3RBUA

N-terminally avitev-tagged human glutamate carboxypeptidase ii in complex with 2-pmpa
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Efficient and versatile one-step affinity purification of in vivo biotinylated proteins: Expression, characterization and structure analysis of recombinant human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 265
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3rbuA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3rbuA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3rbuA02
2AFOA 3LMSA 4C8FA 4CDJA 3TC8A 4NGTA 1PYTB 3B35A 4P4EA 3K2KA 3NA6A 4JYWA 4IAVA 2IQ6A 3CPXA 3SJGA 5LYIA 4BD9A 6CPAA 2IJZA 1YW6A 2JEWA 5J1QA 2WZNA 3EIFA 3KASA 1XBUA 1JQGA 3FX6A 2PIZA 1BPNA 3IC1A 5LRKA 2JBKA 4F9VA 4NFRA 3KR4A 2O53A 4OP4A 3N5FA 3CDXA 1QQ9A 2PJ2A 3NH8A 2C6CA 4UEEA 2DEAA 2ZEPA 3SI2A 3ISZA 2C6PA 2PJCA 4NGQA 4NGMA 4DUKA 1R3NA 3KQXA 1FNOA 4CPAA 2PJ5A 2GLFA 4KNGE 3RAMA 4YN3A 1VGYA 4ZY2A 1TF9A 3GB0A 3K9TA 4A94A 2G9DA 1BPMA 3PB8X 2V8GA 4F8ZA 4P4DA 3WC6A 4NJRA 1BAVA 1KWMA 1F57A 3L2NA 2ZOFA 4EWTA 2AFSA 7CPAA 1XJOA 2HC9A 3KI9A 1LOKA 3PEIA 4KSIA 2EK9A 4K3NA 3LWUA 3NH4A 3QNVA 1ZLIA 4OMEA 5K8PA 1V6CA 4F9UA 1Y0YA 4C8AA 3TX8A 2IMOA 4FUUA 5K8NA 5LRGA 3PRTA 3T8WA 2JBJA 4P45A 3B3CA 2GU2A 1ZLHA 4UIBA 3PB4X 3B3VA 4PXBA 4C8PA 4YU9A 4ZI6A 3WT4A 4C85A 1ZG9A 3V38A 5LRJA 4C84A 1ZG7A 5HXDA 2ZEEA 5LYLA 5I4MA 2NSMA 1VHOA 1HDQA 3B3TA 4ZY1A 1Z5RA 4YWYA 3FH4A 4DYOA 3FMCA 5K8MA 4UEZA 3IO1A 2PRQA 1XMBA 3FVLA 2ZEFA 8CPAA 4C9UA 1XFOA 5JGFA 2PJ7A 2ANPA 3KR5A 2BCOA 4P10A 1LANA 2V8VA 4OIWA 1DE4C 3KZWA 2V8HA 1QMUA 3B7IA 3FEEA 2V8DA 4NGRA 3KL9A 1IGBA 4ZX9A 1H8LA 1EE3P 3HLPA 3FF3A 2CF4A 4MRIA 4R8FA 3V7ZA 1LAMA 4MCSA 4EFDA 3BI0A 3D68A 1ARMA 2QYVA 2CIJA 4OC4A 2ZEMA 3ISXA 3MN8A 2F8HA 3D67A 3H8GA 4PXEA 2PE3A 2ZEOA 2BOAA 4MCPA 3SI0A 4NGSA 3PB9X 5CBMA 3KQZA 4OC5A 2QJ8A 2PJBA 3VH9A 3S9NA 4PXCA 2XEIA 4IHMA 4WWVA 3BHXA 1TXRA 2FVGA 1Y0RA 2Q51A 1CP7A 2GLJA 3D66A 5CPAA 1ARLA 4X8IA 4RUHA 1YW4A 2F7VA 3GLJA 3IFEA 4LQGA 2I3CA 1CX8A 1WVMA 3B3WA 4X3RA 4P4IA 1R43A 3I1UA 3PB7X 2CTBA 3MRUA 1YLOA 2V77A 1ZG8A 3IWWA 3VATA 1YMEA 4Z65A 4NGNA 1XRYA 1NSAA 3H8FA 4TJVA 1RTQA 1BLLE 2ZEHA 3WABA 2AFUA 4B6ZA 3HUVA 1TKJA 1F2PA 4C9RA 2PJ6A 1IY7A 2CTCA 4H2KA 4R76A 3D4UA 4MCRA 3BXMA 1Y7EA 2PJ3A 1Q7LA 4P4FA 2PVWA 1TKFA 3KGQA 4C8CA 2PJ4A 4OC0A 3IEHA 4FWUA 3NH5A 3S9LA 4PXDA 5HVGA 4MHZA 4DJLA 4FBEA 5JH9A 4AXVA 3RZAA 4C8TA 5JM6A 2PVVA 3SJEA 5K8OA 4CDKA 1DTDA 2PJAA 1HEEA 5THWA 3IJ3A 3FEDA 1VIXA 3KHXA 5IB9A 2NYQA 3S9MA 2EWBA 5F09A 4WJBA 3B3SA 4UIAA 3GUXA 2HB6A 4UF4A 2BO9A 3SJFA 3PFEA 4FAIA 3B2YA 2VL1A 1AYEA 4PPZA 1Y9ZA 1OBRA 4P4JA 4X2TA 4UEFA 4TWEA 5LYDA 1CPXA 4MMOA 2XEFA 3DLJA 3PFOA 2Q4ZA 3PBBA 2Q43A 3CT9A 1VHEA 3CPAA 2OOTA 3DGVA 1GYTA 2AFZA 2OR4A 1LCPA 1UWYA 4G1PA 1CP6A 4ONWA 3RBUA 4OKOA 2PJ8A 4ZY0A 1YSJA 3D7HA 2POKA 3D7FA 2RFHA 4C9EA 4NJQA 4P6YA 2ZEDA 4C9VA 1CPSA 2C1CA 1AMPA 2PJ9A 5DS0A 3I74A 2PCUA 3ICUA 4OC1A 1Z8LA 3SJXA 1CG2A 4R6TA 1LAPA 2ZELA 4MXUA 2PJ1A 4O23A 1HDUA 4C99A 3FJUA 2GREA 1LFWA 2AFWA 1Z2LA 1CBXA 3SI1A 3VTAA 4NGPA 4OC3A 4R7MA 4C8UA 5D8NA 4TNUA 4A38A 4PQAA 4GM5A 4P44A 3PB6X 1TKHA 4OIDA 3WC5A 4W9YA 4Q7AA 2O4HA 2EK8A 1ELLP 4MCQA 2ZOGA 2XEJA 4A39A 3NFZA 4P4BA 4MHNA 2ABZA 3FECA 1ELMP 2ZENA 3D7DA 4MHPA 4A37A 4ZX8A 3BI1A 4TJXA 4MHYA 1M4LA 1F2OA 2ZEGA 4ZYQA 2AFXA 3KHZA 3H8EA 1XF1A 4IK2A 1FT7A 3VARA 3JRUA 5HVFA 2AFMA 3WC7A 3D7GA 3PBEA 2RB7A 4JZ0A 3I6SA 1TF8A 2J9AA 2PIYA 5LYFA 4EMEA 2WYRA 3IIBA 5ELYA 2XEGA 4OC2A 1PCAA 2PJ0A 4C9AA 4C86A 2QVPA 5HVHA 2C6GA 5D29A
chains in the Genus database with same CATH superfamily
3H5ZA 2AFOA 3LMSA 4A33A 4C8FA 5AG7A 3TC8A 4CDJA 4CAXA 5IB0A 1S7KA 4KS9A 4QC6A 4M3SA 2Z3PA 4NGTA 1M44A 1N71A 1PYTB 2R98A 4R57A 3SXNA 4MBUA 5DWNA 2CNMA 3B35A 2Y1NA 4P4EA 3K2KA 3NA6A 4NCZA 4A32A 4C2ZA 1U6MA 4JJXA 1QSRA 4MY3A 4MY0A 4Y49C 4K30A 4RI1A 4JYWA 4IAVA 2IQ6A 3HPGG 2YGWA 3CPXA 4KZTA 4PK3A 3SJGA 4BTFA 2IL4A 5F47A 3VROA 4A95A 3FYNA 2FIAA 5LYIA 1T36B 4R87A 3HMJG 2DPTA 4BD9A 3T5MA 6CPAA 3PT1A 2IJZA 2B4DB 4A4CA 1YW6A 3DSBA 3F8KA 2JEWA 2HQYA 1I1DA 2WZNA 3KASA 4UCPA 5J1QA 3EIFA 4B12A 4C68A 4GPLB 1S7FA 1XBUA 5F13A 1JQGA 3FRMA 2JDDA 3FX6A 2BEIA 1BPNA 2PIZA 3IC1A 4IF5A 3BUMB 1NSLA 2DLAA 2JBKA 4YFJA 5LRKA 1ZYMA 1KBLA 4KOUA 1IOFA 2PC1A 4F9VA 4NFRA 4XPLA 3KR4A 3BLNA 1Q2YA 2J8MA 3VWEA 5IR2A 4CGOA 2O53A 2P0WA 1QSOA 4OP4A 3F9KC 2EVNA 3N5FA 4JD6A 2HUZA 3CDXA 1B47A 4CAEA 1QQ9A 2EBJA 1BXRB 3VRPA 2PJ2A 4PK2A 2C5QA 2BUEA 4E0AA 3NH8A 2C6CA 4UEEA 2EO8A 2Z0ZA 2DEAA 1YK3A 2ZEPA 2AJ6A 4JWPA 2GFQA 3ISZA 3SI2A 5C88A 2C6PA 2PJCA 5IX3A 4FD5A 2Y0MA 4NGQA 2PRBA 1LRZA 1JDBC 2ODFA 4I49A 4NGMA 4KSFA 4M6HA 4XNHB 4DUKA 1R3NA 2REEA 5GCNA 2ZW4A 3KQXA 5G22A 1FNOA 3JUWA 4FD4A 4CPAA 2OH1A 2PJ5A 4QVTA 2GLFA 4KNGE 4CYQA 1OZPA 3RAMA 2VZZA 4YN3A 2Z3LA 1VGYA 4NEXA 4ZY2A 5K99A 1GGOA 3FB3A 1TF9A 3GB0A 3K9TA 4COGA 4H89A 4KOWA 2B58A 4UCNA 3B8GA 4A94A 2DF5A 3F5BA 5JQ4A 2G9DA 1BPMA 3HPHE 1JWQA 3PB8X 4ZBGA 2V8GA 4C7HA 4F8ZA 2EZAA 3EZAA 4P4DA 1CM0A 4BMHA 3CXSA 1KEEB 5G1ZA 3T0TA 3D2MA 4CAVA 2PCNA 3TLEA 4B5PA 3WC6A 2RC4A 1YREA 1BAVA 4NJRA 2OLSA 1KWMA 1F57A 3L2NA 2ZOFA 3FBUA 2AFSA 4PSXA 4EWTA 7CPAA 3K4IA 1WVMA 4BINA 1Z8WA 2J8NA 2ZW7A 5FD8A 4CRYB 5J8CA 1XJOA 2HC9A 3I9SA 4KOYA 4M85A 1UFHA 5HKYA 1FBVA 3KI9A 1LOKA 3PEIA 4KSIA 1MJBA 2EK9A 3D8PA 4UFVA 4PSWA 1J4JA 4K3NA 3RO0A 3LWUA 3NH4A 3QNVA 1IU8A 1ZLIA 4OMEA 4HNXB 3OWCA 1FY7A 5K8PA 1V6CA 2R7HA 4B5PB 4Q36A 3QAHA 4F9UA 5IV0A 1Y0YA 3LACA 1Z9EA 1EO0A 3H4QA 4M6IA 3TX8A 4MI1A 4C8AA 2IMOA 4FUUA 4MJ8A 3LD2A 5K8NA 2JLMA 4LX9A 1ZRSA 5LRGA 3PRTA 3T8WA 4F0YA 2JBJA 2PDOA 4ZGYB 4CYPA 4ORFA 4AVAA 4P45A 4CRZB 3B3CA 1S3ZA 1P0HA 2GU2A 4Q38A 1ZLHA 3S6FA 4DNCA 1X12A 4U9ZA 3G3SA 3TOAA 5JYBA 4UIBA 4L8AA 4KOVA 3PB4X 3B3VA 3CXQA 4PXBA 4C8PA 1IYLA 4A30A 4YU9A 4ZI6A 3EFAA 3VRRA 4H6ZA 2YJTA 3PGPA 1XF8A 4HPSA 3WT4A 2FSRA 4C85A 4XNHC 4MFLA 2B3VA 4F0XA 1ZG9A 3GYAA 3DR8A 3V38A 5LRJA 4MFZA 4C84A 1IOIA 1ZG7A 2HROA 2N3AB 2ZEEA 5HXDA 3IWGA 4KORA 5I4MA 5LYLA 2NSMA 3LODA 1VHOA 1MK4A 1HDQA 3B3TA 4ZY1A 2Q44A 2B4JC 1M4DA 1Z5RA 4YWYA 4E2AA 4YRHA 3FH4A 4DYOA 3FMCA 5J8FA 2YNEA 3BUWB 3IO1A 1WJTA 2YNCC 4UEZA 3RNZA 5K8MA 3IWEA 2OZUA 2PRQA 1MJAA 3W6SA 1I21A 1RO5A 1XMBA 3PZJA 3FVLA 2ZEFA 8CPAA 2Q7SA 4M8DA 5F46A 4C9UA 1XFOA 5JGFA 2PJ7A 2ANPA 3KR5A 2BCOA 4CYOA 1KC7A 4P10A 1LANA 2PQ8A 2CNSA 2V8VA 1VBHA 2Q0YA 4OIWA 3TLAA 1DE4C 4ONUA 3KZWA 2V8HA 4MFKA 2PR8A 1QMUA 1CS0B 3B7IA 4KVXA 3FEEA 2A4NA 2OB0A 2V8DA 2DIKA 4GXHA 1VI4A 3D3SA 4NGRA 3KL9A 1IGBA 2Q04A 4X5KA 2ARHA 2G3AA 2CXAA 2YNCA 2D0PA 4Y49B 4ZX9A 1H8LA 2I00A 1EE3P 2P6GA 3EO4A 3DDDA 5HKZA 3HLPA 1NE9A 2ZPAA 3WR7A 3U1BA 3FF3A 2CF4A 1RXTA 3G8WA 1Y9WA 4MRIA 4R8FA 3V7ZA 2MP0A 1LAMA 1M6VB 4NF1A 4MCSA 4E94A 1A9XB 4C7IA 2Y1MA 3BI0A 4EFDA 3D68A 1ARMA 2QYVA 2CIJA 4OC4A 4A4BA 1IB1E 2ZEMA 3ISXA 3MN8A 2F8HA 1YR0A 4J3GA 1B6BA 3D67A 3H8GA 4PXEA 3TTHA 3RYOA 4U9YA 5F49A 2PE3A 2ZEOA 4UFXA 1DIKA 1C3OB 5KTCA 2BOAA 1IIDA 4MCPA 4MI4A 2VZYA 3OAKA 2QVPA 3SI0A 3V8IA 4INJA 3T05A 4NGSA 2FM4A 3PB9X 3TLBA 3SXOA 5CBMA 2G0BA 3T90A 3PP9A 3IGRA 4CGLA 5JVLA 3KQZA 4OC5A 3U88C 2QJ8A 4MHDA 2PJBA 3VH9A 3C26A 3S9NA 1YGHA 2XEIA 3BUOB 2EUIA 2PR1A 4IHMA 4KVME 3OP0A 4PXCA 4WWVA 3BHXA 4UWIA 3GIUA 1TXRA 3CZXA 2FVGA 1Y0RA 3R95A 2B4DA 2Q51A 1CP7A 2GLJA 4MFPA 4CGPA 3D66A 5CPAA 5I0CA 4NXYA 1ARLA 3OB2B 2R1IA 4JXRA 3ZZIA 4X8IA 4RUHA 1YW4A 2CY2A 5BWAB 5JPHA 2F7VA 1C30B 2HWGA 3GLJA 3IFEA 4LQGA 5EMIA 1CX8A 2I3CA 2XPPA 3B3WA 4LUAA 4QBJA 1YQEA 2JDCA 4X3RA 1K4JA 1TIQA 1ZO0A 3QB8A 2Z3KA 4P4IA 2R82A 1R43A 3I1UA 3PB7X 4JXQA 4KVOE 2CTBA 3MRUA 1YLEA 1YLOA 2VQYA 2V77A 4KOXA 3IWWA 3VATA 2E28A 1YMEA 2DPSA 4Z65A 2AUNA 3FNCA 4NGNA 1IICA 1XRYA 1NSAA 3H8FA 1S60A 3UY5A 1PUAA 4CAFA 4TJVA 3SHPA 1RTQA 3EC4A 1BLLE 2H5MA 5F5XA 2ZEHA 1V0CA 3WABA 4B14A 2FCKA 2AFUA 4B6ZA 3HUVA 1TKJA 5BY0A 4QUSA 1F2PA 3E0KA 4B10A 4U5YA 3TE4A 2B0AA 2D0OA 2X7BA 4C9RA 2ZW6A 2PJ6A 3TCVA 1IY7A 1J3LA 1I12A 2CTCA 4H2KA 2Z3MA 3VRQA 3D4UA 4MCRA 3R1KA 2UV8G 4PV6A 4R76A 3BXMA 4A31A 1Y7EA 1Z8TA 2PJ3A 1Q7LA 3GY9A 5HMNA 4P4FA 2PVWA 4FD6A 3SR3A 1TKFA 3KGQA 4C8CA 2PJ4A 2P6EA 4OC0A 3DR6A 3IEHA 4UCMA 4FWUA 3TO6A 3NH5A 3S9LA 4BPWB 1MJ9A 4CGNA 4AG9A 4PXDA 1ZL0A 5HVGA 1Y7RA 3TO7A 4MHZA 1VKCA 4DJLA 4FBEA 5JH9A 2EZBA 4AXVA 4J0NA 3EZEA 5DWMA 3RZAA 1KZFA 2KCWA 4C8TA 4C2YA 4BPXB 1YVKA 5JM6A 2OU2A 2B4BA 3R96A 2PVVA 2OZGA 4H1HA 4FD7A 3SJEA 2F5IA 1VBGA 4BPUB 2G3TA 3KKWA 2FXFA 5AG4A 5K8OA 3PLFB 1DTDA 2PJAA 1HEEA 1BO4A 4CDKA 5THWA 3ZNIA 2HI6A 4XPDC 4AVBA 4OLLA 4E5SA 2ZXVA 1KUXA 3IJ3A 3FEDA 4KLWA 1VIXA 3KHXA 4BBHA 3S6HA 1NMTA 2I79A 5IB9A 2NYQA 3S9MA 2EWBA 5F09A 1S7LA 2FIWA 4WJBA 3B3SA 4UIAA 3GUXA 2O28A 2HB6A 4UF4A 3BJ8A 1WWZA 5EC4A 2K5TA 2ATRA 3S6GA 3TLGA 2BO9A 2ZW5A 3SJFA 2GE3A 1Z4EA 4E8OA 3PFEA 4UWJA 5CNPA 3P2FA 4RS2A 5HKWA 3JTKA 4FAIA 3B2YA 1Z8XA 2VL1A 2WPWA 5KTDA 1Z4RA 5AGEA 2CBLA 1AYEA 1KUVA 4L89A 4PPZA 1S7NA 1Y9ZA 2FL4A 1OBRA 2FS5A 4P4JA 5AXIA 1Y9KA 3GKRA 4X2TA 4B11A 4UEFA 2YNDA 4TWEA 5LYDA 4UFWA 1CPXA 2XPOA 2D4OA 2Z10A 4MMOA 3CXPA 1X10A 1WK4A 2VBQA 3DLJA 3ZJ0A 1JDEA 1EZAA 3PFOA 2Q4ZA 1PU9A 2B3UA 4CS0B 3PBBA 3S6KA 1XEBA 2WSAA 3TLGB 1Q2DA 2YJVA 2OZHA 2DXQA 2Q43A 3CT9A 2NMTA 1M4GA 5H86A 5G20A 1VHEA 3CPAA 1YX0A 2BSWA 5AG5A 2OOTA 3DGVA 3T9YA 1GYTA 3EXNA 2AFZA 2OR4A 5EBVA 3BUNB 5F48A 4AVCA 3TFYA 1LCPA 3NFQA 4NSQA 3R9EA 4II9A 4QB9A 1UWYA 3I3GA 5A27A 4G1PA 4JVOA 2VEZA 1XMTA 2HV2A 1CP6A 4ONWA 3RBUA 4OKOA 2PJ8A 5E96A 4ZY0A 4HNYB 5C82A 1IYKA 4MFQA 1YVHA 2QECA 2XPNA 4HNWB 2VXKA 4B5OA 1YSJA 3D7HA 2POKA 3F0AA 4KLVA 3D7FA 2RFHA 3W91A 4C9EA 5H84A 4NJQA 2AE6A 2C6GA 2ZEDA 2PSWA 4P6YA 3TLCA 4C9VA 1CPSA 2C1CA 1AMPA 4GS4A 2PJ9A 5DS0A 1VHSA 2PCUA 2EZCA 3I74A 3P2HA 2FE7A 3ICUA 4EVYA 2Q4VA 1ON0A 2VKZG 2D4PA 3EZBA 1BOBA 4OC1A 3JVNA 1Z8LA 3SJXA 1AUGA 1CG2A 2QMLA 1LAPA 2VI7A 4KUBA 4R6TA 4UA3A 1S5KA 4R3KA 3VWDA 2ZELA 4MXUA 4RR2B 4AB7A 2B5GA 2PJ1A 4O23A 3C8OA 2J8RA 3QAYA 4XPKA 1L0CA 4MFJA 1HDUA 3K9UA 4C99A 1B87A 3FJUA 4UBRA 2Q4YA 4JLYA 1XIXA 3TOBA 1EZBA 5G21A 2GREA 1LFWA 1QSMA 2FT0A 4OADA 2WPXA 2AFWA 4CZ1A 1Z2LA 1CBXA 3SI1A 3VTAA 4NGPA 4OC3A 5FVJA 5KTAA 1XE4A 3O8ZA 3FIXA 4R7MA 4C8UA 5D8NA 4TNUA 2AUMA 1QSNA 3R9FA 1KUYA 2GIVA 4A38A 3NE8A 3VRNA 4PQAA 4GM5A 4CO9A 3G23A 3PFVA 2BL1A 1A2ZA 5AG6A 4CGMA 4P44A 2REFA 1M1DA 2GP4A 4B13A 3DNSA 3PB6X 1TKHA 2R8VA 4AG7A 1R61A 1M4IA 2QIRA 1CJWA 4OIDA 2C27A 3VGOA 3A9LA 4R3LA 3WC5A 3FXTA 4W9YA 3BJ7A 4Q7AA 4C2XA 3NE7A 3BUXB 4LQ6A 5HH1A 4CYNA 2O4HA 1YVOA 4KSAA 2EK8A 1SQHA 4RN7A 1ELLP 4MCQA 1Z9UA 5J3XA 2CNTA 2ZOGA 2XEJA 3TYXA 4KUAA 4A39A 3NFZA 4P4BA 5A28A 4MHNA 2ABZA 3FECA 1ELMP 2ZENA 1NBWA 4A2ZA 3D7DA 1Q2CA 4MHPA 4A37A 4ZX8A 5ISVA 3BI1A 4TJXA 3W6XA 1XOVA 3IU2A 4MHYA 3NOJA 3T07A 1M4LA 1F2OA 2Z3NA 2ZEGA 4ZYQA 2AFXA 2B5GB 3KHZA 5F1YA 1CE8B 3H8EA 4R9MA 2JEVA 1XF1A 3KRVA 3TLZA 3N7ZA 4COBA 4KOSA 1P4NA 4CAWA 4IK2A 3OB1B 1FT7A 3TO9A 2XPLA 3VARA 4MJXA 3JRUA 2Q7BA 5HVFA 2AFMA 1R57A 3WC7A 3D7GA 2Z3OA 3PBEA 2RB7A 4YGOA 3D2PA 3TT2A 4JZ0A 4H6UA 4IIXA 4F6AA 2X0SA 3I6SA 1GHEA 1TF8A 2J9AA 2WUUA 4IIYA 2PIYA 4IUSA 3R9GA 5LYFA 4EMEA 2WYRA 4HKFA 4EYSA 3MGDA 3IIBA 4OAEA 5ELYA 2XEGA 3GJZA 4OC2A 1PCAA 3EY5A 4M6GA 2Z11A 3IU1A 1QSTA 1Q5XA 5F9MA 2PJ0A 4KOTA 4C9AA 1NXJA 4C86A 3TLYA 2P6FA 2GANA 2XEFA 5HVHA 1ZG8A 5D29A 4XPDB
chains in the Genus database with same CATH topology
2AFOA 3LMSA 4C8FA 4CDJA 3TC8A 4NGTA 1PYTB 3B35A 4P4EA 3K2KA 3NA6A 4JYWA 4IAVA 2IQ6A 3CPXA 3SJGA 5LYIA 4BD9A 6CPAA 2IJZA 1YW6A 2JEWA 5J1QA 2WZNA 3EIFA 3KASA 1XBUA 1JQGA 3FX6A 2PIZA 1BPNA 3IC1A 5LRKA 2JBKA 4F9VA 4NFRA 3KR4A 5IR2A 2O53A 4OP4A 3N5FA 3CDXA 1QQ9A 2PJ2A 2C5QA 3NH8A 2C6CA 4UEEA 2DEAA 2ZEPA 3SI2A 3ISZA 2C6PA 2PJCA 4NGQA 4NGMA 4DUKA 1R3NA 3KQXA 1FNOA 4CPAA 2PJ5A 2GLFA 4KNGE 3RAMA 4YN3A 1VGYA 4ZY2A 1TF9A 3GB0A 3K9TA 4A94A 2G9DA 1BPMA 3PB8X 2V8GA 4F8ZA 4P4DA 3WC6A 4NJRA 1BAVA 1KWMA 1F57A 3L2NA 2ZOFA 4EWTA 2AFSA 7CPAA 1XJOA 2HC9A 3KI9A 1LOKA 3PEIA 4KSIA 2EK9A 4K3NA 3LWUA 3NH4A 3QNVA 1ZLIA 4OMEA 5K8PA 1V6CA 4F9UA 1Y0YA 4C8AA 3TX8A 2IMOA 4FUUA 5K8NA 5LRGA 3PRTA 3T8WA 2JBJA 4P45A 3B3CA 2GU2A 1ZLHA 4UIBA 3PB4X 3B3VA 4PXBA 4C8PA 4YU9A 4ZI6A 3WT4A 4C85A 1ZG9A 3V38A 5LRJA 4C84A 1ZG7A 5HXDA 2ZEEA 5LYLA 5I4MA 2NSMA 1VHOA 1HDQA 3B3TA 4ZY1A 1Z5RA 4YWYA 3FH4A 4DYOA 3FMCA 5K8MA 4UEZA 3IO1A 2PRQA 1XMBA 3FVLA 2ZEFA 8CPAA 4C9UA 1XFOA 5JGFA 2PJ7A 2ANPA 3KR5A 2BCOA 4P10A 1LANA 2V8VA 4OIWA 1DE4C 3KZWA 2V8HA 1QMUA 3B7IA 3FEEA 2V8DA 4NGRA 3KL9A 1IGBA 4ZX9A 1H8LA 1EE3P 3HLPA 3FF3A 2CF4A 4MRIA 4R8FA 3V7ZA 1LAMA 4MCSA 4EFDA 3BI0A 3D68A 1ARMA 2QYVA 2CIJA 4OC4A 2ZEMA 3ISXA 3MN8A 2F8HA 3D67A 3H8GA 4PXEA 2PE3A 2ZEOA 2BOAA 4MCPA 3SI0A 4NGSA 3PB9X 5CBMA 3KQZA 4OC5A 2QJ8A 2PJBA 3VH9A 3S9NA 4PXCA 2XEIA 4IHMA 4WWVA 3BHXA 1TXRA 2FVGA 1Y0RA 2Q51A 1CP7A 2GLJA 3D66A 5CPAA 1ARLA 4X8IA 4RUHA 1YW4A 2F7VA 3GLJA 3IFEA 4LQGA 2I3CA 1CX8A 1WVMA 3B3WA 4X3RA 4P4IA 1R43A 3I1UA 3PB7X 2CTBA 3MRUA 1YLOA 2V77A 1ZG8A 3IWWA 3VATA 1YMEA 4Z65A 4NGNA 1XRYA 1NSAA 3H8FA 4TJVA 1RTQA 1BLLE 2ZEHA 3WABA 2AFUA 4B6ZA 3HUVA 1TKJA 1F2PA 4C9RA 2PJ6A 1IY7A 2CTCA 4H2KA 4R76A 3D4UA 4MCRA 3BXMA 1Y7EA 2PJ3A 1Q7LA 4P4FA 2PVWA 1TKFA 3KGQA 4C8CA 2PJ4A 4OC0A 3IEHA 4FWUA 3NH5A 3S9LA 4PXDA 5HVGA 4MHZA 4DJLA 4FBEA 5JH9A 4AXVA 3RZAA 4C8TA 5JM6A 2PVVA 3SJEA 5K8OA 4CDKA 1DTDA 2PJAA 1HEEA 5THWA 3IJ3A 3FEDA 1VIXA 3KHXA 5IB9A 2NYQA 3S9MA 2EWBA 5F09A 4WJBA 3B3SA 4UIAA 3GUXA 2HB6A 4UF4A 2BO9A 3SJFA 3PFEA 4FAIA 3B2YA 2VL1A 1AYEA 4PPZA 1Y9ZA 1OBRA 4P4JA 4X2TA 4UEFA 4TWEA 5LYDA 1CPXA 4MMOA 2XEFA 3DLJA 3PFOA 2Q4ZA 3PBBA 2Q43A 3CT9A 1VHEA 3CPAA 2OOTA 3DGVA 1GYTA 2AFZA 2OR4A 1LCPA 1UWYA 4G1PA 1CP6A 4ONWA 3RBUA 4OKOA 2PJ8A 4ZY0A 1YSJA 3D7HA 2POKA 3D7FA 2RFHA 4C9EA 4NJQA 4P6YA 2ZEDA 4C9VA 1CPSA 2C1CA 1AMPA 2PJ9A 5DS0A 3I74A 2PCUA 3ICUA 4OC1A 1Z8LA 3SJXA 1CG2A 4R6TA 1LAPA 2ZELA 4MXUA 2PJ1A 4O23A 1HDUA 4C99A 3FJUA 2GREA 1LFWA 2AFWA 1Z2LA 1CBXA 3SI1A 3VTAA 4NGPA 4OC3A 4R7MA 4C8UA 5D8NA 4TNUA 4A38A 4PQAA 4GM5A 4P44A 2GP4A 3PB6X 1TKHA 4OIDA 3WC5A 4W9YA 4Q7AA 2O4HA 2EK8A 1ELLP 4MCQA 2ZOGA 2XEJA 4A39A 3NFZA 4P4BA 4MHNA 2ABZA 3FECA 1ELMP 2ZENA 3D7DA 4MHPA 4A37A 4ZX8A 3BI1A 4TJXA 4MHYA 1M4LA 1F2OA 2ZEGA 4ZYQA 2AFXA 3KHZA 3H8EA 1XF1A 4IK2A 1FT7A 3VARA 3JRUA 5HVFA 2AFMA 3WC7A 3D7GA 3PBEA 2RB7A 4JZ0A 3I6SA 1TF8A 2J9AA 2PIYA 5LYFA 4EMEA 2WYRA 3IIBA 5ELYA 2XEGA 4OC2A 1PCAA 2PJ0A 4C9AA 4C86A 2QVPA 5HVHA 2C6GA 5D29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFO A;  3LMS A;  4C8F A;  4CDJ A;  3TC8 A;  4NGT A;  1PYT B;  3B35 A;  4P4E A;  3K2K A;  3NA6 A;  4JYW A;  4IAV A;  2IQ6 A;  3CPX A;  3SJG A;  5LYI A;  4BD9 A;  6CPA A;  2IJZ A;  1YW6 A;  2JEW A;  5J1Q A;  2WZN A;  3EIF A;  3KAS A;  1XBU A;  1JQG A;  3FX6 A;  2PIZ A;  1BPN A;  3IC1 A;  5LRK A;  2JBK A;  4F9V A;  4NFR A;  3KR4 A;  2O53 A;  4OP4 A;  3N5F A;  3CDX A;  1QQ9 A;  2PJ2 A;  3NH8 A;  2C6C A;  4UEE A;  2DEA A;  2ZEP A;  3SI2 A;  3ISZ A;  2C6P A;  2PJC A;  4NGQ A;  4NGM A;  4DUK A;  1R3N A;  3KQX A;  1FNO A;  4CPA A;  2PJ5 A;  2GLF A;  4KNG E;  3RAM A;  4YN3 A;  1VGY A;  4ZY2 A;  1TF9 A;  3GB0 A;  3K9T A;  4A94 A;  2G9D A;  1BPM A;  3PB8 X;  2V8G A;  4F8Z A;  4P4D A;  3WC6 A;  4NJR A;  1BAV A;  1KWM A;  1F57 A;  3L2N A;  2ZOF A;  4EWT A;  2AFS A;  7CPA A;  1XJO A;  2HC9 A;  3KI9 A;  1LOK A;  3PEI A;  4KSI A;  2EK9 A;  4K3N A;  3LWU A;  3NH4 A;  3QNV A;  1ZLI A;  4OME A;  5K8P A;  1V6C A;  4F9U A;  1Y0Y A;  4C8A A;  3TX8 A;  2IMO A;  4FUU A;  5K8N A;  5LRG A;  3PRT A;  3T8W A;  2JBJ A;  4P45 A;  3B3C A;  2GU2 A;  1ZLH A;  4UIB A;  3PB4 X;  3B3V A;  4PXB A;  4C8P A;  4YU9 A;  4ZI6 A;  3WT4 A;  4C85 A;  1ZG9 A;  3V38 A;  5LRJ A;  4C84 A;  1ZG7 A;  5HXD A;  2ZEE A;  5LYL A;  5I4M A;  2NSM A;  1VHO A;  1HDQ A;  3B3T A;  4ZY1 A;  1Z5R A;  4YWY A;  3FH4 A;  4DYO A;  3FMC A;  5K8M A;  4UEZ A;  3IO1 A;  2PRQ A;  1XMB A;  3FVL A;  2ZEF A;  8CPA A;  4C9U A;  1XFO A;  5JGF A;  2PJ7 A;  2ANP A;  3KR5 A;  2BCO A;  4P10 A;  1LAN A;  2V8V A;  4OIW A;  1DE4 C;  3KZW A;  2V8H A;  1QMU A;  3B7I A;  3FEE A;  2V8D A;  4NGR A;  3KL9 A;  1IGB A;  4ZX9 A;  1H8L A;  1EE3 P;  3HLP A;  3FF3 A;  2CF4 A;  4MRI A;  4R8F A;  3V7Z A;  1LAM A;  4MCS A;  4EFD A;  3BI0 A;  3D68 A;  1ARM A;  2QYV A;  2CIJ A;  4OC4 A;  2ZEM A;  3ISX A;  3MN8 A;  2F8H A;  3D67 A;  3H8G A;  4PXE A;  2PE3 A;  2ZEO A;  2BOA A;  4MCP A;  3SI0 A;  4NGS A;  3PB9 X;  5CBM A;  3KQZ A;  4OC5 A;  2QJ8 A;  2PJB A;  3VH9 A;  3S9N A;  4PXC A;  2XEI A;  4IHM A;  4WWV A;  3BHX A;  1TXR A;  2FVG A;  1Y0R A;  2Q51 A;  1CP7 A;  2GLJ A;  3D66 A;  5CPA A;  1ARL A;  4X8I A;  4RUH A;  1YW4 A;  2F7V A;  3GLJ A;  3IFE A;  4LQG A;  2I3C A;  1CX8 A;  1WVM A;  3B3W A;  4X3R A;  4P4I A;  1R43 A;  3I1U A;  3PB7 X;  2CTB A;  3MRU A;  1YLO A;  2V77 A;  1ZG8 A;  3IWW A;  3VAT A;  1YME A;  4Z65 A;  4NGN A;  1XRY A;  1NSA A;  3H8F A;  4TJV A;  1RTQ A;  1BLL E;  2ZEH A;  3WAB A;  2AFU A;  4B6Z A;  3HUV A;  1TKJ A;  1F2P A;  4C9R A;  2PJ6 A;  1IY7 A;  2CTC A;  4H2K A;  4R76 A;  3D4U A;  4MCR A;  3BXM A;  1Y7E A;  2PJ3 A;  1Q7L A;  4P4F A;  2PVW A;  1TKF A;  3KGQ A;  4C8C A;  2PJ4 A;  4OC0 A;  3IEH A;  4FWU A;  3NH5 A;  3S9L A;  4PXD A;  5HVG A;  4MHZ A;  4DJL A;  4FBE A;  5JH9 A;  4AXV A;  3RZA A;  4C8T A;  5JM6 A;  2PVV A;  3SJE A;  5K8O A;  4CDK A;  1DTD A;  2PJA A;  1HEE A;  5THW A;  3IJ3 A;  3FED A;  1VIX A;  3KHX A;  5IB9 A;  2NYQ A;  3S9M A;  2EWB A;  5F09 A;  4WJB A;  3B3S A;  4UIA A;  3GUX A;  2HB6 A;  4UF4 A;  2BO9 A;  3SJF A;  3PFE A;  4FAI A;  3B2Y A;  2VL1 A;  1AYE A;  4PPZ A;  1Y9Z A;  1OBR A;  4P4J A;  4X2T A;  4UEF A;  4TWE A;  5LYD A;  1CPX A;  4MMO A;  2XEF A;  3DLJ A;  3PFO A;  2Q4Z A;  3PBB A;  2Q43 A;  3CT9 A;  1VHE A;  3CPA A;  2OOT A;  3DGV A;  1GYT A;  2AFZ A;  2OR4 A;  1LCP A;  1UWY A;  4G1P A;  1CP6 A;  4ONW A;  3RBU A;  4OKO A;  2PJ8 A;  4ZY0 A;  1YSJ A;  3D7H A;  2POK A;  3D7F A;  2RFH A;  4C9E A;  4NJQ A;  4P6Y A;  2ZED A;  4C9V A;  1CPS A;  2C1C A;  1AMP A;  2PJ9 A;  5DS0 A;  3I74 A;  2PCU A;  3ICU A;  4OC1 A;  1Z8L A;  3SJX A;  1CG2 A;  4R6T A;  1LAP A;  2ZEL A;  4MXU A;  2PJ1 A;  4O23 A;  1HDU A;  4C99 A;  3FJU A;  2GRE A;  1LFW A;  2AFW A;  1Z2L A;  1CBX A;  3SI1 A;  3VTA A;  4NGP A;  4OC3 A;  4R7M A;  4C8U A;  5D8N A;  4TNU A;  4A38 A;  4PQA A;  4GM5 A;  4P44 A;  3PB6 X;  1TKH A;  4OID A;  3WC5 A;  4W9Y A;  4Q7A A;  2O4H A;  2EK8 A;  1ELL P;  4MCQ A;  2ZOG A;  2XEJ A;  4A39 A;  3NFZ A;  4P4B A;  4MHN A;  2ABZ A;  3FEC A;  1ELM P;  2ZEN A;  3D7D A;  4MHP A;  4A37 A;  4ZX8 A;  3BI1 A;  4TJX A;  4MHY A;  1M4L A;  1F2O A;  2ZEG A;  4ZYQ A;  2AFX A;  3KHZ A;  3H8E A;  1XF1 A;  4IK2 A;  1FT7 A;  3VAR A;  3JRU A;  5HVF A;  2AFM A;  3WC7 A;  3D7G A;  3PBE A;  2RB7 A;  4JZ0 A;  3I6S A;  1TF8 A;  2J9A A;  2PIY A;  5LYF A;  4EME A;  2WYR A;  3IIB A;  5ELY A;  2XEG A;  4OC2 A;  1PCA A;  2PJ0 A;  4C9A A;  4C86 A;  2QVP A;  5HVH A;  2C6G A;  5D29 A; 
#chains in the Genus database with same CATH topology
 3H5Z A;  2AFO A;  3LMS A;  4A33 A;  4C8F A;  5AG7 A;  3TC8 A;  4CDJ A;  4CAX A;  5IB0 A;  1S7K A;  4KS9 A;  4QC6 A;  4M3S A;  2Z3P A;  4NGT A;  1M44 A;  1N71 A;  1PYT B;  2R98 A;  4R57 A;  3SXN A;  4MBU A;  5DWN A;  2CNM A;  3B35 A;  2Y1N A;  4P4E A;  3K2K A;  3NA6 A;  4NCZ A;  4A32 A;  4C2Z A;  1U6M A;  4JJX A;  1QSR A;  4MY3 A;  4MY0 A;  4Y49 C;  4K30 A;  4RI1 A;  4JYW A;  4IAV A;  2IQ6 A;  3HPG G;  2YGW A;  3CPX A;  4KZT A;  4PK3 A;  3SJG A;  4BTF A;  2IL4 A;  5F47 A;  3VRO A;  4A95 A;  3FYN A;  2FIA A;  5LYI A;  1T36 B;  4R87 A;  3HMJ G;  2DPT A;  4BD9 A;  3T5M A;  6CPA A;  3PT1 A;  2IJZ A;  2B4D B;  4A4C A;  1YW6 A;  3DSB A;  3F8K A;  2JEW A;  2HQY A;  1I1D A;  2WZN A;  3KAS A;  4UCP A;  5J1Q A;  3EIF A;  4B12 A;  4C68 A;  4GPL B;  1S7F A;  1XBU A;  5F13 A;  1JQG A;  3FRM A;  2JDD A;  3FX6 A;  2BEI A;  1BPN A;  2PIZ A;  3IC1 A;  4IF5 A;  3BUM B;  1NSL A;  2DLA A;  2JBK A;  4YFJ A;  5LRK A;  1ZYM A;  1KBL A;  4KOU A;  1IOF A;  2PC1 A;  4F9V A;  4NFR A;  4XPL A;  3KR4 A;  3BLN A;  1Q2Y A;  2J8M A;  3VWE A;  5IR2 A;  4CGO A;  2O53 A;  2P0W A;  1QSO A;  4OP4 A;  3F9K C;  2EVN A;  3N5F A;  4JD6 A;  2HUZ A;  3CDX A;  1B47 A;  4CAE A;  1QQ9 A;  2EBJ A;  1BXR B;  3VRP A;  2PJ2 A;  4PK2 A;  2C5Q A;  2BUE A;  4E0A A;  3NH8 A;  2C6C A;  4UEE A;  2EO8 A;  2Z0Z A;  2DEA A;  1YK3 A;  2ZEP A;  2AJ6 A;  4JWP A;  2GFQ A;  3ISZ A;  3SI2 A;  5C88 A;  2C6P A;  2PJC A;  5IX3 A;  4FD5 A;  2Y0M A;  4NGQ A;  2PRB A;  1LRZ A;  1JDB C;  2ODF A;  4I49 A;  4NGM A;  4KSF A;  4M6H A;  4XNH B;  4DUK A;  1R3N A;  2REE A;  5GCN A;  2ZW4 A;  3KQX A;  5G22 A;  1FNO A;  3JUW A;  4FD4 A;  4CPA A;  2OH1 A;  2PJ5 A;  4QVT A;  2GLF A;  4KNG E;  4CYQ A;  1OZP A;  3RAM A;  2VZZ A;  4YN3 A;  2Z3L A;  1VGY A;  4NEX A;  4ZY2 A;  5K99 A;  1GGO A;  3FB3 A;  1TF9 A;  3GB0 A;  3K9T A;  4COG A;  4H89 A;  4KOW A;  2B58 A;  4UCN A;  3B8G A;  4A94 A;  2DF5 A;  3F5B A;  5JQ4 A;  2G9D A;  1BPM A;  3HPH E;  1JWQ A;  3PB8 X;  4ZBG A;  2V8G A;  4C7H A;  4F8Z A;  2EZA A;  3EZA A;  4P4D A;  1CM0 A;  4BMH A;  3CXS A;  1KEE B;  5G1Z A;  3T0T A;  3D2M A;  4CAV A;  2PCN A;  3TLE A;  4B5P A;  3WC6 A;  2RC4 A;  1YRE A;  1BAV A;  4NJR A;  2OLS A;  1KWM A;  1F57 A;  3L2N A;  2ZOF A;  3FBU A;  2AFS A;  4PSX A;  4EWT A;  7CPA A;  3K4I A;  1WVM A;  4BIN A;  1Z8W A;  2J8N A;  2ZW7 A;  5FD8 A;  4CRY B;  5J8C A;  1XJO A;  2HC9 A;  3I9S A;  4KOY A;  4M85 A;  1UFH A;  5HKY A;  1FBV A;  3KI9 A;  1LOK A;  3PEI A;  4KSI A;  1MJB A;  2EK9 A;  3D8P A;  4UFV A;  4PSW A;  1J4J A;  4K3N A;  3RO0 A;  3LWU A;  3NH4 A;  3QNV A;  1IU8 A;  1ZLI A;  4OME A;  4HNX B;  3OWC A;  1FY7 A;  5K8P A;  1V6C A;  2R7H A;  4B5P B;  4Q36 A;  3QAH A;  4F9U A;  5IV0 A;  1Y0Y A;  3LAC A;  1Z9E A;  1EO0 A;  3H4Q A;  4M6I A;  3TX8 A;  4MI1 A;  4C8A A;  2IMO A;  4FUU A;  4MJ8 A;  3LD2 A;  5K8N A;  2JLM A;  4LX9 A;  1ZRS A;  5LRG A;  3PRT A;  3T8W A;  4F0Y A;  2JBJ A;  2PDO A;  4ZGY B;  4CYP A;  4ORF A;  4AVA A;  4P45 A;  4CRZ B;  3B3C A;  1S3Z A;  1P0H A;  2GU2 A;  4Q38 A;  1ZLH A;  3S6F A;  4DNC A;  1X12 A;  4U9Z A;  3G3S A;  3TOA A;  5JYB A;  4UIB A;  4L8A A;  4KOV A;  3PB4 X;  3B3V A;  3CXQ A;  4PXB A;  4C8P A;  1IYL A;  4A30 A;  4YU9 A;  4ZI6 A;  3EFA A;  3VRR A;  4H6Z A;  2YJT A;  3PGP A;  1XF8 A;  4HPS A;  3WT4 A;  2FSR A;  4C85 A;  4XNH C;  4MFL A;  2B3V A;  4F0X A;  1ZG9 A;  3GYA A;  3DR8 A;  3V38 A;  5LRJ A;  4MFZ A;  4C84 A;  1IOI A;  1ZG7 A;  2HRO A;  2N3A B;  2ZEE A;  5HXD A;  3IWG A;  4KOR A;  5I4M A;  5LYL A;  2NSM A;  3LOD A;  1VHO A;  1MK4 A;  1HDQ A;  3B3T A;  4ZY1 A;  2Q44 A;  2B4J C;  1M4D A;  1Z5R A;  4YWY A;  4E2A A;  4YRH A;  3FH4 A;  4DYO A;  3FMC A;  5J8F A;  2YNE A;  3BUW B;  3IO1 A;  1WJT A;  2YNC C;  4UEZ A;  3RNZ A;  5K8M A;  3IWE A;  2OZU A;  2PRQ A;  1MJA A;  3W6S A;  1I21 A;  1RO5 A;  1XMB A;  3PZJ A;  3FVL A;  2ZEF A;  8CPA A;  2Q7S A;  4M8D A;  5F46 A;  4C9U A;  1XFO A;  5JGF A;  2PJ7 A;  2ANP A;  3KR5 A;  2BCO A;  4CYO A;  1KC7 A;  4P10 A;  1LAN A;  2PQ8 A;  2CNS A;  2V8V A;  1VBH A;  2Q0Y A;  4OIW A;  3TLA A;  1DE4 C;  4ONU A;  3KZW A;  2V8H A;  4MFK A;  2PR8 A;  1QMU A;  1CS0 B;  3B7I A;  4KVX A;  3FEE A;  2A4N A;  2OB0 A;  2V8D A;  2DIK A;  4GXH A;  1VI4 A;  3D3S A;  4NGR A;  3KL9 A;  1IGB A;  2Q04 A;  4X5K A;  2ARH A;  2G3A A;  2CXA A;  2YNC A;  2D0P A;  4Y49 B;  4ZX9 A;  1H8L A;  2I00 A;  1EE3 P;  2P6G A;  3EO4 A;  3DDD A;  5HKZ A;  3HLP A;  1NE9 A;  2ZPA A;  3WR7 A;  3U1B A;  3FF3 A;  2CF4 A;  1RXT A;  3G8W A;  1Y9W A;  4MRI A;  4R8F A;  3V7Z A;  2MP0 A;  1LAM A;  1M6V B;  4NF1 A;  4MCS A;  4E94 A;  1A9X B;  4C7I A;  2Y1M A;  3BI0 A;  4EFD A;  3D68 A;  1ARM A;  2QYV A;  2CIJ A;  4OC4 A;  4A4B A;  1IB1 E;  2ZEM A;  3ISX A;  3MN8 A;  2F8H A;  1YR0 A;  4J3G A;  1B6B A;  3D67 A;  3H8G A;  4PXE A;  3TTH A;  3RYO A;  4U9Y A;  5F49 A;  2PE3 A;  2ZEO A;  4UFX A;  1DIK A;  1C3O B;  5KTC A;  2BOA A;  1IID A;  4MCP A;  4MI4 A;  2VZY A;  3OAK A;  2QVP A;  3SI0 A;  3V8I A;  4INJ A;  3T05 A;  4NGS A;  2FM4 A;  3PB9 X;  3TLB A;  3SXO A;  5CBM A;  2G0B A;  3T90 A;  3PP9 A;  3IGR A;  4CGL A;  5JVL A;  3KQZ A;  4OC5 A;  3U88 C;  2QJ8 A;  4MHD A;  2PJB A;  3VH9 A;  3C26 A;  3S9N A;  1YGH A;  2XEI A;  3BUO B;  2EUI A;  2PR1 A;  4IHM A;  4KVM E;  3OP0 A;  4PXC A;  4WWV A;  3BHX A;  4UWI A;  3GIU A;  1TXR A;  3CZX A;  2FVG A;  1Y0R A;  3R95 A;  2B4D A;  2Q51 A;  1CP7 A;  2GLJ A;  4MFP A;  4CGP A;  3D66 A;  5CPA A;  5I0C A;  4NXY A;  1ARL A;  3OB2 B;  2R1I A;  4JXR A;  3ZZI A;  4X8I A;  4RUH A;  1YW4 A;  2CY2 A;  5BWA B;  5JPH A;  2F7V A;  1C30 B;  2HWG A;  3GLJ A;  3IFE A;  4LQG A;  5EMI A;  1CX8 A;  2I3C A;  2XPP A;  3B3W A;  4LUA A;  4QBJ A;  1YQE A;  2JDC A;  4X3R A;  1K4J A;  1TIQ A;  1ZO0 A;  3QB8 A;  2Z3K A;  4P4I A;  2R82 A;  1R43 A;  3I1U A;  3PB7 X;  4JXQ A;  4KVO E;  2CTB A;  3MRU A;  1YLE A;  1YLO A;  2VQY A;  2V77 A;  4KOX A;  3IWW A;  3VAT A;  2E28 A;  1YME A;  2DPS A;  4Z65 A;  2AUN A;  3FNC A;  4NGN A;  1IIC A;  1XRY A;  1NSA A;  3H8F A;  1S60 A;  3UY5 A;  1PUA A;  4CAF A;  4TJV A;  3SHP A;  1RTQ A;  3EC4 A;  1BLL E;  2H5M A;  5F5X A;  2ZEH A;  1V0C A;  3WAB A;  4B14 A;  2FCK A;  2AFU A;  4B6Z A;  3HUV A;  1TKJ A;  5BY0 A;  4QUS A;  1F2P A;  3E0K A;  4B10 A;  4U5Y A;  3TE4 A;  2B0A A;  2D0O A;  2X7B A;  4C9R A;  2ZW6 A;  2PJ6 A;  3TCV A;  1IY7 A;  1J3L A;  1I12 A;  2CTC A;  4H2K A;  2Z3M A;  3VRQ A;  3D4U A;  4MCR A;  3R1K A;  2UV8 G;  4PV6 A;  4R76 A;  3BXM A;  4A31 A;  1Y7E A;  1Z8T A;  2PJ3 A;  1Q7L A;  3GY9 A;  5HMN A;  4P4F A;  2PVW A;  4FD6 A;  3SR3 A;  1TKF A;  3KGQ A;  4C8C A;  2PJ4 A;  2P6E A;  4OC0 A;  3DR6 A;  3IEH A;  4UCM A;  4FWU A;  3TO6 A;  3NH5 A;  3S9L A;  4BPW B;  1MJ9 A;  4CGN A;  4AG9 A;  4PXD A;  1ZL0 A;  5HVG A;  1Y7R A;  3TO7 A;  4MHZ A;  1VKC A;  4DJL A;  4FBE A;  5JH9 A;  2EZB A;  4AXV A;  4J0N A;  3EZE A;  5DWM A;  3RZA A;  1KZF A;  2KCW A;  4C8T A;  4C2Y A;  4BPX B;  1YVK A;  5JM6 A;  2OU2 A;  2B4B A;  3R96 A;  2PVV A;  2OZG A;  4H1H A;  4FD7 A;  3SJE A;  2F5I A;  1VBG A;  4BPU B;  2G3T A;  3KKW A;  2FXF A;  5AG4 A;  5K8O A;  3PLF B;  1DTD A;  2PJA A;  1HEE A;  1BO4 A;  4CDK A;  5THW A;  3ZNI A;  2HI6 A;  4XPD C;  4AVB A;  4OLL A;  4E5S A;  2ZXV A;  1KUX A;  3IJ3 A;  3FED A;  4KLW A;  1VIX A;  3KHX A;  4BBH A;  3S6H A;  1NMT A;  2I79 A;  5IB9 A;  2NYQ A;  3S9M A;  2EWB A;  5F09 A;  1S7L A;  2FIW A;  4WJB A;  3B3S A;  4UIA A;  3GUX A;  2O28 A;  2HB6 A;  4UF4 A;  3BJ8 A;  1WWZ A;  5EC4 A;  2K5T A;  2ATR A;  3S6G A;  3TLG A;  2BO9 A;  2ZW5 A;  3SJF A;  2GE3 A;  1Z4E A;  4E8O A;  3PFE A;  4UWJ A;  5CNP A;  3P2F A;  4RS2 A;  5HKW A;  3JTK A;  4FAI A;  3B2Y A;  1Z8X A;  2VL1 A;  2WPW A;  5KTD A;  1Z4R A;  5AGE A;  2CBL A;  1AYE A;  1KUV A;  4L89 A;  4PPZ A;  1S7N A;  1Y9Z A;  2FL4 A;  1OBR A;  2FS5 A;  4P4J A;  5AXI A;  1Y9K A;  3GKR A;  4X2T A;  4B11 A;  4UEF A;  2YND A;  4TWE A;  5LYD A;  4UFW A;  1CPX A;  2XPO A;  2D4O A;  2Z10 A;  4MMO A;  3CXP A;  1X10 A;  1WK4 A;  2VBQ A;  3DLJ A;  3ZJ0 A;  1JDE A;  1EZA A;  3PFO A;  2Q4Z A;  1PU9 A;  2B3U A;  4CS0 B;  3PBB A;  3S6K A;  1XEB A;  2WSA A;  3TLG B;  1Q2D A;  2YJV A;  2OZH A;  2DXQ A;  2Q43 A;  3CT9 A;  2NMT A;  1M4G A;  5H86 A;  5G20 A;  1VHE A;  3CPA A;  1YX0 A;  2BSW A;  5AG5 A;  2OOT A;  3DGV A;  3T9Y A;  1GYT A;  3EXN A;  2AFZ A;  2OR4 A;  5EBV A;  3BUN B;  5F48 A;  4AVC A;  3TFY A;  1LCP A;  3NFQ A;  4NSQ A;  3R9E A;  4II9 A;  4QB9 A;  1UWY A;  3I3G A;  5A27 A;  4G1P A;  4JVO A;  2VEZ A;  1XMT A;  2HV2 A;  1CP6 A;  4ONW A;  3RBU A;  4OKO A;  2PJ8 A;  5E96 A;  4ZY0 A;  4HNY B;  5C82 A;  1IYK A;  4MFQ A;  1YVH A;  2QEC A;  2XPN A;  4HNW B;  2VXK A;  4B5O A;  1YSJ A;  3D7H A;  2POK A;  3F0A A;  4KLV A;  3D7F A;  2RFH A;  3W91 A;  4C9E A;  5H84 A;  4NJQ A;  2AE6 A;  2C6G A;  2ZED A;  2PSW A;  4P6Y A;  3TLC A;  4C9V A;  1CPS A;  2C1C A;  1AMP A;  4GS4 A;  2PJ9 A;  5DS0 A;  1VHS A;  2PCU A;  2EZC A;  3I74 A;  3P2H A;  2FE7 A;  3ICU A;  4EVY A;  2Q4V A;  1ON0 A;  2VKZ G;  2D4P A;  3EZB A;  1BOB A;  4OC1 A;  3JVN A;  1Z8L A;  3SJX A;  1AUG A;  1CG2 A;  2QML A;  1LAP A;  2VI7 A;  4KUB A;  4R6T A;  4UA3 A;  1S5K A;  4R3K A;  3VWD A;  2ZEL A;  4MXU A;  4RR2 B;  4AB7 A;  2B5G A;  2PJ1 A;  4O23 A;  3C8O A;  2J8R A;  3QAY A;  4XPK A;  1L0C A;  4MFJ A;  1HDU A;  3K9U A;  4C99 A;  1B87 A;  3FJU A;  4UBR A;  2Q4Y A;  4JLY A;  1XIX A;  3TOB A;  1EZB A;  5G21 A;  2GRE A;  1LFW A;  1QSM A;  2FT0 A;  4OAD A;  2WPX A;  2AFW A;  4CZ1 A;  1Z2L A;  1CBX A;  3SI1 A;  3VTA A;  4NGP A;  4OC3 A;  5FVJ A;  5KTA A;  1XE4 A;  3O8Z A;  3FIX A;  4R7M A;  4C8U A;  5D8N A;  4TNU A;  2AUM A;  1QSN A;  3R9F A;  1KUY A;  2GIV A;  4A38 A;  3NE8 A;  3VRN A;  4PQA A;  4GM5 A;  4CO9 A;  3G23 A;  3PFV A;  2BL1 A;  1A2Z A;  5AG6 A;  4CGM A;  4P44 A;  2REF A;  1M1D A;  2GP4 A;  4B13 A;  3DNS A;  3PB6 X;  1TKH A;  2R8V A;  4AG7 A;  1R61 A;  1M4I A;  2QIR A;  1CJW A;  4OID A;  2C27 A;  3VGO A;  3A9L A;  4R3L A;  3WC5 A;  3FXT A;  4W9Y A;  3BJ7 A;  4Q7A A;  4C2X A;  3NE7 A;  3BUX B;  4LQ6 A;  5HH1 A;  4CYN A;  2O4H A;  1YVO A;  4KSA A;  2EK8 A;  1SQH A;  4RN7 A;  1ELL P;  4MCQ A;  1Z9U A;  5J3X A;  2CNT A;  2ZOG A;  2XEJ A;  3TYX A;  4KUA A;  4A39 A;  3NFZ A;  4P4B A;  5A28 A;  4MHN A;  2ABZ A;  3FEC A;  1ELM P;  2ZEN A;  1NBW A;  4A2Z A;  3D7D A;  1Q2C A;  4MHP A;  4A37 A;  4ZX8 A;  5ISV A;  3BI1 A;  4TJX A;  3W6X A;  1XOV A;  3IU2 A;  4MHY A;  3NOJ A;  3T07 A;  1M4L A;  1F2O A;  2Z3N A;  2ZEG A;  4ZYQ A;  2AFX A;  2B5G B;  3KHZ A;  5F1Y A;  1CE8 B;  3H8E A;  4R9M A;  2JEV A;  1XF1 A;  3KRV A;  3TLZ A;  3N7Z A;  4COB A;  4KOS A;  1P4N A;  4CAW A;  4IK2 A;  3OB1 B;  1FT7 A;  3TO9 A;  2XPL A;  3VAR A;  4MJX A;  3JRU A;  2Q7B A;  5HVF A;  2AFM A;  1R57 A;  3WC7 A;  3D7G A;  2Z3O A;  3PBE A;  2RB7 A;  4YGO A;  3D2P A;  3TT2 A;  4JZ0 A;  4H6U A;  4IIX A;  4F6A A;  2X0S A;  3I6S A;  1GHE A;  1TF8 A;  2J9A A;  2WUU A;  4IIY A;  2PIY A;  4IUS A;  3R9G A;  5LYF A;  4EME A;  2WYR A;  4HKF A;  4EYS A;  3MGD A;  3IIB A;  4OAE A;  5ELY A;  2XEG A;  3GJZ A;  4OC2 A;  1PCA A;  3EY5 A;  4M6G A;  2Z11 A;  3IU1 A;  1QST A;  1Q5X A;  5F9M A;  2PJ0 A;  4KOT A;  4C9A A;  1NXJ A;  4C86 A;  3TLY A;  2P6F A;  2GAN A;  2XEF A;  5HVH A;  1ZG8 A;  5D29 A;  4XPD B; 
#chains in the Genus database with same CATH homology
 2AFO A;  3LMS A;  4C8F A;  4CDJ A;  3TC8 A;  4NGT A;  1PYT B;  3B35 A;  4P4E A;  3K2K A;  3NA6 A;  4JYW A;  4IAV A;  2IQ6 A;  3CPX A;  3SJG A;  5LYI A;  4BD9 A;  6CPA A;  2IJZ A;  1YW6 A;  2JEW A;  5J1Q A;  2WZN A;  3EIF A;  3KAS A;  1XBU A;  1JQG A;  3FX6 A;  2PIZ A;  1BPN A;  3IC1 A;  5LRK A;  2JBK A;  4F9V A;  4NFR A;  3KR4 A;  5IR2 A;  2O53 A;  4OP4 A;  3N5F A;  3CDX A;  1QQ9 A;  2PJ2 A;  2C5Q A;  3NH8 A;  2C6C A;  4UEE A;  2DEA A;  2ZEP A;  3SI2 A;  3ISZ A;  2C6P A;  2PJC A;  4NGQ A;  4NGM A;  4DUK A;  1R3N A;  3KQX A;  1FNO A;  4CPA A;  2PJ5 A;  2GLF A;  4KNG E;  3RAM A;  4YN3 A;  1VGY A;  4ZY2 A;  1TF9 A;  3GB0 A;  3K9T A;  4A94 A;  2G9D A;  1BPM A;  3PB8 X;  2V8G A;  4F8Z A;  4P4D A;  3WC6 A;  4NJR A;  1BAV A;  1KWM A;  1F57 A;  3L2N A;  2ZOF A;  4EWT A;  2AFS A;  7CPA A;  1XJO A;  2HC9 A;  3KI9 A;  1LOK A;  3PEI A;  4KSI A;  2EK9 A;  4K3N A;  3LWU A;  3NH4 A;  3QNV A;  1ZLI A;  4OME A;  5K8P A;  1V6C A;  4F9U A;  1Y0Y A;  4C8A A;  3TX8 A;  2IMO A;  4FUU A;  5K8N A;  5LRG A;  3PRT A;  3T8W A;  2JBJ A;  4P45 A;  3B3C A;  2GU2 A;  1ZLH A;  4UIB A;  3PB4 X;  3B3V A;  4PXB A;  4C8P A;  4YU9 A;  4ZI6 A;  3WT4 A;  4C85 A;  1ZG9 A;  3V38 A;  5LRJ A;  4C84 A;  1ZG7 A;  5HXD A;  2ZEE A;  5LYL A;  5I4M A;  2NSM A;  1VHO A;  1HDQ A;  3B3T A;  4ZY1 A;  1Z5R A;  4YWY A;  3FH4 A;  4DYO A;  3FMC A;  5K8M A;  4UEZ A;  3IO1 A;  2PRQ A;  1XMB A;  3FVL A;  2ZEF A;  8CPA A;  4C9U A;  1XFO A;  5JGF A;  2PJ7 A;  2ANP A;  3KR5 A;  2BCO A;  4P10 A;  1LAN A;  2V8V A;  4OIW A;  1DE4 C;  3KZW A;  2V8H A;  1QMU A;  3B7I A;  3FEE A;  2V8D A;  4NGR A;  3KL9 A;  1IGB A;  4ZX9 A;  1H8L A;  1EE3 P;  3HLP A;  3FF3 A;  2CF4 A;  4MRI A;  4R8F A;  3V7Z A;  1LAM A;  4MCS A;  4EFD A;  3BI0 A;  3D68 A;  1ARM A;  2QYV A;  2CIJ A;  4OC4 A;  2ZEM A;  3ISX A;  3MN8 A;  2F8H A;  3D67 A;  3H8G A;  4PXE A;  2PE3 A;  2ZEO A;  2BOA A;  4MCP A;  3SI0 A;  4NGS A;  3PB9 X;  5CBM A;  3KQZ A;  4OC5 A;  2QJ8 A;  2PJB A;  3VH9 A;  3S9N A;  4PXC A;  2XEI A;  4IHM A;  4WWV A;  3BHX A;  1TXR A;  2FVG A;  1Y0R A;  2Q51 A;  1CP7 A;  2GLJ A;  3D66 A;  5CPA A;  1ARL A;  4X8I A;  4RUH A;  1YW4 A;  2F7V A;  3GLJ A;  3IFE A;  4LQG A;  2I3C A;  1CX8 A;  1WVM A;  3B3W A;  4X3R A;  4P4I A;  1R43 A;  3I1U A;  3PB7 X;  2CTB A;  3MRU A;  1YLO A;  2V77 A;  1ZG8 A;  3IWW A;  3VAT A;  1YME A;  4Z65 A;  4NGN A;  1XRY A;  1NSA A;  3H8F A;  4TJV A;  1RTQ A;  1BLL E;  2ZEH A;  3WAB A;  2AFU A;  4B6Z A;  3HUV A;  1TKJ A;  1F2P A;  4C9R A;  2PJ6 A;  1IY7 A;  2CTC A;  4H2K A;  4R76 A;  3D4U A;  4MCR A;  3BXM A;  1Y7E A;  2PJ3 A;  1Q7L A;  4P4F A;  2PVW A;  1TKF A;  3KGQ A;  4C8C A;  2PJ4 A;  4OC0 A;  3IEH A;  4FWU A;  3NH5 A;  3S9L A;  4PXD A;  5HVG A;  4MHZ A;  4DJL A;  4FBE A;  5JH9 A;  4AXV A;  3RZA A;  4C8T A;  5JM6 A;  2PVV A;  3SJE A;  5K8O A;  4CDK A;  1DTD A;  2PJA A;  1HEE A;  5THW A;  3IJ3 A;  3FED A;  1VIX A;  3KHX A;  5IB9 A;  2NYQ A;  3S9M A;  2EWB A;  5F09 A;  4WJB A;  3B3S A;  4UIA A;  3GUX A;  2HB6 A;  4UF4 A;  2BO9 A;  3SJF A;  3PFE A;  4FAI A;  3B2Y A;  2VL1 A;  1AYE A;  4PPZ A;  1Y9Z A;  1OBR A;  4P4J A;  4X2T A;  4UEF A;  4TWE A;  5LYD A;  1CPX A;  4MMO A;  2XEF A;  3DLJ A;  3PFO A;  2Q4Z A;  3PBB A;  2Q43 A;  3CT9 A;  1VHE A;  3CPA A;  2OOT A;  3DGV A;  1GYT A;  2AFZ A;  2OR4 A;  1LCP A;  1UWY A;  4G1P A;  1CP6 A;  4ONW A;  3RBU A;  4OKO A;  2PJ8 A;  4ZY0 A;  1YSJ A;  3D7H A;  2POK A;  3D7F A;  2RFH A;  4C9E A;  4NJQ A;  4P6Y A;  2ZED A;  4C9V A;  1CPS A;  2C1C A;  1AMP A;  2PJ9 A;  5DS0 A;  3I74 A;  2PCU A;  3ICU A;  4OC1 A;  1Z8L A;  3SJX A;  1CG2 A;  4R6T A;  1LAP A;  2ZEL A;  4MXU A;  2PJ1 A;  4O23 A;  1HDU A;  4C99 A;  3FJU A;  2GRE A;  1LFW A;  2AFW A;  1Z2L A;  1CBX A;  3SI1 A;  3VTA A;  4NGP A;  4OC3 A;  4R7M A;  4C8U A;  5D8N A;  4TNU A;  4A38 A;  4PQA A;  4GM5 A;  4P44 A;  2GP4 A;  3PB6 X;  1TKH A;  4OID A;  3WC5 A;  4W9Y A;  4Q7A A;  2O4H A;  2EK8 A;  1ELL P;  4MCQ A;  2ZOG A;  2XEJ A;  4A39 A;  3NFZ A;  4P4B A;  4MHN A;  2ABZ A;  3FEC A;  1ELM P;  2ZEN A;  3D7D A;  4MHP A;  4A37 A;  4ZX8 A;  3BI1 A;  4TJX A;  4MHY A;  1M4L A;  1F2O A;  2ZEG A;  4ZYQ A;  2AFX A;  3KHZ A;  3H8E A;  1XF1 A;  4IK2 A;  1FT7 A;  3VAR A;  3JRU A;  5HVF A;  2AFM A;  3WC7 A;  3D7G A;  3PBE A;  2RB7 A;  4JZ0 A;  3I6S A;  1TF8 A;  2J9A A;  2PIY A;  5LYF A;  4EME A;  2WYR A;  3IIB A;  5ELY A;  2XEG A;  4OC2 A;  1PCA A;  2PJ0 A;  4C9A A;  4C86 A;  2QVP A;  5HVH A;  2C6G A;  5D29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...