3BHXA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of asp-glu
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bhxA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bhxA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bhxA02
3T8WA 2JBJA 4P4IA 1GYTA 4NGQA 5JGFA 5IB9A 2I3CA 3L2NA 2PJ3A 1HDUA 1F2PA 1AMPA 4YWYA 4G1PA 1RTQA 1Y0YA 2PRQA 3N5FA 4ZYQA 2XEIA 4MCPA 3FJUA 4OC2A 3WC7A 3FEEA 1OBRA 3RZAA 4OIDA 3MN8A 4NJQA 2PJ9A 4MMOA 3FX6A 2XEFA 4ZY1A 5CBMA 1LANA 4PPZA 4EWTA 1ZLHA 3BHXA 2PVVA 4KNGE 2C6GA 4O23A 2ZEOA 3K2KA 2EWBA 4R6TA 4R7MA 3SJGA 2NYQA 2V8GA 1TXRA 4MHZA 2OOTA 3D68A 4X3RA 2RFHA 4P4JA 3CDXA 3FEDA 4F9UA 2JBKA 5CPAA 2AFZA 2PJ1A 4A38A 2XEGA 2PJ7A 3I74A 3KHZA 1ELMP 5K8MA 2PJ2A 1QQ9A 1R3NA 3SJFA 4NGRA 4OC3A 2EK9A 2PIZA 5K8NA 4P6YA 4PXCA 4MHYA 1CX8A 5D8NA 2BCOA 1VHOA 3NA6A 4AXVA 2F8HA 2BO9A 3PB6X 2G9DA 3IWWA 3SI0A 1XFOA 1DTDA 3DGVA 2POKA 1ZLIA 4OKOA 2AFOA 3B3WA 4UIBA 1FNOA 2ZOGA 3DLJA 1YW4A 5THWA 2ANPA 2PJ4A 2PJ8A 2NSMA 3KASA 1M4LA 3D7GA 4GM5A 2JEWA 4FBEA 1YSJA 1F57A 3FF3A 1UWYA 1IY7A 1TF8A 2PIYA 5LYFA 3RBUA 1LAPA 2QJ8A 2PJAA 4YN3A 4NGMA 4P45A 3B3TA 1YLOA 3WABA 3FMCA 1VIXA 2GLJA 4OC5A 2AFWA 4PXDA 4FUUA 3PB4X 5D29A 1Z5RA 2AFSA 4IK2A 1CPSA 4MHPA 3IEHA 2O4HA 8CPAA 4C8PA 3HUVA 2PJBA 4OC1A 3B3VA 2GLFA 3IJ3A 3WC6A 3KR5A 4X2TA 4NJRA 4UIAA 2ZOFA 4JZ0A 4C9VA 3KR4A 2ZENA 1BPNA 1ZG7A 1VHEA 5HVFA 4CDJA 1HDQA 2QVPA 4EMEA 3K9TA 1BPMA 2PJCA 4P4EA 4A39A 1AYEA 3H8GA 1Q7LA 3PB9X 3BI1A 1HEEA 4C8AA 3NH8A 3PFEA 2CTCA 1YMEA 3GB0A 1V6CA 3KQZA 3LMSA 3ISZA 3PBBA 2XEJA 3PBEA 3VTAA 4ZX9A 2FVGA 4RUHA 4P10A 1NSAA 4UEZA 1DE4C 4MCRA 1VGYA 5LYIA 2PJ0A 3PFOA 4F8ZA 4C85A 1PCAA 4TNUA 5K8OA 1LAMA 1TF9A 4Z65A 1ARMA 3ICUA 4ZY0A 4C86A 4P4FA 4LQGA 1KWMA 4OP4A 3FH4A 3RAMA 2IJZA 2ZEFA 4FAIA 4C9RA 4PXBA 3SJXA 4TJXA 2O53A 4YU9A 1ELLP 3H8FA 4IAVA 1IGBA 5JM6A 1FT7A 2PJ5A 5HXDA 3CT9A 2IMOA 2CIJA 4C8TA 1LOKA 4JYWA 1H8LA 4NGSA 2ZELA 2EK8A 4ZY2A 4PQAA 2C6CA 4H2KA 3PEIA 6CPAA 3TC8A 3SJEA 3V38A 1Y7EA 4CPAA 2V8HA 4IHMA 3VH9A 3B3CA 1XMBA 2GU2A 2PE3A 4WJBA 1TKFA 1F2OA 4B6ZA 1EE3P 5I4MA 2WZNA 2ZEHA 4DJLA 2ZEPA 4FWUA 3SI1A 4NGPA 2QYVA 5HVHA 2ABZA 3D7DA 3S9LA 2PJ6A 3KL9A 4KSIA 4Q7AA 2HC9A 2CTBA 4BD9A 5F09A 2ZEMA 1BAVA 2C1CA 1XRYA 4CDKA 2PCUA 4F9VA 4C99A 3IFEA 3VATA 4MXUA 3I6SA 4UEEA 3SI2A 2C6PA 1WVMA 3D7HA 1JQGA 4A37A 4OIWA 4C9AA 5LRJA 2ZEEA 2V8DA 1LCPA 5LYDA 5LYLA 1XBUA 4R8FA 2V77A 4MRIA 3D66A 4DUKA 2AFXA 4P44A 2IQ6A 1XF1A 5LRKA 4K3NA 1PYTB 3QNVA 2BOAA 2AFMA 1Z8LA 3KHXA 1BLLE 4UF4A 3KZWA 3H8EA 4NGTA 3EIFA 3KI9A 3PB8X 3NFZA 3FVLA 3TX8A 5J1QA 1TKHA 3KGQA 4EFDA 2HB6A 3IIBA 4MCSA 3PB7X 5DS0A 3D4UA 4P4DA 1CPXA 4WWVA 4C8CA 3NH4A 4OC4A 3IO1A 4ZI6A 2OR4A 3LWUA 2AFUA 5JH9A 3CPAA 4NGNA 1LFWA 3NH5A 4C84A 3VARA 2V8VA 3S9NA 3GLJA 3I1UA 3IC1A 4A94A 4MCQA 2ZEGA 4C9EA 3WT4A 4MHNA 4TWEA 1Y0RA 1Z2LA 5K8PA 2Q51A 1CBXA 5LRGA 4P4BA 1CG2A 2CF4A 2ZEDA 7CPAA 4X8IA 4NFRA 1ZG8A 4OC0A 1R43A 4W9YA 3BXMA 3FECA 4ONWA 2PVWA 5HVGA 4OMEA 1CP7A 3B3SA 1YW6A 3D67A 2GREA 4TJVA 2Q4ZA 3KQXA 3MRUA 1ZG9A 3BI0A 1QMUA 4C8FA 1Y9ZA 3HLPA 4DYOA 5ELYA 4ZX8A 3D7FA 2DEAA 3B7IA 4C9UA 2RB7A 3S9MA 1CP6A 2Q43A 4C8UA 3WC5A 3V7ZA 3CPXA 1ARLA 3GUXA 4R76A 2F7VA 3B2YA 1TKJA 3B35A 2WYRA 2J9AA 1XJOA 3PRTA 2VL1A 3ISXA 3JRUA 4PXEA 4UEFA
chains in the Genus database with same CATH superfamily
2B5GB 3T8WA 3K4IA 2JBJA 4P4IA 4QBJA 2Z3PA 2FT0A 2HROA 1GYTA 4NGQA 5JGFA 5IB9A 3MGDA 3F5BA 1ZRSA 1XE4A 4JXQA 4KOWA 5C82A 4E2AA 2VKZG 2EBJA 2FS5A 2I3CA 2JEVA 1NMTA 1ON0A 3L2NA 4UFXA 4XPDC 2PJ3A 1HDUA 3W6SA 4AG7A 2WPXA 2R82A 1F2PA 1B6BA 1AMPA 2B4BA 2VI7A 4OADA 2C5QA 3CZXA 4KLVA 2Z3OA 4YWYA 4G1PA 4CYQA 2ZW4A 1B87A 1RTQA 1Y0YA 2PRQA 3BJ8A 3N5FA 3KRVA 4ZYQA 2XEIA 4MCPA 3FJUA 4KLWA 4OC2A 2YNEA 4CAXA 3G8WA 1KBLA 2FXFA 3BUOB 1Z8XA 2REEA 2YNDA 2AUMA 2XPLA 3FEEA 3WC7A 1OBRA 2VEZA 3RZAA 1MJBA 4KOVA 4OIDA 4UFWA 2QMLA 4AB7A 4BINA 5EC4A 1CE8B 2REFA 3MN8A 4NJQA 4UBRA 2PJ9A 4XNHC 4XPKA 3PLFB 4MMOA 3FX6A 4CAVA 2XEFA 4RI1A 3ZZIA 4ZY1A 3VRQA 1M1DA 1IIDA 2HUZA 4MHDA 4A32A 4UA3A 1LANA 4PPZA 4EWTA 5H84A 1ZLHA 5CBMA 5JQ4A 3BHXA 2PVVA 5A27A 4KNGE 4JWPA 4H1HA 3TLGB 2C6GA 3HMJG 1M4GA 3TT2A 3T07A 4XPDB 4B5OA 4CO9A 3JVNA 1YGHA 4O23A 3I9SA 1YK3A 3HPHE 2EO8A 3G23A 2OH1A 4UWIA 3PFVA 1M4IA 4FD4A 3VRPA 2ZEOA 3K2KA 2D0PA 4MFZA 2X7BA 2EWBA 1DIKA 1MK4A 4R6TA 4Y49C 4NCZA 2DF5A 1BXRB 1IOFA 4R7MA 3SJGA 4K30A 2NYQA 4CAEA 2V8GA 1TXRA 4MI4A 2ZXVA 2CY2A 4MHZA 2OOTA 3VRNA 4M6GA 2HI6A 1YX0A 3D68A 2R98A 1KC7A 4GPLB 2B5GA 4HNXB 5G21A 2Q44A 4RS2A 4X3RA 2RFHA 4P4JA 2G3TA 2VZYA 3CDXA 2CNMA 1VKCA 3EZBA 3SR3A 3FEDA 2ZW6A 3TE4A 4F9UA 2JBKA 2B4JC 5CPAA 1YVKA 3LODA 2AFZA 2PJ1A 2F5IA 4A38A 1IYLA 4B12A 4JLYA 2XEGA 5BY0A 2PJ7A 4YRHA 4C7IA 3I74A 4KOYA 3KHZA 1ELMP 2Q4YA 1T36B 1N71A 5K8MA 2PJ2A 2FIAA 4A4CA 3PGPA 1QQ9A 1R3NA 2FSRA 2OB0A 4GXHA 4CAWA 3RO0A 3TTHA 3SJFA 4NGRA 4OC3A 4AVAA 4FD5A 2EK9A 3O8ZA 2G3AA 2PIZA 4LX9A 4CYOA 5K8NA 4P6YA 2HWGA 4KORA 5AG7A 1IYKA 2WUUA 5HH1A 4PXCA 2FIWA 2X0SA 4MHYA 4CYNA 1CX8A 5D8NA 3SXOA 2BCOA 4CRYB 1VHOA 2Q7BA 5BWAB 4KS9A 3NA6A 3RYOA 4AXVA 1C30B 2F8HA 1ZL0A 2BO9A 2R1IA 3JUWA 1YREA 3PB6X 2CNSA 3WR7A 3T9YA 4B5PB 4F6AA 4CZ1A 3C8OA 1XF8A 2G9DA 3TLGA 2PQ8A 3IWWA 4LQ6A 3SI0A 1Z4RA 1XFOA 4CAFA 1DTDA 3DGVA 4Q36A 2POKA 1ZLIA 4OKOA 4KZTA 4B14A 3TLEA 3P2FA 3R95A 4QVTA 3GKRA 3FB3A 2AFOA 3B3WA 4KSFA 4DNCA 5IR2A 4KVOE 5F47A 4UIBA 4UFVA 1Q2DA 4JXRA 2HQYA 1FNOA 2ZOGA 4MFPA 3DLJA 3R1KA 3VWDA 4F0XA 1CS0B 1YW4A 4IIXA 5THWA 2ANPA 4H6UA 4CS0B 2D4OA 2PJ4A 2PJ8A 2A4NA 2PSWA 2NSMA 3KASA 5I0CA 1M4LA 3BLNA 1Q2CA 1Q2YA 3D7GA 4JJXA 5DWNA 3C26A 5F49A 4C2YA 4GM5A 3N7ZA 1Z8TA 1ZYMA 4UCMA 2JEWA 2VBQA 4FBEA 1YSJA 1F57A 3FF3A 3U88C 5K99A 1UWYA 3A9LA 1IY7A 1TF8A 4COBA 2EVNA 2PIYA 3IU2A 4Q38A 3RBUA 1LAPA 2QJ8A 4KOXA 2PJAA 4UWJA 5LYFA 4AVCA 2EZAA 4NGMA 4YN3A 1EZAA 3RNZA 4BPWB 4P45A 4BPXB 3B3TA 1YLOA 4M3SA 3V8IA 5FD8A 4PSXA 3WABA 1YVHA 3FMCA 1VIXA 3G3SA 2AE6A 1J3LA 5JYBA 4KVXA 2GLJA 2Z11A 4OC5A 1WJTA 2AFWA 4FUUA 4PXDA 2Y0MA 3PB4X 5D29A 1Z5RA 4PK2A 2AFSA 2Q04A 4JVOA 4IK2A 4NF1A 4B13A 3TLBA 1CPSA 1BO4A 2O28A 4MHPA 4B5PA 3EZAA 3IEHA 4UCPA 2O4HA 3EC4A 4MY3A 8CPAA 4C8PA 1YQEA 2BUEA 3R96A 4A31A 3HUVA 4ONUA 2PJBA 2H5MA 1X12A 4MFKA 4OC1A 3B3VA 2GLFA 2ZPAA 3D2PA 3R9FA 3GYAA 3IJ3A 5F1YA 3WC6A 2N3AB 2OZHA 4C2XA 3KR5A 4X2TA 4NJRA 4UIAA 4E5SA 4INJA 2C27A 2ZOFA 4EYSA 1FBVA 4JZ0A 2YNCA 3KR4A 4C9VA 3T90A 2ZENA 1BPNA 3F8KA 1ZG7A 1VHEA 5HVFA 3W91A 4CDJA 1HDQA 1S7NA 2QVPA 4EMEA 4C2ZA 3K9TA 4H89A 3TO9A 4MI1A 2Q7SA 1BPMA 2PJCA 4P4EA 4A39A 3TLYA 1KUYA 1AYEA 1WWZA 3H8GA 1Q7LA 3PB9X 3BI1A 5F48A 5G20A 2ODFA 4MBUA 1HEEA 4MY0A 3TLAA 4C8AA 3NH8A 1PU9A 1I12A 1GHEA 1P0HA 2ZW7A 3PFEA 2CTCA 1YMEA 3GB0A 1JDEA 4F0YA 1M44A 2D4PA 5AG4A 4XNHB 3TLCA 1V6CA 3KQZA 4HPSA 3LMSA 4LUAA 3ISZA 3PBBA 4MFLA 2XEJA 3PBEA 4CGOA 4UCNA 4ZX9A 4BBHA 2FVGA 3FRMA 4CGLA 3VTAA 2PR8A 4RUHA 5JPHA 4ZGYB 1KEEB 4P10A 1NSAA 3S6KA 4UEZA 3EZEA 3E0KA 4A4BA 1DE4C 4MCRA 1VGYA 1KUXA 4PK3A 1X10A 5LYIA 2GANA 3GJZA 1JWQA 1VHSA 2PJ0A 1U6MA 3I3GA 3PFOA 4F8ZA 4C85A 2IL4A 1PCAA 4TNUA 5K8OA 1LAMA 5KTCA 1QSRA 1AUGA 3B8GA 2Y1MA 2HV2A 4Y49B 5E96A 3TYXA 1A2ZA 3BUWB 1QSTA 1TF9A 4Z65A 5G1ZA 1ARMA 3PT1A 3ICUA 2EUIA 4M6IA 4ZY0A 2JDCA 2Z3MA 4HNWB 4C86A 4P4FA 4LQGA 3VROA 1KWMA 4OP4A 3FH4A 1NXJA 2GIVA 4L89A 1BOBA 3RAMA 2FM4A 2JLMA 2IJZA 4H6ZA 2ZEFA 4FAIA 5IB0A 4C9RA 4PXBA 4FD6A 3SJXA 4TJXA 2O53A 1YR0A 4A30A 4YU9A 1ELLP 3H8FA 2PCNA 3NOJA 4MFQA 4AVBA 4IAVA 5ISVA 1IGBA 4R57A 2I79A 1FT7A 2PJ5A 4R9MA 5JM6A 5HXDA 5KTAA 2EZBA 3CT9A 4KOSA 4U5YA 2IMOA 2CIJA 2FL4A 3S6FA 1LOKA 4C8TA 4JYWA 3EFAA 3VGOA 1H8LA 4AG9A 2Q4VA 4NGSA 4NXYA 2ZELA 2EK8A 4ZY2A 5HKYA 3FBUA 4KOUA 4PQAA 3D8PA 5HKWA 2C6CA 2I00A 2XPPA 2PC1A 3PEIA 4H2KA 6CPAA 3TC8A 2XPOA 3SJEA 3V38A 1Y7EA 4CPAA 2V8HA 3CXQA 4IHMA 1Q5XA 5IX3A 5F5XA 2Z3LA 3VH9A 3B3CA 4E8OA 1XMBA 2GU2A 2PE3A 4WJBA 3TOBA 2NMTA 1TKFA 1F2OA 4B6ZA 2E28A 2YJTA 1EE3P 5AGEA 3VWEA 5I4MA 2WZNA 2ZEHA 3LACA 2GP4A 4B10A 4IUSA 4DJLA 4ORFA 1MJ9A 2ZEPA 2PRBA 4EVYA 4FWUA 3BUMB 2G0BA 4XPLA 3DNSA 3KKWA 1LRZA 3SI1A 2B0AA 2P6EA 2VZZA 3TCVA 4NGPA 2QYVA 5HVHA 4NEXA 2XPNA 5EBVA 4CGPA 1ZO0A 3D7DA 3S9LA 1PUAA 1RO5A 2ABZA 3DR8A 2PJ6A 3KL9A 4KSIA 2P0WA 4Q7AA 4CRZB 2KCWA 1L0CA 2CTBA 2HC9A 2ZW5A 2AUNA 2UV8G 3ZJ0A 4C68A 2Z10A 4BD9A 5KTDA 3TLZA 3LD2A 5F09A 3NE8A 2ZEMA 4OAEA 1BAVA 2OZUA 2C1CA 1XRYA 3JTKA 4BMHA 2PCUA 4F9VA 5J8FA 1C3OB 4CDKA 3OB1B 4C99A 1M4DA 1XMTA 2J8MA 1TIQA 2PDOA 1R57A 4ZBGA 4CYPA 3IFEA 3VATA 4MXUA 4QC6A 3I6SA 3D3SA 3IWEA 4UEEA 3SI2A 2C6PA 2DLAA 1WVMA 3R9EA 3D7HA 1JQGA 4A37A 3T0TA 2R8VA 4OIWA 3PP9A 2RC4A 3QB8A 4GS4A 4U9YA 3K9UA 5LRJA 5HMNA 5DWMA 4C9AA 2ARHA 4KSAA 5AXIA 1S60A 2ZEEA 3CXPA 3CXSA 1QSOA 1Y9WA 1QSMA 2V8DA 3EXNA 1LCPA 1P4NA 3IGRA 5LYDA 1XBUA 4KOTA 4E0AA 5LYLA 4M6HA 1R61A 2VQYA 4R87A 2Y1NA 4R8FA 4QB9A 4CGNA 2Z0ZA 2BEIA 3BUNB 1I1DA 1JDBC 1VBHA 2V77A 2P6FA 1Z8WA 4MRIA 3D66A 4DUKA 3ZNIA 4RN7A 2DIKA 2AFXA 4MFJA 3NFQA 5G22A 4P44A 4IIYA 4C7HA 2IQ6A 1XF1A 5LRKA 2WPWA 3EY5A 4K3NA 1PYTB 3QNVA 2BOAA 2AFMA 1Z8LA 3DDDA 3KHXA 4E94A 2DXQA 4A33A 1CM0A 1BLLE 4UF4A 2B58A 3KZWA 3PZJA 3H8EA 1Z4EA 3UY5A 4NGTA 3EIFA 4COGA 3KI9A 2P6GA 3PB8X 1WK4A 3OB2B 3BJ7A 3NFZA 4A95A 2Q0YA 4MJXA 2OZGA 3FVLA 3TX8A 2Z3NA 2B4DB 1TKHA 3KGQA 5IV0A 5J1QA 2AJ6A 4EFDA 2ATRA 4BPUB 1FY7A 4NSQA 1S7LA 5A28A 2HB6A 3IIBA 4MCSA 3BUXB 3PB7X 5DS0A 2D0OA 3SXNA 3D4UA 4P4DA 5F9MA 4KUBA 4YGOA 3S6GA 5F13A 2JDDA 1K4JA 1CPXA 3D2MA 4WWVA 1Z9UA 5CNPA 4C8CA 3NH4A 4OC4A 3GY9A 3IO1A 4ZI6A 4X5KA 2YJVA 4R3LA 3TFYA 1IU8A 2OR4A 1I21A 2CNTA 4IF5A 3LWUA 3DSBA 4R3KA 3R9GA 2OLSA 2PR1A 2AFUA 4QUSA 5JH9A 4OLLA 2GFQA 3P2HA 5GCNA 4J3GA 3CPAA 4NGNA 1LFWA 3VRRA 3W6XA 3TO6A 3NH5A 1J4JA 1B47A 4C84A 3VARA 2V8VA 3FYNA 3IWGA 1UFHA 1VI4A 3S9NA 2OU2A 3GLJA 3I1UA 3IC1A 2MP0A 1S5KA 2CXAA 3SHPA 2BSWA 4I49A 4L8AA 4A94A 3QAYA 1GGOA 4M8DA 3T5MA 3OAKA 4CGMA 2K5TA 1CJWA 1A9XB 2YGWA 4MCQA 2ZEGA 4PV6A 5FVJA 2WSAA 4C9EA 3WT4A 4MHNA 3F9KC 3FIXA 1IOIA 4TWEA 1S3ZA 4PSWA 1QSNA 1Y0RA 4A2ZA 1Z2LA 2FE7A 5K8PA 3TOAA 3GIUA 2Q51A 2FCKA 1VBGA 1CBXA 5LRGA 3OWCA 1XOVA 1Z9EA 4P4BA 1CG2A 2CF4A 1NE9A 2ZEDA 1RXTA 1SQHA 7CPAA 4X8IA 4NFRA 1ZG8A 4OC0A 4M85A 4II9A 1R43A 3H5ZA 1Y9KA 1S7KA 2VXKA 4W9YA 2YNCC 4HKFA 3NE7A 4B11A 3FNCA 3H4QA 2B4DA 2QIRA 3BXMA 1EO0A 1V0CA 1EZBA 3FECA 4HNYB 4ONWA 1OZPA 2PVWA 3IU1A 5HVGA 2DPSA 4OMEA 1CP7A 4J0NA 3HPGG 3B3SA 1YW6A 1KZFA 3S6HA 3D67A 1NSLA 1IB1E 1NBWA 2GREA 2QECA 5H86A 4KUAA 4TJVA 5AG6A 2Z3KA 4MJ8A 3T05A 2CBLA 2B3VA 2BL1A 4YFJA 1S7FA 5J8CA 2Q4ZA 3KQXA 2DPTA 1M6VB 1YVOA 1XEBA 3MRUA 3FXTA 1Y7RA 4JD6A 4KVME 3TO7A 4BTFA 1KUVA 1ZG9A 4FD7A 3BI0A 1QMUA 4RR2B 4C8FA 1Y9ZA 3HLPA 3EO4A 3F0AA 5ELYA 4ZX8A 4DYOA 3D7FA 2DEAA 3B7IA 4C9UA 2RB7A 5JVLA 2EZCA 5EMIA 3OP0A 1IICA 3S9MA 1CP6A 2J8NA 3DR6A 5J3XA 2Q43A 3QAHA 4U9ZA 4C8UA 2R7HA 2B3UA 5AG5A 3WC5A 3V7ZA 3CPXA 1ARLA 1XIXA 3GUXA 2F7VA 3B2YA 5HKZA 1TKJA 3B35A 4R76A 2J8RA 2WYRA 2J9AA 1YLEA 1XJOA 2GE3A 3U1BA 3PRTA 5C88A 1MJAA 2VL1A 3ISXA 5F46A 3JRUA 4PXEA 4UEFA
chains in the Genus database with same CATH topology
3T8WA 2JBJA 4P4IA 1GYTA 4NGQA 5JGFA 5IB9A 2I3CA 3L2NA 2PJ3A 1HDUA 1F2PA 2C5QA 1AMPA 4YWYA 4G1PA 1RTQA 1Y0YA 2PRQA 3N5FA 4ZYQA 2XEIA 4MCPA 3FJUA 4OC2A 3WC7A 3FEEA 1OBRA 3RZAA 4OIDA 3MN8A 4NJQA 2PJ9A 4MMOA 3FX6A 2XEFA 4ZY1A 5CBMA 1LANA 4PPZA 4EWTA 1ZLHA 3BHXA 2PVVA 4KNGE 2C6GA 4O23A 2ZEOA 3K2KA 2EWBA 4R6TA 4R7MA 3SJGA 2NYQA 2V8GA 1TXRA 4MHZA 2OOTA 3D68A 4X3RA 2RFHA 4P4JA 3CDXA 3FEDA 4F9UA 2JBKA 5CPAA 2AFZA 2PJ1A 4A38A 2XEGA 2PJ7A 3I74A 3KHZA 1ELMP 5K8MA 2PJ2A 1QQ9A 1R3NA 3SJFA 4NGRA 4OC3A 2EK9A 2PIZA 5K8NA 4P6YA 4PXCA 4MHYA 1CX8A 5D8NA 2BCOA 1VHOA 3NA6A 4AXVA 2F8HA 2BO9A 3PB6X 2G9DA 3IWWA 3SI0A 1XFOA 1DTDA 3DGVA 2POKA 1ZLIA 4OKOA 2AFOA 3B3WA 5IR2A 4UIBA 1FNOA 2ZOGA 3DLJA 1YW4A 5THWA 2ANPA 2PJ4A 2PJ8A 2NSMA 3KASA 1M4LA 3D7GA 4GM5A 2JEWA 4FBEA 1YSJA 1F57A 3FF3A 1UWYA 1IY7A 1TF8A 2PIYA 5LYFA 3RBUA 1LAPA 2QJ8A 2PJAA 4YN3A 4NGMA 4P45A 3B3TA 1YLOA 3WABA 3FMCA 1VIXA 2GLJA 4OC5A 2AFWA 4PXDA 4FUUA 3PB4X 5D29A 1Z5RA 2AFSA 4IK2A 1CPSA 4MHPA 3IEHA 2O4HA 8CPAA 4C8PA 3HUVA 2PJBA 4OC1A 3B3VA 2GLFA 3IJ3A 3WC6A 3KR5A 4X2TA 4NJRA 4UIAA 2ZOFA 4JZ0A 4C9VA 3KR4A 2ZENA 1BPNA 1ZG7A 1VHEA 5HVFA 4CDJA 1HDQA 2QVPA 4EMEA 3K9TA 1BPMA 2PJCA 4P4EA 4A39A 1AYEA 3H8GA 1Q7LA 3PB9X 3BI1A 1HEEA 4C8AA 3NH8A 3PFEA 2CTCA 1YMEA 3GB0A 1V6CA 3KQZA 3LMSA 3ISZA 3PBBA 2XEJA 3PBEA 3VTAA 4ZX9A 2FVGA 4RUHA 4P10A 1NSAA 4UEZA 1DE4C 4MCRA 1VGYA 5LYIA 2PJ0A 3PFOA 4F8ZA 4C85A 1PCAA 4TNUA 5K8OA 1LAMA 1TF9A 4Z65A 1ARMA 3ICUA 4ZY0A 4C86A 4P4FA 4LQGA 1KWMA 4OP4A 3FH4A 3RAMA 2IJZA 2ZEFA 4FAIA 4C9RA 4PXBA 3SJXA 4TJXA 2O53A 4YU9A 1ELLP 3H8FA 4IAVA 1IGBA 5JM6A 1FT7A 2PJ5A 5HXDA 3CT9A 2IMOA 2CIJA 4C8TA 1LOKA 4JYWA 1H8LA 4NGSA 2ZELA 2EK8A 4ZY2A 4PQAA 2C6CA 4H2KA 3PEIA 6CPAA 3TC8A 3SJEA 3V38A 1Y7EA 4CPAA 2V8HA 4IHMA 3VH9A 3B3CA 1XMBA 2GU2A 2PE3A 4WJBA 1TKFA 1F2OA 4B6ZA 1EE3P 5I4MA 2WZNA 2ZEHA 2GP4A 4DJLA 2ZEPA 4FWUA 3SI1A 4NGPA 2QYVA 5HVHA 2ABZA 3D7DA 3S9LA 2PJ6A 3KL9A 4KSIA 4Q7AA 2HC9A 2CTBA 4BD9A 5F09A 2ZEMA 1BAVA 2C1CA 1XRYA 4CDKA 2PCUA 4F9VA 4C99A 3IFEA 3VATA 4MXUA 3I6SA 4UEEA 3SI2A 2C6PA 1WVMA 3D7HA 1JQGA 4A37A 4OIWA 4C9AA 5LRJA 2ZEEA 2V8DA 1LCPA 5LYDA 5LYLA 1XBUA 4R8FA 2V77A 4MRIA 3D66A 4DUKA 2AFXA 4P44A 2IQ6A 1XF1A 5LRKA 4K3NA 1PYTB 3QNVA 2BOAA 2AFMA 1Z8LA 3KHXA 1BLLE 4UF4A 3KZWA 3H8EA 4NGTA 3EIFA 3KI9A 3PB8X 3NFZA 3FVLA 3TX8A 5J1QA 1TKHA 3KGQA 4EFDA 2HB6A 3IIBA 4MCSA 3PB7X 5DS0A 3D4UA 4P4DA 1CPXA 4WWVA 4C8CA 3NH4A 4OC4A 3IO1A 4ZI6A 2OR4A 3LWUA 2AFUA 5JH9A 3CPAA 4NGNA 1LFWA 3NH5A 4C84A 3VARA 2V8VA 3S9NA 3GLJA 3I1UA 3IC1A 4A94A 4MCQA 2ZEGA 4C9EA 3WT4A 4MHNA 4TWEA 1Y0RA 1Z2LA 5K8PA 2Q51A 1CBXA 5LRGA 4P4BA 1CG2A 2CF4A 2ZEDA 7CPAA 4X8IA 4NFRA 1ZG8A 4OC0A 1R43A 4W9YA 3BXMA 3FECA 4ONWA 2PVWA 5HVGA 4OMEA 1CP7A 3B3SA 1YW6A 3D67A 2GREA 4TJVA 2Q4ZA 3KQXA 3MRUA 1ZG9A 3BI0A 1QMUA 4C8FA 1Y9ZA 3HLPA 4DYOA 5ELYA 4ZX8A 3D7FA 2DEAA 3B7IA 4C9UA 2RB7A 3S9MA 1CP6A 2Q43A 4C8UA 3WC5A 3V7ZA 3CPXA 1ARLA 3GUXA 4R76A 2F7VA 3B2YA 1TKJA 3B35A 2WYRA 2J9AA 1XJOA 3PRTA 2VL1A 3ISXA 3JRUA 4PXEA 4UEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8W A;  2JBJ A;  4P4I A;  1GYT A;  4NGQ A;  5JGF A;  5IB9 A;  2I3C A;  3L2N A;  2PJ3 A;  1HDU A;  1F2P A;  1AMP A;  4YWY A;  4G1P A;  1RTQ A;  1Y0Y A;  2PRQ A;  3N5F A;  4ZYQ A;  2XEI A;  4MCP A;  3FJU A;  4OC2 A;  3WC7 A;  3FEE A;  1OBR A;  3RZA A;  4OID A;  3MN8 A;  4NJQ A;  2PJ9 A;  4MMO A;  3FX6 A;  2XEF A;  4ZY1 A;  5CBM A;  1LAN A;  4PPZ A;  4EWT A;  1ZLH A;  3BHX A;  2PVV A;  4KNG E;  2C6G A;  4O23 A;  2ZEO A;  3K2K A;  2EWB A;  4R6T A;  4R7M A;  3SJG A;  2NYQ A;  2V8G A;  1TXR A;  4MHZ A;  2OOT A;  3D68 A;  4X3R A;  2RFH A;  4P4J A;  3CDX A;  3FED A;  4F9U A;  2JBK A;  5CPA A;  2AFZ A;  2PJ1 A;  4A38 A;  2XEG A;  2PJ7 A;  3I74 A;  3KHZ A;  1ELM P;  5K8M A;  2PJ2 A;  1QQ9 A;  1R3N A;  3SJF A;  4NGR A;  4OC3 A;  2EK9 A;  2PIZ A;  5K8N A;  4P6Y A;  4PXC A;  4MHY A;  1CX8 A;  5D8N A;  2BCO A;  1VHO A;  3NA6 A;  4AXV A;  2F8H A;  2BO9 A;  3PB6 X;  2G9D A;  3IWW A;  3SI0 A;  1XFO A;  1DTD A;  3DGV A;  2POK A;  1ZLI A;  4OKO A;  2AFO A;  3B3W A;  4UIB A;  1FNO A;  2ZOG A;  3DLJ A;  1YW4 A;  5THW A;  2ANP A;  2PJ4 A;  2PJ8 A;  2NSM A;  3KAS A;  1M4L A;  3D7G A;  4GM5 A;  2JEW A;  4FBE A;  1YSJ A;  1F57 A;  3FF3 A;  1UWY A;  1IY7 A;  1TF8 A;  2PIY A;  5LYF A;  3RBU A;  1LAP A;  2QJ8 A;  2PJA A;  4YN3 A;  4NGM A;  4P45 A;  3B3T A;  1YLO A;  3WAB A;  3FMC A;  1VIX A;  2GLJ A;  4OC5 A;  2AFW A;  4PXD A;  4FUU A;  3PB4 X;  5D29 A;  1Z5R A;  2AFS A;  4IK2 A;  1CPS A;  4MHP A;  3IEH A;  2O4H A;  8CPA A;  4C8P A;  3HUV A;  2PJB A;  4OC1 A;  3B3V A;  2GLF A;  3IJ3 A;  3WC6 A;  3KR5 A;  4X2T A;  4NJR A;  4UIA A;  2ZOF A;  4JZ0 A;  4C9V A;  3KR4 A;  2ZEN A;  1BPN A;  1ZG7 A;  1VHE A;  5HVF A;  4CDJ A;  1HDQ A;  2QVP A;  4EME A;  3K9T A;  1BPM A;  2PJC A;  4P4E A;  4A39 A;  1AYE A;  3H8G A;  1Q7L A;  3PB9 X;  3BI1 A;  1HEE A;  4C8A A;  3NH8 A;  3PFE A;  2CTC A;  1YME A;  3GB0 A;  1V6C A;  3KQZ A;  3LMS A;  3ISZ A;  3PBB A;  2XEJ A;  3PBE A;  3VTA A;  4ZX9 A;  2FVG A;  4RUH A;  4P10 A;  1NSA A;  4UEZ A;  1DE4 C;  4MCR A;  1VGY A;  5LYI A;  2PJ0 A;  3PFO A;  4F8Z A;  4C85 A;  1PCA A;  4TNU A;  5K8O A;  1LAM A;  1TF9 A;  4Z65 A;  1ARM A;  3ICU A;  4ZY0 A;  4C86 A;  4P4F A;  4LQG A;  1KWM A;  4OP4 A;  3FH4 A;  3RAM A;  2IJZ A;  2ZEF A;  4FAI A;  4C9R A;  4PXB A;  3SJX A;  4TJX A;  2O53 A;  4YU9 A;  1ELL P;  3H8F A;  4IAV A;  1IGB A;  5JM6 A;  1FT7 A;  2PJ5 A;  5HXD A;  3CT9 A;  2IMO A;  2CIJ A;  4C8T A;  1LOK A;  4JYW A;  1H8L A;  4NGS A;  2ZEL A;  2EK8 A;  4ZY2 A;  4PQA A;  2C6C A;  4H2K A;  3PEI A;  6CPA A;  3TC8 A;  3SJE A;  3V38 A;  1Y7E A;  4CPA A;  2V8H A;  4IHM A;  3VH9 A;  3B3C A;  1XMB A;  2GU2 A;  2PE3 A;  4WJB A;  1TKF A;  1F2O A;  4B6Z A;  1EE3 P;  5I4M A;  2WZN A;  2ZEH A;  4DJL A;  2ZEP A;  4FWU A;  3SI1 A;  4NGP A;  2QYV A;  5HVH A;  2ABZ A;  3D7D A;  3S9L A;  2PJ6 A;  3KL9 A;  4KSI A;  4Q7A A;  2HC9 A;  2CTB A;  4BD9 A;  5F09 A;  2ZEM A;  1BAV A;  2C1C A;  1XRY A;  4CDK A;  2PCU A;  4F9V A;  4C99 A;  3IFE A;  3VAT A;  4MXU A;  3I6S A;  4UEE A;  3SI2 A;  2C6P A;  1WVM A;  3D7H A;  1JQG A;  4A37 A;  4OIW A;  4C9A A;  5LRJ A;  2ZEE A;  2V8D A;  1LCP A;  5LYD A;  5LYL A;  1XBU A;  4R8F A;  2V77 A;  4MRI A;  3D66 A;  4DUK A;  2AFX A;  4P44 A;  2IQ6 A;  1XF1 A;  5LRK A;  4K3N A;  1PYT B;  3QNV A;  2BOA A;  2AFM A;  1Z8L A;  3KHX A;  1BLL E;  4UF4 A;  3KZW A;  3H8E A;  4NGT A;  3EIF A;  3KI9 A;  3PB8 X;  3NFZ A;  3FVL A;  3TX8 A;  5J1Q A;  1TKH A;  3KGQ A;  4EFD A;  2HB6 A;  3IIB A;  4MCS A;  3PB7 X;  5DS0 A;  3D4U A;  4P4D A;  1CPX A;  4WWV A;  4C8C A;  3NH4 A;  4OC4 A;  3IO1 A;  4ZI6 A;  2OR4 A;  3LWU A;  2AFU A;  5JH9 A;  3CPA A;  4NGN A;  1LFW A;  3NH5 A;  4C84 A;  3VAR A;  2V8V A;  3S9N A;  3GLJ A;  3I1U A;  3IC1 A;  4A94 A;  4MCQ A;  2ZEG A;  4C9E A;  3WT4 A;  4MHN A;  4TWE A;  1Y0R A;  1Z2L A;  5K8P A;  2Q51 A;  1CBX A;  5LRG A;  4P4B A;  1CG2 A;  2CF4 A;  2ZED A;  7CPA A;  4X8I A;  4NFR A;  1ZG8 A;  4OC0 A;  1R43 A;  4W9Y A;  3BXM A;  3FEC A;  4ONW A;  2PVW A;  5HVG A;  4OME A;  1CP7 A;  3B3S A;  1YW6 A;  3D67 A;  2GRE A;  4TJV A;  2Q4Z A;  3KQX A;  3MRU A;  1ZG9 A;  3BI0 A;  1QMU A;  4C8F A;  1Y9Z A;  3HLP A;  4DYO A;  5ELY A;  4ZX8 A;  3D7F A;  2DEA A;  3B7I A;  4C9U A;  2RB7 A;  3S9M A;  1CP6 A;  2Q43 A;  4C8U A;  3WC5 A;  3V7Z A;  3CPX A;  1ARL A;  3GUX A;  4R76 A;  2F7V A;  3B2Y A;  1TKJ A;  3B35 A;  2WYR A;  2J9A A;  1XJO A;  3PRT A;  2VL1 A;  3ISX A;  3JRU A;  4PXE A;  4UEF A; 
#chains in the Genus database with same CATH topology
 2B5G B;  3T8W A;  3K4I A;  2JBJ A;  4P4I A;  4QBJ A;  2Z3P A;  2FT0 A;  2HRO A;  1GYT A;  4NGQ A;  5JGF A;  5IB9 A;  3MGD A;  3F5B A;  1ZRS A;  1XE4 A;  4JXQ A;  4KOW A;  5C82 A;  4E2A A;  2VKZ G;  2EBJ A;  2FS5 A;  2I3C A;  2JEV A;  1NMT A;  1ON0 A;  3L2N A;  4UFX A;  4XPD C;  2PJ3 A;  1HDU A;  3W6S A;  4AG7 A;  2WPX A;  2R82 A;  1F2P A;  1B6B A;  1AMP A;  2B4B A;  2VI7 A;  4OAD A;  2C5Q A;  3CZX A;  4KLV A;  2Z3O A;  4YWY A;  4G1P A;  4CYQ A;  2ZW4 A;  1B87 A;  1RTQ A;  1Y0Y A;  2PRQ A;  3BJ8 A;  3N5F A;  3KRV A;  4ZYQ A;  2XEI A;  4MCP A;  3FJU A;  4KLW A;  4OC2 A;  2YNE A;  4CAX A;  3G8W A;  1KBL A;  2FXF A;  3BUO B;  1Z8X A;  2REE A;  2YND A;  2AUM A;  2XPL A;  3FEE A;  3WC7 A;  1OBR A;  2VEZ A;  3RZA A;  1MJB A;  4KOV A;  4OID A;  4UFW A;  2QML A;  4AB7 A;  4BIN A;  5EC4 A;  1CE8 B;  2REF A;  3MN8 A;  4NJQ A;  4UBR A;  2PJ9 A;  4XNH C;  4XPK A;  3PLF B;  4MMO A;  3FX6 A;  4CAV A;  2XEF A;  4RI1 A;  3ZZI A;  4ZY1 A;  3VRQ A;  1M1D A;  1IID A;  2HUZ A;  4MHD A;  4A32 A;  4UA3 A;  1LAN A;  4PPZ A;  4EWT A;  5H84 A;  1ZLH A;  5CBM A;  5JQ4 A;  3BHX A;  2PVV A;  5A27 A;  4KNG E;  4JWP A;  4H1H A;  3TLG B;  2C6G A;  3HMJ G;  1M4G A;  3TT2 A;  3T07 A;  4XPD B;  4B5O A;  4CO9 A;  3JVN A;  1YGH A;  4O23 A;  3I9S A;  1YK3 A;  3HPH E;  2EO8 A;  3G23 A;  2OH1 A;  4UWI A;  3PFV A;  1M4I A;  4FD4 A;  3VRP A;  2ZEO A;  3K2K A;  2D0P A;  4MFZ A;  2X7B A;  2EWB A;  1DIK A;  1MK4 A;  4R6T A;  4Y49 C;  4NCZ A;  2DF5 A;  1BXR B;  1IOF A;  4R7M A;  3SJG A;  4K30 A;  2NYQ A;  4CAE A;  2V8G A;  1TXR A;  4MI4 A;  2ZXV A;  2CY2 A;  4MHZ A;  2OOT A;  3VRN A;  4M6G A;  2HI6 A;  1YX0 A;  3D68 A;  2R98 A;  1KC7 A;  4GPL B;  2B5G A;  4HNX B;  5G21 A;  2Q44 A;  4RS2 A;  4X3R A;  2RFH A;  4P4J A;  2G3T A;  2VZY A;  3CDX A;  2CNM A;  1VKC A;  3EZB A;  3SR3 A;  3FED A;  2ZW6 A;  3TE4 A;  4F9U A;  2JBK A;  2B4J C;  5CPA A;  1YVK A;  3LOD A;  2AFZ A;  2PJ1 A;  2F5I A;  4A38 A;  1IYL A;  4B12 A;  4JLY A;  2XEG A;  5BY0 A;  2PJ7 A;  4YRH A;  4C7I A;  3I74 A;  4KOY A;  3KHZ A;  1ELM P;  2Q4Y A;  1T36 B;  1N71 A;  5K8M A;  2PJ2 A;  2FIA A;  4A4C A;  3PGP A;  1QQ9 A;  1R3N A;  2FSR A;  2OB0 A;  4GXH A;  4CAW A;  3RO0 A;  3TTH A;  3SJF A;  4NGR A;  4OC3 A;  4AVA A;  4FD5 A;  2EK9 A;  3O8Z A;  2G3A A;  2PIZ A;  4LX9 A;  4CYO A;  5K8N A;  4P6Y A;  2HWG A;  4KOR A;  5AG7 A;  1IYK A;  2WUU A;  5HH1 A;  4PXC A;  2FIW A;  2X0S A;  4MHY A;  4CYN A;  1CX8 A;  5D8N A;  3SXO A;  2BCO A;  4CRY B;  1VHO A;  2Q7B A;  5BWA B;  4KS9 A;  3NA6 A;  3RYO A;  4AXV A;  1C30 B;  2F8H A;  1ZL0 A;  2BO9 A;  2R1I A;  3JUW A;  1YRE A;  3PB6 X;  2CNS A;  3WR7 A;  3T9Y A;  4B5P B;  4F6A A;  4CZ1 A;  3C8O A;  1XF8 A;  2G9D A;  3TLG A;  2PQ8 A;  3IWW A;  4LQ6 A;  3SI0 A;  1Z4R A;  1XFO A;  4CAF A;  1DTD A;  3DGV A;  4Q36 A;  2POK A;  1ZLI A;  4OKO A;  4KZT A;  4B14 A;  3TLE A;  3P2F A;  3R95 A;  4QVT A;  3GKR A;  3FB3 A;  2AFO A;  3B3W A;  4KSF A;  4DNC A;  5IR2 A;  4KVO E;  5F47 A;  4UIB A;  4UFV A;  1Q2D A;  4JXR A;  2HQY A;  1FNO A;  2ZOG A;  4MFP A;  3DLJ A;  3R1K A;  3VWD A;  4F0X A;  1CS0 B;  1YW4 A;  4IIX A;  5THW A;  2ANP A;  4H6U A;  4CS0 B;  2D4O A;  2PJ4 A;  2PJ8 A;  2A4N A;  2PSW A;  2NSM A;  3KAS A;  5I0C A;  1M4L A;  3BLN A;  1Q2C A;  1Q2Y A;  3D7G A;  4JJX A;  5DWN A;  3C26 A;  5F49 A;  4C2Y A;  4GM5 A;  3N7Z A;  1Z8T A;  1ZYM A;  4UCM A;  2JEW A;  2VBQ A;  4FBE A;  1YSJ A;  1F57 A;  3FF3 A;  3U88 C;  5K99 A;  1UWY A;  3A9L A;  1IY7 A;  1TF8 A;  4COB A;  2EVN A;  2PIY A;  3IU2 A;  4Q38 A;  3RBU A;  1LAP A;  2QJ8 A;  4KOX A;  2PJA A;  4UWJ A;  5LYF A;  4AVC A;  2EZA A;  4NGM A;  4YN3 A;  1EZA A;  3RNZ A;  4BPW B;  4P45 A;  4BPX B;  3B3T A;  1YLO A;  4M3S A;  3V8I A;  5FD8 A;  4PSX A;  3WAB A;  1YVH A;  3FMC A;  1VIX A;  3G3S A;  2AE6 A;  1J3L A;  5JYB A;  4KVX A;  2GLJ A;  2Z11 A;  4OC5 A;  1WJT A;  2AFW A;  4FUU A;  4PXD A;  2Y0M A;  3PB4 X;  5D29 A;  1Z5R A;  4PK2 A;  2AFS A;  2Q04 A;  4JVO A;  4IK2 A;  4NF1 A;  4B13 A;  3TLB A;  1CPS A;  1BO4 A;  2O28 A;  4MHP A;  4B5P A;  3EZA A;  3IEH A;  4UCP A;  2O4H A;  3EC4 A;  4MY3 A;  8CPA A;  4C8P A;  1YQE A;  2BUE A;  3R96 A;  4A31 A;  3HUV A;  4ONU A;  2PJB A;  2H5M A;  1X12 A;  4MFK A;  4OC1 A;  3B3V A;  2GLF A;  2ZPA A;  3D2P A;  3R9F A;  3GYA A;  3IJ3 A;  5F1Y A;  3WC6 A;  2N3A B;  2OZH A;  4C2X A;  3KR5 A;  4X2T A;  4NJR A;  4UIA A;  4E5S A;  4INJ A;  2C27 A;  2ZOF A;  4EYS A;  1FBV A;  4JZ0 A;  2YNC A;  3KR4 A;  4C9V A;  3T90 A;  2ZEN A;  1BPN A;  3F8K A;  1ZG7 A;  1VHE A;  5HVF A;  3W91 A;  4CDJ A;  1HDQ A;  1S7N A;  2QVP A;  4EME A;  4C2Z A;  3K9T A;  4H89 A;  3TO9 A;  4MI1 A;  2Q7S A;  1BPM A;  2PJC A;  4P4E A;  4A39 A;  3TLY A;  1KUY A;  1AYE A;  1WWZ A;  3H8G A;  1Q7L A;  3PB9 X;  3BI1 A;  5F48 A;  5G20 A;  2ODF A;  4MBU A;  1HEE A;  4MY0 A;  3TLA A;  4C8A A;  3NH8 A;  1PU9 A;  1I12 A;  1GHE A;  1P0H A;  2ZW7 A;  3PFE A;  2CTC A;  1YME A;  3GB0 A;  1JDE A;  4F0Y A;  1M44 A;  2D4P A;  5AG4 A;  4XNH B;  3TLC A;  1V6C A;  3KQZ A;  4HPS A;  3LMS A;  4LUA A;  3ISZ A;  3PBB A;  4MFL A;  2XEJ A;  3PBE A;  4CGO A;  4UCN A;  4ZX9 A;  4BBH A;  2FVG A;  3FRM A;  4CGL A;  3VTA A;  2PR8 A;  4RUH A;  5JPH A;  4ZGY B;  1KEE B;  4P10 A;  1NSA A;  3S6K A;  4UEZ A;  3EZE A;  3E0K A;  4A4B A;  1DE4 C;  4MCR A;  1VGY A;  1KUX A;  4PK3 A;  1X10 A;  5LYI A;  2GAN A;  3GJZ A;  1JWQ A;  1VHS A;  2PJ0 A;  1U6M A;  3I3G A;  3PFO A;  4F8Z A;  4C85 A;  2IL4 A;  1PCA A;  4TNU A;  5K8O A;  1LAM A;  5KTC A;  1QSR A;  1AUG A;  3B8G A;  2Y1M A;  2HV2 A;  4Y49 B;  5E96 A;  3TYX A;  1A2Z A;  3BUW B;  1QST A;  1TF9 A;  4Z65 A;  5G1Z A;  1ARM A;  3PT1 A;  3ICU A;  2EUI A;  4M6I A;  4ZY0 A;  2JDC A;  2Z3M A;  4HNW B;  4C86 A;  4P4F A;  4LQG A;  3VRO A;  1KWM A;  4OP4 A;  3FH4 A;  1NXJ A;  2GIV A;  4L89 A;  1BOB A;  3RAM A;  2FM4 A;  2JLM A;  2IJZ A;  4H6Z A;  2ZEF A;  4FAI A;  5IB0 A;  4C9R A;  4PXB A;  4FD6 A;  3SJX A;  4TJX A;  2O53 A;  1YR0 A;  4A30 A;  4YU9 A;  1ELL P;  3H8F A;  2PCN A;  3NOJ A;  4MFQ A;  4AVB A;  4IAV A;  5ISV A;  1IGB A;  4R57 A;  2I79 A;  1FT7 A;  2PJ5 A;  4R9M A;  5JM6 A;  5HXD A;  5KTA A;  2EZB A;  3CT9 A;  4KOS A;  4U5Y A;  2IMO A;  2CIJ A;  2FL4 A;  3S6F A;  1LOK A;  4C8T A;  4JYW A;  3EFA A;  3VGO A;  1H8L A;  4AG9 A;  2Q4V A;  4NGS A;  4NXY A;  2ZEL A;  2EK8 A;  4ZY2 A;  5HKY A;  3FBU A;  4KOU A;  4PQA A;  3D8P A;  5HKW A;  2C6C A;  2I00 A;  2XPP A;  2PC1 A;  3PEI A;  4H2K A;  6CPA A;  3TC8 A;  2XPO A;  3SJE A;  3V38 A;  1Y7E A;  4CPA A;  2V8H A;  3CXQ A;  4IHM A;  1Q5X A;  5IX3 A;  5F5X A;  2Z3L A;  3VH9 A;  3B3C A;  4E8O A;  1XMB A;  2GU2 A;  2PE3 A;  4WJB A;  3TOB A;  2NMT A;  1TKF A;  1F2O A;  4B6Z A;  2E28 A;  2YJT A;  1EE3 P;  5AGE A;  3VWE A;  5I4M A;  2WZN A;  2ZEH A;  3LAC A;  2GP4 A;  4B10 A;  4IUS A;  4DJL A;  4ORF A;  1MJ9 A;  2ZEP A;  2PRB A;  4EVY A;  4FWU A;  3BUM B;  2G0B A;  4XPL A;  3DNS A;  3KKW A;  1LRZ A;  3SI1 A;  2B0A A;  2P6E A;  2VZZ A;  3TCV A;  4NGP A;  2QYV A;  5HVH A;  4NEX A;  2XPN A;  5EBV A;  4CGP A;  1ZO0 A;  3D7D A;  3S9L A;  1PUA A;  1RO5 A;  2ABZ A;  3DR8 A;  2PJ6 A;  3KL9 A;  4KSI A;  2P0W A;  4Q7A A;  4CRZ B;  2KCW A;  1L0C A;  2CTB A;  2HC9 A;  2ZW5 A;  2AUN A;  2UV8 G;  3ZJ0 A;  4C68 A;  2Z10 A;  4BD9 A;  5KTD A;  3TLZ A;  3LD2 A;  5F09 A;  3NE8 A;  2ZEM A;  4OAE A;  1BAV A;  2OZU A;  2C1C A;  1XRY A;  3JTK A;  4BMH A;  2PCU A;  4F9V A;  5J8F A;  1C3O B;  4CDK A;  3OB1 B;  4C99 A;  1M4D A;  1XMT A;  2J8M A;  1TIQ A;  2PDO A;  1R57 A;  4ZBG A;  4CYP A;  3IFE A;  3VAT A;  4MXU A;  4QC6 A;  3I6S A;  3D3S A;  3IWE A;  4UEE A;  3SI2 A;  2C6P A;  2DLA A;  1WVM A;  3R9E A;  3D7H A;  1JQG A;  4A37 A;  3T0T A;  2R8V A;  4OIW A;  3PP9 A;  2RC4 A;  3QB8 A;  4GS4 A;  4U9Y A;  3K9U A;  5LRJ A;  5HMN A;  5DWM A;  4C9A A;  2ARH A;  4KSA A;  5AXI A;  1S60 A;  2ZEE A;  3CXP A;  3CXS A;  1QSO A;  1Y9W A;  1QSM A;  2V8D A;  3EXN A;  1LCP A;  1P4N A;  3IGR A;  5LYD A;  1XBU A;  4KOT A;  4E0A A;  5LYL A;  4M6H A;  1R61 A;  2VQY A;  4R87 A;  2Y1N A;  4R8F A;  4QB9 A;  4CGN A;  2Z0Z A;  2BEI A;  3BUN B;  1I1D A;  1JDB C;  1VBH A;  2V77 A;  2P6F A;  1Z8W A;  4MRI A;  3D66 A;  4DUK A;  3ZNI A;  4RN7 A;  2DIK A;  2AFX A;  4MFJ A;  3NFQ A;  5G22 A;  4P44 A;  4IIY A;  4C7H A;  2IQ6 A;  1XF1 A;  5LRK A;  2WPW A;  3EY5 A;  4K3N A;  1PYT B;  3QNV A;  2BOA A;  2AFM A;  1Z8L A;  3DDD A;  3KHX A;  4E94 A;  2DXQ A;  4A33 A;  1CM0 A;  1BLL E;  4UF4 A;  2B58 A;  3KZW A;  3PZJ A;  3H8E A;  1Z4E A;  3UY5 A;  4NGT A;  3EIF A;  4COG A;  3KI9 A;  2P6G A;  3PB8 X;  1WK4 A;  3OB2 B;  3BJ7 A;  3NFZ A;  4A95 A;  2Q0Y A;  4MJX A;  2OZG A;  3FVL A;  3TX8 A;  2Z3N A;  2B4D B;  1TKH A;  3KGQ A;  5IV0 A;  5J1Q A;  2AJ6 A;  4EFD A;  2ATR A;  4BPU B;  1FY7 A;  4NSQ A;  1S7L A;  5A28 A;  2HB6 A;  3IIB A;  4MCS A;  3BUX B;  3PB7 X;  5DS0 A;  2D0O A;  3SXN A;  3D4U A;  4P4D A;  5F9M A;  4KUB A;  4YGO A;  3S6G A;  5F13 A;  2JDD A;  1K4J A;  1CPX A;  3D2M A;  4WWV A;  1Z9U A;  5CNP A;  4C8C A;  3NH4 A;  4OC4 A;  3GY9 A;  3IO1 A;  4ZI6 A;  4X5K A;  2YJV A;  4R3L A;  3TFY A;  1IU8 A;  2OR4 A;  1I21 A;  2CNT A;  4IF5 A;  3LWU A;  3DSB A;  4R3K A;  3R9G A;  2OLS A;  2PR1 A;  2AFU A;  4QUS A;  5JH9 A;  4OLL A;  2GFQ A;  3P2H A;  5GCN A;  4J3G A;  3CPA A;  4NGN A;  1LFW A;  3VRR A;  3W6X A;  3TO6 A;  3NH5 A;  1J4J A;  1B47 A;  4C84 A;  3VAR A;  2V8V A;  3FYN A;  3IWG A;  1UFH A;  1VI4 A;  3S9N A;  2OU2 A;  3GLJ A;  3I1U A;  3IC1 A;  2MP0 A;  1S5K A;  2CXA A;  3SHP A;  2BSW A;  4I49 A;  4L8A A;  4A94 A;  3QAY A;  1GGO A;  4M8D A;  3T5M A;  3OAK A;  4CGM A;  2K5T A;  1CJW A;  1A9X B;  2YGW A;  4MCQ A;  2ZEG A;  4PV6 A;  5FVJ A;  2WSA A;  4C9E A;  3WT4 A;  4MHN A;  3F9K C;  3FIX A;  1IOI A;  4TWE A;  1S3Z A;  4PSW A;  1QSN A;  1Y0R A;  4A2Z A;  1Z2L A;  2FE7 A;  5K8P A;  3TOA A;  3GIU A;  2Q51 A;  2FCK A;  1VBG A;  1CBX A;  5LRG A;  3OWC A;  1XOV A;  1Z9E A;  4P4B A;  1CG2 A;  2CF4 A;  1NE9 A;  2ZED A;  1RXT A;  1SQH A;  7CPA A;  4X8I A;  4NFR A;  1ZG8 A;  4OC0 A;  4M85 A;  4II9 A;  1R43 A;  3H5Z A;  1Y9K A;  1S7K A;  2VXK A;  4W9Y A;  2YNC C;  4HKF A;  3NE7 A;  4B11 A;  3FNC A;  3H4Q A;  2B4D A;  2QIR A;  3BXM A;  1EO0 A;  1V0C A;  1EZB A;  3FEC A;  4HNY B;  4ONW A;  1OZP A;  2PVW A;  3IU1 A;  5HVG A;  2DPS A;  4OME A;  1CP7 A;  4J0N A;  3HPG G;  3B3S A;  1YW6 A;  1KZF A;  3S6H A;  3D67 A;  1NSL A;  1IB1 E;  1NBW A;  2GRE A;  2QEC A;  5H86 A;  4KUA A;  4TJV A;  5AG6 A;  2Z3K A;  4MJ8 A;  3T05 A;  2CBL A;  2B3V A;  2BL1 A;  4YFJ A;  1S7F A;  5J8C A;  2Q4Z A;  3KQX A;  2DPT A;  1M6V B;  1YVO A;  1XEB A;  3MRU A;  3FXT A;  1Y7R A;  4JD6 A;  4KVM E;  3TO7 A;  4BTF A;  1KUV A;  1ZG9 A;  4FD7 A;  3BI0 A;  1QMU A;  4RR2 B;  4C8F A;  1Y9Z A;  3HLP A;  3EO4 A;  3F0A A;  5ELY A;  4ZX8 A;  4DYO A;  3D7F A;  2DEA A;  3B7I A;  4C9U A;  2RB7 A;  5JVL A;  2EZC A;  5EMI A;  3OP0 A;  1IIC A;  3S9M A;  1CP6 A;  2J8N A;  3DR6 A;  5J3X A;  2Q43 A;  3QAH A;  4U9Z A;  4C8U A;  2R7H A;  2B3U A;  5AG5 A;  3WC5 A;  3V7Z A;  3CPX A;  1ARL A;  1XIX A;  3GUX A;  2F7V A;  3B2Y A;  5HKZ A;  1TKJ A;  3B35 A;  4R76 A;  2J8R A;  2WYR A;  2J9A A;  1YLE A;  1XJO A;  2GE3 A;  3U1B A;  3PRT A;  5C88 A;  1MJA A;  2VL1 A;  3ISX A;  5F46 A;  3JRU A;  4PXE A;  4UEF A; 
#chains in the Genus database with same CATH homology
 3T8W A;  2JBJ A;  4P4I A;  1GYT A;  4NGQ A;  5JGF A;  5IB9 A;  2I3C A;  3L2N A;  2PJ3 A;  1HDU A;  1F2P A;  2C5Q A;  1AMP A;  4YWY A;  4G1P A;  1RTQ A;  1Y0Y A;  2PRQ A;  3N5F A;  4ZYQ A;  2XEI A;  4MCP A;  3FJU A;  4OC2 A;  3WC7 A;  3FEE A;  1OBR A;  3RZA A;  4OID A;  3MN8 A;  4NJQ A;  2PJ9 A;  4MMO A;  3FX6 A;  2XEF A;  4ZY1 A;  5CBM A;  1LAN A;  4PPZ A;  4EWT A;  1ZLH A;  3BHX A;  2PVV A;  4KNG E;  2C6G A;  4O23 A;  2ZEO A;  3K2K A;  2EWB A;  4R6T A;  4R7M A;  3SJG A;  2NYQ A;  2V8G A;  1TXR A;  4MHZ A;  2OOT A;  3D68 A;  4X3R A;  2RFH A;  4P4J A;  3CDX A;  3FED A;  4F9U A;  2JBK A;  5CPA A;  2AFZ A;  2PJ1 A;  4A38 A;  2XEG A;  2PJ7 A;  3I74 A;  3KHZ A;  1ELM P;  5K8M A;  2PJ2 A;  1QQ9 A;  1R3N A;  3SJF A;  4NGR A;  4OC3 A;  2EK9 A;  2PIZ A;  5K8N A;  4P6Y A;  4PXC A;  4MHY A;  1CX8 A;  5D8N A;  2BCO A;  1VHO A;  3NA6 A;  4AXV A;  2F8H A;  2BO9 A;  3PB6 X;  2G9D A;  3IWW A;  3SI0 A;  1XFO A;  1DTD A;  3DGV A;  2POK A;  1ZLI A;  4OKO A;  2AFO A;  3B3W A;  5IR2 A;  4UIB A;  1FNO A;  2ZOG A;  3DLJ A;  1YW4 A;  5THW A;  2ANP A;  2PJ4 A;  2PJ8 A;  2NSM A;  3KAS A;  1M4L A;  3D7G A;  4GM5 A;  2JEW A;  4FBE A;  1YSJ A;  1F57 A;  3FF3 A;  1UWY A;  1IY7 A;  1TF8 A;  2PIY A;  5LYF A;  3RBU A;  1LAP A;  2QJ8 A;  2PJA A;  4YN3 A;  4NGM A;  4P45 A;  3B3T A;  1YLO A;  3WAB A;  3FMC A;  1VIX A;  2GLJ A;  4OC5 A;  2AFW A;  4PXD A;  4FUU A;  3PB4 X;  5D29 A;  1Z5R A;  2AFS A;  4IK2 A;  1CPS A;  4MHP A;  3IEH A;  2O4H A;  8CPA A;  4C8P A;  3HUV A;  2PJB A;  4OC1 A;  3B3V A;  2GLF A;  3IJ3 A;  3WC6 A;  3KR5 A;  4X2T A;  4NJR A;  4UIA A;  2ZOF A;  4JZ0 A;  4C9V A;  3KR4 A;  2ZEN A;  1BPN A;  1ZG7 A;  1VHE A;  5HVF A;  4CDJ A;  1HDQ A;  2QVP A;  4EME A;  3K9T A;  1BPM A;  2PJC A;  4P4E A;  4A39 A;  1AYE A;  3H8G A;  1Q7L A;  3PB9 X;  3BI1 A;  1HEE A;  4C8A A;  3NH8 A;  3PFE A;  2CTC A;  1YME A;  3GB0 A;  1V6C A;  3KQZ A;  3LMS A;  3ISZ A;  3PBB A;  2XEJ A;  3PBE A;  3VTA A;  4ZX9 A;  2FVG A;  4RUH A;  4P10 A;  1NSA A;  4UEZ A;  1DE4 C;  4MCR A;  1VGY A;  5LYI A;  2PJ0 A;  3PFO A;  4F8Z A;  4C85 A;  1PCA A;  4TNU A;  5K8O A;  1LAM A;  1TF9 A;  4Z65 A;  1ARM A;  3ICU A;  4ZY0 A;  4C86 A;  4P4F A;  4LQG A;  1KWM A;  4OP4 A;  3FH4 A;  3RAM A;  2IJZ A;  2ZEF A;  4FAI A;  4C9R A;  4PXB A;  3SJX A;  4TJX A;  2O53 A;  4YU9 A;  1ELL P;  3H8F A;  4IAV A;  1IGB A;  5JM6 A;  1FT7 A;  2PJ5 A;  5HXD A;  3CT9 A;  2IMO A;  2CIJ A;  4C8T A;  1LOK A;  4JYW A;  1H8L A;  4NGS A;  2ZEL A;  2EK8 A;  4ZY2 A;  4PQA A;  2C6C A;  4H2K A;  3PEI A;  6CPA A;  3TC8 A;  3SJE A;  3V38 A;  1Y7E A;  4CPA A;  2V8H A;  4IHM A;  3VH9 A;  3B3C A;  1XMB A;  2GU2 A;  2PE3 A;  4WJB A;  1TKF A;  1F2O A;  4B6Z A;  1EE3 P;  5I4M A;  2WZN A;  2ZEH A;  2GP4 A;  4DJL A;  2ZEP A;  4FWU A;  3SI1 A;  4NGP A;  2QYV A;  5HVH A;  2ABZ A;  3D7D A;  3S9L A;  2PJ6 A;  3KL9 A;  4KSI A;  4Q7A A;  2HC9 A;  2CTB A;  4BD9 A;  5F09 A;  2ZEM A;  1BAV A;  2C1C A;  1XRY A;  4CDK A;  2PCU A;  4F9V A;  4C99 A;  3IFE A;  3VAT A;  4MXU A;  3I6S A;  4UEE A;  3SI2 A;  2C6P A;  1WVM A;  3D7H A;  1JQG A;  4A37 A;  4OIW A;  4C9A A;  5LRJ A;  2ZEE A;  2V8D A;  1LCP A;  5LYD A;  5LYL A;  1XBU A;  4R8F A;  2V77 A;  4MRI A;  3D66 A;  4DUK A;  2AFX A;  4P44 A;  2IQ6 A;  1XF1 A;  5LRK A;  4K3N A;  1PYT B;  3QNV A;  2BOA A;  2AFM A;  1Z8L A;  3KHX A;  1BLL E;  4UF4 A;  3KZW A;  3H8E A;  4NGT A;  3EIF A;  3KI9 A;  3PB8 X;  3NFZ A;  3FVL A;  3TX8 A;  5J1Q A;  1TKH A;  3KGQ A;  4EFD A;  2HB6 A;  3IIB A;  4MCS A;  3PB7 X;  5DS0 A;  3D4U A;  4P4D A;  1CPX A;  4WWV A;  4C8C A;  3NH4 A;  4OC4 A;  3IO1 A;  4ZI6 A;  2OR4 A;  3LWU A;  2AFU A;  5JH9 A;  3CPA A;  4NGN A;  1LFW A;  3NH5 A;  4C84 A;  3VAR A;  2V8V A;  3S9N A;  3GLJ A;  3I1U A;  3IC1 A;  4A94 A;  4MCQ A;  2ZEG A;  4C9E A;  3WT4 A;  4MHN A;  4TWE A;  1Y0R A;  1Z2L A;  5K8P A;  2Q51 A;  1CBX A;  5LRG A;  4P4B A;  1CG2 A;  2CF4 A;  2ZED A;  7CPA A;  4X8I A;  4NFR A;  1ZG8 A;  4OC0 A;  1R43 A;  4W9Y A;  3BXM A;  3FEC A;  4ONW A;  2PVW A;  5HVG A;  4OME A;  1CP7 A;  3B3S A;  1YW6 A;  3D67 A;  2GRE A;  4TJV A;  2Q4Z A;  3KQX A;  3MRU A;  1ZG9 A;  3BI0 A;  1QMU A;  4C8F A;  1Y9Z A;  3HLP A;  4DYO A;  5ELY A;  4ZX8 A;  3D7F A;  2DEA A;  3B7I A;  4C9U A;  2RB7 A;  3S9M A;  1CP6 A;  2Q43 A;  4C8U A;  3WC5 A;  3V7Z A;  3CPX A;  1ARL A;  3GUX A;  4R76 A;  2F7V A;  3B2Y A;  1TKJ A;  3B35 A;  2WYR A;  2J9A A;  1XJO A;  3PRT A;  2VL1 A;  3ISX A;  3JRU A;  4PXE A;  4UEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...