y7EA 4NGQA 4H2KA 3GLJA 4ZY2A 3IWWA 2PJ0A 4CDJA 1R43A 3FJUA 4NGNA 4P10A 1ZG9A 4JZ0A 4MCQA 2PVVA 4ZY0A 3KZWA 3NH5A 4PQAA 2PJ4A 4NJQA 2OR4A 4X8IA 4WWVA 2JBJA 2XEGA 3CPXA 1BPNA 2QYVA 3KQZA 2PJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PB9 X;  3FMC A;  2NYQ A;  1R3N A;  2EWB A;  1TXR A;  1LAP A;  3FX6 A;  2BCO A;  3IC1 A;  1XMB A;  2XEI A;  1LCP A;  4LQG A;  2PIZ A;  2QVP A;  2C6C A;  3D7F A;  3JRU A;  3B2Y A;  4UIA A;  5I4M A;  3BXM A;  1F2P A;  2IJZ A;  2CF4 A;  3KR4 A;  3VTA A;  1WVM A;  1LAM A;  4OC5 A;  2PJ1 A;  7CPA A;  2DEA A;  4PXD A;  4A39 A;  2PJC A;  1IGB A;  3N5F A;  2PIY A;  4P6Y A;  1TKF A;  4TWE A;  4Z65 A;  4ZYQ A;  1Z8L A;  2WZN A;  2ZEM A;  3IEH A;  4C86 A;  4OC1 A;  3BHX A;  1VGY A;  4IHM A;  5CPA A;  1YW6 A;  3SJX A;  3HLP A;  4NGS A;  1BLL E;  4MMO A;  3FED A;  1ARM A;  3DLJ A;  3V38 A;  5CBM A;  2ZEE A;  2WYR A;  1VHE A;  4P45 A;  4FBE A;  4C9R A;  3K2K A;  1LFW A;  2ABZ A;  2ZEL A;  1YME A;  3HUV A;  3D7D A;  3NH8 A;  3PEI A;  3FEE A;  1Y0Y A;  4ZY1 A;  3IIB A;  4C84 A;  2AFZ A;  4OKO A;  4PPZ A;  1CPX A;  1ELL P;  3KL9 A;  1M4L A;  1ZG8 A;  5JH9 A;  1HDQ A;  3FH4 A;  3B3T A;  3QNV A;  2PJ5 A;  4KNG E;  3KHX A;  5K8N A;  2C6G A;  4YN3 A;  3PB7 X;  3FEC A;  4DJL A;  2G9D A;  2PE3 A;  3KGQ A;  3B3C A;  4JYW A;  5HVF A;  1QMU A;  3SI0 A;  2AFW A;  4PXE A;  3D66 A;  2POK A;  3D7G A;  4C8P A;  3BI1 A;  1ELM P;  3CT9 A;  4YU9 A;  8CPA A;  5K8O A;  4MHZ A;  2OOT A;  2GLF A;  5LYI A;  1VHO A;  5JGF A;  1IY7 A;  1XJO A;  4MCP A;  2AFU A;  2V8D A;  2BO9 A;  4KSI A;  5JM6 A;  3IO1 A;  2C6P A;  2ZEF A;  3LMS A;  2PRQ A;  4NGM A;  4X3R A;  3PB8 X;  4OIW A;  4P4B A;  4F9U A;  3TC8 A;  1CP7 A;  1YSJ A;  3VH9 A;  1RTQ A;  1AYE A;  2PCU A;  3CPA A;  4C8T A;  3PB4 X;  1ARL A;  4F9V A;  1BPM A;  4DYO A;  1F2O A;  1CPS A;  4EFD A;  2JBK A;  2NSM A;  4FWU A;  4C9E A;  2Q51 A;  4R8F A;  4C8F A;  3H8G A;  2AFM A;  4RUH A;  1CP6 A;  3B3W A;  3FF3 A;  4P4F A;  3GB0 A;  4C8C A;  3SI2 A;  4OC2 A;  4MHN A;  5IB9 A;  4P4J A;  2AFS A;  5LYD A;  5K8P A;  4NGP A;  4ZX9 A;  3SJF A;  1XFO A;  4C9A A;  2ZED A;  4A94 A;  3RBU A;  5K8M A;  1YW4 A;  1AMP A;  4P44 A;  2GLJ A;  3KQX A;  3SI1 A;  3ISX A;  4AXV A;  3D7H A;  1TKH A;  2EK8 A;  3NFZ A;  4PXB A;  1TF9 A;  4P4D A;  2PJ3 A;  1LAN A;  3D4U A;  4CPA A;  4A37 A;  2CTC A;  5LRJ A;  3KHZ A;  2PJ9 A;  1ZLI A;  1BAV A;  2V8V A;  2CIJ A;  5ELY A;  2Q4Z A;  2GRE A;  2C1C A;  4X2T A;  2J9A A;  2O4H A;  2ZEG A;  4IAV A;  4UEZ A;  1KWM A;  2XEJ A;  4ONW A;  4MRI A;  4C9U A;  3PRT A;  4UF4 A;  3V7Z A;  4C9V A;  1NSA A;  3L2N A;  3NA6 A;  4EME A;  4W9Y A;  4F8Z A;  3ICU A;  1EE3 P;  3FVL A;  5D29 A;  5LYF A;  5HXD A;  2ZEN A;  2ZEH A;  1VIX A;  4K3N A;  2O53 A;  4MCS A;  4OC3 A;  4C8U A;  3ISZ A;  3K9T A;  5DS0 A;  4R6T A;  3I1U A;  4R7M A;  1DE4 C;  3LWU A;  2IQ6 A;  5J1Q A;  4NGR A;  1GYT A;  1Z5R A;  5F09 A;  4DUK A;  3WAB A;  4MCR A;  4OME A;  3S9M A;  1JQG A;  1ZLH A;  2F7V A;  4C8A A;  3CDX A;  4FAI A;  3MRU A;  3B3S A;  2I3C A;  6CPA A;  1FT7 A;  4P4E A;  3SJG A;  3KAS A;  2ANP A;  1Y9Z A;  2Q43 A;  1QQ9 A;  5THW A;  4MXU A;  4OID A;  3I74 A;  4TJV A;  3SJE A;  4G1P A;  2BOA A;  4O23 A;  2GU2 A;  4MHY A;  2QJ8 A;  3I6S A;  1PYT B;  1FNO A;  1XRY A;  1YLO A;  1Y0R A;  2IMO A;  3B7I A;  3RAM A;  1ZG7 A;  3WT4 A;  4B6Z A;  1PCA A;  3B35 A;  3H8E A;  2RFH A;  4ZX8 A;  2V8H A;  1DTD A;  4OP4 A;  2PJ7 A;  2PJA A;  1XBU A;  3S9L A;  2AFX A;  2JEW A;  1CX8 A;  4GM5 A;  3NH4 A;  2EK9 A;  5LRG A;  4R76 A;  2PJ8 A;  4C99 A;  2FVG A;  2ZOG A;  1UWY A;  5LRK A;  1CG2 A;  2F8H A;  3B3V A;  3WC7 A;  3VAR A;  2CTB A;  4P4I A;  4MHP A;  4NFR A;  1XF1 A;  4EWT A;  4Q7A A;  2ZOF A;  3GUX A;  5HVG A;  1HEE A;  3MN8 A;  5HVH A;  4UIB A;  1TF8 A;  4A38 A;  1HDU A;  3S9N A;  3BI0 A;  1Q7L A;  4UEE A;  2V8G A;  3WC5 A;  2PJ6 A;  3PBB A;  4OC4 A;  3PBE A;  3TX8 A;  3RZA A;  2VL1 A;  2RB7 A;  4IK2 A;  2PJ2 A;  4ZI6 A;  4YWY A;  3H8F A;  4BD9 A;  1Z2L A;  3PB6 X;  4NJR A;  4C85 A;  2AFO A;  2V77 A;  3D68 A;  4PXC A;  1LOK A;  3IJ3 A;  3VAT A;  2HB6 A;  1F57 A;  2ZEO A;  3EIF A;  2ZEP A;  4CDK A;  3PFE A;  4UEF A;  4NGT A;  3T8W A;  1V6C A;  4OC0 A;  4FUU A;  2XEF A;  2HC9 A;  4WJB A;  1H8L A;  1CBX A;  4TNU A;  3WC6 A;  2PVW A;  3IFE A;  3D67 A;  3KR5 A;  1OBR A;  3DGV A;  5LYL A;  1TKJ A;  5D8N A;  3PFO A;  3KI9 A;  4TJX A;  1Y7E A;  4NGQ A;  4H2K A;  3GLJ A;  4ZY2 A;  3IWW A;  2PJ0 A;  4CDJ A;  1R43 A;  3FJU A;  4NGN A;  4P10 A;  1ZG9 A;  4JZ0 A;  4MCQ A;  2PVV A;  4ZY0 A;  3KZW A;  3NH5 A;  4PQA A;  2PJ4 A;  4NJQ A;  2OR4 A;  4X8I A;  4WWV A;  2JBJ A;  2XEG A;  3CPX A;  1BPN A;  2QYV A;  3KQZ A;  2PJB A; 
#chains in the Genus database with same CATH topology
 1SQH A;  4QC6 A;  4MI1 A;  3TLG B;  2GE3 A;  3PB9 X;  3FMC A;  2NYQ A;  4KOR A;  3IU1 A;  4AVC A;  1X10 A;  3QAH A;  4PK3 A;  1M6V B;  1KZF A;  3CXP A;  1R3N A;  1YQE A;  2NMT A;  1JWQ A;  2EWB A;  1XE4 A;  2I79 A;  3TE4 A;  2D0O A;  1TXR A;  1LAP A;  1M1D A;  3FX6 A;  4JD6 A;  3OB1 B;  2BCO A;  2DPS A;  3HPG G;  2VZZ A;  1XMB A;  3IC1 A;  2EZA A;  2B4D B;  2XEI A;  1LCP A;  4LQG A;  2OZH A;  2PIZ A;  2C6C A;  3D7F A;  2QVP A;  3B2Y A;  3JRU A;  4UIA A;  3SXO A;  5BY0 A;  5I4M A;  3BXM A;  1F2P A;  2IJZ A;  4B14 A;  2CF4 A;  3KR4 A;  4YFJ A;  4NSQ A;  1YVO A;  1Q2Y A;  3VTA A;  4AB7 A;  1WVM A;  1LAM A;  2ZW6 A;  4OC5 A;  4II9 A;  3D2P A;  2PJ1 A;  4KOV A;  5G21 A;  2PQ8 A;  7CPA A;  2FL4 A;  2DEA A;  4PXD A;  4A39 A;  2EUI A;  4M85 A;  4CGL A;  2PJC A;  1IGB A;  3EC4 A;  3N5F A;  3BUW B;  2PIY A;  4P6Y A;  1TKF A;  2QML A;  4TWE A;  2Z3K A;  4Z65 A;  4ZYQ A;  1Z8L A;  1IU8 A;  2IL4 A;  5IB0 A;  2WZN A;  2ZEM A;  4A2Z A;  3IEH A;  4C86 A;  4OC1 A;  3BHX A;  3DNS A;  1VGY A;  1MK4 A;  1CJW A;  5EC4 A;  5KTD A;  5F5X A;  4JLY A;  4IHM A;  5CPA A;  4MFP A;  2FSR A;  1YW6 A;  1S7K A;  1BXR B;  4GS4 A;  3SJX A;  3HLP A;  4NGS A;  4C68 A;  1BLL E;  2D0P A;  3D2M A;  3TO6 A;  4MFL A;  1YVH A;  5AGE A;  5A27 A;  4BTF A;  4MMO A;  3FED A;  4JXQ A;  2YJV A;  1ARM A;  1KUY A;  4B12 A;  3DLJ A;  3V38 A;  3FYN A;  2FCK A;  3VRO A;  2DXQ A;  3H4Q A;  4LQ6 A;  3LAC A;  4R9M A;  2Q7B A;  4BPX B;  2WYR A;  2ZEE A;  5A28 A;  1VHE A;  4P45 A;  4FBE A;  4MJX A;  5FD8 A;  2ARH A;  2QEC A;  5G20 A;  4C9R A;  1LFW A;  2ABZ A;  1IOF A;  2ZEL A;  1YME A;  1N71 A;  1Z8X A;  2EVN A;  3HUV A;  3D7D A;  4UCP A;  3I3G A;  4HNX B;  4E0A A;  2Z3O A;  3JUW A;  4U9Z A;  3NH8 A;  3PEI A;  3FEE A;  1Y0Y A;  4ZY1 A;  2PR1 A;  3IIB A;  4C84 A;  4MHD A;  2AFZ A;  4OKO A;  1EO0 A;  1CPX A;  1ELL P;  4PPZ A;  5G22 A;  1L0C A;  3KL9 A;  1M4L A;  1Z9U A;  1ZG8 A;  3EO4 A;  4B11 A;  1P0H A;  2YJT A;  3OB2 B;  2JEV A;  5JH9 A;  3G8W A;  2FIA A;  1HDQ A;  4JWP A;  4B13 A;  3FH4 A;  3B3T A;  4UFV A;  3QNV A;  1CE8 B;  4AVB A;  3TLY A;  1AUG A;  2PJ5 A;  3FXT A;  4KNG E;  3KHX A;  2BEI A;  3FBU A;  4ONU A;  3HMJ G;  5K8N A;  2C6G A;  4YN3 A;  3PB7 X;  4H89 A;  2Q7S A;  3FEC A;  2Z3M A;  1B6B A;  4DJL A;  2G9D A;  3T0T A;  1IID A;  1XF8 A;  2PE3 A;  3KGQ A;  4NCZ A;  3B3C A;  1VHS A;  4C7H A;  4JYW A;  3N7Z A;  4H6Z A;  5HVF A;  4KOT A;  4H6U A;  1QMU A;  3VWE A;  2FIW A;  2Q44 A;  2AFW A;  2XPO A;  2BSW A;  3SI0 A;  3VWD A;  3DR6 A;  3D66 A;  2POK A;  4PXE A;  3W91 A;  4KOY A;  3D7G A;  1M4I A;  4C8P A;  3BI1 A;  1ELM P;  3TYX A;  3CT9 A;  4COG A;  5K99 A;  4KSA A;  4YU9 A;  2B3V A;  5ISV A;  8CPA A;  3TT2 A;  1NSL A;  5K8O A;  4MHZ A;  2OOT A;  3DR8 A;  3ZZI A;  2GLF A;  5LYI A;  1VHO A;  5JGF A;  3VGO A;  1VKC A;  1IY7 A;  3LD2 A;  1XJO A;  4MCP A;  2AFU A;  2V8D A;  3PZJ A;  5DWM A;  4C2Z A;  5JQ4 A;  2BO9 A;  4KSI A;  4MI4 A;  3ZJ0 A;  4CYQ A;  2ZPA A;  5JM6 A;  4UA3 A;  2R8V A;  2C6P A;  3IO1 A;  4KS9 A;  1S7F A;  5AG4 A;  2ZEF A;  3LMS A;  2PRQ A;  4FD4 A;  4NGM A;  1A2Z A;  4X3R A;  3PB8 X;  4JJX A;  4OIW A;  4U5Y A;  4P4B A;  3K2K A;  2EBJ A;  4F9U A;  3IWE A;  5AG5 A;  2C27 A;  5IX3 A;  5C82 A;  1J3L A;  1GGO A;  4H1H A;  3TC8 A;  1Z9E A;  3T05 A;  1CP7 A;  2J8R A;  4M6H A;  4BMH A;  1YSJ A;  4BBH A;  3U1B A;  4UWJ A;  3VH9 A;  3ZNI A;  1RTQ A;  3PT1 A;  1AYE A;  2PCU A;  2VI7 A;  3CPA A;  4C8T A;  4QVT A;  3PB4 X;  3NFQ A;  3U88 C;  4U9Y A;  3EY5 A;  1ARL A;  2CNS A;  1FBV A;  4F9V A;  2AUN A;  4NXY A;  4CGP A;  1Y7R A;  4KLV A;  1BPM A;  4DYO A;  4IUS A;  1F2O A;  4BIN A;  2XPN A;  4KOX A;  4HNW B;  4A4C A;  3NOJ A;  1IB1 E;  3F5B A;  2R1I A;  4FD6 A;  5F48 A;  4JVO A;  3R9E A;  4CS0 B;  1CPS A;  3FNC A;  5KTC A;  1QSM A;  4EFD A;  2JBK A;  2NSM A;  4FWU A;  4B10 A;  4C9E A;  1Z8T A;  2Q51 A;  4R8F A;  2CBL A;  4C8F A;  4HPS A;  3H8G A;  4NEX A;  2AFM A;  3VRR A;  2Q04 A;  4KZT A;  4RUH A;  2BUE A;  5C88 A;  1CP6 A;  3I9S A;  3B3W A;  3FF3 A;  4P4F A;  3GB0 A;  4R57 A;  4C8C A;  3R96 A;  5H86 A;  1Q5X A;  2GIV A;  3IU2 A;  2Z10 A;  1Z4R A;  2ZXV A;  4Q38 A;  3SI2 A;  4OC2 A;  4MHN A;  3CZX A;  3BJ8 A;  4MY0 A;  5IB9 A;  3DSB A;  4P4J A;  1WK4 A;  2AFS A;  2HUZ A;  2WSA A;  5LYD A;  5K8P A;  3R1K A;  4UFX A;  1FY7 A;  5AG7 A;  4QBJ A;  1R57 A;  4NGP A;  1EZA A;  2EZB A;  4ZX9 A;  4KVM E;  3SJF A;  3GYA A;  4INJ A;  1XFO A;  4OAE A;  4C9A A;  1OZP A;  2ZED A;  4LX9 A;  3RBU A;  4R3K A;  4A94 A;  3BUM B;  5K8M A;  5F9M A;  5EMI A;  4KOW A;  1K4J A;  1AMP A;  1YW4 A;  5JPH A;  4P44 A;  3BUN B;  2GLJ A;  3VRP A;  3KQX A;  5AG6 A;  3SI1 A;  3TFY A;  1QSO A;  3ISX A;  4KVO E;  4CO9 A;  1DIK A;  4AXV A;  1XOV A;  3D7H A;  1TKH A;  2EK8 A;  3NFZ A;  4PXB A;  4A95 A;  4EVY A;  1TF9 A;  4P4D A;  4OLL A;  4ZGY B;  2HRO A;  4X5K A;  1EZB A;  2PJ3 A;  2YNE A;  1LAN A;  3D4U A;  4CPA A;  4A37 A;  3GY9 A;  2CTC A;  5LRJ A;  4ZBG A;  4B5P A;  4UCM A;  2EO8 A;  4XPD C;  2K5T A;  3KHZ A;  2P6E A;  5F49 A;  2PJ9 A;  1QST A;  3F0A A;  1V0C A;  3T5M A;  3R9F A;  3MGD A;  1Z4E A;  4COB A;  4E5S A;  2R98 A;  4PK2 A;  1ZLI A;  2G0B A;  5AXI A;  1BAV A;  2OZG A;  2V8V A;  4CAV A;  2CIJ A;  2DPT A;  4J3G A;  1YVK A;  5ELY A;  1M4D A;  3TLA A;  2CNM A;  1NE9 A;  1S3Z A;  2Q4Z A;  2GRE A;  4CYP A;  4A31 A;  3TLE A;  2C1C A;  4UFW A;  2J9A A;  4X2T A;  2O4H A;  2KCW A;  2PC1 A;  2ZEG A;  4QUS A;  4XPD B;  4CRZ B;  3K4I A;  4IAV A;  1LRZ A;  3NE8 A;  4C2Y A;  1UFH A;  3QAY A;  4KSF A;  4UEZ A;  1KWM A;  2XEJ A;  3OP0 A;  4F6A A;  4ONW A;  3KKW A;  4GXH A;  4MFZ A;  4MRI A;  3EZB A;  3C26 A;  1YX0 A;  2FXF A;  3F8K A;  3PRT A;  3TCV A;  4AVA A;  3GJZ A;  1Q2D A;  4UF4 A;  5F13 A;  3V7Z A;  4C9V A;  1NSA A;  4C9U A;  1T36 B;  3L2N A;  3NA6 A;  4EME A;  4W9Y A;  4F8Z A;  2B0A A;  3ICU A;  2VKZ G;  4CZ1 A;  4MBU A;  2Y1N A;  1EE3 P;  5D29 A;  2ODF A;  1I21 A;  2YND A;  2ZEN A;  3FVL A;  2ZEH A;  3NE7 A;  4CGN A;  5HXD A;  1VIX A;  1JDE A;  1VBG A;  4KUA A;  2VEZ A;  2P6F A;  3W6S A;  5JVL A;  4K3N A;  1I1D A;  2WUU A;  3OAK A;  2O53 A;  4MCS A;  4CYN A;  4OC3 A;  3D3S A;  1J4J A;  1KUX A;  5BWA B;  2B4B A;  4PV6 A;  4C8U A;  4F0Y A;  2PRB A;  4MFJ A;  3EZE A;  2D4P A;  5IR2 A;  3ISZ A;  4C2X A;  3A9L A;  3K9T A;  5DS0 A;  4R6T A;  3G3S A;  5E96 A;  3I1U A;  4R7M A;  1DE4 C;  1MJB A;  1YGH A;  4HKF A;  3LWU A;  1MJ9 A;  2IQ6 A;  2DLA A;  2PDO A;  2RC4 A;  3K9U A;  4NGR A;  1GYT A;  5DWN A;  5J1Q A;  3TLC A;  1Z5R A;  5F09 A;  4DUK A;  3WAB A;  1A9X B;  3GIU A;  4MCR A;  4OME A;  3W6X A;  5F47 A;  3S9M A;  3JTK A;  3RYO A;  5HKW A;  3F9K C;  1B87 A;  1JQG A;  1ZLH A;  2F7V A;  2G3A A;  5J3X A;  4C8A A;  4GPL B;  3CDX A;  4FAI A;  3S6K A;  2G3T A;  3MRU A;  2HQY A;  2Z0Z A;  4DNC A;  3B3S A;  4CYO A;  2I3C A;  3FIX A;  4UWI A;  6CPA A;  5IV0 A;  2EZC A;  1FT7 A;  4Y49 C;  4P4E A;  2REE A;  5HKZ A;  4XPL A;  4PSX A;  3SJG A;  2Q4Y A;  2BL1 A;  2X7B A;  2C5Q A;  3KAS A;  2ANP A;  4AG9 A;  1Y9Z A;  2Q43 A;  1QQ9 A;  5THW A;  4MXU A;  3E0K A;  2OZU A;  4OID A;  3I74 A;  1VI4 A;  4TJV A;  2MP0 A;  1S5K A;  1VBH A;  4MFK A;  3SJE A;  4G1P A;  4CAE A;  2XPP A;  1U6M A;  2BOA A;  2QIR A;  2GU2 A;  4MHY A;  4O23 A;  5HMN A;  2QJ8 A;  2VBQ A;  3I6S A;  5CNP A;  4QB9 A;  4MJ8 A;  1PYT B;  1FNO A;  1KUV A;  4CAX A;  1XRY A;  2VXK A;  4JXR A;  2HI6 A;  3EXN A;  3R95 A;  1YLO A;  1NMT A;  1Y0R A;  2IMO A;  2YGW A;  3B7I A;  2B5G A;  2Y1M A;  1ZG7 A;  2CNT A;  3RAM A;  3TO7 A;  2WPX A;  4XNH C;  4MY3 A;  1ZL0 A;  3WT4 A;  3PGP A;  1M4G A;  4B6Z A;  1PCA A;  4CAW A;  4CRY B;  4EYS A;  1WJT A;  2OU2 A;  3B35 A;  1WWZ A;  2FE7 A;  3H8E A;  3TTH A;  1NXJ A;  2GP4 A;  2RFH A;  1IYL A;  4PSW A;  4ZX8 A;  2V8H A;  4L8A A;  3TOA A;  2Y0M A;  4CGO A;  4Q36 A;  1ZYM A;  4KLW A;  1DTD A;  4OP4 A;  3EFA A;  2PJ7 A;  2PJA A;  1XBU A;  4CAF A;  2JDC A;  3S9L A;  1QSR A;  2AFX A;  5EBV A;  1ZO0 A;  2JEW A;  5HH1 A;  4IIX A;  3LOD A;  1CX8 A;  4GM5 A;  3NH4 A;  1XEB A;  2EK9 A;  4XNH B;  5G1Z A;  5LRG A;  4R76 A;  3SXN A;  1BOB A;  4A32 A;  2DIK A;  2PJ8 A;  2ZW4 A;  4M8D A;  4C99 A;  4YGO A;  2FVG A;  2Q4V A;  2HV2 A;  1UWY A;  2ZOG A;  2HWG A;  2GAN A;  3RNZ A;  5LRK A;  4KUB A;  1CG2 A;  2F8H A;  1KEE B;  3B3V A;  2PCN A;  1Q2C A;  1JDB C;  2P6G A;  3WC7 A;  3VAR A;  4P4I A;  1X12 A;  2B3U A;  2CTB A;  1Z8W A;  2O28 A;  5I0C A;  4MHP A;  4NFR A;  2JLM A;  2VQY A;  4KOU A;  5F1Y A;  3JVN A;  4XPK A;  3T90 A;  1XF1 A;  2YNC A;  4EWT A;  2WPW A;  2R82 A;  4Q7A A;  2ZOF A;  3GUX A;  4C7I A;  2FS5 A;  4K30 A;  4A30 A;  3DDD A;  5HVG A;  1HEE A;  3MN8 A;  4HNY B;  1RXT A;  3WR7 A;  4RN7 A;  4UIB A;  4B5O A;  4E8O A;  5HVH A;  4J0N A;  1TF8 A;  4A38 A;  4RS2 A;  2X0S A;  1HDU A;  3H5Z A;  1CM0 A;  3G23 A;  3S9N A;  2XPL A;  2VZY A;  3BI0 A;  1Q7L A;  4UEE A;  3S6F A;  1C30 B;  2N3A B;  2V8G A;  1YK3 A;  3WC5 A;  2PJ6 A;  4A4B A;  1B47 A;  3PBB A;  4OC4 A;  2GFQ A;  4ORF A;  1RO5 A;  4LUA A;  2JDD A;  3PBE A;  3TX8 A;  2UV8 G;  4CGM A;  5J8F A;  3T07 A;  1PU9 A;  3RZA A;  2VL1 A;  2AJ6 A;  1GHE A;  2OB0 A;  2RB7 A;  1CS0 B;  2Z3N A;  2ZW7 A;  3BUX B;  1ZRS A;  4IK2 A;  2PJ2 A;  1S60 A;  4YWY A;  4ZI6 A;  2I00 A;  2AUM A;  4R3L A;  4MFQ A;  3H8F A;  3BJ7 A;  2B5G B;  2ZW5 A;  4BD9 A;  1Z2L A;  3PB6 X;  4M6I A;  4NJR A;  4C85 A;  2Z11 A;  2PR8 A;  4F0X A;  2DF5 A;  1YR0 A;  3KRV A;  2AFO A;  4IF5 A;  2V77 A;  1YLE A;  2E28 A;  3D68 A;  3TLZ A;  4PXC A;  2OLS A;  1LOK A;  3IJ3 A;  3VAT A;  4KVX A;  3RO0 A;  5F46 A;  1IYK A;  2HB6 A;  2PSW A;  3QB8 A;  2FM4 A;  3TLB A;  3O8Z A;  1F57 A;  2ZEO A;  3EIF A;  5J8C A;  2ZEP A;  5KTA A;  4CDK A;  3PFE A;  4BPU B;  4UEF A;  4NGT A;  2ATR A;  3PLF B;  4FD5 A;  4BPW B;  4I49 A;  1S7L A;  3TLG A;  1S7N A;  4OAD A;  2YNC C;  3T8W A;  1XMT A;  1ON0 A;  4OC0 A;  1Y9W A;  1PUA A;  4FUU A;  3R9G A;  1V6C A;  5HKY A;  3EZA A;  3BUO B;  2XEF A;  2HC9 A;  4WJB A;  1H8L A;  3PP9 A;  3CXQ A;  3FB3 A;  1CBX A;  5CBM A;  1I12 A;  2OH1 A;  3VRQ A;  1IIC A;  1Y9K A;  4TNU A;  3V8I A;  4M3S A;  1M44 A;  3S6G A;  4R87 A;  3WC6 A;  1KC7 A;  2PVW A;  3CXS A;  2A4N A;  3D8P A;  2B4D A;  3IFE A;  3OWC A;  3D67 A;  4L89 A;  3BLN A;  3KR5 A;  1OBR A;  3DGV A;  3T9Y A;  1IOI A;  5LYL A;  5LYF A;  1TKJ A;  2B4J C;  5D8N A;  3PFO A;  3KI9 A;  2B58 A;  4TJX A;  1MJA A;  1Y7E A;  3B8G A;  2P0W A;  4E2A A;  4NGQ A;  4NF1 A;  4RI1 A;  2CY2 A;  1C3O B;  4H2K A;  1YRE A;  3GKR A;  3GLJ A;  3IWW A;  3VRN A;  2PJ0 A;  4ZY2 A;  4CDJ A;  3P2F A;  5JYB A;  5GCN A;  1R43 A;  3FRM A;  3SR3 A;  3FJU A;  2Q0Y A;  4UCN A;  2Z3P A;  3IGR A;  4NGN A;  5H84 A;  1P4N A;  4P10 A;  3S6H A;  2J8M A;  1ZG9 A;  4M6G A;  2AE6 A;  2F5I A;  4IIY A;  4A33 A;  4JZ0 A;  4MCQ A;  2PVV A;  4E94 A;  4ZY0 A;  1BO4 A;  3KZW A;  2H5M A;  3NH5 A;  2J8N A;  1TIQ A;  4PQA A;  3TO9 A;  3PFV A;  2PJ4 A;  4NJQ A;  1R61 A;  2OR4 A;  3P2H A;  4X8I A;  4WWV A;  4B5P B;  1KBL A;  2JBJ A;  3SHP A;  2CXA A;  2Z3L A;  4Y49 B;  2REF A;  4UBR A;  2XEG A;  3CPX A;  1BPN A;  3C8O A;  2D4O A;  3TOB A;  3IWG A;  4RR2 B;  4FD7 A;  5FVJ A;  4KOS A;  1NBW A;  2QYV A;  3HPH E;  2R7H A;  1QSN A;  4YRH A;  2FT0 A;  1XIX A;  3KQZ A;  4AG7 A;  2PJB A;  3UY5 A; 
#chains in the Genus database with same CATH homology
 3PB9 X;  3FMC A;  2NYQ A;  1R3N A;  2EWB A;  1TXR A;  1LAP A;  3FX6 A;  2BCO A;  3IC1 A;  1XMB A;  2XEI A;  1LCP A;  4LQG A;  2PIZ A;  2QVP A;  2C6C A;  3D7F A;  3JRU A;  3B2Y A;  4UIA A;  5I4M A;  3BXM A;  1F2P A;  2IJZ A;  2CF4 A;  3KR4 A;  3VTA A;  1WVM A;  1LAM A;  4OC5 A;  2PJ1 A;  7CPA A;  2DEA A;  4PXD A;  4A39 A;  2PJC A;  1IGB A;  3N5F A;  2PIY A;  4P6Y A;  1TKF A;  4TWE A;  4Z65 A;  4ZYQ A;  1Z8L A;  2WZN A;  2ZEM A;  3IEH A;  4C86 A;  4OC1 A;  3BHX A;  1VGY A;  4IHM A;  5CPA A;  1YW6 A;  3SJX A;  3HLP A;  4NGS A;  1BLL E;  4MMO A;  3FED A;  1ARM A;  3DLJ A;  3V38 A;  5CBM A;  2ZEE A;  2WYR A;  1VHE A;  4P45 A;  4FBE A;  4C9R A;  3K2K A;  1LFW A;  2ABZ A;  2ZEL A;  1YME A;  3HUV A;  3D7D A;  3NH8 A;  3PEI A;  3FEE A;  1Y0Y A;  4ZY1 A;  3IIB A;  4C84 A;  2AFZ A;  4OKO A;  4PPZ A;  1CPX A;  1ELL P;  3KL9 A;  1M4L A;  1ZG8 A;  5JH9 A;  1HDQ A;  3FH4 A;  3B3T A;  3QNV A;  2PJ5 A;  4KNG E;  3KHX A;  5K8N A;  2C6G A;  4YN3 A;  3PB7 X;  3FEC A;  4DJL A;  2G9D A;  2PE3 A;  3KGQ A;  3B3C A;  4JYW A;  5HVF A;  1QMU A;  3SI0 A;  2AFW A;  4PXE A;  3D66 A;  2POK A;  3D7G A;  4C8P A;  3BI1 A;  1ELM P;  3CT9 A;  4YU9 A;  8CPA A;  5K8O A;  4MHZ A;  2OOT A;  2GLF A;  5LYI A;  1VHO A;  5JGF A;  1IY7 A;  1XJO A;  4MCP A;  2AFU A;  2V8D A;  2BO9 A;  4KSI A;  5JM6 A;  3IO1 A;  2C6P A;  2ZEF A;  3LMS A;  2PRQ A;  4NGM A;  4X3R A;  3PB8 X;  4OIW A;  4P4B A;  4F9U A;  3TC8 A;  1CP7 A;  1YSJ A;  3VH9 A;  1RTQ A;  1AYE A;  2PCU A;  3CPA A;  4C8T A;  3PB4 X;  1ARL A;  4F9V A;  1BPM A;  4DYO A;  1F2O A;  1CPS A;  4EFD A;  2JBK A;  2NSM A;  4FWU A;  4C9E A;  2Q51 A;  4R8F A;  4C8F A;  3H8G A;  2AFM A;  4RUH A;  1CP6 A;  3B3W A;  3FF3 A;  4P4F A;  3GB0 A;  4C8C A;  3SI2 A;  4OC2 A;  4MHN A;  5IB9 A;  4P4J A;  2AFS A;  5LYD A;  5K8P A;  4NGP A;  4ZX9 A;  3SJF A;  1XFO A;  4C9A A;  2ZED A;  4A94 A;  3RBU A;  5K8M A;  1YW4 A;  1AMP A;  4P44 A;  2GLJ A;  3KQX A;  3SI1 A;  3ISX A;  4AXV A;  3D7H A;  1TKH A;  2EK8 A;  3NFZ A;  4PXB A;  1TF9 A;  4P4D A;  2PJ3 A;  1LAN A;  3D4U A;  4CPA A;  4A37 A;  2CTC A;  5LRJ A;  3KHZ A;  2PJ9 A;  1ZLI A;  1BAV A;  2V8V A;  2CIJ A;  5ELY A;  2Q4Z A;  2GRE A;  2C1C A;  4X2T A;  2J9A A;  2O4H A;  2ZEG A;  4IAV A;  4UEZ A;  1KWM A;  2XEJ A;  4ONW A;  4MRI A;  4C9U A;  3PRT A;  4UF4 A;  3V7Z A;  4C9V A;  1NSA A;  3L2N A;  3NA6 A;  4EME A;  4W9Y A;  4F8Z A;  3ICU A;  1EE3 P;  3FVL A;  5D29 A;  5LYF A;  5HXD A;  2ZEN A;  2ZEH A;  1VIX A;  4K3N A;  2O53 A;  4MCS A;  4OC3 A;  4C8U A;  5IR2 A;  3ISZ A;  3K9T A;  5DS0 A;  4R6T A;  3I1U A;  4R7M A;  1DE4 C;  3LWU A;  2IQ6 A;  5J1Q A;  4NGR A;  1GYT A;  1Z5R A;  5F09 A;  4DUK A;  3WAB A;  4MCR A;  4OME A;  3S9M A;  1JQG A;  1ZLH A;  2F7V A;  4C8A A;  3CDX A;  4FAI A;  3MRU A;  3B3S A;  2I3C A;  6CPA A;  1FT7 A;  4P4E A;  3SJG A;  2C5Q A;  3KAS A;  2ANP A;  1Y9Z A;  2Q43 A;  1QQ9 A;  5THW A;  4MXU A;  4OID A;  3I74 A;  4TJV A;  3SJE A;  4G1P A;  2BOA A;  4O23 A;  2GU2 A;  4MHY A;  2QJ8 A;  3I6S A;  1PYT B;  1FNO A;  1XRY A;  1YLO A;  1Y0R A;  2IMO A;  3B7I A;  3RAM A;  1ZG7 A;  3WT4 A;  4B6Z A;  1PCA A;  3B35 A;  3H8E A;  2GP4 A;  2RFH A;  4ZX8 A;  2V8H A;  1DTD A;  4OP4 A;  2PJ7 A;  2PJA A;  1XBU A;  3S9L A;  2AFX A;  2JEW A;  1CX8 A;  4GM5 A;  3NH4 A;  2EK9 A;  5LRG A;  4R76 A;  2PJ8 A;  4C99 A;  2FVG A;  2ZOG A;  1UWY A;  5LRK A;  1CG2 A;  2F8H A;  3B3V A;  3WC7 A;  3VAR A;  2CTB A;  4P4I A;  4MHP A;  4NFR A;  1XF1 A;  4EWT A;  4Q7A A;  2ZOF A;  3GUX A;  5HVG A;  1HEE A;  3MN8 A;  5HVH A;  4UIB A;  1TF8 A;  4A38 A;  1HDU A;  3S9N A;  3BI0 A;  1Q7L A;  4UEE A;  2V8G A;  3WC5 A;  2PJ6 A;  3PBB A;  4OC4 A;  3PBE A;  3TX8 A;  3RZA A;  2VL1 A;  2RB7 A;  4IK2 A;  2PJ2 A;  4ZI6 A;  4YWY A;  3H8F A;  4BD9 A;  1Z2L A;  3PB6 X;  4NJR A;  4C85 A;  2AFO A;  2V77 A;  3D68 A;  4PXC A;  1LOK A;  3IJ3 A;  3VAT A;  2HB6 A;  1F57 A;  2ZEO A;  3EIF A;  2ZEP A;  4CDK A;  3PFE A;  4UEF A;  4NGT A;  3T8W A;  1V6C A;  4OC0 A;  4FUU A;  2XEF A;  2HC9 A;  4WJB A;  1H8L A;  1CBX A;  4TNU A;  3WC6 A;  2PVW A;  3IFE A;  3D67 A;  3KR5 A;  1OBR A;  3DGV A;  5LYL A;  1TKJ A;  5D8N A;  3PFO A;  3KI9 A;  4TJX A;  1Y7E A;  4NGQ A;  4H2K A;  3GLJ A;  4ZY2 A;  3IWW A;  2PJ0 A;  4CDJ A;  1R43 A;  3FJU A;  4NGN A;  4P10 A;  1ZG9 A;  4JZ0 A;  4MCQ A;  2PVV A;  4ZY0 A;  3KZW A;  3NH5 A;  4PQA A;  2PJ4 A;  4NJQ A;  2OR4 A;  4X8I A;  4WWV A;  2JBJ A;  2XEG A;  3CPX A;  1BPN A;  2QYV A;  3KQZ A;  2PJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...