3BHXA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of asp-glu
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bhxA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bhxA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bhxA02
4MXUA 3GUXA 4C84A 3H8FA 2WYRA 4PXBA 1ARMA 4NFRA 3GB0A 5JGFA 4R7MA 4YU9A 3KHZA 2PJAA 2PJ3A 4OC0A 4O23A 2PJ7A 2Q51A 4ONWA 3NH8A 4MHZA 3SI0A 2JBKA 4R6TA 4EWTA 4A38A 2WZNA 4CPAA 2XEFA 2JEWA 1Z2LA 2HB6A 3B35A 2AFXA 2POKA 4CDKA 3HLPA 5K8OA 2V8GA 1VHEA 4Z65A 2IQ6A 4A94A 4K3NA 1BPMA 2GU2A 2PJCA 3D67A 3ISZA 5LYLA 2Q43A 4P4JA 5I4MA 1IY7A 2PVVA 3SJFA 3CDXA 3KL9A 1XMBA 4OKOA 4X8IA 4UEEA 4IHMA 3GLJA 4H2KA 2PIYA 4IAVA 3IO1A 2NYQA 3TX8A 2XEJA 3K2KA 2OOTA 1ELMP 1OBRA 3L2NA 1KWMA 3D68A 2PJ9A 3NH5A 3DLJA 3VARA 4C8AA 4ZY0A 4P4DA 3D4UA 4MCPA 1YW4A 3B3SA 1CBXA 1TXRA 3DGVA 3I74A 4C9VA 4PXEA 3MRUA 3PEIA 2Q4ZA 1H8LA 4UEZA 1YMEA 4YN3A 3IIBA 5CPAA 4UIBA 5LYFA 3D66A 1CX8A 3KR5A 3MN8A 4Q7AA 2AFZA 4NGPA 2PIZA 5IB9A 2I3CA 4JYWA 3ICUA 1LFWA 4TWEA 1V6CA 4JZ0A 2IMOA 3PBBA 3KZWA 3B3CA 3PBEA 1PYTB 3CT9A 2AFOA 4PQAA 1QQ9A 2V8HA 1Y9ZA 4OIDA 2XEGA 3NFZA 1VIXA 2F8HA 5DS0A 1Z5RA 3D7FA 2PCUA 4C8PA 1TF8A 3K9TA 1BPNA 3SJXA 1R3NA 3V7ZA 2AFWA 1AMPA 1ZG9A 5LYIA 3FF3A 3KGQA 5J1QA 2QYVA 1Z8LA 1TKFA 3SJGA 1M4LA 4PPZA 2ZELA 3B7IA 4BD9A 1F2PA 2PJ8A 5HXDA 4P4BA 1VHOA 1Y0YA 3I1UA 4NGTA 3WC5A 4RUHA 4C86A 3NA6A 5CBMA 4MCRA 4FBEA 4NGRA 2XEIA 4C9UA 4FAIA 1EE3P 2PRQA 4OC3A 3D7GA 3B3VA 1CPXA 4NGMA 3FEEA 2ZEPA 2CF4A 3ISXA 3FH4A 4W9YA 3FEDA 2C6PA 1CPSA 4C99A 3BHXA 4F8ZA 2BO9A 3IJ3A 1XF1A 2EK8A 2V8VA 2V8DA 4P45A 4C8FA 1YSJA 2ZEFA 3I6SA 2ANPA 3JRUA 4OP4A 5HVGA 2ZEMA 4P4FA 4X3RA 3HUVA 5THWA 2EWBA 3PB8X 2ZOGA 2PJ6A 2V77A 2RB7A 3FX6A 4OC1A 1DE4C 1TF9A 4EFDA 3SI2A 4NJRA 3S9MA 3D7HA 1UWYA 2HC9A 4KSIA 4P4EA 1XRYA 1LCPA 3H8EA 1YLOA 3PB7X 4ZY1A 4MCQA 3BXMA 2IJZA 3CPAA 3QNVA 2J9AA 3VTAA 5LYDA 5JM6A 1ELLP 3KASA 3IWWA 5LRJA 1CP6A 4UF4A 4R8FA 4MMOA 2ZEDA 3LWUA 2AFUA 3FECA 2ABZA 2PVWA 2C6CA 2GREA 4NGNA 5F09A 2RFHA 2PJ0A 4TNUA 1CP7A 4MCSA 1BAVA 2ZEHA 3BI0A 4C8TA 2O4HA 4P44A 1HEEA 1VGYA 5D8NA 3B3TA 3D7DA 2G9DA 4DJLA 5K8NA 4MHPA 5K8PA 4OC2A 2QVPA 4P4IA 1XFOA 4C9RA 4FWUA 1IGBA 5D29A 3WABA 3KHXA 3N5FA 4ZYQA 4FUUA 4PXDA 1Y7EA 2PE3A 4X2TA 5HVFA 5ELYA 1ZLIA 1BLLE 3T8WA 4LQGA 2GLFA 1AYEA 3S9NA 1Q7LA 2FVGA 1Y0RA 2QJ8A 3IEHA 3FVLA 3LMSA 2ZOFA 2PJ1A 3RZAA 4ZX8A 4C8CA 1HDQA 3PRTA 4AXVA 2F7VA 4TJVA 3VH9A 5LRKA 4MHNA 4NGSA 3RBUA 2JBJA 1LOKA 2CIJA 4UIAA 1YW6A 3KQZA 2ZEGA 3KI9A 4NGQA 4R76A 3NH4A 4A39A 3PFEA 1ZG7A 4C9AA 5K8MA 3B3WA 2AFSA 2ZENA 5HVHA 3B2YA 4KNGE 3CPXA 1GYTA 2PJ2A 2O53A 4ZX9A 1ZG8A 3WC6A 3SJEA 2PJ5A 1PCAA 1CG2A 4MHYA 2VL1A 3H8GA 1FT7A 4P10A 4UEFA 2NSMA 2C6GA 8CPAA 4ZI6A 3IC1A 6CPAA 2AFMA 1QMUA 4WJBA 1R43A 2CTCA 3V38A 2BOAA 2OR4A 2C1CA 4DUKA 4OC4A 1ZLHA 4OC5A 3KQXA 1F2OA 4IK2A 3PB6X 2PJBA 4P6YA 1WVMA 4C9EA 2PJ4A 2BCOA 1LAMA 2CTBA 3EIFA 3PFOA 4F9UA 1HDUA 4MRIA 3PB9X 4ZY2A 4PXCA 4OMEA 4B6ZA 5LRGA 7CPAA 2ZEOA 4YWYA 4F9VA 1NSAA 3IFEA 4GM5A 1TKJA 1JQGA 1F57A 1RTQA 3FMCA 3PB4X 1XJOA 4WWVA 4CDJA 1TKHA 4C8UA 4TJXA 3BI1A 3WT4A 4C85A 1LAPA 3S9LA 4OIWA 2DEAA 4G1PA 1XBUA 3SI1A 5JH9A 1ARLA 3RAMA 4DYOA 4A37A 3KR4A 2EK9A 4NJQA 3TC8A 2ZEEA 1DTDA 1LANA 1FNOA 4EMEA 2GLJA 3FJUA 3WC7A 3VATA
chains in the Genus database with same CATH superfamily
3BUWB 4CZ1A 4MXUA 3VRNA 3GUXA 4C7HA 3H5ZA 3OP0A 5F5XA 4C84A 3TOAA 4AVAA 3IWEA 4XPDB 3K9UA 3OB1B 3H8FA 3WR7A 2I00A 4RR2B 2WYRA 1RO5A 1IOIA 4PXBA 2Z3MA 2REFA 4B5OA 1VBGA 1ARMA 4NFRA 4DNCA 4B14A 2YJVA 3T05A 3GB0A 4C2YA 4R7MA 5JGFA 1FBVA 3TLGB 4HPSA 4YU9A 2G0BA 2P6GA 2EZAA 2D0PA 4NXYA 4MFPA 3KHZA 2PJAA 1S7LA 3V8IA 1M4GA 1SQHA 2PJ3A 4M6GA 4F0YA 4OC0A 4O23A 2PJ7A 3VROA 2P6FA 2Q51A 3I3GA 2A4NA 4KVME 4ONWA 4CRYB 1C30B 3NH8A 3CZXA 4MHZA 3SI0A 1GHEA 4A95A 2JBKA 2CNSA 4GS4A 4R6TA 3SHPA 4A38A 4EWTA 5AG4A 2WZNA 3EO4A 5JVLA 2ZW4A 4CPAA 2BSWA 2XEFA 2PR8A 2JEWA 1Z2LA 2WPWA 4M6IA 2HB6A 3B35A 2AFXA 4UBRA 1R57A 2POKA 4ZBGA 3HLPA 2HWGA 2ARHA 3VRQA 2V8GA 4A4CA 2XPLA 1VHEA 1XMTA 5GCNA 5K8OA 2C5QA 2OU2A 1EO0A 1T36B 4Z65A 2IQ6A 5FD8A 4A94A 2DF5A 2Q4YA 4K3NA 2G3AA 3G23A 1BPMA 2GU2A 1XEBA 2PJCA 3D67A 4AG7A 2R8VA 2HQYA 3I9SA 1QSOA 4M85A 4CGLA 1CE8B 3ISZA 5LYLA 4CRZB 3FB3A 1MJAA 1MK4A 2DPTA 2JLMA 2Q43A 3FBUA 4P4JA 1S7KA 4B11A 4C68A 3FRMA 4L8AA 4UA3A 5FVJA 5I4MA 5G21A 1M4IA 1IY7A 4JD6A 2PVVA 4MJXA 3SJFA 5ISVA 1B87A 3CDXA 3KL9A 1M44A 4Y49B 1XMBA 1QSTA 4OKOA 4CYOA 1V0CA 1IYKA 4X8IA 4UEEA 1Q5XA 5HKZA 4IHMA 3GLJA 4H2KA 2J8RA 2PIYA 4A2ZA 1EZBA 4IAVA 3IO1A 4MY3A 1XOVA 2NYQA 1P4NA 4NCZA 4CAEA 3TO7A 3TX8A 4ZGYB 2R98A 3H4QA 4L89A 2XEJA 2YNEA 2YNCA 3LACA 3EZBA 3K2KA 2BEIA 4KOVA 3SR3A 1Z4RA 2OOTA 1ELMP 3SXOA 4H6ZA 1M4DA 1QSNA 4UFVA 4FD6A 5DWNA 2VKZG 1OBRA 3L2NA 3CXPA 4KOYA 1KWMA 4B5PA 5F46A 3N7ZA 2OB0A 2PJ9A 3D68A 5IX3A 2HI6A 3NH5A 1DIKA 3DLJA 3VARA 5K99A 2AUNA 4C8AA 5AG6A 5JQ4A 1Y9KA 2EVNA 4ZY0A 4P4DA 3D4UA 4MCPA 3S6HA 1YW4A 4F0XA 3T9YA 3B3SA 1CBXA 1X10A 1TXRA 3DGVA 4CGPA 3I74A 4R87A 4IF5A 4C9VA 4PXEA 4M6HA 3R95A 3MRUA 2GP4A 3PEIA 2Q4ZA 1H8LA 1YK3A 1YMEA 4UEZA 4YN3A 2B4JC 3IIBA 5CPAA 2ZW7A 4UIBA 3ZNIA 4MBUA 2FS5A 3D66A 5LYFA 4QVTA 1CX8A 2YGWA 2WUUA 3KR5A 4BINA 1WK4A 3DR6A 2B3UA 5F49A 3MN8A 4Q7AA 2AFZA 2O28A 4NGPA 2PIZA 5IB9A 2PQ8A 3QAHA 3RNZA 2N3AB 1VBHA 1LRZA 2I3CA 4A32A 4JYWA 3ICUA 1LFWA 4TWEA 2YNCC 1KEEB 1V6CA 1B47A 4JZ0A 1ZRSA 2H5MA 2IMOA 2WSAA 2ATRA 2ZXVA 2FIWA 3B3CA 3KZWA 3PBEA 3PBBA 4E2AA 1CJWA 1PYTB 3CT9A 1YVOA 2AFOA 3CXQA 4MJ8A 4PQAA 3DDDA 3E0KA 3JVNA 2GFQA 1QQ9A 2V8HA 1Y9ZA 4OIDA 2XEGA 3NFZA 1VIXA 4FD4A 2F8HA 3F9KC 3HMJG 2OZUA 4R57A 3IWGA 4RS2A 5DS0A 3T07A 1Z5RA 3D7FA 2PCUA 1B6BA 3R1KA 3UY5A 1FY7A 4C8PA 1TF8A 4U9ZA 3F8KA 3K9TA 1A9XB 1S7FA 4B12A 2DIKA 1S60A 2UV8G 1BPNA 3SJXA 1R3NA 4IUSA 3V7ZA 2AFWA 1AMPA 1ZG9A 2CXAA 3W6SA 1CM0A 5LYIA 3GJZA 4BTFA 2R82A 5IR2A 3FF3A 5KTCA 4H1HA 3KGQA 4OADA 5J1QA 3RO0A 1YGHA 1Z8LA 2QYVA 1TKFA 3SJGA 1M4LA 2FT0A 2FM4A 4PPZA 2ZELA 3GY9A 3B7IA 1S3ZA 4Q36A 4MFQA 4BD9A 3S6FA 1F2PA 4CS0B 2XPNA 2PJ8A 3TLAA 2XPOA 5HXDA 3TOBA 4H6UA 4A4BA 3EC4A 4P4BA 1VHOA 3LD2A 2IL4A 1Y0YA 2B0AA 3I1UA 4YRHA 4NGTA 3FXTA 4XPDC 4CAWA 3WC5A 4RUHA 1VHSA 4C86A 3NA6A 5CBMA 3EXNA 3BJ7A 4KUAA 2CY2A 3S6KA 4MCRA 1Z9UA 3TO9A 3VATA 4FBEA 4NGRA 2XEIA 1KBLA 4HNYB 4C9UA 4FAIA 1JDEA 3K4IA 1Y7RA 5CNPA 1EE3P 2P0WA 2PRQA 2EBJA 4OC3A 4KOXA 2MP0A 3D7GA 4EVYA 3B3VA 1CPXA 4JJXA 4NGMA 3FEEA 2JDDA 2CF4A 2G3TA 2Q4VA 2VQYA 4W9YA 2ZEPA 3FH4A 3ISXA 3FEDA 2C6PA 1CPSA 1Q2YA 1M6VB 4C99A 4HNWB 5H84A 5DWMA 4UWJA 2REEA 3BHXA 4F8ZA 2EZBA 2CNMA 2BO9A 1GGOA 3IJ3A 1XF1A 2AJ6A 2EK8A 2V8VA 1BOBA 2V8DA 1ZO0A 4P45A 4COGA 3T90A 4C8FA 1YSJA 2ZEFA 3I6SA 2B3VA 2ANPA 3EFAA 2Z3KA 1YX0A 3JRUA 4FD7A 4OP4A 3GYAA 4X5KA 5EBVA 3OAKA 3D8PA 5HVGA 2ZEMA 2AUMA 4GXHA 1N71A 1Z8XA 4P4FA 1JWQA 4X3RA 3HUVA 5THWA 3BUXB 2EWBA 2PCNA 3PB8X 2ZOGA 3TLGA 1KC7A 4AVCA 4K30A 2VEZA 2PJ6A 4OAEA 1J3LA 5J8FA 1OZPA 2B5GB 1RXTA 2V77A 2RB7A 2Z3OA 2CBLA 3FX6A 4KOTA 4MFZA 4RN7A 3R9GA 3TLBA 5A27A 4OC1A 2AE6A 2GIVA 3PGPA 4R9MA 1VI4A 5KTDA 1DE4C 1AUGA 1TF9A 3SI2A 3SXNA 3VWDA 4EFDA 4MI1A 3S9MA 4NJRA 2NMTA 3D7HA 1UWYA 3NE8A 2Y1NA 2HC9A 5I0CA 4UCPA 2I79A 5AG7A 4KSIA 4P4EA 1XRYA 1LCPA 2PC1A 3H8EA 4MI4A 1YLOA 2OZGA 2PRBA 3D2MA 4MCQA 3PB7X 4XNHC 4ZY1A 3BXMA 2IJZA 3CPAA 3QNVA 2J9AA 4UFXA 4FD5A 4LQ6A 3TO6A 3VTAA 3JUWA 5LYDA 4CO9A 2QMLA 4LUAA 1ELLP 3KASA 5JM6A 4COBA 3T5MA 1NE9A 2DLAA 3IWWA 2JEVA 3PT1A 1Q2DA 3MGDA 2Y0MA 5LRJA 2FE7A 3T0TA 1CP6A 2OLSA 1IICA 2GE3A 4UF4A 2Q0YA 4R8FA 3W6XA 4II9A 4MMOA 2ZEDA 4KVOE 3BLNA 3LWUA 5C88A 4CDKA 5HKYA 2AFUA 4R3KA 5F9MA 4CGNA 3FECA 3C8OA 2ABZA 1K4JA 5BWAB 4PV6A 2PVWA 2C6CA 4BPXB 1WJTA 1PUAA 4BPWB 1P0HA 2GREA 4NGNA 5F09A 2RFHA 2PJ0A 4TNUA 4UWIA 5G20A 1CP7A 4H89A 4PSXA 2ZW5A 4MCSA 2D4OA 3BUNB 2B5GA 1BAVA 1QSRA 3BI0A 2EO8A 2ZEHA 2Q44A 3GIUA 4B5PB 4KLVA 4C2ZA 5AXIA 3TT2A 5C82A 1NXJA 4C8TA 2O4HA 4P44A 1HEEA 5HKWA 1VGYA 2FL4A 3B3TA 5D8NA 3DNSA 3D7DA 4CAVA 3A9LA 2G9DA 3TLEA 2HV2A 4DJLA 4QBJA 5K8NA 2EZCA 4KOSA 3IU1A 3IGRA 4ORFA 4MHPA 4A31A 2ZPAA 1YR0A 2FXFA 3VWEA 5K8PA 1KUXA 4MFKA 4OC2A 4QB9A 2QVPA 3QB8A 4P4IA 1YREA 1XFOA 3BUOB 4KOWA 4C9RA 4KUBA 3NE7A 1X12A 3TLYA 2B4BA 4FWUA 2B4DB 4PK3A 4MFLA 1NSLA 5KTAA 1IGBA 2BUEA 2E28A 5D29A 3WABA 5AG5A 3BJ8A 3KHXA 4BMHA 3U1BA 4UCNA 3N5FA 3S6GA 4ZYQA 4E94A 4NEXA 5H86A 4F6AA 3EZAA 2F5IA 2WPXA 3PP9A 2ODFA 1Y7EA 4FUUA 2PE3A 4PXDA 4IIYA 4X2TA 2Q04A 2Z0ZA 2J8NA 1CS0B 1VKCA 4U5YA 5HVFA 2CNTA 5ELYA 1ZLIA 1BLLE 3T8WA 1QSMA 4JXRA 4LQGA 5F48A 3OWCA 2GLFA 1AYEA 4ONUA 3S9NA 1Q7LA 2FVGA 1Y0RA 2D4PA 5IV0A 1PU9A 2QJ8A 3IEHA 1JDBC 2FCKA 4HKFA 4U9YA 2J8MA 3FVLA 3LMSA 3VRRA 1ZL0A 2ZOFA 3TCVA 2PJ1A 2QECA 3RZAA 4ZX8A 4C8CA 4UCMA 5AGEA 1HDQA 4JLYA 4YGOA 4YFJA 3PRTA 4AXVA 1I21A 2F7VA 4CAFA 4TJVA 4EYSA 3VH9A 4C2XA 5LRKA 1TIQA 2FSRA 2X7BA 2Z10A 2Z3PA 4KOUA 4MHNA 4AVBA 4NGSA 3RBUA 5F13A 2JBJA 1LOKA 2JDCA 4B10A 2CIJA 4UIAA 5HH1A 3R9FA 1YW6A 4UFWA 1Y9WA 3KQZA 2VXKA 2ZEGA 2HUZA 3KI9A 3EZEA 3IU2A 4NGQA 4R76A 3NH4A 4KS9A 4A39A 2OH1A 3NOJA 3TTHA 3PFEA 5EMIA 1ZG7A 4OLLA 4J0NA 2GANA 1ZYMA 4C9AA 4BBHA 5K8MA 2YJTA 3B3WA 1KUVA 1I1DA 2AFSA 3NFQA 2ZENA 4BPUB 2ZW6A 1IU8A 5HVHA 3B2YA 4QC6A 4KNGE 3CPXA 2X0SA 1GYTA 3U88C 3TE4A 2PJ2A 4GPLB 4CYNA 2O53A 3G3SA 1S7NA 4KVXA 1C3OB 4ZX9A 1ZG8A 4JXQA 3ZJ0A 3VGOA 3WC6A 3DR8A 3SJEA 1WWZA 4E0AA 2PJ5A 1PCAA 4NSQA 1CG2A 4MHYA 1Z8WA 3D3SA 2VL1A 3HPHE 3H8GA 2VBQA 1FT7A 1YVHA 2K5TA 4P10A 4UEFA 2NSMA 2C6GA 8CPAA 4ZI6A 3IC1A 4HNXB 1J4JA 4J3GA 6CPAA 5HMNA 1XE4A 1KZFA 2AFMA 2PR1A 3HPGG 2VZZA 3F5BA 3W91A 1QMUA 2B58A 4Y49C 2P6EA 1YQEA 3O8ZA 4WJBA 1R43A 2CTCA 3V38A 2BOAA 1EZAA 1ON0A 2OR4A 1M1DA 2C1CA 2Q7SA 3B8GA 3G8WA 3LODA 4OC4A 4XPLA 1ZLHA 2Z3NA 3P2FA 3R9EA 4DUKA 4QUSA 4OC5A 3KQXA 4A33A 3C26A 4M3SA 4F9UA 1IYLA 3TYXA 1F2OA 4IIXA 4IK2A 4CYQA 5JPHA 3PB6X 2RC4A 3TFYA 2PJBA 3FNCA 4MFJA 1YLEA 2B4DA 4CGMA 2VZYA 4P6YA 1WVMA 4C9EA 4KORA 2PJ4A 1BXRB 2BCOA 3FYNA 2PDOA 1LAMA 1IIDA 2CTBA 4KZTA 5G22A 3EIFA 2KCWA 3PFOA 4XNHB 3F0AA 2EUIA 1HDUA 1KUYA 3KKWA 4JWPA 5F47A 4AG9A 4MRIA 2Q7BA 4CYPA 5J8CA 3VRPA 2C27A 3FIXA 2VI7A 4JVOA 3PB9X 4MY0A 4ZY2A 4PXCA 4OMEA 4B6ZA 5J3XA 4NF1A 5LRGA 3PFVA 1IOFA 1NMTA 1Z4EA 7CPAA 5F1YA 2ZEOA 2FIAA 3ZZIA 4YWYA 4F9VA 1NSAA 3IFEA 4GM5A 5IB0A 5EC4A 2PSWA 1TKJA 1BO4A 1JQGA 3RYOA 4R3LA 3BUMB 1F57A 4INJA 3EY5A 1MJ9A 2DPSA 3CXSA 1RTQA 3FMCA 3TLZA 3PLFB 1IB1E 1NBWA 3PB4X 1XJOA 4WWVA 5A28A 1R61A 5E96A 4CDJA 1TKHA 1Z8TA 2XPPA 2BL1A 4RI1A 3KRVA 4TJXA 1XIXA 4C8UA 3BI1A 3R96A 1S5KA 3WT4A 1L0CA 1U6MA 4PK2A 3D2PA 4KSAA 4C85A 1LAPA 5BY0A 2R1IA 2OZHA 4B13A 3S9LA 1MJBA 3OB2B 2Z3LA 2Y1MA 3GKRA 4OIWA 4CAXA 2DEAA 4Q38A 3QAYA 4E8OA 1UFHA 4I49A 4G1PA 1XBUA 3SI1A 2D0OA 5JH9A 2DXQA 4KLWA 1ARLA 1Q2CA 3PZJA 3P2HA 3JTKA 4XPKA 3RAMA 1XF8A 2HROA 4A30A 1I12A 4A37A 4DYOA 5JYBA 3KR4A 3TLCA 3DSBA 4AB7A 2QIRA 4E5SA 2EK9A 4NJQA 4KSFA 3TC8A 1YVKA 2ZEEA 4C7IA 4MHDA 2Z11A 1DTDA 1LANA 1Z9EA 4LX9A 1FNOA 1A2ZA 4CGOA 2GLJA 4PSWA 4EMEA 5G1ZA 2YNDA 3FJUA 4M8DA 3WC7A 2R7HA
chains in the Genus database with same CATH topology
4MXUA 3GUXA 4C84A 3H8FA 2WYRA 4PXBA 1ARMA 4NFRA 3GB0A 5JGFA 4R7MA 4YU9A 3KHZA 2PJAA 2PJ3A 4OC0A 4O23A 2PJ7A 2Q51A 4ONWA 3NH8A 4MHZA 3SI0A 2JBKA 4R6TA 4EWTA 4A38A 2WZNA 4CPAA 2XEFA 2JEWA 1Z2LA 2HB6A 3B35A 2AFXA 2POKA 4CDKA 3HLPA 5K8OA 2V8GA 1VHEA 2C5QA 4Z65A 2IQ6A 4A94A 4K3NA 1BPMA 2GU2A 2PJCA 3D67A 3ISZA 5LYLA 2Q43A 4P4JA 5I4MA 1IY7A 2PVVA 3SJFA 3CDXA 3KL9A 1XMBA 4OKOA 4X8IA 4UEEA 4IHMA 3GLJA 4H2KA 2PIYA 4IAVA 3IO1A 2NYQA 3TX8A 2XEJA 3K2KA 2OOTA 1ELMP 1OBRA 3L2NA 1KWMA 3D68A 2PJ9A 3NH5A 3DLJA 3VARA 4C8AA 4ZY0A 4P4DA 3D4UA 4MCPA 1YW4A 3B3SA 1CBXA 1TXRA 3DGVA 3I74A 4C9VA 4PXEA 3MRUA 2GP4A 3PEIA 2Q4ZA 1H8LA 4UEZA 1YMEA 4YN3A 3IIBA 5CPAA 4UIBA 5LYFA 3D66A 1CX8A 3KR5A 3MN8A 4Q7AA 2AFZA 4NGPA 2PIZA 5IB9A 2I3CA 4JYWA 3ICUA 1LFWA 4TWEA 1V6CA 4JZ0A 2IMOA 3PBBA 3KZWA 3B3CA 3PBEA 1PYTB 3CT9A 2AFOA 4PQAA 1QQ9A 2V8HA 1Y9ZA 4OIDA 2XEGA 3NFZA 1VIXA 2F8HA 5DS0A 1Z5RA 3D7FA 2PCUA 4C8PA 1TF8A 3K9TA 1BPNA 3SJXA 1R3NA 3V7ZA 2AFWA 1AMPA 1ZG9A 5LYIA 5IR2A 3FF3A 3KGQA 5J1QA 2QYVA 1Z8LA 1TKFA 3SJGA 1M4LA 4PPZA 2ZELA 3B7IA 4BD9A 1F2PA 2PJ8A 5HXDA 4P4BA 1VHOA 1Y0YA 3I1UA 4NGTA 3WC5A 4RUHA 4C86A 3NA6A 5CBMA 4MCRA 4FBEA 4NGRA 2XEIA 4C9UA 4FAIA 1EE3P 2PRQA 4OC3A 3D7GA 3B3VA 1CPXA 4NGMA 3FEEA 2ZEPA 2CF4A 3ISXA 3FH4A 4W9YA 3FEDA 2C6PA 1CPSA 4C99A 3BHXA 4F8ZA 2BO9A 3IJ3A 1XF1A 2EK8A 2V8VA 2V8DA 4P45A 4C8FA 1YSJA 2ZEFA 3I6SA 2ANPA 3JRUA 4OP4A 5HVGA 2ZEMA 4P4FA 4X3RA 3HUVA 5THWA 2EWBA 3PB8X 2ZOGA 2PJ6A 2V77A 2RB7A 3FX6A 4OC1A 1DE4C 1TF9A 4EFDA 3SI2A 4NJRA 3S9MA 3D7HA 1UWYA 2HC9A 4KSIA 4P4EA 1XRYA 1LCPA 3H8EA 1YLOA 3PB7X 4ZY1A 4MCQA 3BXMA 2IJZA 3CPAA 3QNVA 2J9AA 3VTAA 5LYDA 5JM6A 1ELLP 3KASA 3IWWA 5LRJA 1CP6A 4UF4A 4R8FA 4MMOA 2ZEDA 3LWUA 2AFUA 3FECA 2ABZA 2PVWA 2C6CA 2GREA 4NGNA 5F09A 2RFHA 2PJ0A 4TNUA 1CP7A 4MCSA 1BAVA 2ZEHA 3BI0A 4C8TA 2O4HA 4P44A 1HEEA 1VGYA 5D8NA 3B3TA 3D7DA 2G9DA 4DJLA 5K8NA 4MHPA 5K8PA 4OC2A 2QVPA 4P4IA 1XFOA 4C9RA 4FWUA 1IGBA 5D29A 3WABA 3KHXA 3N5FA 4ZYQA 4FUUA 4PXDA 1Y7EA 2PE3A 4X2TA 5HVFA 5ELYA 1ZLIA 1BLLE 3T8WA 4LQGA 2GLFA 1AYEA 3S9NA 1Q7LA 2FVGA 1Y0RA 2QJ8A 3IEHA 3FVLA 3LMSA 2ZOFA 2PJ1A 3RZAA 4ZX8A 4C8CA 1HDQA 3PRTA 4AXVA 2F7VA 4TJVA 3VH9A 5LRKA 4MHNA 4NGSA 3RBUA 2JBJA 1LOKA 2CIJA 4UIAA 1YW6A 3KQZA 2ZEGA 3KI9A 4NGQA 4R76A 3NH4A 4A39A 3PFEA 1ZG7A 4C9AA 5K8MA 3B3WA 2AFSA 2ZENA 5HVHA 3B2YA 4KNGE 3CPXA 1GYTA 2PJ2A 2O53A 4ZX9A 1ZG8A 3WC6A 3SJEA 2PJ5A 1PCAA 1CG2A 4MHYA 2VL1A 3H8GA 1FT7A 4P10A 4UEFA 2NSMA 2C6GA 8CPAA 4ZI6A 3IC1A 6CPAA 2AFMA 1QMUA 4WJBA 1R43A 2CTCA 3V38A 2BOAA 2OR4A 2C1CA 4DUKA 4OC4A 1ZLHA 4OC5A 3KQXA 1F2OA 4IK2A 3PB6X 2PJBA 4P6YA 1WVMA 4C9EA 2PJ4A 2BCOA 1LAMA 2CTBA 3EIFA 3PFOA 4F9UA 1HDUA 4MRIA 3PB9X 4ZY2A 4PXCA 4OMEA 4B6ZA 5LRGA 7CPAA 2ZEOA 4YWYA 4F9VA 1NSAA 3IFEA 4GM5A 1TKJA 1JQGA 1F57A 1RTQA 3FMCA 3PB4X 1XJOA 4WWVA 4CDJA 1TKHA 4C8UA 4TJXA 3BI1A 3WT4A 4C85A 1LAPA 3S9LA 4OIWA 2DEAA 4G1PA 1XBUA 3SI1A 5JH9A 1ARLA 3RAMA 4DYOA 4A37A 3KR4A 2EK9A 4NJQA 3TC8A 2ZEEA 1DTDA 1LANA 1FNOA 4EMEA 2GLJA 3FJUA 3WC7A 3VATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MXU A;  3GUX A;  4C84 A;  3H8F A;  2WYR A;  4PXB A;  1ARM A;  4NFR A;  3GB0 A;  5JGF A;  4R7M A;  4YU9 A;  3KHZ A;  2PJA A;  2PJ3 A;  4OC0 A;  4O23 A;  2PJ7 A;  2Q51 A;  4ONW A;  3NH8 A;  4MHZ A;  3SI0 A;  2JBK A;  4R6T A;  4EWT A;  4A38 A;  2WZN A;  4CPA A;  2XEF A;  2JEW A;  1Z2L A;  2HB6 A;  3B35 A;  2AFX A;  2POK A;  4CDK A;  3HLP A;  5K8O A;  2V8G A;  1VHE A;  4Z65 A;  2IQ6 A;  4A94 A;  4K3N A;  1BPM A;  2GU2 A;  2PJC A;  3D67 A;  3ISZ A;  5LYL A;  2Q43 A;  4P4J A;  5I4M A;  1IY7 A;  2PVV A;  3SJF A;  3CDX A;  3KL9 A;  1XMB A;  4OKO A;  4X8I A;  4UEE A;  4IHM A;  3GLJ A;  4H2K A;  2PIY A;  4IAV A;  3IO1 A;  2NYQ A;  3TX8 A;  2XEJ A;  3K2K A;  2OOT A;  1ELM P;  1OBR A;  3L2N A;  1KWM A;  3D68 A;  2PJ9 A;  3NH5 A;  3DLJ A;  3VAR A;  4C8A A;  4ZY0 A;  4P4D A;  3D4U A;  4MCP A;  1YW4 A;  3B3S A;  1CBX A;  1TXR A;  3DGV A;  3I74 A;  4C9V A;  4PXE A;  3MRU A;  3PEI A;  2Q4Z A;  1H8L A;  4UEZ A;  1YME A;  4YN3 A;  3IIB A;  5CPA A;  4UIB A;  5LYF A;  3D66 A;  1CX8 A;  3KR5 A;  3MN8 A;  4Q7A A;  2AFZ A;  4NGP A;  2PIZ A;  5IB9 A;  2I3C A;  4JYW A;  3ICU A;  1LFW A;  4TWE A;  1V6C A;  4JZ0 A;  2IMO A;  3PBB A;  3KZW A;  3B3C A;  3PBE A;  1PYT B;  3CT9 A;  2AFO A;  4PQA A;  1QQ9 A;  2V8H A;  1Y9Z A;  4OID A;  2XEG A;  3NFZ A;  1VIX A;  2F8H A;  5DS0 A;  1Z5R A;  3D7F A;  2PCU A;  4C8P A;  1TF8 A;  3K9T A;  1BPN A;  3SJX A;  1R3N A;  3V7Z A;  2AFW A;  1AMP A;  1ZG9 A;  5LYI A;  3FF3 A;  3KGQ A;  5J1Q A;  2QYV A;  1Z8L A;  1TKF A;  3SJG A;  1M4L A;  4PPZ A;  2ZEL A;  3B7I A;  4BD9 A;  1F2P A;  2PJ8 A;  5HXD A;  4P4B A;  1VHO A;  1Y0Y A;  3I1U A;  4NGT A;  3WC5 A;  4RUH A;  4C86 A;  3NA6 A;  5CBM A;  4MCR A;  4FBE A;  4NGR A;  2XEI A;  4C9U A;  4FAI A;  1EE3 P;  2PRQ A;  4OC3 A;  3D7G A;  3B3V A;  1CPX A;  4NGM A;  3FEE A;  2ZEP A;  2CF4 A;  3ISX A;  3FH4 A;  4W9Y A;  3FED A;  2C6P A;  1CPS A;  4C99 A;  3BHX A;  4F8Z A;  2BO9 A;  3IJ3 A;  1XF1 A;  2EK8 A;  2V8V A;  2V8D A;  4P45 A;  4C8F A;  1YSJ A;  2ZEF A;  3I6S A;  2ANP A;  3JRU A;  4OP4 A;  5HVG A;  2ZEM A;  4P4F A;  4X3R A;  3HUV A;  5THW A;  2EWB A;  3PB8 X;  2ZOG A;  2PJ6 A;  2V77 A;  2RB7 A;  3FX6 A;  4OC1 A;  1DE4 C;  1TF9 A;  4EFD A;  3SI2 A;  4NJR A;  3S9M A;  3D7H A;  1UWY A;  2HC9 A;  4KSI A;  4P4E A;  1XRY A;  1LCP A;  3H8E A;  1YLO A;  3PB7 X;  4ZY1 A;  4MCQ A;  3BXM A;  2IJZ A;  3CPA A;  3QNV A;  2J9A A;  3VTA A;  5LYD A;  5JM6 A;  1ELL P;  3KAS A;  3IWW A;  5LRJ A;  1CP6 A;  4UF4 A;  4R8F A;  4MMO A;  2ZED A;  3LWU A;  2AFU A;  3FEC A;  2ABZ A;  2PVW A;  2C6C A;  2GRE A;  4NGN A;  5F09 A;  2RFH A;  2PJ0 A;  4TNU A;  1CP7 A;  4MCS A;  1BAV A;  2ZEH A;  3BI0 A;  4C8T A;  2O4H A;  4P44 A;  1HEE A;  1VGY A;  5D8N A;  3B3T A;  3D7D A;  2G9D A;  4DJL A;  5K8N A;  4MHP A;  5K8P A;  4OC2 A;  2QVP A;  4P4I A;  1XFO A;  4C9R A;  4FWU A;  1IGB A;  5D29 A;  3WAB A;  3KHX A;  3N5F A;  4ZYQ A;  4FUU A;  4PXD A;  1Y7E A;  2PE3 A;  4X2T A;  5HVF A;  5ELY A;  1ZLI A;  1BLL E;  3T8W A;  4LQG A;  2GLF A;  1AYE A;  3S9N A;  1Q7L A;  2FVG A;  1Y0R A;  2QJ8 A;  3IEH A;  3FVL A;  3LMS A;  2ZOF A;  2PJ1 A;  3RZA A;  4ZX8 A;  4C8C A;  1HDQ A;  3PRT A;  4AXV A;  2F7V A;  4TJV A;  3VH9 A;  5LRK A;  4MHN A;  4NGS A;  3RBU A;  2JBJ A;  1LOK A;  2CIJ A;  4UIA A;  1YW6 A;  3KQZ A;  2ZEG A;  3KI9 A;  4NGQ A;  4R76 A;  3NH4 A;  4A39 A;  3PFE A;  1ZG7 A;  4C9A A;  5K8M A;  3B3W A;  2AFS A;  2ZEN A;  5HVH A;  3B2Y A;  4KNG E;  3CPX A;  1GYT A;  2PJ2 A;  2O53 A;  4ZX9 A;  1ZG8 A;  3WC6 A;  3SJE A;  2PJ5 A;  1PCA A;  1CG2 A;  4MHY A;  2VL1 A;  3H8G A;  1FT7 A;  4P10 A;  4UEF A;  2NSM A;  2C6G A;  8CPA A;  4ZI6 A;  3IC1 A;  6CPA A;  2AFM A;  1QMU A;  4WJB A;  1R43 A;  2CTC A;  3V38 A;  2BOA A;  2OR4 A;  2C1C A;  4DUK A;  4OC4 A;  1ZLH A;  4OC5 A;  3KQX A;  1F2O A;  4IK2 A;  3PB6 X;  2PJB A;  4P6Y A;  1WVM A;  4C9E A;  2PJ4 A;  2BCO A;  1LAM A;  2CTB A;  3EIF A;  3PFO A;  4F9U A;  1HDU A;  4MRI A;  3PB9 X;  4ZY2 A;  4PXC A;  4OME A;  4B6Z A;  5LRG A;  7CPA A;  2ZEO A;  4YWY A;  4F9V A;  1NSA A;  3IFE A;  4GM5 A;  1TKJ A;  1JQG A;  1F57 A;  1RTQ A;  3FMC A;  3PB4 X;  1XJO A;  4WWV A;  4CDJ A;  1TKH A;  4C8U A;  4TJX A;  3BI1 A;  3WT4 A;  4C85 A;  1LAP A;  3S9L A;  4OIW A;  2DEA A;  4G1P A;  1XBU A;  3SI1 A;  5JH9 A;  1ARL A;  3RAM A;  4DYO A;  4A37 A;  3KR4 A;  2EK9 A;  4NJQ A;  3TC8 A;  2ZEE A;  1DTD A;  1LAN A;  1FNO A;  4EME A;  2GLJ A;  3FJU A;  3WC7 A;  3VAT A; 
#chains in the Genus database with same CATH topology
 3BUW B;  4CZ1 A;  4MXU A;  3VRN A;  3GUX A;  4C7H A;  3H5Z A;  3OP0 A;  5F5X A;  4C84 A;  3TOA A;  4AVA A;  3IWE A;  4XPD B;  3K9U A;  3OB1 B;  3H8F A;  3WR7 A;  2I00 A;  4RR2 B;  2WYR A;  1RO5 A;  1IOI A;  4PXB A;  2Z3M A;  2REF A;  4B5O A;  1VBG A;  1ARM A;  4NFR A;  4DNC A;  4B14 A;  2YJV A;  3T05 A;  3GB0 A;  4C2Y A;  4R7M A;  5JGF A;  1FBV A;  3TLG B;  4HPS A;  4YU9 A;  2G0B A;  2P6G A;  2EZA A;  2D0P A;  4NXY A;  4MFP A;  3KHZ A;  2PJA A;  1S7L A;  3V8I A;  1M4G A;  1SQH A;  2PJ3 A;  4M6G A;  4F0Y A;  4OC0 A;  4O23 A;  2PJ7 A;  3VRO A;  2P6F A;  2Q51 A;  3I3G A;  2A4N A;  4KVM E;  4ONW A;  4CRY B;  1C30 B;  3NH8 A;  3CZX A;  4MHZ A;  3SI0 A;  1GHE A;  4A95 A;  2JBK A;  2CNS A;  4GS4 A;  4R6T A;  3SHP A;  4A38 A;  4EWT A;  5AG4 A;  2WZN A;  3EO4 A;  5JVL A;  2ZW4 A;  4CPA A;  2BSW A;  2XEF A;  2PR8 A;  2JEW A;  1Z2L A;  2WPW A;  4M6I A;  2HB6 A;  3B35 A;  2AFX A;  4UBR A;  1R57 A;  2POK A;  4ZBG A;  3HLP A;  2HWG A;  2ARH A;  3VRQ A;  2V8G A;  4A4C A;  2XPL A;  1VHE A;  1XMT A;  5GCN A;  5K8O A;  2C5Q A;  2OU2 A;  1EO0 A;  1T36 B;  4Z65 A;  2IQ6 A;  5FD8 A;  4A94 A;  2DF5 A;  2Q4Y A;  4K3N A;  2G3A A;  3G23 A;  1BPM A;  2GU2 A;  1XEB A;  2PJC A;  3D67 A;  4AG7 A;  2R8V A;  2HQY A;  3I9S A;  1QSO A;  4M85 A;  4CGL A;  1CE8 B;  3ISZ A;  5LYL A;  4CRZ B;  3FB3 A;  1MJA A;  1MK4 A;  2DPT A;  2JLM A;  2Q43 A;  3FBU A;  4P4J A;  1S7K A;  4B11 A;  4C68 A;  3FRM A;  4L8A A;  4UA3 A;  5FVJ A;  5I4M A;  5G21 A;  1M4I A;  1IY7 A;  4JD6 A;  2PVV A;  4MJX A;  3SJF A;  5ISV A;  1B87 A;  3CDX A;  3KL9 A;  1M44 A;  4Y49 B;  1XMB A;  1QST A;  4OKO A;  4CYO A;  1V0C A;  1IYK A;  4X8I A;  4UEE A;  1Q5X A;  5HKZ A;  4IHM A;  3GLJ A;  4H2K A;  2J8R A;  2PIY A;  4A2Z A;  1EZB A;  4IAV A;  3IO1 A;  4MY3 A;  1XOV A;  2NYQ A;  1P4N A;  4NCZ A;  4CAE A;  3TO7 A;  3TX8 A;  4ZGY B;  2R98 A;  3H4Q A;  4L89 A;  2XEJ A;  2YNE A;  2YNC A;  3LAC A;  3EZB A;  3K2K A;  2BEI A;  4KOV A;  3SR3 A;  1Z4R A;  2OOT A;  1ELM P;  3SXO A;  4H6Z A;  1M4D A;  1QSN A;  4UFV A;  4FD6 A;  5DWN A;  2VKZ G;  1OBR A;  3L2N A;  3CXP A;  4KOY A;  1KWM A;  4B5P A;  5F46 A;  3N7Z A;  2OB0 A;  2PJ9 A;  3D68 A;  5IX3 A;  2HI6 A;  3NH5 A;  1DIK A;  3DLJ A;  3VAR A;  5K99 A;  2AUN A;  4C8A A;  5AG6 A;  5JQ4 A;  1Y9K A;  2EVN A;  4ZY0 A;  4P4D A;  3D4U A;  4MCP A;  3S6H A;  1YW4 A;  4F0X A;  3T9Y A;  3B3S A;  1CBX A;  1X10 A;  1TXR A;  3DGV A;  4CGP A;  3I74 A;  4R87 A;  4IF5 A;  4C9V A;  4PXE A;  4M6H A;  3R95 A;  3MRU A;  2GP4 A;  3PEI A;  2Q4Z A;  1H8L A;  1YK3 A;  1YME A;  4UEZ A;  4YN3 A;  2B4J C;  3IIB A;  5CPA A;  2ZW7 A;  4UIB A;  3ZNI A;  4MBU A;  2FS5 A;  3D66 A;  5LYF A;  4QVT A;  1CX8 A;  2YGW A;  2WUU A;  3KR5 A;  4BIN A;  1WK4 A;  3DR6 A;  2B3U A;  5F49 A;  3MN8 A;  4Q7A A;  2AFZ A;  2O28 A;  4NGP A;  2PIZ A;  5IB9 A;  2PQ8 A;  3QAH A;  3RNZ A;  2N3A B;  1VBH A;  1LRZ A;  2I3C A;  4A32 A;  4JYW A;  3ICU A;  1LFW A;  4TWE A;  2YNC C;  1KEE B;  1V6C A;  1B47 A;  4JZ0 A;  1ZRS A;  2H5M A;  2IMO A;  2WSA A;  2ATR A;  2ZXV A;  2FIW A;  3B3C A;  3KZW A;  3PBE A;  3PBB A;  4E2A A;  1CJW A;  1PYT B;  3CT9 A;  1YVO A;  2AFO A;  3CXQ A;  4MJ8 A;  4PQA A;  3DDD A;  3E0K A;  3JVN A;  2GFQ A;  1QQ9 A;  2V8H A;  1Y9Z A;  4OID A;  2XEG A;  3NFZ A;  1VIX A;  4FD4 A;  2F8H A;  3F9K C;  3HMJ G;  2OZU A;  4R57 A;  3IWG A;  4RS2 A;  5DS0 A;  3T07 A;  1Z5R A;  3D7F A;  2PCU A;  1B6B A;  3R1K A;  3UY5 A;  1FY7 A;  4C8P A;  1TF8 A;  4U9Z A;  3F8K A;  3K9T A;  1A9X B;  1S7F A;  4B12 A;  2DIK A;  1S60 A;  2UV8 G;  1BPN A;  3SJX A;  1R3N A;  4IUS A;  3V7Z A;  2AFW A;  1AMP A;  1ZG9 A;  2CXA A;  3W6S A;  1CM0 A;  5LYI A;  3GJZ A;  4BTF A;  2R82 A;  5IR2 A;  3FF3 A;  5KTC A;  4H1H A;  3KGQ A;  4OAD A;  5J1Q A;  3RO0 A;  1YGH A;  1Z8L A;  2QYV A;  1TKF A;  3SJG A;  1M4L A;  2FT0 A;  2FM4 A;  4PPZ A;  2ZEL A;  3GY9 A;  3B7I A;  1S3Z A;  4Q36 A;  4MFQ A;  4BD9 A;  3S6F A;  1F2P A;  4CS0 B;  2XPN A;  2PJ8 A;  3TLA A;  2XPO A;  5HXD A;  3TOB A;  4H6U A;  4A4B A;  3EC4 A;  4P4B A;  1VHO A;  3LD2 A;  2IL4 A;  1Y0Y A;  2B0A A;  3I1U A;  4YRH A;  4NGT A;  3FXT A;  4XPD C;  4CAW A;  3WC5 A;  4RUH A;  1VHS A;  4C86 A;  3NA6 A;  5CBM A;  3EXN A;  3BJ7 A;  4KUA A;  2CY2 A;  3S6K A;  4MCR A;  1Z9U A;  3TO9 A;  3VAT A;  4FBE A;  4NGR A;  2XEI A;  1KBL A;  4HNY B;  4C9U A;  4FAI A;  1JDE A;  3K4I A;  1Y7R A;  5CNP A;  1EE3 P;  2P0W A;  2PRQ A;  2EBJ A;  4OC3 A;  4KOX A;  2MP0 A;  3D7G A;  4EVY A;  3B3V A;  1CPX A;  4JJX A;  4NGM A;  3FEE A;  2JDD A;  2CF4 A;  2G3T A;  2Q4V A;  2VQY A;  4W9Y A;  2ZEP A;  3FH4 A;  3ISX A;  3FED A;  2C6P A;  1CPS A;  1Q2Y A;  1M6V B;  4C99 A;  4HNW B;  5H84 A;  5DWM A;  4UWJ A;  2REE A;  3BHX A;  4F8Z A;  2EZB A;  2CNM A;  2BO9 A;  1GGO A;  3IJ3 A;  1XF1 A;  2AJ6 A;  2EK8 A;  2V8V A;  1BOB A;  2V8D A;  1ZO0 A;  4P45 A;  4COG A;  3T90 A;  4C8F A;  1YSJ A;  2ZEF A;  3I6S A;  2B3V A;  2ANP A;  3EFA A;  2Z3K A;  1YX0 A;  3JRU A;  4FD7 A;  4OP4 A;  3GYA A;  4X5K A;  5EBV A;  3OAK A;  3D8P A;  5HVG A;  2ZEM A;  2AUM A;  4GXH A;  1N71 A;  1Z8X A;  4P4F A;  1JWQ A;  4X3R A;  3HUV A;  5THW A;  3BUX B;  2EWB A;  2PCN A;  3PB8 X;  2ZOG A;  3TLG A;  1KC7 A;  4AVC A;  4K30 A;  2VEZ A;  2PJ6 A;  4OAE A;  1J3L A;  5J8F A;  1OZP A;  2B5G B;  1RXT A;  2V77 A;  2RB7 A;  2Z3O A;  2CBL A;  3FX6 A;  4KOT A;  4MFZ A;  4RN7 A;  3R9G A;  3TLB A;  5A27 A;  4OC1 A;  2AE6 A;  2GIV A;  3PGP A;  4R9M A;  1VI4 A;  5KTD A;  1DE4 C;  1AUG A;  1TF9 A;  3SI2 A;  3SXN A;  3VWD A;  4EFD A;  4MI1 A;  3S9M A;  4NJR A;  2NMT A;  3D7H A;  1UWY A;  3NE8 A;  2Y1N A;  2HC9 A;  5I0C A;  4UCP A;  2I79 A;  5AG7 A;  4KSI A;  4P4E A;  1XRY A;  1LCP A;  2PC1 A;  3H8E A;  4MI4 A;  1YLO A;  2OZG A;  2PRB A;  3D2M A;  4MCQ A;  3PB7 X;  4XNH C;  4ZY1 A;  3BXM A;  2IJZ A;  3CPA A;  3QNV A;  2J9A A;  4UFX A;  4FD5 A;  4LQ6 A;  3TO6 A;  3VTA A;  3JUW A;  5LYD A;  4CO9 A;  2QML A;  4LUA A;  1ELL P;  3KAS A;  5JM6 A;  4COB A;  3T5M A;  1NE9 A;  2DLA A;  3IWW A;  2JEV A;  3PT1 A;  1Q2D A;  3MGD A;  2Y0M A;  5LRJ A;  2FE7 A;  3T0T A;  1CP6 A;  2OLS A;  1IIC A;  2GE3 A;  4UF4 A;  2Q0Y A;  4R8F A;  3W6X A;  4II9 A;  4MMO A;  2ZED A;  4KVO E;  3BLN A;  3LWU A;  5C88 A;  4CDK A;  5HKY A;  2AFU A;  4R3K A;  5F9M A;  4CGN A;  3FEC A;  3C8O A;  2ABZ A;  1K4J A;  5BWA B;  4PV6 A;  2PVW A;  2C6C A;  4BPX B;  1WJT A;  1PUA A;  4BPW B;  1P0H A;  2GRE A;  4NGN A;  5F09 A;  2RFH A;  2PJ0 A;  4TNU A;  4UWI A;  5G20 A;  1CP7 A;  4H89 A;  4PSX A;  2ZW5 A;  4MCS A;  2D4O A;  3BUN B;  2B5G A;  1BAV A;  1QSR A;  3BI0 A;  2EO8 A;  2ZEH A;  2Q44 A;  3GIU A;  4B5P B;  4KLV A;  4C2Z A;  5AXI A;  3TT2 A;  5C82 A;  1NXJ A;  4C8T A;  2O4H A;  4P44 A;  1HEE A;  5HKW A;  1VGY A;  2FL4 A;  3B3T A;  5D8N A;  3DNS A;  3D7D A;  4CAV A;  3A9L A;  2G9D A;  3TLE A;  2HV2 A;  4DJL A;  4QBJ A;  5K8N A;  2EZC A;  4KOS A;  3IU1 A;  3IGR A;  4ORF A;  4MHP A;  4A31 A;  2ZPA A;  1YR0 A;  2FXF A;  3VWE A;  5K8P A;  1KUX A;  4MFK A;  4OC2 A;  4QB9 A;  2QVP A;  3QB8 A;  4P4I A;  1YRE A;  1XFO A;  3BUO B;  4KOW A;  4C9R A;  4KUB A;  3NE7 A;  1X12 A;  3TLY A;  2B4B A;  4FWU A;  2B4D B;  4PK3 A;  4MFL A;  1NSL A;  5KTA A;  1IGB A;  2BUE A;  2E28 A;  5D29 A;  3WAB A;  5AG5 A;  3BJ8 A;  3KHX A;  4BMH A;  3U1B A;  4UCN A;  3N5F A;  3S6G A;  4ZYQ A;  4E94 A;  4NEX A;  5H86 A;  4F6A A;  3EZA A;  2F5I A;  2WPX A;  3PP9 A;  2ODF A;  1Y7E A;  4FUU A;  2PE3 A;  4PXD A;  4IIY A;  4X2T A;  2Q04 A;  2Z0Z A;  2J8N A;  1CS0 B;  1VKC A;  4U5Y A;  5HVF A;  2CNT A;  5ELY A;  1ZLI A;  1BLL E;  3T8W A;  1QSM A;  4JXR A;  4LQG A;  5F48 A;  3OWC A;  2GLF A;  1AYE A;  4ONU A;  3S9N A;  1Q7L A;  2FVG A;  1Y0R A;  2D4P A;  5IV0 A;  1PU9 A;  2QJ8 A;  3IEH A;  1JDB C;  2FCK A;  4HKF A;  4U9Y A;  2J8M A;  3FVL A;  3LMS A;  3VRR A;  1ZL0 A;  2ZOF A;  3TCV A;  2PJ1 A;  2QEC A;  3RZA A;  4ZX8 A;  4C8C A;  4UCM A;  5AGE A;  1HDQ A;  4JLY A;  4YGO A;  4YFJ A;  3PRT A;  4AXV A;  1I21 A;  2F7V A;  4CAF A;  4TJV A;  4EYS A;  3VH9 A;  4C2X A;  5LRK A;  1TIQ A;  2FSR A;  2X7B A;  2Z10 A;  2Z3P A;  4KOU A;  4MHN A;  4AVB A;  4NGS A;  3RBU A;  5F13 A;  2JBJ A;  1LOK A;  2JDC A;  4B10 A;  2CIJ A;  4UIA A;  5HH1 A;  3R9F A;  1YW6 A;  4UFW A;  1Y9W A;  3KQZ A;  2VXK A;  2ZEG A;  2HUZ A;  3KI9 A;  3EZE A;  3IU2 A;  4NGQ A;  4R76 A;  3NH4 A;  4KS9 A;  4A39 A;  2OH1 A;  3NOJ A;  3TTH A;  3PFE A;  5EMI A;  1ZG7 A;  4OLL A;  4J0N A;  2GAN A;  1ZYM A;  4C9A A;  4BBH A;  5K8M A;  2YJT A;  3B3W A;  1KUV A;  1I1D A;  2AFS A;  3NFQ A;  2ZEN A;  4BPU B;  2ZW6 A;  1IU8 A;  5HVH A;  3B2Y A;  4QC6 A;  4KNG E;  3CPX A;  2X0S A;  1GYT A;  3U88 C;  3TE4 A;  2PJ2 A;  4GPL B;  4CYN A;  2O53 A;  3G3S A;  1S7N A;  4KVX A;  1C3O B;  4ZX9 A;  1ZG8 A;  4JXQ A;  3ZJ0 A;  3VGO A;  3WC6 A;  3DR8 A;  3SJE A;  1WWZ A;  4E0A A;  2PJ5 A;  1PCA A;  4NSQ A;  1CG2 A;  4MHY A;  1Z8W A;  3D3S A;  2VL1 A;  3HPH E;  3H8G A;  2VBQ A;  1FT7 A;  1YVH A;  2K5T A;  4P10 A;  4UEF A;  2NSM A;  2C6G A;  8CPA A;  4ZI6 A;  3IC1 A;  4HNX B;  1J4J A;  4J3G A;  6CPA A;  5HMN A;  1XE4 A;  1KZF A;  2AFM A;  2PR1 A;  3HPG G;  2VZZ A;  3F5B A;  3W91 A;  1QMU A;  2B58 A;  4Y49 C;  2P6E A;  1YQE A;  3O8Z A;  4WJB A;  1R43 A;  2CTC A;  3V38 A;  2BOA A;  1EZA A;  1ON0 A;  2OR4 A;  1M1D A;  2C1C A;  2Q7S A;  3B8G A;  3G8W A;  3LOD A;  4OC4 A;  4XPL A;  1ZLH A;  2Z3N A;  3P2F A;  3R9E A;  4DUK A;  4QUS A;  4OC5 A;  3KQX A;  4A33 A;  3C26 A;  4M3S A;  4F9U A;  1IYL A;  3TYX A;  1F2O A;  4IIX A;  4IK2 A;  4CYQ A;  5JPH A;  3PB6 X;  2RC4 A;  3TFY A;  2PJB A;  3FNC A;  4MFJ A;  1YLE A;  2B4D A;  4CGM A;  2VZY A;  4P6Y A;  1WVM A;  4C9E A;  4KOR A;  2PJ4 A;  1BXR B;  2BCO A;  3FYN A;  2PDO A;  1LAM A;  1IID A;  2CTB A;  4KZT A;  5G22 A;  3EIF A;  2KCW A;  3PFO A;  4XNH B;  3F0A A;  2EUI A;  1HDU A;  1KUY A;  3KKW A;  4JWP A;  5F47 A;  4AG9 A;  4MRI A;  2Q7B A;  4CYP A;  5J8C A;  3VRP A;  2C27 A;  3FIX A;  2VI7 A;  4JVO A;  3PB9 X;  4MY0 A;  4ZY2 A;  4PXC A;  4OME A;  4B6Z A;  5J3X A;  4NF1 A;  5LRG A;  3PFV A;  1IOF A;  1NMT A;  1Z4E A;  7CPA A;  5F1Y A;  2ZEO A;  2FIA A;  3ZZI A;  4YWY A;  4F9V A;  1NSA A;  3IFE A;  4GM5 A;  5IB0 A;  5EC4 A;  2PSW A;  1TKJ A;  1BO4 A;  1JQG A;  3RYO A;  4R3L A;  3BUM B;  1F57 A;  4INJ A;  3EY5 A;  1MJ9 A;  2DPS A;  3CXS A;  1RTQ A;  3FMC A;  3TLZ A;  3PLF B;  1IB1 E;  1NBW A;  3PB4 X;  1XJO A;  4WWV A;  5A28 A;  1R61 A;  5E96 A;  4CDJ A;  1TKH A;  1Z8T A;  2XPP A;  2BL1 A;  4RI1 A;  3KRV A;  4TJX A;  1XIX A;  4C8U A;  3BI1 A;  3R96 A;  1S5K A;  3WT4 A;  1L0C A;  1U6M A;  4PK2 A;  3D2P A;  4KSA A;  4C85 A;  1LAP A;  5BY0 A;  2R1I A;  2OZH A;  4B13 A;  3S9L A;  1MJB A;  3OB2 B;  2Z3L A;  2Y1M A;  3GKR A;  4OIW A;  4CAX A;  2DEA A;  4Q38 A;  3QAY A;  4E8O A;  1UFH A;  4I49 A;  4G1P A;  1XBU A;  3SI1 A;  2D0O A;  5JH9 A;  2DXQ A;  4KLW A;  1ARL A;  1Q2C A;  3PZJ A;  3P2H A;  3JTK A;  4XPK A;  3RAM A;  1XF8 A;  2HRO A;  4A30 A;  1I12 A;  4A37 A;  4DYO A;  5JYB A;  3KR4 A;  3TLC A;  3DSB A;  4AB7 A;  2QIR A;  4E5S A;  2EK9 A;  4NJQ A;  4KSF A;  3TC8 A;  1YVK A;  2ZEE A;  4C7I A;  4MHD A;  2Z11 A;  1DTD A;  1LAN A;  1Z9E A;  4LX9 A;  1FNO A;  1A2Z A;  4CGO A;  2GLJ A;  4PSW A;  4EME A;  5G1Z A;  2YND A;  3FJU A;  4M8D A;  3WC7 A;  2R7H A; 
#chains in the Genus database with same CATH homology
 4MXU A;  3GUX A;  4C84 A;  3H8F A;  2WYR A;  4PXB A;  1ARM A;  4NFR A;  3GB0 A;  5JGF A;  4R7M A;  4YU9 A;  3KHZ A;  2PJA A;  2PJ3 A;  4OC0 A;  4O23 A;  2PJ7 A;  2Q51 A;  4ONW A;  3NH8 A;  4MHZ A;  3SI0 A;  2JBK A;  4R6T A;  4EWT A;  4A38 A;  2WZN A;  4CPA A;  2XEF A;  2JEW A;  1Z2L A;  2HB6 A;  3B35 A;  2AFX A;  2POK A;  4CDK A;  3HLP A;  5K8O A;  2V8G A;  1VHE A;  2C5Q A;  4Z65 A;  2IQ6 A;  4A94 A;  4K3N A;  1BPM A;  2GU2 A;  2PJC A;  3D67 A;  3ISZ A;  5LYL A;  2Q43 A;  4P4J A;  5I4M A;  1IY7 A;  2PVV A;  3SJF A;  3CDX A;  3KL9 A;  1XMB A;  4OKO A;  4X8I A;  4UEE A;  4IHM A;  3GLJ A;  4H2K A;  2PIY A;  4IAV A;  3IO1 A;  2NYQ A;  3TX8 A;  2XEJ A;  3K2K A;  2OOT A;  1ELM P;  1OBR A;  3L2N A;  1KWM A;  3D68 A;  2PJ9 A;  3NH5 A;  3DLJ A;  3VAR A;  4C8A A;  4ZY0 A;  4P4D A;  3D4U A;  4MCP A;  1YW4 A;  3B3S A;  1CBX A;  1TXR A;  3DGV A;  3I74 A;  4C9V A;  4PXE A;  3MRU A;  2GP4 A;  3PEI A;  2Q4Z A;  1H8L A;  4UEZ A;  1YME A;  4YN3 A;  3IIB A;  5CPA A;  4UIB A;  5LYF A;  3D66 A;  1CX8 A;  3KR5 A;  3MN8 A;  4Q7A A;  2AFZ A;  4NGP A;  2PIZ A;  5IB9 A;  2I3C A;  4JYW A;  3ICU A;  1LFW A;  4TWE A;  1V6C A;  4JZ0 A;  2IMO A;  3PBB A;  3KZW A;  3B3C A;  3PBE A;  1PYT B;  3CT9 A;  2AFO A;  4PQA A;  1QQ9 A;  2V8H A;  1Y9Z A;  4OID A;  2XEG A;  3NFZ A;  1VIX A;  2F8H A;  5DS0 A;  1Z5R A;  3D7F A;  2PCU A;  4C8P A;  1TF8 A;  3K9T A;  1BPN A;  3SJX A;  1R3N A;  3V7Z A;  2AFW A;  1AMP A;  1ZG9 A;  5LYI A;  5IR2 A;  3FF3 A;  3KGQ A;  5J1Q A;  2QYV A;  1Z8L A;  1TKF A;  3SJG A;  1M4L A;  4PPZ A;  2ZEL A;  3B7I A;  4BD9 A;  1F2P A;  2PJ8 A;  5HXD A;  4P4B A;  1VHO A;  1Y0Y A;  3I1U A;  4NGT A;  3WC5 A;  4RUH A;  4C86 A;  3NA6 A;  5CBM A;  4MCR A;  4FBE A;  4NGR A;  2XEI A;  4C9U A;  4FAI A;  1EE3 P;  2PRQ A;  4OC3 A;  3D7G A;  3B3V A;  1CPX A;  4NGM A;  3FEE A;  2ZEP A;  2CF4 A;  3ISX A;  3FH4 A;  4W9Y A;  3FED A;  2C6P A;  1CPS A;  4C99 A;  3BHX A;  4F8Z A;  2BO9 A;  3IJ3 A;  1XF1 A;  2EK8 A;  2V8V A;  2V8D A;  4P45 A;  4C8F A;  1YSJ A;  2ZEF A;  3I6S A;  2ANP A;  3JRU A;  4OP4 A;  5HVG A;  2ZEM A;  4P4F A;  4X3R A;  3HUV A;  5THW A;  2EWB A;  3PB8 X;  2ZOG A;  2PJ6 A;  2V77 A;  2RB7 A;  3FX6 A;  4OC1 A;  1DE4 C;  1TF9 A;  4EFD A;  3SI2 A;  4NJR A;  3S9M A;  3D7H A;  1UWY A;  2HC9 A;  4KSI A;  4P4E A;  1XRY A;  1LCP A;  3H8E A;  1YLO A;  3PB7 X;  4ZY1 A;  4MCQ A;  3BXM A;  2IJZ A;  3CPA A;  3QNV A;  2J9A A;  3VTA A;  5LYD A;  5JM6 A;  1ELL P;  3KAS A;  3IWW A;  5LRJ A;  1CP6 A;  4UF4 A;  4R8F A;  4MMO A;  2ZED A;  3LWU A;  2AFU A;  3FEC A;  2ABZ A;  2PVW A;  2C6C A;  2GRE A;  4NGN A;  5F09 A;  2RFH A;  2PJ0 A;  4TNU A;  1CP7 A;  4MCS A;  1BAV A;  2ZEH A;  3BI0 A;  4C8T A;  2O4H A;  4P44 A;  1HEE A;  1VGY A;  5D8N A;  3B3T A;  3D7D A;  2G9D A;  4DJL A;  5K8N A;  4MHP A;  5K8P A;  4OC2 A;  2QVP A;  4P4I A;  1XFO A;  4C9R A;  4FWU A;  1IGB A;  5D29 A;  3WAB A;  3KHX A;  3N5F A;  4ZYQ A;  4FUU A;  4PXD A;  1Y7E A;  2PE3 A;  4X2T A;  5HVF A;  5ELY A;  1ZLI A;  1BLL E;  3T8W A;  4LQG A;  2GLF A;  1AYE A;  3S9N A;  1Q7L A;  2FVG A;  1Y0R A;  2QJ8 A;  3IEH A;  3FVL A;  3LMS A;  2ZOF A;  2PJ1 A;  3RZA A;  4ZX8 A;  4C8C A;  1HDQ A;  3PRT A;  4AXV A;  2F7V A;  4TJV A;  3VH9 A;  5LRK A;  4MHN A;  4NGS A;  3RBU A;  2JBJ A;  1LOK A;  2CIJ A;  4UIA A;  1YW6 A;  3KQZ A;  2ZEG A;  3KI9 A;  4NGQ A;  4R76 A;  3NH4 A;  4A39 A;  3PFE A;  1ZG7 A;  4C9A A;  5K8M A;  3B3W A;  2AFS A;  2ZEN A;  5HVH A;  3B2Y A;  4KNG E;  3CPX A;  1GYT A;  2PJ2 A;  2O53 A;  4ZX9 A;  1ZG8 A;  3WC6 A;  3SJE A;  2PJ5 A;  1PCA A;  1CG2 A;  4MHY A;  2VL1 A;  3H8G A;  1FT7 A;  4P10 A;  4UEF A;  2NSM A;  2C6G A;  8CPA A;  4ZI6 A;  3IC1 A;  6CPA A;  2AFM A;  1QMU A;  4WJB A;  1R43 A;  2CTC A;  3V38 A;  2BOA A;  2OR4 A;  2C1C A;  4DUK A;  4OC4 A;  1ZLH A;  4OC5 A;  3KQX A;  1F2O A;  4IK2 A;  3PB6 X;  2PJB A;  4P6Y A;  1WVM A;  4C9E A;  2PJ4 A;  2BCO A;  1LAM A;  2CTB A;  3EIF A;  3PFO A;  4F9U A;  1HDU A;  4MRI A;  3PB9 X;  4ZY2 A;  4PXC A;  4OME A;  4B6Z A;  5LRG A;  7CPA A;  2ZEO A;  4YWY A;  4F9V A;  1NSA A;  3IFE A;  4GM5 A;  1TKJ A;  1JQG A;  1F57 A;  1RTQ A;  3FMC A;  3PB4 X;  1XJO A;  4WWV A;  4CDJ A;  1TKH A;  4C8U A;  4TJX A;  3BI1 A;  3WT4 A;  4C85 A;  1LAP A;  3S9L A;  4OIW A;  2DEA A;  4G1P A;  1XBU A;  3SI1 A;  5JH9 A;  1ARL A;  3RAM A;  4DYO A;  4A37 A;  3KR4 A;  2EK9 A;  4NJQ A;  3TC8 A;  2ZEE A;  1DTD A;  1LAN A;  1FNO A;  4EME A;  2GLJ A;  3FJU A;  3WC7 A;  3VAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...