3RBUA

N-terminally avitev-tagged human glutamate carboxypeptidase ii in complex with 2-pmpa
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
691
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Efficient and versatile one-step affinity purification of in vivo biotinylated proteins: Expression, characterization and structure analysis of recombinant human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3rbuA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3rbuA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3rbuA02
1TKHA 3PFEA 4PXEA 4R6TA 1GYTA 1VIXA 4H2KA 3WC6A 4IK2A 3ISZA 2J9AA 3SJGA 4RUHA 2ZOFA 2QYVA 1WVMA 4MRIA 3BI1A 3KZWA 3HUVA 2Q4ZA 1R3NA 4EWTA 4NGRA 1YSJA 3VTAA 1M4LA 1ELMP 2WZNA 3H8EA 4Z65A 4OC4A 5IB9A 3I6SA 3VATA 3PFOA 1LFWA 3KGQA 1ZG7A 4OC2A 1Z8LA 2V8GA 5CBMA 3D66A 1AYEA 4G1PA 4DUKA 3EIFA 3KHZA 1Q7LA 4MCPA 5D29A 2IMOA 3NH5A 4A39A 2PJ9A 2OR4A 4OIDA 4ZY1A 4C99A 2C6PA 4P44A 2DEAA 4X2TA 4WWVA 4MCSA 4UEFA 4AXVA 4C86A 3PB7X 4UEEA 2JBKA 3RZAA 3DGVA 3MRUA 1HEEA 5K8MA 2PJCA 4P4DA 5I4MA 2QVPA 4K3NA 2ANPA 3D4UA 3PRTA 4MXUA 4PXCA 2PRQA 2EK9A 2Q43A 1LAPA 1ZLIA 1TF8A 2AFWA 1LANA 3SI0A 3LMSA 3TX8A 5LYFA 4MHNA 2C1CA 3PB4X 2PJ0A 3KHXA 4NGSA 2C6GA 3BI0A 4P4FA 2HC9A 2BCOA 4YWYA 3FX6A 4C8PA 2GLJA 3KL9A 4LQGA 2JEWA 4A37A 1RTQA 3PB9X 1CPSA 1IGBA 4PQAA 3RBUA 1XBUA 4P4IA 3IWWA 1CP6A 1CBXA 4B6ZA 4CDKA 3KQZA 3CPXA 1FT7A 3L2NA 3FEEA 1TXRA 3B35A 5JH9A 2ZOGA 3QNVA 3D68A 3V38A 3I1UA 2WYRA 3D67A 1R43A 2ZEGA 4EMEA 4P4BA 2Q51A 2IQ6A 2PJ8A 1YW6A 4KSIA 3IIBA 3H8FA 5JM6A 2AFXA 4TJVA 2V77A 2AFZA 3ICUA 3GLJA 2PCUA 6CPAA 5LRJA 1TKFA 4MHPA 4O23A 2IJZA 4ZX9A 2RFHA 1EE3P 2O4HA 2ZEDA 1DTDA 2GREA 3HLPA 2ABZA 4PPZA 2ZEFA 4R7MA 2AFSA 2PJ1A 3JRUA 2PJAA 1F57A 1DE4C 1Z5RA 1VGYA 4F8ZA 4A94A 3D7DA 4MCQA 4P4EA 1QQ9A 4C9AA 4OP4A 3BXMA 3SJXA 4Q7AA 4P4JA 4NGMA 2QJ8A 1IY7A 3KR4A 1LCPA 3K2KA 4C9VA 4PXDA 3B3SA 3PBEA 2PJ5A 2ZEMA 4P45A 4ONWA 3RAMA 1BPNA 2XEFA 3SJEA 4KNGE 4TWEA 3V7ZA 2PJ7A 4C8TA 3IEHA 1BLLE 2HB6A 1VHOA 3IFEA 4MHYA 4A38A 4GM5A 2F7VA 4PXBA 3KR5A 2V8DA 4DJLA 2AFMA 2PE3A 4F9UA 4ZY0A 3IO1A 1HDQA 3FJUA 2V8HA 4FAIA 4OC5A 4FWUA 2VL1A 5CPAA 3TC8A 3FEDA 4P6YA 3NFZA 3NH8A 4IAVA 2GU2A 4MCRA 1ELLP 3GUXA 3WABA 4X8IA 2CTCA 5K8OA 4C8CA 5THWA 3I74A 4OC3A 2G9DA 4NGTA 2RB7A 3GB0A 4NGQA 2CTBA 1XFOA 2OOTA 2ZEHA 4NFRA 1Y7EA 5K8PA 2O53A 4OC0A 1YMEA 3SJFA 2PJBA 3DLJA 5J1QA 2POKA 2BO9A 2ZEEA 1XRYA 5LRGA 1JQGA 4C85A 4CPAA 3PEIA 1ZG9A 3PB6X 5HXDA 2NSMA 1CPXA 4ZYQA 1VHEA 1NSAA 2C6CA 4C9UA 3D7FA 4YN3A 4CDJA 1ARMA 4W9YA 4OMEA 3IJ3A 3NA6A 1HDUA 4JZ0A 2EK8A 1OBRA 3CDXA 3FMCA 3B3CA 3KQXA 1F2PA 5D8NA 4F9VA 5DS0A 5JGFA 4BD9A 2I3CA 4UIBA 4UIAA 1TKJA 3H8GA 3KI9A 5LYDA 4X3RA 3VH9A 3B2YA 3S9MA 4R8FA 3D7HA 3B7IA 3WC5A 1ZLHA 5HVHA 3ISXA 4DYOA 1AMPA 1YW4A 2PVWA 1BAVA 2V8VA 1PCAA 2PVVA 1TF9A 2GLFA 3B3VA 2AFOA 5F09A 3WC7A 1XMBA 2XEIA 1V6CA 3B3TA 1CX8A 4NGNA 1CG2A 4R76A 2PIZA 5K8NA 1CP7A 2EWBA 2ZEPA 3PB8X 3MN8A 4YU9A 1H8LA 2PJ3A 4FUUA 4IHMA 2ZELA 1PYTB 3SI2A 1FNOA 3PBBA 4ZY2A 2F8HA 4FBEA 1BPMA 7CPAA 2PJ4A 4P10A 4OKOA 3SI1A 1ZG8A 2XEGA 4C8UA 2FVGA 4C8AA 8CPAA 4UF4A 5LYLA 3N5FA 4MHZA 3FVLA 4ZX8A 1XJOA 1KWMA 3FECA 2ZENA 1Y0RA 4WJBA 3K9TA 1XF1A 4OC1A 4EFDA 2NYQA 2AFUA 4NJQA 3IC1A 1Y9ZA 1YLOA 1UWYA 5HVGA 1LOKA 3FH4A 3CT9A 4C9RA 2JBJA 2CIJA 5ELYA 2XEJA 4C9EA 3KASA 5LYIA 3S9LA 1QMUA 4TNUA 5LRKA 4C84A 2PIYA 1Y0YA 3D7GA 4TJXA 3CPAA 2CF4A 4NJRA 2PJ2A 4UEZA 4NGPA 1F2OA 2PJ6A 1Z2LA 3B3WA 4C8FA 4MMOA 1LAMA 3FF3A 5HVFA 3BHXA 4JYWA 2ZEOA 2BOAA 1ARLA 3LWUA 4OIWA 3S9NA 3T8WA 3VARA 3WT4A 3NH4A 4ZI6A
chains in the Genus database with same CATH superfamily
1TKHA 1YREA 1Y9KA 3PFEA 4PXEA 4R6TA 1GYTA 1VIXA 1R57A 1CM0A 4H2KA 4GPLB 1S7FA 3WC6A 1QSMA 4IK2A 4B10A 3ISZA 3TLAA 3D8PA 2J9AA 3SJGA 2Y1MA 4RUHA 2ZOFA 2QYVA 2VXKA 2I79A 1WVMA 4MRIA 3GY9A 3RO0A 3BI1A 3KZWA 2XPNA 1YR0A 2JLMA 2Q4ZA 3HUVA 4JD6A 4H6UA 2FE7A 4CYQA 3QAYA 4KOSA 1R3NA 1CS0B 3EZBA 4EWTA 3DDDA 3TFYA 1AUGA 2OB0A 4NGRA 1YSJA 3VTAA 2A4NA 4R3KA 4CRZB 4CYNA 5KTAA 1KC7A 1M4LA 1ELMP 4UFXA 2VZZA 3ZZIA 2EZCA 2WZNA 1IOFA 4HPSA 3H8EA 3LD2A 2PC1A 3IWGA 4Z65A 1QSNA 4OC4A 3SXNA 3G3SA 5IB9A 3HPHE 3IGRA 4AVBA 1I12A 3I6SA 3VATA 4RI1A 4CZ1A 1V0CA 3PFOA 4XNHB 1IB1E 1LFWA 4HNYB 4LQ6A 3KGQA 1Q2CA 2P6GA 5AXIA 2CNTA 2B4JC 4XPDB 1ZG7A 3R9FA 4OC2A 4ZGYB 4A4BA 4KOTA 5IX3A 1VI4A 1ZL0A 1Z8LA 3NE8A 2P6EA 2REEA 2V8GA 3FRMA 1KZFA 3DR6A 4KOXA 3D66A 1AYEA 5CBMA 4G1PA 4UCPA 3S6FA 4DUKA 4EYSA 3EIFA 3KHZA 1Q7LA 3BUNB 4U9YA 4AG9A 4MCPA 5D29A 1OZPA 2IMOA 3NH5A 4JXRA 3I3GA 4R3LA 2PJ9A 4A39A 2OR4A 4COGA 5JPHA 4QUSA 4OIDA 3OP0A 3CXQA 4ZY1A 2G3AA 4C99A 4ONUA 3TLGB 2C6PA 4BPXB 4P44A 2DF5A 2DEAA 2Z3MA 3JVNA 4X2TA 2B4DB 4KOWA 4WWVA 1NE9A 3LACA 4MCSA 4AVAA 2OLSA 2J8MA 4UEFA 5JYBA 4M6GA 4AXVA 4C86A 3FXTA 4KLWA 5AGEA 3PB7X 4UEEA 2JBKA 4IUSA 1ZRSA 2PR1A 1J3LA 2R82A 3RZAA 3TYXA 1QSOA 1KUYA 3DGVA 1HEEA 3MRUA 4BTFA 5K8MA 2PJCA 3TE4A 5ISVA 1M1DA 4P4DA 4MFZA 5I4MA 2QVPA 4K3NA 3VWEA 3N7ZA 5F46A 2ANPA 3TLBA 2CXAA 3D4UA 3PRTA 3G8WA 1IIDA 4MXUA 4BPUB 2FXFA 2PRQA 4PXCA 2EK9A 4CAEA 2X0SA 3TLCA 2Q43A 1LAPA 4OLLA 1ZLIA 2UV8G 1TF8A 2AFWA 1LANA 1MJBA 5BWAB 3SI0A 5FD8A 3LMSA 4NCZA 3D2PA 1ZYMA 3TX8A 1S7KA 5LYFA 4MHNA 1JDBC 2C1CA 4M6HA 3F0AA 4M3SA 4PSWA 5EMIA 1X12A 1UFHA 2J8NA 3PB4X 4UFVA 4YFJA 1VBHA 4E5SA 2PJ0A 3KHXA 4HKFA 4COBA 4NGSA 2Q0YA 1GGOA 3SXOA 2Q44A 2D4OA 2CY2A 5H86A 2C6GA 3BI0A 3CXSA 2K5TA 4MFKA 4P4FA 4CS0B 2D0PA 3TLEA 1M4IA 1VKCA 2HC9A 2BCOA 4YWYA 4JWPA 1K4JA 3FX6A 1QSTA 4NF1A 4C2XA 2ZW5A 4C8PA 2R1IA 2GLJA 3A9LA 3IWEA 3KL9A 4LQGA 1NMTA 4E8OA 1T36B 2JEWA 3PP9A 4A37A 2OH1A 3BUMB 3VWDA 2B58A 1A2ZA 4KLVA 4B11A 3RYOA 1RTQA 2DIKA 2FSRA 4CRYB 4XNHC 2Q04A 4J3GA 3PB9X 4YGOA 4II9A 3P2FA 2Q7SA 4F6AA 1C30B 2Y1NA 1B47A 5F48A 1CPSA 1IGBA 4PQAA 4Q36A 3TLZA 3RBUA 1XBUA 3FYNA 5G1ZA 4J0NA 3EZEA 1WJTA 4P4IA 3IWWA 3U88C 1CP6A 3R9GA 3PZJA 1CBXA 4B6ZA 1Z8TA 2PR8A 3S6HA 4CDKA 3KQZA 3CPXA 1FT7A 4R57A 3TOAA 2PRBA 3CZXA 2FCKA 4KOUA 2B3VA 3GYAA 4A32A 1A9XB 1CE8B 3L2NA 3FEEA 1TXRA 3B35A 3T9YA 5JH9A 3VROA 2OZHA 2ZOGA 3QNVA 2EBJA 1S7LA 2NMTA 3D68A 5G20A 2CNMA 4CAXA 3V38A 4AB7A 3C8OA 4E94A 4MY0A 3I1UA 2CBLA 2ZW4A 2B4BA 2WYRA 3D67A 4MJ8A 1R43A 5AG5A 2ZEGA 4EMEA 1IYKA 4M6IA 4M8DA 4P4BA 4BPWB 2Q51A 4E2AA 2IQ6A 3VRRA 1N71A 2BEIA 2FIAA 3H4QA 5G21A 2J8RA 2PJ8A 3OAKA 1YW6A 4KSIA 3GKRA 4C2ZA 3IIBA 1WK4A 2ATRA 3H8FA 5JM6A 2AFXA 4TJVA 2V77A 2AFZA 3ICUA 2WSAA 2PCUA 3GLJA 5LRJA 6CPAA 4IIYA 1KBLA 5HKYA 1TKFA 4MHPA 1GHEA 4O23A 2IJZA 1EZAA 2Z11A 5F9MA 3NE7A 1P4NA 4ZX9A 2RFHA 1EE3P 4CYOA 2O4HA 1JWQA 2GIVA 4XPKA 4C7IA 3PT1A 1IICA 1JDEA 3HMJG 2ZEDA 1ON0A 1Z8XA 4C68A 1DTDA 1Y9WA 2GREA 3HLPA 2ABZA 1YX0A 2R98A 4QB9A 4CGPA 2VI7A 4PPZA 2ZEFA 4R7MA 4B5PB 2AFSA 2PJ1A 3T5MA 4R9MA 3JRUA 3K9UA 2EO8A 4A2ZA 2PJAA 1F57A 1RO5A 1DE4C 4CGOA 1Z5RA 1VGYA 2XPOA 4KOYA 4B5PA 4A94A 3D7DA 4MCQA 4P4EA 1QQ9A 4F8ZA 4C9AA 4NSQA 3BXMA 4OP4A 3SJXA 4Q7AA 4P4JA 4ZBGA 2VKZG 4HNXB 3OWCA 4NGMA 2QJ8A 1IY7A 3KR4A 1LCPA 4QC6A 3K2KA 3T05A 5AG6A 4C9VA 4PXDA 3B3SA 3PBEA 2PJ5A 2ZEMA 4P45A 1Z9EA 4ONWA 3RAMA 2JDDA 5H84A 3TO9A 1BPNA 2IL4A 4MJXA 2VEZA 1S5KA 4A95A 2XEFA 3SJEA 4KNGE 2HQYA 2B0AA 2OZUA 2QECA 4TWEA 3V7ZA 2PJ7A 3PLFB 4C8TA 3IEHA 1BLLE 2XPLA 2B5GB 2HB6A 1VHOA 5HH1A 5DWMA 3IFEA 4MHYA 2Q7BA 4GM5A 3BUXB 5HKZA 2F7VA 2R7HA 2B5GA 2REFA 2V8DA 3KR5A 5F13A 4FD7A 3TO6A 4DJLA 4MY3A 4UWIA 2H5MA 4AG7A 2AFMA 2PE3A 1CJWA 2I00A 4F9UA 4KZTA 5AG4A 3BLNA 4ZY0A 3BUWB 1VBGA 3IO1A 5JVLA 1HDQA 1Z9UA 4X5KA 3PFVA 3FJUA 4KVXA 2V8HA 3EC4A 4FAIA 2PDOA 4MI1A 4OC5A 4FWUA 2G0BA 4QVTA 4XPLA 2VL1A 5CPAA 3TC8A 3FEDA 3T90A 1LRZA 4EVYA 4P6YA 3NFZA 1YVKA 4MFPA 3TLYA 5FVJA 3NH8A 2FT0A 4IAVA 2GFQA 4Q38A 2GU2A 4MCRA 1ELLP 3GUXA 5DWNA 3WABA 4X8IA 1XMTA 1EO0A 2MP0A 2HUZA 4CAFA 2KCWA 2GE3A 3CXPA 1P0HA 4MHDA 3D2MA 4QBJA 4KSAA 2CTCA 3W6SA 2HI6A 2G3TA 5K8OA 4C8CA 5THWA 2YGWA 4PK3A 1KUXA 3I74A 2P6FA 2BL1A 5IB0A 1PU9A 1Z4EA 4M85A 5G22A 4OC3A 2G9DA 2ZW7A 2N3AB 4NGTA 5J3XA 2RB7A 3FIXA 4LX9A 4JVOA 4U5YA 3GB0A 5KTDA 4B5OA 2AJ6A 4NGQA 4B14A 2CTBA 1BO4A 1XFOA 1ZO0A 4ORFA 4Y49B 2OOTA 2ZEHA 4NFRA 1Y7EA 5K8PA 2O53A 4OC0A 1YMEA 3SJFA 2PJBA 2YNEA 3DLJA 2Z3NA 4UCMA 4B12A 2POKA 5J1QA 4YRHA 2BO9A 2ZEEA 2Z0ZA 1XRYA 3R1KA 4CGMA 5LRGA 1JQGA 4C85A 4CPAA 4A33A 3EY5A 3I9SA 1ZG9A 3PB6X 3PEIA 2NSMA 3S6KA 1CPXA 4ZYQA 5HXDA 1VHEA 2Q4YA 2B3UA 1NSAA 2HROA 2C6CA 5EC4A 3GIUA 1Z4RA 1NBWA 3D7FA 2D0OA 4C9UA 4YN3A 4F0XA 4CDJA 3C26A 1ARMA 1R61A 4W9YA 3T07A 4OMEA 1YGHA 3E0KA 3IJ3A 3KKWA 3DNSA 3NA6A 1BOBA 2CNSA 1QSRA 1HDUA 4IF5A 4UWJA 5A28A 1NXJA 2FL4A 4RN7A 2FS5A 5IR2A 5JQ4A 1U6MA 4JZ0A 2X7BA 4H6ZA 2YNCA 2EK8A 1OBRA 3CDXA 4F0YA 3FMCA 3B3CA 2EZAA 1J4JA 2DXQA 3KQXA 4GXHA 1F2PA 2Z3PA 5D8NA 4F9VA 2GP4A 3OB1B 4E0AA 1XF8A 5DS0A 1Q5XA 3JTKA 1L0CA 2JDCA 3BJ8A 3R96A 5JGFA 4FD5A 3U1BA 1MJ9A 2D4PA 4BD9A 2I3CA 2Z3LA 4RS2A 5GCNA 3V8IA 4KSFA 2QIRA 4UIBA 4UIAA 3TOBA 1TKJA 3H8GA 4JXQA 3IU1A 3KI9A 1YVOA 3BJ7A 5LYDA 2AUNA 4X3RA 3JUWA 2WPXA 3DSBA 1Z8WA 3VH9A 3O8ZA 4OAEA 5BY0A 3B2YA 1YK3A 3S9MA 5A27A 4R8FA 2FM4A 3D7HA 3B7IA 3R9EA 4CAWA 3WC5A 1ZLHA 5HVHA 5C82A 1WWZA 3ISXA 1FY7A 4A30A 3R95A 4DYOA 4FD6A 2BSWA 1AMPA 1YW4A 3VRNA 3NFQA 4CGNA 2Z3OA 3FNCA 2PVWA 3S6GA 1BAVA 3VRPA 1PCAA 2V8VA 4IIXA 1S7NA 2PVVA 1TF9A 4KS9A 4MFQA 1BXRB 3K4IA 2VBQA 2GLFA 2E28A 3EXNA 2FIWA 1S60A 3B3VA 2ARHA 4JLYA 4KVME 3P2HA 3UY5A 2AFOA 3DR8A 5F09A 3WC7A 2EZBA 1XMBA 3NOJA 2XEIA 4PXBA 1V6CA 5J8FA 1I21A 3B3TA 1CX8A 4NGNA 3TTHA 3KRVA 1CG2A 4Y49C 2DLAA 4R76A 2ZPAA 2PIZA 3HPGG 3EZAA 2DPSA 5K8NA 1CP7A 2EWBA 4MBUA 4R87A 2ZEPA 1MK4A 3SR3A 3PB8X 2EUIA 2YNDA 3MN8A 4YU9A 4NXYA 1H8LA 2PJ3A 5CNPA 4CYPA 1M44A 2C27A 2F5IA 4FUUA 1IOIA 1NSLA 3IU2A 4IHMA 2JEVA 2OU2A 2ZELA 2ODFA 3TCVA 3W6XA 1PYTB 4OADA 3SI2A 1FNOA 2ZXVA 3PBBA 5E96A 4ZY2A 1M6VB 3TO7A 2F8HA 4L8AA 4DNCA 4H89A 4FBEA 5K99A 1BPMA 5F47A 7CPAA 3F8KA 2PJ4A 2EVNA 5KTCA 2AE6A 4P10A 4OKOA 2YNCC 3SI1A 3QB8A 4NEXA 1YVHA 2VQYA 1ZG8A 4PSXA 1IYLA 2XEGA 4BBHA 4UA3A 2FVGA 1TIQA 3TLGA 4C8UA 1Q2YA 3OB2B 2B4DA 2O28A 8CPAA 4UF4A 4C8AA 5LYLA 3EFAA 3N5FA 4MHZA 1YQEA 1XEBA 3FVLA 4KOVA 4ZX8A 2DPTA 5J8CA 2ZW6A 3ZNIA 3G23A 1XJOA 2PCNA 1B87A 3SHPA 3FBUA 1KWMA 4MFJA 4UFWA 1C3OB 3FECA 2ZENA 1Y0RA 4WJBA 3K9TA 3B8GA 5I0CA 4KUBA 2R8VA 1XF1A 4OC1A 2VZYA 5EBVA 4EFDA 2NYQA 5HKWA 2AFUA 3WR7A 4NJQA 3QAHA 3EO4A 3IC1A 4UCNA 5IV0A 1Y9ZA 1YLOA 1UWYA 5HVGA 1XIXA 1LOKA 1VHSA 1XE4A 2HV2A 4U9ZA 2QMLA 2GANA 3FH4A 4KVOE 2Y0MA 4L89A 4AVCA 3CT9A 4C9RA 1EZBA 1XOVA 2OZGA 3VGOA 3TT2A 2PSWA 2Z3KA 2JBJA 2CIJA 4H1HA 5ELYA 2YJTA 1FBVA 1MJAA 5F5XA 4KORA 4UBRA 2XEJA 1X10A 4B13A 3KASA 4C9EA 2WUUA 5LYIA 2AUMA 1DIKA 4PV6A 4A31A 3GJZA 2Q4VA 3S9LA 4HNWB 3RNZA 5C88A 2XPPA 1QMUA 3H5ZA 4TNUA 5LRKA 4CAVA 4C84A 2PIYA 1PUAA 2WPWA 4FD4A 1Q2DA 4C2YA 1Y0YA 2P0WA 3D7GA 4TJXA 3CPAA 2CF4A 4NJRA 4MI4A 2PJ2A 4CO9A 4UEZA 4C7HA 4GS4A 1KUVA 4NGPA 3PGPA 5F49A 3T0TA 4JJXA 1F2OA 5HMNA 1RXTA 4LUAA 4MFLA 2PJ6A 1Z2LA 3B3WA 2Z10A 4BINA 4C8FA 3BUOB 4CGLA 2PQ8A 4XPDC 4MMOA 3MGDA 1KEEB 1SQHA 3W91A 4K30A 4A38A 4BMHA 1LAMA 3FF3A 5HVFA 3BHXA 3LODA 4A4CA 4I49A 4JYWA 1M4GA 2ZEOA 1I1DA 1ARLA 1S3ZA 2BOAA 3LWUA 4OIWA 3ZJ0A 1YLEA 4PK2A 4INJA 2YJVA 2BUEA 4RR2B 3F9KC 1IU8A 3S9NA 3D3SA 3T8WA 3VARA 3WT4A 2HWGA 1B6BA 1Y7RA 2RC4A 2C5QA 5F1YA 3NH4A 4ZI6A 3VRQA 4KUAA 5AG7A 1M4DA 3F5BA 3FB3A
chains in the Genus database with same CATH topology
1TKHA 3PFEA 4PXEA 4R6TA 1GYTA 1VIXA 4H2KA 3WC6A 4IK2A 3ISZA 2J9AA 3SJGA 4RUHA 2ZOFA 2QYVA 1WVMA 4MRIA 3BI1A 3KZWA 3HUVA 2Q4ZA 1R3NA 4EWTA 4NGRA 1YSJA 3VTAA 1M4LA 1ELMP 2WZNA 3H8EA 4Z65A 4OC4A 5IB9A 3I6SA 3VATA 3PFOA 1LFWA 3KGQA 1ZG7A 4OC2A 1Z8LA 2V8GA 5CBMA 3D66A 1AYEA 4G1PA 4DUKA 3EIFA 3KHZA 1Q7LA 4MCPA 5D29A 2IMOA 3NH5A 4A39A 2PJ9A 2OR4A 4OIDA 4ZY1A 4C99A 2C6PA 4P44A 2DEAA 4X2TA 4WWVA 4MCSA 4UEFA 4AXVA 4C86A 3PB7X 4UEEA 2JBKA 3RZAA 3DGVA 3MRUA 1HEEA 5K8MA 2PJCA 4P4DA 5I4MA 2QVPA 4K3NA 2ANPA 3D4UA 3PRTA 4MXUA 4PXCA 2PRQA 2EK9A 2Q43A 1LAPA 1ZLIA 1TF8A 2AFWA 1LANA 3SI0A 3LMSA 3TX8A 5LYFA 4MHNA 2C1CA 3PB4X 2PJ0A 3KHXA 4NGSA 2C6GA 3BI0A 4P4FA 2HC9A 2BCOA 4YWYA 3FX6A 4C8PA 2GLJA 3KL9A 4LQGA 2JEWA 4A37A 1RTQA 3PB9X 1CPSA 1IGBA 4PQAA 3RBUA 1XBUA 4P4IA 3IWWA 1CP6A 1CBXA 4B6ZA 4CDKA 3KQZA 3CPXA 1FT7A 3L2NA 3FEEA 1TXRA 3B35A 5JH9A 2ZOGA 3QNVA 3D68A 3V38A 3I1UA 2WYRA 3D67A 1R43A 2ZEGA 4EMEA 4P4BA 2Q51A 2IQ6A 2PJ8A 1YW6A 4KSIA 3IIBA 3H8FA 5JM6A 2AFXA 4TJVA 2V77A 2AFZA 3ICUA 3GLJA 2PCUA 6CPAA 5LRJA 1TKFA 4MHPA 4O23A 2IJZA 4ZX9A 2RFHA 1EE3P 2O4HA 2ZEDA 1DTDA 2GREA 3HLPA 2ABZA 4PPZA 2ZEFA 4R7MA 2AFSA 2PJ1A 3JRUA 2PJAA 1F57A 1DE4C 1Z5RA 1VGYA 4F8ZA 4A94A 3D7DA 4MCQA 4P4EA 1QQ9A 4C9AA 4OP4A 3BXMA 3SJXA 4Q7AA 4P4JA 4NGMA 2QJ8A 1IY7A 3KR4A 1LCPA 3K2KA 4C9VA 4PXDA 3B3SA 3PBEA 2PJ5A 2ZEMA 4P45A 4ONWA 3RAMA 1BPNA 2XEFA 3SJEA 4KNGE 4TWEA 3V7ZA 2PJ7A 4C8TA 3IEHA 1BLLE 2HB6A 1VHOA 3IFEA 4MHYA 4A38A 4GM5A 2F7VA 4PXBA 3KR5A 2V8DA 4DJLA 2AFMA 2PE3A 4F9UA 4ZY0A 3IO1A 1HDQA 3FJUA 2V8HA 4FAIA 4OC5A 4FWUA 2VL1A 5CPAA 3TC8A 3FEDA 4P6YA 3NFZA 3NH8A 4IAVA 2GU2A 4MCRA 1ELLP 3GUXA 3WABA 4X8IA 2CTCA 5K8OA 4C8CA 5THWA 3I74A 4OC3A 2G9DA 4NGTA 2RB7A 3GB0A 4NGQA 2CTBA 1XFOA 2OOTA 2ZEHA 4NFRA 1Y7EA 5K8PA 2O53A 4OC0A 1YMEA 3SJFA 2PJBA 3DLJA 5J1QA 2POKA 2BO9A 2ZEEA 1XRYA 5LRGA 1JQGA 4C85A 4CPAA 3PEIA 1ZG9A 3PB6X 5HXDA 2NSMA 1CPXA 4ZYQA 1VHEA 1NSAA 2C6CA 4C9UA 3D7FA 4YN3A 4CDJA 1ARMA 4W9YA 4OMEA 3IJ3A 3NA6A 1HDUA 5IR2A 4JZ0A 2EK8A 1OBRA 3CDXA 3FMCA 3B3CA 3KQXA 1F2PA 5D8NA 4F9VA 2GP4A 5DS0A 5JGFA 4BD9A 2I3CA 4UIBA 4UIAA 1TKJA 3H8GA 3KI9A 5LYDA 4X3RA 3VH9A 3B2YA 3S9MA 4R8FA 3D7HA 3B7IA 3WC5A 1ZLHA 5HVHA 3ISXA 4DYOA 1AMPA 1YW4A 2PVWA 1BAVA 2V8VA 1PCAA 2PVVA 1TF9A 2GLFA 3B3VA 2AFOA 5F09A 3WC7A 1XMBA 2XEIA 1V6CA 3B3TA 1CX8A 4NGNA 1CG2A 4R76A 2PIZA 5K8NA 1CP7A 2EWBA 2ZEPA 3PB8X 3MN8A 4YU9A 1H8LA 2PJ3A 4FUUA 4IHMA 2ZELA 1PYTB 3SI2A 1FNOA 3PBBA 4ZY2A 2F8HA 4FBEA 1BPMA 7CPAA 2PJ4A 4P10A 4OKOA 3SI1A 1ZG8A 2XEGA 4C8UA 2FVGA 4C8AA 8CPAA 4UF4A 5LYLA 3N5FA 4MHZA 3FVLA 4ZX8A 1XJOA 1KWMA 3FECA 2ZENA 1Y0RA 4WJBA 3K9TA 1XF1A 4OC1A 4EFDA 2NYQA 2AFUA 4NJQA 3IC1A 1Y9ZA 1YLOA 1UWYA 5HVGA 1LOKA 3FH4A 3CT9A 4C9RA 2JBJA 2CIJA 5ELYA 2XEJA 4C9EA 3KASA 5LYIA 3S9LA 1QMUA 4TNUA 5LRKA 4C84A 2PIYA 1Y0YA 3D7GA 4TJXA 3CPAA 2CF4A 4NJRA 2PJ2A 4UEZA 4NGPA 1F2OA 2PJ6A 1Z2LA 3B3WA 4C8FA 4MMOA 1LAMA 3FF3A 5HVFA 3BHXA 4JYWA 2ZEOA 2BOAA 1ARLA 3LWUA 4OIWA 3S9NA 3T8WA 3VARA 3WT4A 2C5QA 3NH4A 4ZI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKH A;  3PFE A;  4PXE A;  4R6T A;  1GYT A;  1VIX A;  4H2K A;  3WC6 A;  4IK2 A;  3ISZ A;  2J9A A;  3SJG A;  4RUH A;  2ZOF A;  2QYV A;  1WVM A;  4MRI A;  3BI1 A;  3KZW A;  3HUV A;  2Q4Z A;  1R3N A;  4EWT A;  4NGR A;  1YSJ A;  3VTA A;  1M4L A;  1ELM P;  2WZN A;  3H8E A;  4Z65 A;  4OC4 A;  5IB9 A;  3I6S A;  3VAT A;  3PFO A;  1LFW A;  3KGQ A;  1ZG7 A;  4OC2 A;  1Z8L A;  2V8G A;  5CBM A;  3D66 A;  1AYE A;  4G1P A;  4DUK A;  3EIF A;  3KHZ A;  1Q7L A;  4MCP A;  5D29 A;  2IMO A;  3NH5 A;  4A39 A;  2PJ9 A;  2OR4 A;  4OID A;  4ZY1 A;  4C99 A;  2C6P A;  4P44 A;  2DEA A;  4X2T A;  4WWV A;  4MCS A;  4UEF A;  4AXV A;  4C86 A;  3PB7 X;  4UEE A;  2JBK A;  3RZA A;  3DGV A;  3MRU A;  1HEE A;  5K8M A;  2PJC A;  4P4D A;  5I4M A;  2QVP A;  4K3N A;  2ANP A;  3D4U A;  3PRT A;  4MXU A;  4PXC A;  2PRQ A;  2EK9 A;  2Q43 A;  1LAP A;  1ZLI A;  1TF8 A;  2AFW A;  1LAN A;  3SI0 A;  3LMS A;  3TX8 A;  5LYF A;  4MHN A;  2C1C A;  3PB4 X;  2PJ0 A;  3KHX A;  4NGS A;  2C6G A;  3BI0 A;  4P4F A;  2HC9 A;  2BCO A;  4YWY A;  3FX6 A;  4C8P A;  2GLJ A;  3KL9 A;  4LQG A;  2JEW A;  4A37 A;  1RTQ A;  3PB9 X;  1CPS A;  1IGB A;  4PQA A;  3RBU A;  1XBU A;  4P4I A;  3IWW A;  1CP6 A;  1CBX A;  4B6Z A;  4CDK A;  3KQZ A;  3CPX A;  1FT7 A;  3L2N A;  3FEE A;  1TXR A;  3B35 A;  5JH9 A;  2ZOG A;  3QNV A;  3D68 A;  3V38 A;  3I1U A;  2WYR A;  3D67 A;  1R43 A;  2ZEG A;  4EME A;  4P4B A;  2Q51 A;  2IQ6 A;  2PJ8 A;  1YW6 A;  4KSI A;  3IIB A;  3H8F A;  5JM6 A;  2AFX A;  4TJV A;  2V77 A;  2AFZ A;  3ICU A;  3GLJ A;  2PCU A;  6CPA A;  5LRJ A;  1TKF A;  4MHP A;  4O23 A;  2IJZ A;  4ZX9 A;  2RFH A;  1EE3 P;  2O4H A;  2ZED A;  1DTD A;  2GRE A;  3HLP A;  2ABZ A;  4PPZ A;  2ZEF A;  4R7M A;  2AFS A;  2PJ1 A;  3JRU A;  2PJA A;  1F57 A;  1DE4 C;  1Z5R A;  1VGY A;  4F8Z A;  4A94 A;  3D7D A;  4MCQ A;  4P4E A;  1QQ9 A;  4C9A A;  4OP4 A;  3BXM A;  3SJX A;  4Q7A A;  4P4J A;  4NGM A;  2QJ8 A;  1IY7 A;  3KR4 A;  1LCP A;  3K2K A;  4C9V A;  4PXD A;  3B3S A;  3PBE A;  2PJ5 A;  2ZEM A;  4P45 A;  4ONW A;  3RAM A;  1BPN A;  2XEF A;  3SJE A;  4KNG E;  4TWE A;  3V7Z A;  2PJ7 A;  4C8T A;  3IEH A;  1BLL E;  2HB6 A;  1VHO A;  3IFE A;  4MHY A;  4A38 A;  4GM5 A;  2F7V A;  4PXB A;  3KR5 A;  2V8D A;  4DJL A;  2AFM A;  2PE3 A;  4F9U A;  4ZY0 A;  3IO1 A;  1HDQ A;  3FJU A;  2V8H A;  4FAI A;  4OC5 A;  4FWU A;  2VL1 A;  5CPA A;  3TC8 A;  3FED A;  4P6Y A;  3NFZ A;  3NH8 A;  4IAV A;  2GU2 A;  4MCR A;  1ELL P;  3GUX A;  3WAB A;  4X8I A;  2CTC A;  5K8O A;  4C8C A;  5THW A;  3I74 A;  4OC3 A;  2G9D A;  4NGT A;  2RB7 A;  3GB0 A;  4NGQ A;  2CTB A;  1XFO A;  2OOT A;  2ZEH A;  4NFR A;  1Y7E A;  5K8P A;  2O53 A;  4OC0 A;  1YME A;  3SJF A;  2PJB A;  3DLJ A;  5J1Q A;  2POK A;  2BO9 A;  2ZEE A;  1XRY A;  5LRG A;  1JQG A;  4C85 A;  4CPA A;  3PEI A;  1ZG9 A;  3PB6 X;  5HXD A;  2NSM A;  1CPX A;  4ZYQ A;  1VHE A;  1NSA A;  2C6C A;  4C9U A;  3D7F A;  4YN3 A;  4CDJ A;  1ARM A;  4W9Y A;  4OME A;  3IJ3 A;  3NA6 A;  1HDU A;  4JZ0 A;  2EK8 A;  1OBR A;  3CDX A;  3FMC A;  3B3C A;  3KQX A;  1F2P A;  5D8N A;  4F9V A;  5DS0 A;  5JGF A;  4BD9 A;  2I3C A;  4UIB A;  4UIA A;  1TKJ A;  3H8G A;  3KI9 A;  5LYD A;  4X3R A;  3VH9 A;  3B2Y A;  3S9M A;  4R8F A;  3D7H A;  3B7I A;  3WC5 A;  1ZLH A;  5HVH A;  3ISX A;  4DYO A;  1AMP A;  1YW4 A;  2PVW A;  1BAV A;  2V8V A;  1PCA A;  2PVV A;  1TF9 A;  2GLF A;  3B3V A;  2AFO A;  5F09 A;  3WC7 A;  1XMB A;  2XEI A;  1V6C A;  3B3T A;  1CX8 A;  4NGN A;  1CG2 A;  4R76 A;  2PIZ A;  5K8N A;  1CP7 A;  2EWB A;  2ZEP A;  3PB8 X;  3MN8 A;  4YU9 A;  1H8L A;  2PJ3 A;  4FUU A;  4IHM A;  2ZEL A;  1PYT B;  3SI2 A;  1FNO A;  3PBB A;  4ZY2 A;  2F8H A;  4FBE A;  1BPM A;  7CPA A;  2PJ4 A;  4P10 A;  4OKO A;  3SI1 A;  1ZG8 A;  2XEG A;  4C8U A;  2FVG A;  4C8A A;  8CPA A;  4UF4 A;  5LYL A;  3N5F A;  4MHZ A;  3FVL A;  4ZX8 A;  1XJO A;  1KWM A;  3FEC A;  2ZEN A;  1Y0R A;  4WJB A;  3K9T A;  1XF1 A;  4OC1 A;  4EFD A;  2NYQ A;  2AFU A;  4NJQ A;  3IC1 A;  1Y9Z A;  1YLO A;  1UWY A;  5HVG A;  1LOK A;  3FH4 A;  3CT9 A;  4C9R A;  2JBJ A;  2CIJ A;  5ELY A;  2XEJ A;  4C9E A;  3KAS A;  5LYI A;  3S9L A;  1QMU A;  4TNU A;  5LRK A;  4C84 A;  2PIY A;  1Y0Y A;  3D7G A;  4TJX A;  3CPA A;  2CF4 A;  4NJR A;  2PJ2 A;  4UEZ A;  4NGP A;  1F2O A;  2PJ6 A;  1Z2L A;  3B3W A;  4C8F A;  4MMO A;  1LAM A;  3FF3 A;  5HVF A;  3BHX A;  4JYW A;  2ZEO A;  2BOA A;  1ARL A;  3LWU A;  4OIW A;  3S9N A;  3T8W A;  3VAR A;  3WT4 A;  3NH4 A;  4ZI6 A; 
#chains in the Genus database with same CATH topology
 1TKH A;  1YRE A;  1Y9K A;  3PFE A;  4PXE A;  4R6T A;  1GYT A;  1VIX A;  1R57 A;  1CM0 A;  4H2K A;  4GPL B;  1S7F A;  3WC6 A;  1QSM A;  4IK2 A;  4B10 A;  3ISZ A;  3TLA A;  3D8P A;  2J9A A;  3SJG A;  2Y1M A;  4RUH A;  2ZOF A;  2QYV A;  2VXK A;  2I79 A;  1WVM A;  4MRI A;  3GY9 A;  3RO0 A;  3BI1 A;  3KZW A;  2XPN A;  1YR0 A;  2JLM A;  2Q4Z A;  3HUV A;  4JD6 A;  4H6U A;  2FE7 A;  4CYQ A;  3QAY A;  4KOS A;  1R3N A;  1CS0 B;  3EZB A;  4EWT A;  3DDD A;  3TFY A;  1AUG A;  2OB0 A;  4NGR A;  1YSJ A;  3VTA A;  2A4N A;  4R3K A;  4CRZ B;  4CYN A;  5KTA A;  1KC7 A;  1M4L A;  1ELM P;  4UFX A;  2VZZ A;  3ZZI A;  2EZC A;  2WZN A;  1IOF A;  4HPS A;  3H8E A;  3LD2 A;  2PC1 A;  3IWG A;  4Z65 A;  1QSN A;  4OC4 A;  3SXN A;  3G3S A;  5IB9 A;  3HPH E;  3IGR A;  4AVB A;  1I12 A;  3I6S A;  3VAT A;  4RI1 A;  4CZ1 A;  1V0C A;  3PFO A;  4XNH B;  1IB1 E;  1LFW A;  4HNY B;  4LQ6 A;  3KGQ A;  1Q2C A;  2P6G A;  5AXI A;  2CNT A;  2B4J C;  4XPD B;  1ZG7 A;  3R9F A;  4OC2 A;  4ZGY B;  4A4B A;  4KOT A;  5IX3 A;  1VI4 A;  1ZL0 A;  1Z8L A;  3NE8 A;  2P6E A;  2REE A;  2V8G A;  3FRM A;  1KZF A;  3DR6 A;  4KOX A;  3D66 A;  1AYE A;  5CBM A;  4G1P A;  4UCP A;  3S6F A;  4DUK A;  4EYS A;  3EIF A;  3KHZ A;  1Q7L A;  3BUN B;  4U9Y A;  4AG9 A;  4MCP A;  5D29 A;  1OZP A;  2IMO A;  3NH5 A;  4JXR A;  3I3G A;  4R3L A;  2PJ9 A;  4A39 A;  2OR4 A;  4COG A;  5JPH A;  4QUS A;  4OID A;  3OP0 A;  3CXQ A;  4ZY1 A;  2G3A A;  4C99 A;  4ONU A;  3TLG B;  2C6P A;  4BPX B;  4P44 A;  2DF5 A;  2DEA A;  2Z3M A;  3JVN A;  4X2T A;  2B4D B;  4KOW A;  4WWV A;  1NE9 A;  3LAC A;  4MCS A;  4AVA A;  2OLS A;  2J8M A;  4UEF A;  5JYB A;  4M6G A;  4AXV A;  4C86 A;  3FXT A;  4KLW A;  5AGE A;  3PB7 X;  4UEE A;  2JBK A;  4IUS A;  1ZRS A;  2PR1 A;  1J3L A;  2R82 A;  3RZA A;  3TYX A;  1QSO A;  1KUY A;  3DGV A;  1HEE A;  3MRU A;  4BTF A;  5K8M A;  2PJC A;  3TE4 A;  5ISV A;  1M1D A;  4P4D A;  4MFZ A;  5I4M A;  2QVP A;  4K3N A;  3VWE A;  3N7Z A;  5F46 A;  2ANP A;  3TLB A;  2CXA A;  3D4U A;  3PRT A;  3G8W A;  1IID A;  4MXU A;  4BPU B;  2FXF A;  2PRQ A;  4PXC A;  2EK9 A;  4CAE A;  2X0S A;  3TLC A;  2Q43 A;  1LAP A;  4OLL A;  1ZLI A;  2UV8 G;  1TF8 A;  2AFW A;  1LAN A;  1MJB A;  5BWA B;  3SI0 A;  5FD8 A;  3LMS A;  4NCZ A;  3D2P A;  1ZYM A;  3TX8 A;  1S7K A;  5LYF A;  4MHN A;  1JDB C;  2C1C A;  4M6H A;  3F0A A;  4M3S A;  4PSW A;  5EMI A;  1X12 A;  1UFH A;  2J8N A;  3PB4 X;  4UFV A;  4YFJ A;  1VBH A;  4E5S A;  2PJ0 A;  3KHX A;  4HKF A;  4COB A;  4NGS A;  2Q0Y A;  1GGO A;  3SXO A;  2Q44 A;  2D4O A;  2CY2 A;  5H86 A;  2C6G A;  3BI0 A;  3CXS A;  2K5T A;  4MFK A;  4P4F A;  4CS0 B;  2D0P A;  3TLE A;  1M4I A;  1VKC A;  2HC9 A;  2BCO A;  4YWY A;  4JWP A;  1K4J A;  3FX6 A;  1QST A;  4NF1 A;  4C2X A;  2ZW5 A;  4C8P A;  2R1I A;  2GLJ A;  3A9L A;  3IWE A;  3KL9 A;  4LQG A;  1NMT A;  4E8O A;  1T36 B;  2JEW A;  3PP9 A;  4A37 A;  2OH1 A;  3BUM B;  3VWD A;  2B58 A;  1A2Z A;  4KLV A;  4B11 A;  3RYO A;  1RTQ A;  2DIK A;  2FSR A;  4CRY B;  4XNH C;  2Q04 A;  4J3G A;  3PB9 X;  4YGO A;  4II9 A;  3P2F A;  2Q7S A;  4F6A A;  1C30 B;  2Y1N A;  1B47 A;  5F48 A;  1CPS A;  1IGB A;  4PQA A;  4Q36 A;  3TLZ A;  3RBU A;  1XBU A;  3FYN A;  5G1Z A;  4J0N A;  3EZE A;  1WJT A;  4P4I A;  3IWW A;  3U88 C;  1CP6 A;  3R9G A;  3PZJ A;  1CBX A;  4B6Z A;  1Z8T A;  2PR8 A;  3S6H A;  4CDK A;  3KQZ A;  3CPX A;  1FT7 A;  4R57 A;  3TOA A;  2PRB A;  3CZX A;  2FCK A;  4KOU A;  2B3V A;  3GYA A;  4A32 A;  1A9X B;  1CE8 B;  3L2N A;  3FEE A;  1TXR A;  3B35 A;  3T9Y A;  5JH9 A;  3VRO A;  2OZH A;  2ZOG A;  3QNV A;  2EBJ A;  1S7L A;  2NMT A;  3D68 A;  5G20 A;  2CNM A;  4CAX A;  3V38 A;  4AB7 A;  3C8O A;  4E94 A;  4MY0 A;  3I1U A;  2CBL A;  2ZW4 A;  2B4B A;  2WYR A;  3D67 A;  4MJ8 A;  1R43 A;  5AG5 A;  2ZEG A;  4EME A;  1IYK A;  4M6I A;  4M8D A;  4P4B A;  4BPW B;  2Q51 A;  4E2A A;  2IQ6 A;  3VRR A;  1N71 A;  2BEI A;  2FIA A;  3H4Q A;  5G21 A;  2J8R A;  2PJ8 A;  3OAK A;  1YW6 A;  4KSI A;  3GKR A;  4C2Z A;  3IIB A;  1WK4 A;  2ATR A;  3H8F A;  5JM6 A;  2AFX A;  4TJV A;  2V77 A;  2AFZ A;  3ICU A;  2WSA A;  2PCU A;  3GLJ A;  5LRJ A;  6CPA A;  4IIY A;  1KBL A;  5HKY A;  1TKF A;  4MHP A;  1GHE A;  4O23 A;  2IJZ A;  1EZA A;  2Z11 A;  5F9M A;  3NE7 A;  1P4N A;  4ZX9 A;  2RFH A;  1EE3 P;  4CYO A;  2O4H A;  1JWQ A;  2GIV A;  4XPK A;  4C7I A;  3PT1 A;  1IIC A;  1JDE A;  3HMJ G;  2ZED A;  1ON0 A;  1Z8X A;  4C68 A;  1DTD A;  1Y9W A;  2GRE A;  3HLP A;  2ABZ A;  1YX0 A;  2R98 A;  4QB9 A;  4CGP A;  2VI7 A;  4PPZ A;  2ZEF A;  4R7M A;  4B5P B;  2AFS A;  2PJ1 A;  3T5M A;  4R9M A;  3JRU A;  3K9U A;  2EO8 A;  4A2Z A;  2PJA A;  1F57 A;  1RO5 A;  1DE4 C;  4CGO A;  1Z5R A;  1VGY A;  2XPO A;  4KOY A;  4B5P A;  4A94 A;  3D7D A;  4MCQ A;  4P4E A;  1QQ9 A;  4F8Z A;  4C9A A;  4NSQ A;  3BXM A;  4OP4 A;  3SJX A;  4Q7A A;  4P4J A;  4ZBG A;  2VKZ G;  4HNX B;  3OWC A;  4NGM A;  2QJ8 A;  1IY7 A;  3KR4 A;  1LCP A;  4QC6 A;  3K2K A;  3T05 A;  5AG6 A;  4C9V A;  4PXD A;  3B3S A;  3PBE A;  2PJ5 A;  2ZEM A;  4P45 A;  1Z9E A;  4ONW A;  3RAM A;  2JDD A;  5H84 A;  3TO9 A;  1BPN A;  2IL4 A;  4MJX A;  2VEZ A;  1S5K A;  4A95 A;  2XEF A;  3SJE A;  4KNG E;  2HQY A;  2B0A A;  2OZU A;  2QEC A;  4TWE A;  3V7Z A;  2PJ7 A;  3PLF B;  4C8T A;  3IEH A;  1BLL E;  2XPL A;  2B5G B;  2HB6 A;  1VHO A;  5HH1 A;  5DWM A;  3IFE A;  4MHY A;  2Q7B A;  4GM5 A;  3BUX B;  5HKZ A;  2F7V A;  2R7H A;  2B5G A;  2REF A;  2V8D A;  3KR5 A;  5F13 A;  4FD7 A;  3TO6 A;  4DJL A;  4MY3 A;  4UWI A;  2H5M A;  4AG7 A;  2AFM A;  2PE3 A;  1CJW A;  2I00 A;  4F9U A;  4KZT A;  5AG4 A;  3BLN A;  4ZY0 A;  3BUW B;  1VBG A;  3IO1 A;  5JVL A;  1HDQ A;  1Z9U A;  4X5K A;  3PFV A;  3FJU A;  4KVX A;  2V8H A;  3EC4 A;  4FAI A;  2PDO A;  4MI1 A;  4OC5 A;  4FWU A;  2G0B A;  4QVT A;  4XPL A;  2VL1 A;  5CPA A;  3TC8 A;  3FED A;  3T90 A;  1LRZ A;  4EVY A;  4P6Y A;  3NFZ A;  1YVK A;  4MFP A;  3TLY A;  5FVJ A;  3NH8 A;  2FT0 A;  4IAV A;  2GFQ A;  4Q38 A;  2GU2 A;  4MCR A;  1ELL P;  3GUX A;  5DWN A;  3WAB A;  4X8I A;  1XMT A;  1EO0 A;  2MP0 A;  2HUZ A;  4CAF A;  2KCW A;  2GE3 A;  3CXP A;  1P0H A;  4MHD A;  3D2M A;  4QBJ A;  4KSA A;  2CTC A;  3W6S A;  2HI6 A;  2G3T A;  5K8O A;  4C8C A;  5THW A;  2YGW A;  4PK3 A;  1KUX A;  3I74 A;  2P6F A;  2BL1 A;  5IB0 A;  1PU9 A;  1Z4E A;  4M85 A;  5G22 A;  4OC3 A;  2G9D A;  2ZW7 A;  2N3A B;  4NGT A;  5J3X A;  2RB7 A;  3FIX A;  4LX9 A;  4JVO A;  4U5Y A;  3GB0 A;  5KTD A;  4B5O A;  2AJ6 A;  4NGQ A;  4B14 A;  2CTB A;  1BO4 A;  1XFO A;  1ZO0 A;  4ORF A;  4Y49 B;  2OOT A;  2ZEH A;  4NFR A;  1Y7E A;  5K8P A;  2O53 A;  4OC0 A;  1YME A;  3SJF A;  2PJB A;  2YNE A;  3DLJ A;  2Z3N A;  4UCM A;  4B12 A;  2POK A;  5J1Q A;  4YRH A;  2BO9 A;  2ZEE A;  2Z0Z A;  1XRY A;  3R1K A;  4CGM A;  5LRG A;  1JQG A;  4C85 A;  4CPA A;  4A33 A;  3EY5 A;  3I9S A;  1ZG9 A;  3PB6 X;  3PEI A;  2NSM A;  3S6K A;  1CPX A;  4ZYQ A;  5HXD A;  1VHE A;  2Q4Y A;  2B3U A;  1NSA A;  2HRO A;  2C6C A;  5EC4 A;  3GIU A;  1Z4R A;  1NBW A;  3D7F A;  2D0O A;  4C9U A;  4YN3 A;  4F0X A;  4CDJ A;  3C26 A;  1ARM A;  1R61 A;  4W9Y A;  3T07 A;  4OME A;  1YGH A;  3E0K A;  3IJ3 A;  3KKW A;  3DNS A;  3NA6 A;  1BOB A;  2CNS A;  1QSR A;  1HDU A;  4IF5 A;  4UWJ A;  5A28 A;  1NXJ A;  2FL4 A;  4RN7 A;  2FS5 A;  5IR2 A;  5JQ4 A;  1U6M A;  4JZ0 A;  2X7B A;  4H6Z A;  2YNC A;  2EK8 A;  1OBR A;  3CDX A;  4F0Y A;  3FMC A;  3B3C A;  2EZA A;  1J4J A;  2DXQ A;  3KQX A;  4GXH A;  1F2P A;  2Z3P A;  5D8N A;  4F9V A;  2GP4 A;  3OB1 B;  4E0A A;  1XF8 A;  5DS0 A;  1Q5X A;  3JTK A;  1L0C A;  2JDC A;  3BJ8 A;  3R96 A;  5JGF A;  4FD5 A;  3U1B A;  1MJ9 A;  2D4P A;  4BD9 A;  2I3C A;  2Z3L A;  4RS2 A;  5GCN A;  3V8I A;  4KSF A;  2QIR A;  4UIB A;  4UIA A;  3TOB A;  1TKJ A;  3H8G A;  4JXQ A;  3IU1 A;  3KI9 A;  1YVO A;  3BJ7 A;  5LYD A;  2AUN A;  4X3R A;  3JUW A;  2WPX A;  3DSB A;  1Z8W A;  3VH9 A;  3O8Z A;  4OAE A;  5BY0 A;  3B2Y A;  1YK3 A;  3S9M A;  5A27 A;  4R8F A;  2FM4 A;  3D7H A;  3B7I A;  3R9E A;  4CAW A;  3WC5 A;  1ZLH A;  5HVH A;  5C82 A;  1WWZ A;  3ISX A;  1FY7 A;  4A30 A;  3R95 A;  4DYO A;  4FD6 A;  2BSW A;  1AMP A;  1YW4 A;  3VRN A;  3NFQ A;  4CGN A;  2Z3O A;  3FNC A;  2PVW A;  3S6G A;  1BAV A;  3VRP A;  1PCA A;  2V8V A;  4IIX A;  1S7N A;  2PVV A;  1TF9 A;  4KS9 A;  4MFQ A;  1BXR B;  3K4I A;  2VBQ A;  2GLF A;  2E28 A;  3EXN A;  2FIW A;  1S60 A;  3B3V A;  2ARH A;  4JLY A;  4KVM E;  3P2H A;  3UY5 A;  2AFO A;  3DR8 A;  5F09 A;  3WC7 A;  2EZB A;  1XMB A;  3NOJ A;  2XEI A;  4PXB A;  1V6C A;  5J8F A;  1I21 A;  3B3T A;  1CX8 A;  4NGN A;  3TTH A;  3KRV A;  1CG2 A;  4Y49 C;  2DLA A;  4R76 A;  2ZPA A;  2PIZ A;  3HPG G;  3EZA A;  2DPS A;  5K8N A;  1CP7 A;  2EWB A;  4MBU A;  4R87 A;  2ZEP A;  1MK4 A;  3SR3 A;  3PB8 X;  2EUI A;  2YND A;  3MN8 A;  4YU9 A;  4NXY A;  1H8L A;  2PJ3 A;  5CNP A;  4CYP A;  1M44 A;  2C27 A;  2F5I A;  4FUU A;  1IOI A;  1NSL A;  3IU2 A;  4IHM A;  2JEV A;  2OU2 A;  2ZEL A;  2ODF A;  3TCV A;  3W6X A;  1PYT B;  4OAD A;  3SI2 A;  1FNO A;  2ZXV A;  3PBB A;  5E96 A;  4ZY2 A;  1M6V B;  3TO7 A;  2F8H A;  4L8A A;  4DNC A;  4H89 A;  4FBE A;  5K99 A;  1BPM A;  5F47 A;  7CPA A;  3F8K A;  2PJ4 A;  2EVN A;  5KTC A;  2AE6 A;  4P10 A;  4OKO A;  2YNC C;  3SI1 A;  3QB8 A;  4NEX A;  1YVH A;  2VQY A;  1ZG8 A;  4PSX A;  1IYL A;  2XEG A;  4BBH A;  4UA3 A;  2FVG A;  1TIQ A;  3TLG A;  4C8U A;  1Q2Y A;  3OB2 B;  2B4D A;  2O28 A;  8CPA A;  4UF4 A;  4C8A A;  5LYL A;  3EFA A;  3N5F A;  4MHZ A;  1YQE A;  1XEB A;  3FVL A;  4KOV A;  4ZX8 A;  2DPT A;  5J8C A;  2ZW6 A;  3ZNI A;  3G23 A;  1XJO A;  2PCN A;  1B87 A;  3SHP A;  3FBU A;  1KWM A;  4MFJ A;  4UFW A;  1C3O B;  3FEC A;  2ZEN A;  1Y0R A;  4WJB A;  3K9T A;  3B8G A;  5I0C A;  4KUB A;  2R8V A;  1XF1 A;  4OC1 A;  2VZY A;  5EBV A;  4EFD A;  2NYQ A;  5HKW A;  2AFU A;  3WR7 A;  4NJQ A;  3QAH A;  3EO4 A;  3IC1 A;  4UCN A;  5IV0 A;  1Y9Z A;  1YLO A;  1UWY A;  5HVG A;  1XIX A;  1LOK A;  1VHS A;  1XE4 A;  2HV2 A;  4U9Z A;  2QML A;  2GAN A;  3FH4 A;  4KVO E;  2Y0M A;  4L89 A;  4AVC A;  3CT9 A;  4C9R A;  1EZB A;  1XOV A;  2OZG A;  3VGO A;  3TT2 A;  2PSW A;  2Z3K A;  2JBJ A;  2CIJ A;  4H1H A;  5ELY A;  2YJT A;  1FBV A;  1MJA A;  5F5X A;  4KOR A;  4UBR A;  2XEJ A;  1X10 A;  4B13 A;  3KAS A;  4C9E A;  2WUU A;  5LYI A;  2AUM A;  1DIK A;  4PV6 A;  4A31 A;  3GJZ A;  2Q4V A;  3S9L A;  4HNW B;  3RNZ A;  5C88 A;  2XPP A;  1QMU A;  3H5Z A;  4TNU A;  5LRK A;  4CAV A;  4C84 A;  2PIY A;  1PUA A;  2WPW A;  4FD4 A;  1Q2D A;  4C2Y A;  1Y0Y A;  2P0W A;  3D7G A;  4TJX A;  3CPA A;  2CF4 A;  4NJR A;  4MI4 A;  2PJ2 A;  4CO9 A;  4UEZ A;  4C7H A;  4GS4 A;  1KUV A;  4NGP A;  3PGP A;  5F49 A;  3T0T A;  4JJX A;  1F2O A;  5HMN A;  1RXT A;  4LUA A;  4MFL A;  2PJ6 A;  1Z2L A;  3B3W A;  2Z10 A;  4BIN A;  4C8F A;  3BUO B;  4CGL A;  2PQ8 A;  4XPD C;  4MMO A;  3MGD A;  1KEE B;  1SQH A;  3W91 A;  4K30 A;  4A38 A;  4BMH A;  1LAM A;  3FF3 A;  5HVF A;  3BHX A;  3LOD A;  4A4C A;  4I49 A;  4JYW A;  1M4G A;  2ZEO A;  1I1D A;  1ARL A;  1S3Z A;  2BOA A;  3LWU A;  4OIW A;  3ZJ0 A;  1YLE A;  4PK2 A;  4INJ A;  2YJV A;  2BUE A;  4RR2 B;  3F9K C;  1IU8 A;  3S9N A;  3D3S A;  3T8W A;  3VAR A;  3WT4 A;  2HWG A;  1B6B A;  1Y7R A;  2RC4 A;  2C5Q A;  5F1Y A;  3NH4 A;  4ZI6 A;  3VRQ A;  4KUA A;  5AG7 A;  1M4D A;  3F5B A;  3FB3 A; 
#chains in the Genus database with same CATH homology
 1TKH A;  3PFE A;  4PXE A;  4R6T A;  1GYT A;  1VIX A;  4H2K A;  3WC6 A;  4IK2 A;  3ISZ A;  2J9A A;  3SJG A;  4RUH A;  2ZOF A;  2QYV A;  1WVM A;  4MRI A;  3BI1 A;  3KZW A;  3HUV A;  2Q4Z A;  1R3N A;  4EWT A;  4NGR A;  1YSJ A;  3VTA A;  1M4L A;  1ELM P;  2WZN A;  3H8E A;  4Z65 A;  4OC4 A;  5IB9 A;  3I6S A;  3VAT A;  3PFO A;  1LFW A;  3KGQ A;  1ZG7 A;  4OC2 A;  1Z8L A;  2V8G A;  5CBM A;  3D66 A;  1AYE A;  4G1P A;  4DUK A;  3EIF A;  3KHZ A;  1Q7L A;  4MCP A;  5D29 A;  2IMO A;  3NH5 A;  4A39 A;  2PJ9 A;  2OR4 A;  4OID A;  4ZY1 A;  4C99 A;  2C6P A;  4P44 A;  2DEA A;  4X2T A;  4WWV A;  4MCS A;  4UEF A;  4AXV A;  4C86 A;  3PB7 X;  4UEE A;  2JBK A;  3RZA A;  3DGV A;  3MRU A;  1HEE A;  5K8M A;  2PJC A;  4P4D A;  5I4M A;  2QVP A;  4K3N A;  2ANP A;  3D4U A;  3PRT A;  4MXU A;  4PXC A;  2PRQ A;  2EK9 A;  2Q43 A;  1LAP A;  1ZLI A;  1TF8 A;  2AFW A;  1LAN A;  3SI0 A;  3LMS A;  3TX8 A;  5LYF A;  4MHN A;  2C1C A;  3PB4 X;  2PJ0 A;  3KHX A;  4NGS A;  2C6G A;  3BI0 A;  4P4F A;  2HC9 A;  2BCO A;  4YWY A;  3FX6 A;  4C8P A;  2GLJ A;  3KL9 A;  4LQG A;  2JEW A;  4A37 A;  1RTQ A;  3PB9 X;  1CPS A;  1IGB A;  4PQA A;  3RBU A;  1XBU A;  4P4I A;  3IWW A;  1CP6 A;  1CBX A;  4B6Z A;  4CDK A;  3KQZ A;  3CPX A;  1FT7 A;  3L2N A;  3FEE A;  1TXR A;  3B35 A;  5JH9 A;  2ZOG A;  3QNV A;  3D68 A;  3V38 A;  3I1U A;  2WYR A;  3D67 A;  1R43 A;  2ZEG A;  4EME A;  4P4B A;  2Q51 A;  2IQ6 A;  2PJ8 A;  1YW6 A;  4KSI A;  3IIB A;  3H8F A;  5JM6 A;  2AFX A;  4TJV A;  2V77 A;  2AFZ A;  3ICU A;  3GLJ A;  2PCU A;  6CPA A;  5LRJ A;  1TKF A;  4MHP A;  4O23 A;  2IJZ A;  4ZX9 A;  2RFH A;  1EE3 P;  2O4H A;  2ZED A;  1DTD A;  2GRE A;  3HLP A;  2ABZ A;  4PPZ A;  2ZEF A;  4R7M A;  2AFS A;  2PJ1 A;  3JRU A;  2PJA A;  1F57 A;  1DE4 C;  1Z5R A;  1VGY A;  4F8Z A;  4A94 A;  3D7D A;  4MCQ A;  4P4E A;  1QQ9 A;  4C9A A;  4OP4 A;  3BXM A;  3SJX A;  4Q7A A;  4P4J A;  4NGM A;  2QJ8 A;  1IY7 A;  3KR4 A;  1LCP A;  3K2K A;  4C9V A;  4PXD A;  3B3S A;  3PBE A;  2PJ5 A;  2ZEM A;  4P45 A;  4ONW A;  3RAM A;  1BPN A;  2XEF A;  3SJE A;  4KNG E;  4TWE A;  3V7Z A;  2PJ7 A;  4C8T A;  3IEH A;  1BLL E;  2HB6 A;  1VHO A;  3IFE A;  4MHY A;  4A38 A;  4GM5 A;  2F7V A;  4PXB A;  3KR5 A;  2V8D A;  4DJL A;  2AFM A;  2PE3 A;  4F9U A;  4ZY0 A;  3IO1 A;  1HDQ A;  3FJU A;  2V8H A;  4FAI A;  4OC5 A;  4FWU A;  2VL1 A;  5CPA A;  3TC8 A;  3FED A;  4P6Y A;  3NFZ A;  3NH8 A;  4IAV A;  2GU2 A;  4MCR A;  1ELL P;  3GUX A;  3WAB A;  4X8I A;  2CTC A;  5K8O A;  4C8C A;  5THW A;  3I74 A;  4OC3 A;  2G9D A;  4NGT A;  2RB7 A;  3GB0 A;  4NGQ A;  2CTB A;  1XFO A;  2OOT A;  2ZEH A;  4NFR A;  1Y7E A;  5K8P A;  2O53 A;  4OC0 A;  1YME A;  3SJF A;  2PJB A;  3DLJ A;  5J1Q A;  2POK A;  2BO9 A;  2ZEE A;  1XRY A;  5LRG A;  1JQG A;  4C85 A;  4CPA A;  3PEI A;  1ZG9 A;  3PB6 X;  5HXD A;  2NSM A;  1CPX A;  4ZYQ A;  1VHE A;  1NSA A;  2C6C A;  4C9U A;  3D7F A;  4YN3 A;  4CDJ A;  1ARM A;  4W9Y A;  4OME A;  3IJ3 A;  3NA6 A;  1HDU A;  5IR2 A;  4JZ0 A;  2EK8 A;  1OBR A;  3CDX A;  3FMC A;  3B3C A;  3KQX A;  1F2P A;  5D8N A;  4F9V A;  2GP4 A;  5DS0 A;  5JGF A;  4BD9 A;  2I3C A;  4UIB A;  4UIA A;  1TKJ A;  3H8G A;  3KI9 A;  5LYD A;  4X3R A;  3VH9 A;  3B2Y A;  3S9M A;  4R8F A;  3D7H A;  3B7I A;  3WC5 A;  1ZLH A;  5HVH A;  3ISX A;  4DYO A;  1AMP A;  1YW4 A;  2PVW A;  1BAV A;  2V8V A;  1PCA A;  2PVV A;  1TF9 A;  2GLF A;  3B3V A;  2AFO A;  5F09 A;  3WC7 A;  1XMB A;  2XEI A;  1V6C A;  3B3T A;  1CX8 A;  4NGN A;  1CG2 A;  4R76 A;  2PIZ A;  5K8N A;  1CP7 A;  2EWB A;  2ZEP A;  3PB8 X;  3MN8 A;  4YU9 A;  1H8L A;  2PJ3 A;  4FUU A;  4IHM A;  2ZEL A;  1PYT B;  3SI2 A;  1FNO A;  3PBB A;  4ZY2 A;  2F8H A;  4FBE A;  1BPM A;  7CPA A;  2PJ4 A;  4P10 A;  4OKO A;  3SI1 A;  1ZG8 A;  2XEG A;  4C8U A;  2FVG A;  4C8A A;  8CPA A;  4UF4 A;  5LYL A;  3N5F A;  4MHZ A;  3FVL A;  4ZX8 A;  1XJO A;  1KWM A;  3FEC A;  2ZEN A;  1Y0R A;  4WJB A;  3K9T A;  1XF1 A;  4OC1 A;  4EFD A;  2NYQ A;  2AFU A;  4NJQ A;  3IC1 A;  1Y9Z A;  1YLO A;  1UWY A;  5HVG A;  1LOK A;  3FH4 A;  3CT9 A;  4C9R A;  2JBJ A;  2CIJ A;  5ELY A;  2XEJ A;  4C9E A;  3KAS A;  5LYI A;  3S9L A;  1QMU A;  4TNU A;  5LRK A;  4C84 A;  2PIY A;  1Y0Y A;  3D7G A;  4TJX A;  3CPA A;  2CF4 A;  4NJR A;  2PJ2 A;  4UEZ A;  4NGP A;  1F2O A;  2PJ6 A;  1Z2L A;  3B3W A;  4C8F A;  4MMO A;  1LAM A;  3FF3 A;  5HVF A;  3BHX A;  4JYW A;  2ZEO A;  2BOA A;  1ARL A;  3LWU A;  4OIW A;  3S9N A;  3T8W A;  3VAR A;  3WT4 A;  2C5Q A;  3NH4 A;  4ZI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...