3RBUA

N-terminally avitev-tagged human glutamate carboxypeptidase ii in complex with 2-pmpa
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Efficient and versatile one-step affinity purification of in vivo biotinylated proteins: Expression, characterization and structure analysis of recombinant human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 265
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3rbuA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3rbuA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3rbuA02
4PXCA 2IMOA 2XEFA 2HB6A 5IB9A 5LRGA 5LYLA 2ZEOA 4YWYA 1TF9A 2G9DA 3IC1A 1LCPA 3KQXA 3NFZA 2PIZA 1IY7A 4R8FA 4MRIA 4JZ0A 2ZOFA 2RFHA 1ELLP 4MCRA 4OC1A 4C99A 2ZEFA 3D4UA 4CPAA 4MXUA 3KL9A 4OC2A 4TNUA 3KI9A 3SJXA 3DGVA 4DYOA 1HDUA 2PVWA 3S9LA 1Z5RA 3I74A 2EK8A 4OMEA 3RZAA 3L2NA 4YU9A 2Q4ZA 4CDKA 5LYIA 1TKHA 4C85A 3FJUA 4OC0A 1CPXA 1V6CA 1ZG8A 3KQZA 1AMPA 3QNVA 5K8NA 5CBMA 5HVGA 3PB9X 4C8AA 4UEZA 1XRYA 4WJBA 3SI2A 2PJ2A 5LYFA 4C9UA 7CPAA 2PJBA 4MCPA 4OIDA 4NGSA 3WC7A 3RAMA 4RUHA 4F9UA 5K8OA 4C84A 3MRUA 4NGPA 2CF4A 4PXDA 4EWTA 2ABZA 2VL1A 1LFWA 4LQGA 3PB4X 4ONWA 3B35A 4C86A 2PJ5A 2XEIA 3D66A 1LANA 1EE3P 2O53A 4TJVA 3IEHA 4ZX9A 1CBXA 4DJLA 2NYQA 3CDXA 3H8FA 4ZI6A 4JYWA 4KNGE 2EWBA 1WVMA 1CPSA 4YN3A 1YLOA 2BOAA 1Q7LA 1Y0RA 3B3CA 3S9NA 2PIYA 4A94A 1CX8A 2CTCA 4W9YA 3D7DA 1BPMA 1ELMP 4P10A 1PCAA 3VTAA 3HLPA 4NGTA 2GLFA 1GYTA 3IJ3A 3ISXA 2HC9A 5D29A 3PEIA 3VARA 4UEEA 4A39A 1TXRA 2OOTA 3CPXA 1Y0YA 4C9RA 1FT7A 3WC6A 5JH9A 3LMSA 1F2OA 4OIWA 4R7MA 5ELYA 1HDQA 3V38A 3KASA 1HEEA 2J9AA 4EMEA 3B3VA 4UF4A 1XFOA 4BD9A 1VHOA 4NFRA 4C9AA 4P4DA 3RBUA 2ZENA 1UWYA 2ZELA 1JQGA 4ZX8A 2IQ6A 1KWMA 2PJ1A 2PJ6A 3NH5A 1ARMA 3WABA 1XMBA 1LOKA 2V8HA 4PPZA 4AXVA 3WC5A 4NGRA 1AYEA 3FX6A 4ZY0A 2NSMA 3EIFA 2C6CA 4F9VA 1PYTB 3BXMA 4F8ZA 5JGFA 1ZLIA 1LAMA 4MHYA 3TX8A 3KR5A 4OKOA 5HVHA 3D7GA 2PVVA 2WYRA 4P4IA 4ZYQA 3BI0A 8CPAA 5HVFA 3CT9A 2V8DA 5CPAA 1IGBA 3KGQA 3GLJA 4MHNA 5LYDA 4C8PA 4X3RA 4TJXA 1QQ9A 2ZEEA 3K2KA 2C6PA 3DLJA 4P6YA 3BI1A 3JRUA 1VHEA 1TKJA 5HXDA 3NA6A 5D8NA 4MCQA 3B3SA 3D7HA 2AFSA 2ZEPA 4FAIA 5LRJA 3FECA 4IAVA 4P4EA 3D68A 1Y9ZA 3D67A 5K8MA 2POKA 3ISZA 4KSIA 2AFOA 2QVPA 4OC4A 3B7IA 3SI1A 3K9TA 2AFWA 3KHZA 3PB8X 2XEGA 2IJZA 3ICUA 3PB7X 4R6TA 1YW4A 2Q51A 3KHXA 4ZY2A 2FVGA 4P45A 3FVLA 4G1PA 3H8GA 4UIBA 3B2YA 3KR4A 4PQAA 2PRQA 4PXBA 3T8WA 2F7VA 1F2PA 3KZWA 4P4BA 2JBJA 3SJGA 3NH4A 1YW6A 1CG2A 1DE4C 4Z65A 4A37A 2GREA 3I1UA 2V77A 3H8EA 3SJEA 4R76A 3IIBA 4NJRA 3PFOA 4B6ZA 3BHXA 3B3TA 3VH9A 2ZEHA 3N5FA 2XEJA 4WWVA 4A38A 1M4LA 3PRTA 3S9MA 1LAPA 2AFUA 4H2KA 3IO1A 4GM5A 1CP7A 3MN8A 3FEEA 4C8FA 2BCOA 1YSJA 4FBEA 3PB6X 1ZLHA 1BLLE 3HUVA 5LRKA 4MCSA 2I3CA 4X2TA 3PFEA 4P44A 4IK2A 4FUUA 4MHPA 4K3NA 1DTDA 2AFXA 2GLJA 2V8VA 2JEWA 2ZEGA 2PJ0A 5JM6A 5J1QA 4C8UA 4TWEA 1R3NA 2RB7A 3IWWA 1BAVA 2F8HA 1ZG7A 5DS0A 2AFZA 1RTQA 1VGYA 3GB0A 2PJ9A 1QMUA 4O23A 3FMCA 2V8GA 4C9EA 4FWUA 1Z8LA 4OC3A 3I6SA 4NJQA 4C9VA 4MHZA 2PE3A 4MMOA 4NGQA 1NSAA 4C8CA 2EK9A 2QJ8A 4ZY1A 2AFMA 1XJOA 5I4MA 1F57A 5THWA 1ARLA 2PJ8A 3FF3A 3FEDA 4CDJA 2WZNA 1XBUA 1Z2LA 2ANPA 1YMEA 3NH8A 2PJCA 2PJ4A 2CIJA 3LWUA 2PCUA 4X8IA 2PJ3A 3CPAA 3GUXA 3D7FA 2GU2A 2O4HA 4Q7AA 1OBRA 3PBEA 2BO9A 2ZEMA 4P4JA 5K8PA 2PJAA 4EFDA 2QYVA 4OC5A 3SI0A 2OR4A 1ZG9A 1TF8A 2CTBA 2DEAA 3FH4A 6CPAA 4IHMA 3V7ZA 2C6GA 1CP6A 4C8TA 4DUKA 2Q43A 1Y7EA 2JBKA 2ZOGA 3IFEA 4NGNA 4UIAA 1R43A 1XF1A 3VATA 3WT4A 4NGMA 1H8LA 1FNOA 3SJFA 4OP4A 1VIXA 3PBBA 4UEFA 4PXEA 3B3WA 1BPNA 5F09A 2ZEDA 2PJ7A 1TKFA 4P4FA 2C1CA 3TC8A
chains in the Genus database with same CATH superfamily
4PXCA 2IMOA 4B12A 4MI1A 2R98A 2XEFA 4KS9A 1KUYA 4CZ1A 4B5PB 2HB6A 5IB9A 4BTFA 2YJTA 5G1ZA 2AJ6A 5LRGA 5LYLA 2ZEOA 1XE4A 2YNCC 2ARHA 4YWYA 5HMNA 1TF9A 2G9DA 3IC1A 4UBRA 4FD7A 1LCPA 3W6XA 3KQXA 3LACA 2A4NA 3NFZA 2PIZA 2VZYA 1CM0A 1IY7A 3GJZA 2O28A 4MFZA 3S6HA 4R8FA 4MRIA 1RO5A 4JZ0A 4RN7A 2ZOFA 2RFHA 1ELLP 1B6BA 2YGWA 4UCPA 4YFJA 4IIYA 1YVOA 4KOSA 2K5TA 4MCRA 4MBUA 2ZPAA 1R57A 2P0WA 4OC1A 4H6UA 1VBHA 4CGPA 4C99A 2PCNA 2Z3OA 2X0SA 2ZEFA 1WJTA 2CBLA 3D4UA 4MXUA 4CPAA 3KL9A 4OC2A 5J3XA 2J8NA 3KI9A 4KOVA 1Z4EA 4TNUA 1FBVA 1PU9A 3RYOA 4KSAA 1GGOA 3SJXA 3DGVA 4YRHA 4DYOA 1NBWA 2H5MA 4PK2A 3R9FA 3JTKA 2PDOA 4INJA 4Q36A 4H89A 4COBA 1HDUA 3SXOA 4F0YA 4GS4A 2CY2A 2PVWA 3S9LA 1ON0A 1Z5RA 1X12A 3I74A 3G8WA 3JUWA 2EK8A 1S60A 1C30B 5F48A 4OMEA 3RZAA 4C2XA 3C8OA 3L2NA 3KRVA 1L0CA 4CRZB 4YU9A 3TTHA 2Q4ZA 3TYXA 3F9KC 1XMTA 5J8CA 4CDKA 4E0AA 2EZBA 5LYIA 4CAWA 1TKHA 2OZUA 4C85A 3FJUA 4MFJA 2PR8A 4OC0A 3BUMB 1N71A 4C68A 1Y7RA 1CPXA 4PSWA 2Z11A 4QUSA 3RO0A 1CJWA 3VROA 1J4JA 1ZG8A 3BUXB 2D4PA 3KQZA 3P2HA 3BUNB 1WWZA 2B58A 4CYOA 3CXPA 3EZEA 1AMPA 2ZW7A 3QNVA 4JWPA 3DR6A 3F5BA 5K8NA 5JYBA 1IICA 5CBMA 2DLAA 3PB9X 2ODFA 4CAXA 3E0KA 3OWCA 4JJXA 5HVGA 4C8AA 4UEZA 4EYSA 3EZAA 2KCWA 1XRYA 2HUZA 3R9EA 4WJBA 3SI2A 3FRMA 2PJ2A 5LYFA 2EBJA 4C9UA 1EO0A 4UA3A 1BXRB 4II9A 3D3SA 7CPAA 2PJBA 1VBGA 1UFHA 2REEA 3LD2A 1NXJA 1I1DA 4J0NA 3MGDA 4MCPA 4NCZA 4OIDA 4NGSA 3EC4A 3WC7A 3RAMA 4RUHA 5C88A 4RS2A 4F9UA 5K8OA 4C84A 3MRUA 4F0XA 2GIVA 4NGPA 2CF4A 4PXDA 4EWTA 5H86A 2ABZA 1NMTA 2B4DA 1Z4RA 4LUAA 2VL1A 3B8GA 3IWGA 1OZPA 3WR7A 3T07A 1LFWA 3TLAA 4LQGA 5FVJA 4KZTA 3PB4X 4ONWA 4MJXA 1M4GA 5IX3A 5FD8A 4M6GA 4Y49C 3B35A 4AG7A 4C86A 2VXKA 2PJ5A 2XEIA 3D66A 1LANA 3DNSA 1KBLA 1EE3P 2O53A 4EVYA 4TJVA 3IEHA 1K4JA 4ZX9A 5AXIA 3TLGA 3VRNA 1CBXA 2GANA 4OAEA 4DJLA 2NYQA 4RI1A 2PC1A 3CDXA 4M3SA 2P6GA 3H8FA 3VRRA 4LQ6A 1S7LA 3W6SA 4LX9A 4B5PA 4ZI6A 4JYWA 2VBQA 3A9LA 4KNGE 2EWBA 2R82A 1WVMA 5CNPA 5EBVA 1CPSA 3EY5A 4J3GA 3I3GA 1YLOA 4K30A 2B0AA 4YN3A 1IYKA 2BOAA 2Z0ZA 2EZAA 1Q7LA 3F8KA 1P4NA 3DR8A 1Y0RA 2YNDA 1RXTA 2FT0A 3B3CA 3C26A 3S9NA 3GKRA 2PIYA 3VWDA 1DIKA 3K4IA 1NSLA 2FXFA 4MFKA 2P6FA 2Q4VA 4KVME 2BSWA 4A94A 5F46A 3TFYA 1CX8A 2CTCA 2FM4A 4W9YA 3FYNA 4CGNA 4KUAA 3VWEA 3TC8A 3D7DA 1BPMA 1ELMP 1TIQA 2Y0MA 1ZYMA 1V0CA 4A4BA 1PCAA 1QSTA 4P10A 3VTAA 3HLPA 4NGTA 4MJ8A 4NF1A 1IOFA 1YVKA 2GLFA 1S3ZA 4A30A 2Q44A 3T05A 1GYTA 3IJ3A 2ZW6A 3T9YA 3ISXA 3KKWA 5F9MA 4AVAA 2HC9A 5D29A 3PEIA 3QB8A 3SXNA 3VARA 2EZCA 4UEEA 4A39A 1VHSA 2WSAA 1TXRA 2OOTA 2C5QA 2WPWA 2GP4A 2ATRA 1Y0YA 3CPXA 4B5OA 5F47A 3BUOB 4C9RA 1YQEA 1FT7A 1M4DA 5THWA 3WC6A 5JH9A 3NE8A 4COGA 2CXAA 5HKZA 2F5IA 3TOAA 1U6MA 5IB0A 1Z9EA 1KUVA 1F2OA 3LMSA 2Q7SA 4C7IA 3QAHA 4UFVA 4OIWA 1Q2CA 4R7MA 5ELYA 3ZJ0A 1C3OB 5EC4A 1HDQA 1QSRA 3V38A 4JLYA 4IIXA 2P6EA 1V6CA 4ZGYB 3KASA 1HEEA 2J9AA 4XPDC 4UWJA 3RNZA 5BWAB 4EMEA 3B3VA 4UF4A 2OZHA 2HV2A 1XFOA 2JDDA 4BD9A 2Z3MA 2OZGA 1VHOA 4NFRA 2N3AB 4C9AA 4P4DA 3RBUA 2ZENA 1KEEB 1UWYA 2ZELA 1JQGA 2JLMA 4XNHC 4ZX8A 1YLEA 1JDBC 4CAVA 2IQ6A 2XPLA 2RC4A 4KVXA 4X5KA 1KWMA 2PJ1A 1M44A 1VKCA 2PJ6A 5ISVA 3NH5A 1ARMA 3IWEA 1YVHA 4R57A 3WABA 5AGEA 5I0CA 3ZNIA 1XMBA 5DWNA 2MP0A 2R8VA 3HPGG 5AG5A 1B87A 1LOKA 2V8HA 3FIXA 1M6VB 3T5MA 3TOBA 1GHEA 4PPZA 3QAYA 4AXVA 2R7HA 2XPPA 3WC5A 3U1BA 4NGRA 1AYEA 3FX6A 4ZY0A 2NSMA 4MI4A 3VRPA 3EIFA 2C6CA 3DDDA 4F9VA 5KTCA 4UWIA 1PYTB 4HNYB 3BXMA 1MJBA 4F8ZA 5AG4A 1ZLIA 5JGFA 4QBJA 1LAMA 4MHYA 4CAEA 1A9XB 5K99A 2D0OA 3TX8A 3KR5A 4OKOA 1XOVA 5HVHA 3D7GA 1BOBA 2PVVA 2WYRA 5BY0A 2AUNA 4P4IA 4Y49B 2AUMA 4A4CA 3PLFB 4ZYQA 3BI0A 3T90A 4JVOA 1NE9A 5F1YA 8CPAA 3OB2B 2EVNA 2Z3NA 5HVFA 4R3LA 2AE6A 4MY3A 2PQ8A 3CT9A 2V8DA 1Q5XA 2QIRA 5CPAA 4XPLA 1IGBA 3KGQA 3GLJA 1KZFA 3NE7A 4MHNA 5LYDA 4C8PA 4CGLA 4X3RA 2OU2A 4TJXA 1QQ9A 2DPSA 2ZEEA 4CYQA 3K2KA 2C6PA 4MFLA 4KVOE 3DLJA 4P6YA 3BI1A 3JRUA 4QC6A 1VHEA 4FD6A 1TKJA 2DIKA 2VI7A 2UV8G 5HXDA 4OADA 1A2ZA 2BEIA 2YNCA 3NA6A 5D8NA 4CGOA 1CS0B 3HMJG 5F5XA 1PUAA 4MCQA 1Z8WA 2PR1A 4H1HA 3LODA 2E28A 2IL4A 4C2ZA 3GYAA 3B3SA 3D7HA 3R1KA 2AFSA 2ZEPA 2FCKA 3H5ZA 4FAIA 1AUGA 5LRJA 3FECA 4IAVA 5IV0A 4BPWB 5GCNA 1T36B 4YGOA 4P4EA 3D68A 1IOIA 4KUBA 4MFPA 1Y9ZA 3D67A 4U9ZA 4E2AA 3PFVA 4ORFA 2POKA 5K8MA 1Q2YA 2I79A 3ISZA 3ZZIA 1LRZA 1MJ9A 4KSIA 3CXQA 3OP0A 1S5KA 2GFQA 2AFOA 5HKWA 2QVPA 2Z3PA 1XEBA 4M6HA 4M85A 1ZO0A 3HPHE 4PV6A 4OC4A 5JPHA 1MK4A 3B7IA 3K9UA 3SI1A 2Z10A 4R9MA 4RR2B 3K9TA 3R96A 2AFWA 4MHDA 2DF5A 3KHZA 1YK3A 4BPXB 3PB8X 5F49A 5G22A 2XEGA 3OB1B 1QSNA 2IJZA 4GPLB 4KOTA 2D0PA 5G20A 3ICUA 3PB7X 2Z3KA 4R6TA 1BO4A 1YW4A 2G3TA 4C7HA 2B5GB 3DSBA 3H4QA 1I12A 4ZBGA 4FD5A 2REFA 2EO8A 2G3AA 4AB7A 2Q51A 2OLSA 3PT1A 3EZBA 4AVBA 1JWQA 3F0AA 3KHXA 3R95A 3TO6A 2HROA 4KORA 3SR3A 4ZY2A 4DNCA 2FIWA 2FVGA 4M6IA 4P45A 2C27A 3FVLA 4G1PA 3H8GA 3CZXA 4UIBA 4XPDB 3B2YA 3KR4A 2DXQA 4PQAA 2ZXVA 3FXTA 2PRQA 4PXBA 2BL1A 3T8WA 4B13A 2F7VA 1F2PA 3KZWA 3P2FA 1YR0A 4A2ZA 4P4BA 3TO9A 1EZAA 2JBJA 3SJGA 2FE7A 1IU8A 3N7ZA 3NH4A 4XNHB 4AG9A 1I21A 1YW6A 1CG2A 1M1DA 1J3LA 2OH1A 1DE4C 4Z65A 4A37A 1YREA 2GREA 2V77A 3I1UA 1S7FA 2I00A 2NMTA 3PZJA 3TE4A 2YNEA 2J8MA 1CE8B 1QSMA 4UFWA 2YJVA 2CNMA 3H8EA 3SJEA 2BUEA 2D4OA 3PGPA 3EO4A 4R76A 3IIBA 5G21A 5HH1A 4NJRA 4CS0B 3PFOA 4B6ZA 4QB9A 2CNSA 1Z9UA 2ZW4A 3D2PA 3BHXA 4HPSA 4PSXA 3B3TA 4M8DA 3VH9A 4C2YA 2ZEHA 3N5FA 3W91A 4BBHA 2PSWA 2XEJA 3IU1A 3TLZA 4WWVA 4A38A 1M4LA 2Q04A 5J8FA 3CXSA 3PRTA 3S9MA 1LAPA 1IIDA 5DWMA 2AFUA 4H2KA 4B14A 1R61A 2J8RA 3IO1A 1Y9KA 4GM5A 1CP7A 4A31A 3MN8A 3FEEA 3TLBA 2VEZA 2B3VA 4ONUA 4C8FA 3PP9A 2JDCA 2BCOA 1YSJA 3S6FA 4FBEA 3EFAA 3G3SA 3PB6X 4IF5A 1ZLHA 3IU2A 4I49A 1BLLE 2JEVA 4HNWB 2FL4A 4HNXB 5H84A 3TCVA 3HUVA 4B11A 5LRKA 4MCSA 2I3CA 2VQYA 3D8PA 3PFEA 4X2TA 4P44A 4IK2A 2PRBA 4FUUA 4MHPA 4K3NA 3O8ZA 1DTDA 4KSFA 1B47A 4BMHA 2Y1NA 2AFXA 2GLJA 4XPKA 2V8VA 4QVTA 4CYNA 4A33A 2JEWA 4F6AA 2FS5A 5A28A 1FY7A 4L8AA 1IB1E 5A27A 2EUIA 1MJAA 2ZEGA 4U5YA 2PJ0A 2B3UA 2Q0YA 5JM6A 4KOXA 4E5SA 5J1QA 1SQHA 4C8UA 4R3KA 4TWEA 4CRYB 5AG6A 5E96A 1R3NA 2RB7A 2HI6A 4KLVA 3BLNA 1WK4A 3IWWA 1BAVA 4MY0A 2VZZA 2DPTA 2F8HA 2G0BA 1ZG7A 4E8OA 4FD4A 3U88C 5DS0A 1X10A 1RTQA 2AFZA 1VGYA 1Z8XA 3GB0A 2PJ9A 1QMUA 4O23A 4H6ZA 3FMCA 5F13A 2V8GA 4JD6A 3FNCA 4C9EA 3SHPA 4FWUA 3G23A 1Z8LA 3IGRA 4OC3A 4KOUA 3I6SA 2B4JC 4PK3A 3TLCA 5KTDA 4NJQA 3R9GA 1Q2DA 4C9VA 4MHZA 4A32A 2PE3A 4MMOA 4NGQA 1NSAA 3D2MA 2EK9A 2QJ8A 4ZY1A 4C8CA 4UCNA 2AFMA 1XJOA 5I4MA 1F57A 1S7KA 4Q38A 1ARLA 1QSOA 3OAKA 2PJ8A 3I9SA 3FF3A 2B5GA 2WPXA 4BPUB 4CO9A 3FEDA 4CDJA 2WZNA 3TLEA 1YGHA 1XBUA 1Z2LA 2ANPA 4CYPA 3NOJA 4NSQA 4KOWA 1YMEA 3T0TA 3NH8A 2PJCA 2PJ4A 2CIJA 3LWUA 4CAFA 1EZBA 2PCUA 3FBUA 4HKFA 4GXHA 4X8IA 2PJ3A 3CPAA 3GY9A 4NEXA 3GUXA 3D7FA 2GU2A 2O4HA 4Q7AA 4UCMA 2XPOA 1VI4A 5IR2A 1OBRA 3VRQA 5JQ4A 2B4BA 4R87A 2FSRA 3PBEA 5HKYA 2BO9A 2FIAA 3FB3A 1P0HA 2ZEMA 4B10A 4P4JA 4IUSA 2WUUA 3BJ7A 5K8PA 1JDEA 2PJAA 1XIXA 1S7NA 2QMLA 1IYLA 2HQYA 4EFDA 2Q7BA 2QYVA 4OC5A 3S6GA 1KUXA 4KOYA 3SI0A 2OR4A 2XPNA 3NFQA 4L89A 3TO7A 2R1IA 1ZG9A 5KTAA 2X7BA 4A95A 1TF8A 2CTBA 1M4IA 2DEAA 3FH4A 6CPAA 4IHMA 1ZRSA 4OLLA 4BINA 3BJ8A 3V7ZA 4MFQA 4CGMA 2C6GA 1CP6A 4C8TA 2VKZG 3JVNA 4E94A 3GIUA 3V8IA 4JXQA 4UFXA 4DUKA 2Q43A 3VGOA 1Y7EA 3S6KA 2Q4YA 2JBKA 2ZOGA 1Z8TA 4NGNA 3IFEA 1R43A 4UIAA 3UY5A 1XF1A 4U9YA 2CNTA 2B4DB 2Z3LA 1XF8A 4NXYA 4NGMA 1H8LA 3VATA 1FNOA 3WT4A 3SJFA 5EMIA 4OP4A 3TLYA 2OB0A 4JXRA 1VIXA 4KLWA 2HWGA 2GE3A 3PBBA 5AG7A 1YX0A 5C82A 4UEFA 1Y9WA 4PXEA 3B3WA 1ZL0A 5JVLA 1KC7A 1BPNA 5F09A 3TLGB 2ZEDA 2PJ7A 1TKFA 3EXNA 4AVCA 4P4FA 2Y1MA 2C1CA 3BUWB 2ZW5A 2QECA 3TT2A
chains in the Genus database with same CATH topology
4PXCA 2IMOA 2XEFA 2HB6A 5IB9A 5LRGA 5LYLA 2ZEOA 4YWYA 1TF9A 2G9DA 3IC1A 1LCPA 3KQXA 3NFZA 2PIZA 1IY7A 4R8FA 4MRIA 4JZ0A 2ZOFA 2RFHA 1ELLP 4MCRA 4OC1A 4C99A 2ZEFA 3D4UA 4CPAA 4MXUA 3KL9A 4OC2A 4TNUA 3KI9A 3SJXA 3DGVA 4DYOA 1HDUA 2PVWA 3S9LA 1Z5RA 3I74A 2EK8A 4OMEA 3RZAA 3L2NA 4YU9A 2Q4ZA 4CDKA 5LYIA 1TKHA 4C85A 3FJUA 4OC0A 1CPXA 1V6CA 1ZG8A 3KQZA 1AMPA 3QNVA 5K8NA 5CBMA 5HVGA 3PB9X 4C8AA 4UEZA 1XRYA 4WJBA 3SI2A 2PJ2A 5LYFA 4C9UA 7CPAA 2PJBA 4MCPA 4OIDA 4NGSA 3WC7A 3RAMA 4RUHA 4F9UA 5K8OA 4C84A 3MRUA 4NGPA 2CF4A 4PXDA 4EWTA 2ABZA 2VL1A 1LFWA 4LQGA 3PB4X 4ONWA 3B35A 4C86A 2PJ5A 2XEIA 3D66A 1LANA 1EE3P 2O53A 4TJVA 3IEHA 4ZX9A 1CBXA 4DJLA 2NYQA 3CDXA 3H8FA 4ZI6A 4JYWA 4KNGE 2EWBA 1WVMA 1CPSA 4YN3A 1YLOA 2BOAA 1Q7LA 1Y0RA 3B3CA 3S9NA 2PIYA 4A94A 1CX8A 2CTCA 4W9YA 3D7DA 1BPMA 1ELMP 4P10A 1PCAA 3VTAA 3HLPA 4NGTA 2GLFA 1GYTA 3IJ3A 3ISXA 2HC9A 5D29A 3PEIA 3VARA 4UEEA 4A39A 1TXRA 2OOTA 2C5QA 3CPXA 1Y0YA 4C9RA 1FT7A 3WC6A 5JH9A 3LMSA 1F2OA 4OIWA 4R7MA 5ELYA 1HDQA 3V38A 3KASA 1HEEA 2J9AA 4EMEA 3B3VA 4UF4A 1XFOA 4BD9A 1VHOA 4NFRA 4C9AA 4P4DA 3RBUA 2ZENA 1UWYA 2ZELA 1JQGA 4ZX8A 2IQ6A 1KWMA 2PJ1A 2PJ6A 3NH5A 1ARMA 3WABA 1XMBA 1LOKA 2V8HA 4PPZA 4AXVA 3WC5A 4NGRA 1AYEA 3FX6A 4ZY0A 2NSMA 3EIFA 2C6CA 4F9VA 1PYTB 3BXMA 4F8ZA 5JGFA 1ZLIA 1LAMA 4MHYA 3TX8A 3KR5A 4OKOA 5HVHA 3D7GA 2PVVA 2WYRA 4P4IA 4ZYQA 3BI0A 8CPAA 5HVFA 3CT9A 2V8DA 2GP4A 5CPAA 1IGBA 3KGQA 3GLJA 4MHNA 5LYDA 4C8PA 4X3RA 4TJXA 1QQ9A 2ZEEA 3K2KA 2C6PA 3DLJA 4P6YA 3BI1A 3JRUA 1VHEA 1TKJA 5HXDA 3NA6A 5D8NA 4MCQA 3B3SA 3D7HA 2AFSA 2ZEPA 4FAIA 5LRJA 3FECA 4IAVA 4P4EA 3D68A 1Y9ZA 3D67A 5K8MA 2POKA 3ISZA 4KSIA 2AFOA 2QVPA 4OC4A 3B7IA 3SI1A 3K9TA 2AFWA 3KHZA 3PB8X 2XEGA 2IJZA 3ICUA 3PB7X 4R6TA 1YW4A 2Q51A 3KHXA 4ZY2A 2FVGA 4P45A 3FVLA 4G1PA 3H8GA 4UIBA 3B2YA 3KR4A 4PQAA 2PRQA 4PXBA 3T8WA 2F7VA 1F2PA 3KZWA 4P4BA 2JBJA 3SJGA 3NH4A 1YW6A 1CG2A 1DE4C 4Z65A 4A37A 2GREA 3I1UA 2V77A 3H8EA 3SJEA 4R76A 3IIBA 4NJRA 3PFOA 4B6ZA 3BHXA 3B3TA 3VH9A 2ZEHA 3N5FA 2XEJA 4WWVA 4A38A 1M4LA 3PRTA 3S9MA 1LAPA 2AFUA 4H2KA 3IO1A 4GM5A 1CP7A 3MN8A 3FEEA 4C8FA 2BCOA 1YSJA 4FBEA 3PB6X 1ZLHA 1BLLE 3HUVA 5LRKA 4MCSA 2I3CA 4X2TA 3PFEA 4P44A 4IK2A 4FUUA 4MHPA 4K3NA 1DTDA 2AFXA 2GLJA 2V8VA 2JEWA 2ZEGA 2PJ0A 5JM6A 5J1QA 4C8UA 4TWEA 1R3NA 2RB7A 3IWWA 1BAVA 2F8HA 1ZG7A 5DS0A 2AFZA 1RTQA 1VGYA 3GB0A 2PJ9A 1QMUA 4O23A 3FMCA 2V8GA 4C9EA 4FWUA 1Z8LA 4OC3A 3I6SA 4NJQA 4C9VA 4MHZA 2PE3A 4MMOA 4NGQA 1NSAA 4C8CA 2EK9A 2QJ8A 4ZY1A 2AFMA 1XJOA 5I4MA 1F57A 5THWA 1ARLA 2PJ8A 3FF3A 3FEDA 4CDJA 2WZNA 1XBUA 1Z2LA 2ANPA 1YMEA 3NH8A 2PJCA 2PJ4A 2CIJA 3LWUA 2PCUA 4X8IA 2PJ3A 3CPAA 3GUXA 3D7FA 2GU2A 2O4HA 4Q7AA 5IR2A 1OBRA 3PBEA 2BO9A 2ZEMA 4P4JA 5K8PA 2PJAA 4EFDA 2QYVA 4OC5A 3SI0A 2OR4A 1ZG9A 1TF8A 2CTBA 2DEAA 3FH4A 6CPAA 4IHMA 3V7ZA 2C6GA 1CP6A 4C8TA 4DUKA 2Q43A 1Y7EA 2JBKA 2ZOGA 3IFEA 4NGNA 4UIAA 1R43A 1XF1A 3VATA 3WT4A 4NGMA 1H8LA 1FNOA 3SJFA 4OP4A 1VIXA 3PBBA 4UEFA 4PXEA 3B3WA 1BPNA 5F09A 2ZEDA 2PJ7A 1TKFA 4P4FA 2C1CA 3TC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXC A;  2IMO A;  2XEF A;  2HB6 A;  5IB9 A;  5LRG A;  5LYL A;  2ZEO A;  4YWY A;  1TF9 A;  2G9D A;  3IC1 A;  1LCP A;  3KQX A;  3NFZ A;  2PIZ A;  1IY7 A;  4R8F A;  4MRI A;  4JZ0 A;  2ZOF A;  2RFH A;  1ELL P;  4MCR A;  4OC1 A;  4C99 A;  2ZEF A;  3D4U A;  4CPA A;  4MXU A;  3KL9 A;  4OC2 A;  4TNU A;  3KI9 A;  3SJX A;  3DGV A;  4DYO A;  1HDU A;  2PVW A;  3S9L A;  1Z5R A;  3I74 A;  2EK8 A;  4OME A;  3RZA A;  3L2N A;  4YU9 A;  2Q4Z A;  4CDK A;  5LYI A;  1TKH A;  4C85 A;  3FJU A;  4OC0 A;  1CPX A;  1V6C A;  1ZG8 A;  3KQZ A;  1AMP A;  3QNV A;  5K8N A;  5CBM A;  5HVG A;  3PB9 X;  4C8A A;  4UEZ A;  1XRY A;  4WJB A;  3SI2 A;  2PJ2 A;  5LYF A;  4C9U A;  7CPA A;  2PJB A;  4MCP A;  4OID A;  4NGS A;  3WC7 A;  3RAM A;  4RUH A;  4F9U A;  5K8O A;  4C84 A;  3MRU A;  4NGP A;  2CF4 A;  4PXD A;  4EWT A;  2ABZ A;  2VL1 A;  1LFW A;  4LQG A;  3PB4 X;  4ONW A;  3B35 A;  4C86 A;  2PJ5 A;  2XEI A;  3D66 A;  1LAN A;  1EE3 P;  2O53 A;  4TJV A;  3IEH A;  4ZX9 A;  1CBX A;  4DJL A;  2NYQ A;  3CDX A;  3H8F A;  4ZI6 A;  4JYW A;  4KNG E;  2EWB A;  1WVM A;  1CPS A;  4YN3 A;  1YLO A;  2BOA A;  1Q7L A;  1Y0R A;  3B3C A;  3S9N A;  2PIY A;  4A94 A;  1CX8 A;  2CTC A;  4W9Y A;  3D7D A;  1BPM A;  1ELM P;  4P10 A;  1PCA A;  3VTA A;  3HLP A;  4NGT A;  2GLF A;  1GYT A;  3IJ3 A;  3ISX A;  2HC9 A;  5D29 A;  3PEI A;  3VAR A;  4UEE A;  4A39 A;  1TXR A;  2OOT A;  3CPX A;  1Y0Y A;  4C9R A;  1FT7 A;  3WC6 A;  5JH9 A;  3LMS A;  1F2O A;  4OIW A;  4R7M A;  5ELY A;  1HDQ A;  3V38 A;  3KAS A;  1HEE A;  2J9A A;  4EME A;  3B3V A;  4UF4 A;  1XFO A;  4BD9 A;  1VHO A;  4NFR A;  4C9A A;  4P4D A;  3RBU A;  2ZEN A;  1UWY A;  2ZEL A;  1JQG A;  4ZX8 A;  2IQ6 A;  1KWM A;  2PJ1 A;  2PJ6 A;  3NH5 A;  1ARM A;  3WAB A;  1XMB A;  1LOK A;  2V8H A;  4PPZ A;  4AXV A;  3WC5 A;  4NGR A;  1AYE A;  3FX6 A;  4ZY0 A;  2NSM A;  3EIF A;  2C6C A;  4F9V A;  1PYT B;  3BXM A;  4F8Z A;  5JGF A;  1ZLI A;  1LAM A;  4MHY A;  3TX8 A;  3KR5 A;  4OKO A;  5HVH A;  3D7G A;  2PVV A;  2WYR A;  4P4I A;  4ZYQ A;  3BI0 A;  8CPA A;  5HVF A;  3CT9 A;  2V8D A;  5CPA A;  1IGB A;  3KGQ A;  3GLJ A;  4MHN A;  5LYD A;  4C8P A;  4X3R A;  4TJX A;  1QQ9 A;  2ZEE A;  3K2K A;  2C6P A;  3DLJ A;  4P6Y A;  3BI1 A;  3JRU A;  1VHE A;  1TKJ A;  5HXD A;  3NA6 A;  5D8N A;  4MCQ A;  3B3S A;  3D7H A;  2AFS A;  2ZEP A;  4FAI A;  5LRJ A;  3FEC A;  4IAV A;  4P4E A;  3D68 A;  1Y9Z A;  3D67 A;  5K8M A;  2POK A;  3ISZ A;  4KSI A;  2AFO A;  2QVP A;  4OC4 A;  3B7I A;  3SI1 A;  3K9T A;  2AFW A;  3KHZ A;  3PB8 X;  2XEG A;  2IJZ A;  3ICU A;  3PB7 X;  4R6T A;  1YW4 A;  2Q51 A;  3KHX A;  4ZY2 A;  2FVG A;  4P45 A;  3FVL A;  4G1P A;  3H8G A;  4UIB A;  3B2Y A;  3KR4 A;  4PQA A;  2PRQ A;  4PXB A;  3T8W A;  2F7V A;  1F2P A;  3KZW A;  4P4B A;  2JBJ A;  3SJG A;  3NH4 A;  1YW6 A;  1CG2 A;  1DE4 C;  4Z65 A;  4A37 A;  2GRE A;  3I1U A;  2V77 A;  3H8E A;  3SJE A;  4R76 A;  3IIB A;  4NJR A;  3PFO A;  4B6Z A;  3BHX A;  3B3T A;  3VH9 A;  2ZEH A;  3N5F A;  2XEJ A;  4WWV A;  4A38 A;  1M4L A;  3PRT A;  3S9M A;  1LAP A;  2AFU A;  4H2K A;  3IO1 A;  4GM5 A;  1CP7 A;  3MN8 A;  3FEE A;  4C8F A;  2BCO A;  1YSJ A;  4FBE A;  3PB6 X;  1ZLH A;  1BLL E;  3HUV A;  5LRK A;  4MCS A;  2I3C A;  4X2T A;  3PFE A;  4P44 A;  4IK2 A;  4FUU A;  4MHP A;  4K3N A;  1DTD A;  2AFX A;  2GLJ A;  2V8V A;  2JEW A;  2ZEG A;  2PJ0 A;  5JM6 A;  5J1Q A;  4C8U A;  4TWE A;  1R3N A;  2RB7 A;  3IWW A;  1BAV A;  2F8H A;  1ZG7 A;  5DS0 A;  2AFZ A;  1RTQ A;  1VGY A;  3GB0 A;  2PJ9 A;  1QMU A;  4O23 A;  3FMC A;  2V8G A;  4C9E A;  4FWU A;  1Z8L A;  4OC3 A;  3I6S A;  4NJQ A;  4C9V A;  4MHZ A;  2PE3 A;  4MMO A;  4NGQ A;  1NSA A;  4C8C A;  2EK9 A;  2QJ8 A;  4ZY1 A;  2AFM A;  1XJO A;  5I4M A;  1F57 A;  5THW A;  1ARL A;  2PJ8 A;  3FF3 A;  3FED A;  4CDJ A;  2WZN A;  1XBU A;  1Z2L A;  2ANP A;  1YME A;  3NH8 A;  2PJC A;  2PJ4 A;  2CIJ A;  3LWU A;  2PCU A;  4X8I A;  2PJ3 A;  3CPA A;  3GUX A;  3D7F A;  2GU2 A;  2O4H A;  4Q7A A;  1OBR A;  3PBE A;  2BO9 A;  2ZEM A;  4P4J A;  5K8P A;  2PJA A;  4EFD A;  2QYV A;  4OC5 A;  3SI0 A;  2OR4 A;  1ZG9 A;  1TF8 A;  2CTB A;  2DEA A;  3FH4 A;  6CPA A;  4IHM A;  3V7Z A;  2C6G A;  1CP6 A;  4C8T A;  4DUK A;  2Q43 A;  1Y7E A;  2JBK A;  2ZOG A;  3IFE A;  4NGN A;  4UIA A;  1R43 A;  1XF1 A;  3VAT A;  3WT4 A;  4NGM A;  1H8L A;  1FNO A;  3SJF A;  4OP4 A;  1VIX A;  3PBB A;  4UEF A;  4PXE A;  3B3W A;  1BPN A;  5F09 A;  2ZED A;  2PJ7 A;  1TKF A;  4P4F A;  2C1C A;  3TC8 A; 
#chains in the Genus database with same CATH topology
 4PXC A;  2IMO A;  4B12 A;  4MI1 A;  2R98 A;  2XEF A;  4KS9 A;  1KUY A;  4CZ1 A;  4B5P B;  2HB6 A;  5IB9 A;  4BTF A;  2YJT A;  5G1Z A;  2AJ6 A;  5LRG A;  5LYL A;  2ZEO A;  1XE4 A;  2YNC C;  2ARH A;  4YWY A;  5HMN A;  1TF9 A;  2G9D A;  3IC1 A;  4UBR A;  4FD7 A;  1LCP A;  3W6X A;  3KQX A;  3LAC A;  2A4N A;  3NFZ A;  2PIZ A;  2VZY A;  1CM0 A;  1IY7 A;  3GJZ A;  2O28 A;  4MFZ A;  3S6H A;  4R8F A;  4MRI A;  1RO5 A;  4JZ0 A;  4RN7 A;  2ZOF A;  2RFH A;  1ELL P;  1B6B A;  2YGW A;  4UCP A;  4YFJ A;  4IIY A;  1YVO A;  4KOS A;  2K5T A;  4MCR A;  4MBU A;  2ZPA A;  1R57 A;  2P0W A;  4OC1 A;  4H6U A;  1VBH A;  4CGP A;  4C99 A;  2PCN A;  2Z3O A;  2X0S A;  2ZEF A;  1WJT A;  2CBL A;  3D4U A;  4MXU A;  4CPA A;  3KL9 A;  4OC2 A;  5J3X A;  2J8N A;  3KI9 A;  4KOV A;  1Z4E A;  4TNU A;  1FBV A;  1PU9 A;  3RYO A;  4KSA A;  1GGO A;  3SJX A;  3DGV A;  4YRH A;  4DYO A;  1NBW A;  2H5M A;  4PK2 A;  3R9F A;  3JTK A;  2PDO A;  4INJ A;  4Q36 A;  4H89 A;  4COB A;  1HDU A;  3SXO A;  4F0Y A;  4GS4 A;  2CY2 A;  2PVW A;  3S9L A;  1ON0 A;  1Z5R A;  1X12 A;  3I74 A;  3G8W A;  3JUW A;  2EK8 A;  1S60 A;  1C30 B;  5F48 A;  4OME A;  3RZA A;  4C2X A;  3C8O A;  3L2N A;  3KRV A;  1L0C A;  4CRZ B;  4YU9 A;  3TTH A;  2Q4Z A;  3TYX A;  3F9K C;  1XMT A;  5J8C A;  4CDK A;  4E0A A;  2EZB A;  5LYI A;  4CAW A;  1TKH A;  2OZU A;  4C85 A;  3FJU A;  4MFJ A;  2PR8 A;  4OC0 A;  3BUM B;  1N71 A;  4C68 A;  1Y7R A;  1CPX A;  4PSW A;  2Z11 A;  4QUS A;  3RO0 A;  1CJW A;  3VRO A;  1J4J A;  1ZG8 A;  3BUX B;  2D4P A;  3KQZ A;  3P2H A;  3BUN B;  1WWZ A;  2B58 A;  4CYO A;  3CXP A;  3EZE A;  1AMP A;  2ZW7 A;  3QNV A;  4JWP A;  3DR6 A;  3F5B A;  5K8N A;  5JYB A;  1IIC A;  5CBM A;  2DLA A;  3PB9 X;  2ODF A;  4CAX A;  3E0K A;  3OWC A;  4JJX A;  5HVG A;  4C8A A;  4UEZ A;  4EYS A;  3EZA A;  2KCW A;  1XRY A;  2HUZ A;  3R9E A;  4WJB A;  3SI2 A;  3FRM A;  2PJ2 A;  5LYF A;  2EBJ A;  4C9U A;  1EO0 A;  4UA3 A;  1BXR B;  4II9 A;  3D3S A;  7CPA A;  2PJB A;  1VBG A;  1UFH A;  2REE A;  3LD2 A;  1NXJ A;  1I1D A;  4J0N A;  3MGD A;  4MCP A;  4NCZ A;  4OID A;  4NGS A;  3EC4 A;  3WC7 A;  3RAM A;  4RUH A;  5C88 A;  4RS2 A;  4F9U A;  5K8O A;  4C84 A;  3MRU A;  4F0X A;  2GIV A;  4NGP A;  2CF4 A;  4PXD A;  4EWT A;  5H86 A;  2ABZ A;  1NMT A;  2B4D A;  1Z4R A;  4LUA A;  2VL1 A;  3B8G A;  3IWG A;  1OZP A;  3WR7 A;  3T07 A;  1LFW A;  3TLA A;  4LQG A;  5FVJ A;  4KZT A;  3PB4 X;  4ONW A;  4MJX A;  1M4G A;  5IX3 A;  5FD8 A;  4M6G A;  4Y49 C;  3B35 A;  4AG7 A;  4C86 A;  2VXK A;  2PJ5 A;  2XEI A;  3D66 A;  1LAN A;  3DNS A;  1KBL A;  1EE3 P;  2O53 A;  4EVY A;  4TJV A;  3IEH A;  1K4J A;  4ZX9 A;  5AXI A;  3TLG A;  3VRN A;  1CBX A;  2GAN A;  4OAE A;  4DJL A;  2NYQ A;  4RI1 A;  2PC1 A;  3CDX A;  4M3S A;  2P6G A;  3H8F A;  3VRR A;  4LQ6 A;  1S7L A;  3W6S A;  4LX9 A;  4B5P A;  4ZI6 A;  4JYW A;  2VBQ A;  3A9L A;  4KNG E;  2EWB A;  2R82 A;  1WVM A;  5CNP A;  5EBV A;  1CPS A;  3EY5 A;  4J3G A;  3I3G A;  1YLO A;  4K30 A;  2B0A A;  4YN3 A;  1IYK A;  2BOA A;  2Z0Z A;  2EZA A;  1Q7L A;  3F8K A;  1P4N A;  3DR8 A;  1Y0R A;  2YND A;  1RXT A;  2FT0 A;  3B3C A;  3C26 A;  3S9N A;  3GKR A;  2PIY A;  3VWD A;  1DIK A;  3K4I A;  1NSL A;  2FXF A;  4MFK A;  2P6F A;  2Q4V A;  4KVM E;  2BSW A;  4A94 A;  5F46 A;  3TFY A;  1CX8 A;  2CTC A;  2FM4 A;  4W9Y A;  3FYN A;  4CGN A;  4KUA A;  3VWE A;  3TC8 A;  3D7D A;  1BPM A;  1ELM P;  1TIQ A;  2Y0M A;  1ZYM A;  1V0C A;  4A4B A;  1PCA A;  1QST A;  4P10 A;  3VTA A;  3HLP A;  4NGT A;  4MJ8 A;  4NF1 A;  1IOF A;  1YVK A;  2GLF A;  1S3Z A;  4A30 A;  2Q44 A;  3T05 A;  1GYT A;  3IJ3 A;  2ZW6 A;  3T9Y A;  3ISX A;  3KKW A;  5F9M A;  4AVA A;  2HC9 A;  5D29 A;  3PEI A;  3QB8 A;  3SXN A;  3VAR A;  2EZC A;  4UEE A;  4A39 A;  1VHS A;  2WSA A;  1TXR A;  2OOT A;  2C5Q A;  2WPW A;  2GP4 A;  2ATR A;  1Y0Y A;  3CPX A;  4B5O A;  5F47 A;  3BUO B;  4C9R A;  1YQE A;  1FT7 A;  1M4D A;  5THW A;  3WC6 A;  5JH9 A;  3NE8 A;  4COG A;  2CXA A;  5HKZ A;  2F5I A;  3TOA A;  1U6M A;  5IB0 A;  1Z9E A;  1KUV A;  1F2O A;  3LMS A;  2Q7S A;  4C7I A;  3QAH A;  4UFV A;  4OIW A;  1Q2C A;  4R7M A;  5ELY A;  3ZJ0 A;  1C3O B;  5EC4 A;  1HDQ A;  1QSR A;  3V38 A;  4JLY A;  4IIX A;  2P6E A;  1V6C A;  4ZGY B;  3KAS A;  1HEE A;  2J9A A;  4XPD C;  4UWJ A;  3RNZ A;  5BWA B;  4EME A;  3B3V A;  4UF4 A;  2OZH A;  2HV2 A;  1XFO A;  2JDD A;  4BD9 A;  2Z3M A;  2OZG A;  1VHO A;  4NFR A;  2N3A B;  4C9A A;  4P4D A;  3RBU A;  2ZEN A;  1KEE B;  1UWY A;  2ZEL A;  1JQG A;  2JLM A;  4XNH C;  4ZX8 A;  1YLE A;  1JDB C;  4CAV A;  2IQ6 A;  2XPL A;  2RC4 A;  4KVX A;  4X5K A;  1KWM A;  2PJ1 A;  1M44 A;  1VKC A;  2PJ6 A;  5ISV A;  3NH5 A;  1ARM A;  3IWE A;  1YVH A;  4R57 A;  3WAB A;  5AGE A;  5I0C A;  3ZNI A;  1XMB A;  5DWN A;  2MP0 A;  2R8V A;  3HPG G;  5AG5 A;  1B87 A;  1LOK A;  2V8H A;  3FIX A;  1M6V B;  3T5M A;  3TOB A;  1GHE A;  4PPZ A;  3QAY A;  4AXV A;  2R7H A;  2XPP A;  3WC5 A;  3U1B A;  4NGR A;  1AYE A;  3FX6 A;  4ZY0 A;  2NSM A;  4MI4 A;  3VRP A;  3EIF A;  2C6C A;  3DDD A;  4F9V A;  5KTC A;  4UWI A;  1PYT B;  4HNY B;  3BXM A;  1MJB A;  4F8Z A;  5AG4 A;  1ZLI A;  5JGF A;  4QBJ A;  1LAM A;  4MHY A;  4CAE A;  1A9X B;  5K99 A;  2D0O A;  3TX8 A;  3KR5 A;  4OKO A;  1XOV A;  5HVH A;  3D7G A;  1BOB A;  2PVV A;  2WYR A;  5BY0 A;  2AUN A;  4P4I A;  4Y49 B;  2AUM A;  4A4C A;  3PLF B;  4ZYQ A;  3BI0 A;  3T90 A;  4JVO A;  1NE9 A;  5F1Y A;  8CPA A;  3OB2 B;  2EVN A;  2Z3N A;  5HVF A;  4R3L A;  2AE6 A;  4MY3 A;  2PQ8 A;  3CT9 A;  2V8D A;  1Q5X A;  2QIR A;  5CPA A;  4XPL A;  1IGB A;  3KGQ A;  3GLJ A;  1KZF A;  3NE7 A;  4MHN A;  5LYD A;  4C8P A;  4CGL A;  4X3R A;  2OU2 A;  4TJX A;  1QQ9 A;  2DPS A;  2ZEE A;  4CYQ A;  3K2K A;  2C6P A;  4MFL A;  4KVO E;  3DLJ A;  4P6Y A;  3BI1 A;  3JRU A;  4QC6 A;  1VHE A;  4FD6 A;  1TKJ A;  2DIK A;  2VI7 A;  2UV8 G;  5HXD A;  4OAD A;  1A2Z A;  2BEI A;  2YNC A;  3NA6 A;  5D8N A;  4CGO A;  1CS0 B;  3HMJ G;  5F5X A;  1PUA A;  4MCQ A;  1Z8W A;  2PR1 A;  4H1H A;  3LOD A;  2E28 A;  2IL4 A;  4C2Z A;  3GYA A;  3B3S A;  3D7H A;  3R1K A;  2AFS A;  2ZEP A;  2FCK A;  3H5Z A;  4FAI A;  1AUG A;  5LRJ A;  3FEC A;  4IAV A;  5IV0 A;  4BPW B;  5GCN A;  1T36 B;  4YGO A;  4P4E A;  3D68 A;  1IOI A;  4KUB A;  4MFP A;  1Y9Z A;  3D67 A;  4U9Z A;  4E2A A;  3PFV A;  4ORF A;  2POK A;  5K8M A;  1Q2Y A;  2I79 A;  3ISZ A;  3ZZI A;  1LRZ A;  1MJ9 A;  4KSI A;  3CXQ A;  3OP0 A;  1S5K A;  2GFQ A;  2AFO A;  5HKW A;  2QVP A;  2Z3P A;  1XEB A;  4M6H A;  4M85 A;  1ZO0 A;  3HPH E;  4PV6 A;  4OC4 A;  5JPH A;  1MK4 A;  3B7I A;  3K9U A;  3SI1 A;  2Z10 A;  4R9M A;  4RR2 B;  3K9T A;  3R96 A;  2AFW A;  4MHD A;  2DF5 A;  3KHZ A;  1YK3 A;  4BPX B;  3PB8 X;  5F49 A;  5G22 A;  2XEG A;  3OB1 B;  1QSN A;  2IJZ A;  4GPL B;  4KOT A;  2D0P A;  5G20 A;  3ICU A;  3PB7 X;  2Z3K A;  4R6T A;  1BO4 A;  1YW4 A;  2G3T A;  4C7H A;  2B5G B;  3DSB A;  3H4Q A;  1I12 A;  4ZBG A;  4FD5 A;  2REF A;  2EO8 A;  2G3A A;  4AB7 A;  2Q51 A;  2OLS A;  3PT1 A;  3EZB A;  4AVB A;  1JWQ A;  3F0A A;  3KHX A;  3R95 A;  3TO6 A;  2HRO A;  4KOR A;  3SR3 A;  4ZY2 A;  4DNC A;  2FIW A;  2FVG A;  4M6I A;  4P45 A;  2C27 A;  3FVL A;  4G1P A;  3H8G A;  3CZX A;  4UIB A;  4XPD B;  3B2Y A;  3KR4 A;  2DXQ A;  4PQA A;  2ZXV A;  3FXT A;  2PRQ A;  4PXB A;  2BL1 A;  3T8W A;  4B13 A;  2F7V A;  1F2P A;  3KZW A;  3P2F A;  1YR0 A;  4A2Z A;  4P4B A;  3TO9 A;  1EZA A;  2JBJ A;  3SJG A;  2FE7 A;  1IU8 A;  3N7Z A;  3NH4 A;  4XNH B;  4AG9 A;  1I21 A;  1YW6 A;  1CG2 A;  1M1D A;  1J3L A;  2OH1 A;  1DE4 C;  4Z65 A;  4A37 A;  1YRE A;  2GRE A;  2V77 A;  3I1U A;  1S7F A;  2I00 A;  2NMT A;  3PZJ A;  3TE4 A;  2YNE A;  2J8M A;  1CE8 B;  1QSM A;  4UFW A;  2YJV A;  2CNM A;  3H8E A;  3SJE A;  2BUE A;  2D4O A;  3PGP A;  3EO4 A;  4R76 A;  3IIB A;  5G21 A;  5HH1 A;  4NJR A;  4CS0 B;  3PFO A;  4B6Z A;  4QB9 A;  2CNS A;  1Z9U A;  2ZW4 A;  3D2P A;  3BHX A;  4HPS A;  4PSX A;  3B3T A;  4M8D A;  3VH9 A;  4C2Y A;  2ZEH A;  3N5F A;  3W91 A;  4BBH A;  2PSW A;  2XEJ A;  3IU1 A;  3TLZ A;  4WWV A;  4A38 A;  1M4L A;  2Q04 A;  5J8F A;  3CXS A;  3PRT A;  3S9M A;  1LAP A;  1IID A;  5DWM A;  2AFU A;  4H2K A;  4B14 A;  1R61 A;  2J8R A;  3IO1 A;  1Y9K A;  4GM5 A;  1CP7 A;  4A31 A;  3MN8 A;  3FEE A;  3TLB A;  2VEZ A;  2B3V A;  4ONU A;  4C8F A;  3PP9 A;  2JDC A;  2BCO A;  1YSJ A;  3S6F A;  4FBE A;  3EFA A;  3G3S A;  3PB6 X;  4IF5 A;  1ZLH A;  3IU2 A;  4I49 A;  1BLL E;  2JEV A;  4HNW B;  2FL4 A;  4HNX B;  5H84 A;  3TCV A;  3HUV A;  4B11 A;  5LRK A;  4MCS A;  2I3C A;  2VQY A;  3D8P A;  3PFE A;  4X2T A;  4P44 A;  4IK2 A;  2PRB A;  4FUU A;  4MHP A;  4K3N A;  3O8Z A;  1DTD A;  4KSF A;  1B47 A;  4BMH A;  2Y1N A;  2AFX A;  2GLJ A;  4XPK A;  2V8V A;  4QVT A;  4CYN A;  4A33 A;  2JEW A;  4F6A A;  2FS5 A;  5A28 A;  1FY7 A;  4L8A A;  1IB1 E;  5A27 A;  2EUI A;  1MJA A;  2ZEG A;  4U5Y A;  2PJ0 A;  2B3U A;  2Q0Y A;  5JM6 A;  4KOX A;  4E5S A;  5J1Q A;  1SQH A;  4C8U A;  4R3K A;  4TWE A;  4CRY B;  5AG6 A;  5E96 A;  1R3N A;  2RB7 A;  2HI6 A;  4KLV A;  3BLN A;  1WK4 A;  3IWW A;  1BAV A;  4MY0 A;  2VZZ A;  2DPT A;  2F8H A;  2G0B A;  1ZG7 A;  4E8O A;  4FD4 A;  3U88 C;  5DS0 A;  1X10 A;  1RTQ A;  2AFZ A;  1VGY A;  1Z8X A;  3GB0 A;  2PJ9 A;  1QMU A;  4O23 A;  4H6Z A;  3FMC A;  5F13 A;  2V8G A;  4JD6 A;  3FNC A;  4C9E A;  3SHP A;  4FWU A;  3G23 A;  1Z8L A;  3IGR A;  4OC3 A;  4KOU A;  3I6S A;  2B4J C;  4PK3 A;  3TLC A;  5KTD A;  4NJQ A;  3R9G A;  1Q2D A;  4C9V A;  4MHZ A;  4A32 A;  2PE3 A;  4MMO A;  4NGQ A;  1NSA A;  3D2M A;  2EK9 A;  2QJ8 A;  4ZY1 A;  4C8C A;  4UCN A;  2AFM A;  1XJO A;  5I4M A;  1F57 A;  1S7K A;  4Q38 A;  1ARL A;  1QSO A;  3OAK A;  2PJ8 A;  3I9S A;  3FF3 A;  2B5G A;  2WPX A;  4BPU B;  4CO9 A;  3FED A;  4CDJ A;  2WZN A;  3TLE A;  1YGH A;  1XBU A;  1Z2L A;  2ANP A;  4CYP A;  3NOJ A;  4NSQ A;  4KOW A;  1YME A;  3T0T A;  3NH8 A;  2PJC A;  2PJ4 A;  2CIJ A;  3LWU A;  4CAF A;  1EZB A;  2PCU A;  3FBU A;  4HKF A;  4GXH A;  4X8I A;  2PJ3 A;  3CPA A;  3GY9 A;  4NEX A;  3GUX A;  3D7F A;  2GU2 A;  2O4H A;  4Q7A A;  4UCM A;  2XPO A;  1VI4 A;  5IR2 A;  1OBR A;  3VRQ A;  5JQ4 A;  2B4B A;  4R87 A;  2FSR A;  3PBE A;  5HKY A;  2BO9 A;  2FIA A;  3FB3 A;  1P0H A;  2ZEM A;  4B10 A;  4P4J A;  4IUS A;  2WUU A;  3BJ7 A;  5K8P A;  1JDE A;  2PJA A;  1XIX A;  1S7N A;  2QML A;  1IYL A;  2HQY A;  4EFD A;  2Q7B A;  2QYV A;  4OC5 A;  3S6G A;  1KUX A;  4KOY A;  3SI0 A;  2OR4 A;  2XPN A;  3NFQ A;  4L89 A;  3TO7 A;  2R1I A;  1ZG9 A;  5KTA A;  2X7B A;  4A95 A;  1TF8 A;  2CTB A;  1M4I A;  2DEA A;  3FH4 A;  6CPA A;  4IHM A;  1ZRS A;  4OLL A;  4BIN A;  3BJ8 A;  3V7Z A;  4MFQ A;  4CGM A;  2C6G A;  1CP6 A;  4C8T A;  2VKZ G;  3JVN A;  4E94 A;  3GIU A;  3V8I A;  4JXQ A;  4UFX A;  4DUK A;  2Q43 A;  3VGO A;  1Y7E A;  3S6K A;  2Q4Y A;  2JBK A;  2ZOG A;  1Z8T A;  4NGN A;  3IFE A;  1R43 A;  4UIA A;  3UY5 A;  1XF1 A;  4U9Y A;  2CNT A;  2B4D B;  2Z3L A;  1XF8 A;  4NXY A;  4NGM A;  1H8L A;  3VAT A;  1FNO A;  3WT4 A;  3SJF A;  5EMI A;  4OP4 A;  3TLY A;  2OB0 A;  4JXR A;  1VIX A;  4KLW A;  2HWG A;  2GE3 A;  3PBB A;  5AG7 A;  1YX0 A;  5C82 A;  4UEF A;  1Y9W A;  4PXE A;  3B3W A;  1ZL0 A;  5JVL A;  1KC7 A;  1BPN A;  5F09 A;  3TLG B;  2ZED A;  2PJ7 A;  1TKF A;  3EXN A;  4AVC A;  4P4F A;  2Y1M A;  2C1C A;  3BUW B;  2ZW5 A;  2QEC A;  3TT2 A; 
#chains in the Genus database with same CATH homology
 4PXC A;  2IMO A;  2XEF A;  2HB6 A;  5IB9 A;  5LRG A;  5LYL A;  2ZEO A;  4YWY A;  1TF9 A;  2G9D A;  3IC1 A;  1LCP A;  3KQX A;  3NFZ A;  2PIZ A;  1IY7 A;  4R8F A;  4MRI A;  4JZ0 A;  2ZOF A;  2RFH A;  1ELL P;  4MCR A;  4OC1 A;  4C99 A;  2ZEF A;  3D4U A;  4CPA A;  4MXU A;  3KL9 A;  4OC2 A;  4TNU A;  3KI9 A;  3SJX A;  3DGV A;  4DYO A;  1HDU A;  2PVW A;  3S9L A;  1Z5R A;  3I74 A;  2EK8 A;  4OME A;  3RZA A;  3L2N A;  4YU9 A;  2Q4Z A;  4CDK A;  5LYI A;  1TKH A;  4C85 A;  3FJU A;  4OC0 A;  1CPX A;  1V6C A;  1ZG8 A;  3KQZ A;  1AMP A;  3QNV A;  5K8N A;  5CBM A;  5HVG A;  3PB9 X;  4C8A A;  4UEZ A;  1XRY A;  4WJB A;  3SI2 A;  2PJ2 A;  5LYF A;  4C9U A;  7CPA A;  2PJB A;  4MCP A;  4OID A;  4NGS A;  3WC7 A;  3RAM A;  4RUH A;  4F9U A;  5K8O A;  4C84 A;  3MRU A;  4NGP A;  2CF4 A;  4PXD A;  4EWT A;  2ABZ A;  2VL1 A;  1LFW A;  4LQG A;  3PB4 X;  4ONW A;  3B35 A;  4C86 A;  2PJ5 A;  2XEI A;  3D66 A;  1LAN A;  1EE3 P;  2O53 A;  4TJV A;  3IEH A;  4ZX9 A;  1CBX A;  4DJL A;  2NYQ A;  3CDX A;  3H8F A;  4ZI6 A;  4JYW A;  4KNG E;  2EWB A;  1WVM A;  1CPS A;  4YN3 A;  1YLO A;  2BOA A;  1Q7L A;  1Y0R A;  3B3C A;  3S9N A;  2PIY A;  4A94 A;  1CX8 A;  2CTC A;  4W9Y A;  3D7D A;  1BPM A;  1ELM P;  4P10 A;  1PCA A;  3VTA A;  3HLP A;  4NGT A;  2GLF A;  1GYT A;  3IJ3 A;  3ISX A;  2HC9 A;  5D29 A;  3PEI A;  3VAR A;  4UEE A;  4A39 A;  1TXR A;  2OOT A;  2C5Q A;  3CPX A;  1Y0Y A;  4C9R A;  1FT7 A;  3WC6 A;  5JH9 A;  3LMS A;  1F2O A;  4OIW A;  4R7M A;  5ELY A;  1HDQ A;  3V38 A;  3KAS A;  1HEE A;  2J9A A;  4EME A;  3B3V A;  4UF4 A;  1XFO A;  4BD9 A;  1VHO A;  4NFR A;  4C9A A;  4P4D A;  3RBU A;  2ZEN A;  1UWY A;  2ZEL A;  1JQG A;  4ZX8 A;  2IQ6 A;  1KWM A;  2PJ1 A;  2PJ6 A;  3NH5 A;  1ARM A;  3WAB A;  1XMB A;  1LOK A;  2V8H A;  4PPZ A;  4AXV A;  3WC5 A;  4NGR A;  1AYE A;  3FX6 A;  4ZY0 A;  2NSM A;  3EIF A;  2C6C A;  4F9V A;  1PYT B;  3BXM A;  4F8Z A;  5JGF A;  1ZLI A;  1LAM A;  4MHY A;  3TX8 A;  3KR5 A;  4OKO A;  5HVH A;  3D7G A;  2PVV A;  2WYR A;  4P4I A;  4ZYQ A;  3BI0 A;  8CPA A;  5HVF A;  3CT9 A;  2V8D A;  2GP4 A;  5CPA A;  1IGB A;  3KGQ A;  3GLJ A;  4MHN A;  5LYD A;  4C8P A;  4X3R A;  4TJX A;  1QQ9 A;  2ZEE A;  3K2K A;  2C6P A;  3DLJ A;  4P6Y A;  3BI1 A;  3JRU A;  1VHE A;  1TKJ A;  5HXD A;  3NA6 A;  5D8N A;  4MCQ A;  3B3S A;  3D7H A;  2AFS A;  2ZEP A;  4FAI A;  5LRJ A;  3FEC A;  4IAV A;  4P4E A;  3D68 A;  1Y9Z A;  3D67 A;  5K8M A;  2POK A;  3ISZ A;  4KSI A;  2AFO A;  2QVP A;  4OC4 A;  3B7I A;  3SI1 A;  3K9T A;  2AFW A;  3KHZ A;  3PB8 X;  2XEG A;  2IJZ A;  3ICU A;  3PB7 X;  4R6T A;  1YW4 A;  2Q51 A;  3KHX A;  4ZY2 A;  2FVG A;  4P45 A;  3FVL A;  4G1P A;  3H8G A;  4UIB A;  3B2Y A;  3KR4 A;  4PQA A;  2PRQ A;  4PXB A;  3T8W A;  2F7V A;  1F2P A;  3KZW A;  4P4B A;  2JBJ A;  3SJG A;  3NH4 A;  1YW6 A;  1CG2 A;  1DE4 C;  4Z65 A;  4A37 A;  2GRE A;  3I1U A;  2V77 A;  3H8E A;  3SJE A;  4R76 A;  3IIB A;  4NJR A;  3PFO A;  4B6Z A;  3BHX A;  3B3T A;  3VH9 A;  2ZEH A;  3N5F A;  2XEJ A;  4WWV A;  4A38 A;  1M4L A;  3PRT A;  3S9M A;  1LAP A;  2AFU A;  4H2K A;  3IO1 A;  4GM5 A;  1CP7 A;  3MN8 A;  3FEE A;  4C8F A;  2BCO A;  1YSJ A;  4FBE A;  3PB6 X;  1ZLH A;  1BLL E;  3HUV A;  5LRK A;  4MCS A;  2I3C A;  4X2T A;  3PFE A;  4P44 A;  4IK2 A;  4FUU A;  4MHP A;  4K3N A;  1DTD A;  2AFX A;  2GLJ A;  2V8V A;  2JEW A;  2ZEG A;  2PJ0 A;  5JM6 A;  5J1Q A;  4C8U A;  4TWE A;  1R3N A;  2RB7 A;  3IWW A;  1BAV A;  2F8H A;  1ZG7 A;  5DS0 A;  2AFZ A;  1RTQ A;  1VGY A;  3GB0 A;  2PJ9 A;  1QMU A;  4O23 A;  3FMC A;  2V8G A;  4C9E A;  4FWU A;  1Z8L A;  4OC3 A;  3I6S A;  4NJQ A;  4C9V A;  4MHZ A;  2PE3 A;  4MMO A;  4NGQ A;  1NSA A;  4C8C A;  2EK9 A;  2QJ8 A;  4ZY1 A;  2AFM A;  1XJO A;  5I4M A;  1F57 A;  5THW A;  1ARL A;  2PJ8 A;  3FF3 A;  3FED A;  4CDJ A;  2WZN A;  1XBU A;  1Z2L A;  2ANP A;  1YME A;  3NH8 A;  2PJC A;  2PJ4 A;  2CIJ A;  3LWU A;  2PCU A;  4X8I A;  2PJ3 A;  3CPA A;  3GUX A;  3D7F A;  2GU2 A;  2O4H A;  4Q7A A;  5IR2 A;  1OBR A;  3PBE A;  2BO9 A;  2ZEM A;  4P4J A;  5K8P A;  2PJA A;  4EFD A;  2QYV A;  4OC5 A;  3SI0 A;  2OR4 A;  1ZG9 A;  1TF8 A;  2CTB A;  2DEA A;  3FH4 A;  6CPA A;  4IHM A;  3V7Z A;  2C6G A;  1CP6 A;  4C8T A;  4DUK A;  2Q43 A;  1Y7E A;  2JBK A;  2ZOG A;  3IFE A;  4NGN A;  4UIA A;  1R43 A;  1XF1 A;  3VAT A;  3WT4 A;  4NGM A;  1H8L A;  1FNO A;  3SJF A;  4OP4 A;  1VIX A;  3PBB A;  4UEF A;  4PXE A;  3B3W A;  1BPN A;  5F09 A;  2ZED A;  2PJ7 A;  1TKF A;  4P4F A;  2C1C A;  3TC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...