2CIJA

Membrane-bound glutamate carboxypeptidase ii (gcpii) with bound methionine
Total Genus 244
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
244
sequence length
694
structure length
687
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
publication title Glutamate Carboxypeptidase II
rcsb
source organism Homo sapiens
total genus 244
structure length 687
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2cijA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2cijA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2cijA02
2Q51A 3B3WA 4P4BA 1IY7A 1Q7LA 3DGVA 3PB4X 3IFEA 4OP4A 3SJFA 1YSJA 4P45A 4C9EA 5JGFA 2ABZA 3D67A 4CPAA 1UWYA 2V8HA 1LANA 2VL1A 4MMOA 1VHEA 4YWYA 1HDQA 3B35A 4OC1A 3JRUA 2PJ9A 3S9LA 1CP6A 2GLJA 2AFXA 1LFWA 3KASA 4MRIA 1F2OA 4P6YA 4C9AA 3B3CA 1TKHA 3KHXA 3KQZA 2FVGA 1XMBA 4MHNA 4EWTA 2PVVA 1LAMA 3I74A 3K2KA 2GLFA 2CIJA 5CPAA 4LQGA 2XEIA 2EK9A 2GU2A 2EWBA 2JBKA 5LRGA 1XRYA 4C8PA 2PJ0A 3HLPA 3BI0A 2PJCA 4TJVA 3PFOA 7CPAA 5LYDA 3IIBA 3SJGA 2AFMA 3TC8A 5K8NA 4P4DA 1DE4C 4ZX9A 4RUHA 4NGMA 4O23A 3PEIA 3VARA 4DUKA 2XEFA 4F8ZA 5LYIA 2PJ3A 2IMOA 2PJ7A 2IQ6A 3KI9A 1HDUA 2BCOA 4TWEA 2POKA 4ZY2A 3D66A 3CT9A 2JBJA 3SJXA 1YMEA 1ZLHA 2PJAA 2ZEEA 2PJ6A 3GB0A 1DTDA 4JYWA 3FVLA 3VATA 2V8GA 2JEWA 4EMEA 4OC5A 2F8HA 2C1CA 3FF3A 1TF9A 3MN8A 3PB9X 3RBUA 4KNGE 3H8FA 4OC3A 1Y7EA 5D29A 4C99A 4NGNA 1WVMA 3KZWA 2PIZA 5HVFA 2Q4ZA 3K9TA 3IWWA 1YW6A 4IAVA 4NGRA 1PYTB 2ANPA 5K8MA 4C8AA 4P10A 1BPNA 3LWUA 1YLOA 4X3RA 3FMCA 4R76A 3WC6A 2RB7A 3SJEA 5LRJA 2CTCA 1CX8A 3MRUA 5LYLA 1ELMP 4MHPA 3BI1A 4OMEA 1F2PA 2ZEOA 1FNOA 4MXUA 4UEFA 3PFEA 3V38A 3S9NA 1XBUA 5CBMA 4MHZA 4H2KA 3HUVA 2OOTA 1ZG9A 4MCPA 4NGTA 2ZOFA 4FBEA 4Z65A 4OC2A 1Y0RA 2AFZA 3BXMA 1CPSA 1TKFA 4DYOA 3VTAA 1ZG8A 2AFUA 2PE3A 2I3CA 4CDKA 2BOAA 3D7FA 3WC7A 5THWA 2AFSA 2IJZA 4G1PA 4A37A 3FX6A 1QMUA 4MCQA 2EK8A 3ISXA 3KR4A 4NFRA 3V7ZA 4DJLA 4OC0A 4C9UA 2G9DA 4NJQA 1BPMA 3QNVA 3IJ3A 4WWVA 3B3SA 2AFWA 1BLLE 2O4HA 4F9VA 3D7GA 1YW4A 4YU9A 4X2TA 3I6SA 1CP7A 4P44A 1HEEA 2PJ4A 3NFZA 5LRKA 4NGQA 4ZYQA 1ZG7A 2BO9A 1PCAA 4WJBA 4C84A 3EIFA 4FUUA 2C6GA 3NA6A 2WZNA 5LYFA 2ZEMA 2GREA 3CDXA 4PPZA 3D4UA 1CBXA 3RZAA 3NH8A 4OIWA 4UF4A 5HXDA 2C6CA 3IO1A 3FEDA 2PRQA 3WT4A 2J9AA 1VHOA 3I1UA 3KQXA 2DEAA 1AYEA 3KR5A 4P4JA 3FJUA 2PCUA 1R43A 3KHZA 1CG2A 4K3NA 6CPAA 4X8IA 1XF1A 3PB6X 4OIDA 2PVWA 4UEZA 5JM6A 2ZEHA 1Z5RA 4MCSA 4B6ZA 1BAVA 3B3VA 1RTQA 2CTBA 3DLJA 4CDJA 5HVHA 4NGSA 3KL9A 1V6CA 1Y9ZA 3GLJA 4A38A 3FH4A 3S9MA 4FAIA 3ICUA 1XJOA 2QVPA 5ELYA 2O53A 2OR4A 3D68A 4FWUA 3PB7X 1Z8LA 1Y0YA 4C8UA 1FT7A 3PRTA 1NSAA 4OC4A 4UEEA 2RFHA 4C86A 1F57A 3D7HA 1CPXA 2AFOA 3NH5A 1Z2LA 3WC5A 1ZLIA 1GYTA 1TXRA 2XEGA 1ARLA 4AXVA 2NYQA 3B3TA 5I4MA 3TX8A 2CF4A 3LMSA 2XEJA 1VGYA 3IEHA 5HVGA 4MCRA 3VH9A 3B7IA 1EE3P 2PJ2A 1AMPA 4W9YA 1LOKA 3FECA 1H8LA 1LCPA 3T8WA 4ZY0A 4ZY1A 4A94A 4C85A 4ZI6A 3PBBA 4R7MA 5K8PA 2NSMA 4YN3A 1KWMA 2ZENA 2V8VA 1XFOA 3ISZA 3BHXA 2QJ8A 3H8GA 4GM5A 2C6PA 4PXEA 2V77A 4TNUA 3RAMA 5DS0A 3L2NA 4EFDA 4PXDA 4JZ0A 2ZEPA 1QQ9A 2HC9A 4P4EA 4C8TA 4IHMA 4UIAA 2ZEDA 4UIBA 3PBEA 4C9RA 1VIXA 3FEEA 4IK2A 5D8NA 3D7DA 1R3NA 4F9UA 5K8OA 2Q43A 4KSIA 4C8FA 3PB8X 5J1QA 4C8CA 1OBRA 4A39A 3SI0A 1ARMA 4R8FA 5IB9A 4Q7AA 3N5FA 3IC1A 3WABA 2PJ1A 3CPAA 1M4LA 2QYVA 3CPXA 1TKJA 5F09A 4PXBA 4OKOA 4PQAA 2ZEFA 3SI1A 2ZOGA 2V8DA 2ZELA 4PXCA 4NGPA 2ZEGA 1TF8A 3SI2A 2PIYA 5JH9A 4MHYA 1LAPA 4ZX8A 2PJ5A 8CPAA 3KGQA 1ELLP 2PJ8A 2WYRA 3B2YA 3GUXA 3H8EA 3NH4A 4NJRA 4P4FA 4P4IA 1JQGA 2F7VA 4R6TA 4BD9A 4C9VA 1IGBA 2PJBA 4ONWA 4TJXA 2HB6A
chains in the Genus database with same CATH superfamily
2Q51A 3B3WA 4P4BA 1IY7A 1Q7LA 1UFHA 3DGVA 1BXRB 3PB4X 5EC4A 3IFEA 4OP4A 1PU9A 5EBVA 3SJFA 1KUYA 4CGLA 3TLBA 1YSJA 4P45A 2YNDA 3TLGA 5JGFA 4C9EA 1IIDA 2ABZA 3D67A 3ZNIA 4ZBGA 4CPAA 1UWYA 2V8HA 1LANA 2VL1A 4B11A 3T05A 4COGA 4MMOA 4UCNA 2BEIA 5GCNA 1VHEA 4YWYA 3TO6A 4E5SA 2R8VA 4C2ZA 3F9KC 1HDQA 5F9MA 4AB7A 4B10A 3JUWA 4QVTA 4GXHA 2Y0MA 3B35A 4OC1A 3JRUA 2PJ9A 3S9LA 1CP6A 1XEBA 4KORA 3TYXA 1QSRA 4CO9A 2GLJA 2AFXA 5A27A 1LFWA 1WK4A 3KASA 5IR2A 4MRIA 1F2OA 2Q7SA 3UY5A 4P6YA 2JLMA 3N7ZA 3BUOB 5DWNA 2HROA 4C9AA 5K99A 3IWEA 1NMTA 3B3CA 4U9ZA 5F13A 2WUUA 3ZZIA 2E28A 1TKHA 4Q38A 3KHXA 3KQZA 5F47A 2EZBA 2CNMA 2B5GB 2FVGA 1XMBA 4UCMA 4MHNA 4EWTA 2PVVA 1LAMA 3I74A 3K2KA 3HPHE 5IX3A 3S6HA 2GLFA 2CIJA 5CPAA 4LQGA 5HKYA 4KZTA 2XEIA 2FIAA 3FRMA 2EK9A 4E0AA 4JD6A 2GU2A 2EWBA 4H89A 1M6VB 4MJXA 4Y49B 1RXTA 2JBKA 5LRGA 2B4DA 4MFLA 1XRYA 4RI1A 4CGOA 1IOIA 3G23A 2PJ0A 3HLPA 3KKWA 3BI0A 4M6HA 2PJCA 1EZAA 1P4NA 1BOBA 4TJVA 3EFAA 3T90A 1XF8A 3PFOA 7CPAA 3NFQA 2EZAA 5F49A 5LYDA 3IIBA 3SJGA 1M4GA 2AFMA 2G0BA 3GY9A 1M4IA 1S7NA 4FD7A 4CYPA 5JVLA 3D8PA 4B5PA 1CE8B 3TC8A 4F6AA 5K8NA 1CJWA 1R61A 5AG6A 4P4DA 2HUZA 1DE4C 4ZX9A 4RUHA 2AUMA 4NGMA 4MFZA 4O23A 1M4DA 3PEIA 3VARA 2VBQA 3W6XA 3VROA 4KLWA 2YNCC 4JXRA 2DPTA 2Y1MA 4DUKA 2XEFA 1S7KA 4F8ZA 5LYIA 4UWIA 2R82A 2PJ3A 2IMOA 1EO0A 2PJ7A 2OZUA 2IQ6A 5H86A 3KI9A 3OWCA 4GS4A 1ZYMA 4YGOA 1HDUA 2DIKA 2BCOA 4TWEA 2POKA 4ZY2A 3EZBA 4KVME 4EYSA 2D0PA 3GJZA 3D66A 3CT9A 2JBJA 4BPXB 3SJXA 1P0HA 1YMEA 1ZLHA 3BLNA 4KVXA 4ZGYB 2PJAA 2ZEEA 3R9GA 2PJ6A 1JDBC 2H5MA 3GB0A 3EO4A 1DTDA 2YNEA 3FYNA 4JYWA 1B87A 3FVLA 4KOUA 4C2XA 3VATA 1R57A 2V8GA 2JEWA 4EMEA 3NOJA 4OC5A 2F8HA 4C2YA 3WC7A 1IU8A 2C1CA 3FF3A 3TE4A 3GYAA 1TF9A 1XMTA 3MN8A 4IUSA 3PB9X 4OLLA 3RBUA 2YJTA 3DSBA 4EVYA 4KNGE 3H8FA 4OC3A 1Y7EA 1YX0A 3FIXA 2Q7BA 5D29A 3RNZA 4ONUA 1C30B 4H1HA 3BUWB 4C99A 3BJ8A 4NGNA 2B3VA 2HWGA 1WVMA 1K4JA 3JVNA 3C26A 4R3LA 3T9YA 1MJ9A 2R98A 4FD6A 2X0SA 3KZWA 2PIZA 5HVFA 1Z9EA 2Q4ZA 3K9TA 5F1YA 3R96A 4JLYA 4MFKA 2FXFA 1AUGA 1C3OB 3IWWA 4R3KA 1YW6A 4IAVA 3TOAA 1YVOA 5G20A 4NGRA 1PYTB 1LRZA 2ANPA 4AVCA 2CNSA 5K8MA 4C8AA 1KZFA 2OU2A 3G8WA 4CS0B 3HMJG 4A4BA 2AE6A 4CGNA 2C5QA 5AXIA 4P10A 3OAKA 1BPNA 4JJXA 5F46A 1VKCA 3LWUA 4HNYB 3FNCA 2YGWA 1YLOA 3IU2A 4R87A 5A28A 4HNXB 4AG7A 4X3RA 3FMCA 4R76A 4UFVA 2FSRA 1YK3A 3WC6A 2RB7A 4BBHA 3SJEA 2VI7A 3VWDA 5LRJA 5C88A 1NSLA 1B6BA 2CTCA 1CX8A 1X10A 1JDEA 3S6FA 3KRVA 3BUXB 3VRQA 2OB0A 3MRUA 1CM0A 5LYLA 1ELMP 2I79A 4MHPA 3BI1A 4OMEA 3B8GA 5HH1A 3W91A 3C8OA 5ISVA 1Z8XA 1F2PA 2ZEOA 5FVJA 1FNOA 4MXUA 3TLAA 4UEFA 3PFEA 3V38A 3U88C 4A32A 3S9NA 1XBUA 3S6GA 5CBMA 1ON0A 1A2ZA 3IGRA 4KUBA 4MHZA 5EMIA 4B14A 4HPSA 4C7IA 3TFYA 5J8CA 5G22A 5JYBA 4QB9A 3U1BA 2VZZA 4AG9A 4H2KA 3HUVA 3G3SA 4JXQA 1EZBA 3QAHA 2Q44A 2OOTA 1ZG9A 4MCPA 4NGTA 2ZOFA 4M6IA 4GPLB 3I9SA 4UBRA 4FBEA 4NSQA 4XPDB 2Q4YA 1WJTA 4OC2A 4Z65A 1T36B 4PV6A 4RS2A 3H5ZA 1Y0RA 2AFZA 4KOSA 3BXMA 1CPSA 2I00A 4KOYA 3SXNA 1TKFA 5BWAB 4IIXA 4DYOA 3VTAA 4H6UA 1ZG8A 2J8RA 5DWMA 2FM4A 2AFUA 2PE3A 2I3CA 5C82A 4CDKA 4XPDC 2BOAA 3D7FA 2GIVA 2EBJA 3S6KA 5THWA 1Z4EA 3OB1B 2BSWA 1KUXA 2AFSA 2HV2A 2IJZA 2F5IA 2ARHA 4G1PA 4A37A 3TLYA 2ODFA 4L8AA 3FX6A 3F0AA 3EC4A 1QMUA 2PRBA 2JDCA 5G1ZA 4MCQA 2EK8A 3ISXA 2FS5A 3KR4A 4NFRA 2GFQA 3V7ZA 4DJLA 1GGOA 4C7HA 2G3TA 4OC0A 3RYOA 4B13A 2G9DA 4C9UA 1VBHA 4INJA 4NJQA 4KUAA 1BPMA 2NMTA 3QNVA 4CRYB 3IJ3A 4WWVA 1N71A 1NBWA 3B3SA 2AFWA 3T07A 1BLLE 2O4HA 2CY2A 3D7GA 1YW4A 2HQYA 2Z3PA 4X2TA 4YU9A 4EFDA 5HKWA 4F9VA 3I6SA 3O8ZA 1CP7A 1S7FA 2FT0A 4P44A 1HEEA 2OH1A 4CAVA 3T0TA 1L0CA 2GE3A 2PJ4A 3NFZA 4J3GA 1JWQA 4PSWA 5LRKA 1CS0B 3GIUA 3CXSA 3T5MA 1SQHA 1YLEA 4NGQA 4ZYQA 1ZG7A 1PCAA 2B5GA 2BO9A 2ZPAA 1Z8WA 4WJBA 4HNWB 3EIFA 4C84A 4FUUA 2B4JC 2C6GA 3NA6A 2K5TA 1S3ZA 1WWZA 3K9UA 3VRRA 2KCWA 2JDDA 2WZNA 3WR7A 5H84A 5LYFA 3SR3A 2DPSA 3R95A 4B12A 1Y7RA 2ZEMA 4NXYA 2GREA 3CDXA 3TCVA 4PPZA 3D4UA 4R9MA 3R9EA 4A2ZA 1ZO0A 1CBXA 4XNHC 4MI4A 3RZAA 2WPWA 2D4PA 3TLEA 3K4IA 1IICA 2ZW6A 4JVOA 4UFWA 3NH8A 1VI4A 1S5KA 2EVNA 2A4NA 3IWGA 4OIWA 2PR1A 1YVHA 4UF4A 5HXDA 4CDJA 4MFQA 2C6CA 3IO1A 3FEDA 4MJ8A 1X12A 1Q2CA 2PRQA 4PK3A 5CNPA 4HKFA 3WT4A 2J9AA 1VHOA 3I1UA 3KQXA 2DEAA 2XPLA 1Q2YA 1AYEA 1Y9WA 2YNCA 2P6EA 3KR5A 4P4JA 2VEZA 2P6GA 4COBA 3FJUA 2PCUA 4CGPA 1MJAA 1R43A 3CXQA 4U5YA 3KHZA 1CG2A 3D2MA 4K3NA 1I12A 3VWEA 3R1KA 4X8IA 6CPAA 1QSTA 1XF1A 2MP0A 3VRNA 3PB6X 5KTDA 3LODA 4CYNA 2RC4A 4OIDA 2PVWA 2AJ6A 4UEZA 2ZEHA 4M3SA 5JM6A 4X5KA 1Z5RA 4PK2A 1NE9A 1Z8TA 4Q36A 4MCSA 2EO8A 2CBLA 3DDDA 4A95A 4B6ZA 4CYQA 4II9A 4C8PA 1BAVA 4H6ZA 2B4BA 3B3VA 4MI1A 1RTQA 2DXQA 3PFVA 4F0YA 2D4OA 2CTBA 4BTFA 4OAEA 1BO4A 3DLJA 3LACA 3LD2A 5HVHA 2PSWA 4NGSA 3KL9A 4KS9A 1V6CA 1VHSA 4KOTA 4M85A 1Y9ZA 3GLJA 4QUSA 4OADA 4RR2B 4A38A 3FH4A 2OZHA 3S9MA 3VRPA 4NCZA 2BL1A 4FAIA 5KTCA 3ICUA 1XJOA 2QVPA 5ELYA 2O53A 2OR4A 3D68A 1XOVA 3DR8A 3PB7X 4FWUA 3JTKA 3FBUA 3SHPA 1Z8LA 1Y0YA 4ORFA 4UA3A 1U6MA 1FT7A 4C8UA 4E94A 3PRTA 1YR0A 3W6SA 1NSAA 4OC4A 4UEEA 2RFHA 1A9XB 4R57A 4C86A 1KC7A 1F57A 2D0OA 4KOVA 4F0XA 5J3XA 1KUVA 1YREA 4E2AA 3D7HA 5AG5A 1CPXA 2AFOA 4KVOE 3NH5A 3FB3A 3D2PA 4YRHA 1Z2LA 4AVAA 2WSAA 3WC5A 1ZLIA 1GYTA 3P2HA 2XPPA 1ZL0A 1TXRA 3SXOA 2XEGA 1ARLA 4AXVA 2NYQA 3B3TA 1YVKA 5AGEA 1DIKA 3OB2B 1MK4A 2Z11A 3TLGB 2B4DB 2ZW5A 5I4MA 3TX8A 4A31A 3OP0A 2HI6A 2QIRA 4AVBA 4CZ1A 2CF4A 1S60A 2VZYA 2Z3OA 4A4CA 3LMSA 1FBVA 2XEJA 1VGYA 2REEA 3BUMB 3IEHA 5HVGA 2UV8G 4BPUB 2CXAA 4MCRA 3VH9A 3FXTA 4B5PB 3TTHA 3B7IA 4K30A 1J4JA 2VQYA 3F8KA 1EE3P 2PR8A 2R1IA 2PJ2A 3PZJA 2P0WA 1AMPA 4W9YA 3TT2A 2PCNA 4LQ6A 2QECA 2Z10A 1LOKA 4M6GA 2FIWA 3FECA 1H8LA 1LCPA 3T8WA 4ZY0A 4CAWA 2O28A 4B5OA 4ZY1A 4NF1A 4A94A 3TLCA 5J8FA 4XPLA 3R9FA 4XPKA 4C85A 4ZI6A 3PBBA 3BUNB 4R7MA 5K8PA 3EXNA 2NSMA 4YN3A 1ZRSA 3EZEA 1OZPA 1KWMA 4CGMA 2VKZG 2PC1A 2ZENA 1PUAA 2DF5A 2ATRA 2Y1NA 1B47A 1FY7A 5BY0A 2V8VA 1XFOA 5F5XA 4A33A 3ISZA 3HPGG 3BHXA 2PDOA 2B0AA 2QJ8A 3H8GA 2ZXVA 4GM5A 3I3GA 2C6PA 4IF5A 5F48A 2BUEA 2XPNA 4KSFA 4PXEA 2V77A 2WPXA 4TNUA 3RAMA 5JPHA 5DS0A 3L2NA 2ZW7A 4FD5A 4KOXA 1Y9KA 4JZ0A 3PGPA 2ZEPA 2XPOA 3DR6A 4PXDA 1I1DA 4C68A 1M44A 1QQ9A 4CAFA 2HC9A 4BMHA 4P4EA 4C8TA 4IHMA 4UIAA 2ZEDA 4UIBA 4I49A 4XNHB 3PBEA 4Y49C 4CAXA 4C9RA 1Q5XA 1VIXA 5E96A 3FEEA 2B3UA 2C27A 1TIQA 3A9LA 4MY3A 4IK2A 2J8NA 3BJ7A 2Z3KA 3TO7A 3D3SA 1M1DA 4CAEA 3TLZA 2Z3LA 3DNSA 3QB8A 4MY0A 2FL4A 5D8NA 3D7DA 1R3NA 4F9UA 3PP9A 2G3AA 1QSNA 5K8OA 2GANA 2IL4A 2Q43A 4A30A 4KSIA 4C8FA 2DLAA 1QSOA 3PB8X 4QBJA 5J1QA 2Z3MA 1RO5A 4C8CA 5HKZA 5IB0A 1OBRA 3RO0A 4A39A 2B58A 2QMLA 2Z0ZA 3SI0A 1ARMA 4QC6A 3P2FA 4LUAA 2REFA 4R8FA 1VBGA 4BPWB 5IB9A 4E8OA 2N3AB 1IOFA 1Z9UA 4Q7AA 3N5FA 2GP4A 2VXKA 1GHEA 4RN7A 3MGDA 2PQ8A 1IYLA 5IV0A 4UWJA 3IC1A 5AG7A 1V0CA 3F5BA 3H4QA 2X7BA 3WABA 3PLFB 4KOWA 4U9YA 4MBUA 5HMNA 1IYKA 2FE7A 2PJ1A 3CPAA 4J0NA 2JEVA 1KEEB 1M4LA 2QYVA 3CPXA 2CNTA 2Q4VA 2Q04A 2FCKA 1TKJA 1Z4RA 2YJVA 4UCPA 2J8MA 5F09A 4PXBA 4OKOA 3E0KA 2OZGA 4PQAA 2OLSA 3EY5A 1YGHA 2ZEFA 4KLVA 1Q2DA 3SI1A 4UFXA 2ZOGA 1YQEA 2V8DA 2ZELA 3NE8A 4PXCA 4NGPA 1XIXA 2ZEGA 5KTAA 1TF8A 1KBLA 4IIYA 3SI2A 2PIYA 4DNCA 5JH9A 5FD8A 3V8IA 3GKRA 4MHYA 1I21A 1LAPA 4MHDA 2AUNA 4ZX8A 2PJ5A 3ZJ0A 4BINA 3TO9A 8CPAA 1J3LA 4M8DA 3KGQA 5G21A 4CYOA 1ELLP 2PJ8A 2WYRA 3B2YA 3GUXA 4YFJA 1NXJA 1QSMA 2Z3NA 2P6FA 4L89A 3H8EA 3NH4A 3NE7A 3VGOA 1IB1E 4KSAA 3TOBA 4CRZB 5AG4A 3EZAA 4NJRA 3IU1A 2ZW4A 4MFJA 3CXPA 4P4FA 4P4IA 1JQGA 2F7VA 4LX9A 4R6TA 4BD9A 4C9VA 2R7HA 1IGBA 4JWPA 2PJBA 5I0CA 3CZXA 2EUIA 2EZCA 3QAYA 4MFPA 1MJBA 5JQ4A 3PT1A 4FD4A 4ONWA 4TJXA 1XE4A 2HB6A 4NEXA 2Q0YA 1S7LA 4PSXA
chains in the Genus database with same CATH topology
2Q51A 3B3WA 4P4BA 1IY7A 1Q7LA 3DGVA 3PB4X 3IFEA 4OP4A 3SJFA 1YSJA 4P45A 4C9EA 5JGFA 2ABZA 3D67A 4CPAA 1UWYA 2V8HA 1LANA 2VL1A 4MMOA 1VHEA 4YWYA 1HDQA 3B35A 4OC1A 3JRUA 2PJ9A 3S9LA 1CP6A 2GLJA 2AFXA 1LFWA 3KASA 5IR2A 4MRIA 1F2OA 4P6YA 4C9AA 3B3CA 1TKHA 3KHXA 3KQZA 2FVGA 1XMBA 4MHNA 4EWTA 2PVVA 1LAMA 3I74A 3K2KA 2GLFA 2CIJA 5CPAA 4LQGA 2XEIA 2EK9A 2GU2A 2EWBA 2JBKA 5LRGA 1XRYA 4C8PA 2PJ0A 3HLPA 3BI0A 2PJCA 4TJVA 3PFOA 7CPAA 5LYDA 3IIBA 3SJGA 2AFMA 3TC8A 5K8NA 4P4DA 1DE4C 4ZX9A 4RUHA 4NGMA 4O23A 3PEIA 3VARA 4DUKA 2XEFA 4F8ZA 5LYIA 2PJ3A 2IMOA 2PJ7A 2IQ6A 3KI9A 1HDUA 2BCOA 4TWEA 2POKA 4ZY2A 3D66A 3CT9A 2JBJA 3SJXA 1YMEA 1ZLHA 2PJAA 2ZEEA 2PJ6A 3GB0A 1DTDA 4JYWA 3FVLA 3VATA 2V8GA 2JEWA 4EMEA 4OC5A 2F8HA 2C1CA 3FF3A 1TF9A 3MN8A 3PB9X 3RBUA 4KNGE 3H8FA 4OC3A 1Y7EA 5D29A 4C99A 4NGNA 1WVMA 3KZWA 2PIZA 5HVFA 2Q4ZA 3K9TA 3IWWA 1YW6A 4IAVA 4NGRA 1PYTB 2ANPA 5K8MA 4C8AA 2C5QA 4P10A 1BPNA 3LWUA 1YLOA 4X3RA 3FMCA 4R76A 3WC6A 2RB7A 3SJEA 5LRJA 2CTCA 1CX8A 3MRUA 5LYLA 1ELMP 4MHPA 3BI1A 4OMEA 1F2PA 2ZEOA 1FNOA 4MXUA 4UEFA 3PFEA 3V38A 3S9NA 1XBUA 5CBMA 4MHZA 4H2KA 3HUVA 2OOTA 1ZG9A 4MCPA 4NGTA 2ZOFA 4FBEA 4Z65A 4OC2A 1Y0RA 2AFZA 3BXMA 1CPSA 1TKFA 4DYOA 3VTAA 1ZG8A 2AFUA 2PE3A 2I3CA 4CDKA 2BOAA 3D7FA 3WC7A 5THWA 2AFSA 2IJZA 4G1PA 4A37A 3FX6A 1QMUA 4MCQA 2EK8A 3ISXA 3KR4A 4NFRA 3V7ZA 4DJLA 4OC0A 4C9UA 2G9DA 4NJQA 1BPMA 3QNVA 3IJ3A 4WWVA 3B3SA 2AFWA 1BLLE 2O4HA 4F9VA 3D7GA 1YW4A 4YU9A 4X2TA 3I6SA 1CP7A 4P44A 1HEEA 2PJ4A 3NFZA 5LRKA 4NGQA 4ZYQA 1ZG7A 2BO9A 1PCAA 4WJBA 4C84A 3EIFA 4FUUA 2C6GA 3NA6A 2WZNA 5LYFA 2ZEMA 2GREA 3CDXA 4PPZA 3D4UA 1CBXA 3RZAA 3NH8A 4OIWA 4UF4A 5HXDA 2C6CA 3IO1A 3FEDA 2PRQA 3WT4A 2J9AA 1VHOA 3I1UA 3KQXA 2DEAA 1AYEA 3KR5A 4P4JA 3FJUA 2PCUA 1R43A 3KHZA 1CG2A 4K3NA 6CPAA 4X8IA 1XF1A 3PB6X 4OIDA 2PVWA 4UEZA 5JM6A 2ZEHA 1Z5RA 4MCSA 4B6ZA 1BAVA 3B3VA 1RTQA 2CTBA 3DLJA 4CDJA 5HVHA 4NGSA 3KL9A 1V6CA 1Y9ZA 3GLJA 4A38A 3FH4A 3S9MA 4FAIA 3ICUA 1XJOA 2QVPA 5ELYA 2O53A 2OR4A 3D68A 4FWUA 3PB7X 1Z8LA 1Y0YA 4C8UA 1FT7A 3PRTA 1NSAA 4OC4A 4UEEA 2RFHA 4C86A 1F57A 3D7HA 1CPXA 2AFOA 3NH5A 1Z2LA 3WC5A 1ZLIA 1GYTA 1TXRA 2XEGA 1ARLA 4AXVA 2NYQA 3B3TA 5I4MA 3TX8A 2CF4A 3LMSA 2XEJA 1VGYA 3IEHA 5HVGA 4MCRA 3VH9A 3B7IA 1EE3P 2PJ2A 1AMPA 4W9YA 1LOKA 3FECA 1H8LA 1LCPA 3T8WA 4ZY0A 4ZY1A 4A94A 4C85A 4ZI6A 3PBBA 4R7MA 5K8PA 2NSMA 4YN3A 1KWMA 2ZENA 2V8VA 1XFOA 3ISZA 3BHXA 2QJ8A 3H8GA 4GM5A 2C6PA 4PXEA 2V77A 4TNUA 3RAMA 5DS0A 3L2NA 4EFDA 4PXDA 4JZ0A 2ZEPA 1QQ9A 2HC9A 4P4EA 4C8TA 4IHMA 4UIAA 2ZEDA 4UIBA 3PBEA 4C9RA 1VIXA 3FEEA 4IK2A 5D8NA 3D7DA 1R3NA 4F9UA 5K8OA 2Q43A 4KSIA 4C8FA 3PB8X 5J1QA 4C8CA 1OBRA 4A39A 3SI0A 1ARMA 4R8FA 5IB9A 4Q7AA 3N5FA 2GP4A 3IC1A 3WABA 2PJ1A 3CPAA 1M4LA 2QYVA 3CPXA 1TKJA 5F09A 4PXBA 4OKOA 4PQAA 2ZEFA 3SI1A 2ZOGA 2V8DA 2ZELA 4PXCA 4NGPA 2ZEGA 1TF8A 3SI2A 2PIYA 5JH9A 4MHYA 1LAPA 4ZX8A 2PJ5A 8CPAA 3KGQA 1ELLP 2PJ8A 2WYRA 3B2YA 3GUXA 3H8EA 3NH4A 4NJRA 4P4FA 4P4IA 1JQGA 2F7VA 4R6TA 4BD9A 4C9VA 1IGBA 2PJBA 4ONWA 4TJXA 2HB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q51 A;  3B3W A;  4P4B A;  1IY7 A;  1Q7L A;  3DGV A;  3PB4 X;  3IFE A;  4OP4 A;  3SJF A;  1YSJ A;  4P45 A;  4C9E A;  5JGF A;  2ABZ A;  3D67 A;  4CPA A;  1UWY A;  2V8H A;  1LAN A;  2VL1 A;  4MMO A;  1VHE A;  4YWY A;  1HDQ A;  3B35 A;  4OC1 A;  3JRU A;  2PJ9 A;  3S9L A;  1CP6 A;  2GLJ A;  2AFX A;  1LFW A;  3KAS A;  4MRI A;  1F2O A;  4P6Y A;  4C9A A;  3B3C A;  1TKH A;  3KHX A;  3KQZ A;  2FVG A;  1XMB A;  4MHN A;  4EWT A;  2PVV A;  1LAM A;  3I74 A;  3K2K A;  2GLF A;  2CIJ A;  5CPA A;  4LQG A;  2XEI A;  2EK9 A;  2GU2 A;  2EWB A;  2JBK A;  5LRG A;  1XRY A;  4C8P A;  2PJ0 A;  3HLP A;  3BI0 A;  2PJC A;  4TJV A;  3PFO A;  7CPA A;  5LYD A;  3IIB A;  3SJG A;  2AFM A;  3TC8 A;  5K8N A;  4P4D A;  1DE4 C;  4ZX9 A;  4RUH A;  4NGM A;  4O23 A;  3PEI A;  3VAR A;  4DUK A;  2XEF A;  4F8Z A;  5LYI A;  2PJ3 A;  2IMO A;  2PJ7 A;  2IQ6 A;  3KI9 A;  1HDU A;  2BCO A;  4TWE A;  2POK A;  4ZY2 A;  3D66 A;  3CT9 A;  2JBJ A;  3SJX A;  1YME A;  1ZLH A;  2PJA A;  2ZEE A;  2PJ6 A;  3GB0 A;  1DTD A;  4JYW A;  3FVL A;  3VAT A;  2V8G A;  2JEW A;  4EME A;  4OC5 A;  2F8H A;  2C1C A;  3FF3 A;  1TF9 A;  3MN8 A;  3PB9 X;  3RBU A;  4KNG E;  3H8F A;  4OC3 A;  1Y7E A;  5D29 A;  4C99 A;  4NGN A;  1WVM A;  3KZW A;  2PIZ A;  5HVF A;  2Q4Z A;  3K9T A;  3IWW A;  1YW6 A;  4IAV A;  4NGR A;  1PYT B;  2ANP A;  5K8M A;  4C8A A;  4P10 A;  1BPN A;  3LWU A;  1YLO A;  4X3R A;  3FMC A;  4R76 A;  3WC6 A;  2RB7 A;  3SJE A;  5LRJ A;  2CTC A;  1CX8 A;  3MRU A;  5LYL A;  1ELM P;  4MHP A;  3BI1 A;  4OME A;  1F2P A;  2ZEO A;  1FNO A;  4MXU A;  4UEF A;  3PFE A;  3V38 A;  3S9N A;  1XBU A;  5CBM A;  4MHZ A;  4H2K A;  3HUV A;  2OOT A;  1ZG9 A;  4MCP A;  4NGT A;  2ZOF A;  4FBE A;  4Z65 A;  4OC2 A;  1Y0R A;  2AFZ A;  3BXM A;  1CPS A;  1TKF A;  4DYO A;  3VTA A;  1ZG8 A;  2AFU A;  2PE3 A;  2I3C A;  4CDK A;  2BOA A;  3D7F A;  3WC7 A;  5THW A;  2AFS A;  2IJZ A;  4G1P A;  4A37 A;  3FX6 A;  1QMU A;  4MCQ A;  2EK8 A;  3ISX A;  3KR4 A;  4NFR A;  3V7Z A;  4DJL A;  4OC0 A;  4C9U A;  2G9D A;  4NJQ A;  1BPM A;  3QNV A;  3IJ3 A;  4WWV A;  3B3S A;  2AFW A;  1BLL E;  2O4H A;  4F9V A;  3D7G A;  1YW4 A;  4YU9 A;  4X2T A;  3I6S A;  1CP7 A;  4P44 A;  1HEE A;  2PJ4 A;  3NFZ A;  5LRK A;  4NGQ A;  4ZYQ A;  1ZG7 A;  2BO9 A;  1PCA A;  4WJB A;  4C84 A;  3EIF A;  4FUU A;  2C6G A;  3NA6 A;  2WZN A;  5LYF A;  2ZEM A;  2GRE A;  3CDX A;  4PPZ A;  3D4U A;  1CBX A;  3RZA A;  3NH8 A;  4OIW A;  4UF4 A;  5HXD A;  2C6C A;  3IO1 A;  3FED A;  2PRQ A;  3WT4 A;  2J9A A;  1VHO A;  3I1U A;  3KQX A;  2DEA A;  1AYE A;  3KR5 A;  4P4J A;  3FJU A;  2PCU A;  1R43 A;  3KHZ A;  1CG2 A;  4K3N A;  6CPA A;  4X8I A;  1XF1 A;  3PB6 X;  4OID A;  2PVW A;  4UEZ A;  5JM6 A;  2ZEH A;  1Z5R A;  4MCS A;  4B6Z A;  1BAV A;  3B3V A;  1RTQ A;  2CTB A;  3DLJ A;  4CDJ A;  5HVH A;  4NGS A;  3KL9 A;  1V6C A;  1Y9Z A;  3GLJ A;  4A38 A;  3FH4 A;  3S9M A;  4FAI A;  3ICU A;  1XJO A;  2QVP A;  5ELY A;  2O53 A;  2OR4 A;  3D68 A;  4FWU A;  3PB7 X;  1Z8L A;  1Y0Y A;  4C8U A;  1FT7 A;  3PRT A;  1NSA A;  4OC4 A;  4UEE A;  2RFH A;  4C86 A;  1F57 A;  3D7H A;  1CPX A;  2AFO A;  3NH5 A;  1Z2L A;  3WC5 A;  1ZLI A;  1GYT A;  1TXR A;  2XEG A;  1ARL A;  4AXV A;  2NYQ A;  3B3T A;  5I4M A;  3TX8 A;  2CF4 A;  3LMS A;  2XEJ A;  1VGY A;  3IEH A;  5HVG A;  4MCR A;  3VH9 A;  3B7I A;  1EE3 P;  2PJ2 A;  1AMP A;  4W9Y A;  1LOK A;  3FEC A;  1H8L A;  1LCP A;  3T8W A;  4ZY0 A;  4ZY1 A;  4A94 A;  4C85 A;  4ZI6 A;  3PBB A;  4R7M A;  5K8P A;  2NSM A;  4YN3 A;  1KWM A;  2ZEN A;  2V8V A;  1XFO A;  3ISZ A;  3BHX A;  2QJ8 A;  3H8G A;  4GM5 A;  2C6P A;  4PXE A;  2V77 A;  4TNU A;  3RAM A;  5DS0 A;  3L2N A;  4EFD A;  4PXD A;  4JZ0 A;  2ZEP A;  1QQ9 A;  2HC9 A;  4P4E A;  4C8T A;  4IHM A;  4UIA A;  2ZED A;  4UIB A;  3PBE A;  4C9R A;  1VIX A;  3FEE A;  4IK2 A;  5D8N A;  3D7D A;  1R3N A;  4F9U A;  5K8O A;  2Q43 A;  4KSI A;  4C8F A;  3PB8 X;  5J1Q A;  4C8C A;  1OBR A;  4A39 A;  3SI0 A;  1ARM A;  4R8F A;  5IB9 A;  4Q7A A;  3N5F A;  3IC1 A;  3WAB A;  2PJ1 A;  3CPA A;  1M4L A;  2QYV A;  3CPX A;  1TKJ A;  5F09 A;  4PXB A;  4OKO A;  4PQA A;  2ZEF A;  3SI1 A;  2ZOG A;  2V8D A;  2ZEL A;  4PXC A;  4NGP A;  2ZEG A;  1TF8 A;  3SI2 A;  2PIY A;  5JH9 A;  4MHY A;  1LAP A;  4ZX8 A;  2PJ5 A;  8CPA A;  3KGQ A;  1ELL P;  2PJ8 A;  2WYR A;  3B2Y A;  3GUX A;  3H8E A;  3NH4 A;  4NJR A;  4P4F A;  4P4I A;  1JQG A;  2F7V A;  4R6T A;  4BD9 A;  4C9V A;  1IGB A;  2PJB A;  4ONW A;  4TJX A;  2HB6 A; 
#chains in the Genus database with same CATH topology
 2Q51 A;  3B3W A;  4P4B A;  1IY7 A;  1Q7L A;  1UFH A;  3DGV A;  1BXR B;  3PB4 X;  5EC4 A;  3IFE A;  4OP4 A;  1PU9 A;  5EBV A;  3SJF A;  1KUY A;  4CGL A;  3TLB A;  1YSJ A;  4P45 A;  2YND A;  3TLG A;  5JGF A;  4C9E A;  1IID A;  2ABZ A;  3D67 A;  3ZNI A;  4ZBG A;  4CPA A;  1UWY A;  2V8H A;  1LAN A;  2VL1 A;  4B11 A;  3T05 A;  4COG A;  4MMO A;  4UCN A;  2BEI A;  5GCN A;  1VHE A;  4YWY A;  3TO6 A;  4E5S A;  2R8V A;  4C2Z A;  3F9K C;  1HDQ A;  5F9M A;  4AB7 A;  4B10 A;  3JUW A;  4QVT A;  4GXH A;  2Y0M A;  3B35 A;  4OC1 A;  3JRU A;  2PJ9 A;  3S9L A;  1CP6 A;  1XEB A;  4KOR A;  3TYX A;  1QSR A;  4CO9 A;  2GLJ A;  2AFX A;  5A27 A;  1LFW A;  1WK4 A;  3KAS A;  5IR2 A;  4MRI A;  1F2O A;  2Q7S A;  3UY5 A;  4P6Y A;  2JLM A;  3N7Z A;  3BUO B;  5DWN A;  2HRO A;  4C9A A;  5K99 A;  3IWE A;  1NMT A;  3B3C A;  4U9Z A;  5F13 A;  2WUU A;  3ZZI A;  2E28 A;  1TKH A;  4Q38 A;  3KHX A;  3KQZ A;  5F47 A;  2EZB A;  2CNM A;  2B5G B;  2FVG A;  1XMB A;  4UCM A;  4MHN A;  4EWT A;  2PVV A;  1LAM A;  3I74 A;  3K2K A;  3HPH E;  5IX3 A;  3S6H A;  2GLF A;  2CIJ A;  5CPA A;  4LQG A;  5HKY A;  4KZT A;  2XEI A;  2FIA A;  3FRM A;  2EK9 A;  4E0A A;  4JD6 A;  2GU2 A;  2EWB A;  4H89 A;  1M6V B;  4MJX A;  4Y49 B;  1RXT A;  2JBK A;  5LRG A;  2B4D A;  4MFL A;  1XRY A;  4RI1 A;  4CGO A;  1IOI A;  3G23 A;  2PJ0 A;  3HLP A;  3KKW A;  3BI0 A;  4M6H A;  2PJC A;  1EZA A;  1P4N A;  1BOB A;  4TJV A;  3EFA A;  3T90 A;  1XF8 A;  3PFO A;  7CPA A;  3NFQ A;  2EZA A;  5F49 A;  5LYD A;  3IIB A;  3SJG A;  1M4G A;  2AFM A;  2G0B A;  3GY9 A;  1M4I A;  1S7N A;  4FD7 A;  4CYP A;  5JVL A;  3D8P A;  4B5P A;  1CE8 B;  3TC8 A;  4F6A A;  5K8N A;  1CJW A;  1R61 A;  5AG6 A;  4P4D A;  2HUZ A;  1DE4 C;  4ZX9 A;  4RUH A;  2AUM A;  4NGM A;  4MFZ A;  4O23 A;  1M4D A;  3PEI A;  3VAR A;  2VBQ A;  3W6X A;  3VRO A;  4KLW A;  2YNC C;  4JXR A;  2DPT A;  2Y1M A;  4DUK A;  2XEF A;  1S7K A;  4F8Z A;  5LYI A;  4UWI A;  2R82 A;  2PJ3 A;  2IMO A;  1EO0 A;  2PJ7 A;  2OZU A;  2IQ6 A;  5H86 A;  3KI9 A;  3OWC A;  4GS4 A;  1ZYM A;  4YGO A;  1HDU A;  2DIK A;  2BCO A;  4TWE A;  2POK A;  4ZY2 A;  3EZB A;  4KVM E;  4EYS A;  2D0P A;  3GJZ A;  3D66 A;  3CT9 A;  2JBJ A;  4BPX B;  3SJX A;  1P0H A;  1YME A;  1ZLH A;  3BLN A;  4KVX A;  4ZGY B;  2PJA A;  2ZEE A;  3R9G A;  2PJ6 A;  1JDB C;  2H5M A;  3GB0 A;  3EO4 A;  1DTD A;  2YNE A;  3FYN A;  4JYW A;  1B87 A;  3FVL A;  4KOU A;  4C2X A;  3VAT A;  1R57 A;  2V8G A;  2JEW A;  4EME A;  3NOJ A;  4OC5 A;  2F8H A;  4C2Y A;  3WC7 A;  1IU8 A;  2C1C A;  3FF3 A;  3TE4 A;  3GYA A;  1TF9 A;  1XMT A;  3MN8 A;  4IUS A;  3PB9 X;  4OLL A;  3RBU A;  2YJT A;  3DSB A;  4EVY A;  4KNG E;  3H8F A;  4OC3 A;  1Y7E A;  1YX0 A;  3FIX A;  2Q7B A;  5D29 A;  3RNZ A;  4ONU A;  1C30 B;  4H1H A;  3BUW B;  4C99 A;  3BJ8 A;  4NGN A;  2B3V A;  2HWG A;  1WVM A;  1K4J A;  3JVN A;  3C26 A;  4R3L A;  3T9Y A;  1MJ9 A;  2R98 A;  4FD6 A;  2X0S A;  3KZW A;  2PIZ A;  5HVF A;  1Z9E A;  2Q4Z A;  3K9T A;  5F1Y A;  3R96 A;  4JLY A;  4MFK A;  2FXF A;  1AUG A;  1C3O B;  3IWW A;  4R3K A;  1YW6 A;  4IAV A;  3TOA A;  1YVO A;  5G20 A;  4NGR A;  1PYT B;  1LRZ A;  2ANP A;  4AVC A;  2CNS A;  5K8M A;  4C8A A;  1KZF A;  2OU2 A;  3G8W A;  4CS0 B;  3HMJ G;  4A4B A;  2AE6 A;  4CGN A;  2C5Q A;  5AXI A;  4P10 A;  3OAK A;  1BPN A;  4JJX A;  5F46 A;  1VKC A;  3LWU A;  4HNY B;  3FNC A;  2YGW A;  1YLO A;  3IU2 A;  4R87 A;  5A28 A;  4HNX B;  4AG7 A;  4X3R A;  3FMC A;  4R76 A;  4UFV A;  2FSR A;  1YK3 A;  3WC6 A;  2RB7 A;  4BBH A;  3SJE A;  2VI7 A;  3VWD A;  5LRJ A;  5C88 A;  1NSL A;  1B6B A;  2CTC A;  1CX8 A;  1X10 A;  1JDE A;  3S6F A;  3KRV A;  3BUX B;  3VRQ A;  2OB0 A;  3MRU A;  1CM0 A;  5LYL A;  1ELM P;  2I79 A;  4MHP A;  3BI1 A;  4OME A;  3B8G A;  5HH1 A;  3W91 A;  3C8O A;  5ISV A;  1Z8X A;  1F2P A;  2ZEO A;  5FVJ A;  1FNO A;  4MXU A;  3TLA A;  4UEF A;  3PFE A;  3V38 A;  3U88 C;  4A32 A;  3S9N A;  1XBU A;  3S6G A;  5CBM A;  1ON0 A;  1A2Z A;  3IGR A;  4KUB A;  4MHZ A;  5EMI A;  4B14 A;  4HPS A;  4C7I A;  3TFY A;  5J8C A;  5G22 A;  5JYB A;  4QB9 A;  3U1B A;  2VZZ A;  4AG9 A;  4H2K A;  3HUV A;  3G3S A;  4JXQ A;  1EZB A;  3QAH A;  2Q44 A;  2OOT A;  1ZG9 A;  4MCP A;  4NGT A;  2ZOF A;  4M6I A;  4GPL B;  3I9S A;  4UBR A;  4FBE A;  4NSQ A;  4XPD B;  2Q4Y A;  1WJT A;  4OC2 A;  4Z65 A;  1T36 B;  4PV6 A;  4RS2 A;  3H5Z A;  1Y0R A;  2AFZ A;  4KOS A;  3BXM A;  1CPS A;  2I00 A;  4KOY A;  3SXN A;  1TKF A;  5BWA B;  4IIX A;  4DYO A;  3VTA A;  4H6U A;  1ZG8 A;  2J8R A;  5DWM A;  2FM4 A;  2AFU A;  2PE3 A;  2I3C A;  5C82 A;  4CDK A;  4XPD C;  2BOA A;  3D7F A;  2GIV A;  2EBJ A;  3S6K A;  5THW A;  1Z4E A;  3OB1 B;  2BSW A;  1KUX A;  2AFS A;  2HV2 A;  2IJZ A;  2F5I A;  2ARH A;  4G1P A;  4A37 A;  3TLY A;  2ODF A;  4L8A A;  3FX6 A;  3F0A A;  3EC4 A;  1QMU A;  2PRB A;  2JDC A;  5G1Z A;  4MCQ A;  2EK8 A;  3ISX A;  2FS5 A;  3KR4 A;  4NFR A;  2GFQ A;  3V7Z A;  4DJL A;  1GGO A;  4C7H A;  2G3T A;  4OC0 A;  3RYO A;  4B13 A;  2G9D A;  4C9U A;  1VBH A;  4INJ A;  4NJQ A;  4KUA A;  1BPM A;  2NMT A;  3QNV A;  4CRY B;  3IJ3 A;  4WWV A;  1N71 A;  1NBW A;  3B3S A;  2AFW A;  3T07 A;  1BLL E;  2O4H A;  2CY2 A;  3D7G A;  1YW4 A;  2HQY A;  2Z3P A;  4X2T A;  4YU9 A;  4EFD A;  5HKW A;  4F9V A;  3I6S A;  3O8Z A;  1CP7 A;  1S7F A;  2FT0 A;  4P44 A;  1HEE A;  2OH1 A;  4CAV A;  3T0T A;  1L0C A;  2GE3 A;  2PJ4 A;  3NFZ A;  4J3G A;  1JWQ A;  4PSW A;  5LRK A;  1CS0 B;  3GIU A;  3CXS A;  3T5M A;  1SQH A;  1YLE A;  4NGQ A;  4ZYQ A;  1ZG7 A;  1PCA A;  2B5G A;  2BO9 A;  2ZPA A;  1Z8W A;  4WJB A;  4HNW B;  3EIF A;  4C84 A;  4FUU A;  2B4J C;  2C6G A;  3NA6 A;  2K5T A;  1S3Z A;  1WWZ A;  3K9U A;  3VRR A;  2KCW A;  2JDD A;  2WZN A;  3WR7 A;  5H84 A;  5LYF A;  3SR3 A;  2DPS A;  3R95 A;  4B12 A;  1Y7R A;  2ZEM A;  4NXY A;  2GRE A;  3CDX A;  3TCV A;  4PPZ A;  3D4U A;  4R9M A;  3R9E A;  4A2Z A;  1ZO0 A;  1CBX A;  4XNH C;  4MI4 A;  3RZA A;  2WPW A;  2D4P A;  3TLE A;  3K4I A;  1IIC A;  2ZW6 A;  4JVO A;  4UFW A;  3NH8 A;  1VI4 A;  1S5K A;  2EVN A;  2A4N A;  3IWG A;  4OIW A;  2PR1 A;  1YVH A;  4UF4 A;  5HXD A;  4CDJ A;  4MFQ A;  2C6C A;  3IO1 A;  3FED A;  4MJ8 A;  1X12 A;  1Q2C A;  2PRQ A;  4PK3 A;  5CNP A;  4HKF A;  3WT4 A;  2J9A A;  1VHO A;  3I1U A;  3KQX A;  2DEA A;  2XPL A;  1Q2Y A;  1AYE A;  1Y9W A;  2YNC A;  2P6E A;  3KR5 A;  4P4J A;  2VEZ A;  2P6G A;  4COB A;  3FJU A;  2PCU A;  4CGP A;  1MJA A;  1R43 A;  3CXQ A;  4U5Y A;  3KHZ A;  1CG2 A;  3D2M A;  4K3N A;  1I12 A;  3VWE A;  3R1K A;  4X8I A;  6CPA A;  1QST A;  1XF1 A;  2MP0 A;  3VRN A;  3PB6 X;  5KTD A;  3LOD A;  4CYN A;  2RC4 A;  4OID A;  2PVW A;  2AJ6 A;  4UEZ A;  2ZEH A;  4M3S A;  5JM6 A;  4X5K A;  1Z5R A;  4PK2 A;  1NE9 A;  1Z8T A;  4Q36 A;  4MCS A;  2EO8 A;  2CBL A;  3DDD A;  4A95 A;  4B6Z A;  4CYQ A;  4II9 A;  4C8P A;  1BAV A;  4H6Z A;  2B4B A;  3B3V A;  4MI1 A;  1RTQ A;  2DXQ A;  3PFV A;  4F0Y A;  2D4O A;  2CTB A;  4BTF A;  4OAE A;  1BO4 A;  3DLJ A;  3LAC A;  3LD2 A;  5HVH A;  2PSW A;  4NGS A;  3KL9 A;  4KS9 A;  1V6C A;  1VHS A;  4KOT A;  4M85 A;  1Y9Z A;  3GLJ A;  4QUS A;  4OAD A;  4RR2 B;  4A38 A;  3FH4 A;  2OZH A;  3S9M A;  3VRP A;  4NCZ A;  2BL1 A;  4FAI A;  5KTC A;  3ICU A;  1XJO A;  2QVP A;  5ELY A;  2O53 A;  2OR4 A;  3D68 A;  1XOV A;  3DR8 A;  3PB7 X;  4FWU A;  3JTK A;  3FBU A;  3SHP A;  1Z8L A;  1Y0Y A;  4ORF A;  4UA3 A;  1U6M A;  1FT7 A;  4C8U A;  4E94 A;  3PRT A;  1YR0 A;  3W6S A;  1NSA A;  4OC4 A;  4UEE A;  2RFH A;  1A9X B;  4R57 A;  4C86 A;  1KC7 A;  1F57 A;  2D0O A;  4KOV A;  4F0X A;  5J3X A;  1KUV A;  1YRE A;  4E2A A;  3D7H A;  5AG5 A;  1CPX A;  2AFO A;  4KVO E;  3NH5 A;  3FB3 A;  3D2P A;  4YRH A;  1Z2L A;  4AVA A;  2WSA A;  3WC5 A;  1ZLI A;  1GYT A;  3P2H A;  2XPP A;  1ZL0 A;  1TXR A;  3SXO A;  2XEG A;  1ARL A;  4AXV A;  2NYQ A;  3B3T A;  1YVK A;  5AGE A;  1DIK A;  3OB2 B;  1MK4 A;  2Z11 A;  3TLG B;  2B4D B;  2ZW5 A;  5I4M A;  3TX8 A;  4A31 A;  3OP0 A;  2HI6 A;  2QIR A;  4AVB A;  4CZ1 A;  2CF4 A;  1S60 A;  2VZY A;  2Z3O A;  4A4C A;  3LMS A;  1FBV A;  2XEJ A;  1VGY A;  2REE A;  3BUM B;  3IEH A;  5HVG A;  2UV8 G;  4BPU B;  2CXA A;  4MCR A;  3VH9 A;  3FXT A;  4B5P B;  3TTH A;  3B7I A;  4K30 A;  1J4J A;  2VQY A;  3F8K A;  1EE3 P;  2PR8 A;  2R1I A;  2PJ2 A;  3PZJ A;  2P0W A;  1AMP A;  4W9Y A;  3TT2 A;  2PCN A;  4LQ6 A;  2QEC A;  2Z10 A;  1LOK A;  4M6G A;  2FIW A;  3FEC A;  1H8L A;  1LCP A;  3T8W A;  4ZY0 A;  4CAW A;  2O28 A;  4B5O A;  4ZY1 A;  4NF1 A;  4A94 A;  3TLC A;  5J8F A;  4XPL A;  3R9F A;  4XPK A;  4C85 A;  4ZI6 A;  3PBB A;  3BUN B;  4R7M A;  5K8P A;  3EXN A;  2NSM A;  4YN3 A;  1ZRS A;  3EZE A;  1OZP A;  1KWM A;  4CGM A;  2VKZ G;  2PC1 A;  2ZEN A;  1PUA A;  2DF5 A;  2ATR A;  2Y1N A;  1B47 A;  1FY7 A;  5BY0 A;  2V8V A;  1XFO A;  5F5X A;  4A33 A;  3ISZ A;  3HPG G;  3BHX A;  2PDO A;  2B0A A;  2QJ8 A;  3H8G A;  2ZXV A;  4GM5 A;  3I3G A;  2C6P A;  4IF5 A;  5F48 A;  2BUE A;  2XPN A;  4KSF A;  4PXE A;  2V77 A;  2WPX A;  4TNU A;  3RAM A;  5JPH A;  5DS0 A;  3L2N A;  2ZW7 A;  4FD5 A;  4KOX A;  1Y9K A;  4JZ0 A;  3PGP A;  2ZEP A;  2XPO A;  3DR6 A;  4PXD A;  1I1D A;  4C68 A;  1M44 A;  1QQ9 A;  4CAF A;  2HC9 A;  4BMH A;  4P4E A;  4C8T A;  4IHM A;  4UIA A;  2ZED A;  4UIB A;  4I49 A;  4XNH B;  3PBE A;  4Y49 C;  4CAX A;  4C9R A;  1Q5X A;  1VIX A;  5E96 A;  3FEE A;  2B3U A;  2C27 A;  1TIQ A;  3A9L A;  4MY3 A;  4IK2 A;  2J8N A;  3BJ7 A;  2Z3K A;  3TO7 A;  3D3S A;  1M1D A;  4CAE A;  3TLZ A;  2Z3L A;  3DNS A;  3QB8 A;  4MY0 A;  2FL4 A;  5D8N A;  3D7D A;  1R3N A;  4F9U A;  3PP9 A;  2G3A A;  1QSN A;  5K8O A;  2GAN A;  2IL4 A;  2Q43 A;  4A30 A;  4KSI A;  4C8F A;  2DLA A;  1QSO A;  3PB8 X;  4QBJ A;  5J1Q A;  2Z3M A;  1RO5 A;  4C8C A;  5HKZ A;  5IB0 A;  1OBR A;  3RO0 A;  4A39 A;  2B58 A;  2QML A;  2Z0Z A;  3SI0 A;  1ARM A;  4QC6 A;  3P2F A;  4LUA A;  2REF A;  4R8F A;  1VBG A;  4BPW B;  5IB9 A;  4E8O A;  2N3A B;  1IOF A;  1Z9U A;  4Q7A A;  3N5F A;  2GP4 A;  2VXK A;  1GHE A;  4RN7 A;  3MGD A;  2PQ8 A;  1IYL A;  5IV0 A;  4UWJ A;  3IC1 A;  5AG7 A;  1V0C A;  3F5B A;  3H4Q A;  2X7B A;  3WAB A;  3PLF B;  4KOW A;  4U9Y A;  4MBU A;  5HMN A;  1IYK A;  2FE7 A;  2PJ1 A;  3CPA A;  4J0N A;  2JEV A;  1KEE B;  1M4L A;  2QYV A;  3CPX A;  2CNT A;  2Q4V A;  2Q04 A;  2FCK A;  1TKJ A;  1Z4R A;  2YJV A;  4UCP A;  2J8M A;  5F09 A;  4PXB A;  4OKO A;  3E0K A;  2OZG A;  4PQA A;  2OLS A;  3EY5 A;  1YGH A;  2ZEF A;  4KLV A;  1Q2D A;  3SI1 A;  4UFX A;  2ZOG A;  1YQE A;  2V8D A;  2ZEL A;  3NE8 A;  4PXC A;  4NGP A;  1XIX A;  2ZEG A;  5KTA A;  1TF8 A;  1KBL A;  4IIY A;  3SI2 A;  2PIY A;  4DNC A;  5JH9 A;  5FD8 A;  3V8I A;  3GKR A;  4MHY A;  1I21 A;  1LAP A;  4MHD A;  2AUN A;  4ZX8 A;  2PJ5 A;  3ZJ0 A;  4BIN A;  3TO9 A;  8CPA A;  1J3L A;  4M8D A;  3KGQ A;  5G21 A;  4CYO A;  1ELL P;  2PJ8 A;  2WYR A;  3B2Y A;  3GUX A;  4YFJ A;  1NXJ A;  1QSM A;  2Z3N A;  2P6F A;  4L89 A;  3H8E A;  3NH4 A;  3NE7 A;  3VGO A;  1IB1 E;  4KSA A;  3TOB A;  4CRZ B;  5AG4 A;  3EZA A;  4NJR A;  3IU1 A;  2ZW4 A;  4MFJ A;  3CXP A;  4P4F A;  4P4I A;  1JQG A;  2F7V A;  4LX9 A;  4R6T A;  4BD9 A;  4C9V A;  2R7H A;  1IGB A;  4JWP A;  2PJB A;  5I0C A;  3CZX A;  2EUI A;  2EZC A;  3QAY A;  4MFP A;  1MJB A;  5JQ4 A;  3PT1 A;  4FD4 A;  4ONW A;  4TJX A;  1XE4 A;  2HB6 A;  4NEX A;  2Q0Y A;  1S7L A;  4PSX A; 
#chains in the Genus database with same CATH homology
 2Q51 A;  3B3W A;  4P4B A;  1IY7 A;  1Q7L A;  3DGV A;  3PB4 X;  3IFE A;  4OP4 A;  3SJF A;  1YSJ A;  4P45 A;  4C9E A;  5JGF A;  2ABZ A;  3D67 A;  4CPA A;  1UWY A;  2V8H A;  1LAN A;  2VL1 A;  4MMO A;  1VHE A;  4YWY A;  1HDQ A;  3B35 A;  4OC1 A;  3JRU A;  2PJ9 A;  3S9L A;  1CP6 A;  2GLJ A;  2AFX A;  1LFW A;  3KAS A;  5IR2 A;  4MRI A;  1F2O A;  4P6Y A;  4C9A A;  3B3C A;  1TKH A;  3KHX A;  3KQZ A;  2FVG A;  1XMB A;  4MHN A;  4EWT A;  2PVV A;  1LAM A;  3I74 A;  3K2K A;  2GLF A;  2CIJ A;  5CPA A;  4LQG A;  2XEI A;  2EK9 A;  2GU2 A;  2EWB A;  2JBK A;  5LRG A;  1XRY A;  4C8P A;  2PJ0 A;  3HLP A;  3BI0 A;  2PJC A;  4TJV A;  3PFO A;  7CPA A;  5LYD A;  3IIB A;  3SJG A;  2AFM A;  3TC8 A;  5K8N A;  4P4D A;  1DE4 C;  4ZX9 A;  4RUH A;  4NGM A;  4O23 A;  3PEI A;  3VAR A;  4DUK A;  2XEF A;  4F8Z A;  5LYI A;  2PJ3 A;  2IMO A;  2PJ7 A;  2IQ6 A;  3KI9 A;  1HDU A;  2BCO A;  4TWE A;  2POK A;  4ZY2 A;  3D66 A;  3CT9 A;  2JBJ A;  3SJX A;  1YME A;  1ZLH A;  2PJA A;  2ZEE A;  2PJ6 A;  3GB0 A;  1DTD A;  4JYW A;  3FVL A;  3VAT A;  2V8G A;  2JEW A;  4EME A;  4OC5 A;  2F8H A;  2C1C A;  3FF3 A;  1TF9 A;  3MN8 A;  3PB9 X;  3RBU A;  4KNG E;  3H8F A;  4OC3 A;  1Y7E A;  5D29 A;  4C99 A;  4NGN A;  1WVM A;  3KZW A;  2PIZ A;  5HVF A;  2Q4Z A;  3K9T A;  3IWW A;  1YW6 A;  4IAV A;  4NGR A;  1PYT B;  2ANP A;  5K8M A;  4C8A A;  2C5Q A;  4P10 A;  1BPN A;  3LWU A;  1YLO A;  4X3R A;  3FMC A;  4R76 A;  3WC6 A;  2RB7 A;  3SJE A;  5LRJ A;  2CTC A;  1CX8 A;  3MRU A;  5LYL A;  1ELM P;  4MHP A;  3BI1 A;  4OME A;  1F2P A;  2ZEO A;  1FNO A;  4MXU A;  4UEF A;  3PFE A;  3V38 A;  3S9N A;  1XBU A;  5CBM A;  4MHZ A;  4H2K A;  3HUV A;  2OOT A;  1ZG9 A;  4MCP A;  4NGT A;  2ZOF A;  4FBE A;  4Z65 A;  4OC2 A;  1Y0R A;  2AFZ A;  3BXM A;  1CPS A;  1TKF A;  4DYO A;  3VTA A;  1ZG8 A;  2AFU A;  2PE3 A;  2I3C A;  4CDK A;  2BOA A;  3D7F A;  3WC7 A;  5THW A;  2AFS A;  2IJZ A;  4G1P A;  4A37 A;  3FX6 A;  1QMU A;  4MCQ A;  2EK8 A;  3ISX A;  3KR4 A;  4NFR A;  3V7Z A;  4DJL A;  4OC0 A;  4C9U A;  2G9D A;  4NJQ A;  1BPM A;  3QNV A;  3IJ3 A;  4WWV A;  3B3S A;  2AFW A;  1BLL E;  2O4H A;  4F9V A;  3D7G A;  1YW4 A;  4YU9 A;  4X2T A;  3I6S A;  1CP7 A;  4P44 A;  1HEE A;  2PJ4 A;  3NFZ A;  5LRK A;  4NGQ A;  4ZYQ A;  1ZG7 A;  2BO9 A;  1PCA A;  4WJB A;  4C84 A;  3EIF A;  4FUU A;  2C6G A;  3NA6 A;  2WZN A;  5LYF A;  2ZEM A;  2GRE A;  3CDX A;  4PPZ A;  3D4U A;  1CBX A;  3RZA A;  3NH8 A;  4OIW A;  4UF4 A;  5HXD A;  2C6C A;  3IO1 A;  3FED A;  2PRQ A;  3WT4 A;  2J9A A;  1VHO A;  3I1U A;  3KQX A;  2DEA A;  1AYE A;  3KR5 A;  4P4J A;  3FJU A;  2PCU A;  1R43 A;  3KHZ A;  1CG2 A;  4K3N A;  6CPA A;  4X8I A;  1XF1 A;  3PB6 X;  4OID A;  2PVW A;  4UEZ A;  5JM6 A;  2ZEH A;  1Z5R A;  4MCS A;  4B6Z A;  1BAV A;  3B3V A;  1RTQ A;  2CTB A;  3DLJ A;  4CDJ A;  5HVH A;  4NGS A;  3KL9 A;  1V6C A;  1Y9Z A;  3GLJ A;  4A38 A;  3FH4 A;  3S9M A;  4FAI A;  3ICU A;  1XJO A;  2QVP A;  5ELY A;  2O53 A;  2OR4 A;  3D68 A;  4FWU A;  3PB7 X;  1Z8L A;  1Y0Y A;  4C8U A;  1FT7 A;  3PRT A;  1NSA A;  4OC4 A;  4UEE A;  2RFH A;  4C86 A;  1F57 A;  3D7H A;  1CPX A;  2AFO A;  3NH5 A;  1Z2L A;  3WC5 A;  1ZLI A;  1GYT A;  1TXR A;  2XEG A;  1ARL A;  4AXV A;  2NYQ A;  3B3T A;  5I4M A;  3TX8 A;  2CF4 A;  3LMS A;  2XEJ A;  1VGY A;  3IEH A;  5HVG A;  4MCR A;  3VH9 A;  3B7I A;  1EE3 P;  2PJ2 A;  1AMP A;  4W9Y A;  1LOK A;  3FEC A;  1H8L A;  1LCP A;  3T8W A;  4ZY0 A;  4ZY1 A;  4A94 A;  4C85 A;  4ZI6 A;  3PBB A;  4R7M A;  5K8P A;  2NSM A;  4YN3 A;  1KWM A;  2ZEN A;  2V8V A;  1XFO A;  3ISZ A;  3BHX A;  2QJ8 A;  3H8G A;  4GM5 A;  2C6P A;  4PXE A;  2V77 A;  4TNU A;  3RAM A;  5DS0 A;  3L2N A;  4EFD A;  4PXD A;  4JZ0 A;  2ZEP A;  1QQ9 A;  2HC9 A;  4P4E A;  4C8T A;  4IHM A;  4UIA A;  2ZED A;  4UIB A;  3PBE A;  4C9R A;  1VIX A;  3FEE A;  4IK2 A;  5D8N A;  3D7D A;  1R3N A;  4F9U A;  5K8O A;  2Q43 A;  4KSI A;  4C8F A;  3PB8 X;  5J1Q A;  4C8C A;  1OBR A;  4A39 A;  3SI0 A;  1ARM A;  4R8F A;  5IB9 A;  4Q7A A;  3N5F A;  2GP4 A;  3IC1 A;  3WAB A;  2PJ1 A;  3CPA A;  1M4L A;  2QYV A;  3CPX A;  1TKJ A;  5F09 A;  4PXB A;  4OKO A;  4PQA A;  2ZEF A;  3SI1 A;  2ZOG A;  2V8D A;  2ZEL A;  4PXC A;  4NGP A;  2ZEG A;  1TF8 A;  3SI2 A;  2PIY A;  5JH9 A;  4MHY A;  1LAP A;  4ZX8 A;  2PJ5 A;  8CPA A;  3KGQ A;  1ELL P;  2PJ8 A;  2WYR A;  3B2Y A;  3GUX A;  3H8E A;  3NH4 A;  4NJR A;  4P4F A;  4P4I A;  1JQG A;  2F7V A;  4R6T A;  4BD9 A;  4C9V A;  1IGB A;  2PJB A;  4ONW A;  4TJX A;  2HB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...