3BHXA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of asp-glu
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bhxA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bhxA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bhxA02
4CPAA 4PXBA 3K9TA 4NGRA 4JZ0A 2ZEGA 4OIWA 2F7VA 3DLJA 1TKFA 2ZEOA 3VH9A 4P6YA 3TX8A 4C84A 1TF8A 1TXRA 2J9AA 3EIFA 3D7HA 4C85A 2PJ3A 2ANPA 3GUXA 1DE4C 4ZYQA 3H8FA 4PPZA 4EMEA 1Z2LA 3SJGA 2POKA 2ZEDA 1Q7LA 1PCAA 2NSMA 1JQGA 3SJEA 1TF9A 1ZG7A 4A39A 2GLJA 3KZWA 4PXEA 2AFMA 3V38A 4ZY1A 4AXVA 1ELMP 4NGNA 5K8OA 4KSIA 2PJ7A 1CPXA 2VL1A 3B3VA 4MMOA 3B3TA 1BAVA 2I3CA 4UEZA 3VARA 2Q4ZA 3CPXA 3PBEA 1KWMA 5J1QA 1ZG9A 5HVGA 4A37A 3FMCA 3IFEA 3BI0A 3VATA 3WABA 1LOKA 2IQ6A 3BI1A 2QVPA 4IHMA 5THWA 3FVLA 1IGBA 3FEEA 1FNOA 4P10A 2ZENA 2C1CA 3H8EA 3H8GA 2GU2A 1ARLA 4MCSA 2PRQA 2IJZA 1H8LA 3IO1A 3D67A 3PB8X 3QNVA 5HVHA 2PCUA 4A94A 2PJ2A 3D68A 2AFUA 4NGQA 1ELLP 4F9VA 1Y9ZA 3D7DA 1YW4A 5LRJA 2Q43A 4EWTA 4ZX8A 3KR4A 4IAVA 5D8NA 4OC1A 4NGSA 1M4LA 3WC6A 5F09A 4NJQA 3MN8A 2PJ6A 4EFDA 1CPSA 1HDQA 2HC9A 1ZLHA 3RBUA 1XFOA 3B3SA 2PJAA 4PQAA 4F9UA 2PJBA 3WT4A 1VGYA 5HVFA 1HEEA 5LYFA 1UWYA 5LYLA 2PJ9A 4P45A 1Y7EA 4C9RA 1EE3P 4P4FA 4WJBA 5HXDA 2EK8A 4ZY0A 4C9UA 1XF1A 3IC1A 2O53A 4IK2A 4C86A 4MRIA 4Z65A 1BLLE 1R43A 1LCPA 3LWUA 3PFOA 1ZG8A 3RZAA 3B2YA 4MXUA 1Y0RA 4NGTA 3B7IA 1VIXA 4F8ZA 4C8AA 1TKHA 2V8HA 3KHZA 3KHXA 2C6CA 3PEIA 3LMSA 4W9YA 2RFHA 1R3NA 1LANA 3KI9A 3JRUA 3HUVA 1BPMA 2JBKA 5ELYA 3SI2A 3SI1A 5JGFA 5LYDA 1QMUA 4C8TA 4X3RA 3CDXA 3GB0A 1DTDA 3IJ3A 2PJ8A 2ZEMA 1VHOA 3D7FA 1XRYA 1LAPA 4MHZA 2C6GA 4FWUA 2CIJA 1YLOA 2V8DA 4C8FA 2ABZA 2DEAA 2NYQA 4FBEA 4MCPA 5CBMA 7CPAA 2WZNA 5JM6A 4OMEA 4CDKA 1GYTA 3RAMA 2ZEHA 1OBRA 2XEJA 2ZOGA 4NFRA 4MHNA 4DYOA 4GM5A 4TJVA 4MCRA 1YSJA 5LRGA 5DS0A 3NH5A 3BXMA 4OC2A 3FJUA 2V8VA 2JBJA 8CPAA 4WWVA 3MRUA 2V8GA 4P4IA 3PB4X 3CPAA 2PJ4A 4C8UA 2CTCA 2OOTA 2FVGA 3D4UA 4OC3A 4P44A 1CP6A 4CDJA 2C6PA 2ZELA 4H2KA 3WC7A 3HLPA 4JYWA 3WC5A 2ZEEA 4X2TA 4ZY2A 4P4EA 1XBUA 3ICUA 3I1UA 1AYEA 2OR4A 3VTAA 2GLFA 4UIBA 2AFZA 1V6CA 1F57A 3I6SA 4UEEA 4TNUA 1QQ9A 4C9AA 3IIBA 2XEIA 1Z8LA 3TC8A 3KASA 2AFXA 2PJ1A 3KQZA 4B6ZA 1CBXA 4MHPA 3B35A 3PB7X 4C99A 3PRTA 3SJFA 2ZEFA 2BOAA 4OP4A 3B3WA 1XJOA 2PIZA 2F8HA 3SJXA 1BPNA 2PVWA 1TKJA 2EWBA 4YWYA 3T8WA 1XMBA 3NH8A 3FF3A 1LFWA 2AFWA 4R8FA 1LAMA 2Q51A 3FX6A 4P4DA 5D29A 1ZLIA 5JH9A 2QYVA 5CPAA 2AFOA 4RUHA 4ONWA 4NJRA 4Q7AA 4R6TA 2CTBA 4R76A 2JEWA 3V7ZA 5LRKA 4C9EA 1CG2A 1WVMA 2PE3A 1ARMA 4P4BA 5LYIA 4FAIA 4X8IA 1Y0YA 3BHXA 2PVVA 4OC0A 1F2OA 4C8CA 4PXCA 2PJ5A 4NGPA 4P4JA 3IWWA 4ZI6A 3NFZA 2WYRA 3PB6X 4DUKA 4OC5A 3CT9A 1NSAA 4MCQA 4UF4A 4YN3A 2BCOA 2V77A 1RTQA 1HDUA 1FT7A 1Z5RA 4PXDA 4BD9A 4UIAA 4MHYA 5K8PA 5I4MA 3ISZA 3S9NA 5K8MA 4TJXA 2RB7A 1PYTB 3S9LA 3KGQA 2GREA 3DGVA 4K3NA 3NH4A 4KNGE 2PJCA 3KL9A 3PFEA 3D66A 4A38A 1YW6A 4ZX9A 2IMOA 3K2KA 3GLJA 2G9DA 2EK9A 4YU9A 4G1PA 3SI0A 3PBBA 3IEHA 2BO9A 6CPAA 2CF4A 3I74A 2XEGA 2QJ8A 1AMPA 3KR5A 1YMEA 3B3CA 3ISXA 3FEDA 2ZEPA 4TWEA 5IB9A 2HB6A 4UEFA 3N5FA 3KQXA 5K8NA 4OC4A 4C8PA 4O23A 4NGMA 4OKOA 4LQGA 1CX8A 3PB9X 4R7MA 1F2PA 4FUUA 3D7GA 3L2NA 3FH4A 3FECA 1VHEA 2PJ0A 4OIDA 2XEFA 4C9VA 1CP7A 3S9MA 3NA6A 1IY7A 2AFSA 2PIYA 2O4HA 2ZOFA 4DJLA
chains in the Genus database with same CATH superfamily
1IOFA 3S6GA 4C2ZA 4CPAA 5F46A 1FY7A 2B4JC 4PXBA 3V8IA 2GANA 1S3ZA 3JVNA 5IX3A 3K9TA 4NGRA 3QAHA 4JZ0A 2Q4YA 2ZEGA 4OIWA 4QVTA 2F7VA 3R95A 3FBUA 3WR7A 2R82A 4KOUA 5J8CA 4HNXB 5BWAB 3DLJA 4HKFA 1QSMA 3ZJ0A 2GE3A 4A32A 4QUSA 1TKFA 4UBRA 5ISVA 4CRZB 2ZEOA 2N3AB 2REEA 5EC4A 2Q7SA 4P6YA 3VH9A 2CBLA 1KBLA 2Y1NA 4H6ZA 2B3UA 3G8WA 3HPHE 3DNSA 3F0AA 3TX8A 3S6HA 2MP0A 4C84A 1S60A 1TF8A 3BUNB 1TXRA 2J9AA 3BJ8A 3TT2A 3EIFA 3D7HA 3EXNA 4J0NA 2FE7A 2AJ6A 5EMIA 4C85A 2PJ3A 2K5TA 4EVYA 2ANPA 3GUXA 4KOYA 1DE4C 4ZYQA 5K99A 3H8FA 3UY5A 4B5PA 4PPZA 2Y0MA 4XNHC 1Y9KA 4EMEA 4XPKA 2B4DB 1Z2LA 4GPLB 3SJGA 2DF5A 5AG4A 2POKA 4GS4A 2ZEDA 4IF5A 1Q7LA 2QMLA 1PCAA 2NSMA 1JQGA 3SJEA 1CJWA 1TF9A 4CYOA 3KRVA 5DWMA 1ZG7A 2XPNA 2GLJA 4A39A 4CGNA 3T05A 3KZWA 4PXEA 2JLMA 3TLYA 2AFMA 2R1IA 3V38A 4CGMA 5HH1A 4UFVA 4AVBA 2I79A 2GIVA 2PR1A 4XNHB 1S7FA 1Y7RA 1M44A 3K9UA 3HMJG 4MJ8A 4F0YA 2FM4A 3TLZA 2CNTA 2G3TA 4AXVA 1ELMP 4NGNA 3CXPA 4ZY1A 3NOJA 5K8OA 2HWGA 4KSIA 2PJ7A 1CPXA 3VRRA 2VL1A 5G1ZA 3R9FA 2D0OA 3B3VA 1YLEA 3LODA 1MJBA 4M8DA 4MFLA 4MMOA 1VBHA 2Z3PA 3JTKA 3B3TA 4OAEA 4YRHA 1BAVA 2I3CA 2AUNA 4UEZA 3VARA 2Q4ZA 2VXKA 3CPXA 2VI7A 4A31A 3PBEA 3K4IA 1Q5XA 1IOIA 1KWMA 4BINA 5J1QA 1J3LA 5HKWA 1ZG9A 4PK2A 2JEVA 3RNZA 1YVKA 5HVGA 2P6FA 2ZXVA 4KUBA 4A37A 2FXFA 1KUYA 3GIUA 3FMCA 4NXYA 3VROA 4C7HA 1ZL0A 2R8VA 1NE9A 4MBUA 2XPLA 3IFEA 2DXQA 4H89A 4UFWA 3VWEA 3BI0A 2CXAA 1S7NA 1J4JA 3PGPA 3VATA 4CAEA 3WABA 1LOKA 5HMNA 1T36B 2IQ6A 2Z3LA 2HI6A 3BI1A 3O8ZA 2QVPA 2YNEA 4IHMA 3RYOA 3I9SA 3F5BA 3FVLA 4M85A 1IGBA 3FEEA 1YQEA 1FNOA 2CNMA 4P10A 2ZENA 4J3GA 4PSWA 4CAVA 1I12A 2C1CA 1XE4A 2ODFA 3OP0A 2B5GA 2GU2A 2R98A 3H8EA 3H8GA 4KOTA 3ZZIA 3BUWB 1ARLA 4MCSA 3G23A 2PRQA 3OAKA 5G22A 2IJZA 4KLWA 1H8LA 3IO1A 2F5IA 1XF8A 3D67A 3VRPA 3PB8X 3P2HA 3QNVA 2IL4A 4FD5A 2BL1A 5HVHA 2B58A 4FD6A 2OB0A 2PCUA 4A94A 2PJ2A 3D68A 2AFUA 3T90A 1CE8B 3IU1A 4NGQA 2Q0YA 1ELLP 2FS5A 4F9VA 2ZW4A 3D7DA 1YGHA 1YW4A 1ZO0A 2Q43A 5LRJA 3TOAA 4EWTA 3TO9A 3F9KC 1YK3A 4UFXA 4ZX8A 3KR4A 4IAVA 5D8NA 2P0WA 4OC1A 4NGSA 1M6VB 5KTCA 4BPXB 1M4LA 1YREA 4C68A 2I00A 3WC6A 1ZYMA 5F09A 4UA3A 1A2ZA 4NJQA 3MN8A 2PJ6A 4EFDA 1CPSA 1HDQA 2XPPA 2HC9A 1ZLHA 5J8FA 3RBUA 2C5QA 1XFOA 3H4QA 4BPWB 3B3SA 3BLNA 4M3SA 2PJAA 4PQAA 1IU8A 4MFQA 2PJBA 3WT4A 4CGOA 4F9UA 3T0TA 1VGYA 2VZZA 5HVFA 1TIQA 1HEEA 2EBJA 2P6EA 2HUZA 3IWGA 4MY3A 5LYFA 4INJA 3JUWA 1UWYA 1Z9EA 2BSWA 4AG9A 2PJ9A 2G0BA 4P45A 5IB0A 5LYLA 1R61A 5JVLA 1Y7EA 2B3VA 4FD4A 4E2AA 4C9RA 2PC1A 1EE3P 4P4FA 3CXSA 5J3XA 4WJBA 2DPTA 3EC4A 4QBJA 5HXDA 1EO0A 2EK8A 1P4NA 1KUVA 1Z8TA 4CRYB 4ZY0A 5JPHA 4C9UA 3G3SA 1XF1A 2Y1MA 3OB2B 2OZHA 3IC1A 2O53A 2D4OA 4IK2A 4C86A 4U9ZA 4MRIA 4Z65A 1C3OB 2REFA 1BLLE 1R43A 1LCPA 3LWUA 3PFOA 1ZRSA 1ZG8A 4B5OA 4IIYA 4JLYA 3RZAA 3B2YA 1YX0A 2J8NA 2Q4VA 4MXUA 1Y0RA 5KTDA 1YVHA 3NE7A 4NGTA 1Z4RA 3B7IA 4KVME 1CS0B 3HPGG 1VIXA 2VZYA 4F8ZA 3R9GA 4C8AA 3PFVA 1TKHA 4CGLA 3ZNIA 2V8HA 4OLLA 3KHZA 4JD6A 5C88A 3U1BA 2ZOFA 1IYKA 3KHXA 2C6CA 3PEIA 2XPOA 2B4BA 4W9YA 3LMSA 1DIKA 5JYBA 3BJ7A 2RFHA 1R3NA 1LANA 4JXRA 4CAWA 1U6MA 5F49A 3KI9A 2PRBA 3JRUA 4JJXA 3HUVA 4E8OA 4MY0A 2YJVA 4JVOA 1BPMA 3GJZA 1B47A 4L89A 2JBKA 5ELYA 3SI2A 1OZPA 3SI1A 5JGFA 4MI1A 5LYDA 1KEEB 1QMUA 2CNSA 2Q44A 1K4JA 3T07A 4C8TA 2WPXA 1MJAA 4X3RA 3CDXA 1YR0A 3GB0A 4CYQA 1DTDA 3IJ3A 2ARHA 1L0CA 2PJ8A 4HNWB 4B11A 3EY5A 2ZEMA 1VHOA 4C7IA 3D7FA 1XRYA 1LAPA 4K30A 1JDBC 4MHZA 3TLGB 2B4DA 2C6GA 3CZXA 4FWUA 2CIJA 4LUAA 4XPDC 1YLOA 4ZBGA 4A33A 2V8DA 2HROA 3PT1A 4C8FA 5F1YA 1PUAA 2X7BA 4UCMA 2EZAA 3MGDA 2EZCA 5I0CA 3EZAA 4A2ZA 1VBGA 3P2FA 2AE6A 1VKCA 3N7ZA 1YVOA 2ABZA 2OLSA 1FBVA 2DEAA 2YJTA 2JDDA 2NYQA 4KS9A 3BUMB 5EBVA 4FBEA 1Z8XA 4R87A 1MJ9A 4MCPA 5CBMA 7CPAA 2WZNA 3GKRA 5BY0A 5JM6A 3TO6A 1KUXA 4OMEA 4II9A 5KTAA 4CDKA 1GYTA 5F48A 3SHPA 2KCWA 4M6HA 3RAMA 3EZEA 4AVAA 2ZEHA 5IV0A 2RC4A 3SXNA 1OBRA 2XEJA 2ZOGA 1QSTA 5CNPA 4NFRA 3OB1B 4R57A 3TO7A 2QIRA 4MHNA 3VRNA 4NEXA 4QB9A 4E0AA 2EZBA 4DYOA 4QC6A 2VBQA 4YGOA 4KOSA 2ZW5A 2G3AA 2EUIA 1Z4EA 4GM5A 4MCRA 4ZGYB 1YSJA 4YFJA 4TJVA 2R7HA 5LRGA 5DS0A 3FB3A 3NH5A 3BXMA 4KUAA 5H86A 4OC2A 3FJUA 4Q36A 2V8VA 2JBJA 8CPAA 3EFAA 2CY2A 4WWVA 5A28A 5HKYA 2PQ8A 3MRUA 2PDOA 3W6XA 4EYSA 1IB1E 3TYXA 1KZFA 2DLAA 2V8GA 4AB7A 4JWPA 4P4IA 3PB4X 1Q2CA 4CGPA 2DPSA 2BEIA 2X0SA 1QSOA 3NE8A 3CPAA 2PJ4A 4C8UA 2CTCA 5A27A 2Q04A 4MFKA 4C2YA 3LD2A 2OOTA 1QSRA 2Z3OA 2FVGA 4I49A 1IICA 3D4UA 2HQYA 2YNDA 4OC3A 4P44A 1X10A 2ATRA 4FD7A 2BUEA 1LRZA 3IWEA 1CP6A 3QB8A 5AG5A 3TLCA 4CDJA 2C6PA 2Z0ZA 2ZELA 4H2KA 3WC7A 4MI4A 5FD8A 3HLPA 4MFPA 4LQ6A 4JYWA 4CAXA 1XMTA 1M4GA 3WC5A 2J8RA 2ZEEA 4E5SA 5GCNA 4X2TA 1R57A 4ZY2A 4ORFA 4P4EA 1XBUA 2HV2A 3ICUA 5F9MA 3I1UA 3F8KA 4HPSA 1AYEA 2OR4A 2C27A 2H5MA 4KVOE 3VTAA 2NMTA 4M6IA 2GLFA 4CYPA 4UIBA 3CXQA 4B13A 3E0KA 4ONUA 2AFZA 4KORA 4UCPA 1V6CA 4RR2B 2GP4A 1F57A 5FVJA 1M1DA 3KKWA 2D0PA 3FRMA 4COGA 4A4BA 3I6SA 4NCZA 2VKZG 3D2MA 3GYAA 3PZJA 2Z3KA 4UEEA 4TNUA 1SQHA 1QQ9A 4C9AA 3PP9A 4BBHA 2FSRA 3TLAA 3IIBA 5JQ4A 4H6UA 1NXJA 1B87A 4C2XA 3S6KA 2XEIA 1Z8LA 2AUMA 1X12A 3TOBA 3TC8A 3FXTA 2OZGA 5HKZA 2FIAA 3KASA 3QAYA 3EZBA 2AFXA 4RS2A 2YNCA 1V0CA 4PV6A 3D2PA 2PJ1A 4CYNA 3W91A 3KQZA 1JWQA 3R1KA 4B6ZA 1CBXA 2ZPAA 4MHPA 3B35A 3EO4A 3PB7X 4C99A 4AG7A 3PRTA 3SJFA 2ZEFA 1Z8WA 4KSAA 3IU2A 2BOAA 4OP4A 4R9MA 3B3WA 1XJOA 2PIZA 3TLBA 1B6BA 2F8HA 4R3LA 3SJXA 1BPNA 1CM0A 2WUUA 4F6AA 2PVWA 1TKJA 2EWBA 4MFZA 4YWYA 3T8WA 1NBWA 1XMBA 5THWA 4JXQA 1XEBA 3TTHA 1C30B 3R96A 1MK4A 2FT0A 3NH8A 3C8OA 1WWZA 3FF3A 1LFWA 4KVXA 3RO0A 2AFWA 4NF1A 4KLVA 4LX9A 5F47A 2ZW7A 4R8FA 3T5MA 1LAMA 2Q51A 3FX6A 4M6GA 4UWJA 4B5PB 2ZW6A 4P4DA 5D29A 1ON0A 1ZLIA 2FIWA 2GFQA 5G20A 1M4IA 2P6GA 4DNCA 5JH9A 2QYVA 4CAFA 5CPAA 2DIKA 3B8GA 3TCVA 4A95A 2D4PA 2EO8A 2AFOA 1EZBA 4RUHA 1XIXA 1P0HA 4NJRA 4ONWA 4Q7AA 4R6TA 2CTBA 4R3KA 4R76A 5H84A 1Y9WA 4RN7A 2JEWA 1S5KA 4CO9A 3V7ZA 2EVNA 3TE4A 4Q38A 5LRKA 4C9EA 4H1HA 1CG2A 2WSAA 4KOWA 4F0XA 2Q7BA 2PE3A 1WVMA 1I1DA 1QSNA 1ARMA 4P4BA 5LYIA 3TLGA 1EZAA 4FAIA 2UV8G 4X8IA 1A9XB 1Y0YA 4L8AA 1GHEA 4XPDB 3BHXA 4B10A 2PVVA 1BO4A 1M4DA 2PR8A 4OC0A 1F2OA 3SR3A 4C8CA 2PSWA 4AVCA 4PXCA 4MHDA 2PJ5A 4BPUB 4NGPA 1AUGA 4MFJA 4P4JA 3IWWA 2OU2A 2VQYA 4ZI6A 3NFZA 4BTFA 2WYRA 3PB6X 4Y49C 4DUKA 4IIXA 4KOXA 4KZTA 4OC5A 3CT9A 1NSAA 4MCQA 4UF4A 3GY9A 3VWDA 4YN3A 2BCOA 2V77A 4HNYB 1RTQA 1HDUA 3PLFB 1FT7A 1IIDA 1Z5RA 4PXDA 4UWIA 3BUOB 5AGEA 4BD9A 4UIAA 4MHYA 5K8PA 5I4MA 3ISZA 3S9NA 5K8MA 1IYLA 4TJXA 3TLEA 5F13A 1S7LA 4Y49B 2O28A 1RXTA 2RB7A 3FIXA 1PYTB 3W6SA 3S9LA 2YGWA 1BXRB 2B5GB 3IGRA 4KOVA 4OADA 3KGQA 1WJTA 4XPLA 4CZ1A 2OZUA 5AG6A 4PK3A 2GREA 4B12A 1BOBA 3DGVA 2Z10A 3NH4A 4K3NA 1NSLA 1GGOA 4KNGE 2QECA 3NFQA 2PJCA 3KL9A 3PFEA 3D66A 4IUSA 1Z9UA 3A9LA 4A38A 1I21A 1Y9ZA 1YW6A 2PCNA 3VRQA 4ZX9A 5F5XA 2IMOA 3K2KA 4COBA 3GLJA 1PU9A 3OWCA 2VEZA 5AXIA 1Q2DA 5G21A 3SXOA 2G9DA 2EK9A 4YU9A 4G1PA 3SI0A 1XOVA 3PBBA 3R9EA 3TFYA 3IEHA 2BO9A 4PSXA 6CPAA 3DSBA 2CF4A 2OH1A 3C26A 1JDEA 1S7KA 3I74A 4MJXA 3D8PA 5DWNA 4X5KA 3S6FA 4CS0B 2XEGA 2QJ8A 2E28A 1KC7A 1AMPA 3KR5A 1YMEA 3B3CA 3ISXA 5E96A 1Q2YA 3FEDA 2ZEPA 4KSFA 4TWEA 5IB9A 2HB6A 3FYNA 1UFHA 2FL4A 4UEFA 1RO5A 3D3SA 3N5FA 3KQXA 5K8NA 3DR8A 5IR2A 4OC4A 4C8PA 4O23A 4NGMA 2J8MA 4OKOA 4LQGA 1CX8A 3PB9X 4R7MA 4BMHA 1F2PA 4GXHA 4RI1A 4FUUA 1VI4A 3T9YA 3D7GA 1WK4A 2YNCC 3L2NA 3FH4A 1VHSA 3H5ZA 4A4CA 3FECA 1VHEA 2PJ0A 2WPWA 4UCNA 4U5YA 4OIDA 2XEFA 2JDCA 2FCKA 4C9VA 3FNCA 2Z3MA 1CP7A 1NMTA 1N71A 3S9MA 3U88C 3NA6A 4NSQA 3BUXB 4A30A 3DR6A 1IY7A 2AFSA 5AG7A 4B14A 2Z11A 2PIYA 3DDDA 2B0AA 3VGOA 2O4HA 3I3GA 4E94A 4U9YA 3LACA 2A4NA 4DJLA 2Z3NA 5C82A
chains in the Genus database with same CATH topology
4CPAA 4PXBA 3K9TA 4NGRA 4JZ0A 2ZEGA 4OIWA 2F7VA 3DLJA 1TKFA 2ZEOA 3VH9A 4P6YA 3TX8A 4C84A 1TF8A 1TXRA 2J9AA 3EIFA 3D7HA 4C85A 2PJ3A 2ANPA 3GUXA 1DE4C 4ZYQA 3H8FA 4PPZA 4EMEA 1Z2LA 3SJGA 2POKA 2ZEDA 1Q7LA 1PCAA 2NSMA 1JQGA 3SJEA 1TF9A 1ZG7A 4A39A 2GLJA 3KZWA 4PXEA 2AFMA 3V38A 4ZY1A 4AXVA 1ELMP 4NGNA 5K8OA 4KSIA 2PJ7A 1CPXA 2VL1A 3B3VA 4MMOA 3B3TA 1BAVA 2I3CA 4UEZA 3VARA 2Q4ZA 3CPXA 3PBEA 1KWMA 5J1QA 1ZG9A 5HVGA 4A37A 3FMCA 3IFEA 3BI0A 3VATA 3WABA 1LOKA 2IQ6A 3BI1A 2QVPA 4IHMA 5THWA 3FVLA 1IGBA 3FEEA 1FNOA 4P10A 2ZENA 2C1CA 3H8EA 3H8GA 2GU2A 1ARLA 4MCSA 2PRQA 2IJZA 1H8LA 3IO1A 3D67A 3PB8X 3QNVA 5HVHA 2PCUA 4A94A 2PJ2A 3D68A 2AFUA 4NGQA 1ELLP 4F9VA 1Y9ZA 3D7DA 1YW4A 5LRJA 2Q43A 4EWTA 4ZX8A 3KR4A 4IAVA 5D8NA 4OC1A 4NGSA 1M4LA 3WC6A 5F09A 4NJQA 3MN8A 2PJ6A 4EFDA 1CPSA 1HDQA 2HC9A 1ZLHA 3RBUA 2C5QA 1XFOA 3B3SA 2PJAA 4PQAA 4F9UA 2PJBA 3WT4A 1VGYA 5HVFA 1HEEA 5LYFA 1UWYA 5LYLA 2PJ9A 4P45A 1Y7EA 4C9RA 1EE3P 4P4FA 4WJBA 5HXDA 2EK8A 4ZY0A 4C9UA 1XF1A 3IC1A 2O53A 4IK2A 4C86A 4MRIA 4Z65A 1BLLE 1R43A 1LCPA 3LWUA 3PFOA 1ZG8A 3RZAA 3B2YA 4MXUA 1Y0RA 4NGTA 3B7IA 1VIXA 4F8ZA 4C8AA 1TKHA 2V8HA 3KHZA 3KHXA 2C6CA 3PEIA 3LMSA 4W9YA 2RFHA 1R3NA 1LANA 3KI9A 3JRUA 3HUVA 1BPMA 2JBKA 5ELYA 3SI2A 3SI1A 5JGFA 5LYDA 1QMUA 4C8TA 4X3RA 3CDXA 3GB0A 1DTDA 3IJ3A 2PJ8A 2ZEMA 1VHOA 3D7FA 1XRYA 1LAPA 4MHZA 2C6GA 4FWUA 2CIJA 1YLOA 2V8DA 4C8FA 2ABZA 2DEAA 2NYQA 4FBEA 4MCPA 5CBMA 7CPAA 2WZNA 5JM6A 4OMEA 4CDKA 1GYTA 3RAMA 2ZEHA 1OBRA 2XEJA 2ZOGA 4NFRA 4MHNA 4DYOA 4GM5A 4TJVA 4MCRA 1YSJA 5LRGA 5DS0A 3NH5A 3BXMA 4OC2A 3FJUA 2V8VA 2JBJA 8CPAA 4WWVA 3MRUA 2V8GA 4P4IA 3PB4X 3CPAA 2PJ4A 4C8UA 2CTCA 2OOTA 2FVGA 3D4UA 4OC3A 4P44A 1CP6A 4CDJA 2C6PA 2ZELA 4H2KA 3WC7A 3HLPA 4JYWA 3WC5A 2ZEEA 4X2TA 4ZY2A 4P4EA 1XBUA 3ICUA 3I1UA 1AYEA 2OR4A 3VTAA 2GLFA 4UIBA 2AFZA 2GP4A 1V6CA 1F57A 3I6SA 4UEEA 4TNUA 1QQ9A 4C9AA 3IIBA 2XEIA 1Z8LA 3TC8A 3KASA 2AFXA 2PJ1A 3KQZA 4B6ZA 1CBXA 4MHPA 3B35A 3PB7X 4C99A 3PRTA 3SJFA 2ZEFA 2BOAA 4OP4A 3B3WA 1XJOA 2PIZA 2F8HA 3SJXA 1BPNA 2PVWA 1TKJA 2EWBA 4YWYA 3T8WA 1XMBA 3NH8A 3FF3A 1LFWA 2AFWA 4R8FA 1LAMA 2Q51A 3FX6A 4P4DA 5D29A 1ZLIA 5JH9A 2QYVA 5CPAA 2AFOA 4RUHA 4ONWA 4NJRA 4Q7AA 4R6TA 2CTBA 4R76A 2JEWA 3V7ZA 5LRKA 4C9EA 1CG2A 1WVMA 2PE3A 1ARMA 4P4BA 5LYIA 4FAIA 4X8IA 1Y0YA 3BHXA 2PVVA 4OC0A 1F2OA 4C8CA 4PXCA 2PJ5A 4NGPA 4P4JA 3IWWA 4ZI6A 3NFZA 2WYRA 3PB6X 4DUKA 4OC5A 3CT9A 1NSAA 4MCQA 4UF4A 4YN3A 2BCOA 2V77A 1RTQA 1HDUA 1FT7A 1Z5RA 4PXDA 4BD9A 4UIAA 4MHYA 5K8PA 5I4MA 3ISZA 3S9NA 5K8MA 4TJXA 2RB7A 1PYTB 3S9LA 3KGQA 2GREA 3DGVA 4K3NA 3NH4A 4KNGE 2PJCA 3KL9A 3PFEA 3D66A 4A38A 1YW6A 4ZX9A 2IMOA 3K2KA 3GLJA 2G9DA 2EK9A 4YU9A 4G1PA 3SI0A 3PBBA 3IEHA 2BO9A 6CPAA 2CF4A 3I74A 2XEGA 2QJ8A 1AMPA 3KR5A 1YMEA 3B3CA 3ISXA 3FEDA 2ZEPA 4TWEA 5IB9A 2HB6A 4UEFA 3N5FA 3KQXA 5K8NA 5IR2A 4OC4A 4C8PA 4O23A 4NGMA 4OKOA 4LQGA 1CX8A 3PB9X 4R7MA 1F2PA 4FUUA 3D7GA 3L2NA 3FH4A 3FECA 1VHEA 2PJ0A 4OIDA 2XEFA 4C9VA 1CP7A 3S9MA 3NA6A 1IY7A 2AFSA 2PIYA 2O4HA 2ZOFA 4DJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CPA A;  4PXB A;  3K9T A;  4NGR A;  4JZ0 A;  2ZEG A;  4OIW A;  2F7V A;  3DLJ A;  1TKF A;  2ZEO A;  3VH9 A;  4P6Y A;  3TX8 A;  4C84 A;  1TF8 A;  1TXR A;  2J9A A;  3EIF A;  3D7H A;  4C85 A;  2PJ3 A;  2ANP A;  3GUX A;  1DE4 C;  4ZYQ A;  3H8F A;  4PPZ A;  4EME A;  1Z2L A;  3SJG A;  2POK A;  2ZED A;  1Q7L A;  1PCA A;  2NSM A;  1JQG A;  3SJE A;  1TF9 A;  1ZG7 A;  4A39 A;  2GLJ A;  3KZW A;  4PXE A;  2AFM A;  3V38 A;  4ZY1 A;  4AXV A;  1ELM P;  4NGN A;  5K8O A;  4KSI A;  2PJ7 A;  1CPX A;  2VL1 A;  3B3V A;  4MMO A;  3B3T A;  1BAV A;  2I3C A;  4UEZ A;  3VAR A;  2Q4Z A;  3CPX A;  3PBE A;  1KWM A;  5J1Q A;  1ZG9 A;  5HVG A;  4A37 A;  3FMC A;  3IFE A;  3BI0 A;  3VAT A;  3WAB A;  1LOK A;  2IQ6 A;  3BI1 A;  2QVP A;  4IHM A;  5THW A;  3FVL A;  1IGB A;  3FEE A;  1FNO A;  4P10 A;  2ZEN A;  2C1C A;  3H8E A;  3H8G A;  2GU2 A;  1ARL A;  4MCS A;  2PRQ A;  2IJZ A;  1H8L A;  3IO1 A;  3D67 A;  3PB8 X;  3QNV A;  5HVH A;  2PCU A;  4A94 A;  2PJ2 A;  3D68 A;  2AFU A;  4NGQ A;  1ELL P;  4F9V A;  1Y9Z A;  3D7D A;  1YW4 A;  5LRJ A;  2Q43 A;  4EWT A;  4ZX8 A;  3KR4 A;  4IAV A;  5D8N A;  4OC1 A;  4NGS A;  1M4L A;  3WC6 A;  5F09 A;  4NJQ A;  3MN8 A;  2PJ6 A;  4EFD A;  1CPS A;  1HDQ A;  2HC9 A;  1ZLH A;  3RBU A;  1XFO A;  3B3S A;  2PJA A;  4PQA A;  4F9U A;  2PJB A;  3WT4 A;  1VGY A;  5HVF A;  1HEE A;  5LYF A;  1UWY A;  5LYL A;  2PJ9 A;  4P45 A;  1Y7E A;  4C9R A;  1EE3 P;  4P4F A;  4WJB A;  5HXD A;  2EK8 A;  4ZY0 A;  4C9U A;  1XF1 A;  3IC1 A;  2O53 A;  4IK2 A;  4C86 A;  4MRI A;  4Z65 A;  1BLL E;  1R43 A;  1LCP A;  3LWU A;  3PFO A;  1ZG8 A;  3RZA A;  3B2Y A;  4MXU A;  1Y0R A;  4NGT A;  3B7I A;  1VIX A;  4F8Z A;  4C8A A;  1TKH A;  2V8H A;  3KHZ A;  3KHX A;  2C6C A;  3PEI A;  3LMS A;  4W9Y A;  2RFH A;  1R3N A;  1LAN A;  3KI9 A;  3JRU A;  3HUV A;  1BPM A;  2JBK A;  5ELY A;  3SI2 A;  3SI1 A;  5JGF A;  5LYD A;  1QMU A;  4C8T A;  4X3R A;  3CDX A;  3GB0 A;  1DTD A;  3IJ3 A;  2PJ8 A;  2ZEM A;  1VHO A;  3D7F A;  1XRY A;  1LAP A;  4MHZ A;  2C6G A;  4FWU A;  2CIJ A;  1YLO A;  2V8D A;  4C8F A;  2ABZ A;  2DEA A;  2NYQ A;  4FBE A;  4MCP A;  5CBM A;  7CPA A;  2WZN A;  5JM6 A;  4OME A;  4CDK A;  1GYT A;  3RAM A;  2ZEH A;  1OBR A;  2XEJ A;  2ZOG A;  4NFR A;  4MHN A;  4DYO A;  4GM5 A;  4TJV A;  4MCR A;  1YSJ A;  5LRG A;  5DS0 A;  3NH5 A;  3BXM A;  4OC2 A;  3FJU A;  2V8V A;  2JBJ A;  8CPA A;  4WWV A;  3MRU A;  2V8G A;  4P4I A;  3PB4 X;  3CPA A;  2PJ4 A;  4C8U A;  2CTC A;  2OOT A;  2FVG A;  3D4U A;  4OC3 A;  4P44 A;  1CP6 A;  4CDJ A;  2C6P A;  2ZEL A;  4H2K A;  3WC7 A;  3HLP A;  4JYW A;  3WC5 A;  2ZEE A;  4X2T A;  4ZY2 A;  4P4E A;  1XBU A;  3ICU A;  3I1U A;  1AYE A;  2OR4 A;  3VTA A;  2GLF A;  4UIB A;  2AFZ A;  1V6C A;  1F57 A;  3I6S A;  4UEE A;  4TNU A;  1QQ9 A;  4C9A A;  3IIB A;  2XEI A;  1Z8L A;  3TC8 A;  3KAS A;  2AFX A;  2PJ1 A;  3KQZ A;  4B6Z A;  1CBX A;  4MHP A;  3B35 A;  3PB7 X;  4C99 A;  3PRT A;  3SJF A;  2ZEF A;  2BOA A;  4OP4 A;  3B3W A;  1XJO A;  2PIZ A;  2F8H A;  3SJX A;  1BPN A;  2PVW A;  1TKJ A;  2EWB A;  4YWY A;  3T8W A;  1XMB A;  3NH8 A;  3FF3 A;  1LFW A;  2AFW A;  4R8F A;  1LAM A;  2Q51 A;  3FX6 A;  4P4D A;  5D29 A;  1ZLI A;  5JH9 A;  2QYV A;  5CPA A;  2AFO A;  4RUH A;  4ONW A;  4NJR A;  4Q7A A;  4R6T A;  2CTB A;  4R76 A;  2JEW A;  3V7Z A;  5LRK A;  4C9E A;  1CG2 A;  1WVM A;  2PE3 A;  1ARM A;  4P4B A;  5LYI A;  4FAI A;  4X8I A;  1Y0Y A;  3BHX A;  2PVV A;  4OC0 A;  1F2O A;  4C8C A;  4PXC A;  2PJ5 A;  4NGP A;  4P4J A;  3IWW A;  4ZI6 A;  3NFZ A;  2WYR A;  3PB6 X;  4DUK A;  4OC5 A;  3CT9 A;  1NSA A;  4MCQ A;  4UF4 A;  4YN3 A;  2BCO A;  2V77 A;  1RTQ A;  1HDU A;  1FT7 A;  1Z5R A;  4PXD A;  4BD9 A;  4UIA A;  4MHY A;  5K8P A;  5I4M A;  3ISZ A;  3S9N A;  5K8M A;  4TJX A;  2RB7 A;  1PYT B;  3S9L A;  3KGQ A;  2GRE A;  3DGV A;  4K3N A;  3NH4 A;  4KNG E;  2PJC A;  3KL9 A;  3PFE A;  3D66 A;  4A38 A;  1YW6 A;  4ZX9 A;  2IMO A;  3K2K A;  3GLJ A;  2G9D A;  2EK9 A;  4YU9 A;  4G1P A;  3SI0 A;  3PBB A;  3IEH A;  2BO9 A;  6CPA A;  2CF4 A;  3I74 A;  2XEG A;  2QJ8 A;  1AMP A;  3KR5 A;  1YME A;  3B3C A;  3ISX A;  3FED A;  2ZEP A;  4TWE A;  5IB9 A;  2HB6 A;  4UEF A;  3N5F A;  3KQX A;  5K8N A;  4OC4 A;  4C8P A;  4O23 A;  4NGM A;  4OKO A;  4LQG A;  1CX8 A;  3PB9 X;  4R7M A;  1F2P A;  4FUU A;  3D7G A;  3L2N A;  3FH4 A;  3FEC A;  1VHE A;  2PJ0 A;  4OID A;  2XEF A;  4C9V A;  1CP7 A;  3S9M A;  3NA6 A;  1IY7 A;  2AFS A;  2PIY A;  2O4H A;  2ZOF A;  4DJL A; 
#chains in the Genus database with same CATH topology
 1IOF A;  3S6G A;  4C2Z A;  4CPA A;  5F46 A;  1FY7 A;  2B4J C;  4PXB A;  3V8I A;  2GAN A;  1S3Z A;  3JVN A;  5IX3 A;  3K9T A;  4NGR A;  3QAH A;  4JZ0 A;  2Q4Y A;  2ZEG A;  4OIW A;  4QVT A;  2F7V A;  3R95 A;  3FBU A;  3WR7 A;  2R82 A;  4KOU A;  5J8C A;  4HNX B;  5BWA B;  3DLJ A;  4HKF A;  1QSM A;  3ZJ0 A;  2GE3 A;  4A32 A;  4QUS A;  1TKF A;  4UBR A;  5ISV A;  4CRZ B;  2ZEO A;  2N3A B;  2REE A;  5EC4 A;  2Q7S A;  4P6Y A;  3VH9 A;  2CBL A;  1KBL A;  2Y1N A;  4H6Z A;  2B3U A;  3G8W A;  3HPH E;  3DNS A;  3F0A A;  3TX8 A;  3S6H A;  2MP0 A;  4C84 A;  1S60 A;  1TF8 A;  3BUN B;  1TXR A;  2J9A A;  3BJ8 A;  3TT2 A;  3EIF A;  3D7H A;  3EXN A;  4J0N A;  2FE7 A;  2AJ6 A;  5EMI A;  4C85 A;  2PJ3 A;  2K5T A;  4EVY A;  2ANP A;  3GUX A;  4KOY A;  1DE4 C;  4ZYQ A;  5K99 A;  3H8F A;  3UY5 A;  4B5P A;  4PPZ A;  2Y0M A;  4XNH C;  1Y9K A;  4EME A;  4XPK A;  2B4D B;  1Z2L A;  4GPL B;  3SJG A;  2DF5 A;  5AG4 A;  2POK A;  4GS4 A;  2ZED A;  4IF5 A;  1Q7L A;  2QML A;  1PCA A;  2NSM A;  1JQG A;  3SJE A;  1CJW A;  1TF9 A;  4CYO A;  3KRV A;  5DWM A;  1ZG7 A;  2XPN A;  2GLJ A;  4A39 A;  4CGN A;  3T05 A;  3KZW A;  4PXE A;  2JLM A;  3TLY A;  2AFM A;  2R1I A;  3V38 A;  4CGM A;  5HH1 A;  4UFV A;  4AVB A;  2I79 A;  2GIV A;  2PR1 A;  4XNH B;  1S7F A;  1Y7R A;  1M44 A;  3K9U A;  3HMJ G;  4MJ8 A;  4F0Y A;  2FM4 A;  3TLZ A;  2CNT A;  2G3T A;  4AXV A;  1ELM P;  4NGN A;  3CXP A;  4ZY1 A;  3NOJ A;  5K8O A;  2HWG A;  4KSI A;  2PJ7 A;  1CPX A;  3VRR A;  2VL1 A;  5G1Z A;  3R9F A;  2D0O A;  3B3V A;  1YLE A;  3LOD A;  1MJB A;  4M8D A;  4MFL A;  4MMO A;  1VBH A;  2Z3P A;  3JTK A;  3B3T A;  4OAE A;  4YRH A;  1BAV A;  2I3C A;  2AUN A;  4UEZ A;  3VAR A;  2Q4Z A;  2VXK A;  3CPX A;  2VI7 A;  4A31 A;  3PBE A;  3K4I A;  1Q5X A;  1IOI A;  1KWM A;  4BIN A;  5J1Q A;  1J3L A;  5HKW A;  1ZG9 A;  4PK2 A;  2JEV A;  3RNZ A;  1YVK A;  5HVG A;  2P6F A;  2ZXV A;  4KUB A;  4A37 A;  2FXF A;  1KUY A;  3GIU A;  3FMC A;  4NXY A;  3VRO A;  4C7H A;  1ZL0 A;  2R8V A;  1NE9 A;  4MBU A;  2XPL A;  3IFE A;  2DXQ A;  4H89 A;  4UFW A;  3VWE A;  3BI0 A;  2CXA A;  1S7N A;  1J4J A;  3PGP A;  3VAT A;  4CAE A;  3WAB A;  1LOK A;  5HMN A;  1T36 B;  2IQ6 A;  2Z3L A;  2HI6 A;  3BI1 A;  3O8Z A;  2QVP A;  2YNE A;  4IHM A;  3RYO A;  3I9S A;  3F5B A;  3FVL A;  4M85 A;  1IGB A;  3FEE A;  1YQE A;  1FNO A;  2CNM A;  4P10 A;  2ZEN A;  4J3G A;  4PSW A;  4CAV A;  1I12 A;  2C1C A;  1XE4 A;  2ODF A;  3OP0 A;  2B5G A;  2GU2 A;  2R98 A;  3H8E A;  3H8G A;  4KOT A;  3ZZI A;  3BUW B;  1ARL A;  4MCS A;  3G23 A;  2PRQ A;  3OAK A;  5G22 A;  2IJZ A;  4KLW A;  1H8L A;  3IO1 A;  2F5I A;  1XF8 A;  3D67 A;  3VRP A;  3PB8 X;  3P2H A;  3QNV A;  2IL4 A;  4FD5 A;  2BL1 A;  5HVH A;  2B58 A;  4FD6 A;  2OB0 A;  2PCU A;  4A94 A;  2PJ2 A;  3D68 A;  2AFU A;  3T90 A;  1CE8 B;  3IU1 A;  4NGQ A;  2Q0Y A;  1ELL P;  2FS5 A;  4F9V A;  2ZW4 A;  3D7D A;  1YGH A;  1YW4 A;  1ZO0 A;  2Q43 A;  5LRJ A;  3TOA A;  4EWT A;  3TO9 A;  3F9K C;  1YK3 A;  4UFX A;  4ZX8 A;  3KR4 A;  4IAV A;  5D8N A;  2P0W A;  4OC1 A;  4NGS A;  1M6V B;  5KTC A;  4BPX B;  1M4L A;  1YRE A;  4C68 A;  2I00 A;  3WC6 A;  1ZYM A;  5F09 A;  4UA3 A;  1A2Z A;  4NJQ A;  3MN8 A;  2PJ6 A;  4EFD A;  1CPS A;  1HDQ A;  2XPP A;  2HC9 A;  1ZLH A;  5J8F A;  3RBU A;  2C5Q A;  1XFO A;  3H4Q A;  4BPW B;  3B3S A;  3BLN A;  4M3S A;  2PJA A;  4PQA A;  1IU8 A;  4MFQ A;  2PJB A;  3WT4 A;  4CGO A;  4F9U A;  3T0T A;  1VGY A;  2VZZ A;  5HVF A;  1TIQ A;  1HEE A;  2EBJ A;  2P6E A;  2HUZ A;  3IWG A;  4MY3 A;  5LYF A;  4INJ A;  3JUW A;  1UWY A;  1Z9E A;  2BSW A;  4AG9 A;  2PJ9 A;  2G0B A;  4P45 A;  5IB0 A;  5LYL A;  1R61 A;  5JVL A;  1Y7E A;  2B3V A;  4FD4 A;  4E2A A;  4C9R A;  2PC1 A;  1EE3 P;  4P4F A;  3CXS A;  5J3X A;  4WJB A;  2DPT A;  3EC4 A;  4QBJ A;  5HXD A;  1EO0 A;  2EK8 A;  1P4N A;  1KUV A;  1Z8T A;  4CRY B;  4ZY0 A;  5JPH A;  4C9U A;  3G3S A;  1XF1 A;  2Y1M A;  3OB2 B;  2OZH A;  3IC1 A;  2O53 A;  2D4O A;  4IK2 A;  4C86 A;  4U9Z A;  4MRI A;  4Z65 A;  1C3O B;  2REF A;  1BLL E;  1R43 A;  1LCP A;  3LWU A;  3PFO A;  1ZRS A;  1ZG8 A;  4B5O A;  4IIY A;  4JLY A;  3RZA A;  3B2Y A;  1YX0 A;  2J8N A;  2Q4V A;  4MXU A;  1Y0R A;  5KTD A;  1YVH A;  3NE7 A;  4NGT A;  1Z4R A;  3B7I A;  4KVM E;  1CS0 B;  3HPG G;  1VIX A;  2VZY A;  4F8Z A;  3R9G A;  4C8A A;  3PFV A;  1TKH A;  4CGL A;  3ZNI A;  2V8H A;  4OLL A;  3KHZ A;  4JD6 A;  5C88 A;  3U1B A;  2ZOF A;  1IYK A;  3KHX A;  2C6C A;  3PEI A;  2XPO A;  2B4B A;  4W9Y A;  3LMS A;  1DIK A;  5JYB A;  3BJ7 A;  2RFH A;  1R3N A;  1LAN A;  4JXR A;  4CAW A;  1U6M A;  5F49 A;  3KI9 A;  2PRB A;  3JRU A;  4JJX A;  3HUV A;  4E8O A;  4MY0 A;  2YJV A;  4JVO A;  1BPM A;  3GJZ A;  1B47 A;  4L89 A;  2JBK A;  5ELY A;  3SI2 A;  1OZP A;  3SI1 A;  5JGF A;  4MI1 A;  5LYD A;  1KEE B;  1QMU A;  2CNS A;  2Q44 A;  1K4J A;  3T07 A;  4C8T A;  2WPX A;  1MJA A;  4X3R A;  3CDX A;  1YR0 A;  3GB0 A;  4CYQ A;  1DTD A;  3IJ3 A;  2ARH A;  1L0C A;  2PJ8 A;  4HNW B;  4B11 A;  3EY5 A;  2ZEM A;  1VHO A;  4C7I A;  3D7F A;  1XRY A;  1LAP A;  4K30 A;  1JDB C;  4MHZ A;  3TLG B;  2B4D A;  2C6G A;  3CZX A;  4FWU A;  2CIJ A;  4LUA A;  4XPD C;  1YLO A;  4ZBG A;  4A33 A;  2V8D A;  2HRO A;  3PT1 A;  4C8F A;  5F1Y A;  1PUA A;  2X7B A;  4UCM A;  2EZA A;  3MGD A;  2EZC A;  5I0C A;  3EZA A;  4A2Z A;  1VBG A;  3P2F A;  2AE6 A;  1VKC A;  3N7Z A;  1YVO A;  2ABZ A;  2OLS A;  1FBV A;  2DEA A;  2YJT A;  2JDD A;  2NYQ A;  4KS9 A;  3BUM B;  5EBV A;  4FBE A;  1Z8X A;  4R87 A;  1MJ9 A;  4MCP A;  5CBM A;  7CPA A;  2WZN A;  3GKR A;  5BY0 A;  5JM6 A;  3TO6 A;  1KUX A;  4OME A;  4II9 A;  5KTA A;  4CDK A;  1GYT A;  5F48 A;  3SHP A;  2KCW A;  4M6H A;  3RAM A;  3EZE A;  4AVA A;  2ZEH A;  5IV0 A;  2RC4 A;  3SXN A;  1OBR A;  2XEJ A;  2ZOG A;  1QST A;  5CNP A;  4NFR A;  3OB1 B;  4R57 A;  3TO7 A;  2QIR A;  4MHN A;  3VRN A;  4NEX A;  4QB9 A;  4E0A A;  2EZB A;  4DYO A;  4QC6 A;  2VBQ A;  4YGO A;  4KOS A;  2ZW5 A;  2G3A A;  2EUI A;  1Z4E A;  4GM5 A;  4MCR A;  4ZGY B;  1YSJ A;  4YFJ A;  4TJV A;  2R7H A;  5LRG A;  5DS0 A;  3FB3 A;  3NH5 A;  3BXM A;  4KUA A;  5H86 A;  4OC2 A;  3FJU A;  4Q36 A;  2V8V A;  2JBJ A;  8CPA A;  3EFA A;  2CY2 A;  4WWV A;  5A28 A;  5HKY A;  2PQ8 A;  3MRU A;  2PDO A;  3W6X A;  4EYS A;  1IB1 E;  3TYX A;  1KZF A;  2DLA A;  2V8G A;  4AB7 A;  4JWP A;  4P4I A;  3PB4 X;  1Q2C A;  4CGP A;  2DPS A;  2BEI A;  2X0S A;  1QSO A;  3NE8 A;  3CPA A;  2PJ4 A;  4C8U A;  2CTC A;  5A27 A;  2Q04 A;  4MFK A;  4C2Y A;  3LD2 A;  2OOT A;  1QSR A;  2Z3O A;  2FVG A;  4I49 A;  1IIC A;  3D4U A;  2HQY A;  2YND A;  4OC3 A;  4P44 A;  1X10 A;  2ATR A;  4FD7 A;  2BUE A;  1LRZ A;  3IWE A;  1CP6 A;  3QB8 A;  5AG5 A;  3TLC A;  4CDJ A;  2C6P A;  2Z0Z A;  2ZEL A;  4H2K A;  3WC7 A;  4MI4 A;  5FD8 A;  3HLP A;  4MFP A;  4LQ6 A;  4JYW A;  4CAX A;  1XMT A;  1M4G A;  3WC5 A;  2J8R A;  2ZEE A;  4E5S A;  5GCN A;  4X2T A;  1R57 A;  4ZY2 A;  4ORF A;  4P4E A;  1XBU A;  2HV2 A;  3ICU A;  5F9M A;  3I1U A;  3F8K A;  4HPS A;  1AYE A;  2OR4 A;  2C27 A;  2H5M A;  4KVO E;  3VTA A;  2NMT A;  4M6I A;  2GLF A;  4CYP A;  4UIB A;  3CXQ A;  4B13 A;  3E0K A;  4ONU A;  2AFZ A;  4KOR A;  4UCP A;  1V6C A;  4RR2 B;  2GP4 A;  1F57 A;  5FVJ A;  1M1D A;  3KKW A;  2D0P A;  3FRM A;  4COG A;  4A4B A;  3I6S A;  4NCZ A;  2VKZ G;  3D2M A;  3GYA A;  3PZJ A;  2Z3K A;  4UEE A;  4TNU A;  1SQH A;  1QQ9 A;  4C9A A;  3PP9 A;  4BBH A;  2FSR A;  3TLA A;  3IIB A;  5JQ4 A;  4H6U A;  1NXJ A;  1B87 A;  4C2X A;  3S6K A;  2XEI A;  1Z8L A;  2AUM A;  1X12 A;  3TOB A;  3TC8 A;  3FXT A;  2OZG A;  5HKZ A;  2FIA A;  3KAS A;  3QAY A;  3EZB A;  2AFX A;  4RS2 A;  2YNC A;  1V0C A;  4PV6 A;  3D2P A;  2PJ1 A;  4CYN A;  3W91 A;  3KQZ A;  1JWQ A;  3R1K A;  4B6Z A;  1CBX A;  2ZPA A;  4MHP A;  3B35 A;  3EO4 A;  3PB7 X;  4C99 A;  4AG7 A;  3PRT A;  3SJF A;  2ZEF A;  1Z8W A;  4KSA A;  3IU2 A;  2BOA A;  4OP4 A;  4R9M A;  3B3W A;  1XJO A;  2PIZ A;  3TLB A;  1B6B A;  2F8H A;  4R3L A;  3SJX A;  1BPN A;  1CM0 A;  2WUU A;  4F6A A;  2PVW A;  1TKJ A;  2EWB A;  4MFZ A;  4YWY A;  3T8W A;  1NBW A;  1XMB A;  5THW A;  4JXQ A;  1XEB A;  3TTH A;  1C30 B;  3R96 A;  1MK4 A;  2FT0 A;  3NH8 A;  3C8O A;  1WWZ A;  3FF3 A;  1LFW A;  4KVX A;  3RO0 A;  2AFW A;  4NF1 A;  4KLV A;  4LX9 A;  5F47 A;  2ZW7 A;  4R8F A;  3T5M A;  1LAM A;  2Q51 A;  3FX6 A;  4M6G A;  4UWJ A;  4B5P B;  2ZW6 A;  4P4D A;  5D29 A;  1ON0 A;  1ZLI A;  2FIW A;  2GFQ A;  5G20 A;  1M4I A;  2P6G A;  4DNC A;  5JH9 A;  2QYV A;  4CAF A;  5CPA A;  2DIK A;  3B8G A;  3TCV A;  4A95 A;  2D4P A;  2EO8 A;  2AFO A;  1EZB A;  4RUH A;  1XIX A;  1P0H A;  4NJR A;  4ONW A;  4Q7A A;  4R6T A;  2CTB A;  4R3K A;  4R76 A;  5H84 A;  1Y9W A;  4RN7 A;  2JEW A;  1S5K A;  4CO9 A;  3V7Z A;  2EVN A;  3TE4 A;  4Q38 A;  5LRK A;  4C9E A;  4H1H A;  1CG2 A;  2WSA A;  4KOW A;  4F0X A;  2Q7B A;  2PE3 A;  1WVM A;  1I1D A;  1QSN A;  1ARM A;  4P4B A;  5LYI A;  3TLG A;  1EZA A;  4FAI A;  2UV8 G;  4X8I A;  1A9X B;  1Y0Y A;  4L8A A;  1GHE A;  4XPD B;  3BHX A;  4B10 A;  2PVV A;  1BO4 A;  1M4D A;  2PR8 A;  4OC0 A;  1F2O A;  3SR3 A;  4C8C A;  2PSW A;  4AVC A;  4PXC A;  4MHD A;  2PJ5 A;  4BPU B;  4NGP A;  1AUG A;  4MFJ A;  4P4J A;  3IWW A;  2OU2 A;  2VQY A;  4ZI6 A;  3NFZ A;  4BTF A;  2WYR A;  3PB6 X;  4Y49 C;  4DUK A;  4IIX A;  4KOX A;  4KZT A;  4OC5 A;  3CT9 A;  1NSA A;  4MCQ A;  4UF4 A;  3GY9 A;  3VWD A;  4YN3 A;  2BCO A;  2V77 A;  4HNY B;  1RTQ A;  1HDU A;  3PLF B;  1FT7 A;  1IID A;  1Z5R A;  4PXD A;  4UWI A;  3BUO B;  5AGE A;  4BD9 A;  4UIA A;  4MHY A;  5K8P A;  5I4M A;  3ISZ A;  3S9N A;  5K8M A;  1IYL A;  4TJX A;  3TLE A;  5F13 A;  1S7L A;  4Y49 B;  2O28 A;  1RXT A;  2RB7 A;  3FIX A;  1PYT B;  3W6S A;  3S9L A;  2YGW A;  1BXR B;  2B5G B;  3IGR A;  4KOV A;  4OAD A;  3KGQ A;  1WJT A;  4XPL A;  4CZ1 A;  2OZU A;  5AG6 A;  4PK3 A;  2GRE A;  4B12 A;  1BOB A;  3DGV A;  2Z10 A;  3NH4 A;  4K3N A;  1NSL A;  1GGO A;  4KNG E;  2QEC A;  3NFQ A;  2PJC A;  3KL9 A;  3PFE A;  3D66 A;  4IUS A;  1Z9U A;  3A9L A;  4A38 A;  1I21 A;  1Y9Z A;  1YW6 A;  2PCN A;  3VRQ A;  4ZX9 A;  5F5X A;  2IMO A;  3K2K A;  4COB A;  3GLJ A;  1PU9 A;  3OWC A;  2VEZ A;  5AXI A;  1Q2D A;  5G21 A;  3SXO A;  2G9D A;  2EK9 A;  4YU9 A;  4G1P A;  3SI0 A;  1XOV A;  3PBB A;  3R9E A;  3TFY A;  3IEH A;  2BO9 A;  4PSX A;  6CPA A;  3DSB A;  2CF4 A;  2OH1 A;  3C26 A;  1JDE A;  1S7K A;  3I74 A;  4MJX A;  3D8P A;  5DWN A;  4X5K A;  3S6F A;  4CS0 B;  2XEG A;  2QJ8 A;  2E28 A;  1KC7 A;  1AMP A;  3KR5 A;  1YME A;  3B3C A;  3ISX A;  5E96 A;  1Q2Y A;  3FED A;  2ZEP A;  4KSF A;  4TWE A;  5IB9 A;  2HB6 A;  3FYN A;  1UFH A;  2FL4 A;  4UEF A;  1RO5 A;  3D3S A;  3N5F A;  3KQX A;  5K8N A;  3DR8 A;  5IR2 A;  4OC4 A;  4C8P A;  4O23 A;  4NGM A;  2J8M A;  4OKO A;  4LQG A;  1CX8 A;  3PB9 X;  4R7M A;  4BMH A;  1F2P A;  4GXH A;  4RI1 A;  4FUU A;  1VI4 A;  3T9Y A;  3D7G A;  1WK4 A;  2YNC C;  3L2N A;  3FH4 A;  1VHS A;  3H5Z A;  4A4C A;  3FEC A;  1VHE A;  2PJ0 A;  2WPW A;  4UCN A;  4U5Y A;  4OID A;  2XEF A;  2JDC A;  2FCK A;  4C9V A;  3FNC A;  2Z3M A;  1CP7 A;  1NMT A;  1N71 A;  3S9M A;  3U88 C;  3NA6 A;  4NSQ A;  3BUX B;  4A30 A;  3DR6 A;  1IY7 A;  2AFS A;  5AG7 A;  4B14 A;  2Z11 A;  2PIY A;  3DDD A;  2B0A A;  3VGO A;  2O4H A;  3I3G A;  4E94 A;  4U9Y A;  3LAC A;  2A4N A;  4DJL A;  2Z3N A;  5C82 A; 
#chains in the Genus database with same CATH homology
 4CPA A;  4PXB A;  3K9T A;  4NGR A;  4JZ0 A;  2ZEG A;  4OIW A;  2F7V A;  3DLJ A;  1TKF A;  2ZEO A;  3VH9 A;  4P6Y A;  3TX8 A;  4C84 A;  1TF8 A;  1TXR A;  2J9A A;  3EIF A;  3D7H A;  4C85 A;  2PJ3 A;  2ANP A;  3GUX A;  1DE4 C;  4ZYQ A;  3H8F A;  4PPZ A;  4EME A;  1Z2L A;  3SJG A;  2POK A;  2ZED A;  1Q7L A;  1PCA A;  2NSM A;  1JQG A;  3SJE A;  1TF9 A;  1ZG7 A;  4A39 A;  2GLJ A;  3KZW A;  4PXE A;  2AFM A;  3V38 A;  4ZY1 A;  4AXV A;  1ELM P;  4NGN A;  5K8O A;  4KSI A;  2PJ7 A;  1CPX A;  2VL1 A;  3B3V A;  4MMO A;  3B3T A;  1BAV A;  2I3C A;  4UEZ A;  3VAR A;  2Q4Z A;  3CPX A;  3PBE A;  1KWM A;  5J1Q A;  1ZG9 A;  5HVG A;  4A37 A;  3FMC A;  3IFE A;  3BI0 A;  3VAT A;  3WAB A;  1LOK A;  2IQ6 A;  3BI1 A;  2QVP A;  4IHM A;  5THW A;  3FVL A;  1IGB A;  3FEE A;  1FNO A;  4P10 A;  2ZEN A;  2C1C A;  3H8E A;  3H8G A;  2GU2 A;  1ARL A;  4MCS A;  2PRQ A;  2IJZ A;  1H8L A;  3IO1 A;  3D67 A;  3PB8 X;  3QNV A;  5HVH A;  2PCU A;  4A94 A;  2PJ2 A;  3D68 A;  2AFU A;  4NGQ A;  1ELL P;  4F9V A;  1Y9Z A;  3D7D A;  1YW4 A;  5LRJ A;  2Q43 A;  4EWT A;  4ZX8 A;  3KR4 A;  4IAV A;  5D8N A;  4OC1 A;  4NGS A;  1M4L A;  3WC6 A;  5F09 A;  4NJQ A;  3MN8 A;  2PJ6 A;  4EFD A;  1CPS A;  1HDQ A;  2HC9 A;  1ZLH A;  3RBU A;  2C5Q A;  1XFO A;  3B3S A;  2PJA A;  4PQA A;  4F9U A;  2PJB A;  3WT4 A;  1VGY A;  5HVF A;  1HEE A;  5LYF A;  1UWY A;  5LYL A;  2PJ9 A;  4P45 A;  1Y7E A;  4C9R A;  1EE3 P;  4P4F A;  4WJB A;  5HXD A;  2EK8 A;  4ZY0 A;  4C9U A;  1XF1 A;  3IC1 A;  2O53 A;  4IK2 A;  4C86 A;  4MRI A;  4Z65 A;  1BLL E;  1R43 A;  1LCP A;  3LWU A;  3PFO A;  1ZG8 A;  3RZA A;  3B2Y A;  4MXU A;  1Y0R A;  4NGT A;  3B7I A;  1VIX A;  4F8Z A;  4C8A A;  1TKH A;  2V8H A;  3KHZ A;  3KHX A;  2C6C A;  3PEI A;  3LMS A;  4W9Y A;  2RFH A;  1R3N A;  1LAN A;  3KI9 A;  3JRU A;  3HUV A;  1BPM A;  2JBK A;  5ELY A;  3SI2 A;  3SI1 A;  5JGF A;  5LYD A;  1QMU A;  4C8T A;  4X3R A;  3CDX A;  3GB0 A;  1DTD A;  3IJ3 A;  2PJ8 A;  2ZEM A;  1VHO A;  3D7F A;  1XRY A;  1LAP A;  4MHZ A;  2C6G A;  4FWU A;  2CIJ A;  1YLO A;  2V8D A;  4C8F A;  2ABZ A;  2DEA A;  2NYQ A;  4FBE A;  4MCP A;  5CBM A;  7CPA A;  2WZN A;  5JM6 A;  4OME A;  4CDK A;  1GYT A;  3RAM A;  2ZEH A;  1OBR A;  2XEJ A;  2ZOG A;  4NFR A;  4MHN A;  4DYO A;  4GM5 A;  4TJV A;  4MCR A;  1YSJ A;  5LRG A;  5DS0 A;  3NH5 A;  3BXM A;  4OC2 A;  3FJU A;  2V8V A;  2JBJ A;  8CPA A;  4WWV A;  3MRU A;  2V8G A;  4P4I A;  3PB4 X;  3CPA A;  2PJ4 A;  4C8U A;  2CTC A;  2OOT A;  2FVG A;  3D4U A;  4OC3 A;  4P44 A;  1CP6 A;  4CDJ A;  2C6P A;  2ZEL A;  4H2K A;  3WC7 A;  3HLP A;  4JYW A;  3WC5 A;  2ZEE A;  4X2T A;  4ZY2 A;  4P4E A;  1XBU A;  3ICU A;  3I1U A;  1AYE A;  2OR4 A;  3VTA A;  2GLF A;  4UIB A;  2AFZ A;  2GP4 A;  1V6C A;  1F57 A;  3I6S A;  4UEE A;  4TNU A;  1QQ9 A;  4C9A A;  3IIB A;  2XEI A;  1Z8L A;  3TC8 A;  3KAS A;  2AFX A;  2PJ1 A;  3KQZ A;  4B6Z A;  1CBX A;  4MHP A;  3B35 A;  3PB7 X;  4C99 A;  3PRT A;  3SJF A;  2ZEF A;  2BOA A;  4OP4 A;  3B3W A;  1XJO A;  2PIZ A;  2F8H A;  3SJX A;  1BPN A;  2PVW A;  1TKJ A;  2EWB A;  4YWY A;  3T8W A;  1XMB A;  3NH8 A;  3FF3 A;  1LFW A;  2AFW A;  4R8F A;  1LAM A;  2Q51 A;  3FX6 A;  4P4D A;  5D29 A;  1ZLI A;  5JH9 A;  2QYV A;  5CPA A;  2AFO A;  4RUH A;  4ONW A;  4NJR A;  4Q7A A;  4R6T A;  2CTB A;  4R76 A;  2JEW A;  3V7Z A;  5LRK A;  4C9E A;  1CG2 A;  1WVM A;  2PE3 A;  1ARM A;  4P4B A;  5LYI A;  4FAI A;  4X8I A;  1Y0Y A;  3BHX A;  2PVV A;  4OC0 A;  1F2O A;  4C8C A;  4PXC A;  2PJ5 A;  4NGP A;  4P4J A;  3IWW A;  4ZI6 A;  3NFZ A;  2WYR A;  3PB6 X;  4DUK A;  4OC5 A;  3CT9 A;  1NSA A;  4MCQ A;  4UF4 A;  4YN3 A;  2BCO A;  2V77 A;  1RTQ A;  1HDU A;  1FT7 A;  1Z5R A;  4PXD A;  4BD9 A;  4UIA A;  4MHY A;  5K8P A;  5I4M A;  3ISZ A;  3S9N A;  5K8M A;  4TJX A;  2RB7 A;  1PYT B;  3S9L A;  3KGQ A;  2GRE A;  3DGV A;  4K3N A;  3NH4 A;  4KNG E;  2PJC A;  3KL9 A;  3PFE A;  3D66 A;  4A38 A;  1YW6 A;  4ZX9 A;  2IMO A;  3K2K A;  3GLJ A;  2G9D A;  2EK9 A;  4YU9 A;  4G1P A;  3SI0 A;  3PBB A;  3IEH A;  2BO9 A;  6CPA A;  2CF4 A;  3I74 A;  2XEG A;  2QJ8 A;  1AMP A;  3KR5 A;  1YME A;  3B3C A;  3ISX A;  3FED A;  2ZEP A;  4TWE A;  5IB9 A;  2HB6 A;  4UEF A;  3N5F A;  3KQX A;  5K8N A;  5IR2 A;  4OC4 A;  4C8P A;  4O23 A;  4NGM A;  4OKO A;  4LQG A;  1CX8 A;  3PB9 X;  4R7M A;  1F2P A;  4FUU A;  3D7G A;  3L2N A;  3FH4 A;  3FEC A;  1VHE A;  2PJ0 A;  4OID A;  2XEF A;  4C9V A;  1CP7 A;  3S9M A;  3NA6 A;  1IY7 A;  2AFS A;  2PIY A;  2O4H A;  2ZOF A;  4DJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...