3BHXA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of asp-glu
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bhxA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bhxA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bhxA02
2ZELA 4RUHA 2XEGA 1ARLA 3N5FA 2RB7A 4NFRA 1NSAA 4C9AA 3K2KA 5LYIA 2PJ8A 3B3TA 2I3CA 4P4FA 2Q43A 2ZENA 3NFZA 3PB9X 4P6YA 3FH4A 2F8HA 2WZNA 2FVGA 1AMPA 2ZEMA 3CPXA 5K8PA 2V8HA 1QMUA 3PFEA 4MRIA 1CPXA 2BOAA 2ZEFA 2NYQA 3BXMA 1FT7A 3FMCA 1DTDA 1RTQA 1F2PA 4A38A 1VHOA 2EWBA 1Y9ZA 2JEWA 4ZX9A 3IFEA 3PBEA 4DUKA 2GLFA 4C84A 3B35A 4FAIA 1LAMA 4KSIA 2V77A 1ELLP 1HEEA 3SI2A 2PJ6A 2IJZA 3ISXA 1TXRA 2XEIA 1YMEA 3PB4X 3TX8A 5IB9A 5F09A 3MRUA 2C6PA 1M4LA 2ZOFA 2ABZA 1TF8A 5CPAA 4MHPA 4NGNA 4C86A 3D4UA 1GYTA 4UEEA 4OP4A 1VHEA 3IEHA 3VARA 2VL1A 4TJVA 2AFWA 1R43A 2Q51A 2NSMA 2ZEHA 2WYRA 3D7FA 2OOTA 3VATA 3KL9A 2IMOA 4ZY2A 2O4HA 2F7VA 4KNGE 2QVPA 4PXCA 5K8NA 3GB0A 2PVVA 1DE4C 3IJ3A 5DS0A 2HC9A 3TC8A 2ZEPA 1Z5RA 1BAVA 2CF4A 3B3CA 3NA6A 3S9NA 1ZLIA 4PXDA 4EFDA 3SI1A 5HXDA 1LANA 3PB7X 4P4BA 3PEIA 4W9YA 3KQZA 4OIDA 3SI0A 4X8IA 3GUXA 1PYTB 4P4DA 1F2OA 3WC6A 4R8FA 4OC3A 1VIXA 2PJ5A 3LMSA 4JZ0A 4IAVA 1XFOA 4MMOA 4C8FA 1CG2A 2PCUA 4O23A 3KR5A 2CTCA 3PFOA 3V7ZA 4C99A 4R76A 5LRGA 2AFZA 3SJXA 2PJAA 3NH4A 1ZG9A 2JBJA 2V8DA 2G9DA 1TKJA 1R3NA 1CPSA 3BI1A 2C6GA 3PB8X 2PJ9A 3I1UA 3WC7A 1H8LA 5K8MA 1ZG7A 1Z2LA 4NJRA 1Y0RA 4YN3A 1Y7EA 4BD9A 4B6ZA 1HDUA 3WABA 5D29A 3CPAA 2AFSA 2PJ0A 3SJGA 3HUVA 4R7MA 4JYWA 2AFXA 3ICUA 4MHYA 3H8GA 5HVFA 2AFOA 4P4IA 2ZEDA 2ZEEA 3BHXA 3KI9A 4FWUA 4F9UA 1LOKA 3D66A 2CIJA 4TNUA 4OC4A 3EIFA 4H2KA 3FF3A 1TKFA 2ZEOA 3VTAA 3VH9A 3SJEA 1YW4A 4UIBA 4DJLA 4AXVA 4ZX8A 1ARMA 1XMBA 3NH5A 5J1QA 3B3VA 1AYEA 4MCSA 4F9VA 1ZG8A 4CPAA 2OR4A 3RAMA 3FVLA 3FJUA 3L2NA 4P4JA 4EWTA 1ELMP 5HVHA 1CBXA 1CP7A 4YWYA 4A94A 1V6CA 5K8OA 4G1PA 4PXEA 3I6SA 3PRTA 3I74A 3D7HA 1LFWA 3MN8A 4MCRA 1YSJA 5LYLA 3FECA 2PVWA 4F8ZA 2PJ4A 1YW6A 2QJ8A 4PXBA 2POKA 2AFMA 3CT9A 4ONWA 3KHZA 1BPMA 3GLJA 2CTBA 3FEDA 2PJ3A 3B3WA 4UEFA 4NGSA 1PCAA 4UIAA 5ELYA 1XJOA 4MCPA 4ZY1A 5HVGA 4NGRA 4P44A 3FX6A 4YU9A 4GM5A 4OC1A 1LAPA 4C8AA 1BLLE 4FUUA 2C1CA 4FBEA 3WT4A 3D7GA 4OIWA 4WJBA 4C8CA 1HDQA 2GLJA 2BO9A 2Q4ZA 3DLJA 5LYDA 3HLPA 3KHXA 4PQAA 4OKOA 1IY7A 4NJQA 4WWVA 7CPAA 3ISZA 4TJXA 3KGQA 2PIZA 4C8TA 3FEEA 4ZY0A 1VGYA 2V8GA 2IQ6A 4UF4A 1XF1A 1OBRA 3S9LA 3B2YA 4K3NA 5JH9A 4OC5A 1YLOA 5D8NA 5THWA 1Q7LA 8CPAA 1BPNA 3QNVA 2PE3A 1XRYA 1F57A 3B3SA 4MHNA 4P4EA 1KWMA 4UEZA 4CDKA 5LRKA 2JBKA 2EK9A 1TF9A 2PJ1A 4P45A 2ZOGA 3D7DA 3D67A 4P10A 4X2TA 4Q7AA 4CDJA 2DEAA 4Z65A 3B7IA 4MHZA 3NH8A 4R6TA 4X3RA 3KQXA 2C6CA 2XEFA 3BI0A 1QQ9A 1EE3P 2GU2A 2RFHA 2V8VA 4NGTA 2PJCA 3IO1A 3K9TA 4ZYQA 2QYVA 2PIYA 4C9VA 3D68A 4C9RA 4OC0A 3WC5A 4C9EA 1Y0YA 4C8UA 5LRJA 3IWWA 3RZAA 4C85A 2HB6A 3KASA 3S9MA 4LQGA 2ANPA 2PJ2A 3SJFA 4C9UA 2PJ7A 4MCQA 4C8PA 5JGFA 2ZEGA 4DYOA 4OMEA 4NGQA 6CPAA 4ZI6A 1FNOA 4EMEA 1LCPA 4NGMA 2EK8A 3KR4A 4IK2A 2PRQA 1IGBA 3KZWA 4IHMA 5JM6A 1TKHA 3IIBA 3RBUA 4A39A 4A37A 4TWEA 4NGPA 3LWUA 3JRUA 1XBUA 3DGVA 1CX8A 1ZLHA 2XEJA 1UWYA 3PB6X 4MXUA 1JQGA 2BCOA 2O53A 3H8FA 5LYFA 1Z8LA 1CP6A 3PBBA 5I4MA 2GREA 3T8WA 5CBMA 3V38A 1WVMA 3IC1A 4PPZA 2AFUA 2J9AA 3H8EA 2PJBA 3CDXA 4OC2A
chains in the Genus database with same CATH superfamily
2ZELA 3IU2A 3LODA 4L89A 4C68A 4RUHA 3EZBA 2XEGA 1ARLA 3N5FA 2C27A 2RB7A 2WUUA 4NFRA 1NSAA 2P6FA 5F46A 1NMTA 3K2KA 4ZBGA 4BPXB 5LYIA 4C9AA 4M6GA 2PJ8A 3B3TA 2I3CA 2CXAA 2OLSA 4P4FA 2QIRA 2Q43A 2ZENA 4LUAA 3NFZA 3PB9X 2VQYA 4P6YA 2B3VA 1IOIA 2HWGA 3FH4A 4C7HA 4Q36A 2F8HA 2YJVA 2WZNA 1ZO0A 4MI1A 1KC7A 3TLAA 2FVGA 3V8IA 1AMPA 2ZEMA 3CPXA 1YK3A 5IR2A 1S60A 2V8HA 5K8PA 2Z10A 1QMUA 3IU1A 4Q38A 2F5IA 5F48A 3PFEA 4MFJA 4MRIA 1CPXA 1QSMA 2BOAA 2ZEFA 4M8DA 3TTHA 2NYQA 3BXMA 1FT7A 2AJ6A 2R8VA 2GE3A 3FMCA 1DTDA 1RTQA 3ZJ0A 2D4PA 1WJTA 2G3TA 2Q7BA 3T07A 5AG5A 1F2PA 1OZPA 4A38A 1VHOA 4MFLA 2EWBA 1Y9ZA 4COGA 2B4BA 4E5SA 5F9MA 2JEWA 4RS2A 1C3OB 5DWNA 2PC1A 2DLAA 4ZX9A 3T05A 2B4DA 3IFEA 1M1DA 3PBEA 4MFKA 4DUKA 2R98A 1AUGA 1S7KA 2GLFA 3DDDA 3H5ZA 1R57A 4CGPA 3B35A 4C84A 4FAIA 1LAMA 4KSIA 4B11A 3T0TA 2YGWA 4ORFA 4KOVA 2V77A 1ELLP 4COBA 1HEEA 1R61A 3P2FA 3SI2A 2PJ6A 3A9LA 2IJZA 3ISXA 4XNHC 1PUAA 2N3AB 1MJBA 1N71A 1TXRA 2PSWA 5KTCA 2XEIA 3VRNA 4BMHA 3FB3A 2R1IA 3T9YA 1YMEA 2EO8A 3B8GA 3PB4X 3OB1B 3TX8A 3R1KA 5IB9A 3OB2B 5F09A 3MRUA 1KUXA 2PRBA 2C6PA 2J8MA 1M4LA 2ZOFA 1DIKA 4QVTA 2ABZA 3FBUA 3EZEA 1Q2CA 2Z3NA 4UCPA 4MFQA 4ZGYB 1TF8A 1P4NA 3CZXA 4MHPA 5CPAA 1JDBC 4NGNA 4C86A 1UFHA 1GYTA 2FXFA 3D4UA 4UEEA 4OP4A 1VHEA 2REEA 4UFWA 3IEHA 3VARA 1YVHA 2OZHA 3TYXA 2VL1A 4TJVA 1Q5XA 5EC4A 2AFWA 2BUEA 4FD6A 2J8NA 1R43A 2Q51A 2NSMA 4R3KA 2PDOA 2ZEHA 2Q04A 3D7FA 2WYRA 1Z4RA 2Z3LA 2Q0YA 2OOTA 3VATA 4YFJA 3KL9A 3TLGB 2HI6A 3G23A 2IMOA 5C82A 2GIVA 2QMLA 2O4HA 4ZY2A 3QAHA 2X0SA 2VKZG 2F7VA 1Z9EA 5EBVA 2C5QA 4A4CA 4KNGE 5HKWA 2QVPA 4PXCA 5K8NA 4KSAA 1Z8XA 3GB0A 2PVVA 4UCNA 4KOSA 2AE6A 1DE4C 3IJ3A 3QAYA 5DS0A 1GHEA 2HC9A 2VBQA 2WSAA 4JJXA 3TC8A 4A30A 4OADA 2ZEPA 1Z5RA 1BAVA 2WPXA 3MGDA 4AVCA 3TT2A 5G22A 2PR8A 5A28A 2CF4A 1BOBA 3B3CA 3NA6A 3S9NA 2CNMA 1ZLIA 3FYNA 3TO7A 2DXQA 2KCWA 5ISVA 4PXDA 4EFDA 3SI1A 5HXDA 3FXTA 1LANA 5FVJA 3R96A 3PB7X 2EZCA 4P4BA 3PEIA 4W9YA 3KQZA 1QSTA 3NE7A 2B4JC 1VBHA 3D8PA 4OIDA 1CE8B 3KKWA 4Y49B 3SI0A 2CBLA 4CAVA 2B0AA 3F9KC 4BBHA 2B5GA 4JLYA 4X8IA 1XIXA 3GUXA 2Q4YA 5C88A 1PYTB 2FIWA 2JDDA 4B5PA 1VI4A 4CGNA 4P4DA 5BWAB 5J3XA 2WPWA 5K99A 3I9SA 1F2OA 2I79A 4PK2A 3WC6A 2R7HA 2REFA 5CNPA 1JWQA 4R8FA 2OU2A 2Q7SA 3VRRA 4OC3A 3D2MA 1S7NA 1VIXA 2HV2A 2VXKA 2PJ5A 3LMSA 4JZ0A 5J8CA 2K5TA 3D3SA 4IAVA 5IV0A 1XFOA 4MMOA 4C8FA 4JXRA 1CG2A 2PCUA 4NXYA 3KR5A 4O23A 5JVLA 2CTCA 3PFOA 4FD4A 3V7ZA 4C99A 4R76A 4BPWB 5LRGA 3ZZIA 2AFZA 3SJXA 2PJAA 3NH4A 4CYPA 1ZG9A 2JBJA 3JTKA 2D0OA 3PGPA 2V8DA 4MFZA 2G9DA 4F0XA 3S6GA 2Z3MA 1TKJA 4A95A 1R3NA 1M4GA 1CPSA 1Z9UA 3PFVA 4R3LA 3BI1A 3TO9A 4INJA 2C6GA 4MHDA 4CS0B 3TE4A 3PB8X 2PJ9A 1Z8TA 3I1UA 4MJ8A 3WC7A 4H89A 5DWMA 2ZW6A 1H8LA 5K8MA 1ZG7A 1Z2LA 2A4NA 4XPDB 4NJRA 1Y0RA 2B4DB 4AG7A 4YN3A 4E94A 2BSWA 1Y7EA 1X12A 2VEZA 4CYOA 3HPGG 4MY0A 4BD9A 5IB0A 4IIXA 4B6ZA 2J8RA 1HDUA 4C2XA 3WABA 5D29A 3CPAA 2AFSA 2PJ0A 3SJGA 3HUVA 4U9YA 4R7MA 3K9UA 1VBGA 4A33A 4JYWA 1WK4A 1XF8A 2AFXA 1Q2YA 4MHYA 4RN7A 4CGOA 3ICUA 2OH1A 3H8GA 1Z4EA 5HVFA 2AFOA 1M44A 4P4IA 2XPPA 2ZEDA 3BUWB 2B58A 4CZ1A 3DSBA 2ZEEA 4YRHA 4Y49C 4H1HA 2OZGA 3BHXA 3KI9A 4KVME 4FWUA 4F9UA 2Y0MA 3W6XA 2EZAA 3TLBA 3TLCA 4C2ZA 2AUMA 4QB9A 1LOKA 3D66A 2CIJA 1J4JA 4TNUA 2PR1A 5F5XA 3E0KA 4OC4A 3S6HA 3ZNIA 1K4JA 3EIFA 4H2KA 4R9MA 1SQHA 2P0WA 3FF3A 3TCVA 2UV8G 1TKFA 1T36B 2X7BA 2ZEOA 4KLWA 3NOJA 3VTAA 3VH9A 3HPHE 3SJEA 1YW4A 4BTFA 3PZJA 4UIBA 3CXQA 1RO5A 4AXVA 4DJLA 4E2AA 4CAWA 3DNSA 3JVNA 4GXHA 4ZX8A 1ARMA 1CJWA 2JDCA 5KTAA 3PT1A 2ODFA 1XMBA 2JLMA 3NH5A 1NSLA 5J1QA 1FBVA 2JEVA 3B3VA 1AYEA 1IIDA 4B10A 2GP4A 1EO0A 4NEXA 4AB7A 3VWEA 4JWPA 4PSXA 1XE4A 1TIQA 4MCSA 2D4OA 4F9VA 4OAEA 4FD7A 5A27A 1BXRB 1ZG8A 4CPAA 2OR4A 3RAMA 4HKFA 3FVLA 3FJUA 3L2NA 4HPSA 5H84A 5H86A 4P4JA 3IWGA 4NF1A 3SXNA 5G1ZA 1ELMP 4BINA 4EWTA 5HVHA 2YNCA 5AXIA 1CBXA 1CP7A 1XEBA 4L8AA 3SXOA 4YWYA 4A94A 1V6CA 5K8OA 4G1PA 4PXEA 2ATRA 4XPDC 3I6SA 4UWIA 3KRVA 3PRTA 4CGLA 3I74A 4GS4A 3D7HA 1LFWA 3MN8A 2ZW7A 4H6UA 4I49A 2QECA 2FT0A 4MCRA 1YSJA 5LYLA 4E0AA 1NBWA 2E28A 3FECA 2PVWA 4JD6A 1FY7A 4M85A 3NFQA 3VROA 4F8ZA 2PJ4A 2B5GB 1YW6A 2O28A 2QJ8A 3G3SA 3GYAA 4KZTA 2POKA 1YQEA 2AFMA 3CT9A 3F8KA 4PXBA 4ONWA 3KHZA 1BPMA 3GLJA 1CM0A 2CTBA 3FEDA 2PJ3A 4J3GA 5AG6A 3B3WA 3TO6A 1IB1E 4UEFA 4NGSA 4AVAA 1PCAA 5BY0A 2G0BA 4UBRA 4UIAA 5F47A 3I3GA 4PK3A 5ELYA 1L0CA 1XJOA 4AVBA 4MCPA 5JYBA 1IYLA 3LD2A 4ZY1A 5HVGA 4ONUA 4NGRA 4A31A 1ZYMA 4KVOE 4P44A 3R95A 5AGEA 2OZUA 2FCKA 2AUNA 3FX6A 2Z3KA 1VKCA 4LQ6A 4YU9A 3HMJG 3TLZA 4GM5A 1XMTA 3FIXA 4OC1A 4RR2B 1LAPA 3GIUA 4C8AA 1BLLE 4FUUA 2XPLA 4KLVA 3UY5A 2C1CA 4UFXA 1B87A 2CY2A 1I1DA 4FBEA 3WT4A 3QB8A 1KBLA 3D7GA 2P6EA 4OIWA 4WJBA 5HKYA 2FSRA 4JXQA 3VWDA 4CYQA 5GCNA 1QSRA 4KUAA 3EZAA 4C8CA 1ON0A 1V0CA 1S5KA 1Y9KA 1HDQA 1M6VB 3BUOB 1IICA 2FS5A 4U5YA 5KTDA 3EFAA 2Z11A 1QSNA 4KUBA 2GLJA 2BO9A 1Y7RA 2Q4ZA 3DLJA 4F6AA 5I0CA 5LYDA 2DF5A 4LX9A 3HLPA 2FM4A 3KHXA 4PQAA 4OKOA 1S3ZA 1VHSA 1IY7A 2GANA 4NJQA 4WWVA 7CPAA 3ISZA 4IUSA 4CRYB 5J8FA 4A4BA 4CO9A 1LRZA 1EZAA 3BUXB 4TJXA 3KGQA 3FRMA 4A32A 4KS9A 1C30B 3IWEA 4CAFA 2PIZA 3T90A 2DIKA 3U1BA 2EBJA 5HKZA 4C8TA 2EVNA 3FEEA 4ZY0A 5F1YA 4XPKA 2YNDA 5F13A 1VGYA 1ZL0A 2VI7A 2V8GA 4R87A 4B5OA 2IQ6A 1NE9A 4IF5A 4KVXA 4UF4A 4CAEA 1XF1A 3SR3A 1OBRA 3GKRA 3S9LA 3CXPA 3D2PA 4QC6A 1I12A 3B2YA 4K3NA 1PU9A 5JH9A 3R9FA 4OC5A 1YLOA 5D8NA 5THWA 4BPUB 3T5MA 3LACA 1KZFA 1MJAA 1Q7LA 2EUIA 4FD5A 4M6HA 4E8OA 2YJTA 8CPAA 1BPNA 3QNVA 1YX0A 2PE3A 4MI4A 1XRYA 1F57A 1WWZA 2FIAA 3B3SA 4MHNA 4P4EA 4B13A 1EZBA 3SHPA 1KWMA 3RO0A 4RI1A 4UEZA 4CDKA 5LRKA 2HUZA 1X10A 3GY9A 2JBKA 4HNWB 2EK9A 1TF9A 2PCNA 3PLFB 2PJ1A 4P45A 2Z3OA 2EZBA 3TOBA 2Y1MA 2ZOGA 4PSWA 2B3UA 4U9ZA 2CNTA 4A2ZA 3FNCA 3W6SA 3D7DA 3D67A 1YR0A 4MFPA 2CNSA 4P10A 4X2TA 2MP0A 3OP0A 4Q7AA 2NMTA 2BL1A 4H6ZA 4EVYA 2R82A 4CDJA 3GJZA 5G21A 2DEAA 1XOVA 4Z65A 2Z3PA 2ZW4A 1IU8A 3B7IA 3BUNB 2DPSA 4MHZA 4CGMA 3NH8A 4QUSA 1YREA 4R6TA 2HROA 4X3RA 3KQXA 1P0HA 1B6BA 3DR8A 5IX3A 1U6MA 3RYOA 4MY3A 3EXNA 2C6CA 2XEFA 3BI0A 1QQ9A 3NE8A 1EE3P 2GU2A 2RFHA 1A9XB 2VZZA 4C7IA 2Z0ZA 3EY5A 4KSFA 4JVOA 3BLNA 1KUYA 1Y9WA 2V8VA 4M3SA 4CRZB 4NGTA 4K30A 4QBJA 1ZRSA 2PJCA 3IO1A 3K9TA 3P2HA 3R9EA 2QYVA 4ZYQA 3VRPA 2PIYA 3DR6A 4KOYA 2Q44A 1Q2DA 4OC0A 3D68A 4PV6A 4II9A 1JDEA 4C9VA 4C9RA 3WC5A 4C9EA 1Y0YA 4C8UA 4KOXA 4MBUA 3IWWA 5LRJA 4EYSA 2FE7A 3RZAA 4C85A 4CAXA 2HB6A 2XPOA 1M4IA 1YGHA 3KASA 3S9MA 2IL4A 4LQGA 2ANPA 2PJ2A 3SJFA 2ZPAA 3IGRA 4B12A 2FL4A 1RXTA 3TOAA 4C9UA 4GPLB 2PJ7A 3BJ7A 4MCQA 4KOWA 4C8PA 3TLYA 2Q4VA 4KORA 4M6IA 5JGFA 2ZEGA 3C26A 3BJ8A 4HNXB 3O8ZA 3PP9A 4DYOA 1MJ9A 3BUMB 4OMEA 4NGQA 5EMIA 3VRQA 1BO4A 1M4DA 3CXSA 6CPAA 1YVOA 4XPLA 4ZI6A 3S6FA 3U88C 3OWCA 4UWJA 2VZYA 1FNOA 3F5BA 5FD8A 4NCZA 1S7LA 1YLEA 4EMEA 3F0AA 1LCPA 1A2ZA 4NGMA 2EK8A 3KR4A 1MK4A 4IK2A 4KOTA 2PRQA 4B14A 4J0NA 1IGBA 3KZWA 4HNYB 1Z8WA 4IHMA 2RC4A 4UCMA 5JM6A 1TKHA 4R57A 3IIBA 3RBUA 4A39A 1KUVA 4X5KA 4A37A 4TWEA 4NGPA 5JPHA 5F49A 3LWUA 4NSQA 3JRUA 2XPNA 3S6KA 4IIYA 3K4IA 2D0PA 2BEIA 2Y1NA 5AG7A 3TLGA 4CYNA 4AG9A 4UFVA 1XBUA 2ARHA 2G3AA 2YNCC 1GGOA 5HMNA 3DGVA 1CX8A 2HQYA 4OLLA 3VGOA 1ZLHA 3R9GA 2DPTA 2XEJA 1NXJA 4MJXA 2YNEA 1UWYA 3PB6X 4MXUA 2PQ8A 1JQGA 4UA3A 2BCOA 2O53A 3H8FA 3WR7A 2P6GA 3H4QA 1Z8LA 1IYKA 3N7ZA 4F0YA 5LYFA 3TLEA 1CP6A 5G20A 1KEEB 3PBBA 4B5PB 4DNCA 4C2YA 3TFYA 4KOUA 1QSOA 2H5MA 4YGOA 5I4MA 2GREA 1I21A 3T8WA 3G8WA 5CBMA 1B47A 2ZXVA 1IOFA 3JUWA 3V38A 1CS0B 1YVKA 1WVMA 5E96A 2OB0A 3C8OA 3W91A 3EC4A 3IC1A 4PPZA 2AFUA 3EO4A 5AG4A 2I00A 1J3LA 2J9AA 3H8EA 4XNHB 2GFQA 2PJBA 2ZW5A 3OAKA 3RNZA 1S7FA 3CDXA 5JQ4A 4OC2A 5HH1A
chains in the Genus database with same CATH topology
2ZELA 4RUHA 2XEGA 1ARLA 3N5FA 2RB7A 4NFRA 1NSAA 4C9AA 3K2KA 5LYIA 2PJ8A 3B3TA 2I3CA 4P4FA 2Q43A 2ZENA 3NFZA 3PB9X 4P6YA 3FH4A 2F8HA 2WZNA 2FVGA 1AMPA 2ZEMA 3CPXA 5IR2A 5K8PA 2V8HA 1QMUA 3PFEA 4MRIA 1CPXA 2BOAA 2ZEFA 2NYQA 3BXMA 1FT7A 3FMCA 1DTDA 1RTQA 1F2PA 4A38A 1VHOA 2EWBA 1Y9ZA 2JEWA 4ZX9A 3IFEA 3PBEA 4DUKA 2GLFA 4C84A 3B35A 4FAIA 1LAMA 4KSIA 2V77A 1ELLP 1HEEA 3SI2A 2PJ6A 2IJZA 3ISXA 1TXRA 2XEIA 1YMEA 3PB4X 3TX8A 5IB9A 5F09A 3MRUA 2C6PA 1M4LA 2ZOFA 2ABZA 1TF8A 5CPAA 4MHPA 4NGNA 4C86A 3D4UA 1GYTA 4UEEA 4OP4A 1VHEA 3IEHA 3VARA 2VL1A 4TJVA 2AFWA 1R43A 2Q51A 2NSMA 2ZEHA 2WYRA 3D7FA 2OOTA 3VATA 3KL9A 2IMOA 4ZY2A 2O4HA 2F7VA 2C5QA 4KNGE 2QVPA 4PXCA 5K8NA 3GB0A 2PVVA 1DE4C 3IJ3A 5DS0A 2HC9A 3TC8A 2ZEPA 1Z5RA 1BAVA 2CF4A 3B3CA 3NA6A 3S9NA 1ZLIA 4PXDA 4EFDA 3SI1A 5HXDA 1LANA 3PB7X 4P4BA 3PEIA 4W9YA 3KQZA 4OIDA 3SI0A 4X8IA 3GUXA 1PYTB 4P4DA 1F2OA 3WC6A 4R8FA 4OC3A 1VIXA 2PJ5A 3LMSA 4JZ0A 4IAVA 1XFOA 4MMOA 4C8FA 1CG2A 2PCUA 4O23A 3KR5A 2CTCA 3PFOA 3V7ZA 4C99A 4R76A 5LRGA 2AFZA 3SJXA 2PJAA 3NH4A 1ZG9A 2JBJA 2V8DA 2G9DA 1TKJA 1R3NA 1CPSA 3BI1A 2C6GA 3PB8X 2PJ9A 3I1UA 3WC7A 1H8LA 5K8MA 1ZG7A 1Z2LA 4NJRA 1Y0RA 4YN3A 1Y7EA 4BD9A 4B6ZA 1HDUA 3WABA 5D29A 3CPAA 2AFSA 2PJ0A 3SJGA 3HUVA 4R7MA 4JYWA 2AFXA 3ICUA 4MHYA 3H8GA 5HVFA 2AFOA 4P4IA 2ZEDA 2ZEEA 3BHXA 3KI9A 4FWUA 4F9UA 1LOKA 3D66A 2CIJA 4TNUA 4OC4A 3EIFA 4H2KA 3FF3A 1TKFA 2ZEOA 3VTAA 3VH9A 3SJEA 1YW4A 4UIBA 4DJLA 4AXVA 4ZX8A 1ARMA 1XMBA 3NH5A 5J1QA 3B3VA 1AYEA 2GP4A 4MCSA 4F9VA 1ZG8A 4CPAA 2OR4A 3RAMA 3FVLA 3FJUA 3L2NA 4P4JA 4EWTA 1ELMP 5HVHA 1CBXA 1CP7A 4YWYA 4A94A 1V6CA 5K8OA 4G1PA 4PXEA 3I6SA 3PRTA 3I74A 3D7HA 1LFWA 3MN8A 4MCRA 1YSJA 5LYLA 3FECA 2PVWA 4F8ZA 2PJ4A 1YW6A 2QJ8A 4PXBA 2POKA 2AFMA 3CT9A 4ONWA 3KHZA 1BPMA 3GLJA 2CTBA 3FEDA 2PJ3A 3B3WA 4UEFA 4NGSA 1PCAA 4UIAA 5ELYA 1XJOA 4MCPA 4ZY1A 5HVGA 4NGRA 4P44A 3FX6A 4YU9A 4GM5A 4OC1A 1LAPA 4C8AA 1BLLE 4FUUA 2C1CA 4FBEA 3WT4A 3D7GA 4OIWA 4WJBA 4C8CA 1HDQA 2GLJA 2BO9A 2Q4ZA 3DLJA 5LYDA 3HLPA 3KHXA 4PQAA 4OKOA 1IY7A 4NJQA 4WWVA 7CPAA 3ISZA 4TJXA 3KGQA 2PIZA 4C8TA 3FEEA 4ZY0A 1VGYA 2V8GA 2IQ6A 4UF4A 1XF1A 1OBRA 3S9LA 3B2YA 4K3NA 5JH9A 4OC5A 1YLOA 5D8NA 5THWA 1Q7LA 8CPAA 1BPNA 3QNVA 2PE3A 1XRYA 1F57A 3B3SA 4MHNA 4P4EA 1KWMA 4UEZA 4CDKA 5LRKA 2JBKA 2EK9A 1TF9A 2PJ1A 4P45A 2ZOGA 3D7DA 3D67A 4P10A 4X2TA 4Q7AA 4CDJA 2DEAA 4Z65A 3B7IA 4MHZA 3NH8A 4R6TA 4X3RA 3KQXA 2C6CA 2XEFA 3BI0A 1QQ9A 1EE3P 2GU2A 2RFHA 2V8VA 4NGTA 2PJCA 3IO1A 3K9TA 4ZYQA 2QYVA 2PIYA 4C9VA 3D68A 4C9RA 4OC0A 3WC5A 4C9EA 1Y0YA 4C8UA 5LRJA 3IWWA 3RZAA 4C85A 2HB6A 3KASA 3S9MA 4LQGA 2ANPA 2PJ2A 3SJFA 4C9UA 2PJ7A 4MCQA 4C8PA 5JGFA 2ZEGA 4DYOA 4OMEA 4NGQA 6CPAA 4ZI6A 1FNOA 4EMEA 1LCPA 4NGMA 2EK8A 3KR4A 4IK2A 2PRQA 1IGBA 3KZWA 4IHMA 5JM6A 1TKHA 3IIBA 3RBUA 4A39A 4A37A 4TWEA 4NGPA 3LWUA 3JRUA 1XBUA 3DGVA 1CX8A 1ZLHA 2XEJA 1UWYA 3PB6X 4MXUA 1JQGA 2BCOA 2O53A 3H8FA 5LYFA 1Z8LA 1CP6A 3PBBA 5I4MA 2GREA 3T8WA 5CBMA 3V38A 1WVMA 3IC1A 4PPZA 2AFUA 2J9AA 3H8EA 2PJBA 3CDXA 4OC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEL A;  4RUH A;  2XEG A;  1ARL A;  3N5F A;  2RB7 A;  4NFR A;  1NSA A;  4C9A A;  3K2K A;  5LYI A;  2PJ8 A;  3B3T A;  2I3C A;  4P4F A;  2Q43 A;  2ZEN A;  3NFZ A;  3PB9 X;  4P6Y A;  3FH4 A;  2F8H A;  2WZN A;  2FVG A;  1AMP A;  2ZEM A;  3CPX A;  5K8P A;  2V8H A;  1QMU A;  3PFE A;  4MRI A;  1CPX A;  2BOA A;  2ZEF A;  2NYQ A;  3BXM A;  1FT7 A;  3FMC A;  1DTD A;  1RTQ A;  1F2P A;  4A38 A;  1VHO A;  2EWB A;  1Y9Z A;  2JEW A;  4ZX9 A;  3IFE A;  3PBE A;  4DUK A;  2GLF A;  4C84 A;  3B35 A;  4FAI A;  1LAM A;  4KSI A;  2V77 A;  1ELL P;  1HEE A;  3SI2 A;  2PJ6 A;  2IJZ A;  3ISX A;  1TXR A;  2XEI A;  1YME A;  3PB4 X;  3TX8 A;  5IB9 A;  5F09 A;  3MRU A;  2C6P A;  1M4L A;  2ZOF A;  2ABZ A;  1TF8 A;  5CPA A;  4MHP A;  4NGN A;  4C86 A;  3D4U A;  1GYT A;  4UEE A;  4OP4 A;  1VHE A;  3IEH A;  3VAR A;  2VL1 A;  4TJV A;  2AFW A;  1R43 A;  2Q51 A;  2NSM A;  2ZEH A;  2WYR A;  3D7F A;  2OOT A;  3VAT A;  3KL9 A;  2IMO A;  4ZY2 A;  2O4H A;  2F7V A;  4KNG E;  2QVP A;  4PXC A;  5K8N A;  3GB0 A;  2PVV A;  1DE4 C;  3IJ3 A;  5DS0 A;  2HC9 A;  3TC8 A;  2ZEP A;  1Z5R A;  1BAV A;  2CF4 A;  3B3C A;  3NA6 A;  3S9N A;  1ZLI A;  4PXD A;  4EFD A;  3SI1 A;  5HXD A;  1LAN A;  3PB7 X;  4P4B A;  3PEI A;  4W9Y A;  3KQZ A;  4OID A;  3SI0 A;  4X8I A;  3GUX A;  1PYT B;  4P4D A;  1F2O A;  3WC6 A;  4R8F A;  4OC3 A;  1VIX A;  2PJ5 A;  3LMS A;  4JZ0 A;  4IAV A;  1XFO A;  4MMO A;  4C8F A;  1CG2 A;  2PCU A;  4O23 A;  3KR5 A;  2CTC A;  3PFO A;  3V7Z A;  4C99 A;  4R76 A;  5LRG A;  2AFZ A;  3SJX A;  2PJA A;  3NH4 A;  1ZG9 A;  2JBJ A;  2V8D A;  2G9D A;  1TKJ A;  1R3N A;  1CPS A;  3BI1 A;  2C6G A;  3PB8 X;  2PJ9 A;  3I1U A;  3WC7 A;  1H8L A;  5K8M A;  1ZG7 A;  1Z2L A;  4NJR A;  1Y0R A;  4YN3 A;  1Y7E A;  4BD9 A;  4B6Z A;  1HDU A;  3WAB A;  5D29 A;  3CPA A;  2AFS A;  2PJ0 A;  3SJG A;  3HUV A;  4R7M A;  4JYW A;  2AFX A;  3ICU A;  4MHY A;  3H8G A;  5HVF A;  2AFO A;  4P4I A;  2ZED A;  2ZEE A;  3BHX A;  3KI9 A;  4FWU A;  4F9U A;  1LOK A;  3D66 A;  2CIJ A;  4TNU A;  4OC4 A;  3EIF A;  4H2K A;  3FF3 A;  1TKF A;  2ZEO A;  3VTA A;  3VH9 A;  3SJE A;  1YW4 A;  4UIB A;  4DJL A;  4AXV A;  4ZX8 A;  1ARM A;  1XMB A;  3NH5 A;  5J1Q A;  3B3V A;  1AYE A;  4MCS A;  4F9V A;  1ZG8 A;  4CPA A;  2OR4 A;  3RAM A;  3FVL A;  3FJU A;  3L2N A;  4P4J A;  4EWT A;  1ELM P;  5HVH A;  1CBX A;  1CP7 A;  4YWY A;  4A94 A;  1V6C A;  5K8O A;  4G1P A;  4PXE A;  3I6S A;  3PRT A;  3I74 A;  3D7H A;  1LFW A;  3MN8 A;  4MCR A;  1YSJ A;  5LYL A;  3FEC A;  2PVW A;  4F8Z A;  2PJ4 A;  1YW6 A;  2QJ8 A;  4PXB A;  2POK A;  2AFM A;  3CT9 A;  4ONW A;  3KHZ A;  1BPM A;  3GLJ A;  2CTB A;  3FED A;  2PJ3 A;  3B3W A;  4UEF A;  4NGS A;  1PCA A;  4UIA A;  5ELY A;  1XJO A;  4MCP A;  4ZY1 A;  5HVG A;  4NGR A;  4P44 A;  3FX6 A;  4YU9 A;  4GM5 A;  4OC1 A;  1LAP A;  4C8A A;  1BLL E;  4FUU A;  2C1C A;  4FBE A;  3WT4 A;  3D7G A;  4OIW A;  4WJB A;  4C8C A;  1HDQ A;  2GLJ A;  2BO9 A;  2Q4Z A;  3DLJ A;  5LYD A;  3HLP A;  3KHX A;  4PQA A;  4OKO A;  1IY7 A;  4NJQ A;  4WWV A;  7CPA A;  3ISZ A;  4TJX A;  3KGQ A;  2PIZ A;  4C8T A;  3FEE A;  4ZY0 A;  1VGY A;  2V8G A;  2IQ6 A;  4UF4 A;  1XF1 A;  1OBR A;  3S9L A;  3B2Y A;  4K3N A;  5JH9 A;  4OC5 A;  1YLO A;  5D8N A;  5THW A;  1Q7L A;  8CPA A;  1BPN A;  3QNV A;  2PE3 A;  1XRY A;  1F57 A;  3B3S A;  4MHN A;  4P4E A;  1KWM A;  4UEZ A;  4CDK A;  5LRK A;  2JBK A;  2EK9 A;  1TF9 A;  2PJ1 A;  4P45 A;  2ZOG A;  3D7D A;  3D67 A;  4P10 A;  4X2T A;  4Q7A A;  4CDJ A;  2DEA A;  4Z65 A;  3B7I A;  4MHZ A;  3NH8 A;  4R6T A;  4X3R A;  3KQX A;  2C6C A;  2XEF A;  3BI0 A;  1QQ9 A;  1EE3 P;  2GU2 A;  2RFH A;  2V8V A;  4NGT A;  2PJC A;  3IO1 A;  3K9T A;  4ZYQ A;  2QYV A;  2PIY A;  4C9V A;  3D68 A;  4C9R A;  4OC0 A;  3WC5 A;  4C9E A;  1Y0Y A;  4C8U A;  5LRJ A;  3IWW A;  3RZA A;  4C85 A;  2HB6 A;  3KAS A;  3S9M A;  4LQG A;  2ANP A;  2PJ2 A;  3SJF A;  4C9U A;  2PJ7 A;  4MCQ A;  4C8P A;  5JGF A;  2ZEG A;  4DYO A;  4OME A;  4NGQ A;  6CPA A;  4ZI6 A;  1FNO A;  4EME A;  1LCP A;  4NGM A;  2EK8 A;  3KR4 A;  4IK2 A;  2PRQ A;  1IGB A;  3KZW A;  4IHM A;  5JM6 A;  1TKH A;  3IIB A;  3RBU A;  4A39 A;  4A37 A;  4TWE A;  4NGP A;  3LWU A;  3JRU A;  1XBU A;  3DGV A;  1CX8 A;  1ZLH A;  2XEJ A;  1UWY A;  3PB6 X;  4MXU A;  1JQG A;  2BCO A;  2O53 A;  3H8F A;  5LYF A;  1Z8L A;  1CP6 A;  3PBB A;  5I4M A;  2GRE A;  3T8W A;  5CBM A;  3V38 A;  1WVM A;  3IC1 A;  4PPZ A;  2AFU A;  2J9A A;  3H8E A;  2PJB A;  3CDX A;  4OC2 A; 
#chains in the Genus database with same CATH topology
 2ZEL A;  3IU2 A;  3LOD A;  4L89 A;  4C68 A;  4RUH A;  3EZB A;  2XEG A;  1ARL A;  3N5F A;  2C27 A;  2RB7 A;  2WUU A;  4NFR A;  1NSA A;  2P6F A;  5F46 A;  1NMT A;  3K2K A;  4ZBG A;  4BPX B;  5LYI A;  4C9A A;  4M6G A;  2PJ8 A;  3B3T A;  2I3C A;  2CXA A;  2OLS A;  4P4F A;  2QIR A;  2Q43 A;  2ZEN A;  4LUA A;  3NFZ A;  3PB9 X;  2VQY A;  4P6Y A;  2B3V A;  1IOI A;  2HWG A;  3FH4 A;  4C7H A;  4Q36 A;  2F8H A;  2YJV A;  2WZN A;  1ZO0 A;  4MI1 A;  1KC7 A;  3TLA A;  2FVG A;  3V8I A;  1AMP A;  2ZEM A;  3CPX A;  1YK3 A;  5IR2 A;  1S60 A;  2V8H A;  5K8P A;  2Z10 A;  1QMU A;  3IU1 A;  4Q38 A;  2F5I A;  5F48 A;  3PFE A;  4MFJ A;  4MRI A;  1CPX A;  1QSM A;  2BOA A;  2ZEF A;  4M8D A;  3TTH A;  2NYQ A;  3BXM A;  1FT7 A;  2AJ6 A;  2R8V A;  2GE3 A;  3FMC A;  1DTD A;  1RTQ A;  3ZJ0 A;  2D4P A;  1WJT A;  2G3T A;  2Q7B A;  3T07 A;  5AG5 A;  1F2P A;  1OZP A;  4A38 A;  1VHO A;  4MFL A;  2EWB A;  1Y9Z A;  4COG A;  2B4B A;  4E5S A;  5F9M A;  2JEW A;  4RS2 A;  1C3O B;  5DWN A;  2PC1 A;  2DLA A;  4ZX9 A;  3T05 A;  2B4D A;  3IFE A;  1M1D A;  3PBE A;  4MFK A;  4DUK A;  2R98 A;  1AUG A;  1S7K A;  2GLF A;  3DDD A;  3H5Z A;  1R57 A;  4CGP A;  3B35 A;  4C84 A;  4FAI A;  1LAM A;  4KSI A;  4B11 A;  3T0T A;  2YGW A;  4ORF A;  4KOV A;  2V77 A;  1ELL P;  4COB A;  1HEE A;  1R61 A;  3P2F A;  3SI2 A;  2PJ6 A;  3A9L A;  2IJZ A;  3ISX A;  4XNH C;  1PUA A;  2N3A B;  1MJB A;  1N71 A;  1TXR A;  2PSW A;  5KTC A;  2XEI A;  3VRN A;  4BMH A;  3FB3 A;  2R1I A;  3T9Y A;  1YME A;  2EO8 A;  3B8G A;  3PB4 X;  3OB1 B;  3TX8 A;  3R1K A;  5IB9 A;  3OB2 B;  5F09 A;  3MRU A;  1KUX A;  2PRB A;  2C6P A;  2J8M A;  1M4L A;  2ZOF A;  1DIK A;  4QVT A;  2ABZ A;  3FBU A;  3EZE A;  1Q2C A;  2Z3N A;  4UCP A;  4MFQ A;  4ZGY B;  1TF8 A;  1P4N A;  3CZX A;  4MHP A;  5CPA A;  1JDB C;  4NGN A;  4C86 A;  1UFH A;  1GYT A;  2FXF A;  3D4U A;  4UEE A;  4OP4 A;  1VHE A;  2REE A;  4UFW A;  3IEH A;  3VAR A;  1YVH A;  2OZH A;  3TYX A;  2VL1 A;  4TJV A;  1Q5X A;  5EC4 A;  2AFW A;  2BUE A;  4FD6 A;  2J8N A;  1R43 A;  2Q51 A;  2NSM A;  4R3K A;  2PDO A;  2ZEH A;  2Q04 A;  3D7F A;  2WYR A;  1Z4R A;  2Z3L A;  2Q0Y A;  2OOT A;  3VAT A;  4YFJ A;  3KL9 A;  3TLG B;  2HI6 A;  3G23 A;  2IMO A;  5C82 A;  2GIV A;  2QML A;  2O4H A;  4ZY2 A;  3QAH A;  2X0S A;  2VKZ G;  2F7V A;  1Z9E A;  5EBV A;  2C5Q A;  4A4C A;  4KNG E;  5HKW A;  2QVP A;  4PXC A;  5K8N A;  4KSA A;  1Z8X A;  3GB0 A;  2PVV A;  4UCN A;  4KOS A;  2AE6 A;  1DE4 C;  3IJ3 A;  3QAY A;  5DS0 A;  1GHE A;  2HC9 A;  2VBQ A;  2WSA A;  4JJX A;  3TC8 A;  4A30 A;  4OAD A;  2ZEP A;  1Z5R A;  1BAV A;  2WPX A;  3MGD A;  4AVC A;  3TT2 A;  5G22 A;  2PR8 A;  5A28 A;  2CF4 A;  1BOB A;  3B3C A;  3NA6 A;  3S9N A;  2CNM A;  1ZLI A;  3FYN A;  3TO7 A;  2DXQ A;  2KCW A;  5ISV A;  4PXD A;  4EFD A;  3SI1 A;  5HXD A;  3FXT A;  1LAN A;  5FVJ A;  3R96 A;  3PB7 X;  2EZC A;  4P4B A;  3PEI A;  4W9Y A;  3KQZ A;  1QST A;  3NE7 A;  2B4J C;  1VBH A;  3D8P A;  4OID A;  1CE8 B;  3KKW A;  4Y49 B;  3SI0 A;  2CBL A;  4CAV A;  2B0A A;  3F9K C;  4BBH A;  2B5G A;  4JLY A;  4X8I A;  1XIX A;  3GUX A;  2Q4Y A;  5C88 A;  1PYT B;  2FIW A;  2JDD A;  4B5P A;  1VI4 A;  4CGN A;  4P4D A;  5BWA B;  5J3X A;  2WPW A;  5K99 A;  3I9S A;  1F2O A;  2I79 A;  4PK2 A;  3WC6 A;  2R7H A;  2REF A;  5CNP A;  1JWQ A;  4R8F A;  2OU2 A;  2Q7S A;  3VRR A;  4OC3 A;  3D2M A;  1S7N A;  1VIX A;  2HV2 A;  2VXK A;  2PJ5 A;  3LMS A;  4JZ0 A;  5J8C A;  2K5T A;  3D3S A;  4IAV A;  5IV0 A;  1XFO A;  4MMO A;  4C8F A;  4JXR A;  1CG2 A;  2PCU A;  4NXY A;  3KR5 A;  4O23 A;  5JVL A;  2CTC A;  3PFO A;  4FD4 A;  3V7Z A;  4C99 A;  4R76 A;  4BPW B;  5LRG A;  3ZZI A;  2AFZ A;  3SJX A;  2PJA A;  3NH4 A;  4CYP A;  1ZG9 A;  2JBJ A;  3JTK A;  2D0O A;  3PGP A;  2V8D A;  4MFZ A;  2G9D A;  4F0X A;  3S6G A;  2Z3M A;  1TKJ A;  4A95 A;  1R3N A;  1M4G A;  1CPS A;  1Z9U A;  3PFV A;  4R3L A;  3BI1 A;  3TO9 A;  4INJ A;  2C6G A;  4MHD A;  4CS0 B;  3TE4 A;  3PB8 X;  2PJ9 A;  1Z8T A;  3I1U A;  4MJ8 A;  3WC7 A;  4H89 A;  5DWM A;  2ZW6 A;  1H8L A;  5K8M A;  1ZG7 A;  1Z2L A;  2A4N A;  4XPD B;  4NJR A;  1Y0R A;  2B4D B;  4AG7 A;  4YN3 A;  4E94 A;  2BSW A;  1Y7E A;  1X12 A;  2VEZ A;  4CYO A;  3HPG G;  4MY0 A;  4BD9 A;  5IB0 A;  4IIX A;  4B6Z A;  2J8R A;  1HDU A;  4C2X A;  3WAB A;  5D29 A;  3CPA A;  2AFS A;  2PJ0 A;  3SJG A;  3HUV A;  4U9Y A;  4R7M A;  3K9U A;  1VBG A;  4A33 A;  4JYW A;  1WK4 A;  1XF8 A;  2AFX A;  1Q2Y A;  4MHY A;  4RN7 A;  4CGO A;  3ICU A;  2OH1 A;  3H8G A;  1Z4E A;  5HVF A;  2AFO A;  1M44 A;  4P4I A;  2XPP A;  2ZED A;  3BUW B;  2B58 A;  4CZ1 A;  3DSB A;  2ZEE A;  4YRH A;  4Y49 C;  4H1H A;  2OZG A;  3BHX A;  3KI9 A;  4KVM E;  4FWU A;  4F9U A;  2Y0M A;  3W6X A;  2EZA A;  3TLB A;  3TLC A;  4C2Z A;  2AUM A;  4QB9 A;  1LOK A;  3D66 A;  2CIJ A;  1J4J A;  4TNU A;  2PR1 A;  5F5X A;  3E0K A;  4OC4 A;  3S6H A;  3ZNI A;  1K4J A;  3EIF A;  4H2K A;  4R9M A;  1SQH A;  2P0W A;  3FF3 A;  3TCV A;  2UV8 G;  1TKF A;  1T36 B;  2X7B A;  2ZEO A;  4KLW A;  3NOJ A;  3VTA A;  3VH9 A;  3HPH E;  3SJE A;  1YW4 A;  4BTF A;  3PZJ A;  4UIB A;  3CXQ A;  1RO5 A;  4AXV A;  4DJL A;  4E2A A;  4CAW A;  3DNS A;  3JVN A;  4GXH A;  4ZX8 A;  1ARM A;  1CJW A;  2JDC A;  5KTA A;  3PT1 A;  2ODF A;  1XMB A;  2JLM A;  3NH5 A;  1NSL A;  5J1Q A;  1FBV A;  2JEV A;  3B3V A;  1AYE A;  1IID A;  4B10 A;  2GP4 A;  1EO0 A;  4NEX A;  4AB7 A;  3VWE A;  4JWP A;  4PSX A;  1XE4 A;  1TIQ A;  4MCS A;  2D4O A;  4F9V A;  4OAE A;  4FD7 A;  5A27 A;  1BXR B;  1ZG8 A;  4CPA A;  2OR4 A;  3RAM A;  4HKF A;  3FVL A;  3FJU A;  3L2N A;  4HPS A;  5H84 A;  5H86 A;  4P4J A;  3IWG A;  4NF1 A;  3SXN A;  5G1Z A;  1ELM P;  4BIN A;  4EWT A;  5HVH A;  2YNC A;  5AXI A;  1CBX A;  1CP7 A;  1XEB A;  4L8A A;  3SXO A;  4YWY A;  4A94 A;  1V6C A;  5K8O A;  4G1P A;  4PXE A;  2ATR A;  4XPD C;  3I6S A;  4UWI A;  3KRV A;  3PRT A;  4CGL A;  3I74 A;  4GS4 A;  3D7H A;  1LFW A;  3MN8 A;  2ZW7 A;  4H6U A;  4I49 A;  2QEC A;  2FT0 A;  4MCR A;  1YSJ A;  5LYL A;  4E0A A;  1NBW A;  2E28 A;  3FEC A;  2PVW A;  4JD6 A;  1FY7 A;  4M85 A;  3NFQ A;  3VRO A;  4F8Z A;  2PJ4 A;  2B5G B;  1YW6 A;  2O28 A;  2QJ8 A;  3G3S A;  3GYA A;  4KZT A;  2POK A;  1YQE A;  2AFM A;  3CT9 A;  3F8K A;  4PXB A;  4ONW A;  3KHZ A;  1BPM A;  3GLJ A;  1CM0 A;  2CTB A;  3FED A;  2PJ3 A;  4J3G A;  5AG6 A;  3B3W A;  3TO6 A;  1IB1 E;  4UEF A;  4NGS A;  4AVA A;  1PCA A;  5BY0 A;  2G0B A;  4UBR A;  4UIA A;  5F47 A;  3I3G A;  4PK3 A;  5ELY A;  1L0C A;  1XJO A;  4AVB A;  4MCP A;  5JYB A;  1IYL A;  3LD2 A;  4ZY1 A;  5HVG A;  4ONU A;  4NGR A;  4A31 A;  1ZYM A;  4KVO E;  4P44 A;  3R95 A;  5AGE A;  2OZU A;  2FCK A;  2AUN A;  3FX6 A;  2Z3K A;  1VKC A;  4LQ6 A;  4YU9 A;  3HMJ G;  3TLZ A;  4GM5 A;  1XMT A;  3FIX A;  4OC1 A;  4RR2 B;  1LAP A;  3GIU A;  4C8A A;  1BLL E;  4FUU A;  2XPL A;  4KLV A;  3UY5 A;  2C1C A;  4UFX A;  1B87 A;  2CY2 A;  1I1D A;  4FBE A;  3WT4 A;  3QB8 A;  1KBL A;  3D7G A;  2P6E A;  4OIW A;  4WJB A;  5HKY A;  2FSR A;  4JXQ A;  3VWD A;  4CYQ A;  5GCN A;  1QSR A;  4KUA A;  3EZA A;  4C8C A;  1ON0 A;  1V0C A;  1S5K A;  1Y9K A;  1HDQ A;  1M6V B;  3BUO B;  1IIC A;  2FS5 A;  4U5Y A;  5KTD A;  3EFA A;  2Z11 A;  1QSN A;  4KUB A;  2GLJ A;  2BO9 A;  1Y7R A;  2Q4Z A;  3DLJ A;  4F6A A;  5I0C A;  5LYD A;  2DF5 A;  4LX9 A;  3HLP A;  2FM4 A;  3KHX A;  4PQA A;  4OKO A;  1S3Z A;  1VHS A;  1IY7 A;  2GAN A;  4NJQ A;  4WWV A;  7CPA A;  3ISZ A;  4IUS A;  4CRY B;  5J8F A;  4A4B A;  4CO9 A;  1LRZ A;  1EZA A;  3BUX B;  4TJX A;  3KGQ A;  3FRM A;  4A32 A;  4KS9 A;  1C30 B;  3IWE A;  4CAF A;  2PIZ A;  3T90 A;  2DIK A;  3U1B A;  2EBJ A;  5HKZ A;  4C8T A;  2EVN A;  3FEE A;  4ZY0 A;  5F1Y A;  4XPK A;  2YND A;  5F13 A;  1VGY A;  1ZL0 A;  2VI7 A;  2V8G A;  4R87 A;  4B5O A;  2IQ6 A;  1NE9 A;  4IF5 A;  4KVX A;  4UF4 A;  4CAE A;  1XF1 A;  3SR3 A;  1OBR A;  3GKR A;  3S9L A;  3CXP A;  3D2P A;  4QC6 A;  1I12 A;  3B2Y A;  4K3N A;  1PU9 A;  5JH9 A;  3R9F A;  4OC5 A;  1YLO A;  5D8N A;  5THW A;  4BPU B;  3T5M A;  3LAC A;  1KZF A;  1MJA A;  1Q7L A;  2EUI A;  4FD5 A;  4M6H A;  4E8O A;  2YJT A;  8CPA A;  1BPN A;  3QNV A;  1YX0 A;  2PE3 A;  4MI4 A;  1XRY A;  1F57 A;  1WWZ A;  2FIA A;  3B3S A;  4MHN A;  4P4E A;  4B13 A;  1EZB A;  3SHP A;  1KWM A;  3RO0 A;  4RI1 A;  4UEZ A;  4CDK A;  5LRK A;  2HUZ A;  1X10 A;  3GY9 A;  2JBK A;  4HNW B;  2EK9 A;  1TF9 A;  2PCN A;  3PLF B;  2PJ1 A;  4P45 A;  2Z3O A;  2EZB A;  3TOB A;  2Y1M A;  2ZOG A;  4PSW A;  2B3U A;  4U9Z A;  2CNT A;  4A2Z A;  3FNC A;  3W6S A;  3D7D A;  3D67 A;  1YR0 A;  4MFP A;  2CNS A;  4P10 A;  4X2T A;  2MP0 A;  3OP0 A;  4Q7A A;  2NMT A;  2BL1 A;  4H6Z A;  4EVY A;  2R82 A;  4CDJ A;  3GJZ A;  5G21 A;  2DEA A;  1XOV A;  4Z65 A;  2Z3P A;  2ZW4 A;  1IU8 A;  3B7I A;  3BUN B;  2DPS A;  4MHZ A;  4CGM A;  3NH8 A;  4QUS A;  1YRE A;  4R6T A;  2HRO A;  4X3R A;  3KQX A;  1P0H A;  1B6B A;  3DR8 A;  5IX3 A;  1U6M A;  3RYO A;  4MY3 A;  3EXN A;  2C6C A;  2XEF A;  3BI0 A;  1QQ9 A;  3NE8 A;  1EE3 P;  2GU2 A;  2RFH A;  1A9X B;  2VZZ A;  4C7I A;  2Z0Z A;  3EY5 A;  4KSF A;  4JVO A;  3BLN A;  1KUY A;  1Y9W A;  2V8V A;  4M3S A;  4CRZ B;  4NGT A;  4K30 A;  4QBJ A;  1ZRS A;  2PJC A;  3IO1 A;  3K9T A;  3P2H A;  3R9E A;  2QYV A;  4ZYQ A;  3VRP A;  2PIY A;  3DR6 A;  4KOY A;  2Q44 A;  1Q2D A;  4OC0 A;  3D68 A;  4PV6 A;  4II9 A;  1JDE A;  4C9V A;  4C9R A;  3WC5 A;  4C9E A;  1Y0Y A;  4C8U A;  4KOX A;  4MBU A;  3IWW A;  5LRJ A;  4EYS A;  2FE7 A;  3RZA A;  4C85 A;  4CAX A;  2HB6 A;  2XPO A;  1M4I A;  1YGH A;  3KAS A;  3S9M A;  2IL4 A;  4LQG A;  2ANP A;  2PJ2 A;  3SJF A;  2ZPA A;  3IGR A;  4B12 A;  2FL4 A;  1RXT A;  3TOA A;  4C9U A;  4GPL B;  2PJ7 A;  3BJ7 A;  4MCQ A;  4KOW A;  4C8P A;  3TLY A;  2Q4V A;  4KOR A;  4M6I A;  5JGF A;  2ZEG A;  3C26 A;  3BJ8 A;  4HNX B;  3O8Z A;  3PP9 A;  4DYO A;  1MJ9 A;  3BUM B;  4OME A;  4NGQ A;  5EMI A;  3VRQ A;  1BO4 A;  1M4D A;  3CXS A;  6CPA A;  1YVO A;  4XPL A;  4ZI6 A;  3S6F A;  3U88 C;  3OWC A;  4UWJ A;  2VZY A;  1FNO A;  3F5B A;  5FD8 A;  4NCZ A;  1S7L A;  1YLE A;  4EME A;  3F0A A;  1LCP A;  1A2Z A;  4NGM A;  2EK8 A;  3KR4 A;  1MK4 A;  4IK2 A;  4KOT A;  2PRQ A;  4B14 A;  4J0N A;  1IGB A;  3KZW A;  4HNY B;  1Z8W A;  4IHM A;  2RC4 A;  4UCM A;  5JM6 A;  1TKH A;  4R57 A;  3IIB A;  3RBU A;  4A39 A;  1KUV A;  4X5K A;  4A37 A;  4TWE A;  4NGP A;  5JPH A;  5F49 A;  3LWU A;  4NSQ A;  3JRU A;  2XPN A;  3S6K A;  4IIY A;  3K4I A;  2D0P A;  2BEI A;  2Y1N A;  5AG7 A;  3TLG A;  4CYN A;  4AG9 A;  4UFV A;  1XBU A;  2ARH A;  2G3A A;  2YNC C;  1GGO A;  5HMN A;  3DGV A;  1CX8 A;  2HQY A;  4OLL A;  3VGO A;  1ZLH A;  3R9G A;  2DPT A;  2XEJ A;  1NXJ A;  4MJX A;  2YNE A;  1UWY A;  3PB6 X;  4MXU A;  2PQ8 A;  1JQG A;  4UA3 A;  2BCO A;  2O53 A;  3H8F A;  3WR7 A;  2P6G A;  3H4Q A;  1Z8L A;  1IYK A;  3N7Z A;  4F0Y A;  5LYF A;  3TLE A;  1CP6 A;  5G20 A;  1KEE B;  3PBB A;  4B5P B;  4DNC A;  4C2Y A;  3TFY A;  4KOU A;  1QSO A;  2H5M A;  4YGO A;  5I4M A;  2GRE A;  1I21 A;  3T8W A;  3G8W A;  5CBM A;  1B47 A;  2ZXV A;  1IOF A;  3JUW A;  3V38 A;  1CS0 B;  1YVK A;  1WVM A;  5E96 A;  2OB0 A;  3C8O A;  3W91 A;  3EC4 A;  3IC1 A;  4PPZ A;  2AFU A;  3EO4 A;  5AG4 A;  2I00 A;  1J3L A;  2J9A A;  3H8E A;  4XNH B;  2GFQ A;  2PJB A;  2ZW5 A;  3OAK A;  3RNZ A;  1S7F A;  3CDX A;  5JQ4 A;  4OC2 A;  5HH1 A; 
#chains in the Genus database with same CATH homology
 2ZEL A;  4RUH A;  2XEG A;  1ARL A;  3N5F A;  2RB7 A;  4NFR A;  1NSA A;  4C9A A;  3K2K A;  5LYI A;  2PJ8 A;  3B3T A;  2I3C A;  4P4F A;  2Q43 A;  2ZEN A;  3NFZ A;  3PB9 X;  4P6Y A;  3FH4 A;  2F8H A;  2WZN A;  2FVG A;  1AMP A;  2ZEM A;  3CPX A;  5IR2 A;  5K8P A;  2V8H A;  1QMU A;  3PFE A;  4MRI A;  1CPX A;  2BOA A;  2ZEF A;  2NYQ A;  3BXM A;  1FT7 A;  3FMC A;  1DTD A;  1RTQ A;  1F2P A;  4A38 A;  1VHO A;  2EWB A;  1Y9Z A;  2JEW A;  4ZX9 A;  3IFE A;  3PBE A;  4DUK A;  2GLF A;  4C84 A;  3B35 A;  4FAI A;  1LAM A;  4KSI A;  2V77 A;  1ELL P;  1HEE A;  3SI2 A;  2PJ6 A;  2IJZ A;  3ISX A;  1TXR A;  2XEI A;  1YME A;  3PB4 X;  3TX8 A;  5IB9 A;  5F09 A;  3MRU A;  2C6P A;  1M4L A;  2ZOF A;  2ABZ A;  1TF8 A;  5CPA A;  4MHP A;  4NGN A;  4C86 A;  3D4U A;  1GYT A;  4UEE A;  4OP4 A;  1VHE A;  3IEH A;  3VAR A;  2VL1 A;  4TJV A;  2AFW A;  1R43 A;  2Q51 A;  2NSM A;  2ZEH A;  2WYR A;  3D7F A;  2OOT A;  3VAT A;  3KL9 A;  2IMO A;  4ZY2 A;  2O4H A;  2F7V A;  2C5Q A;  4KNG E;  2QVP A;  4PXC A;  5K8N A;  3GB0 A;  2PVV A;  1DE4 C;  3IJ3 A;  5DS0 A;  2HC9 A;  3TC8 A;  2ZEP A;  1Z5R A;  1BAV A;  2CF4 A;  3B3C A;  3NA6 A;  3S9N A;  1ZLI A;  4PXD A;  4EFD A;  3SI1 A;  5HXD A;  1LAN A;  3PB7 X;  4P4B A;  3PEI A;  4W9Y A;  3KQZ A;  4OID A;  3SI0 A;  4X8I A;  3GUX A;  1PYT B;  4P4D A;  1F2O A;  3WC6 A;  4R8F A;  4OC3 A;  1VIX A;  2PJ5 A;  3LMS A;  4JZ0 A;  4IAV A;  1XFO A;  4MMO A;  4C8F A;  1CG2 A;  2PCU A;  4O23 A;  3KR5 A;  2CTC A;  3PFO A;  3V7Z A;  4C99 A;  4R76 A;  5LRG A;  2AFZ A;  3SJX A;  2PJA A;  3NH4 A;  1ZG9 A;  2JBJ A;  2V8D A;  2G9D A;  1TKJ A;  1R3N A;  1CPS A;  3BI1 A;  2C6G A;  3PB8 X;  2PJ9 A;  3I1U A;  3WC7 A;  1H8L A;  5K8M A;  1ZG7 A;  1Z2L A;  4NJR A;  1Y0R A;  4YN3 A;  1Y7E A;  4BD9 A;  4B6Z A;  1HDU A;  3WAB A;  5D29 A;  3CPA A;  2AFS A;  2PJ0 A;  3SJG A;  3HUV A;  4R7M A;  4JYW A;  2AFX A;  3ICU A;  4MHY A;  3H8G A;  5HVF A;  2AFO A;  4P4I A;  2ZED A;  2ZEE A;  3BHX A;  3KI9 A;  4FWU A;  4F9U A;  1LOK A;  3D66 A;  2CIJ A;  4TNU A;  4OC4 A;  3EIF A;  4H2K A;  3FF3 A;  1TKF A;  2ZEO A;  3VTA A;  3VH9 A;  3SJE A;  1YW4 A;  4UIB A;  4DJL A;  4AXV A;  4ZX8 A;  1ARM A;  1XMB A;  3NH5 A;  5J1Q A;  3B3V A;  1AYE A;  2GP4 A;  4MCS A;  4F9V A;  1ZG8 A;  4CPA A;  2OR4 A;  3RAM A;  3FVL A;  3FJU A;  3L2N A;  4P4J A;  4EWT A;  1ELM P;  5HVH A;  1CBX A;  1CP7 A;  4YWY A;  4A94 A;  1V6C A;  5K8O A;  4G1P A;  4PXE A;  3I6S A;  3PRT A;  3I74 A;  3D7H A;  1LFW A;  3MN8 A;  4MCR A;  1YSJ A;  5LYL A;  3FEC A;  2PVW A;  4F8Z A;  2PJ4 A;  1YW6 A;  2QJ8 A;  4PXB A;  2POK A;  2AFM A;  3CT9 A;  4ONW A;  3KHZ A;  1BPM A;  3GLJ A;  2CTB A;  3FED A;  2PJ3 A;  3B3W A;  4UEF A;  4NGS A;  1PCA A;  4UIA A;  5ELY A;  1XJO A;  4MCP A;  4ZY1 A;  5HVG A;  4NGR A;  4P44 A;  3FX6 A;  4YU9 A;  4GM5 A;  4OC1 A;  1LAP A;  4C8A A;  1BLL E;  4FUU A;  2C1C A;  4FBE A;  3WT4 A;  3D7G A;  4OIW A;  4WJB A;  4C8C A;  1HDQ A;  2GLJ A;  2BO9 A;  2Q4Z A;  3DLJ A;  5LYD A;  3HLP A;  3KHX A;  4PQA A;  4OKO A;  1IY7 A;  4NJQ A;  4WWV A;  7CPA A;  3ISZ A;  4TJX A;  3KGQ A;  2PIZ A;  4C8T A;  3FEE A;  4ZY0 A;  1VGY A;  2V8G A;  2IQ6 A;  4UF4 A;  1XF1 A;  1OBR A;  3S9L A;  3B2Y A;  4K3N A;  5JH9 A;  4OC5 A;  1YLO A;  5D8N A;  5THW A;  1Q7L A;  8CPA A;  1BPN A;  3QNV A;  2PE3 A;  1XRY A;  1F57 A;  3B3S A;  4MHN A;  4P4E A;  1KWM A;  4UEZ A;  4CDK A;  5LRK A;  2JBK A;  2EK9 A;  1TF9 A;  2PJ1 A;  4P45 A;  2ZOG A;  3D7D A;  3D67 A;  4P10 A;  4X2T A;  4Q7A A;  4CDJ A;  2DEA A;  4Z65 A;  3B7I A;  4MHZ A;  3NH8 A;  4R6T A;  4X3R A;  3KQX A;  2C6C A;  2XEF A;  3BI0 A;  1QQ9 A;  1EE3 P;  2GU2 A;  2RFH A;  2V8V A;  4NGT A;  2PJC A;  3IO1 A;  3K9T A;  4ZYQ A;  2QYV A;  2PIY A;  4C9V A;  3D68 A;  4C9R A;  4OC0 A;  3WC5 A;  4C9E A;  1Y0Y A;  4C8U A;  5LRJ A;  3IWW A;  3RZA A;  4C85 A;  2HB6 A;  3KAS A;  3S9M A;  4LQG A;  2ANP A;  2PJ2 A;  3SJF A;  4C9U A;  2PJ7 A;  4MCQ A;  4C8P A;  5JGF A;  2ZEG A;  4DYO A;  4OME A;  4NGQ A;  6CPA A;  4ZI6 A;  1FNO A;  4EME A;  1LCP A;  4NGM A;  2EK8 A;  3KR4 A;  4IK2 A;  2PRQ A;  1IGB A;  3KZW A;  4IHM A;  5JM6 A;  1TKH A;  3IIB A;  3RBU A;  4A39 A;  4A37 A;  4TWE A;  4NGP A;  3LWU A;  3JRU A;  1XBU A;  3DGV A;  1CX8 A;  1ZLH A;  2XEJ A;  1UWY A;  3PB6 X;  4MXU A;  1JQG A;  2BCO A;  2O53 A;  3H8F A;  5LYF A;  1Z8L A;  1CP6 A;  3PBB A;  5I4M A;  2GRE A;  3T8W A;  5CBM A;  3V38 A;  1WVM A;  3IC1 A;  4PPZ A;  2AFU A;  2J9A A;  3H8E A;  2PJB A;  3CDX A;  4OC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...