2CIJA

Membrane-bound glutamate carboxypeptidase ii (gcpii) with bound methionine
Total Genus 244
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
244
sequence length
694
structure length
687
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Glutamate Carboxypeptidase II
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
total genus 244
structure length 687
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2cijA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2cijA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2cijA02
3PFOA 4Z65A 2F8HA 2PJ3A 3SJXA 3PFEA 2QJ8A 4PPZA 2GU2A 5K8PA 2I3CA 2J9AA 3FF3A 3N5FA 4BD9A 3B3CA 4F9VA 3FEDA 3KZWA 4PQAA 3L2NA 2XEIA 5D8NA 5LYIA 3PB4X 1F2PA 3IEHA 4X2TA 3PB7X 4F8ZA 3MRUA 2PVVA 1XJOA 5DS0A 2BCOA 8CPAA 2PJCA 3S9MA 2C6PA 5ELYA 3IIBA 1TKFA 3SJGA 3NH5A 2AFMA 1R3NA 3WT4A 2OOTA 2IJZA 2CIJA 4C8CA 1XRYA 3FMCA 4R7MA 4C99A 4P4FA 1ARLA 1HDQA 1NSAA 5CPAA 2AFSA 4JZ0A 2RFHA 6CPAA 4C9UA 4CDKA 3B3SA 5K8OA 1LAMA 3B3VA 3EIFA 3PBBA 1Y7EA 4P6YA 4EFDA 3VATA 1CBXA 4WJBA 5LRGA 4MRIA 2PE3A 2IMOA 5JGFA 5LYLA 2ZEPA 2ZEDA 4R76A 3D7HA 2GLFA 3V7ZA 5LRKA 1Y9ZA 4IAVA 3K2KA 4PXCA 4C84A 2QYVA 4AXVA 2DEAA 4B6ZA 1RTQA 4MCSA 4C8PA 4H2KA 2Q51A 3KQXA 5K8NA 1YW6A 1R43A 1YW4A 3K9TA 3I6SA 1PCAA 2V8GA 3CPXA 5HVGA 3H8EA 2O4HA 1QQ9A 3NH8A 4R8FA 1F57A 4MCRA 1TKJA 1TKHA 5HXDA 1JQGA 4OKOA 2C6CA 4FWUA 1BAVA 4YU9A 4A39A 1XBUA 2AFOA 4OMEA 2PJBA 1Y0YA 2PRQA 4NFRA 4OC4A 1IGBA 1VHEA 5CBMA 4CDJA 3PB6X 4PXEA 3D7DA 3H8GA 2NYQA 3ISXA 4YN3A 1QMUA 4NGSA 4C8UA 3VH9A 3PB8X 3ICUA 5IB9A 3D68A 3NA6A 2PJ2A 1VIXA 4ZX8A 1LAPA 4P4EA 2HB6A 1YMEA 4EMEA 4TJVA 2PIZA 1BPMA 3I74A 4NJRA 2ZEMA 3VARA 1LANA 2AFUA 1HEEA 2PJ0A 2BOAA 4ZY0A 3MN8A 3VTAA 3FECA 4NGTA 1H8LA 4NJQA 2BO9A 2CF4A 2OR4A 2PJ9A 1ZG7A 1ZG8A 4ZX9A 4OP4A 3S9LA 4OC5A 4MHZA 2PIYA 3BXMA 5J1QA 1HDUA 2QVPA 3NH4A 3WABA 1ZLHA 3IO1A 2C6GA 2PVWA 4NGMA 1ELLP 1FNOA 4X3RA 1OBRA 3FEEA 4ZYQA 2IQ6A 1F2OA 1Z8LA 4MCPA 4MHPA 3TC8A 3KR5A 5I4MA 3BHXA 2GLJA 4ZY1A 3SJFA 2Q4ZA 4TJXA 4P4DA 3B3WA 3H8FA 2ABZA 4YWYA 1ELMP 4OC1A 2ZEOA 2AFXA 4TNUA 4MCQA 3B7IA 3D66A 3WC7A 2AFWA 4G1PA 1ZG9A 2JEWA 1YLOA 4OIDA 4OC0A 2PCUA 4RUHA 2V8DA 1Q7LA 1AYEA 4PXBA 1AMPA 2PJ1A 4EWTA 4F9UA 1CG2A 2ZOGA 3IJ3A 2NSMA 3FH4A 3I1UA 1CP7A 3PRTA 3RBUA 4UEZA 4NGQA 3BI1A 2PJ8A 2V8VA 4O23A 1V6CA 4C8AA 2JBJA 4GM5A 1EE3P 1DTDA 3KL9A 3KR4A 2VL1A 4MMOA 4IK2A 4MHYA 3B3TA 4FUUA 4P4IA 1GYTA 2ANPA 3SJEA 1BLLE 4C86A 3V38A 3FX6A 3S9NA 2ZEEA 2RB7A 5THWA 4OC3A 2ZEFA 4FBEA 2C1CA 7CPAA 4UEEA 1M4LA 1XMBA 2V8HA 4ZI6A 2PJAA 4ZY2A 4P45A 3B2YA 5HVFA 5LRJA 2ZOFA 3GB0A 4C9RA 4C9VA 1CPXA 1PYTB 3CDXA 4A94A 1VGYA 4UIAA 4P44A 4MXUA 2GREA 4NGPA 4DJLA 4C9EA 1IY7A 2WYRA 4A38A 4OIWA 3RAMA 3IFEA 4KSIA 1UWYA 5JM6A 3TX8A 4Q7AA 4LQGA 2PJ5A 5JH9A 2Q43A 4C8FA 3KGQA 3KHXA 5F09A 2POKA 1BPNA 3LWUA 4P10A 4PXDA 3CT9A 4X8IA 1Z5RA 4DYOA 3BI0A 3D4UA 1TF9A 3KQZA 4JYWA 3D67A 3GUXA 2V77A 2EK9A 4W9YA 1CX8A 3PBEA 1FT7A 3LMSA 4R6TA 4P4BA 4P4JA 1ARMA 2O53A 2F7VA 3B35A 3DLJA 5HVHA 1LOKA 3IWWA 2ZENA 1Y0RA 3QNVA 1KWMA 4UIBA 2FVGA 4FAIA 5LYDA 2PJ6A 4NGRA 2ZEHA 3SI1A 3GLJA 4WWVA 3CPAA 3NFZA 4A37A 2XEGA 2WZNA 4OC2A 4TWEA 3FJUA 3JRUA 4DUKA 1WVMA 1XFOA 1YSJA 3PB9X 5LYFA 3HUVA 2ZELA 3D7FA 1LCPA 3SI2A 3DGVA 1Z2LA 1XF1A 2EK8A 3WC5A 2AFZA 2ZEGA 3WC6A 3D7GA 4C8TA 4CPAA 2CTCA 2EWBA 1ZLIA 4UF4A 1TXRA 4MHNA 2JBKA 2HC9A 2PJ7A 1CP6A 1LFWA 3T8WA 3FVLA 4C85A 1CPSA 3ISZA 4KNGE 5D29A 4IHMA 3KI9A 3IC1A 3PEIA 4ONWA 2XEFA 3KHZA 2XEJA 5K8MA 2G9DA 4UEFA 2CTBA 4C9AA 4K3NA 3SI0A 2PJ4A 1TF8A 4NGNA 1VHOA 1DE4C 3HLPA 3KASA 3RZAA
chains in the Genus database with same CATH superfamily
4CAEA 3R95A 4UFWA 3R9FA 3PFOA 4Z65A 3QAYA 2F8HA 2PJ3A 3SJXA 3PFEA 3SR3A 2QECA 2QJ8A 4PPZA 1M1DA 3TLYA 2GU2A 5K8PA 2I3CA 3EC4A 4KORA 1UFHA 2J9AA 3EFAA 4M3SA 3FF3A 3N5FA 1QSRA 2EUIA 4UCMA 1KUXA 3B3CA 1BOBA 3FEDA 2G3TA 3KZWA 4KVXA 3L2NA 2B5GA 4PQAA 1KEEB 2K5TA 2XEIA 3ICUA 5D8NA 1CJWA 5LYIA 3PB4X 4EYSA 4IF5A 1Q2DA 1F2PA 3DNSA 3NE8A 3IEHA 4X2TA 1NSLA 3PB7X 2WPWA 2Q4VA 4F9VA 2YGWA 4F8ZA 3MRUA 2PVVA 3TYXA 2B58A 3VRQA 3TFYA 2Z3LA 4KOXA 1XJOA 4B5OA 5DS0A 2BCOA 2EO8A 8CPAA 3R9EA 2PJCA 4CGPA 3TLEA 3D3SA 2CBLA 3S9MA 2C6PA 5ELYA 5GCNA 5C82A 3P2HA 3VRRA 2DLAA 2E28A 3DR6A 3TLZA 3BUOB 1TKFA 3IIBA 1YK3A 3SJGA 3NH5A 3GY9A 2MP0A 4MBUA 2BEIA 1ZYMA 3PGPA 5F48A 2AFMA 1R3NA 3WT4A 2ZW6A 3BUXB 3IU1A 2OOTA 4HNYB 4NF1A 4J0NA 2IJZA 3OP0A 2CIJA 2B4BA 2FSRA 2VXKA 1XRYA 3I9SA 4KOSA 4C8CA 2Z11A 4GPLB 1YVKA 5E96A 3FMCA 1B47A 4R7MA 5EBVA 4HNWB 4CYNA 4K30A 4A4CA 5AG4A 4C99A 1XF8A 4P4FA 1ARLA 1HDQA 2AE6A 2GANA 4C68A 4CAXA 3BJ8A 2D4PA 1NSAA 2J8RA 4M6GA 2DF5A 2XPNA 1Z4EA 5CPAA 2AFSA 1SQHA 1MJ9A 2B0AA 2GFQA 4JZ0A 3TTHA 2RFHA 4U9YA 6CPAA 4C9UA 4CDKA 3B3SA 5K8OA 3GKRA 1LAMA 1PU9A 2REFA 3B3VA 3EIFA 4B13A 4RI1A 5IX3A 2PDOA 1KUYA 3PBBA 1Y7EA 3VWEA 3KRVA 4P6YA 4EFDA 1Y9KA 4PSXA 3VATA 1CBXA 2CNSA 4BPWB 1GHEA 4GS4A 1X10A 1XOVA 4WJBA 5F46A 4LX9A 5LRGA 1GGOA 5F13A 3LACA 5ISVA 2B4DA 4E8OA 3BUWB 2PE3A 4MRIA 5EC4A 3GJZA 2IMOA 4B5PA 4UWJA 4KS9A 4AVCA 2HROA 5JGFA 5LYLA 2ZEPA 2ZEDA 4R76A 4RN7A 2G3AA 3D7HA 2GLFA 4MFJA 4Y49C 3V7ZA 3W6SA 5A27A 4IAVA 5LRKA 1CE8B 2PR8A 1Y9ZA 5G20A 3S6GA 3K2KA 4PXCA 3VROA 3NFQA 2OH1A 4C84A 1Z8WA 2QYVA 1X12A 2DEAA 4AXVA 4CS0B 3HPHE 3HPGG 1RTQA 4A31A 4AVBA 4MCSA 4B6ZA 4EVYA 4C8PA 4H2KA 1TIQA 2Q51A 3KQXA 4XPLA 4C7HA 1YW6A 2AJ6A 1R43A 5K8NA 1VBGA 4F0YA 1BXRB 1YW4A 3K9TA 5H84A 3I6SA 1PCAA 2V8GA 3CPXA 5HVGA 4QC6A 2AUMA 2OZHA 2ZXVA 3TLBA 5F47A 4CGMA 3H8EA 2R82A 2O4HA 1QQ9A 3NH8A 4YFJA 4R8FA 4YRHA 3PT1A 1F57A 4MCRA 2Y0MA 4RR2B 1TKJA 4JJXA 5KTDA 5FD8A 5JQ4A 1TKHA 5HXDA 1IYLA 1JQGA 4OKOA 2C6CA 4FWUA 4MFLA 1BAVA 2ARHA 2B3VA 4KOUA 3FYNA 4MFQA 4MI4A 1XBUA 2AFOA 4OMEA 2Z3NA 2PJBA 4R3KA 4YU9A 4A39A 4L8AA 1Y0YA 2FIWA 2PRQA 1FBVA 4B11A 3E0KA 2Z3MA 4OC4A 1IGBA 1NE9A 4NFRA 5IB0A 1ZRSA 4CGOA 1VHEA 5CBMA 3BJ7A 4CDJA 3FB3A 4XPDB 2GP4A 1MJAA 3PB6X 1S60A 4KVME 4LQ6A 4PXEA 3D7DA 1KUVA 3H8GA 4BD9A 2NYQA 3ISXA 1YX0A 4YN3A 3TLGB 1QMUA 4L89A 4NGSA 4QVTA 2REEA 4C8UA 3SXOA 3BLNA 3T9YA 1M4IA 2I79A 3PB8X 3VH9A 2YNCC 4C7IA 3D68A 3NA6A 3BUNB 1OZPA 2PJ2A 1VIXA 4R57A 4AVAA 5IB9A 2VI7A 4UFXA 2BUEA 4MFKA 3NOJA 2OZGA 3D2PA 4ZX8A 1YVOA 2Q04A 2VZYA 1LAPA 5DWMA 4KUAA 4AG7A 5HMNA 3EZEA 5K99A 1V0CA 4E94A 3OWCA 4GXHA 3PP9A 4MFZA 4P4EA 1Q2YA 1YMEA 2HB6A 3R1KA 4M6IA 4A95A 4EMEA 4R87A 3G23A 2PIZA 4TJVA 5HKYA 2ODFA 3JUWA 4JXRA 1Y7RA 1BPMA 4ZGYB 4AB7A 3I74A 3F0AA 4NJRA 2ZEMA 3KKWA 3VARA 3OAKA 1LANA 2AFUA 4JLYA 1HEEA 1QSMA 2PJ0A 2BOAA 3CXQA 4ZY0A 3JTKA 2J8NA 2X0SA 5G22A 4KLVA 5EMIA 1P0HA 4Q36A 3MN8A 2JDCA 4PK3A 5AGEA 3UY5A 3FECA 3VTAA 2Y1NA 4NGTA 2B3UA 2VZZA 4BPUB 1H8LA 4NJQA 3GYAA 2B4JC 2ZW5A 3F9KC 2BO9A 2CF4A 2OR4A 2PJ9A 1C3OB 1ZG7A 1ZG8A 3FBUA 4JXQA 1DIKA 3D2MA 4ZX9A 4COGA 5AG7A 2DPTA 5DWNA 4OP4A 1T36B 5JVLA 4IUSA 4A2ZA 2PC1A 3S6HA 3TO9A 3S9LA 3EXNA 4KSFA 1Q2CA 1VBHA 4OC5A 1EZBA 3U88C 4E2AA 4MHZA 2PIYA 2HV2A 4XNHB 3BXMA 2QMLA 1HDUA 5J1QA 4H6ZA 2QVPA 3NH4A 2PR1A 3WABA 1A9XB 1ZLHA 2BL1A 2C6GA 2Q0YA 3I3GA 3IO1A 3T90A 4C2XA 1NBWA 4U9ZA 2PVWA 1J4JA 3OB1B 4NGMA 1S3ZA 4CYQA 5CNPA 1WWZA 1EZAA 1ELLP 1FNOA 4X3RA 1OBRA 4QB9A 4B14A 3FEEA 3O8ZA 4ZYQA 1KBLA 2IQ6A 1F2OA 3DR8A 5KTCA 1Z8LA 4MCPA 2ZW7A 4MHPA 3TOAA 3TOBA 2FL4A 1WK4A 3EY5A 3TO6A 3ZZIA 2JEVA 2VKZG 3TC8A 4CZ1A 3B8GA 3IU2A 1B87A 3KR5A 2Y1MA 5I4MA 3BHXA 2GLJA 4UWIA 4ZY1A 1B6BA 3SJFA 2Q4ZA 4MFPA 4ONUA 2EZAA 4TJXA 4P4DA 3T0TA 3B3WA 3H8FA 4CYPA 2ABZA 4YWYA 1JWQA 3QAHA 4CAVA 1ELMP 1LRZA 4OC1A 1A2ZA 2AFXA 1Y9WA 2ZEOA 4TNUA 4A32A 4IIXA 4MCQA 3ZJ0A 1IOIA 1MJBA 1WJTA 1S7KA 3B7IA 3D66A 1IYKA 3WC7A 2AFWA 1U6MA 4G1PA 4H6UA 1VKCA 1S7FA 4FD4A 5F9MA 1ZG9A 2JEWA 1YLOA 4KOYA 5F1YA 4OIDA 4MI1A 2OB0A 2FXFA 4OC0A 2JLMA 3SXNA 2PCUA 4HNXB 4J3GA 4LUAA 3R96A 4RUHA 2V8DA 4UFVA 1KZFA 1Q7LA 1AYEA 4KLWA 2C5QA 2Z10A 1RXTA 3T5MA 2GE3A 4PXBA 1AMPA 2XPOA 1P4NA 2PJ1A 4EWTA 2WSAA 3IGRA 4ORFA 4F9UA 1CG2A 2ZOGA 3IJ3A 2NSMA 2JDDA 3FH4A 3I1UA 4A4BA 3S6KA 3HMJG 1CP7A 1XE4A 2DPSA 3PRTA 4MY3A 2IL4A 4DNCA 3RBUA 4UEZA 1YR0A 2FT0A 5C88A 1YQEA 3CZXA 4NGQA 3BI1A 3TLGA 1NMTA 2PJ8A 2V8VA 3JVNA 4MJXA 1MK4A 2R7HA 1R61A 4O23A 5JYBA 4CGNA 2XPLA 2RC4A 3CXSA 1V6CA 1ON0A 5IR2A 4C8AA 2JBJA 2Z3OA 2H5MA 4GM5A 1BO4A 1EE3P 2YNDA 3V8IA 1DTDA 3KL9A 3KR4A 1S5KA 2VL1A 2ZPAA 5J8CA 3C8OA 4MMOA 2Z0ZA 2X7BA 4IK2A 2R8VA 4MHYA 3B3TA 2PRBA 3TCVA 4FUUA 4BINA 3PLFB 4P4IA 1XIXA 2PCNA 1GYTA 4KSAA 3T05A 1ZO0A 2ANPA 3SJEA 4HKFA 1BLLE 2A4NA 3VRPA 3TT2A 4C86A 4AG9A 2R98A 3F5BA 3V38A 3FX6A 3S9NA 4BTFA 2YJVA 2FCKA 2ZEEA 2RB7A 5THWA 3PFVA 2CNTA 4YGOA 4R3LA 4OC3A 2ZEFA 3G8WA 4FBEA 2C1CA 7CPAA 4UEEA 1M4LA 1CS0B 4C2YA 1XMBA 2V8HA 4ZBGA 2CNMA 3MGDA 5F49A 4ZI6A 1I12A 2PJAA 4KUBA 4ZY2A 4P45A 3B2YA 3GIUA 5HVFA 4CYOA 3SHPA 5LRJA 2ZOFA 3GB0A 4C9RA 4CGLA 2PQ8A 4I49A 3VRNA 4UA3A 4C9VA 1CPXA 3P2FA 4MHDA 4FD5A 1PYTB 3CDXA 5HKZA 5HH1A 1RO5A 4A94A 4C8FA 1ZL0A 1VGYA 4UIAA 2Q44A 4JWPA 5AG5A 4C2ZA 4P44A 4MXUA 1I21A 2GREA 4NGPA 4M6HA 2ATRA 1M4GA 1IB1E 4UBRA 4DJLA 1IY7A 4C9EA 3K9UA 2WYRA 2OU2A 3R9GA 2VEZA 4OIWA 3RAMA 4A38A 3IFEA 4KSIA 3G3SA 1UWYA 4KOTA 3TO7A 4B12A 2OZUA 2P6FA 1FY7A 2P6EA 3H4QA 3F8KA 5JM6A 2FIAA 2Q4YA 5G1ZA 5BWAB 1VI4A 1IIDA 3TX8A 2D0OA 4Q7AA 4LQGA 2J8MA 2PJ5A 3DDDA 2Q43A 4M85A 2BSWA 2VQYA 2YNEA 3KGQA 4KOWA 3KHXA 4PK2A 4F0XA 1Q5XA 3A9LA 5F09A 2POKA 2AUNA 2EZBA 1BPNA 3LWUA 3EO4A 4P10A 4E5SA 2DIKA 3BUMB 2HQYA 2FS5A 4PXDA 3CT9A 4X8IA 2YJTA 1Z5RA 4KVOE 5JPHA 3VGOA 1VHSA 1YREA 4H89A 2D0PA 4DYOA 4COBA 3N7ZA 1QSTA 2XPPA 3BI0A 3FXTA 3D4UA 3H5ZA 4Q38A 4JVOA 1TF9A 1Z4RA 4JYWA 3KQZA 3D67A 3GUXA 2EK9A 2V77A 3EZBA 4W9YA 1IOFA 3OB2B 1K4JA 2NMTA 4NEXA 4HPSA 1CX8A 3IWGA 4XPDC 4OAEA 5AXIA 1EO0A 2B5GB 4Y49B 3PBEA 2KCWA 1FT7A 3LMSA 4R6TA 2D4OA 4QBJA 4P4BA 3IWEA 4P4JA 1ARMA 1Z9EA 1QSOA 2O53A 2F7VA 3B35A 1JDEA 3DLJA 4MY0A 4CAFA 5HVHA 1LOKA 3IWWA 2ZENA 1Y0RA 3QNVA 4PV6A 3TLCA 2ZW4A 3FNCA 5KTAA 1KWMA 4NSQA 4UIBA 2UV8G 2FVGA 4UCNA 4FAIA 5LYDA 1IICA 2PJ6A 5FVJA 4F6AA 4NGRA 1M4DA 2ZEHA 4A33A 2G0BA 3SI1A 3GLJA 4WWVA 3CPAA 2HUZA 4XPKA 4CRYB 3T07A 3NFZA 3W6XA 4A37A 2XEGA 2QIRA 2WZNA 4OC2A 1J3LA 4TWEA 1PUAA 3EZAA 4CRZB 2EZCA 4NCZA 2FM4A 2R1IA 1S7NA 3FJUA 3JRUA 4PSWA 4UCPA 3FIXA 4DUKA 1WVMA 4IIYA 1QSNA 4JD6A 1XFOA 4II9A 1YSJA 4RS2A 3DSBA 3QB8A 5J3XA 2FE7A 3RYOA 4FD7A 2OLSA 1XMTA 1IU8A 3PB9X 2YNCA 4R9MA 5IV0A 4H1HA 5HKWA 5LYFA 1I1DA 5I0CA 3HUVA 2WPXA 2ZELA 1Z9UA 4B10A 1Z8XA 4INJA 3D7FA 1LCPA 5G21A 2N3AB 3SI2A 4BBHA 5BY0A 1YLEA 3DGVA 2F5IA 2HI6A 1Z2LA 2Q7SA 2GIVA 4OADA 3PZJA 1XF1A 2EK8A 4MJ8A 3WC5A 3TE4A 2AFZA 2ZEGA 3WC6A 1C30B 3ZNIA 4KOVA 3D7GA 4A30A 4C8TA 3NE7A 4CPAA 2CTCA 1KC7A 3S6FA 1R57A 2EWBA 3RNZA 3CXPA 1YVHA 1ZLIA 4CO9A 2B4DB 4UF4A 2PSWA 3FRMA 3K4IA 1TXRA 1L0CA 2JBKA 2HC9A 4MHNA 4M8DA 4B5PB 2PJ7A 3D8PA 1CP6A 3LD2A 4OLLA 1LFWA 3T8WA 2P0WA 2Z3KA 4BPXB 3FVLA 4C85A 4BMHA 1CPSA 1XEBA 2C27A 3ISZA 4U5YA 3WR7A 2HWGA 4KNGE 4XNHC 1JDBC 5J8FA 3LODA 3RO0A 5D29A 1CM0A 4IHMA 1N71A 2EVNA 3KI9A 3IC1A 4QUSA 3PEIA 2I00A 2WUUA 4ONWA 2VBQA 4X5KA 3VWDA 3W91A 1M6VB 2CY2A 2XEFA 3KHZA 4NXYA 2O28A 5H86A 2XEJA 1S7LA 2Q7BA 5K8MA 1AUGA 2DXQA 3U1BA 2G9DA 5A28A 4UEFA 3TLAA 5F5XA 2P6GA 4KZTA 5AG6A 4FD6A 2CTBA 2EBJA 4C9AA 4K3NA 4CAWA 1M44A 3C26A 2Z3PA 2PJ4A 1YGHA 3SI0A 4E0AA 1Z8TA 1TF8A 2CXAA 5JH9A 4NGNA 1VHOA 1NXJA 1DE4C 3HLPA 3KASA 3RZAA
chains in the Genus database with same CATH topology
3PFOA 4Z65A 2F8HA 2PJ3A 3SJXA 3PFEA 2QJ8A 4PPZA 2GU2A 5K8PA 2I3CA 2J9AA 3FF3A 3N5FA 4BD9A 3B3CA 4F9VA 3FEDA 3KZWA 4PQAA 3L2NA 2XEIA 5D8NA 5LYIA 3PB4X 1F2PA 3IEHA 4X2TA 3PB7X 4F8ZA 3MRUA 2PVVA 1XJOA 5DS0A 2BCOA 8CPAA 2PJCA 3S9MA 2C6PA 5ELYA 3IIBA 1TKFA 3SJGA 3NH5A 2AFMA 1R3NA 3WT4A 2OOTA 2IJZA 2CIJA 4C8CA 1XRYA 3FMCA 4R7MA 4C99A 4P4FA 1ARLA 1HDQA 5IR2A 1NSAA 5CPAA 2AFSA 4JZ0A 2RFHA 6CPAA 4C9UA 4CDKA 3B3SA 5K8OA 1LAMA 3B3VA 3EIFA 3PBBA 1Y7EA 4P6YA 4EFDA 3VATA 1CBXA 4WJBA 5LRGA 4MRIA 2PE3A 2IMOA 5JGFA 5LYLA 2ZEPA 2ZEDA 4R76A 3D7HA 2GLFA 3V7ZA 5LRKA 1Y9ZA 4IAVA 3K2KA 4PXCA 4C84A 2QYVA 4AXVA 2DEAA 4B6ZA 1RTQA 4MCSA 4C8PA 4H2KA 2Q51A 3KQXA 5K8NA 1YW6A 1R43A 1YW4A 3K9TA 3I6SA 1PCAA 2V8GA 3CPXA 5HVGA 3H8EA 2O4HA 1QQ9A 3NH8A 4R8FA 1F57A 4MCRA 1TKJA 1TKHA 5HXDA 1JQGA 4OKOA 2C6CA 4FWUA 1BAVA 4YU9A 4A39A 1XBUA 2AFOA 4OMEA 2PJBA 1Y0YA 2PRQA 4NFRA 4OC4A 1IGBA 1VHEA 5CBMA 4CDJA 2GP4A 3PB6X 4PXEA 3D7DA 3H8GA 2NYQA 3ISXA 4YN3A 1QMUA 4NGSA 4C8UA 3VH9A 3PB8X 3ICUA 5IB9A 3D68A 3NA6A 2PJ2A 1VIXA 4ZX8A 1LAPA 4P4EA 2HB6A 1YMEA 4EMEA 4TJVA 2PIZA 1BPMA 3I74A 4NJRA 2ZEMA 3VARA 1LANA 2AFUA 1HEEA 2PJ0A 2BOAA 4ZY0A 3MN8A 3VTAA 3FECA 4NGTA 1H8LA 4NJQA 2BO9A 2CF4A 2OR4A 2PJ9A 1ZG7A 1ZG8A 4ZX9A 4OP4A 3S9LA 4OC5A 4MHZA 2PIYA 3BXMA 5J1QA 1HDUA 2QVPA 3NH4A 3WABA 1ZLHA 3IO1A 2C6GA 2PVWA 4NGMA 1ELLP 1FNOA 4X3RA 1OBRA 3FEEA 4ZYQA 2IQ6A 1F2OA 1Z8LA 4MCPA 4MHPA 3TC8A 3KR5A 5I4MA 3BHXA 2GLJA 4ZY1A 3SJFA 2Q4ZA 4TJXA 4P4DA 3B3WA 3H8FA 2ABZA 4YWYA 1ELMP 4OC1A 2ZEOA 2AFXA 4TNUA 4MCQA 3B7IA 3D66A 3WC7A 2AFWA 4G1PA 1ZG9A 2JEWA 1YLOA 4OIDA 4OC0A 2PCUA 4RUHA 2V8DA 2C5QA 1Q7LA 1AYEA 4PXBA 1AMPA 2PJ1A 4EWTA 4F9UA 1CG2A 2ZOGA 3IJ3A 2NSMA 3FH4A 3I1UA 1CP7A 3PRTA 3RBUA 4UEZA 4NGQA 3BI1A 2PJ8A 2V8VA 4O23A 1V6CA 4C8AA 2JBJA 4GM5A 1EE3P 1DTDA 3KL9A 3KR4A 2VL1A 4MMOA 4IK2A 4MHYA 3B3TA 4FUUA 4P4IA 1GYTA 2ANPA 3SJEA 1BLLE 4C86A 3V38A 3FX6A 3S9NA 2ZEEA 2RB7A 5THWA 4OC3A 2ZEFA 4FBEA 2C1CA 7CPAA 4UEEA 1M4LA 1XMBA 2V8HA 4ZI6A 2PJAA 4ZY2A 4P45A 3B2YA 5HVFA 5LRJA 2ZOFA 3GB0A 4C9RA 4C9VA 1CPXA 1PYTB 3CDXA 4A94A 1VGYA 4UIAA 4P44A 4MXUA 2GREA 4NGPA 4DJLA 4C9EA 1IY7A 2WYRA 4A38A 4OIWA 3RAMA 3IFEA 4KSIA 1UWYA 5JM6A 3TX8A 4Q7AA 4LQGA 2PJ5A 5JH9A 2Q43A 4C8FA 3KGQA 3KHXA 5F09A 2POKA 1BPNA 3LWUA 4P10A 4PXDA 3CT9A 4X8IA 1Z5RA 4DYOA 3BI0A 3D4UA 1TF9A 3KQZA 4JYWA 3D67A 3GUXA 2V77A 2EK9A 4W9YA 1CX8A 3PBEA 1FT7A 3LMSA 4R6TA 4P4BA 4P4JA 1ARMA 2O53A 2F7VA 3B35A 3DLJA 5HVHA 1LOKA 3IWWA 2ZENA 1Y0RA 3QNVA 1KWMA 4UIBA 2FVGA 4FAIA 5LYDA 2PJ6A 4NGRA 2ZEHA 3SI1A 3GLJA 4WWVA 3CPAA 3NFZA 4A37A 2XEGA 2WZNA 4OC2A 4TWEA 3FJUA 3JRUA 4DUKA 1WVMA 1XFOA 1YSJA 3PB9X 5LYFA 3HUVA 2ZELA 3D7FA 1LCPA 3SI2A 3DGVA 1Z2LA 1XF1A 2EK8A 3WC5A 2AFZA 2ZEGA 3WC6A 3D7GA 4C8TA 4CPAA 2CTCA 2EWBA 1ZLIA 4UF4A 1TXRA 4MHNA 2JBKA 2HC9A 2PJ7A 1CP6A 1LFWA 3T8WA 3FVLA 4C85A 1CPSA 3ISZA 4KNGE 5D29A 4IHMA 3KI9A 3IC1A 3PEIA 4ONWA 2XEFA 3KHZA 2XEJA 5K8MA 2G9DA 4UEFA 2CTBA 4C9AA 4K3NA 3SI0A 2PJ4A 1TF8A 4NGNA 1VHOA 1DE4C 3HLPA 3KASA 3RZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFO A;  4Z65 A;  2F8H A;  2PJ3 A;  3SJX A;  3PFE A;  2QJ8 A;  4PPZ A;  2GU2 A;  5K8P A;  2I3C A;  2J9A A;  3FF3 A;  3N5F A;  4BD9 A;  3B3C A;  4F9V A;  3FED A;  3KZW A;  4PQA A;  3L2N A;  2XEI A;  5D8N A;  5LYI A;  3PB4 X;  1F2P A;  3IEH A;  4X2T A;  3PB7 X;  4F8Z A;  3MRU A;  2PVV A;  1XJO A;  5DS0 A;  2BCO A;  8CPA A;  2PJC A;  3S9M A;  2C6P A;  5ELY A;  3IIB A;  1TKF A;  3SJG A;  3NH5 A;  2AFM A;  1R3N A;  3WT4 A;  2OOT A;  2IJZ A;  2CIJ A;  4C8C A;  1XRY A;  3FMC A;  4R7M A;  4C99 A;  4P4F A;  1ARL A;  1HDQ A;  1NSA A;  5CPA A;  2AFS A;  4JZ0 A;  2RFH A;  6CPA A;  4C9U A;  4CDK A;  3B3S A;  5K8O A;  1LAM A;  3B3V A;  3EIF A;  3PBB A;  1Y7E A;  4P6Y A;  4EFD A;  3VAT A;  1CBX A;  4WJB A;  5LRG A;  4MRI A;  2PE3 A;  2IMO A;  5JGF A;  5LYL A;  2ZEP A;  2ZED A;  4R76 A;  3D7H A;  2GLF A;  3V7Z A;  5LRK A;  1Y9Z A;  4IAV A;  3K2K A;  4PXC A;  4C84 A;  2QYV A;  4AXV A;  2DEA A;  4B6Z A;  1RTQ A;  4MCS A;  4C8P A;  4H2K A;  2Q51 A;  3KQX A;  5K8N A;  1YW6 A;  1R43 A;  1YW4 A;  3K9T A;  3I6S A;  1PCA A;  2V8G A;  3CPX A;  5HVG A;  3H8E A;  2O4H A;  1QQ9 A;  3NH8 A;  4R8F A;  1F57 A;  4MCR A;  1TKJ A;  1TKH A;  5HXD A;  1JQG A;  4OKO A;  2C6C A;  4FWU A;  1BAV A;  4YU9 A;  4A39 A;  1XBU A;  2AFO A;  4OME A;  2PJB A;  1Y0Y A;  2PRQ A;  4NFR A;  4OC4 A;  1IGB A;  1VHE A;  5CBM A;  4CDJ A;  3PB6 X;  4PXE A;  3D7D A;  3H8G A;  2NYQ A;  3ISX A;  4YN3 A;  1QMU A;  4NGS A;  4C8U A;  3VH9 A;  3PB8 X;  3ICU A;  5IB9 A;  3D68 A;  3NA6 A;  2PJ2 A;  1VIX A;  4ZX8 A;  1LAP A;  4P4E A;  2HB6 A;  1YME A;  4EME A;  4TJV A;  2PIZ A;  1BPM A;  3I74 A;  4NJR A;  2ZEM A;  3VAR A;  1LAN A;  2AFU A;  1HEE A;  2PJ0 A;  2BOA A;  4ZY0 A;  3MN8 A;  3VTA A;  3FEC A;  4NGT A;  1H8L A;  4NJQ A;  2BO9 A;  2CF4 A;  2OR4 A;  2PJ9 A;  1ZG7 A;  1ZG8 A;  4ZX9 A;  4OP4 A;  3S9L A;  4OC5 A;  4MHZ A;  2PIY A;  3BXM A;  5J1Q A;  1HDU A;  2QVP A;  3NH4 A;  3WAB A;  1ZLH A;  3IO1 A;  2C6G A;  2PVW A;  4NGM A;  1ELL P;  1FNO A;  4X3R A;  1OBR A;  3FEE A;  4ZYQ A;  2IQ6 A;  1F2O A;  1Z8L A;  4MCP A;  4MHP A;  3TC8 A;  3KR5 A;  5I4M A;  3BHX A;  2GLJ A;  4ZY1 A;  3SJF A;  2Q4Z A;  4TJX A;  4P4D A;  3B3W A;  3H8F A;  2ABZ A;  4YWY A;  1ELM P;  4OC1 A;  2ZEO A;  2AFX A;  4TNU A;  4MCQ A;  3B7I A;  3D66 A;  3WC7 A;  2AFW A;  4G1P A;  1ZG9 A;  2JEW A;  1YLO A;  4OID A;  4OC0 A;  2PCU A;  4RUH A;  2V8D A;  1Q7L A;  1AYE A;  4PXB A;  1AMP A;  2PJ1 A;  4EWT A;  4F9U A;  1CG2 A;  2ZOG A;  3IJ3 A;  2NSM A;  3FH4 A;  3I1U A;  1CP7 A;  3PRT A;  3RBU A;  4UEZ A;  4NGQ A;  3BI1 A;  2PJ8 A;  2V8V A;  4O23 A;  1V6C A;  4C8A A;  2JBJ A;  4GM5 A;  1EE3 P;  1DTD A;  3KL9 A;  3KR4 A;  2VL1 A;  4MMO A;  4IK2 A;  4MHY A;  3B3T A;  4FUU A;  4P4I A;  1GYT A;  2ANP A;  3SJE A;  1BLL E;  4C86 A;  3V38 A;  3FX6 A;  3S9N A;  2ZEE A;  2RB7 A;  5THW A;  4OC3 A;  2ZEF A;  4FBE A;  2C1C A;  7CPA A;  4UEE A;  1M4L A;  1XMB A;  2V8H A;  4ZI6 A;  2PJA A;  4ZY2 A;  4P45 A;  3B2Y A;  5HVF A;  5LRJ A;  2ZOF A;  3GB0 A;  4C9R A;  4C9V A;  1CPX A;  1PYT B;  3CDX A;  4A94 A;  1VGY A;  4UIA A;  4P44 A;  4MXU A;  2GRE A;  4NGP A;  4DJL A;  4C9E A;  1IY7 A;  2WYR A;  4A38 A;  4OIW A;  3RAM A;  3IFE A;  4KSI A;  1UWY A;  5JM6 A;  3TX8 A;  4Q7A A;  4LQG A;  2PJ5 A;  5JH9 A;  2Q43 A;  4C8F A;  3KGQ A;  3KHX A;  5F09 A;  2POK A;  1BPN A;  3LWU A;  4P10 A;  4PXD A;  3CT9 A;  4X8I A;  1Z5R A;  4DYO A;  3BI0 A;  3D4U A;  1TF9 A;  3KQZ A;  4JYW A;  3D67 A;  3GUX A;  2V77 A;  2EK9 A;  4W9Y A;  1CX8 A;  3PBE A;  1FT7 A;  3LMS A;  4R6T A;  4P4B A;  4P4J A;  1ARM A;  2O53 A;  2F7V A;  3B35 A;  3DLJ A;  5HVH A;  1LOK A;  3IWW A;  2ZEN A;  1Y0R A;  3QNV A;  1KWM A;  4UIB A;  2FVG A;  4FAI A;  5LYD A;  2PJ6 A;  4NGR A;  2ZEH A;  3SI1 A;  3GLJ A;  4WWV A;  3CPA A;  3NFZ A;  4A37 A;  2XEG A;  2WZN A;  4OC2 A;  4TWE A;  3FJU A;  3JRU A;  4DUK A;  1WVM A;  1XFO A;  1YSJ A;  3PB9 X;  5LYF A;  3HUV A;  2ZEL A;  3D7F A;  1LCP A;  3SI2 A;  3DGV A;  1Z2L A;  1XF1 A;  2EK8 A;  3WC5 A;  2AFZ A;  2ZEG A;  3WC6 A;  3D7G A;  4C8T A;  4CPA A;  2CTC A;  2EWB A;  1ZLI A;  4UF4 A;  1TXR A;  4MHN A;  2JBK A;  2HC9 A;  2PJ7 A;  1CP6 A;  1LFW A;  3T8W A;  3FVL A;  4C85 A;  1CPS A;  3ISZ A;  4KNG E;  5D29 A;  4IHM A;  3KI9 A;  3IC1 A;  3PEI A;  4ONW A;  2XEF A;  3KHZ A;  2XEJ A;  5K8M A;  2G9D A;  4UEF A;  2CTB A;  4C9A A;  4K3N A;  3SI0 A;  2PJ4 A;  1TF8 A;  4NGN A;  1VHO A;  1DE4 C;  3HLP A;  3KAS A;  3RZA A; 
#chains in the Genus database with same CATH topology
 4CAE A;  3R95 A;  4UFW A;  3R9F A;  3PFO A;  4Z65 A;  3QAY A;  2F8H A;  2PJ3 A;  3SJX A;  3PFE A;  3SR3 A;  2QEC A;  2QJ8 A;  4PPZ A;  1M1D A;  3TLY A;  2GU2 A;  5K8P A;  2I3C A;  3EC4 A;  4KOR A;  1UFH A;  2J9A A;  3EFA A;  4M3S A;  3FF3 A;  3N5F A;  1QSR A;  2EUI A;  4UCM A;  1KUX A;  3B3C A;  1BOB A;  3FED A;  2G3T A;  3KZW A;  4KVX A;  3L2N A;  2B5G A;  4PQA A;  1KEE B;  2K5T A;  2XEI A;  3ICU A;  5D8N A;  1CJW A;  5LYI A;  3PB4 X;  4EYS A;  4IF5 A;  1Q2D A;  1F2P A;  3DNS A;  3NE8 A;  3IEH A;  4X2T A;  1NSL A;  3PB7 X;  2WPW A;  2Q4V A;  4F9V A;  2YGW A;  4F8Z A;  3MRU A;  2PVV A;  3TYX A;  2B58 A;  3VRQ A;  3TFY A;  2Z3L A;  4KOX A;  1XJO A;  4B5O A;  5DS0 A;  2BCO A;  2EO8 A;  8CPA A;  3R9E A;  2PJC A;  4CGP A;  3TLE A;  3D3S A;  2CBL A;  3S9M A;  2C6P A;  5ELY A;  5GCN A;  5C82 A;  3P2H A;  3VRR A;  2DLA A;  2E28 A;  3DR6 A;  3TLZ A;  3BUO B;  1TKF A;  3IIB A;  1YK3 A;  3SJG A;  3NH5 A;  3GY9 A;  2MP0 A;  4MBU A;  2BEI A;  1ZYM A;  3PGP A;  5F48 A;  2AFM A;  1R3N A;  3WT4 A;  2ZW6 A;  3BUX B;  3IU1 A;  2OOT A;  4HNY B;  4NF1 A;  4J0N A;  2IJZ A;  3OP0 A;  2CIJ A;  2B4B A;  2FSR A;  2VXK A;  1XRY A;  3I9S A;  4KOS A;  4C8C A;  2Z11 A;  4GPL B;  1YVK A;  5E96 A;  3FMC A;  1B47 A;  4R7M A;  5EBV A;  4HNW B;  4CYN A;  4K30 A;  4A4C A;  5AG4 A;  4C99 A;  1XF8 A;  4P4F A;  1ARL A;  1HDQ A;  2AE6 A;  2GAN A;  4C68 A;  4CAX A;  3BJ8 A;  2D4P A;  1NSA A;  2J8R A;  4M6G A;  2DF5 A;  2XPN A;  1Z4E A;  5CPA A;  2AFS A;  1SQH A;  1MJ9 A;  2B0A A;  2GFQ A;  4JZ0 A;  3TTH A;  2RFH A;  4U9Y A;  6CPA A;  4C9U A;  4CDK A;  3B3S A;  5K8O A;  3GKR A;  1LAM A;  1PU9 A;  2REF A;  3B3V A;  3EIF A;  4B13 A;  4RI1 A;  5IX3 A;  2PDO A;  1KUY A;  3PBB A;  1Y7E A;  3VWE A;  3KRV A;  4P6Y A;  4EFD A;  1Y9K A;  4PSX A;  3VAT A;  1CBX A;  2CNS A;  4BPW B;  1GHE A;  4GS4 A;  1X10 A;  1XOV A;  4WJB A;  5F46 A;  4LX9 A;  5LRG A;  1GGO A;  5F13 A;  3LAC A;  5ISV A;  2B4D A;  4E8O A;  3BUW B;  2PE3 A;  4MRI A;  5EC4 A;  3GJZ A;  2IMO A;  4B5P A;  4UWJ A;  4KS9 A;  4AVC A;  2HRO A;  5JGF A;  5LYL A;  2ZEP A;  2ZED A;  4R76 A;  4RN7 A;  2G3A A;  3D7H A;  2GLF A;  4MFJ A;  4Y49 C;  3V7Z A;  3W6S A;  5A27 A;  4IAV A;  5LRK A;  1CE8 B;  2PR8 A;  1Y9Z A;  5G20 A;  3S6G A;  3K2K A;  4PXC A;  3VRO A;  3NFQ A;  2OH1 A;  4C84 A;  1Z8W A;  2QYV A;  1X12 A;  2DEA A;  4AXV A;  4CS0 B;  3HPH E;  3HPG G;  1RTQ A;  4A31 A;  4AVB A;  4MCS A;  4B6Z A;  4EVY A;  4C8P A;  4H2K A;  1TIQ A;  2Q51 A;  3KQX A;  4XPL A;  4C7H A;  1YW6 A;  2AJ6 A;  1R43 A;  5K8N A;  1VBG A;  4F0Y A;  1BXR B;  1YW4 A;  3K9T A;  5H84 A;  3I6S A;  1PCA A;  2V8G A;  3CPX A;  5HVG A;  4QC6 A;  2AUM A;  2OZH A;  2ZXV A;  3TLB A;  5F47 A;  4CGM A;  3H8E A;  2R82 A;  2O4H A;  1QQ9 A;  3NH8 A;  4YFJ A;  4R8F A;  4YRH A;  3PT1 A;  1F57 A;  4MCR A;  2Y0M A;  4RR2 B;  1TKJ A;  4JJX A;  5KTD A;  5FD8 A;  5JQ4 A;  1TKH A;  5HXD A;  1IYL A;  1JQG A;  4OKO A;  2C6C A;  4FWU A;  4MFL A;  1BAV A;  2ARH A;  2B3V A;  4KOU A;  3FYN A;  4MFQ A;  4MI4 A;  1XBU A;  2AFO A;  4OME A;  2Z3N A;  2PJB A;  4R3K A;  4YU9 A;  4A39 A;  4L8A A;  1Y0Y A;  2FIW A;  2PRQ A;  1FBV A;  4B11 A;  3E0K A;  2Z3M A;  4OC4 A;  1IGB A;  1NE9 A;  4NFR A;  5IB0 A;  1ZRS A;  4CGO A;  1VHE A;  5CBM A;  3BJ7 A;  4CDJ A;  3FB3 A;  4XPD B;  2GP4 A;  1MJA A;  3PB6 X;  1S60 A;  4KVM E;  4LQ6 A;  4PXE A;  3D7D A;  1KUV A;  3H8G A;  4BD9 A;  2NYQ A;  3ISX A;  1YX0 A;  4YN3 A;  3TLG B;  1QMU A;  4L89 A;  4NGS A;  4QVT A;  2REE A;  4C8U A;  3SXO A;  3BLN A;  3T9Y A;  1M4I A;  2I79 A;  3PB8 X;  3VH9 A;  2YNC C;  4C7I A;  3D68 A;  3NA6 A;  3BUN B;  1OZP A;  2PJ2 A;  1VIX A;  4R57 A;  4AVA A;  5IB9 A;  2VI7 A;  4UFX A;  2BUE A;  4MFK A;  3NOJ A;  2OZG A;  3D2P A;  4ZX8 A;  1YVO A;  2Q04 A;  2VZY A;  1LAP A;  5DWM A;  4KUA A;  4AG7 A;  5HMN A;  3EZE A;  5K99 A;  1V0C A;  4E94 A;  3OWC A;  4GXH A;  3PP9 A;  4MFZ A;  4P4E A;  1Q2Y A;  1YME A;  2HB6 A;  3R1K A;  4M6I A;  4A95 A;  4EME A;  4R87 A;  3G23 A;  2PIZ A;  4TJV A;  5HKY A;  2ODF A;  3JUW A;  4JXR A;  1Y7R A;  1BPM A;  4ZGY B;  4AB7 A;  3I74 A;  3F0A A;  4NJR A;  2ZEM A;  3KKW A;  3VAR A;  3OAK A;  1LAN A;  2AFU A;  4JLY A;  1HEE A;  1QSM A;  2PJ0 A;  2BOA A;  3CXQ A;  4ZY0 A;  3JTK A;  2J8N A;  2X0S A;  5G22 A;  4KLV A;  5EMI A;  1P0H A;  4Q36 A;  3MN8 A;  2JDC A;  4PK3 A;  5AGE A;  3UY5 A;  3FEC A;  3VTA A;  2Y1N A;  4NGT A;  2B3U A;  2VZZ A;  4BPU B;  1H8L A;  4NJQ A;  3GYA A;  2B4J C;  2ZW5 A;  3F9K C;  2BO9 A;  2CF4 A;  2OR4 A;  2PJ9 A;  1C3O B;  1ZG7 A;  1ZG8 A;  3FBU A;  4JXQ A;  1DIK A;  3D2M A;  4ZX9 A;  4COG A;  5AG7 A;  2DPT A;  5DWN A;  4OP4 A;  1T36 B;  5JVL A;  4IUS A;  4A2Z A;  2PC1 A;  3S6H A;  3TO9 A;  3S9L A;  3EXN A;  4KSF A;  1Q2C A;  1VBH A;  4OC5 A;  1EZB A;  3U88 C;  4E2A A;  4MHZ A;  2PIY A;  2HV2 A;  4XNH B;  3BXM A;  2QML A;  1HDU A;  5J1Q A;  4H6Z A;  2QVP A;  3NH4 A;  2PR1 A;  3WAB A;  1A9X B;  1ZLH A;  2BL1 A;  2C6G A;  2Q0Y A;  3I3G A;  3IO1 A;  3T90 A;  4C2X A;  1NBW A;  4U9Z A;  2PVW A;  1J4J A;  3OB1 B;  4NGM A;  1S3Z A;  4CYQ A;  5CNP A;  1WWZ A;  1EZA A;  1ELL P;  1FNO A;  4X3R A;  1OBR A;  4QB9 A;  4B14 A;  3FEE A;  3O8Z A;  4ZYQ A;  1KBL A;  2IQ6 A;  1F2O A;  3DR8 A;  5KTC A;  1Z8L A;  4MCP A;  2ZW7 A;  4MHP A;  3TOA A;  3TOB A;  2FL4 A;  1WK4 A;  3EY5 A;  3TO6 A;  3ZZI A;  2JEV A;  2VKZ G;  3TC8 A;  4CZ1 A;  3B8G A;  3IU2 A;  1B87 A;  3KR5 A;  2Y1M A;  5I4M A;  3BHX A;  2GLJ A;  4UWI A;  4ZY1 A;  1B6B A;  3SJF A;  2Q4Z A;  4MFP A;  4ONU A;  2EZA A;  4TJX A;  4P4D A;  3T0T A;  3B3W A;  3H8F A;  4CYP A;  2ABZ A;  4YWY A;  1JWQ A;  3QAH A;  4CAV A;  1ELM P;  1LRZ A;  4OC1 A;  1A2Z A;  2AFX A;  1Y9W A;  2ZEO A;  4TNU A;  4A32 A;  4IIX A;  4MCQ A;  3ZJ0 A;  1IOI A;  1MJB A;  1WJT A;  1S7K A;  3B7I A;  3D66 A;  1IYK A;  3WC7 A;  2AFW A;  1U6M A;  4G1P A;  4H6U A;  1VKC A;  1S7F A;  4FD4 A;  5F9M A;  1ZG9 A;  2JEW A;  1YLO A;  4KOY A;  5F1Y A;  4OID A;  4MI1 A;  2OB0 A;  2FXF A;  4OC0 A;  2JLM A;  3SXN A;  2PCU A;  4HNX B;  4J3G A;  4LUA A;  3R96 A;  4RUH A;  2V8D A;  4UFV A;  1KZF A;  1Q7L A;  1AYE A;  4KLW A;  2C5Q A;  2Z10 A;  1RXT A;  3T5M A;  2GE3 A;  4PXB A;  1AMP A;  2XPO A;  1P4N A;  2PJ1 A;  4EWT A;  2WSA A;  3IGR A;  4ORF A;  4F9U A;  1CG2 A;  2ZOG A;  3IJ3 A;  2NSM A;  2JDD A;  3FH4 A;  3I1U A;  4A4B A;  3S6K A;  3HMJ G;  1CP7 A;  1XE4 A;  2DPS A;  3PRT A;  4MY3 A;  2IL4 A;  4DNC A;  3RBU A;  4UEZ A;  1YR0 A;  2FT0 A;  5C88 A;  1YQE A;  3CZX A;  4NGQ A;  3BI1 A;  3TLG A;  1NMT A;  2PJ8 A;  2V8V A;  3JVN A;  4MJX A;  1MK4 A;  2R7H A;  1R61 A;  4O23 A;  5JYB A;  4CGN A;  2XPL A;  2RC4 A;  3CXS A;  1V6C A;  1ON0 A;  5IR2 A;  4C8A A;  2JBJ A;  2Z3O A;  2H5M A;  4GM5 A;  1BO4 A;  1EE3 P;  2YND A;  3V8I A;  1DTD A;  3KL9 A;  3KR4 A;  1S5K A;  2VL1 A;  2ZPA A;  5J8C A;  3C8O A;  4MMO A;  2Z0Z A;  2X7B A;  4IK2 A;  2R8V A;  4MHY A;  3B3T A;  2PRB A;  3TCV A;  4FUU A;  4BIN A;  3PLF B;  4P4I A;  1XIX A;  2PCN A;  1GYT A;  4KSA A;  3T05 A;  1ZO0 A;  2ANP A;  3SJE A;  4HKF A;  1BLL E;  2A4N A;  3VRP A;  3TT2 A;  4C86 A;  4AG9 A;  2R98 A;  3F5B A;  3V38 A;  3FX6 A;  3S9N A;  4BTF A;  2YJV A;  2FCK A;  2ZEE A;  2RB7 A;  5THW A;  3PFV A;  2CNT A;  4YGO A;  4R3L A;  4OC3 A;  2ZEF A;  3G8W A;  4FBE A;  2C1C A;  7CPA A;  4UEE A;  1M4L A;  1CS0 B;  4C2Y A;  1XMB A;  2V8H A;  4ZBG A;  2CNM A;  3MGD A;  5F49 A;  4ZI6 A;  1I12 A;  2PJA A;  4KUB A;  4ZY2 A;  4P45 A;  3B2Y A;  3GIU A;  5HVF A;  4CYO A;  3SHP A;  5LRJ A;  2ZOF A;  3GB0 A;  4C9R A;  4CGL A;  2PQ8 A;  4I49 A;  3VRN A;  4UA3 A;  4C9V A;  1CPX A;  3P2F A;  4MHD A;  4FD5 A;  1PYT B;  3CDX A;  5HKZ A;  5HH1 A;  1RO5 A;  4A94 A;  4C8F A;  1ZL0 A;  1VGY A;  4UIA A;  2Q44 A;  4JWP A;  5AG5 A;  4C2Z A;  4P44 A;  4MXU A;  1I21 A;  2GRE A;  4NGP A;  4M6H A;  2ATR A;  1M4G A;  1IB1 E;  4UBR A;  4DJL A;  1IY7 A;  4C9E A;  3K9U A;  2WYR A;  2OU2 A;  3R9G A;  2VEZ A;  4OIW A;  3RAM A;  4A38 A;  3IFE A;  4KSI A;  3G3S A;  1UWY A;  4KOT A;  3TO7 A;  4B12 A;  2OZU A;  2P6F A;  1FY7 A;  2P6E A;  3H4Q A;  3F8K A;  5JM6 A;  2FIA A;  2Q4Y A;  5G1Z A;  5BWA B;  1VI4 A;  1IID A;  3TX8 A;  2D0O A;  4Q7A A;  4LQG A;  2J8M A;  2PJ5 A;  3DDD A;  2Q43 A;  4M85 A;  2BSW A;  2VQY A;  2YNE A;  3KGQ A;  4KOW A;  3KHX A;  4PK2 A;  4F0X A;  1Q5X A;  3A9L A;  5F09 A;  2POK A;  2AUN A;  2EZB A;  1BPN A;  3LWU A;  3EO4 A;  4P10 A;  4E5S A;  2DIK A;  3BUM B;  2HQY A;  2FS5 A;  4PXD A;  3CT9 A;  4X8I A;  2YJT A;  1Z5R A;  4KVO E;  5JPH A;  3VGO A;  1VHS A;  1YRE A;  4H89 A;  2D0P A;  4DYO A;  4COB A;  3N7Z A;  1QST A;  2XPP A;  3BI0 A;  3FXT A;  3D4U A;  3H5Z A;  4Q38 A;  4JVO A;  1TF9 A;  1Z4R A;  4JYW A;  3KQZ A;  3D67 A;  3GUX A;  2EK9 A;  2V77 A;  3EZB A;  4W9Y A;  1IOF A;  3OB2 B;  1K4J A;  2NMT A;  4NEX A;  4HPS A;  1CX8 A;  3IWG A;  4XPD C;  4OAE A;  5AXI A;  1EO0 A;  2B5G B;  4Y49 B;  3PBE A;  2KCW A;  1FT7 A;  3LMS A;  4R6T A;  2D4O A;  4QBJ A;  4P4B A;  3IWE A;  4P4J A;  1ARM A;  1Z9E A;  1QSO A;  2O53 A;  2F7V A;  3B35 A;  1JDE A;  3DLJ A;  4MY0 A;  4CAF A;  5HVH A;  1LOK A;  3IWW A;  2ZEN A;  1Y0R A;  3QNV A;  4PV6 A;  3TLC A;  2ZW4 A;  3FNC A;  5KTA A;  1KWM A;  4NSQ A;  4UIB A;  2UV8 G;  2FVG A;  4UCN A;  4FAI A;  5LYD A;  1IIC A;  2PJ6 A;  5FVJ A;  4F6A A;  4NGR A;  1M4D A;  2ZEH A;  4A33 A;  2G0B A;  3SI1 A;  3GLJ A;  4WWV A;  3CPA A;  2HUZ A;  4XPK A;  4CRY B;  3T07 A;  3NFZ A;  3W6X A;  4A37 A;  2XEG A;  2QIR A;  2WZN A;  4OC2 A;  1J3L A;  4TWE A;  1PUA A;  3EZA A;  4CRZ B;  2EZC A;  4NCZ A;  2FM4 A;  2R1I A;  1S7N A;  3FJU A;  3JRU A;  4PSW A;  4UCP A;  3FIX A;  4DUK A;  1WVM A;  4IIY A;  1QSN A;  4JD6 A;  1XFO A;  4II9 A;  1YSJ A;  4RS2 A;  3DSB A;  3QB8 A;  5J3X A;  2FE7 A;  3RYO A;  4FD7 A;  2OLS A;  1XMT A;  1IU8 A;  3PB9 X;  2YNC A;  4R9M A;  5IV0 A;  4H1H A;  5HKW A;  5LYF A;  1I1D A;  5I0C A;  3HUV A;  2WPX A;  2ZEL A;  1Z9U A;  4B10 A;  1Z8X A;  4INJ A;  3D7F A;  1LCP A;  5G21 A;  2N3A B;  3SI2 A;  4BBH A;  5BY0 A;  1YLE A;  3DGV A;  2F5I A;  2HI6 A;  1Z2L A;  2Q7S A;  2GIV A;  4OAD A;  3PZJ A;  1XF1 A;  2EK8 A;  4MJ8 A;  3WC5 A;  3TE4 A;  2AFZ A;  2ZEG A;  3WC6 A;  1C30 B;  3ZNI A;  4KOV A;  3D7G A;  4A30 A;  4C8T A;  3NE7 A;  4CPA A;  2CTC A;  1KC7 A;  3S6F A;  1R57 A;  2EWB A;  3RNZ A;  3CXP A;  1YVH A;  1ZLI A;  4CO9 A;  2B4D B;  4UF4 A;  2PSW A;  3FRM A;  3K4I A;  1TXR A;  1L0C A;  2JBK A;  2HC9 A;  4MHN A;  4M8D A;  4B5P B;  2PJ7 A;  3D8P A;  1CP6 A;  3LD2 A;  4OLL A;  1LFW A;  3T8W A;  2P0W A;  2Z3K A;  4BPX B;  3FVL A;  4C85 A;  4BMH A;  1CPS A;  1XEB A;  2C27 A;  3ISZ A;  4U5Y A;  3WR7 A;  2HWG A;  4KNG E;  4XNH C;  1JDB C;  5J8F A;  3LOD A;  3RO0 A;  5D29 A;  1CM0 A;  4IHM A;  1N71 A;  2EVN A;  3KI9 A;  3IC1 A;  4QUS A;  3PEI A;  2I00 A;  2WUU A;  4ONW A;  2VBQ A;  4X5K A;  3VWD A;  3W91 A;  1M6V B;  2CY2 A;  2XEF A;  3KHZ A;  4NXY A;  2O28 A;  5H86 A;  2XEJ A;  1S7L A;  2Q7B A;  5K8M A;  1AUG A;  2DXQ A;  3U1B A;  2G9D A;  5A28 A;  4UEF A;  3TLA A;  5F5X A;  2P6G A;  4KZT A;  5AG6 A;  4FD6 A;  2CTB A;  2EBJ A;  4C9A A;  4K3N A;  4CAW A;  1M44 A;  3C26 A;  2Z3P A;  2PJ4 A;  1YGH A;  3SI0 A;  4E0A A;  1Z8T A;  1TF8 A;  2CXA A;  5JH9 A;  4NGN A;  1VHO A;  1NXJ A;  1DE4 C;  3HLP A;  3KAS A;  3RZA A; 
#chains in the Genus database with same CATH homology
 3PFO A;  4Z65 A;  2F8H A;  2PJ3 A;  3SJX A;  3PFE A;  2QJ8 A;  4PPZ A;  2GU2 A;  5K8P A;  2I3C A;  2J9A A;  3FF3 A;  3N5F A;  4BD9 A;  3B3C A;  4F9V A;  3FED A;  3KZW A;  4PQA A;  3L2N A;  2XEI A;  5D8N A;  5LYI A;  3PB4 X;  1F2P A;  3IEH A;  4X2T A;  3PB7 X;  4F8Z A;  3MRU A;  2PVV A;  1XJO A;  5DS0 A;  2BCO A;  8CPA A;  2PJC A;  3S9M A;  2C6P A;  5ELY A;  3IIB A;  1TKF A;  3SJG A;  3NH5 A;  2AFM A;  1R3N A;  3WT4 A;  2OOT A;  2IJZ A;  2CIJ A;  4C8C A;  1XRY A;  3FMC A;  4R7M A;  4C99 A;  4P4F A;  1ARL A;  1HDQ A;  5IR2 A;  1NSA A;  5CPA A;  2AFS A;  4JZ0 A;  2RFH A;  6CPA A;  4C9U A;  4CDK A;  3B3S A;  5K8O A;  1LAM A;  3B3V A;  3EIF A;  3PBB A;  1Y7E A;  4P6Y A;  4EFD A;  3VAT A;  1CBX A;  4WJB A;  5LRG A;  4MRI A;  2PE3 A;  2IMO A;  5JGF A;  5LYL A;  2ZEP A;  2ZED A;  4R76 A;  3D7H A;  2GLF A;  3V7Z A;  5LRK A;  1Y9Z A;  4IAV A;  3K2K A;  4PXC A;  4C84 A;  2QYV A;  4AXV A;  2DEA A;  4B6Z A;  1RTQ A;  4MCS A;  4C8P A;  4H2K A;  2Q51 A;  3KQX A;  5K8N A;  1YW6 A;  1R43 A;  1YW4 A;  3K9T A;  3I6S A;  1PCA A;  2V8G A;  3CPX A;  5HVG A;  3H8E A;  2O4H A;  1QQ9 A;  3NH8 A;  4R8F A;  1F57 A;  4MCR A;  1TKJ A;  1TKH A;  5HXD A;  1JQG A;  4OKO A;  2C6C A;  4FWU A;  1BAV A;  4YU9 A;  4A39 A;  1XBU A;  2AFO A;  4OME A;  2PJB A;  1Y0Y A;  2PRQ A;  4NFR A;  4OC4 A;  1IGB A;  1VHE A;  5CBM A;  4CDJ A;  2GP4 A;  3PB6 X;  4PXE A;  3D7D A;  3H8G A;  2NYQ A;  3ISX A;  4YN3 A;  1QMU A;  4NGS A;  4C8U A;  3VH9 A;  3PB8 X;  3ICU A;  5IB9 A;  3D68 A;  3NA6 A;  2PJ2 A;  1VIX A;  4ZX8 A;  1LAP A;  4P4E A;  2HB6 A;  1YME A;  4EME A;  4TJV A;  2PIZ A;  1BPM A;  3I74 A;  4NJR A;  2ZEM A;  3VAR A;  1LAN A;  2AFU A;  1HEE A;  2PJ0 A;  2BOA A;  4ZY0 A;  3MN8 A;  3VTA A;  3FEC A;  4NGT A;  1H8L A;  4NJQ A;  2BO9 A;  2CF4 A;  2OR4 A;  2PJ9 A;  1ZG7 A;  1ZG8 A;  4ZX9 A;  4OP4 A;  3S9L A;  4OC5 A;  4MHZ A;  2PIY A;  3BXM A;  5J1Q A;  1HDU A;  2QVP A;  3NH4 A;  3WAB A;  1ZLH A;  3IO1 A;  2C6G A;  2PVW A;  4NGM A;  1ELL P;  1FNO A;  4X3R A;  1OBR A;  3FEE A;  4ZYQ A;  2IQ6 A;  1F2O A;  1Z8L A;  4MCP A;  4MHP A;  3TC8 A;  3KR5 A;  5I4M A;  3BHX A;  2GLJ A;  4ZY1 A;  3SJF A;  2Q4Z A;  4TJX A;  4P4D A;  3B3W A;  3H8F A;  2ABZ A;  4YWY A;  1ELM P;  4OC1 A;  2ZEO A;  2AFX A;  4TNU A;  4MCQ A;  3B7I A;  3D66 A;  3WC7 A;  2AFW A;  4G1P A;  1ZG9 A;  2JEW A;  1YLO A;  4OID A;  4OC0 A;  2PCU A;  4RUH A;  2V8D A;  2C5Q A;  1Q7L A;  1AYE A;  4PXB A;  1AMP A;  2PJ1 A;  4EWT A;  4F9U A;  1CG2 A;  2ZOG A;  3IJ3 A;  2NSM A;  3FH4 A;  3I1U A;  1CP7 A;  3PRT A;  3RBU A;  4UEZ A;  4NGQ A;  3BI1 A;  2PJ8 A;  2V8V A;  4O23 A;  1V6C A;  4C8A A;  2JBJ A;  4GM5 A;  1EE3 P;  1DTD A;  3KL9 A;  3KR4 A;  2VL1 A;  4MMO A;  4IK2 A;  4MHY A;  3B3T A;  4FUU A;  4P4I A;  1GYT A;  2ANP A;  3SJE A;  1BLL E;  4C86 A;  3V38 A;  3FX6 A;  3S9N A;  2ZEE A;  2RB7 A;  5THW A;  4OC3 A;  2ZEF A;  4FBE A;  2C1C A;  7CPA A;  4UEE A;  1M4L A;  1XMB A;  2V8H A;  4ZI6 A;  2PJA A;  4ZY2 A;  4P45 A;  3B2Y A;  5HVF A;  5LRJ A;  2ZOF A;  3GB0 A;  4C9R A;  4C9V A;  1CPX A;  1PYT B;  3CDX A;  4A94 A;  1VGY A;  4UIA A;  4P44 A;  4MXU A;  2GRE A;  4NGP A;  4DJL A;  4C9E A;  1IY7 A;  2WYR A;  4A38 A;  4OIW A;  3RAM A;  3IFE A;  4KSI A;  1UWY A;  5JM6 A;  3TX8 A;  4Q7A A;  4LQG A;  2PJ5 A;  5JH9 A;  2Q43 A;  4C8F A;  3KGQ A;  3KHX A;  5F09 A;  2POK A;  1BPN A;  3LWU A;  4P10 A;  4PXD A;  3CT9 A;  4X8I A;  1Z5R A;  4DYO A;  3BI0 A;  3D4U A;  1TF9 A;  3KQZ A;  4JYW A;  3D67 A;  3GUX A;  2V77 A;  2EK9 A;  4W9Y A;  1CX8 A;  3PBE A;  1FT7 A;  3LMS A;  4R6T A;  4P4B A;  4P4J A;  1ARM A;  2O53 A;  2F7V A;  3B35 A;  3DLJ A;  5HVH A;  1LOK A;  3IWW A;  2ZEN A;  1Y0R A;  3QNV A;  1KWM A;  4UIB A;  2FVG A;  4FAI A;  5LYD A;  2PJ6 A;  4NGR A;  2ZEH A;  3SI1 A;  3GLJ A;  4WWV A;  3CPA A;  3NFZ A;  4A37 A;  2XEG A;  2WZN A;  4OC2 A;  4TWE A;  3FJU A;  3JRU A;  4DUK A;  1WVM A;  1XFO A;  1YSJ A;  3PB9 X;  5LYF A;  3HUV A;  2ZEL A;  3D7F A;  1LCP A;  3SI2 A;  3DGV A;  1Z2L A;  1XF1 A;  2EK8 A;  3WC5 A;  2AFZ A;  2ZEG A;  3WC6 A;  3D7G A;  4C8T A;  4CPA A;  2CTC A;  2EWB A;  1ZLI A;  4UF4 A;  1TXR A;  4MHN A;  2JBK A;  2HC9 A;  2PJ7 A;  1CP6 A;  1LFW A;  3T8W A;  3FVL A;  4C85 A;  1CPS A;  3ISZ A;  4KNG E;  5D29 A;  4IHM A;  3KI9 A;  3IC1 A;  3PEI A;  4ONW A;  2XEF A;  3KHZ A;  2XEJ A;  5K8M A;  2G9D A;  4UEF A;  2CTB A;  4C9A A;  4K3N A;  3SI0 A;  2PJ4 A;  1TF8 A;  4NGN A;  1VHO A;  1DE4 C;  3HLP A;  3KAS A;  3RZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...