3BHXA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of asp-glu
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bhxA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bhxA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bhxA02
1Y0YA 3I1UA 4C84A 3HLPA 3PB4X 3K2KA 3WABA 2C6CA 5IB9A 4WJBA 4PXCA 5ELYA 2C1CA 1IY7A 2BOAA 3FEDA 4F9VA 4C9AA 4JZ0A 4PXEA 2XEGA 4G1PA 4ZY1A 4EFDA 2V8DA 4NGPA 3D7GA 3D7FA 1HDUA 1CP6A 3WC6A 2PJ5A 4MCRA 4NJQA 2G9DA 2PVWA 2IMOA 4R6TA 4TNUA 2ZEDA 3PB8X 4OC2A 1QMUA 2PJ0A 4TWEA 5D8NA 1ELMP 2XEJA 5HVHA 1AMPA 4X2TA 3I6SA 4F9UA 4YU9A 6CPAA 3PFEA 3FVLA 4C9RA 1BPMA 1ZLHA 4A39A 4RUHA 3GB0A 2V8GA 4UIAA 5K8MA 4NGNA 2XEIA 5HVFA 4OC4A 4YN3A 1V6CA 4C8AA 4OKOA 3KR5A 4MHZA 3CPXA 2QYVA 4MHPA 2EWBA 1TKHA 3EIFA 4C8UA 1NSAA 2AFMA 1AYEA 4H2KA 3IC1A 1VHOA 2JEWA 4UEFA 2RB7A 1XRYA 4PQAA 1XF1A 1LOKA 2ZELA 3B3WA 2AFXA 5LYIA 2OR4A 2POKA 1VGYA 1CP7A 2GLFA 3D7HA 4OIWA 2PJCA 3V38A 3B3VA 5LYLA 4NGRA 4UIBA 3LWUA 1CPSA 5JGFA 3SJEA 4GM5A 3NH8A 3MRUA 1ARMA 4DYOA 4OP4A 4A94A 3TC8A 1LANA 3HUVA 3JRUA 4C9UA 1H8LA 3BI0A 3MN8A 1F2OA 2BO9A 3N5FA 4P44A 2PJ8A 1F57A 1Z5RA 4FBEA 3FMCA 1TXRA 2QJ8A 3RAMA 1RTQA 1Z8LA 7CPAA 2PJ2A 1CPXA 2FVGA 1ZG8A 3BI1A 3GLJA 4A37A 5JM6A 3KGQA 3FEEA 4KSIA 4EMEA 2BCOA 3KHZA 1YLOA 2ABZA 4NGMA 2ZEMA 3B35A 4X3RA 1TF9A 4PXDA 4IHMA 2GLJA 2J9AA 1YMEA 3KASA 4P45A 3CPAA 2PIZA 3SJGA 3PB7X 3FJUA 5K8NA 2JBJA 2WZNA 3SI1A 2GREA 1YSJA 3GUXA 3K9TA 3IO1A 3SJXA 3PFOA 4C8TA 2XEFA 5LYDA 3NH5A 4C8CA 3IJ3A 4ZYQA 1XJOA 2PCUA 3NA6A 4MHNA 3S9LA 4ZX9A 4UF4A 4P4EA 3KHXA 2IQ6A 1OBRA 5LRKA 1F2PA 2ANPA 4A38A 5K8OA 2ZOGA 2OOTA 1ARLA 3KI9A 2HC9A 1DTDA 4FUUA 4P4FA 4OC5A 3B3TA 4MHYA 2EK8A 3H8GA 1EE3P 3V7ZA 1QQ9A 4OC1A 1PCAA 4C8FA 4ZX8A 3CDXA 4NGQA 4NGTA 5CPAA 4B6ZA 1R43A 1LAPA 5LYFA 4FWUA 4CDJA 3FF3A 2F7VA 2NYQA 2ZEPA 4JYWA 2AFSA 1PYTB 3IIBA 2HB6A 4R7MA 2AFOA 3PBBA 2PJ4A 1LAMA 2ZEOA 4MRIA 5J1QA 2CTCA 4TJVA 2JBKA 1VIXA 2NSMA 3H8FA 2CIJA 2V77A 3RZAA 3SJFA 3B2YA 4ZY2A 4LQGA 4ZY0A 4C9EA 4K3NA 3IWWA 2I3CA 3SI2A 1TF8A 4X8IA 3L2NA 3VTAA 2IJZA 4BD9A 4C8PA 1XBUA 4C85A 4OMEA 3T8WA 2Q43A 2O53A 2PJBA 3FX6A 4P4IA 4UEZA 5CBMA 1BAVA 1BLLE 3D7DA 4DJLA 3D67A 1DE4C 3D4UA 4PPZA 2V8VA 1CBXA 2C6PA 4MXUA 2ZENA 3PB6X 1CX8A 3B3CA 1Y0RA 4IK2A 4MMOA 1IGBA 3WC7A 1UWYA 4CPAA 5I4MA 3KR4A 2C6GA 3PB9X 3ISZA 2WYRA 2QVPA 3RBUA 3KQXA 2PIYA 3KL9A 4KNGE 3KZWA 4NJRA 3VARA 2VL1A 1FT7A 4P6YA 2AFWA 2ZEGA 5LRJA 4DUKA 1Y9ZA 1Y7EA 1HEEA 3CT9A 3S9NA 3DGVA 3IFEA 5LRGA 4P4BA 2EK9A 4MCQA 1R3NA 3NH4A 2GU2A 4P10A 5D29A 4C9VA 3KQZA 4R8FA 3NFZA 3WT4A 3B7IA 4Z65A 2PVVA 5DS0A 3QNVA 4Q7AA 3PEIA 2ZEEA 3FH4A 3ISXA 1TKJA 3S9MA 2PE3A 3IEHA 4FAIA 1XFOA 3B3SA 5HXDA 3D66A 5HVGA 2ZEFA 4MCPA 2PJ6A 4ONWA 3SI0A 4P4DA 5JH9A 3I74A 2Q51A 3ICUA 1Z2LA 2PRQA 4OC3A 4W9YA 3VATA 1HDQA 1M4LA 1YW4A 4UEEA 1ZG9A 4F8ZA 2O4HA 1YW6A 2PJ7A 1VHEA 3H8EA 1JQGA 2AFUA 1GYTA 8CPAA 4P4JA 1ELLP 4OIDA 3FECA 4IAVA 4C86A 2ZOFA 2PJAA 2RFHA 4NFRA 4CDKA 3PRTA 4PXBA 3LMSA 2V8HA 3VH9A 4MCSA 1KWMA 4NGSA 3WC5A 1TKFA 1CG2A 2AFZA 2ZEHA 5THWA 2CTBA 1XMBA 3BXMA 2PJ3A 1LFWA 4O23A 2PJ9A 3PBEA 4YWYA 1ZLIA 3D68A 2DEAA 2Q4ZA 1ZG7A 1BPNA 2PJ1A 5K8PA 4EWTA 3DLJA 3TX8A 2F8HA 2CF4A 1WVMA 4TJXA 4OC0A 1FNOA 4ZI6A 5F09A 4WWVA 3BHXA 1Q7LA 1LCPA 4R76A 4AXVA 4C99A
chains in the Genus database with same CATH superfamily
1I1DA 1J3LA 1Y0YA 3I1UA 4CGMA 3FXTA 4C84A 3HLPA 3PB4X 1Z8TA 2GE3A 4B5OA 3K2KA 5G20A 2C6CA 3WABA 5A28A 3P2HA 5IB9A 4FD4A 4JJXA 4MY3A 4HNWB 4WJBA 4PXCA 5ELYA 3R95A 2C1CA 2B0AA 2Q7SA 1IY7A 2BOAA 4CYPA 3TYXA 3OWCA 3FEDA 4OLLA 4B14A 1WK4A 3F0AA 4LUAA 4F9VA 1NXJA 4C9AA 3LACA 4JWPA 4JZ0A 4PXEA 4BINA 4KLVA 2XEGA 1P4NA 2FE7A 4G1PA 4ZY1A 2YJVA 2D0PA 4EFDA 2V8DA 3D8PA 4NGPA 1Z9EA 2HV2A 3D7GA 1IOIA 2CNSA 2Q4VA 4B5PA 1K4JA 3D7FA 1IOFA 1CP6A 1HDUA 2FS5A 4KOWA 4B10A 4XNHC 2FM4A 3WC6A 4MBUA 2PJ5A 3PZJA 4MCRA 3TLZA 4NJQA 4B11A 2G9DA 2PVWA 1Y7RA 2IMOA 3U1BA 3W91A 3FRMA 3VROA 4R6TA 5JQ4A 4AG7A 4CGLA 4TNUA 2ZEDA 3PB8X 4OC2A 3DDDA 5AGEA 4CS0B 1QMUA 4MI4A 2PJ0A 4TWEA 5D8NA 4IIYA 1ELMP 2XEJA 3S6HA 5HVHA 2G3AA 1AMPA 4X2TA 3I6SA 4F9UA 4YU9A 4ONUA 6CPAA 3PFEA 4C2ZA 3FVLA 4C9RA 1MK4A 4MFQA 2R8VA 4QB9A 1GGOA 1BPMA 2HUZA 3VRQA 1ZLHA 4A39A 3I3GA 4RUHA 1B6BA 2QIRA 4PSXA 1QSRA 3GB0A 2V8GA 4JXRA 3T90A 2G0BA 4UIAA 5K8MA 2CY2A 3VRNA 3JUWA 1X12A 4NGNA 2XEIA 3U88C 2BEIA 3F5BA 3W6XA 3GJZA 5HVFA 3TLCA 2BSWA 4OC4A 4XPDC 4YN3A 5K99A 4KSFA 2Z3LA 4Q38A 2BL1A 4C7IA 2VZYA 4E8OA 1V6CA 3R96A 4CGOA 4BPWB 3QAHA 4OKOA 3KR5A 4II9A 4J0NA 4C8AA 4MHZA 3IWEA 3CPXA 4YGOA 1Z8WA 2QYVA 4C2YA 3EZAA 1MJBA 3GKRA 2D4PA 4LX9A 1YGHA 4MHPA 4CYOA 2EWBA 4MJ8A 1TKHA 3NFQA 2J8NA 4MJXA 2WPWA 2B5GA 3EIFA 4ZGYB 4C8UA 1Z4EA 4KOVA 1NSAA 2AFMA 2J8RA 1AYEA 5IR2A 2P6EA 4H2KA 5EC4A 5F1YA 1R61A 4RS2A 1QSNA 4COBA 3TFYA 1M4IA 3FBUA 4QC6A 2R7HA 4UFVA 3TCVA 2D4OA 3OP0A 5HKYA 3IC1A 4NCZA 1VHOA 2JEWA 4UEFA 2RB7A 4BMHA 2OLSA 1XRYA 4PQAA 1XF1A 4CAFA 1LOKA 2HQYA 5E96A 2ZELA 5HH1A 3FB3A 3B3WA 2AFXA 5LYIA 2OR4A 2POKA 4J3GA 4UA3A 1VGYA 3KKWA 1CP7A 1FY7A 2GLFA 4HNXB 2YNCC 5DWMA 3D7HA 1FBVA 5H86A 4OIWA 5AG5A 2PJCA 3CXPA 4R9MA 4MFZA 3V38A 2P6FA 1KEEB 3TLYA 2PR1A 3S6FA 4A4BA 3B3VA 4HKFA 5LYLA 1SQHA 4NGRA 2CBLA 2Z3KA 2ZW5A 4XPLA 3TLEA 3O8ZA 2FSRA 3PGPA 2DLAA 5IB0A 4UIBA 1M44A 3LWUA 2EZCA 1CPSA 5JGFA 3SJEA 4GM5A 3NH8A 4FD5A 2YGWA 4K30A 3MRUA 3R9FA 1ARMA 3TO9A 4UFXA 2EVNA 4DYOA 4QBJA 2A4NA 4OP4A 4A94A 3TC8A 2IL4A 1LANA 4BPXB 2OB0A 3HUVA 3IGRA 3JRUA 4RN7A 4C9UA 1H8LA 2R82A 3BI0A 3MN8A 4CRZB 1F2OA 2BO9A 5JPHA 3BUWB 3N5FA 3F9KC 4P44A 5JVLA 2PJ8A 4GXHA 3DSBA 1F57A 1Z5RA 4FBEA 5G22A 3TLAA 4NSQA 3FMCA 1TXRA 5AXIA 1YVOA 1RTQA 2QJ8A 3D2PA 2AJ6A 3R1KA 4M6IA 3RAMA 1C30B 2YNDA 4KOYA 1Z8LA 4L8AA 4OADA 3TO7A 4MFLA 4GPLB 7CPAA 2QMLA 2PJ2A 1CPXA 2FVGA 1ZG8A 4Q36A 3D3SA 5JYBA 3BI1A 3GLJA 1TIQA 3T05A 1EO0A 4A37A 3D2MA 5JM6A 3KGQA 3FEEA 4IIXA 4KSIA 1CE8B 1KBLA 2C27A 4EMEA 4B5PB 3JTKA 4CYNA 3S6GA 2BCOA 2DF5A 3KHZA 4AVAA 4KORA 1YLOA 2ABZA 5FVJA 2P6GA 4NGMA 2ZEMA 3GY9A 3I9SA 2Z0ZA 3B35A 3SXOA 2VKZG 4X3RA 2YNCA 1TF9A 2VBQA 1Y9KA 4PXDA 4IHMA 4H89A 1S7KA 2GLJA 4INJA 1QSTA 4KVXA 2J9AA 2Y1MA 2PC1A 2Z10A 1QSMA 1YMEA 2Z3NA 5EBVA 5BWAB 3PT1A 3KASA 4P45A 3CPAA 2PIZA 3SJGA 3PB7X 4A32A 2DPTA 3FJUA 5K8NA 2JBJA 2WZNA 1YLEA 4CZ1A 1YVKA 3OAKA 3ZNIA 1IU8A 3SI1A 3NOJA 5AG6A 1LRZA 3TLGB 4Y49B 2GREA 2X0SA 3HPHE 1YSJA 1M4DA 2ZXVA 3A9LA 2GP4A 1GHEA 3GUXA 3K9TA 3IO1A 2VXKA 4C7HA 4JD6A 3SJXA 3QB8A 1IYKA 4E5SA 4KOSA 3PFOA 2EO8A 3S6KA 4C8TA 3VWDA 4U5YA 2QECA 2ZW6A 2XEFA 2H5MA 3NH5A 5LYDA 4C8CA 5HKWA 4PK3A 3IJ3A 1V0CA 1XJOA 2GIVA 4ZYQA 5C88A 2C5QA 4JLYA 4FD6A 5DWNA 1M6VB 2PCUA 3NA6A 2OU2A 3S9LA 4MHNA 4ZX9A 2HROA 3C8OA 4UF4A 4P4EA 3T0TA 3KHXA 4I49A 2IQ6A 1OBRA 5LRKA 1F2PA 2ANPA 4KUAA 4A38A 2I79A 1VI4A 5K8OA 2ZOGA 2OOTA 1B47A 4A31A 1ARLA 3KI9A 2Z11A 2HC9A 5KTDA 3EFAA 1J4JA 1EZAA 3RO0A 4PK2A 1DTDA 3DR8A 4EYSA 4JVOA 5AG7A 2B5GB 4FUUA 4P4FA 4OC5A 2XPNA 4A4CA 1XE4A 3G3SA 3B3TA 4F6AA 4MHYA 4MHDA 2EK8A 3HMJG 1EE3P 2ZW7A 2Z3MA 3H8GA 4FD7A 3V7ZA 3TE4A 1RO5A 2FL4A 1QQ9A 4COGA 2HWGA 4NEXA 4OC1A 2GANA 4MFPA 4XNHB 3LD2A 5F13A 1PCAA 4C8FA 4ZX8A 3CDXA 2AE6A 4NGQA 4NGTA 1S7LA 2R1IA 4M6GA 5CPAA 4B6ZA 1YREA 1R43A 2VI7A 3PLFB 1S5KA 1LAPA 3BJ8A 1IB1E 2PR8A 5LYFA 1DIKA 4MI1A 3CZXA 4FWUA 4CDJA 3VTAA 1ON0A 2ZW4A 3FF3A 2F7VA 2NYQA 3H4QA 4M6HA 2ZEPA 5EMIA 4EVYA 3KRVA 4JYWA 2AFSA 1PYTB 3QAYA 2FT0A 2K5TA 3IIBA 3LODA 2HB6A 1EZBA 2O28A 4R7MA 3GYAA 2AFOA 1MJAA 1X10A 4QUSA 4CAVA 3G23A 3PBBA 2B4DA 2PJ4A 1VHSA 4AB7A 1YK3A 1LAMA 4YFJA 3NE7A 1YX0A 2ZEOA 4UCMA 4RI1A 4AVBA 4XPDB 4KVME 4MRIA 4MY0A 2EBJA 1I12A 4MFKA 5J1QA 3ZZIA 2CTCA 4TJVA 1Z8XA 3GIUA 5GCNA 2JBKA 4KOXA 1M1DA 3R9GA 4A30A 5FD8A 4YRHA 5KTAA 5BY0A 1VKCA 1VIXA 4CGNA 2NSMA 1I21A 4A95A 3H8FA 2Q0YA 4B12A 2CIJA 3E0KA 2V77A 3RZAA 2PDOA 4B13A 2CNTA 3SJFA 3SR3A 1XOVA 3B2YA 1CM0A 1B87A 2VEZA 4UWJA 1Q2CA 4ZY2A 4LQGA 1KUVA 3F8KA 2VZZA 4K3NA 1Z4RA 4E2AA 3IWWA 4ZY0A 2AUNA 2I3CA 3SI2A 4R87A 1TF8A 3TOAA 2DIKA 3IU1A 3HPGG 1VBGA 3OB1B 4CGPA 1UFHA 4UWIA 3BUMB 3K4IA 2P0WA 4X8IA 3VGOA 2ATRA 1R57A 5I0CA 1JDEA 3L2NA 3T5MA 4A2ZA 4C68A 2IJZA 2REEA 4H6UA 4BD9A 1XBUA 2Z3PA 4H6ZA 5IV0A 2E28A 4C8PA 4C85A 4OMEA 1ZL0A 3T8WA 2Q43A 2O53A 3B8GA 3IWGA 3TTHA 3EC4A 2MP0A 1KZFA 1VBHA 2PJBA 4CRYB 3FX6A 3OB2B 4KUBA 4P4IA 4LQ6A 4UEZA 1XEBA 1IIDA 1Y9WA 1MJ9A 1BAVA 2REFA 5G1ZA 1BLLE 5CBMA 3D7DA 3JVNA 4M3SA 4KVOE 4DJLA 5F9MA 4AG9A 1AUGA 3D67A 1DE4C 3D4UA 1S60A 4BBHA 3MGDA 4PPZA 2V8VA 1CBXA 1PU9A 2JDDA 3TO6A 5ISVA 2C6PA 4GS4A 2R98A 4MXUA 2B4BA 2ZENA 3PB6X 1RXTA 3EY5A 3VWEA 4CAWA 1BXRB 1YVHA 3NE8A 2D0OA 4C2XA 3EZBA 1Q2YA 1Z9UA 5F46A 3WR7A 1CX8A 2ARHA 1Y0RA 3B3CA 4CYQA 1A9XB 2OZGA 4IK2A 1XIXA 3W6SA 3BLNA 1JDBC 1S3ZA 4MMOA 1IGBA 3WC7A 1UWYA 4ORFA 1NBWA 4CPAA 3TLBA 5I4MA 3KR4A 2C6GA 3PB9X 3ISZA 1KC7A 2WYRA 5F48A 4C9EA 2QVPA 3RBUA 4R3LA 3KQXA 4DNCA 3H5ZA 2PIYA 4F0XA 4UBRA 2JEVA 3KL9A 4HNYB 2YJTA 3FYNA 4KNGE 3KZWA 2VQYA 4NJRA 3VARA 2Q4YA 4AVCA 1FT7A 2VL1A 4BTFA 2AFWA 4MFJA 2ZEGA 3G8WA 4P6YA 2OZHA 5LRJA 3TT2A 4DUKA 1Y9ZA 3IU2A 1Y7EA 2ODFA 4R57A 1HEEA 2FIAA 3SXNA 3CT9A 3S9NA 2RC4A 2F5IA 2YNEA 4KLWA 2FIWA 3DGVA 3BJ7A 3ZJ0A 1OZPA 3IFEA 4QVTA 5LRGA 4P4BA 5F5XA 3SHPA 2AUMA 2B4JC 2EK9A 4MCQA 4ZBGA 4KOTA 2XPPA 1R3NA 3NH4A 1P0HA 3C26A 4RR2B 2GU2A 4KS9A 4P10A 5D29A 2CNMA 4C9VA 3KQZA 1IICA 1ZYMA 4R8FA 3NFZA 5IX3A 4M8DA 3TLGA 3WT4A 1JWQA 1ZO0A 3B7IA 4Z65A 2PVVA 5DS0A 3QNVA 4Q7AA 1XF8A 3PEIA 4C99A 1CJWA 2ZEEA 4BPUB 2FCKA 4M85A 3FH4A 2DXQA 2OH1A 4HPSA 2I00A 2Q7BA 3ISXA 1TKJA 4PSWA 3UY5A 3S9MA 2PE3A 2CXAA 4IF5A 1WJTA 1BOBA 3TOBA 2B58A 3IEHA 4A33A 3CXSA 4FAIA 2ZPAA 1XFOA 3FNCA 3B3SA 2B4DB 3EO4A 3PP9A 5KTCA 5HXDA 3D66A 2HI6A 5HVGA 4UCPA 2DPSA 5J8FA 2ZEFA 1Q2DA 4MCPA 2PJ6A 4ONWA 3SI0A 1S7NA 4P4DA 5JH9A 1NMTA 3I74A 1YR0A 2Q51A 3ICUA 3V8IA 5HKZA 1Z2LA 2JDCA 2PRQA 1C3OB 4OC3A 4W9YA 2WSAA 3T9YA 3FIXA 3VATA 1HDQA 4XPKA 1M4LA 1YW4A 4UEEA 1ZG9A 4F8ZA 2G3TA 2XPLA 2Q04A 2O4HA 1CS0B 1YW6A 2PJ7A 3DNSA 2UV8G 1QSOA 1VHEA 3H8EA 4H1HA 1JQGA 2AFUA 2NMTA 1GYTA 4UFWA 5F49A 1PUAA 1S7FA 3VRRA 8CPAA 4P4JA 1ELLP 4OIDA 3R9EA 1U6MA 4CAEA 2J8MA 3FECA 5G21A 5AG4A 4IAVA 4JXQA 2B3UA 5C82A 3T07A 4C86A 1N71A 2ZOFA 4CO9A 4UCNA 2PJAA 2RFHA 4NFRA 2EZAA 4CDKA 5A27A 3PRTA 4PXBA 2FXFA 5F47A 3LMSA 2V8HA 3VH9A 4MCSA 1KWMA 2Z3OA 4NGSA 3WC5A 2PSWA 1TKFA 1CG2A 1BO4A 2PRBA 2X7BA 2AFZA 3PFVA 4L89A 3BUNB 3BUXB 4E0AA 2ZEHA 4KZTA 5THWA 2PCNA 2CTBA 1XMBA 1WWZA 2N3AB 1XMTA 3BXMA 2KCWA 2EZBA 3EZEA 1IYLA 2PJ3A 2WUUA 1LFWA 2GFQA 3P2FA 4O23A 1KUXA 1NSLA 3BUOB 2PJ9A 3PBEA 4R3KA 2WPXA 3RYOA 1ZRSA 4F0YA 1M4GA 2B3VA 4YWYA 3RNZA 1L0CA 1ZLIA 3D68A 2DEAA 2Q4ZA 1ZG7A 2PQ8A 4KOUA 4IUSA 4PV6A 1BPNA 2Q44A 2PJ1A 3DR6A 4KSAA 5HMNA 4NXYA 5K8PA 5J3XA 1YQEA 2XPOA 4NF1A 4EWTA 3DLJA 3TX8A 3CXQA 2F8HA 4X5KA 2CF4A 1WVMA 4TJXA 4OC0A 1FNOA 4E94A 4ZI6A 3N7ZA 1T36B 5F09A 2JLMA 4OAEA 4WWVA 1Q5XA 1A2ZA 3BHXA 4Y49C 1Q7LA 2BUEA 4U9YA 1LCPA 2EUIA 4CAXA 4R76A 1KUYA 3EXNA 4U9ZA 5H84A 1NE9A 4AXVA 3K9UA 5J8CA 3VRPA 2Y0MA 5CNPA 2Y1NA 2OZUA
chains in the Genus database with same CATH topology
1Y0YA 3I1UA 4C84A 3HLPA 3PB4X 3K2KA 3WABA 2C6CA 5IB9A 4WJBA 4PXCA 5ELYA 2C1CA 1IY7A 2BOAA 3FEDA 4F9VA 4C9AA 4JZ0A 4PXEA 2XEGA 4G1PA 4ZY1A 4EFDA 2V8DA 4NGPA 3D7GA 3D7FA 1HDUA 1CP6A 3WC6A 2PJ5A 4MCRA 4NJQA 2G9DA 2PVWA 2IMOA 4R6TA 4TNUA 2ZEDA 3PB8X 4OC2A 1QMUA 2PJ0A 4TWEA 5D8NA 1ELMP 2XEJA 5HVHA 1AMPA 4X2TA 3I6SA 4F9UA 4YU9A 6CPAA 3PFEA 3FVLA 4C9RA 1BPMA 1ZLHA 4A39A 4RUHA 3GB0A 2V8GA 4UIAA 5K8MA 4NGNA 2XEIA 5HVFA 4OC4A 4YN3A 1V6CA 4C8AA 4OKOA 3KR5A 4MHZA 3CPXA 2QYVA 4MHPA 2EWBA 1TKHA 3EIFA 4C8UA 1NSAA 2AFMA 1AYEA 5IR2A 4H2KA 3IC1A 1VHOA 2JEWA 4UEFA 2RB7A 1XRYA 4PQAA 1XF1A 1LOKA 2ZELA 3B3WA 2AFXA 5LYIA 2OR4A 2POKA 1VGYA 1CP7A 2GLFA 3D7HA 4OIWA 2PJCA 3V38A 3B3VA 5LYLA 4NGRA 4UIBA 3LWUA 1CPSA 5JGFA 3SJEA 4GM5A 3NH8A 3MRUA 1ARMA 4DYOA 4OP4A 4A94A 3TC8A 1LANA 3HUVA 3JRUA 4C9UA 1H8LA 3BI0A 3MN8A 1F2OA 2BO9A 3N5FA 4P44A 2PJ8A 1F57A 1Z5RA 4FBEA 3FMCA 1TXRA 2QJ8A 3RAMA 1RTQA 1Z8LA 7CPAA 2PJ2A 1CPXA 2FVGA 1ZG8A 3BI1A 3GLJA 4A37A 5JM6A 3KGQA 3FEEA 4KSIA 4EMEA 2BCOA 3KHZA 1YLOA 2ABZA 4NGMA 2ZEMA 3B35A 4X3RA 1TF9A 4PXDA 4IHMA 2GLJA 2J9AA 1YMEA 3KASA 4P45A 3CPAA 2PIZA 3SJGA 3PB7X 3FJUA 5K8NA 2JBJA 2WZNA 3SI1A 2GREA 1YSJA 2GP4A 3GUXA 3K9TA 3IO1A 3SJXA 3PFOA 4C8TA 2XEFA 5LYDA 3NH5A 4C8CA 3IJ3A 4ZYQA 1XJOA 2C5QA 2PCUA 3NA6A 4MHNA 3S9LA 4ZX9A 4UF4A 4P4EA 3KHXA 2IQ6A 1OBRA 5LRKA 1F2PA 2ANPA 4A38A 5K8OA 2ZOGA 2OOTA 1ARLA 3KI9A 2HC9A 1DTDA 4FUUA 4P4FA 4OC5A 3B3TA 4MHYA 2EK8A 3H8GA 1EE3P 3V7ZA 1QQ9A 4OC1A 1PCAA 4C8FA 4ZX8A 3CDXA 4NGQA 4NGTA 5CPAA 4B6ZA 1R43A 1LAPA 5LYFA 4FWUA 4CDJA 3FF3A 2F7VA 2NYQA 2ZEPA 4JYWA 2AFSA 1PYTB 3IIBA 2HB6A 4R7MA 2AFOA 3PBBA 2PJ4A 1LAMA 2ZEOA 4MRIA 5J1QA 2CTCA 4TJVA 2JBKA 1VIXA 2NSMA 3H8FA 2CIJA 2V77A 3RZAA 3SJFA 3B2YA 4ZY2A 4LQGA 4ZY0A 4C9EA 4K3NA 3IWWA 2I3CA 3SI2A 1TF8A 4X8IA 3L2NA 3VTAA 2IJZA 4BD9A 4C8PA 1XBUA 4C85A 4OMEA 3T8WA 2Q43A 2O53A 2PJBA 3FX6A 4P4IA 4UEZA 5CBMA 1BAVA 1BLLE 3D7DA 4DJLA 3D67A 1DE4C 3D4UA 4PPZA 2V8VA 1CBXA 2C6PA 4MXUA 2ZENA 3PB6X 1CX8A 3B3CA 1Y0RA 4IK2A 4MMOA 1IGBA 3WC7A 1UWYA 4CPAA 5I4MA 3KR4A 2C6GA 3PB9X 3ISZA 2WYRA 2QVPA 3RBUA 3KQXA 2PIYA 3KL9A 4KNGE 3KZWA 4NJRA 3VARA 2VL1A 1FT7A 4P6YA 2AFWA 2ZEGA 5LRJA 4DUKA 1Y9ZA 1Y7EA 1HEEA 3CT9A 3S9NA 3DGVA 3IFEA 5LRGA 4P4BA 2EK9A 4MCQA 1R3NA 3NH4A 2GU2A 4P10A 5D29A 4C9VA 3KQZA 4R8FA 3NFZA 3WT4A 3B7IA 4Z65A 2PVVA 5DS0A 3QNVA 4Q7AA 3PEIA 2ZEEA 3FH4A 3ISXA 1TKJA 3S9MA 2PE3A 3IEHA 4FAIA 1XFOA 3B3SA 5HXDA 3D66A 5HVGA 2ZEFA 4MCPA 2PJ6A 4ONWA 3SI0A 4P4DA 5JH9A 3I74A 2Q51A 3ICUA 1Z2LA 2PRQA 4OC3A 4W9YA 3VATA 1HDQA 1M4LA 1YW4A 4UEEA 1ZG9A 4F8ZA 2O4HA 1YW6A 2PJ7A 1VHEA 3H8EA 1JQGA 2AFUA 1GYTA 8CPAA 4P4JA 1ELLP 4OIDA 3FECA 4IAVA 4C86A 2ZOFA 2PJAA 2RFHA 4NFRA 4CDKA 3PRTA 4PXBA 3LMSA 2V8HA 3VH9A 4MCSA 1KWMA 4NGSA 3WC5A 1TKFA 1CG2A 2AFZA 2ZEHA 5THWA 2CTBA 1XMBA 3BXMA 2PJ3A 1LFWA 4O23A 2PJ9A 3PBEA 4YWYA 1ZLIA 3D68A 2DEAA 2Q4ZA 1ZG7A 1BPNA 2PJ1A 5K8PA 4EWTA 3DLJA 3TX8A 2F8HA 2CF4A 1WVMA 4TJXA 4OC0A 1FNOA 4ZI6A 5F09A 4WWVA 3BHXA 1Q7LA 1LCPA 4R76A 4AXVA 4C99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0Y A;  3I1U A;  4C84 A;  3HLP A;  3PB4 X;  3K2K A;  3WAB A;  2C6C A;  5IB9 A;  4WJB A;  4PXC A;  5ELY A;  2C1C A;  1IY7 A;  2BOA A;  3FED A;  4F9V A;  4C9A A;  4JZ0 A;  4PXE A;  2XEG A;  4G1P A;  4ZY1 A;  4EFD A;  2V8D A;  4NGP A;  3D7G A;  3D7F A;  1HDU A;  1CP6 A;  3WC6 A;  2PJ5 A;  4MCR A;  4NJQ A;  2G9D A;  2PVW A;  2IMO A;  4R6T A;  4TNU A;  2ZED A;  3PB8 X;  4OC2 A;  1QMU A;  2PJ0 A;  4TWE A;  5D8N A;  1ELM P;  2XEJ A;  5HVH A;  1AMP A;  4X2T A;  3I6S A;  4F9U A;  4YU9 A;  6CPA A;  3PFE A;  3FVL A;  4C9R A;  1BPM A;  1ZLH A;  4A39 A;  4RUH A;  3GB0 A;  2V8G A;  4UIA A;  5K8M A;  4NGN A;  2XEI A;  5HVF A;  4OC4 A;  4YN3 A;  1V6C A;  4C8A A;  4OKO A;  3KR5 A;  4MHZ A;  3CPX A;  2QYV A;  4MHP A;  2EWB A;  1TKH A;  3EIF A;  4C8U A;  1NSA A;  2AFM A;  1AYE A;  4H2K A;  3IC1 A;  1VHO A;  2JEW A;  4UEF A;  2RB7 A;  1XRY A;  4PQA A;  1XF1 A;  1LOK A;  2ZEL A;  3B3W A;  2AFX A;  5LYI A;  2OR4 A;  2POK A;  1VGY A;  1CP7 A;  2GLF A;  3D7H A;  4OIW A;  2PJC A;  3V38 A;  3B3V A;  5LYL A;  4NGR A;  4UIB A;  3LWU A;  1CPS A;  5JGF A;  3SJE A;  4GM5 A;  3NH8 A;  3MRU A;  1ARM A;  4DYO A;  4OP4 A;  4A94 A;  3TC8 A;  1LAN A;  3HUV A;  3JRU A;  4C9U A;  1H8L A;  3BI0 A;  3MN8 A;  1F2O A;  2BO9 A;  3N5F A;  4P44 A;  2PJ8 A;  1F57 A;  1Z5R A;  4FBE A;  3FMC A;  1TXR A;  2QJ8 A;  3RAM A;  1RTQ A;  1Z8L A;  7CPA A;  2PJ2 A;  1CPX A;  2FVG A;  1ZG8 A;  3BI1 A;  3GLJ A;  4A37 A;  5JM6 A;  3KGQ A;  3FEE A;  4KSI A;  4EME A;  2BCO A;  3KHZ A;  1YLO A;  2ABZ A;  4NGM A;  2ZEM A;  3B35 A;  4X3R A;  1TF9 A;  4PXD A;  4IHM A;  2GLJ A;  2J9A A;  1YME A;  3KAS A;  4P45 A;  3CPA A;  2PIZ A;  3SJG A;  3PB7 X;  3FJU A;  5K8N A;  2JBJ A;  2WZN A;  3SI1 A;  2GRE A;  1YSJ A;  3GUX A;  3K9T A;  3IO1 A;  3SJX A;  3PFO A;  4C8T A;  2XEF A;  5LYD A;  3NH5 A;  4C8C A;  3IJ3 A;  4ZYQ A;  1XJO A;  2PCU A;  3NA6 A;  4MHN A;  3S9L A;  4ZX9 A;  4UF4 A;  4P4E A;  3KHX A;  2IQ6 A;  1OBR A;  5LRK A;  1F2P A;  2ANP A;  4A38 A;  5K8O A;  2ZOG A;  2OOT A;  1ARL A;  3KI9 A;  2HC9 A;  1DTD A;  4FUU A;  4P4F A;  4OC5 A;  3B3T A;  4MHY A;  2EK8 A;  3H8G A;  1EE3 P;  3V7Z A;  1QQ9 A;  4OC1 A;  1PCA A;  4C8F A;  4ZX8 A;  3CDX A;  4NGQ A;  4NGT A;  5CPA A;  4B6Z A;  1R43 A;  1LAP A;  5LYF A;  4FWU A;  4CDJ A;  3FF3 A;  2F7V A;  2NYQ A;  2ZEP A;  4JYW A;  2AFS A;  1PYT B;  3IIB A;  2HB6 A;  4R7M A;  2AFO A;  3PBB A;  2PJ4 A;  1LAM A;  2ZEO A;  4MRI A;  5J1Q A;  2CTC A;  4TJV A;  2JBK A;  1VIX A;  2NSM A;  3H8F A;  2CIJ A;  2V77 A;  3RZA A;  3SJF A;  3B2Y A;  4ZY2 A;  4LQG A;  4ZY0 A;  4C9E A;  4K3N A;  3IWW A;  2I3C A;  3SI2 A;  1TF8 A;  4X8I A;  3L2N A;  3VTA A;  2IJZ A;  4BD9 A;  4C8P A;  1XBU A;  4C85 A;  4OME A;  3T8W A;  2Q43 A;  2O53 A;  2PJB A;  3FX6 A;  4P4I A;  4UEZ A;  5CBM A;  1BAV A;  1BLL E;  3D7D A;  4DJL A;  3D67 A;  1DE4 C;  3D4U A;  4PPZ A;  2V8V A;  1CBX A;  2C6P A;  4MXU A;  2ZEN A;  3PB6 X;  1CX8 A;  3B3C A;  1Y0R A;  4IK2 A;  4MMO A;  1IGB A;  3WC7 A;  1UWY A;  4CPA A;  5I4M A;  3KR4 A;  2C6G A;  3PB9 X;  3ISZ A;  2WYR A;  2QVP A;  3RBU A;  3KQX A;  2PIY A;  3KL9 A;  4KNG E;  3KZW A;  4NJR A;  3VAR A;  2VL1 A;  1FT7 A;  4P6Y A;  2AFW A;  2ZEG A;  5LRJ A;  4DUK A;  1Y9Z A;  1Y7E A;  1HEE A;  3CT9 A;  3S9N A;  3DGV A;  3IFE A;  5LRG A;  4P4B A;  2EK9 A;  4MCQ A;  1R3N A;  3NH4 A;  2GU2 A;  4P10 A;  5D29 A;  4C9V A;  3KQZ A;  4R8F A;  3NFZ A;  3WT4 A;  3B7I A;  4Z65 A;  2PVV A;  5DS0 A;  3QNV A;  4Q7A A;  3PEI A;  2ZEE A;  3FH4 A;  3ISX A;  1TKJ A;  3S9M A;  2PE3 A;  3IEH A;  4FAI A;  1XFO A;  3B3S A;  5HXD A;  3D66 A;  5HVG A;  2ZEF A;  4MCP A;  2PJ6 A;  4ONW A;  3SI0 A;  4P4D A;  5JH9 A;  3I74 A;  2Q51 A;  3ICU A;  1Z2L A;  2PRQ A;  4OC3 A;  4W9Y A;  3VAT A;  1HDQ A;  1M4L A;  1YW4 A;  4UEE A;  1ZG9 A;  4F8Z A;  2O4H A;  1YW6 A;  2PJ7 A;  1VHE A;  3H8E A;  1JQG A;  2AFU A;  1GYT A;  8CPA A;  4P4J A;  1ELL P;  4OID A;  3FEC A;  4IAV A;  4C86 A;  2ZOF A;  2PJA A;  2RFH A;  4NFR A;  4CDK A;  3PRT A;  4PXB A;  3LMS A;  2V8H A;  3VH9 A;  4MCS A;  1KWM A;  4NGS A;  3WC5 A;  1TKF A;  1CG2 A;  2AFZ A;  2ZEH A;  5THW A;  2CTB A;  1XMB A;  3BXM A;  2PJ3 A;  1LFW A;  4O23 A;  2PJ9 A;  3PBE A;  4YWY A;  1ZLI A;  3D68 A;  2DEA A;  2Q4Z A;  1ZG7 A;  1BPN A;  2PJ1 A;  5K8P A;  4EWT A;  3DLJ A;  3TX8 A;  2F8H A;  2CF4 A;  1WVM A;  4TJX A;  4OC0 A;  1FNO A;  4ZI6 A;  5F09 A;  4WWV A;  3BHX A;  1Q7L A;  1LCP A;  4R76 A;  4AXV A;  4C99 A; 
#chains in the Genus database with same CATH topology
 1I1D A;  1J3L A;  1Y0Y A;  3I1U A;  4CGM A;  3FXT A;  4C84 A;  3HLP A;  3PB4 X;  1Z8T A;  2GE3 A;  4B5O A;  3K2K A;  5G20 A;  2C6C A;  3WAB A;  5A28 A;  3P2H A;  5IB9 A;  4FD4 A;  4JJX A;  4MY3 A;  4HNW B;  4WJB A;  4PXC A;  5ELY A;  3R95 A;  2C1C A;  2B0A A;  2Q7S A;  1IY7 A;  2BOA A;  4CYP A;  3TYX A;  3OWC A;  3FED A;  4OLL A;  4B14 A;  1WK4 A;  3F0A A;  4LUA A;  4F9V A;  1NXJ A;  4C9A A;  3LAC A;  4JWP A;  4JZ0 A;  4PXE A;  4BIN A;  4KLV A;  2XEG A;  1P4N A;  2FE7 A;  4G1P A;  4ZY1 A;  2YJV A;  2D0P A;  4EFD A;  2V8D A;  3D8P A;  4NGP A;  1Z9E A;  2HV2 A;  3D7G A;  1IOI A;  2CNS A;  2Q4V A;  4B5P A;  1K4J A;  3D7F A;  1IOF A;  1CP6 A;  1HDU A;  2FS5 A;  4KOW A;  4B10 A;  4XNH C;  2FM4 A;  3WC6 A;  4MBU A;  2PJ5 A;  3PZJ A;  4MCR A;  3TLZ A;  4NJQ A;  4B11 A;  2G9D A;  2PVW A;  1Y7R A;  2IMO A;  3U1B A;  3W91 A;  3FRM A;  3VRO A;  4R6T A;  5JQ4 A;  4AG7 A;  4CGL A;  4TNU A;  2ZED A;  3PB8 X;  4OC2 A;  3DDD A;  5AGE A;  4CS0 B;  1QMU A;  4MI4 A;  2PJ0 A;  4TWE A;  5D8N A;  4IIY A;  1ELM P;  2XEJ A;  3S6H A;  5HVH A;  2G3A A;  1AMP A;  4X2T A;  3I6S A;  4F9U A;  4YU9 A;  4ONU A;  6CPA A;  3PFE A;  4C2Z A;  3FVL A;  4C9R A;  1MK4 A;  4MFQ A;  2R8V A;  4QB9 A;  1GGO A;  1BPM A;  2HUZ A;  3VRQ A;  1ZLH A;  4A39 A;  3I3G A;  4RUH A;  1B6B A;  2QIR A;  4PSX A;  1QSR A;  3GB0 A;  2V8G A;  4JXR A;  3T90 A;  2G0B A;  4UIA A;  5K8M A;  2CY2 A;  3VRN A;  3JUW A;  1X12 A;  4NGN A;  2XEI A;  3U88 C;  2BEI A;  3F5B A;  3W6X A;  3GJZ A;  5HVF A;  3TLC A;  2BSW A;  4OC4 A;  4XPD C;  4YN3 A;  5K99 A;  4KSF A;  2Z3L A;  4Q38 A;  2BL1 A;  4C7I A;  2VZY A;  4E8O A;  1V6C A;  3R96 A;  4CGO A;  4BPW B;  3QAH A;  4OKO A;  3KR5 A;  4II9 A;  4J0N A;  4C8A A;  4MHZ A;  3IWE A;  3CPX A;  4YGO A;  1Z8W A;  2QYV A;  4C2Y A;  3EZA A;  1MJB A;  3GKR A;  2D4P A;  4LX9 A;  1YGH A;  4MHP A;  4CYO A;  2EWB A;  4MJ8 A;  1TKH A;  3NFQ A;  2J8N A;  4MJX A;  2WPW A;  2B5G A;  3EIF A;  4ZGY B;  4C8U A;  1Z4E A;  4KOV A;  1NSA A;  2AFM A;  2J8R A;  1AYE A;  5IR2 A;  2P6E A;  4H2K A;  5EC4 A;  5F1Y A;  1R61 A;  4RS2 A;  1QSN A;  4COB A;  3TFY A;  1M4I A;  3FBU A;  4QC6 A;  2R7H A;  4UFV A;  3TCV A;  2D4O A;  3OP0 A;  5HKY A;  3IC1 A;  4NCZ A;  1VHO A;  2JEW A;  4UEF A;  2RB7 A;  4BMH A;  2OLS A;  1XRY A;  4PQA A;  1XF1 A;  4CAF A;  1LOK A;  2HQY A;  5E96 A;  2ZEL A;  5HH1 A;  3FB3 A;  3B3W A;  2AFX A;  5LYI A;  2OR4 A;  2POK A;  4J3G A;  4UA3 A;  1VGY A;  3KKW A;  1CP7 A;  1FY7 A;  2GLF A;  4HNX B;  2YNC C;  5DWM A;  3D7H A;  1FBV A;  5H86 A;  4OIW A;  5AG5 A;  2PJC A;  3CXP A;  4R9M A;  4MFZ A;  3V38 A;  2P6F A;  1KEE B;  3TLY A;  2PR1 A;  3S6F A;  4A4B A;  3B3V A;  4HKF A;  5LYL A;  1SQH A;  4NGR A;  2CBL A;  2Z3K A;  2ZW5 A;  4XPL A;  3TLE A;  3O8Z A;  2FSR A;  3PGP A;  2DLA A;  5IB0 A;  4UIB A;  1M44 A;  3LWU A;  2EZC A;  1CPS A;  5JGF A;  3SJE A;  4GM5 A;  3NH8 A;  4FD5 A;  2YGW A;  4K30 A;  3MRU A;  3R9F A;  1ARM A;  3TO9 A;  4UFX A;  2EVN A;  4DYO A;  4QBJ A;  2A4N A;  4OP4 A;  4A94 A;  3TC8 A;  2IL4 A;  1LAN A;  4BPX B;  2OB0 A;  3HUV A;  3IGR A;  3JRU A;  4RN7 A;  4C9U A;  1H8L A;  2R82 A;  3BI0 A;  3MN8 A;  4CRZ B;  1F2O A;  2BO9 A;  5JPH A;  3BUW B;  3N5F A;  3F9K C;  4P44 A;  5JVL A;  2PJ8 A;  4GXH A;  3DSB A;  1F57 A;  1Z5R A;  4FBE A;  5G22 A;  3TLA A;  4NSQ A;  3FMC A;  1TXR A;  5AXI A;  1YVO A;  1RTQ A;  2QJ8 A;  3D2P A;  2AJ6 A;  3R1K A;  4M6I A;  3RAM A;  1C30 B;  2YND A;  4KOY A;  1Z8L A;  4L8A A;  4OAD A;  3TO7 A;  4MFL A;  4GPL B;  7CPA A;  2QML A;  2PJ2 A;  1CPX A;  2FVG A;  1ZG8 A;  4Q36 A;  3D3S A;  5JYB A;  3BI1 A;  3GLJ A;  1TIQ A;  3T05 A;  1EO0 A;  4A37 A;  3D2M A;  5JM6 A;  3KGQ A;  3FEE A;  4IIX A;  4KSI A;  1CE8 B;  1KBL A;  2C27 A;  4EME A;  4B5P B;  3JTK A;  4CYN A;  3S6G A;  2BCO A;  2DF5 A;  3KHZ A;  4AVA A;  4KOR A;  1YLO A;  2ABZ A;  5FVJ A;  2P6G A;  4NGM A;  2ZEM A;  3GY9 A;  3I9S A;  2Z0Z A;  3B35 A;  3SXO A;  2VKZ G;  4X3R A;  2YNC A;  1TF9 A;  2VBQ A;  1Y9K A;  4PXD A;  4IHM A;  4H89 A;  1S7K A;  2GLJ A;  4INJ A;  1QST A;  4KVX A;  2J9A A;  2Y1M A;  2PC1 A;  2Z10 A;  1QSM A;  1YME A;  2Z3N A;  5EBV A;  5BWA B;  3PT1 A;  3KAS A;  4P45 A;  3CPA A;  2PIZ A;  3SJG A;  3PB7 X;  4A32 A;  2DPT A;  3FJU A;  5K8N A;  2JBJ A;  2WZN A;  1YLE A;  4CZ1 A;  1YVK A;  3OAK A;  3ZNI A;  1IU8 A;  3SI1 A;  3NOJ A;  5AG6 A;  1LRZ A;  3TLG B;  4Y49 B;  2GRE A;  2X0S A;  3HPH E;  1YSJ A;  1M4D A;  2ZXV A;  3A9L A;  2GP4 A;  1GHE A;  3GUX A;  3K9T A;  3IO1 A;  2VXK A;  4C7H A;  4JD6 A;  3SJX A;  3QB8 A;  1IYK A;  4E5S A;  4KOS A;  3PFO A;  2EO8 A;  3S6K A;  4C8T A;  3VWD A;  4U5Y A;  2QEC A;  2ZW6 A;  2XEF A;  2H5M A;  3NH5 A;  5LYD A;  4C8C A;  5HKW A;  4PK3 A;  3IJ3 A;  1V0C A;  1XJO A;  2GIV A;  4ZYQ A;  5C88 A;  2C5Q A;  4JLY A;  4FD6 A;  5DWN A;  1M6V B;  2PCU A;  3NA6 A;  2OU2 A;  3S9L A;  4MHN A;  4ZX9 A;  2HRO A;  3C8O A;  4UF4 A;  4P4E A;  3T0T A;  3KHX A;  4I49 A;  2IQ6 A;  1OBR A;  5LRK A;  1F2P A;  2ANP A;  4KUA A;  4A38 A;  2I79 A;  1VI4 A;  5K8O A;  2ZOG A;  2OOT A;  1B47 A;  4A31 A;  1ARL A;  3KI9 A;  2Z11 A;  2HC9 A;  5KTD A;  3EFA A;  1J4J A;  1EZA A;  3RO0 A;  4PK2 A;  1DTD A;  3DR8 A;  4EYS A;  4JVO A;  5AG7 A;  2B5G B;  4FUU A;  4P4F A;  4OC5 A;  2XPN A;  4A4C A;  1XE4 A;  3G3S A;  3B3T A;  4F6A A;  4MHY A;  4MHD A;  2EK8 A;  3HMJ G;  1EE3 P;  2ZW7 A;  2Z3M A;  3H8G A;  4FD7 A;  3V7Z A;  3TE4 A;  1RO5 A;  2FL4 A;  1QQ9 A;  4COG A;  2HWG A;  4NEX A;  4OC1 A;  2GAN A;  4MFP A;  4XNH B;  3LD2 A;  5F13 A;  1PCA A;  4C8F A;  4ZX8 A;  3CDX A;  2AE6 A;  4NGQ A;  4NGT A;  1S7L A;  2R1I A;  4M6G A;  5CPA A;  4B6Z A;  1YRE A;  1R43 A;  2VI7 A;  3PLF B;  1S5K A;  1LAP A;  3BJ8 A;  1IB1 E;  2PR8 A;  5LYF A;  1DIK A;  4MI1 A;  3CZX A;  4FWU A;  4CDJ A;  3VTA A;  1ON0 A;  2ZW4 A;  3FF3 A;  2F7V A;  2NYQ A;  3H4Q A;  4M6H A;  2ZEP A;  5EMI A;  4EVY A;  3KRV A;  4JYW A;  2AFS A;  1PYT B;  3QAY A;  2FT0 A;  2K5T A;  3IIB A;  3LOD A;  2HB6 A;  1EZB A;  2O28 A;  4R7M A;  3GYA A;  2AFO A;  1MJA A;  1X10 A;  4QUS A;  4CAV A;  3G23 A;  3PBB A;  2B4D A;  2PJ4 A;  1VHS A;  4AB7 A;  1YK3 A;  1LAM A;  4YFJ A;  3NE7 A;  1YX0 A;  2ZEO A;  4UCM A;  4RI1 A;  4AVB A;  4XPD B;  4KVM E;  4MRI A;  4MY0 A;  2EBJ A;  1I12 A;  4MFK A;  5J1Q A;  3ZZI A;  2CTC A;  4TJV A;  1Z8X A;  3GIU A;  5GCN A;  2JBK A;  4KOX A;  1M1D A;  3R9G A;  4A30 A;  5FD8 A;  4YRH A;  5KTA A;  5BY0 A;  1VKC A;  1VIX A;  4CGN A;  2NSM A;  1I21 A;  4A95 A;  3H8F A;  2Q0Y A;  4B12 A;  2CIJ A;  3E0K A;  2V77 A;  3RZA A;  2PDO A;  4B13 A;  2CNT A;  3SJF A;  3SR3 A;  1XOV A;  3B2Y A;  1CM0 A;  1B87 A;  2VEZ A;  4UWJ A;  1Q2C A;  4ZY2 A;  4LQG A;  1KUV A;  3F8K A;  2VZZ A;  4K3N A;  1Z4R A;  4E2A A;  3IWW A;  4ZY0 A;  2AUN A;  2I3C A;  3SI2 A;  4R87 A;  1TF8 A;  3TOA A;  2DIK A;  3IU1 A;  3HPG G;  1VBG A;  3OB1 B;  4CGP A;  1UFH A;  4UWI A;  3BUM B;  3K4I A;  2P0W A;  4X8I A;  3VGO A;  2ATR A;  1R57 A;  5I0C A;  1JDE A;  3L2N A;  3T5M A;  4A2Z A;  4C68 A;  2IJZ A;  2REE A;  4H6U A;  4BD9 A;  1XBU A;  2Z3P A;  4H6Z A;  5IV0 A;  2E28 A;  4C8P A;  4C85 A;  4OME A;  1ZL0 A;  3T8W A;  2Q43 A;  2O53 A;  3B8G A;  3IWG A;  3TTH A;  3EC4 A;  2MP0 A;  1KZF A;  1VBH A;  2PJB A;  4CRY B;  3FX6 A;  3OB2 B;  4KUB A;  4P4I A;  4LQ6 A;  4UEZ A;  1XEB A;  1IID A;  1Y9W A;  1MJ9 A;  1BAV A;  2REF A;  5G1Z A;  1BLL E;  5CBM A;  3D7D A;  3JVN A;  4M3S A;  4KVO E;  4DJL A;  5F9M A;  4AG9 A;  1AUG A;  3D67 A;  1DE4 C;  3D4U A;  1S60 A;  4BBH A;  3MGD A;  4PPZ A;  2V8V A;  1CBX A;  1PU9 A;  2JDD A;  3TO6 A;  5ISV A;  2C6P A;  4GS4 A;  2R98 A;  4MXU A;  2B4B A;  2ZEN A;  3PB6 X;  1RXT A;  3EY5 A;  3VWE A;  4CAW A;  1BXR B;  1YVH A;  3NE8 A;  2D0O A;  4C2X A;  3EZB A;  1Q2Y A;  1Z9U A;  5F46 A;  3WR7 A;  1CX8 A;  2ARH A;  1Y0R A;  3B3C A;  4CYQ A;  1A9X B;  2OZG A;  4IK2 A;  1XIX A;  3W6S A;  3BLN A;  1JDB C;  1S3Z A;  4MMO A;  1IGB A;  3WC7 A;  1UWY A;  4ORF A;  1NBW A;  4CPA A;  3TLB A;  5I4M A;  3KR4 A;  2C6G A;  3PB9 X;  3ISZ A;  1KC7 A;  2WYR A;  5F48 A;  4C9E A;  2QVP A;  3RBU A;  4R3L A;  3KQX A;  4DNC A;  3H5Z A;  2PIY A;  4F0X A;  4UBR A;  2JEV A;  3KL9 A;  4HNY B;  2YJT A;  3FYN A;  4KNG E;  3KZW A;  2VQY A;  4NJR A;  3VAR A;  2Q4Y A;  4AVC A;  1FT7 A;  2VL1 A;  4BTF A;  2AFW A;  4MFJ A;  2ZEG A;  3G8W A;  4P6Y A;  2OZH A;  5LRJ A;  3TT2 A;  4DUK A;  1Y9Z A;  3IU2 A;  1Y7E A;  2ODF A;  4R57 A;  1HEE A;  2FIA A;  3SXN A;  3CT9 A;  3S9N A;  2RC4 A;  2F5I A;  2YNE A;  4KLW A;  2FIW A;  3DGV A;  3BJ7 A;  3ZJ0 A;  1OZP A;  3IFE A;  4QVT A;  5LRG A;  4P4B A;  5F5X A;  3SHP A;  2AUM A;  2B4J C;  2EK9 A;  4MCQ A;  4ZBG A;  4KOT A;  2XPP A;  1R3N A;  3NH4 A;  1P0H A;  3C26 A;  4RR2 B;  2GU2 A;  4KS9 A;  4P10 A;  5D29 A;  2CNM A;  4C9V A;  3KQZ A;  1IIC A;  1ZYM A;  4R8F A;  3NFZ A;  5IX3 A;  4M8D A;  3TLG A;  3WT4 A;  1JWQ A;  1ZO0 A;  3B7I A;  4Z65 A;  2PVV A;  5DS0 A;  3QNV A;  4Q7A A;  1XF8 A;  3PEI A;  4C99 A;  1CJW A;  2ZEE A;  4BPU B;  2FCK A;  4M85 A;  3FH4 A;  2DXQ A;  2OH1 A;  4HPS A;  2I00 A;  2Q7B A;  3ISX A;  1TKJ A;  4PSW A;  3UY5 A;  3S9M A;  2PE3 A;  2CXA A;  4IF5 A;  1WJT A;  1BOB A;  3TOB A;  2B58 A;  3IEH A;  4A33 A;  3CXS A;  4FAI A;  2ZPA A;  1XFO A;  3FNC A;  3B3S A;  2B4D B;  3EO4 A;  3PP9 A;  5KTC A;  5HXD A;  3D66 A;  2HI6 A;  5HVG A;  4UCP A;  2DPS A;  5J8F A;  2ZEF A;  1Q2D A;  4MCP A;  2PJ6 A;  4ONW A;  3SI0 A;  1S7N A;  4P4D A;  5JH9 A;  1NMT A;  3I74 A;  1YR0 A;  2Q51 A;  3ICU A;  3V8I A;  5HKZ A;  1Z2L A;  2JDC A;  2PRQ A;  1C3O B;  4OC3 A;  4W9Y A;  2WSA A;  3T9Y A;  3FIX A;  3VAT A;  1HDQ A;  4XPK A;  1M4L A;  1YW4 A;  4UEE A;  1ZG9 A;  4F8Z A;  2G3T A;  2XPL A;  2Q04 A;  2O4H A;  1CS0 B;  1YW6 A;  2PJ7 A;  3DNS A;  2UV8 G;  1QSO A;  1VHE A;  3H8E A;  4H1H A;  1JQG A;  2AFU A;  2NMT A;  1GYT A;  4UFW A;  5F49 A;  1PUA A;  1S7F A;  3VRR A;  8CPA A;  4P4J A;  1ELL P;  4OID A;  3R9E A;  1U6M A;  4CAE A;  2J8M A;  3FEC A;  5G21 A;  5AG4 A;  4IAV A;  4JXQ A;  2B3U A;  5C82 A;  3T07 A;  4C86 A;  1N71 A;  2ZOF A;  4CO9 A;  4UCN A;  2PJA A;  2RFH A;  4NFR A;  2EZA A;  4CDK A;  5A27 A;  3PRT A;  4PXB A;  2FXF A;  5F47 A;  3LMS A;  2V8H A;  3VH9 A;  4MCS A;  1KWM A;  2Z3O A;  4NGS A;  3WC5 A;  2PSW A;  1TKF A;  1CG2 A;  1BO4 A;  2PRB A;  2X7B A;  2AFZ A;  3PFV A;  4L89 A;  3BUN B;  3BUX B;  4E0A A;  2ZEH A;  4KZT A;  5THW A;  2PCN A;  2CTB A;  1XMB A;  1WWZ A;  2N3A B;  1XMT A;  3BXM A;  2KCW A;  2EZB A;  3EZE A;  1IYL A;  2PJ3 A;  2WUU A;  1LFW A;  2GFQ A;  3P2F A;  4O23 A;  1KUX A;  1NSL A;  3BUO B;  2PJ9 A;  3PBE A;  4R3K A;  2WPX A;  3RYO A;  1ZRS A;  4F0Y A;  1M4G A;  2B3V A;  4YWY A;  3RNZ A;  1L0C A;  1ZLI A;  3D68 A;  2DEA A;  2Q4Z A;  1ZG7 A;  2PQ8 A;  4KOU A;  4IUS A;  4PV6 A;  1BPN A;  2Q44 A;  2PJ1 A;  3DR6 A;  4KSA A;  5HMN A;  4NXY A;  5K8P A;  5J3X A;  1YQE A;  2XPO A;  4NF1 A;  4EWT A;  3DLJ A;  3TX8 A;  3CXQ A;  2F8H A;  4X5K A;  2CF4 A;  1WVM A;  4TJX A;  4OC0 A;  1FNO A;  4E94 A;  4ZI6 A;  3N7Z A;  1T36 B;  5F09 A;  2JLM A;  4OAE A;  4WWV A;  1Q5X A;  1A2Z A;  3BHX A;  4Y49 C;  1Q7L A;  2BUE A;  4U9Y A;  1LCP A;  2EUI A;  4CAX A;  4R76 A;  1KUY A;  3EXN A;  4U9Z A;  5H84 A;  1NE9 A;  4AXV A;  3K9U A;  5J8C A;  3VRP A;  2Y0M A;  5CNP A;  2Y1N A;  2OZU A; 
#chains in the Genus database with same CATH homology
 1Y0Y A;  3I1U A;  4C84 A;  3HLP A;  3PB4 X;  3K2K A;  3WAB A;  2C6C A;  5IB9 A;  4WJB A;  4PXC A;  5ELY A;  2C1C A;  1IY7 A;  2BOA A;  3FED A;  4F9V A;  4C9A A;  4JZ0 A;  4PXE A;  2XEG A;  4G1P A;  4ZY1 A;  4EFD A;  2V8D A;  4NGP A;  3D7G A;  3D7F A;  1HDU A;  1CP6 A;  3WC6 A;  2PJ5 A;  4MCR A;  4NJQ A;  2G9D A;  2PVW A;  2IMO A;  4R6T A;  4TNU A;  2ZED A;  3PB8 X;  4OC2 A;  1QMU A;  2PJ0 A;  4TWE A;  5D8N A;  1ELM P;  2XEJ A;  5HVH A;  1AMP A;  4X2T A;  3I6S A;  4F9U A;  4YU9 A;  6CPA A;  3PFE A;  3FVL A;  4C9R A;  1BPM A;  1ZLH A;  4A39 A;  4RUH A;  3GB0 A;  2V8G A;  4UIA A;  5K8M A;  4NGN A;  2XEI A;  5HVF A;  4OC4 A;  4YN3 A;  1V6C A;  4C8A A;  4OKO A;  3KR5 A;  4MHZ A;  3CPX A;  2QYV A;  4MHP A;  2EWB A;  1TKH A;  3EIF A;  4C8U A;  1NSA A;  2AFM A;  1AYE A;  5IR2 A;  4H2K A;  3IC1 A;  1VHO A;  2JEW A;  4UEF A;  2RB7 A;  1XRY A;  4PQA A;  1XF1 A;  1LOK A;  2ZEL A;  3B3W A;  2AFX A;  5LYI A;  2OR4 A;  2POK A;  1VGY A;  1CP7 A;  2GLF A;  3D7H A;  4OIW A;  2PJC A;  3V38 A;  3B3V A;  5LYL A;  4NGR A;  4UIB A;  3LWU A;  1CPS A;  5JGF A;  3SJE A;  4GM5 A;  3NH8 A;  3MRU A;  1ARM A;  4DYO A;  4OP4 A;  4A94 A;  3TC8 A;  1LAN A;  3HUV A;  3JRU A;  4C9U A;  1H8L A;  3BI0 A;  3MN8 A;  1F2O A;  2BO9 A;  3N5F A;  4P44 A;  2PJ8 A;  1F57 A;  1Z5R A;  4FBE A;  3FMC A;  1TXR A;  2QJ8 A;  3RAM A;  1RTQ A;  1Z8L A;  7CPA A;  2PJ2 A;  1CPX A;  2FVG A;  1ZG8 A;  3BI1 A;  3GLJ A;  4A37 A;  5JM6 A;  3KGQ A;  3FEE A;  4KSI A;  4EME A;  2BCO A;  3KHZ A;  1YLO A;  2ABZ A;  4NGM A;  2ZEM A;  3B35 A;  4X3R A;  1TF9 A;  4PXD A;  4IHM A;  2GLJ A;  2J9A A;  1YME A;  3KAS A;  4P45 A;  3CPA A;  2PIZ A;  3SJG A;  3PB7 X;  3FJU A;  5K8N A;  2JBJ A;  2WZN A;  3SI1 A;  2GRE A;  1YSJ A;  2GP4 A;  3GUX A;  3K9T A;  3IO1 A;  3SJX A;  3PFO A;  4C8T A;  2XEF A;  5LYD A;  3NH5 A;  4C8C A;  3IJ3 A;  4ZYQ A;  1XJO A;  2C5Q A;  2PCU A;  3NA6 A;  4MHN A;  3S9L A;  4ZX9 A;  4UF4 A;  4P4E A;  3KHX A;  2IQ6 A;  1OBR A;  5LRK A;  1F2P A;  2ANP A;  4A38 A;  5K8O A;  2ZOG A;  2OOT A;  1ARL A;  3KI9 A;  2HC9 A;  1DTD A;  4FUU A;  4P4F A;  4OC5 A;  3B3T A;  4MHY A;  2EK8 A;  3H8G A;  1EE3 P;  3V7Z A;  1QQ9 A;  4OC1 A;  1PCA A;  4C8F A;  4ZX8 A;  3CDX A;  4NGQ A;  4NGT A;  5CPA A;  4B6Z A;  1R43 A;  1LAP A;  5LYF A;  4FWU A;  4CDJ A;  3FF3 A;  2F7V A;  2NYQ A;  2ZEP A;  4JYW A;  2AFS A;  1PYT B;  3IIB A;  2HB6 A;  4R7M A;  2AFO A;  3PBB A;  2PJ4 A;  1LAM A;  2ZEO A;  4MRI A;  5J1Q A;  2CTC A;  4TJV A;  2JBK A;  1VIX A;  2NSM A;  3H8F A;  2CIJ A;  2V77 A;  3RZA A;  3SJF A;  3B2Y A;  4ZY2 A;  4LQG A;  4ZY0 A;  4C9E A;  4K3N A;  3IWW A;  2I3C A;  3SI2 A;  1TF8 A;  4X8I A;  3L2N A;  3VTA A;  2IJZ A;  4BD9 A;  4C8P A;  1XBU A;  4C85 A;  4OME A;  3T8W A;  2Q43 A;  2O53 A;  2PJB A;  3FX6 A;  4P4I A;  4UEZ A;  5CBM A;  1BAV A;  1BLL E;  3D7D A;  4DJL A;  3D67 A;  1DE4 C;  3D4U A;  4PPZ A;  2V8V A;  1CBX A;  2C6P A;  4MXU A;  2ZEN A;  3PB6 X;  1CX8 A;  3B3C A;  1Y0R A;  4IK2 A;  4MMO A;  1IGB A;  3WC7 A;  1UWY A;  4CPA A;  5I4M A;  3KR4 A;  2C6G A;  3PB9 X;  3ISZ A;  2WYR A;  2QVP A;  3RBU A;  3KQX A;  2PIY A;  3KL9 A;  4KNG E;  3KZW A;  4NJR A;  3VAR A;  2VL1 A;  1FT7 A;  4P6Y A;  2AFW A;  2ZEG A;  5LRJ A;  4DUK A;  1Y9Z A;  1Y7E A;  1HEE A;  3CT9 A;  3S9N A;  3DGV A;  3IFE A;  5LRG A;  4P4B A;  2EK9 A;  4MCQ A;  1R3N A;  3NH4 A;  2GU2 A;  4P10 A;  5D29 A;  4C9V A;  3KQZ A;  4R8F A;  3NFZ A;  3WT4 A;  3B7I A;  4Z65 A;  2PVV A;  5DS0 A;  3QNV A;  4Q7A A;  3PEI A;  2ZEE A;  3FH4 A;  3ISX A;  1TKJ A;  3S9M A;  2PE3 A;  3IEH A;  4FAI A;  1XFO A;  3B3S A;  5HXD A;  3D66 A;  5HVG A;  2ZEF A;  4MCP A;  2PJ6 A;  4ONW A;  3SI0 A;  4P4D A;  5JH9 A;  3I74 A;  2Q51 A;  3ICU A;  1Z2L A;  2PRQ A;  4OC3 A;  4W9Y A;  3VAT A;  1HDQ A;  1M4L A;  1YW4 A;  4UEE A;  1ZG9 A;  4F8Z A;  2O4H A;  1YW6 A;  2PJ7 A;  1VHE A;  3H8E A;  1JQG A;  2AFU A;  1GYT A;  8CPA A;  4P4J A;  1ELL P;  4OID A;  3FEC A;  4IAV A;  4C86 A;  2ZOF A;  2PJA A;  2RFH A;  4NFR A;  4CDK A;  3PRT A;  4PXB A;  3LMS A;  2V8H A;  3VH9 A;  4MCS A;  1KWM A;  4NGS A;  3WC5 A;  1TKF A;  1CG2 A;  2AFZ A;  2ZEH A;  5THW A;  2CTB A;  1XMB A;  3BXM A;  2PJ3 A;  1LFW A;  4O23 A;  2PJ9 A;  3PBE A;  4YWY A;  1ZLI A;  3D68 A;  2DEA A;  2Q4Z A;  1ZG7 A;  1BPN A;  2PJ1 A;  5K8P A;  4EWT A;  3DLJ A;  3TX8 A;  2F8H A;  2CF4 A;  1WVM A;  4TJX A;  4OC0 A;  1FNO A;  4ZI6 A;  5F09 A;  4WWV A;  3BHX A;  1Q7L A;  1LCP A;  4R76 A;  4AXV A;  4C99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...