3RBUA

N-terminally avitev-tagged human glutamate carboxypeptidase ii in complex with 2-pmpa
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Efficient and versatile one-step affinity purification of in vivo biotinylated proteins: Expression, characterization and structure analysis of recombinant human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2011-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3rbuA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3rbuA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3rbuA02
3PB9X 1TF9A 1Y7EA 4P6YA 5K8PA 1H8LA 4ZY2A 5LYIA 2V77A 4GM5A 2O4HA 5K8MA 4H2KA 4MCRA 3PBBA 4A37A 4A94A 1Y0RA 4A39A 3SJEA 4C84A 2XEGA 3CPAA 3KR4A 1XFOA 3NFZA 1AYEA 3PBEA 4FUUA 4OKOA 3GLJA 3V7ZA 2V8HA 4OC0A 4NJQA 4IAVA 4ZY1A 2ZEMA 3VARA 2VL1A 3S9NA 3IO1A 4UIBA 4MXUA 5HVGA 3PB7X 4TJXA 2BO9A 3HLPA 2PE3A 3WC6A 2PVWA 1FNOA 5D8NA 4MHYA 5LYLA 4C9EA 4WJBA 4MCQA 1IGBA 2Q4ZA 2EWBA 1Q7LA 3GUXA 3KI9A 3B3SA 3JRUA 4C9VA 3RBUA 2CIJA 2I3CA 3SJGA 4CDJA 1IY7A 3TC8A 4ZX9A 2AFZA 4G1PA 4DUKA 4YWYA 4CPAA 1VHOA 4BD9A 1V6CA 2HB6A 3D68A 1ARLA 1PCAA 3K2KA 2PJAA 4C8PA 4NGNA 1CX8A 3SJFA 2C6PA 5CPAA 1F2PA 4YN3A 2PJ6A 3PB6X 3FF3A 2AFSA 5DS0A 4UEFA 4X8IA 1AMPA 5LRGA 4DJLA 4X3RA 3FH4A 2F7VA 3D66A 3KL9A 3BXMA 2ZOFA 2PJ5A 4MHNA 4C9RA 3KQXA 3B35A 2PJ2A 1Z8LA 1LAPA 2NYQA 4P44A 5HXDA 4KSIA 3ISXA 2OOTA 4UEZA 4C86A 4IHMA 3LWUA 2PJ0A 4YU9A 1VGYA 4TNUA 2PJ3A 3I1UA 3IEHA 3B3CA 3VH9A 4PXBA 4JYWA 1YW4A 4P4IA 1HDQA 2GLJA 3RAMA 5CBMA 2PJ8A 2PJ7A 4P10A 1ZLIA 3SI2A 3PFEA 2PJCA 1TKHA 3KGQA 3TX8A 2JBJA 4NGMA 2GU2A 3B3VA 5I4MA 2ZENA 3DLJA 4C8UA 4C8AA 4P4EA 2RB7A 5HVFA 1EE3P 1FT7A 2CF4A 4NJRA 5JM6A 3IWWA 4ZX8A 4C99A 2CTBA 1Y9ZA 2PJ4A 1YW6A 5K8OA 5HVHA 3EIFA 5LYDA 3IC1A 3GB0A 3IIBA 3RZAA 1RTQA 1ZLHA 4W9YA 4C8FA 3B3TA 3D7FA 2XEFA 1KWMA 3D4UA 3QNVA 4Q7AA 3K9TA 2ZEHA 4OMEA 4B6ZA 1CP6A 3H8GA 1YSJA 2JBKA 1GYTA 2OR4A 4DYOA 2G9DA 1CP7A 3H8EA 4JZ0A 5ELYA 5F09A 4PPZA 4NFRA 1OBRA 1TF8A 2EK9A 4Z65A 5LRJA 8CPAA 4F9VA 3D67A 1LOKA 3SJXA 2QYVA 2ZEGA 1LFWA 5LRKA 4FBEA 1BAVA 1M4LA 3V38A 4R8FA 4FWUA 4R6TA 3BHXA 4TWEA 1QQ9A 4C85A 2V8GA 4ONWA 3S9MA 5IB9A 4F8ZA 3MRUA 2WYRA 3D7GA 5LYFA 2XEIA 2POKA 4P4JA 1HDUA 4ZY0A 4LQGA 1F57A 3PB4X 3N5FA 4EWTA 3B3WA 4P4FA 3NH5A 5JGFA 4C8TA 4EFDA 4C9UA 2AFWA 4R76A 1ELMP 3CDXA 4IK2A 3B2YA 1XMBA 2PJ1A 3KQZA 1CBXA 3CT9A 2QJ8A 5THWA 3MN8A 3D7DA 4MCPA 4PXEA 3SI0A 2PVVA 2ZEEA 3VATA 3VTAA 3FJUA 4UEEA 3CPXA 2NSMA 1XRYA 3WT4A 1Z2LA 3KHXA 3SI1A 3WC7A 4MRIA 1PYTB 3KR5A 4OIWA 2HC9A 4MCSA 4NGSA 4CDKA 2GREA 2PIYA 2ZOGA 2AFUA 3NA6A 4F9UA 4OC3A 2DEAA 4PQAA 1DE4C 1VIXA 2O53A 2WZNA 2AFMA 1QMUA 1HEEA 2BCOA 3KHZA 2IMOA 1TKJA 2PRQA 3LMSA 3S9LA 4OC5A 1CPXA 3BI1A 2XEJA 4KNGE 2J9AA 2C6CA 4P45A 4AXVA 2PCUA 2QVPA 1DTDA 2Q51A 3FX6A 3WC5A 4ZYQA 4PXCA 3D7HA 4OC4A 1F2OA 3NH8A 1LAMA 1R3NA 4RUHA 5K8NA 3IFEA 3FECA 1XF1A 3PRTA 2ZELA 3WABA 2AFOA 2BOAA 1YMEA 4EMEA 4C8CA 1VHEA 2JEWA 2PJBA 1TKFA 2RFHA 2Q43A 3ICUA 1ZG9A 3IJ3A 4R7MA 1LANA 4PXDA 3I74A 3PFOA 2PJ9A 2GLFA 4NGRA 5D29A 4OIDA 4P4DA 3FMCA 1ZG7A 3B7IA 4X2TA 1YLOA 4MHZA 4NGTA 3FEDA 1UWYA 1ELLP 2V8DA 2CTCA 3FVLA 5J1QA 3FEEA 4MMOA 1NSAA 3KZWA 3L2NA 2IQ6A 2ZEDA 3H8FA 2ABZA 4A38A 1BPMA 2PIZA 3BI0A 2V8VA 2C6GA 4UF4A 2IJZA 3PB8X 4NGPA 2EK8A 2ZEPA 4MHPA 4OC1A 4OC2A 4WWVA 1TXRA 3DGVA 4NGQA 2ANPA 1BLLE 1Z5RA 1CPSA 1XJOA 3NH4A 1BPNA 1Y0YA 4FAIA 4OP4A 4P4BA 1JQGA 1XBUA 3I6SA 5JH9A 3ISZA 3PEIA 2FVGA 2AFXA 4O23A 2ZEOA 4UIAA 4C9AA 2F8HA 3T8WA 1LCPA 3HUVA 4TJVA 2C1CA 1R43A 7CPAA 6CPAA 1CG2A 2ZEFA 1ZG8A 1ARMA 1WVMA 4ZI6A 4K3NA 3KASA
chains in the Genus database with same CATH superfamily
1OZPA 3PB9X 3R9EA 1TF9A 1Y7EA 4P6YA 1RXTA 1YX0A 4CAFA 1H8LA 4ZY2A 5K8PA 5LYIA 2MP0A 3TLBA 2V77A 1KUXA 1S3ZA 1NE9A 1ZYMA 4HNXB 5A27A 2GP4A 4GM5A 2XPLA 2O4HA 4M85A 5K8MA 1CE8B 4H2KA 4MCRA 3PBBA 4A37A 4A94A 3OAKA 1NSLA 2N3AB 1Y0RA 4A39A 3R9GA 4CAXA 2P6FA 2FS5A 4CDKA 3SJEA 4C84A 2XEGA 5J3XA 3CPAA 3EY5A 4XPDB 5G20A 3F0AA 1C3OB 3KR4A 1UFHA 1XFOA 3DDDA 3NFZA 1BOBA 2BEIA 1AYEA 1XEBA 3CXPA 2VZZA 3PBEA 4FUUA 4E0AA 4UFXA 4OKOA 3GLJA 2EZCA 2D4PA 4BBHA 2XPPA 3VGOA 3V7ZA 2V8HA 1EZAA 3R95A 4OC0A 4LUAA 4NJQA 2VKZG 4IAVA 4ZY1A 5F49A 2ZEMA 2EUIA 3VWEA 3VARA 3W6XA 2ZPAA 2VL1A 2YJTA 3S9NA 2J8RA 3IO1A 4UIBA 3BUXB 1KZFA 4MXUA 3A9LA 5HVGA 1Q5XA 3PB7X 4TJXA 3VROA 4IUSA 2BO9A 4M6HA 3HLPA 2PE3A 2REFA 4FD7A 3DNSA 4UWIA 2Q7BA 3WC6A 2E28A 4B5OA 2PVWA 1FNOA 4B5PA 5D8NA 2J8MA 4NCZA 4MHYA 2ODFA 4OLLA 4AVAA 4MFPA 5LYLA 1BO4A 4WJBA 4C9EA 4MCQA 1IGBA 3TLGA 2Q4ZA 2EWBA 1Q7LA 3GUXA 2OB0A 3BLNA 3KI9A 4NXYA 2YJVA 3OP0A 3B3SA 3JRUA 4C9VA 3RBUA 5EMIA 2X0SA 4H6UA 2G3AA 4RS2A 2BL1A 1XIXA 1R61A 2CIJA 2I3CA 3SJGA 4CDJA 1IY7A 3TC8A 1ZO0A 4ZX9A 5JPHA 3T05A 1I21A 2AFZA 3PGPA 4G1PA 4DUKA 5G22A 1QSRA 4YWYA 4CGNA 4CPAA 1VHOA 4BD9A 1V6CA 2HB6A 3D68A 4UBRA 1ARLA 4ZBGA 4RN7A 4KSAA 1PCAA 1YVKA 3K2KA 1Z9UA 2WPXA 2PJAA 4Q38A 2FIWA 2QMLA 3F5BA 4C8PA 4NGNA 4KOXA 2B4JC 1CX8A 4XPLA 3SJFA 4BPXB 1Z9EA 2C6PA 4ORFA 5CPAA 2C5QA 1F2PA 2JEVA 4B13A 4YN3A 3NE7A 4MFZA 2PJ6A 3TO6A 3PB6X 3C26A 3JVNA 2FE7A 1ON0A 3IGRA 4CRYB 4A95A 3ZJ0A 3FF3A 2EBJA 2AFSA 3H4QA 4HKFA 5AGEA 5DS0A 4UEFA 4X8IA 1AMPA 5LRGA 1KUYA 4X3RA 2Z3OA 3FH4A 4GS4A 4DJLA 2F7VA 5DWMA 2PCNA 4ZGYB 2AE6A 1X12A 2Z11A 3GY9A 4JWPA 3TFYA 4A31A 3D66A 3ZZIA 2HI6A 3BXMA 2ZOFA 3KL9A 2PJ5A 4MHNA 4C9RA 2B4BA 2PSWA 3FBUA 2EVNA 3KQXA 3B35A 2AUMA 3TLYA 2PJ2A 1Z8LA 2YGWA 3EZAA 1LAPA 2NYQA 3WR7A 3KRVA 4P44A 5HXDA 2G0BA 4KSIA 3ISXA 2OOTA 4UEZA 1L0CA 1Q2CA 4BMHA 3FIXA 2Q0YA 4IHMA 4C86A 2PRBA 3LWUA 1SQHA 4R3LA 2R1IA 2HWGA 2PJ0A 5G1ZA 4CO9A 4YU9A 2GIVA 2B4DA 3GJZA 1VGYA 4JJXA 4TNUA 3RYOA 3NE8A 2WSAA 2ZW6A 2PJ3A 3I1UA 3IEHA 3IWGA 3T90A 5HKYA 3U1BA 4PK3A 2B5GA 2VBQA 3B3CA 1YR0A 4CYNA 1U6MA 3VH9A 1Z8XA 4PXBA 5CNPA 5HKZA 1MJBA 4KZTA 4AVCA 4QC6A 4JYWA 1YW4A 4AG9A 4GPLB 4LX9A 4P4IA 1HDQA 1EO0A 2GLJA 3RAMA 3CZXA 5CBMA 5KTCA 3H5ZA 2PJ8A 4BTFA 2PJ7A 4NEXA 4P10A 1ZLIA 2RC4A 2KCWA 3SI2A 3PFEA 4JLYA 4CGMA 2PJCA 3TT2A 1TKHA 3KGQA 4KOUA 2EZAA 1WK4A 3TX8A 3TLAA 3TLCA 2DF5A 2JBJA 4NGMA 2GU2A 3B3VA 3OB1B 2P6GA 2WPWA 3W91A 4COGA 4M3SA 1CS0B 5I4MA 4IIYA 2ZENA 2B3UA 1QSMA 1EZBA 3DLJA 3G3SA 2CNMA 4C8UA 4C8AA 3T0TA 3F8KA 2IL4A 3D3SA 1YK3A 4KUAA 4P4EA 1KUVA 2ZW4A 4PSXA 4E94A 2RB7A 5ISVA 1QSNA 5HVFA 1EE3P 1BXRB 1QSOA 2FCKA 3BUOB 4CAVA 2JDCA 1FT7A 2CF4A 2GE3A 4KVME 4NJRA 5JM6A 3IWWA 2UV8G 4ZX8A 4MFKA 1P4NA 1S60A 4C99A 1YLEA 1KC7A 1YVHA 2CTBA 1Y9ZA 2PJ4A 1YW6A 4CYOA 5K8OA 3PT1A 1VBGA 3VWDA 2Z0ZA 2O28A 5HVHA 3EIFA 4QUSA 3VRPA 5LYDA 4CS0B 3IC1A 2ZXVA 3TO7A 4A2ZA 4H1HA 3GB0A 1Z4RA 3IIBA 3O8ZA 3MGDA 3RZAA 1RTQA 1ZLHA 2R98A 4W9YA 2PR8A 3BUNB 3B3TA 3TO9A 4C8FA 4DNCA 3D7FA 2XEFA 2P0WA 5DWNA 3T07A 1KWMA 4L89A 3D4UA 3QNVA 4Q7AA 3K9TA 4C7IA 2D0PA 2ZEHA 4OMEA 3JUWA 1CP6A 3H8GA 4B6ZA 4E8OA 1T36B 1CM0A 4INJA 1YSJA 2JBKA 1GYTA 1MJ9A 1S7LA 2YNEA 5EC4A 4MFQA 4KOYA 1K4JA 2OR4A 4DYOA 2G9DA 3V8IA 1CP7A 3H8EA 2REEA 4JZ0A 5ELYA 4KLWA 5F09A 4PPZA 4AVBA 4NFRA 1M4DA 1OBRA 1TF8A 2PR1A 2EK9A 4KVXA 5LRJA 4Z65A 8CPAA 4F9VA 3BJ7A 3D67A 1LOKA 3P2FA 3SJXA 3B8GA 4PK2A 2QYVA 4XPKA 2ZEGA 1LFWA 2YNCA 5IX3A 4FBEA 5LRKA 3G23A 3HMJG 1BAVA 1IYKA 1M4LA 4YRHA 2Y1NA 1Z8WA 4F0YA 4OAEA 4MHDA 3V38A 4R8FA 4XNHC 3TCVA 2FXFA 4FWUA 4M6GA 4A30A 4R6TA 3BHXA 3K9UA 2ZW5A 1Z8TA 1Y7RA 2YNDA 4TWEA 4QB9A 4C2ZA 1QQ9A 2VEZA 4C85A 4Y49C 4CYPA 2V8GA 2Z3PA 4ONWA 5AG5A 2B0AA 2Z3NA 5J8FA 3S9MA 3S6GA 5IB9A 4RR2B 2XPNA 3R1KA 4KLVA 4AB7A 3MRUA 4F8ZA 2WYRA 4Q36A 3D7GA 3VRQA 5A28A 1KEEB 3OWCA 2Q4YA 5LYFA 5AXIA 4NSQA 2XEIA 2POKA 4QVTA 3RO0A 1B6BA 3SHPA 4P4JA 2FL4A 1HDUA 4ZY0A 3TTHA 4LQGA 1F57A 2G3TA 3BUWB 2DXQA 3PB4X 2Q7SA 3N5FA 4EWTA 1M4GA 3B3WA 4P4FA 5JYBA 1IYLA 3N7ZA 3UY5A 1YQEA 3NH5A 5FD8A 4NF1A 5JGFA 2FT0A 2DLAA 3EXNA 4M8DA 4C8TA 4JD6A 4ONUA 4EFDA 1M6VB 4A4CA 1VI4A 4MI4A 4C9UA 4MI1A 1I12A 2AFWA 2GANA 1KBLA 4R76A 5J8CA 3PP9A 2CY2A 4UFVA 3QAHA 1ELMP 3CDXA 3IWEA 4IK2A 1Y9WA 1Q2YA 3B2YA 1XMBA 2PJ1A 3KQZA 3DSBA 4KUBA 5C82A 4B11A 4EYSA 2EZBA 1CBXA 3E0KA 4KS9A 3CT9A 1AUGA 2QJ8A 2VQYA 4YGOA 5THWA 3MN8A 3D7DA 4MCPA 4PXEA 1CJWA 5EBVA 3GKRA 2WUUA 1IB1E 3SI0A 2PVVA 2ZEEA 1J4JA 3TOBA 1V0CA 3S6HA 4HPSA 3VATA 3VTAA 3IU1A 4CZ1A 1B87A 2OU2A 3JTKA 4MFJA 2I79A 3FB3A 3FJUA 5C88A 4UEEA 3CPXA 2NSMA 3EZEA 4A4BA 1XRYA 3C8OA 1JWQA 4E2AA 5AG4A 2BSWA 5KTAA 3BUMB 5K99A 3EFAA 1Z2LA 2EO8A 3KHXA 4MJ8A 3SI1A 3WC7A 3WT4A 4BPWB 4MRIA 1PYTB 2J8NA 1QSTA 4C68A 2Y0MA 3EO4A 3KR5A 3KKWA 3TYXA 1PUAA 1WWZA 2PC1A 4CGLA 4FD5A 4KOSA 4OIWA 5H84A 4R87A 2HC9A 2R82A 4MCSA 1IOFA 1FY7A 4NGSA 2DPSA 2JLMA 3GIUA 1P0HA 2GREA 4PSWA 5HH1A 4B5PB 1X10A 1MJAA 4COBA 1JDEA 2AJ6A 2PIYA 4MJXA 4Y49B 2ZOGA 3FXTA 3TLZA 2AFUA 1XOVA 2HQYA 2VI7A 3NA6A 4UCPA 4F9UA 3NFQA 4OC3A 2DEAA 3TLGB 1VKCA 4PQAA 5IB0A 5I0CA 3P2HA 1DE4C 1VIXA 2O53A 3LACA 3BJ8A 2K5TA 2WZNA 4IF5A 2AFMA 4GXHA 1QMUA 2BUEA 2OZHA 2HROA 1HEEA 1NXJA 3PLFB 2BCOA 3CXSA 3FNCA 3KHZA 2IMOA 5F47A 3TE4A 1TKJA 5F9MA 2PRQA 3HPGG 3LMSA 5KTDA 1DIKA 3S9LA 1WVMA 5F1YA 4OC5A 1CPXA 4K30A 3BI1A 2QECA 4FD4A 2XEJA 2R7HA 3EZBA 2R8VA 4KNGE 4FD6A 1XMTA 2J9AA 4U5YA 4JVOA 2C6CA 4P45A 1GHEA 4AXVA 2PCUA 2QVPA 1DTDA 2Q51A 3FX6A 2HV2A 3WC5A 4F0XA 4E5SA 3TOAA 1LRZA 2CXAA 4PXCA 3D7HA 4OC4A 1M4IA 1Z4EA 4MY3A 4ZYQA 5H86A 5F46A 1VBHA 3TLEA 4JXRA 1F2OA 2QIRA 3SR3A 3HPHE 3F9KC 2VXKA 3NH8A 1LAMA 1JDBC 4QBJA 1IIDA 5IR2A 2Q04A 3D8PA 3DR8A 1R3NA 2CNTA 4UA3A 4RUHA 2A4NA 1IU8A 3IFEA 5K8NA 1M1DA 3FECA 2XPOA 2H5MA 5F13A 1YVOA 1XF1A 1N71A 3PRTA 5JVLA 2PQ8A 2P6EA 2ZELA 1B47A 4HNWB 3WABA 4I49A 2AFOA 3CXQA 1A2ZA 2BOAA 2OZUA 2F5IA 3G8WA 2DIKA 1YMEA 1XE4A 4H89A 4KOVA 4EMEA 1Q2DA 1ZL0A 1VHEA 4C2YA 4C8CA 4J0NA 2ARHA 3FYNA 2JEWA 2OH1A 4M6IA 4C2XA 3D2PA 2PJBA 1TKFA 2FM4A 2RFHA 2OLSA 2Q43A 4JXQA 2Z10A 3FRMA 1M44A 3IU2A 3ICUA 1J3LA 2B4DB 1ZG9A 3IJ3A 2Z3KA 4R7MA 5FVJA 2I00A 3SXOA 1LANA 4PXDA 1S7FA 3PFOA 3I74A 2Q4VA 3DR6A 3K4IA 2B5GB 2PJ9A 1MK4A 3PZJA 5G21A 4EVYA 1WJTA 2GLFA 4NGRA 1XF8A 1Y9KA 4UFWA 3T9YA 3LODA 4L8AA 5D29A 2B58A 4OIDA 3ZNIA 2C27A 4AG7A 4P4DA 3FMCA 3R9FA 1ZG7A 3B7IA 3U88C 4KVOE 3RNZA 4CAEA 4X2TA 1S5KA 1YLOA 4MHZA 4NGTA 4CGPA 3T5MA 2FSRA 3VRNA 5E96A 1FBVA 3FEDA 1UWYA 1ELLP 2NMTA 2V8DA 2AUNA 2CTCA 4CGOA 5HKWA 3FVLA 2PDOA 1VHSA 2YNCC 5J1QA 4RI1A 4UCMA 5AG6A 3FEEA 4MMOA 1TIQA 4CAWA 4BINA 1YREA 4R57A 2CNSA 4XPDC 4X5KA 4B14A 5F48A 3R96A 1NSAA 3KZWA 3L2NA 2VZYA 2X7BA 2IQ6A 4KOTA 2D4OA 2Z3MA 2ZEDA 3H8FA 4KORA 4R3KA 1ZRSA 3QAYA 2ABZA 4HNYB 1I1DA 1IOIA 3I3GA 1BPMA 4A38A 5JH9A 2PIZA 2D0OA 5BY0A 3BI0A 2V8VA 2C6GA 4UF4A 4YFJA 2IJZA 3PB8X 3W6SA 4A33A 4C7HA 2DPTA 2ATRA 4KSFA 4A32A 2ZW7A 1PU9A 4NGPA 2EK8A 2ZEPA 4MHPA 3SXNA 1GGOA 4OC1A 1A9XB 4OC2A 1S7NA 2Q44A 2Y1MA 5GCNA 4WWVA 1TXRA 3VRRA 1C30B 3DGVA 1YGHA 3I9SA 4NGQA 4OADA 2FIAA 2ANPA 4B12A 1IICA 5AG7A 1BLLE 5HMNA 1Z5RA 1R57A 2GFQA 1CPSA 1RO5A 2JDDA 5IV0A 1XJOA 3LD2A 3NH4A 1BPNA 1Y0YA 4KOWA 4FAIA 4U9ZA 1NMTA 4OP4A 4P4BA 1JQGA 1XBUA 3I6SA 4XNHB 3PFVA 3D2MA 4H6ZA 4PV6A 4UWJA 3EC4A 4CYQA 4CRZB 3ISZA 3PEIA 5BWAB 2FVGA 4U9YA 2AFXA 2CBLA 4LQ6A 4O23A 5JQ4A 2Z3LA 1S7KA 3S6FA 4F6AA 2ZEOA 4UIAA 4MFLA 4BPUB 2F8HA 3T8WA 1LCPA 4R9MA 3QB8A 4C9AA 3OB2B 2B3VA 3HUVA 3GYAA 4MBUA 4TJVA 2C1CA 3NOJA 1R43A 7CPAA 2OZGA 1CG2A 2ZEFA 4J3GA 6CPAA 4UCNA 4MY0A 2HUZA 4II9A 5F5XA 4IIXA 1ZG8A 1ARMA 3S6KA 4B10A 1NBWA 4ZI6A 4K3NA 3KASA
chains in the Genus database with same CATH topology
3PB9X 1TF9A 1Y7EA 4P6YA 5K8PA 1H8LA 4ZY2A 5LYIA 2V77A 2GP4A 4GM5A 2O4HA 5K8MA 4H2KA 4MCRA 3PBBA 4A37A 4A94A 1Y0RA 4A39A 3SJEA 4C84A 2XEGA 3CPAA 3KR4A 1XFOA 3NFZA 1AYEA 3PBEA 4FUUA 4OKOA 3GLJA 3V7ZA 2V8HA 4OC0A 4NJQA 4IAVA 4ZY1A 2ZEMA 3VARA 2VL1A 3S9NA 3IO1A 4UIBA 4MXUA 5HVGA 3PB7X 4TJXA 2BO9A 3HLPA 2PE3A 3WC6A 2PVWA 1FNOA 5D8NA 4MHYA 5LYLA 4C9EA 4WJBA 4MCQA 1IGBA 2Q4ZA 2EWBA 1Q7LA 3GUXA 3KI9A 3B3SA 3JRUA 4C9VA 3RBUA 2CIJA 2I3CA 3SJGA 4CDJA 1IY7A 3TC8A 4ZX9A 2AFZA 4G1PA 4DUKA 4YWYA 4CPAA 1VHOA 4BD9A 1V6CA 2HB6A 3D68A 1ARLA 1PCAA 3K2KA 2PJAA 4C8PA 4NGNA 1CX8A 3SJFA 2C6PA 5CPAA 2C5QA 1F2PA 4YN3A 2PJ6A 3PB6X 3FF3A 2AFSA 5DS0A 4UEFA 4X8IA 1AMPA 5LRGA 4DJLA 4X3RA 3FH4A 2F7VA 3D66A 3KL9A 3BXMA 2ZOFA 2PJ5A 4MHNA 4C9RA 3KQXA 3B35A 2PJ2A 1Z8LA 1LAPA 2NYQA 4P44A 5HXDA 4KSIA 3ISXA 2OOTA 4UEZA 4C86A 4IHMA 3LWUA 2PJ0A 4YU9A 1VGYA 4TNUA 2PJ3A 3I1UA 3IEHA 3B3CA 3VH9A 4PXBA 4JYWA 1YW4A 4P4IA 1HDQA 2GLJA 3RAMA 5CBMA 2PJ8A 2PJ7A 4P10A 1ZLIA 3SI2A 3PFEA 2PJCA 1TKHA 3KGQA 3TX8A 2JBJA 4NGMA 2GU2A 3B3VA 5I4MA 2ZENA 3DLJA 4C8UA 4C8AA 4P4EA 2RB7A 5HVFA 1EE3P 1FT7A 2CF4A 4NJRA 5JM6A 3IWWA 4ZX8A 4C99A 2CTBA 1Y9ZA 2PJ4A 1YW6A 5K8OA 5HVHA 3EIFA 5LYDA 3IC1A 3GB0A 3IIBA 3RZAA 1RTQA 1ZLHA 4W9YA 4C8FA 3B3TA 3D7FA 2XEFA 1KWMA 3D4UA 3QNVA 4Q7AA 3K9TA 2ZEHA 4OMEA 4B6ZA 1CP6A 3H8GA 1YSJA 2JBKA 1GYTA 2OR4A 4DYOA 2G9DA 1CP7A 3H8EA 4JZ0A 5ELYA 5F09A 4PPZA 4NFRA 1OBRA 1TF8A 2EK9A 4Z65A 5LRJA 8CPAA 4F9VA 3D67A 1LOKA 3SJXA 2QYVA 2ZEGA 1LFWA 5LRKA 4FBEA 1BAVA 1M4LA 3V38A 4R8FA 4FWUA 4R6TA 3BHXA 4TWEA 1QQ9A 4C85A 2V8GA 4ONWA 3S9MA 5IB9A 4F8ZA 3MRUA 2WYRA 3D7GA 5LYFA 2XEIA 2POKA 4P4JA 1HDUA 4ZY0A 4LQGA 1F57A 3PB4X 3N5FA 4EWTA 3B3WA 4P4FA 3NH5A 5JGFA 4C8TA 4EFDA 4C9UA 2AFWA 4R76A 1ELMP 3CDXA 4IK2A 3B2YA 1XMBA 2PJ1A 3KQZA 1CBXA 3CT9A 2QJ8A 5THWA 3MN8A 3D7DA 4MCPA 4PXEA 3SI0A 2PVVA 2ZEEA 3VATA 3VTAA 3FJUA 4UEEA 3CPXA 2NSMA 1XRYA 3WT4A 1Z2LA 3KHXA 3SI1A 3WC7A 4MRIA 1PYTB 3KR5A 4OIWA 2HC9A 4MCSA 4NGSA 4CDKA 2GREA 2PIYA 2ZOGA 2AFUA 3NA6A 4F9UA 4OC3A 2DEAA 4PQAA 1DE4C 1VIXA 2O53A 2WZNA 2AFMA 1QMUA 1HEEA 2BCOA 3KHZA 2IMOA 1TKJA 2PRQA 3LMSA 3S9LA 4OC5A 1CPXA 3BI1A 2XEJA 4KNGE 2J9AA 2C6CA 4P45A 4AXVA 2PCUA 2QVPA 1DTDA 2Q51A 3FX6A 3WC5A 4ZYQA 4PXCA 3D7HA 4OC4A 1F2OA 3NH8A 1LAMA 5IR2A 1R3NA 4RUHA 5K8NA 3IFEA 3FECA 1XF1A 3PRTA 2ZELA 3WABA 2AFOA 2BOAA 1YMEA 4EMEA 4C8CA 1VHEA 2JEWA 2PJBA 1TKFA 2RFHA 2Q43A 3ICUA 1ZG9A 3IJ3A 4R7MA 1LANA 4PXDA 3I74A 3PFOA 2PJ9A 2GLFA 4NGRA 5D29A 4OIDA 4P4DA 3FMCA 1ZG7A 3B7IA 4X2TA 1YLOA 4MHZA 4NGTA 3FEDA 1UWYA 1ELLP 2V8DA 2CTCA 3FVLA 5J1QA 3FEEA 4MMOA 1NSAA 3KZWA 3L2NA 2IQ6A 2ZEDA 3H8FA 2ABZA 4A38A 1BPMA 2PIZA 3BI0A 2V8VA 2C6GA 4UF4A 2IJZA 3PB8X 4NGPA 2EK8A 2ZEPA 4MHPA 4OC1A 4OC2A 4WWVA 1TXRA 3DGVA 4NGQA 2ANPA 1BLLE 1Z5RA 1CPSA 1XJOA 3NH4A 1BPNA 1Y0YA 4FAIA 4OP4A 4P4BA 1JQGA 1XBUA 3I6SA 5JH9A 3ISZA 3PEIA 2FVGA 2AFXA 4O23A 2ZEOA 4UIAA 4C9AA 2F8HA 3T8WA 1LCPA 3HUVA 4TJVA 2C1CA 1R43A 7CPAA 6CPAA 1CG2A 2ZEFA 1ZG8A 1ARMA 1WVMA 4ZI6A 4K3NA 3KASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PB9 X;  1TF9 A;  1Y7E A;  4P6Y A;  5K8P A;  1H8L A;  4ZY2 A;  5LYI A;  2V77 A;  4GM5 A;  2O4H A;  5K8M A;  4H2K A;  4MCR A;  3PBB A;  4A37 A;  4A94 A;  1Y0R A;  4A39 A;  3SJE A;  4C84 A;  2XEG A;  3CPA A;  3KR4 A;  1XFO A;  3NFZ A;  1AYE A;  3PBE A;  4FUU A;  4OKO A;  3GLJ A;  3V7Z A;  2V8H A;  4OC0 A;  4NJQ A;  4IAV A;  4ZY1 A;  2ZEM A;  3VAR A;  2VL1 A;  3S9N A;  3IO1 A;  4UIB A;  4MXU A;  5HVG A;  3PB7 X;  4TJX A;  2BO9 A;  3HLP A;  2PE3 A;  3WC6 A;  2PVW A;  1FNO A;  5D8N A;  4MHY A;  5LYL A;  4C9E A;  4WJB A;  4MCQ A;  1IGB A;  2Q4Z A;  2EWB A;  1Q7L A;  3GUX A;  3KI9 A;  3B3S A;  3JRU A;  4C9V A;  3RBU A;  2CIJ A;  2I3C A;  3SJG A;  4CDJ A;  1IY7 A;  3TC8 A;  4ZX9 A;  2AFZ A;  4G1P A;  4DUK A;  4YWY A;  4CPA A;  1VHO A;  4BD9 A;  1V6C A;  2HB6 A;  3D68 A;  1ARL A;  1PCA A;  3K2K A;  2PJA A;  4C8P A;  4NGN A;  1CX8 A;  3SJF A;  2C6P A;  5CPA A;  1F2P A;  4YN3 A;  2PJ6 A;  3PB6 X;  3FF3 A;  2AFS A;  5DS0 A;  4UEF A;  4X8I A;  1AMP A;  5LRG A;  4DJL A;  4X3R A;  3FH4 A;  2F7V A;  3D66 A;  3KL9 A;  3BXM A;  2ZOF A;  2PJ5 A;  4MHN A;  4C9R A;  3KQX A;  3B35 A;  2PJ2 A;  1Z8L A;  1LAP A;  2NYQ A;  4P44 A;  5HXD A;  4KSI A;  3ISX A;  2OOT A;  4UEZ A;  4C86 A;  4IHM A;  3LWU A;  2PJ0 A;  4YU9 A;  1VGY A;  4TNU A;  2PJ3 A;  3I1U A;  3IEH A;  3B3C A;  3VH9 A;  4PXB A;  4JYW A;  1YW4 A;  4P4I A;  1HDQ A;  2GLJ A;  3RAM A;  5CBM A;  2PJ8 A;  2PJ7 A;  4P10 A;  1ZLI A;  3SI2 A;  3PFE A;  2PJC A;  1TKH A;  3KGQ A;  3TX8 A;  2JBJ A;  4NGM A;  2GU2 A;  3B3V A;  5I4M A;  2ZEN A;  3DLJ A;  4C8U A;  4C8A A;  4P4E A;  2RB7 A;  5HVF A;  1EE3 P;  1FT7 A;  2CF4 A;  4NJR A;  5JM6 A;  3IWW A;  4ZX8 A;  4C99 A;  2CTB A;  1Y9Z A;  2PJ4 A;  1YW6 A;  5K8O A;  5HVH A;  3EIF A;  5LYD A;  3IC1 A;  3GB0 A;  3IIB A;  3RZA A;  1RTQ A;  1ZLH A;  4W9Y A;  4C8F A;  3B3T A;  3D7F A;  2XEF A;  1KWM A;  3D4U A;  3QNV A;  4Q7A A;  3K9T A;  2ZEH A;  4OME A;  4B6Z A;  1CP6 A;  3H8G A;  1YSJ A;  2JBK A;  1GYT A;  2OR4 A;  4DYO A;  2G9D A;  1CP7 A;  3H8E A;  4JZ0 A;  5ELY A;  5F09 A;  4PPZ A;  4NFR A;  1OBR A;  1TF8 A;  2EK9 A;  4Z65 A;  5LRJ A;  8CPA A;  4F9V A;  3D67 A;  1LOK A;  3SJX A;  2QYV A;  2ZEG A;  1LFW A;  5LRK A;  4FBE A;  1BAV A;  1M4L A;  3V38 A;  4R8F A;  4FWU A;  4R6T A;  3BHX A;  4TWE A;  1QQ9 A;  4C85 A;  2V8G A;  4ONW A;  3S9M A;  5IB9 A;  4F8Z A;  3MRU A;  2WYR A;  3D7G A;  5LYF A;  2XEI A;  2POK A;  4P4J A;  1HDU A;  4ZY0 A;  4LQG A;  1F57 A;  3PB4 X;  3N5F A;  4EWT A;  3B3W A;  4P4F A;  3NH5 A;  5JGF A;  4C8T A;  4EFD A;  4C9U A;  2AFW A;  4R76 A;  1ELM P;  3CDX A;  4IK2 A;  3B2Y A;  1XMB A;  2PJ1 A;  3KQZ A;  1CBX A;  3CT9 A;  2QJ8 A;  5THW A;  3MN8 A;  3D7D A;  4MCP A;  4PXE A;  3SI0 A;  2PVV A;  2ZEE A;  3VAT A;  3VTA A;  3FJU A;  4UEE A;  3CPX A;  2NSM A;  1XRY A;  3WT4 A;  1Z2L A;  3KHX A;  3SI1 A;  3WC7 A;  4MRI A;  1PYT B;  3KR5 A;  4OIW A;  2HC9 A;  4MCS A;  4NGS A;  4CDK A;  2GRE A;  2PIY A;  2ZOG A;  2AFU A;  3NA6 A;  4F9U A;  4OC3 A;  2DEA A;  4PQA A;  1DE4 C;  1VIX A;  2O53 A;  2WZN A;  2AFM A;  1QMU A;  1HEE A;  2BCO A;  3KHZ A;  2IMO A;  1TKJ A;  2PRQ A;  3LMS A;  3S9L A;  4OC5 A;  1CPX A;  3BI1 A;  2XEJ A;  4KNG E;  2J9A A;  2C6C A;  4P45 A;  4AXV A;  2PCU A;  2QVP A;  1DTD A;  2Q51 A;  3FX6 A;  3WC5 A;  4ZYQ A;  4PXC A;  3D7H A;  4OC4 A;  1F2O A;  3NH8 A;  1LAM A;  1R3N A;  4RUH A;  5K8N A;  3IFE A;  3FEC A;  1XF1 A;  3PRT A;  2ZEL A;  3WAB A;  2AFO A;  2BOA A;  1YME A;  4EME A;  4C8C A;  1VHE A;  2JEW A;  2PJB A;  1TKF A;  2RFH A;  2Q43 A;  3ICU A;  1ZG9 A;  3IJ3 A;  4R7M A;  1LAN A;  4PXD A;  3I74 A;  3PFO A;  2PJ9 A;  2GLF A;  4NGR A;  5D29 A;  4OID A;  4P4D A;  3FMC A;  1ZG7 A;  3B7I A;  4X2T A;  1YLO A;  4MHZ A;  4NGT A;  3FED A;  1UWY A;  1ELL P;  2V8D A;  2CTC A;  3FVL A;  5J1Q A;  3FEE A;  4MMO A;  1NSA A;  3KZW A;  3L2N A;  2IQ6 A;  2ZED A;  3H8F A;  2ABZ A;  4A38 A;  1BPM A;  2PIZ A;  3BI0 A;  2V8V A;  2C6G A;  4UF4 A;  2IJZ A;  3PB8 X;  4NGP A;  2EK8 A;  2ZEP A;  4MHP A;  4OC1 A;  4OC2 A;  4WWV A;  1TXR A;  3DGV A;  4NGQ A;  2ANP A;  1BLL E;  1Z5R A;  1CPS A;  1XJO A;  3NH4 A;  1BPN A;  1Y0Y A;  4FAI A;  4OP4 A;  4P4B A;  1JQG A;  1XBU A;  3I6S A;  5JH9 A;  3ISZ A;  3PEI A;  2FVG A;  2AFX A;  4O23 A;  2ZEO A;  4UIA A;  4C9A A;  2F8H A;  3T8W A;  1LCP A;  3HUV A;  4TJV A;  2C1C A;  1R43 A;  7CPA A;  6CPA A;  1CG2 A;  2ZEF A;  1ZG8 A;  1ARM A;  1WVM A;  4ZI6 A;  4K3N A;  3KAS A; 
#chains in the Genus database with same CATH topology
 1OZP A;  3PB9 X;  3R9E A;  1TF9 A;  1Y7E A;  4P6Y A;  1RXT A;  1YX0 A;  4CAF A;  1H8L A;  4ZY2 A;  5K8P A;  5LYI A;  2MP0 A;  3TLB A;  2V77 A;  1KUX A;  1S3Z A;  1NE9 A;  1ZYM A;  4HNX B;  5A27 A;  2GP4 A;  4GM5 A;  2XPL A;  2O4H A;  4M85 A;  5K8M A;  1CE8 B;  4H2K A;  4MCR A;  3PBB A;  4A37 A;  4A94 A;  3OAK A;  1NSL A;  2N3A B;  1Y0R A;  4A39 A;  3R9G A;  4CAX A;  2P6F A;  2FS5 A;  4CDK A;  3SJE A;  4C84 A;  2XEG A;  5J3X A;  3CPA A;  3EY5 A;  4XPD B;  5G20 A;  3F0A A;  1C3O B;  3KR4 A;  1UFH A;  1XFO A;  3DDD A;  3NFZ A;  1BOB A;  2BEI A;  1AYE A;  1XEB A;  3CXP A;  2VZZ A;  3PBE A;  4FUU A;  4E0A A;  4UFX A;  4OKO A;  3GLJ A;  2EZC A;  2D4P A;  4BBH A;  2XPP A;  3VGO A;  3V7Z A;  2V8H A;  1EZA A;  3R95 A;  4OC0 A;  4LUA A;  4NJQ A;  2VKZ G;  4IAV A;  4ZY1 A;  5F49 A;  2ZEM A;  2EUI A;  3VWE A;  3VAR A;  3W6X A;  2ZPA A;  2VL1 A;  2YJT A;  3S9N A;  2J8R A;  3IO1 A;  4UIB A;  3BUX B;  1KZF A;  4MXU A;  3A9L A;  5HVG A;  1Q5X A;  3PB7 X;  4TJX A;  3VRO A;  4IUS A;  2BO9 A;  4M6H A;  3HLP A;  2PE3 A;  2REF A;  4FD7 A;  3DNS A;  4UWI A;  2Q7B A;  3WC6 A;  2E28 A;  4B5O A;  2PVW A;  1FNO A;  4B5P A;  5D8N A;  2J8M A;  4NCZ A;  4MHY A;  2ODF A;  4OLL A;  4AVA A;  4MFP A;  5LYL A;  1BO4 A;  4WJB A;  4C9E A;  4MCQ A;  1IGB A;  3TLG A;  2Q4Z A;  2EWB A;  1Q7L A;  3GUX A;  2OB0 A;  3BLN A;  3KI9 A;  4NXY A;  2YJV A;  3OP0 A;  3B3S A;  3JRU A;  4C9V A;  3RBU A;  5EMI A;  2X0S A;  4H6U A;  2G3A A;  4RS2 A;  2BL1 A;  1XIX A;  1R61 A;  2CIJ A;  2I3C A;  3SJG A;  4CDJ A;  1IY7 A;  3TC8 A;  1ZO0 A;  4ZX9 A;  5JPH A;  3T05 A;  1I21 A;  2AFZ A;  3PGP A;  4G1P A;  4DUK A;  5G22 A;  1QSR A;  4YWY A;  4CGN A;  4CPA A;  1VHO A;  4BD9 A;  1V6C A;  2HB6 A;  3D68 A;  4UBR A;  1ARL A;  4ZBG A;  4RN7 A;  4KSA A;  1PCA A;  1YVK A;  3K2K A;  1Z9U A;  2WPX A;  2PJA A;  4Q38 A;  2FIW A;  2QML A;  3F5B A;  4C8P A;  4NGN A;  4KOX A;  2B4J C;  1CX8 A;  4XPL A;  3SJF A;  4BPX B;  1Z9E A;  2C6P A;  4ORF A;  5CPA A;  2C5Q A;  1F2P A;  2JEV A;  4B13 A;  4YN3 A;  3NE7 A;  4MFZ A;  2PJ6 A;  3TO6 A;  3PB6 X;  3C26 A;  3JVN A;  2FE7 A;  1ON0 A;  3IGR A;  4CRY B;  4A95 A;  3ZJ0 A;  3FF3 A;  2EBJ A;  2AFS A;  3H4Q A;  4HKF A;  5AGE A;  5DS0 A;  4UEF A;  4X8I A;  1AMP A;  5LRG A;  1KUY A;  4X3R A;  2Z3O A;  3FH4 A;  4GS4 A;  4DJL A;  2F7V A;  5DWM A;  2PCN A;  4ZGY B;  2AE6 A;  1X12 A;  2Z11 A;  3GY9 A;  4JWP A;  3TFY A;  4A31 A;  3D66 A;  3ZZI A;  2HI6 A;  3BXM A;  2ZOF A;  3KL9 A;  2PJ5 A;  4MHN A;  4C9R A;  2B4B A;  2PSW A;  3FBU A;  2EVN A;  3KQX A;  3B35 A;  2AUM A;  3TLY A;  2PJ2 A;  1Z8L A;  2YGW A;  3EZA A;  1LAP A;  2NYQ A;  3WR7 A;  3KRV A;  4P44 A;  5HXD A;  2G0B A;  4KSI A;  3ISX A;  2OOT A;  4UEZ A;  1L0C A;  1Q2C A;  4BMH A;  3FIX A;  2Q0Y A;  4IHM A;  4C86 A;  2PRB A;  3LWU A;  1SQH A;  4R3L A;  2R1I A;  2HWG A;  2PJ0 A;  5G1Z A;  4CO9 A;  4YU9 A;  2GIV A;  2B4D A;  3GJZ A;  1VGY A;  4JJX A;  4TNU A;  3RYO A;  3NE8 A;  2WSA A;  2ZW6 A;  2PJ3 A;  3I1U A;  3IEH A;  3IWG A;  3T90 A;  5HKY A;  3U1B A;  4PK3 A;  2B5G A;  2VBQ A;  3B3C A;  1YR0 A;  4CYN A;  1U6M A;  3VH9 A;  1Z8X A;  4PXB A;  5CNP A;  5HKZ A;  1MJB A;  4KZT A;  4AVC A;  4QC6 A;  4JYW A;  1YW4 A;  4AG9 A;  4GPL B;  4LX9 A;  4P4I A;  1HDQ A;  1EO0 A;  2GLJ A;  3RAM A;  3CZX A;  5CBM A;  5KTC A;  3H5Z A;  2PJ8 A;  4BTF A;  2PJ7 A;  4NEX A;  4P10 A;  1ZLI A;  2RC4 A;  2KCW A;  3SI2 A;  3PFE A;  4JLY A;  4CGM A;  2PJC A;  3TT2 A;  1TKH A;  3KGQ A;  4KOU A;  2EZA A;  1WK4 A;  3TX8 A;  3TLA A;  3TLC A;  2DF5 A;  2JBJ A;  4NGM A;  2GU2 A;  3B3V A;  3OB1 B;  2P6G A;  2WPW A;  3W91 A;  4COG A;  4M3S A;  1CS0 B;  5I4M A;  4IIY A;  2ZEN A;  2B3U A;  1QSM A;  1EZB A;  3DLJ A;  3G3S A;  2CNM A;  4C8U A;  4C8A A;  3T0T A;  3F8K A;  2IL4 A;  3D3S A;  1YK3 A;  4KUA A;  4P4E A;  1KUV A;  2ZW4 A;  4PSX A;  4E94 A;  2RB7 A;  5ISV A;  1QSN A;  5HVF A;  1EE3 P;  1BXR B;  1QSO A;  2FCK A;  3BUO B;  4CAV A;  2JDC A;  1FT7 A;  2CF4 A;  2GE3 A;  4KVM E;  4NJR A;  5JM6 A;  3IWW A;  2UV8 G;  4ZX8 A;  4MFK A;  1P4N A;  1S60 A;  4C99 A;  1YLE A;  1KC7 A;  1YVH A;  2CTB A;  1Y9Z A;  2PJ4 A;  1YW6 A;  4CYO A;  5K8O A;  3PT1 A;  1VBG A;  3VWD A;  2Z0Z A;  2O28 A;  5HVH A;  3EIF A;  4QUS A;  3VRP A;  5LYD A;  4CS0 B;  3IC1 A;  2ZXV A;  3TO7 A;  4A2Z A;  4H1H A;  3GB0 A;  1Z4R A;  3IIB A;  3O8Z A;  3MGD A;  3RZA A;  1RTQ A;  1ZLH A;  2R98 A;  4W9Y A;  2PR8 A;  3BUN B;  3B3T A;  3TO9 A;  4C8F A;  4DNC A;  3D7F A;  2XEF A;  2P0W A;  5DWN A;  3T07 A;  1KWM A;  4L89 A;  3D4U A;  3QNV A;  4Q7A A;  3K9T A;  4C7I A;  2D0P A;  2ZEH A;  4OME A;  3JUW A;  1CP6 A;  3H8G A;  4B6Z A;  4E8O A;  1T36 B;  1CM0 A;  4INJ A;  1YSJ A;  2JBK A;  1GYT A;  1MJ9 A;  1S7L A;  2YNE A;  5EC4 A;  4MFQ A;  4KOY A;  1K4J A;  2OR4 A;  4DYO A;  2G9D A;  3V8I A;  1CP7 A;  3H8E A;  2REE A;  4JZ0 A;  5ELY A;  4KLW A;  5F09 A;  4PPZ A;  4AVB A;  4NFR A;  1M4D A;  1OBR A;  1TF8 A;  2PR1 A;  2EK9 A;  4KVX A;  5LRJ A;  4Z65 A;  8CPA A;  4F9V A;  3BJ7 A;  3D67 A;  1LOK A;  3P2F A;  3SJX A;  3B8G A;  4PK2 A;  2QYV A;  4XPK A;  2ZEG A;  1LFW A;  2YNC A;  5IX3 A;  4FBE A;  5LRK A;  3G23 A;  3HMJ G;  1BAV A;  1IYK A;  1M4L A;  4YRH A;  2Y1N A;  1Z8W A;  4F0Y A;  4OAE A;  4MHD A;  3V38 A;  4R8F A;  4XNH C;  3TCV A;  2FXF A;  4FWU A;  4M6G A;  4A30 A;  4R6T A;  3BHX A;  3K9U A;  2ZW5 A;  1Z8T A;  1Y7R A;  2YND A;  4TWE A;  4QB9 A;  4C2Z A;  1QQ9 A;  2VEZ A;  4C85 A;  4Y49 C;  4CYP A;  2V8G A;  2Z3P A;  4ONW A;  5AG5 A;  2B0A A;  2Z3N A;  5J8F A;  3S9M A;  3S6G A;  5IB9 A;  4RR2 B;  2XPN A;  3R1K A;  4KLV A;  4AB7 A;  3MRU A;  4F8Z A;  2WYR A;  4Q36 A;  3D7G A;  3VRQ A;  5A28 A;  1KEE B;  3OWC A;  2Q4Y A;  5LYF A;  5AXI A;  4NSQ A;  2XEI A;  2POK A;  4QVT A;  3RO0 A;  1B6B A;  3SHP A;  4P4J A;  2FL4 A;  1HDU A;  4ZY0 A;  3TTH A;  4LQG A;  1F57 A;  2G3T A;  3BUW B;  2DXQ A;  3PB4 X;  2Q7S A;  3N5F A;  4EWT A;  1M4G A;  3B3W A;  4P4F A;  5JYB A;  1IYL A;  3N7Z A;  3UY5 A;  1YQE A;  3NH5 A;  5FD8 A;  4NF1 A;  5JGF A;  2FT0 A;  2DLA A;  3EXN A;  4M8D A;  4C8T A;  4JD6 A;  4ONU A;  4EFD A;  1M6V B;  4A4C A;  1VI4 A;  4MI4 A;  4C9U A;  4MI1 A;  1I12 A;  2AFW A;  2GAN A;  1KBL A;  4R76 A;  5J8C A;  3PP9 A;  2CY2 A;  4UFV A;  3QAH A;  1ELM P;  3CDX A;  3IWE A;  4IK2 A;  1Y9W A;  1Q2Y A;  3B2Y A;  1XMB A;  2PJ1 A;  3KQZ A;  3DSB A;  4KUB A;  5C82 A;  4B11 A;  4EYS A;  2EZB A;  1CBX A;  3E0K A;  4KS9 A;  3CT9 A;  1AUG A;  2QJ8 A;  2VQY A;  4YGO A;  5THW A;  3MN8 A;  3D7D A;  4MCP A;  4PXE A;  1CJW A;  5EBV A;  3GKR A;  2WUU A;  1IB1 E;  3SI0 A;  2PVV A;  2ZEE A;  1J4J A;  3TOB A;  1V0C A;  3S6H A;  4HPS A;  3VAT A;  3VTA A;  3IU1 A;  4CZ1 A;  1B87 A;  2OU2 A;  3JTK A;  4MFJ A;  2I79 A;  3FB3 A;  3FJU A;  5C88 A;  4UEE A;  3CPX A;  2NSM A;  3EZE A;  4A4B A;  1XRY A;  3C8O A;  1JWQ A;  4E2A A;  5AG4 A;  2BSW A;  5KTA A;  3BUM B;  5K99 A;  3EFA A;  1Z2L A;  2EO8 A;  3KHX A;  4MJ8 A;  3SI1 A;  3WC7 A;  3WT4 A;  4BPW B;  4MRI A;  1PYT B;  2J8N A;  1QST A;  4C68 A;  2Y0M A;  3EO4 A;  3KR5 A;  3KKW A;  3TYX A;  1PUA A;  1WWZ A;  2PC1 A;  4CGL A;  4FD5 A;  4KOS A;  4OIW A;  5H84 A;  4R87 A;  2HC9 A;  2R82 A;  4MCS A;  1IOF A;  1FY7 A;  4NGS A;  2DPS A;  2JLM A;  3GIU A;  1P0H A;  2GRE A;  4PSW A;  5HH1 A;  4B5P B;  1X10 A;  1MJA A;  4COB A;  1JDE A;  2AJ6 A;  2PIY A;  4MJX A;  4Y49 B;  2ZOG A;  3FXT A;  3TLZ A;  2AFU A;  1XOV A;  2HQY A;  2VI7 A;  3NA6 A;  4UCP A;  4F9U A;  3NFQ A;  4OC3 A;  2DEA A;  3TLG B;  1VKC A;  4PQA A;  5IB0 A;  5I0C A;  3P2H A;  1DE4 C;  1VIX A;  2O53 A;  3LAC A;  3BJ8 A;  2K5T A;  2WZN A;  4IF5 A;  2AFM A;  4GXH A;  1QMU A;  2BUE A;  2OZH A;  2HRO A;  1HEE A;  1NXJ A;  3PLF B;  2BCO A;  3CXS A;  3FNC A;  3KHZ A;  2IMO A;  5F47 A;  3TE4 A;  1TKJ A;  5F9M A;  2PRQ A;  3HPG G;  3LMS A;  5KTD A;  1DIK A;  3S9L A;  1WVM A;  5F1Y A;  4OC5 A;  1CPX A;  4K30 A;  3BI1 A;  2QEC A;  4FD4 A;  2XEJ A;  2R7H A;  3EZB A;  2R8V A;  4KNG E;  4FD6 A;  1XMT A;  2J9A A;  4U5Y A;  4JVO A;  2C6C A;  4P45 A;  1GHE A;  4AXV A;  2PCU A;  2QVP A;  1DTD A;  2Q51 A;  3FX6 A;  2HV2 A;  3WC5 A;  4F0X A;  4E5S A;  3TOA A;  1LRZ A;  2CXA A;  4PXC A;  3D7H A;  4OC4 A;  1M4I A;  1Z4E A;  4MY3 A;  4ZYQ A;  5H86 A;  5F46 A;  1VBH A;  3TLE A;  4JXR A;  1F2O A;  2QIR A;  3SR3 A;  3HPH E;  3F9K C;  2VXK A;  3NH8 A;  1LAM A;  1JDB C;  4QBJ A;  1IID A;  5IR2 A;  2Q04 A;  3D8P A;  3DR8 A;  1R3N A;  2CNT A;  4UA3 A;  4RUH A;  2A4N A;  1IU8 A;  3IFE A;  5K8N A;  1M1D A;  3FEC A;  2XPO A;  2H5M A;  5F13 A;  1YVO A;  1XF1 A;  1N71 A;  3PRT A;  5JVL A;  2PQ8 A;  2P6E A;  2ZEL A;  1B47 A;  4HNW B;  3WAB A;  4I49 A;  2AFO A;  3CXQ A;  1A2Z A;  2BOA A;  2OZU A;  2F5I A;  3G8W A;  2DIK A;  1YME A;  1XE4 A;  4H89 A;  4KOV A;  4EME A;  1Q2D A;  1ZL0 A;  1VHE A;  4C2Y A;  4C8C A;  4J0N A;  2ARH A;  3FYN A;  2JEW A;  2OH1 A;  4M6I A;  4C2X A;  3D2P A;  2PJB A;  1TKF A;  2FM4 A;  2RFH A;  2OLS A;  2Q43 A;  4JXQ A;  2Z10 A;  3FRM A;  1M44 A;  3IU2 A;  3ICU A;  1J3L A;  2B4D B;  1ZG9 A;  3IJ3 A;  2Z3K A;  4R7M A;  5FVJ A;  2I00 A;  3SXO A;  1LAN A;  4PXD A;  1S7F A;  3PFO A;  3I74 A;  2Q4V A;  3DR6 A;  3K4I A;  2B5G B;  2PJ9 A;  1MK4 A;  3PZJ A;  5G21 A;  4EVY A;  1WJT A;  2GLF A;  4NGR A;  1XF8 A;  1Y9K A;  4UFW A;  3T9Y A;  3LOD A;  4L8A A;  5D29 A;  2B58 A;  4OID A;  3ZNI A;  2C27 A;  4AG7 A;  4P4D A;  3FMC A;  3R9F A;  1ZG7 A;  3B7I A;  3U88 C;  4KVO E;  3RNZ A;  4CAE A;  4X2T A;  1S5K A;  1YLO A;  4MHZ A;  4NGT A;  4CGP A;  3T5M A;  2FSR A;  3VRN A;  5E96 A;  1FBV A;  3FED A;  1UWY A;  1ELL P;  2NMT A;  2V8D A;  2AUN A;  2CTC A;  4CGO A;  5HKW A;  3FVL A;  2PDO A;  1VHS A;  2YNC C;  5J1Q A;  4RI1 A;  4UCM A;  5AG6 A;  3FEE A;  4MMO A;  1TIQ A;  4CAW A;  4BIN A;  1YRE A;  4R57 A;  2CNS A;  4XPD C;  4X5K A;  4B14 A;  5F48 A;  3R96 A;  1NSA A;  3KZW A;  3L2N A;  2VZY A;  2X7B A;  2IQ6 A;  4KOT A;  2D4O A;  2Z3M A;  2ZED A;  3H8F A;  4KOR A;  4R3K A;  1ZRS A;  3QAY A;  2ABZ A;  4HNY B;  1I1D A;  1IOI A;  3I3G A;  1BPM A;  4A38 A;  5JH9 A;  2PIZ A;  2D0O A;  5BY0 A;  3BI0 A;  2V8V A;  2C6G A;  4UF4 A;  4YFJ A;  2IJZ A;  3PB8 X;  3W6S A;  4A33 A;  4C7H A;  2DPT A;  2ATR A;  4KSF A;  4A32 A;  2ZW7 A;  1PU9 A;  4NGP A;  2EK8 A;  2ZEP A;  4MHP A;  3SXN A;  1GGO A;  4OC1 A;  1A9X B;  4OC2 A;  1S7N A;  2Q44 A;  2Y1M A;  5GCN A;  4WWV A;  1TXR A;  3VRR A;  1C30 B;  3DGV A;  1YGH A;  3I9S A;  4NGQ A;  4OAD A;  2FIA A;  2ANP A;  4B12 A;  1IIC A;  5AG7 A;  1BLL E;  5HMN A;  1Z5R A;  1R57 A;  2GFQ A;  1CPS A;  1RO5 A;  2JDD A;  5IV0 A;  1XJO A;  3LD2 A;  3NH4 A;  1BPN A;  1Y0Y A;  4KOW A;  4FAI A;  4U9Z A;  1NMT A;  4OP4 A;  4P4B A;  1JQG A;  1XBU A;  3I6S A;  4XNH B;  3PFV A;  3D2M A;  4H6Z A;  4PV6 A;  4UWJ A;  3EC4 A;  4CYQ A;  4CRZ B;  3ISZ A;  3PEI A;  5BWA B;  2FVG A;  4U9Y A;  2AFX A;  2CBL A;  4LQ6 A;  4O23 A;  5JQ4 A;  2Z3L A;  1S7K A;  3S6F A;  4F6A A;  2ZEO A;  4UIA A;  4MFL A;  4BPU B;  2F8H A;  3T8W A;  1LCP A;  4R9M A;  3QB8 A;  4C9A A;  3OB2 B;  2B3V A;  3HUV A;  3GYA A;  4MBU A;  4TJV A;  2C1C A;  3NOJ A;  1R43 A;  7CPA A;  2OZG A;  1CG2 A;  2ZEF A;  4J3G A;  6CPA A;  4UCN A;  4MY0 A;  2HUZ A;  4II9 A;  5F5X A;  4IIX A;  1ZG8 A;  1ARM A;  3S6K A;  4B10 A;  1NBW A;  4ZI6 A;  4K3N A;  3KAS A; 
#chains in the Genus database with same CATH homology
 3PB9 X;  1TF9 A;  1Y7E A;  4P6Y A;  5K8P A;  1H8L A;  4ZY2 A;  5LYI A;  2V77 A;  2GP4 A;  4GM5 A;  2O4H A;  5K8M A;  4H2K A;  4MCR A;  3PBB A;  4A37 A;  4A94 A;  1Y0R A;  4A39 A;  3SJE A;  4C84 A;  2XEG A;  3CPA A;  3KR4 A;  1XFO A;  3NFZ A;  1AYE A;  3PBE A;  4FUU A;  4OKO A;  3GLJ A;  3V7Z A;  2V8H A;  4OC0 A;  4NJQ A;  4IAV A;  4ZY1 A;  2ZEM A;  3VAR A;  2VL1 A;  3S9N A;  3IO1 A;  4UIB A;  4MXU A;  5HVG A;  3PB7 X;  4TJX A;  2BO9 A;  3HLP A;  2PE3 A;  3WC6 A;  2PVW A;  1FNO A;  5D8N A;  4MHY A;  5LYL A;  4C9E A;  4WJB A;  4MCQ A;  1IGB A;  2Q4Z A;  2EWB A;  1Q7L A;  3GUX A;  3KI9 A;  3B3S A;  3JRU A;  4C9V A;  3RBU A;  2CIJ A;  2I3C A;  3SJG A;  4CDJ A;  1IY7 A;  3TC8 A;  4ZX9 A;  2AFZ A;  4G1P A;  4DUK A;  4YWY A;  4CPA A;  1VHO A;  4BD9 A;  1V6C A;  2HB6 A;  3D68 A;  1ARL A;  1PCA A;  3K2K A;  2PJA A;  4C8P A;  4NGN A;  1CX8 A;  3SJF A;  2C6P A;  5CPA A;  2C5Q A;  1F2P A;  4YN3 A;  2PJ6 A;  3PB6 X;  3FF3 A;  2AFS A;  5DS0 A;  4UEF A;  4X8I A;  1AMP A;  5LRG A;  4DJL A;  4X3R A;  3FH4 A;  2F7V A;  3D66 A;  3KL9 A;  3BXM A;  2ZOF A;  2PJ5 A;  4MHN A;  4C9R A;  3KQX A;  3B35 A;  2PJ2 A;  1Z8L A;  1LAP A;  2NYQ A;  4P44 A;  5HXD A;  4KSI A;  3ISX A;  2OOT A;  4UEZ A;  4C86 A;  4IHM A;  3LWU A;  2PJ0 A;  4YU9 A;  1VGY A;  4TNU A;  2PJ3 A;  3I1U A;  3IEH A;  3B3C A;  3VH9 A;  4PXB A;  4JYW A;  1YW4 A;  4P4I A;  1HDQ A;  2GLJ A;  3RAM A;  5CBM A;  2PJ8 A;  2PJ7 A;  4P10 A;  1ZLI A;  3SI2 A;  3PFE A;  2PJC A;  1TKH A;  3KGQ A;  3TX8 A;  2JBJ A;  4NGM A;  2GU2 A;  3B3V A;  5I4M A;  2ZEN A;  3DLJ A;  4C8U A;  4C8A A;  4P4E A;  2RB7 A;  5HVF A;  1EE3 P;  1FT7 A;  2CF4 A;  4NJR A;  5JM6 A;  3IWW A;  4ZX8 A;  4C99 A;  2CTB A;  1Y9Z A;  2PJ4 A;  1YW6 A;  5K8O A;  5HVH A;  3EIF A;  5LYD A;  3IC1 A;  3GB0 A;  3IIB A;  3RZA A;  1RTQ A;  1ZLH A;  4W9Y A;  4C8F A;  3B3T A;  3D7F A;  2XEF A;  1KWM A;  3D4U A;  3QNV A;  4Q7A A;  3K9T A;  2ZEH A;  4OME A;  4B6Z A;  1CP6 A;  3H8G A;  1YSJ A;  2JBK A;  1GYT A;  2OR4 A;  4DYO A;  2G9D A;  1CP7 A;  3H8E A;  4JZ0 A;  5ELY A;  5F09 A;  4PPZ A;  4NFR A;  1OBR A;  1TF8 A;  2EK9 A;  4Z65 A;  5LRJ A;  8CPA A;  4F9V A;  3D67 A;  1LOK A;  3SJX A;  2QYV A;  2ZEG A;  1LFW A;  5LRK A;  4FBE A;  1BAV A;  1M4L A;  3V38 A;  4R8F A;  4FWU A;  4R6T A;  3BHX A;  4TWE A;  1QQ9 A;  4C85 A;  2V8G A;  4ONW A;  3S9M A;  5IB9 A;  4F8Z A;  3MRU A;  2WYR A;  3D7G A;  5LYF A;  2XEI A;  2POK A;  4P4J A;  1HDU A;  4ZY0 A;  4LQG A;  1F57 A;  3PB4 X;  3N5F A;  4EWT A;  3B3W A;  4P4F A;  3NH5 A;  5JGF A;  4C8T A;  4EFD A;  4C9U A;  2AFW A;  4R76 A;  1ELM P;  3CDX A;  4IK2 A;  3B2Y A;  1XMB A;  2PJ1 A;  3KQZ A;  1CBX A;  3CT9 A;  2QJ8 A;  5THW A;  3MN8 A;  3D7D A;  4MCP A;  4PXE A;  3SI0 A;  2PVV A;  2ZEE A;  3VAT A;  3VTA A;  3FJU A;  4UEE A;  3CPX A;  2NSM A;  1XRY A;  3WT4 A;  1Z2L A;  3KHX A;  3SI1 A;  3WC7 A;  4MRI A;  1PYT B;  3KR5 A;  4OIW A;  2HC9 A;  4MCS A;  4NGS A;  4CDK A;  2GRE A;  2PIY A;  2ZOG A;  2AFU A;  3NA6 A;  4F9U A;  4OC3 A;  2DEA A;  4PQA A;  1DE4 C;  1VIX A;  2O53 A;  2WZN A;  2AFM A;  1QMU A;  1HEE A;  2BCO A;  3KHZ A;  2IMO A;  1TKJ A;  2PRQ A;  3LMS A;  3S9L A;  4OC5 A;  1CPX A;  3BI1 A;  2XEJ A;  4KNG E;  2J9A A;  2C6C A;  4P45 A;  4AXV A;  2PCU A;  2QVP A;  1DTD A;  2Q51 A;  3FX6 A;  3WC5 A;  4ZYQ A;  4PXC A;  3D7H A;  4OC4 A;  1F2O A;  3NH8 A;  1LAM A;  5IR2 A;  1R3N A;  4RUH A;  5K8N A;  3IFE A;  3FEC A;  1XF1 A;  3PRT A;  2ZEL A;  3WAB A;  2AFO A;  2BOA A;  1YME A;  4EME A;  4C8C A;  1VHE A;  2JEW A;  2PJB A;  1TKF A;  2RFH A;  2Q43 A;  3ICU A;  1ZG9 A;  3IJ3 A;  4R7M A;  1LAN A;  4PXD A;  3I74 A;  3PFO A;  2PJ9 A;  2GLF A;  4NGR A;  5D29 A;  4OID A;  4P4D A;  3FMC A;  1ZG7 A;  3B7I A;  4X2T A;  1YLO A;  4MHZ A;  4NGT A;  3FED A;  1UWY A;  1ELL P;  2V8D A;  2CTC A;  3FVL A;  5J1Q A;  3FEE A;  4MMO A;  1NSA A;  3KZW A;  3L2N A;  2IQ6 A;  2ZED A;  3H8F A;  2ABZ A;  4A38 A;  1BPM A;  2PIZ A;  3BI0 A;  2V8V A;  2C6G A;  4UF4 A;  2IJZ A;  3PB8 X;  4NGP A;  2EK8 A;  2ZEP A;  4MHP A;  4OC1 A;  4OC2 A;  4WWV A;  1TXR A;  3DGV A;  4NGQ A;  2ANP A;  1BLL E;  1Z5R A;  1CPS A;  1XJO A;  3NH4 A;  1BPN A;  1Y0Y A;  4FAI A;  4OP4 A;  4P4B A;  1JQG A;  1XBU A;  3I6S A;  5JH9 A;  3ISZ A;  3PEI A;  2FVG A;  2AFX A;  4O23 A;  2ZEO A;  4UIA A;  4C9A A;  2F8H A;  3T8W A;  1LCP A;  3HUV A;  4TJV A;  2C1C A;  1R43 A;  7CPA A;  6CPA A;  1CG2 A;  2ZEF A;  1ZG8 A;  1ARM A;  1WVM A;  4ZI6 A;  4K3N A;  3KAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...