2CIJA

Membrane-bound glutamate carboxypeptidase ii (gcpii) with bound methionine
Total Genus 244
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
244
sequence length
694
structure length
687
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
publication title Glutamate Carboxypeptidase II
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 244
structure length 687
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2cijA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2cijA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2cijA02
2F8HA 2I3CA 2C1CA 4ZY0A 4WJBA 3ICUA 1Q7LA 3GLJA 3VATA 5CBMA 4OC2A 1ZG7A 3N5FA 4NGPA 3WABA 3D7FA 3JRUA 2BOAA 2O53A 3RBUA 4NJQA 4MCRA 1TF8A 3IJ3A 3KQXA 2AFOA 4P4BA 4PXDA 5LYIA 2HB6A 4X8IA 1Z2LA 5J1QA 3S9MA 3T8WA 5I4MA 4AXVA 4K3NA 4R8FA 4FUUA 1Z5RA 4C8PA 4UEZA 4FWUA 2F7VA 3MRUA 2CTCA 2XEFA 3IC1A 3PEIA 2PJ3A 2XEJA 3D7HA 1YW6A 3H8FA 2PVWA 2C6PA 3CPXA 2NYQA 4B6ZA 1ZG8A 3SI0A 5THWA 2BCOA 4H2KA 1VHOA 3NA6A 4DUKA 4C84A 3IWWA 1Z8LA 1TKHA 3KR4A 4P44A 4DJLA 2ZEMA 4C99A 2FVGA 3BXMA 2ZEDA 4IAVA 4X2TA 4F8ZA 1H8LA 3DGVA 4ZI6A 5JGFA 4C8CA 3K2KA 2QYVA 3PBBA 1BPMA 5K8MA 2PE3A 1ZLHA 4C85A 4MCQA 5HXDA 3FEDA 1XJOA 4UF4A 7CPAA 1BPNA 3BI0A 1CG2A 4P4FA 2ANPA 4KNGE 3PBEA 1EE3P 6CPAA 2ABZA 3FH4A 4UIBA 1GYTA 2BO9A 2HC9A 1YW4A 3FJUA 1HDQA 4C9RA 2CF4A 3SJXA 1CX8A 4NGNA 2GREA 4C8TA 2C6GA 1PCAA 5JM6A 4BD9A 2WYRA 2GU2A 2AFSA 4PQAA 2ZOFA 4MCSA 3KQZA 3B2YA 2ZELA 2ZOGA 3PFEA 2JBJA 2PJ7A 3WC6A 3FX6A 4ZX8A 2O4HA 4KSIA 2V77A 2C6CA 3D7DA 3D66A 2AFUA 3NH4A 4OC4A 4UEEA 1ARMA 4C8UA 3H8EA 5CPAA 3VARA 4A37A 2AFXA 1RTQA 4P6YA 1XMBA 3I6SA 1CBXA 2VL1A 4P4IA 5DS0A 2GLJA 4WWVA 4X3RA 4MMOA 4JYWA 2PJ2A 1LCPA 3B3WA 3PFOA 1IGBA 2POKA 3CT9A 3SJEA 4PXEA 4CDJA 2ZEPA 4ZY2A 3PB4X 2EK9A 4R7MA 4ZX9A 4IHMA 2NSMA 2ZEFA 3LMSA 2PJBA 5LYFA 1FT7A 2PCUA 4LQGA 2PRQA 4NGQA 2AFZA 1TXRA 1XFOA 4EFDA 5K8OA 1FNOA 1CPXA 5HVFA 3RZAA 1YLOA 4C9EA 4CDKA 3WC5A 4MHZA 4PXBA 3KASA 5LYLA 4RUHA 2ZEHA 2RFHA 3B7IA 3D7GA 4EMEA 4C86A 3BHXA 3IEHA 1TF9A 3WT4A 4W9YA 4F9UA 4ONWA 3B3SA 4TWEA 4MCPA 5LYDA 4CPAA 3TX8A 3EIFA 2PJ5A 1F2PA 1LOKA 4F9VA 1Y0RA 3SI2A 3GUXA 3PB7X 1NSAA 2ZENA 3DLJA 2PJ6A 1Y0YA 3I74A 3SJFA 1DE4C 3CPAA 1BAVA 4MRIA 3PRTA 1WVMA 4OIWA 2V8HA 3KI9A 3ISZA 1CP6A 4P10A 3LWUA 3FF3A 2IQ6A 5D29A 1V6CA 1DTDA 4A38A 3PB8X 3FMCA 1VHEA 3B3CA 1ELLP 4NGMA 2XEIA 3D4UA 1HEEA 5K8NA 3HUVA 3V38A 2PJ4A 4P45A 2G9DA 4DYOA 5K8PA 1VGYA 2GLFA 1R3NA 4ZY1A 2PJ9A 3KL9A 4UIAA 4NGTA 4GM5A 3H8GA 2OR4A 1AYEA 4C9VA 3I1UA 1IY7A 1HDUA 2PIYA 3KZWA 4C9AA 2V8VA 3FEEA 1BLLE 1LFWA 1ZLIA 4ZYQA 1TKFA 3VH9A 8CPAA 4PXCA 4R76A 3IO1A 3QNVA 2PJAA 3WC7A 3HLPA 1R43A 1YSJA 2Q51A 3NH5A 4A39A 3B3TA 4O23A 1ELMP 4P4EA 2PJCA 4OC0A 2PJ0A 5LRGA 2Q4ZA 4MXUA 4MHPA 2PJ8A 2ZEGA 2IJZA 4OKOA 2EWBA 2CTBA 2V8GA 3KR5A 5IB9A 1JQGA 2RB7A 2JEWA 4C9UA 2JBKA 4OC3A 2QVPA 4OIDA 3BI1A 2CIJA 1ARLA 3NFZA 3FVLA 4Q7AA 4P4DA 3K9TA 4NFRA 3IFEA 1XBUA 3KHZA 5HVHA 3SJGA 3B3VA 4YWYA 1M4LA 2ZEOA 3PB6X 1PYTB 5ELYA 4R6TA 3NH8A 3D68A 4OP4A 4OC1A 3TC8A 1LAPA 2PIZA 4P4JA 2V8DA 4MHYA 2PJ1A 1VIXA 2DEAA 3SI1A 1OBRA 3VTAA 4PPZA 4IK2A 5D8NA 4NGSA 1KWMA 2OOTA 5F09A 3V7ZA 5HVGA 3PB9X 1YMEA 1XF1A 1LANA 4FAIA 2Q43A 4TJVA 4FBEA 2EK8A 3L2NA 4OMEA 3S9LA 2AFMA 4OC5A 4MHNA 4Z65A 4C8AA 4JZ0A 1QMUA 2PVVA 1XRYA 3CDXA 4TJXA 1CP7A 4NJRA 5LRKA 1QQ9A 1UWYA 3ISXA 4YN3A 1CPSA 3KHXA 2ZEEA 5JH9A 3IIBA 1AMPA 4EWTA 3KGQA 4G1PA 4TNUA 3GB0A 5LRJA 3B35A 4UEFA 2WZNA 1F57A 2QJ8A 1ZG9A 2AFWA 1Y7EA 1Y9ZA 1LAMA 3D67A 4C8FA 4YU9A 4A94A 4NGRA 1F2OA 2XEGA 2J9AA 2IMOA 3S9NA 1TKJA 3RAMA 3FECA 3MN8A
chains in the Genus database with same CATH superfamily
2F8HA 2I3CA 4C2XA 3K4IA 2C1CA 1EO0A 4ZY0A 4WJBA 4A4CA 3R95A 1QSNA 4CGMA 1R61A 3ICUA 1Q7LA 3TLYA 3GLJA 3VATA 5CBMA 1QSTA 2Q7BA 4OC2A 1MJ9A 1ZG7A 2FSRA 2HV2A 3N5FA 4HNXB 4NGPA 3WABA 3DR8A 2VQYA 3R9FA 3D7FA 5HH1A 1JDBC 4PK2A 2XPNA 3JRUA 5F49A 1FBVA 5HKWA 2BOAA 4GXHA 2ZPAA 2O53A 4JD6A 3RBUA 4MY3A 5KTCA 4LQ6A 4NJQA 4LX9A 3BJ7A 3EFAA 4PSWA 2ZW7A 4MCRA 4BPWB 3U88C 3I9SA 4JXRA 1TF8A 3IJ3A 3G23A 1A2ZA 3KQXA 2AFOA 4P4BA 4KVXA 4PXDA 5LYIA 2HB6A 4OADA 5G20A 4E8OA 2G3TA 4J3GA 1JDEA 2EZAA 2VEZA 4KLWA 4BPXB 2P0WA 4X8IA 1WWZA 1Z2LA 2DXQA 2F5IA 5J8CA 4UBRA 5J1QA 3TYXA 4CGNA 4NF1A 4MI1A 3S9MA 1M6VB 3T8WA 3OP0A 5I4MA 3LODA 1IOFA 3OB1B 4AXVA 4K3NA 4R8FA 4FUUA 2FL4A 2PR1A 4XNHC 3OB2B 5G1ZA 2H5MA 2Z0ZA 4A32A 1Z5RA 4PV6A 4C8PA 4UEZA 4KOTA 4FWUA 2F7VA 2Q4YA 2Z3LA 4U9YA 3MRUA 2CTCA 4Q36A 3BLNA 2XEFA 4JLYA 3IC1A 3PEIA 2PJ3A 2XEJA 2GANA 3D7HA 4KLVA 4L8AA 4Q38A 2YNCA 3PLFB 1AUGA 1YW6A 4ZBGA 4MJXA 1M1DA 3H8FA 2C5QA 2PVWA 2C6PA 1CM0A 2JEVA 1A9XB 3CPXA 3EO4A 2Z3NA 2NYQA 4QBJA 4B6ZA 1ZG8A 3SI0A 3W91A 5THWA 2DPSA 2BCOA 4INJA 1Z8XA 3T0TA 4H2KA 2YJVA 4C7HA 4JWPA 1X12A 4XPDC 1VHOA 3NA6A 5AGEA 3T07A 4MJ8A 4DUKA 3IWWA 3FB3A 4B10A 1Z8LA 1TKHA 3KR4A 4C2YA 4P44A 1CJWA 5A28A 2QECA 2ZEMA 4DJLA 1Q5XA 4C99A 2FVGA 3PT1A 4KORA 3JTKA 1YVHA 4KOWA 4EYSA 3BXMA 2DLAA 2Z3PA 2ZEDA 2CNSA 1IB1E 4IAVA 4X2TA 4F8ZA 2GIVA 1H8LA 3DGVA 4ZI6A 3T5MA 5JGFA 4C8CA 3K2KA 1C3OB 2PDOA 2QYVA 3PBBA 4HNWB 1BPMA 4BINA 5K8MA 2PE3A 1DIKA 4R9MA 2FM4A 4COBA 1ZLHA 4C85A 4MCQA 2EUIA 5HXDA 1B47A 3FEDA 4MY0A 4XNHB 4C7IA 1XJOA 4OAEA 4UF4A 4R57A 3IU2A 2K5TA 3D2MA 2JLMA 2DF5A 1BPNA 3BI0A 1CG2A 7CPAA 4IIXA 4P4FA 2ANPA 1GHEA 4KNGE 3PBEA 1EE3P 4MFLA 1KZFA 6CPAA 2ABZA 2R7HA 3PFVA 4F6AA 2D0OA 3JUWA 5DWNA 1CS0B 3BUWB 3FH4A 5C82A 4KOSA 4UIBA 4PK3A 2Y0MA 2B4JC 1GYTA 2BO9A 2HC9A 1YW4A 3FJUA 4CYOA 4UFXA 1HDQA 4KSFA 3ZZIA 4ONUA 3KRVA 4M8DA 2XPOA 3H5ZA 4C9RA 3NOJA 2MP0A 1S7KA 2CF4A 3SJXA 1CX8A 4NGNA 2HI6A 2GREA 4XPDB 2C6GA 3O8ZA 1VHSA 4C8TA 1EZBA 3TCVA 4UCPA 1PCAA 1Y9KA 1ZRSA 5JM6A 4BD9A 1MJBA 1RXTA 1YVKA 2GU2A 2R1IA 2WYRA 5FD8A 4BTFA 4EVYA 2AFSA 2BL1A 4QC6A 3CXSA 3VROA 2FS5A 3IWGA 3EZAA 2BUEA 2J8NA 4PQAA 2FXFA 5GCNA 2ZOFA 4AG7A 4MCSA 3TO7A 4J0NA 2Z3OA 3KQZA 4KOYA 3B2YA 4QVTA 1VI4A 2ZELA 2B3UA 4RN7A 3HPHE 1TIQA 2Q04A 2ZOGA 3PFEA 1Z4RA 3TTHA 1CE8B 2JBJA 2PJ7A 4QB9A 3WC6A 2WUUA 4C84A 1PU9A 1ZYMA 1OZPA 3FX6A 4ZX8A 3R9GA 5HMNA 2O4HA 1M4DA 4KSIA 1KUYA 4II9A 2V77A 4KUBA 2B4DB 2C6CA 3D7DA 3VGOA 3D66A 2IL4A 2AFUA 3NH4A 1I1DA 4NCZA 4OC4A 4UEEA 1NMTA 1ARMA 4XPKA 4C8UA 2R8VA 3H8EA 5CPAA 3RO0A 3VARA 1YGHA 4UFWA 2AE6A 3TLAA 3K9UA 3TOBA 4A37A 2AFXA 1RTQA 3EXNA 2BEIA 4P6YA 4NSQA 3RYOA 4CO9A 1XMBA 4M3SA 3I6SA 4A30A 1CBXA 2VL1A 4P4IA 3QB8A 5DS0A 2Y1MA 3LD2A 1Q2YA 4K30A 5IB0A 1M4IA 3BUXB 2GLJA 4WWVA 4X3RA 4MMOA 3S6KA 3G8WA 4F0YA 4JYWA 2OZUA 2PJ2A 4CYNA 2PRBA 1LCPA 4AB7A 2JDCA 3F9KC 3B3WA 2R82A 2XPLA 1IGBA 3PFOA 1I12A 2POKA 2VZYA 2D4OA 3OWCA 3CT9A 2J8RA 1KUXA 4AG9A 4CAWA 1GGOA 3SJEA 4UCMA 3FXTA 4PXEA 4FD4A 2ZEPA 4CDJA 1S7FA 4ZY2A 3EZEA 2B0AA 3PB4X 2EK9A 4R7MA 2PR8A 5JYBA 4ZX9A 2FT0A 3NE8A 4IHMA 2NSMA 2ZEFA 3LMSA 3PP9A 2NMTA 1Z9EA 4B5PB 1NBWA 2PJBA 3GKRA 3FYNA 4CAXA 3C8OA 1V0CA 4CAFA 1FT7A 5LYFA 4FD5A 3H4QA 4CGPA 2PCUA 4HPSA 1BXRB 4LQGA 1XF8A 2Y1NA 2PRQA 1ZL0A 4NGQA 1B6BA 2AFZA 4KOUA 1TXRA 1XFOA 2PQ8A 4EFDA 5K8OA 1FNOA 1CPXA 5HVFA 3QAYA 3IGRA 1YLOA 3RZAA 3SXOA 4C9EA 2P6EA 2HROA 3BUMB 2OZHA 4GPLB 3E0KA 3SXNA 3W6XA 1RO5A 1VBGA 4CDKA 2VXKA 3D8PA 4YRHA 4E2AA 5AG7A 4MFPA 1Q2DA 4MFKA 3V8IA 5IR2A 3WC5A 2PC1A 2Q4VA 2Z3KA 1WJTA 4MHZA 3KASA 4PXBA 5LYLA 4E94A 4RUHA 2ZEHA 3PGPA 2RFHA 2EO8A 1SQHA 3EZBA 3B7IA 2FIAA 4U5YA 3D7GA 5AG4A 5F5XA 3P2HA 1YQEA 1YR0A 4EMEA 4C86A 3BHXA 1Z8WA 3CZXA 3IEHA 3TO9A 1IICA 3NFQA 1TF9A 3WT4A 1YLEA 4W9YA 3DDDA 4CYPA 1T36B 2WPXA 1MJAA 1P0HA 2Z10A 3QAHA 4F9UA 1VKCA 2ATRA 4UWIA 5J3XA 4RR2B 1WK4A 4ONWA 3GYAA 4KVOE 4F0XA 3FBUA 2AUMA 4MBUA 1N71A 3B3SA 3DNSA 4TWEA 3TLBA 2UV8G 4MCPA 1YK3A 4IUSA 5LYDA 4CPAA 3BUNB 2GFQA 3TX8A 4X5KA 2C27A 4BBHA 5KTDA 1BOBA 3TFYA 2B5GB 4KZTA 2A4NA 4E5SA 3EY5A 1S3ZA 3EIFA 3GJZA 2PJ5A 5G22A 1F2PA 1LOKA 4F9VA 1Y0RA 3SI2A 3GUXA 4CAEA 3PB7X 2E28A 3JVNA 3VRQA 4GS4A 1S7LA 5H84A 1NSAA 2ZENA 3DLJA 3A9LA 2PJ6A 1Y0YA 3I74A 3VWEA 5F46A 3SJFA 4JXQA 4NEXA 1KBLA 1DE4C 4LUAA 4HKFA 3CPAA 1BAVA 2EVNA 3PRTA 3BUOB 4M85A 4MRIA 1WVMA 3TLGB 4MI4A 2X0SA 4OIWA 2V8HA 3TLZA 3KI9A 5CNPA 4B12A 3S6GA 2Z11A 1CP6A 3ISZA 4P10A 3R9EA 3SR3A 3VRNA 2DPTA 3LWUA 3FF3A 2Q44A 2IQ6A 5D29A 5EMIA 1NSLA 1C30B 1DTDA 1V6CA 3GY9A 4A38A 2Q0YA 3PB8X 2B4BA 1XOVA 4CZ1A 1ON0A 3TLEA 3FMCA 5JPHA 1VHEA 4COGA 1Z9UA 3B3CA 1ELLP 3VRRA 4NGMA 3IU1A 4HNYB 2ZXVA 3R1KA 5F13A 2XEIA 3D4UA 1HEEA 4CGOA 1FY7A 3GIUA 4C2ZA 5K8NA 3HUVA 3V38A 5JVLA 2OU2A 2FE7A 2PJ4A 2B58A 1X10A 4P45A 2CY2A 2G9DA 5F1YA 4DYOA 4B14A 5IV0A 5K8PA 1VGYA 2GLFA 1R3NA 2FIWA 4ZY1A 4M6IA 1B87A 4UWJA 2Z3MA 3DSBA 4M6GA 4ORFA 1XMTA 4BMHA 2PJ9A 1IIDA 5H86A 2EZBA 2YNCC 3KL9A 4PSXA 1Z4EA 4UIAA 4NGTA 4GM5A 3H8GA 2J8MA 2OR4A 1AYEA 2QIRA 4R3KA 3NE7A 2YGWA 4C9VA 3I1UA 2RC4A 4DNCA 1IY7A 3W6SA 3F5BA 1HDUA 4BPUB 5K99A 2PIYA 5F47A 1KC7A 3KZWA 4C9AA 4KOXA 3UY5A 4NXYA 1UFHA 5HKYA 2V8VA 3FEEA 1NXJA 1VBHA 1BLLE 3C26A 1Y9WA 1LFWA 4CYQA 2AUNA 2EZCA 3I3GA 1ZLIA 3LACA 4E0AA 2ZW6A 4ZYQA 5I0CA 2B4DA 1TKFA 3VH9A 8CPAA 1J4JA 4PXCA 4R76A 2P6GA 3FNCA 3IO1A 3S6HA 2YNDA 3QNVA 2GE3A 4CAVA 3OAKA 3VRPA 2PJAA 3EC4A 4B5OA 5F9MA 2I79A 2REEA 3WC7A 3HLPA 5F48A 1IYKA 1IU8A 1QSRA 4TJVA 5IX3A 1KEEB 1R43A 3MGDA 1YSJA 2Q51A 2OH1A 3NH5A 4KVME 4FD7A 4L89A 4KOVA 3B3TA 4UA3A 4O23A 4A39A 1ELMP 4P4EA 2PJCA 4OC0A 2QMLA 1MK4A 2REFA 2OZGA 2PJ0A 4RI1A 5LRGA 1NE9A 2Q4ZA 2FCKA 4MHPA 4MXUA 3R96A 2PJ8A 2R98A 2ZEGA 2IJZA 4OKOA 2EWBA 4H89A 2CTBA 3F8KA 1IYLA 2V8GA 3KR5A 4MHDA 1BO4A 3SHPA 1JQGA 1IOIA 1M44A 3T9YA 5IB9A 2RB7A 3TLCA 4CS0B 2VKZG 2JEWA 2OB0A 4C9UA 2JBKA 4OC3A 2QVPA 1LRZA 1U6MA 3P2FA 4R3LA 4OIDA 3BI1A 2CIJA 1ARLA 3DR6A 3TE4A 1QSMA 3NFZA 4B5PA 3FVLA 4Q7AA 4P4DA 3K9TA 1XIXA 3TO6A 1ZO0A 1YX0A 4NFRA 4B13A 3T05A 1KUVA 3IFEA 4KUAA 4UCNA 4A2ZA 1L0CA 1XBUA 2D4PA 3D3SA 3TOAA 3KHZA 5HVHA 5C88A 4CRZB 3SJGA 1Y7RA 3B3VA 4XPLA 4YWYA 4CGLA 3CXPA 1M4LA 3B8GA 2ZEOA 4M6HA 4MFJA 2VI7A 2X7BA 3PB6X 3WR7A 1PYTB 5ELYA 2EBJA 3CXQA 3N7ZA 4R6TA 3NH8A 3D68A 2CNTA 4OP4A 4OC1A 2CBLA 3TC8A 4B11A 1LAPA 3T90A 2PIZA 4P4JA 1M4GA 1EZAA 3G3SA 1R57A 1J3LA 1S5KA 2JDDA 2VBQA 4QUSA 4AVBA 5EC4A 4A95A 4JVOA 4H6UA 5J8FA 5JQ4A 2V8DA 2PSWA 3ZJ0A 1YVOA 4MHYA 5AG5A 2PJ1A 1VIXA 2DEAA 4MFQA 3FIXA 3VWDA 2YNEA 2OLSA 2G3AA 4KSAA 3KKWA 5DWMA 1S60A 3SI1A 1PUAA 1OBRA 4AVCA 3VTAA 2ODFA 2AJ6A 4IK2A 4PPZA 5D8NA 5FVJA 4NGSA 3S6FA 4A33A 5AXIA 5AG6A 2ARHA 1KWMA 2OOTA 5F09A 2CNMA 4I49A 5E96A 3V7ZA 5HVGA 3PZJA 2ZW4A 3HPGG 1YMEA 1LANA 3PB9X 2Q43A 1YREA 4H6ZA 4FAIA 3ZNIA 1XF1A 4FBEA 2EK8A 3L2NA 4OMEA 2HWGA 4RS2A 3S9LA 2AFMA 2HUZA 2N3AB 2B5GA 4OC5A 2P6FA 4MHNA 3RNZA 4Z65A 4C8AA 4JZ0A 4Y49C 3U1BA 1QMUA 2PVVA 4YGOA 1XRYA 3TT2A 3CDXA 5BY0A 4U9ZA 4TJXA 1CP7A 4NJRA 5G21A 2Q7SA 5KTAA 2WPWA 4OLLA 4R87A 5EBVA 1QSOA 2GP4A 5LRKA 1QQ9A 1UWYA 4A4BA 2B3VA 2VZZA 4JJXA 3ISXA 4YFJA 5A27A 2CXAA 4IIYA 1XEBA 4YN3A 2I00A 1CPSA 3KHXA 4AVAA 3FRMA 1I21A 2ZEEA 4CRYB 3IIBA 5BWAB 1JWQA 5JH9A 2YJTA 3TLGA 4IF5A 1AMPA 4EWTA 2HQYA 1Z8TA 1XE4A 3KGQA 2D0PA 2O28A 1Q2CA 4G1PA 4TNUA 3IWEA 3GB0A 4H1HA 3HMJG 5LRJA 3B35A 4KS9A 3D2PA 4MFZA 2KCWA 2WZNA 4UEFA 2DIKA 1F57A 2QJ8A 1P4NA 1ZG9A 2G0BA 2PCNA 2AFWA 1Y7EA 1Y9ZA 1LAMA 3D67A 4ZGYB 2BSWA 4C8FA 5HKZA 1K4JA 4YU9A 4FD6A 4NGRA 1F2OA 3BJ8A 4A94A 5ISVA 1S7NA 2XEGA 2J9AA 2IMOA 2ZW5A 2XPPA 3S9NA 4UFVA 1TKJA 3F0AA 2WSAA 3RAMA 4A31A 3FECA 4Y49B 3MN8A 4C68A
chains in the Genus database with same CATH topology
2F8HA 2I3CA 2C1CA 4ZY0A 4WJBA 3ICUA 1Q7LA 3GLJA 3VATA 5CBMA 4OC2A 1ZG7A 3N5FA 4NGPA 3WABA 3D7FA 3JRUA 2BOAA 2O53A 3RBUA 4NJQA 4MCRA 1TF8A 3IJ3A 3KQXA 2AFOA 4P4BA 4PXDA 5LYIA 2HB6A 4X8IA 1Z2LA 5J1QA 3S9MA 3T8WA 5I4MA 4AXVA 4K3NA 4R8FA 4FUUA 1Z5RA 4C8PA 4UEZA 4FWUA 2F7VA 3MRUA 2CTCA 2XEFA 3IC1A 3PEIA 2PJ3A 2XEJA 3D7HA 1YW6A 3H8FA 2PVWA 2C6PA 3CPXA 2NYQA 4B6ZA 1ZG8A 3SI0A 5THWA 2BCOA 4H2KA 1VHOA 3NA6A 4DUKA 4C84A 3IWWA 1Z8LA 1TKHA 3KR4A 4P44A 4DJLA 2ZEMA 4C99A 2FVGA 3BXMA 2ZEDA 4IAVA 4X2TA 4F8ZA 1H8LA 3DGVA 4ZI6A 5JGFA 4C8CA 3K2KA 2QYVA 3PBBA 1BPMA 5K8MA 2PE3A 1ZLHA 4C85A 4MCQA 5HXDA 3FEDA 1XJOA 4UF4A 7CPAA 1BPNA 3BI0A 1CG2A 4P4FA 2ANPA 4KNGE 3PBEA 1EE3P 6CPAA 2ABZA 3FH4A 4UIBA 1GYTA 2BO9A 2HC9A 1YW4A 3FJUA 1HDQA 4C9RA 2CF4A 3SJXA 1CX8A 4NGNA 2GREA 4C8TA 2C6GA 1PCAA 5JM6A 4BD9A 2WYRA 2GU2A 2AFSA 4PQAA 2ZOFA 4MCSA 3KQZA 3B2YA 2ZELA 2ZOGA 3PFEA 2JBJA 2PJ7A 3WC6A 3FX6A 4ZX8A 2O4HA 4KSIA 2V77A 2C6CA 3D7DA 3D66A 2AFUA 3NH4A 4OC4A 4UEEA 1ARMA 4C8UA 3H8EA 5CPAA 3VARA 4A37A 2AFXA 1RTQA 4P6YA 1XMBA 3I6SA 1CBXA 2VL1A 4P4IA 5DS0A 2GLJA 4WWVA 4X3RA 4MMOA 4JYWA 2PJ2A 1LCPA 3B3WA 3PFOA 1IGBA 2POKA 3CT9A 3SJEA 4PXEA 4CDJA 2ZEPA 4ZY2A 3PB4X 2EK9A 4R7MA 4ZX9A 4IHMA 2NSMA 2ZEFA 3LMSA 2PJBA 5LYFA 1FT7A 2PCUA 4LQGA 2C5QA 2PRQA 4NGQA 2AFZA 1TXRA 1XFOA 4EFDA 5K8OA 1FNOA 1CPXA 5HVFA 3RZAA 1YLOA 4C9EA 4CDKA 5IR2A 3WC5A 4MHZA 4PXBA 3KASA 5LYLA 4RUHA 2ZEHA 2RFHA 3B7IA 3D7GA 4EMEA 4C86A 3BHXA 3IEHA 1TF9A 3WT4A 4W9YA 4F9UA 4ONWA 3B3SA 4TWEA 4MCPA 5LYDA 4CPAA 3TX8A 3EIFA 2PJ5A 1F2PA 1LOKA 4F9VA 1Y0RA 3SI2A 3GUXA 3PB7X 1NSAA 2ZENA 3DLJA 2PJ6A 1Y0YA 3I74A 3SJFA 1DE4C 3CPAA 1BAVA 4MRIA 3PRTA 1WVMA 4OIWA 2V8HA 3KI9A 3ISZA 1CP6A 4P10A 3LWUA 3FF3A 2IQ6A 5D29A 1V6CA 1DTDA 4A38A 3PB8X 3FMCA 1VHEA 3B3CA 1ELLP 4NGMA 2XEIA 3D4UA 1HEEA 5K8NA 3HUVA 3V38A 2PJ4A 4P45A 2G9DA 4DYOA 5K8PA 1VGYA 2GLFA 1R3NA 4ZY1A 2PJ9A 3KL9A 4UIAA 4NGTA 4GM5A 3H8GA 2OR4A 1AYEA 4C9VA 3I1UA 1IY7A 1HDUA 2PIYA 3KZWA 4C9AA 2V8VA 3FEEA 1BLLE 1LFWA 1ZLIA 4ZYQA 1TKFA 3VH9A 8CPAA 4PXCA 4R76A 3IO1A 3QNVA 2PJAA 3WC7A 3HLPA 1R43A 1YSJA 2Q51A 3NH5A 4A39A 3B3TA 4O23A 1ELMP 4P4EA 2PJCA 4OC0A 2PJ0A 5LRGA 2Q4ZA 4MXUA 4MHPA 2PJ8A 2ZEGA 2IJZA 4OKOA 2EWBA 2CTBA 2V8GA 3KR5A 5IB9A 1JQGA 2RB7A 2JEWA 4C9UA 2JBKA 4OC3A 2QVPA 4OIDA 3BI1A 2CIJA 1ARLA 3NFZA 3FVLA 4Q7AA 4P4DA 3K9TA 4NFRA 3IFEA 1XBUA 3KHZA 5HVHA 3SJGA 3B3VA 4YWYA 1M4LA 2ZEOA 3PB6X 1PYTB 5ELYA 4R6TA 3NH8A 3D68A 4OP4A 4OC1A 3TC8A 1LAPA 2PIZA 4P4JA 2V8DA 4MHYA 2PJ1A 1VIXA 2DEAA 3SI1A 1OBRA 3VTAA 4PPZA 4IK2A 5D8NA 4NGSA 1KWMA 2OOTA 5F09A 3V7ZA 5HVGA 3PB9X 1YMEA 1XF1A 1LANA 4FAIA 2Q43A 4TJVA 4FBEA 2EK8A 3L2NA 4OMEA 3S9LA 2AFMA 4OC5A 4MHNA 4Z65A 4C8AA 4JZ0A 1QMUA 2PVVA 1XRYA 3CDXA 4TJXA 1CP7A 4NJRA 2GP4A 5LRKA 1QQ9A 1UWYA 3ISXA 4YN3A 1CPSA 3KHXA 2ZEEA 5JH9A 3IIBA 1AMPA 4EWTA 3KGQA 4G1PA 4TNUA 3GB0A 5LRJA 3B35A 4UEFA 2WZNA 1F57A 2QJ8A 1ZG9A 2AFWA 1Y7EA 1Y9ZA 1LAMA 3D67A 4C8FA 4YU9A 4A94A 4NGRA 1F2OA 2XEGA 2J9AA 2IMOA 3S9NA 1TKJA 3RAMA 3FECA 3MN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8H A;  2I3C A;  2C1C A;  4ZY0 A;  4WJB A;  3ICU A;  1Q7L A;  3GLJ A;  3VAT A;  5CBM A;  4OC2 A;  1ZG7 A;  3N5F A;  4NGP A;  3WAB A;  3D7F A;  3JRU A;  2BOA A;  2O53 A;  3RBU A;  4NJQ A;  4MCR A;  1TF8 A;  3IJ3 A;  3KQX A;  2AFO A;  4P4B A;  4PXD A;  5LYI A;  2HB6 A;  4X8I A;  1Z2L A;  5J1Q A;  3S9M A;  3T8W A;  5I4M A;  4AXV A;  4K3N A;  4R8F A;  4FUU A;  1Z5R A;  4C8P A;  4UEZ A;  4FWU A;  2F7V A;  3MRU A;  2CTC A;  2XEF A;  3IC1 A;  3PEI A;  2PJ3 A;  2XEJ A;  3D7H A;  1YW6 A;  3H8F A;  2PVW A;  2C6P A;  3CPX A;  2NYQ A;  4B6Z A;  1ZG8 A;  3SI0 A;  5THW A;  2BCO A;  4H2K A;  1VHO A;  3NA6 A;  4DUK A;  4C84 A;  3IWW A;  1Z8L A;  1TKH A;  3KR4 A;  4P44 A;  4DJL A;  2ZEM A;  4C99 A;  2FVG A;  3BXM A;  2ZED A;  4IAV A;  4X2T A;  4F8Z A;  1H8L A;  3DGV A;  4ZI6 A;  5JGF A;  4C8C A;  3K2K A;  2QYV A;  3PBB A;  1BPM A;  5K8M A;  2PE3 A;  1ZLH A;  4C85 A;  4MCQ A;  5HXD A;  3FED A;  1XJO A;  4UF4 A;  7CPA A;  1BPN A;  3BI0 A;  1CG2 A;  4P4F A;  2ANP A;  4KNG E;  3PBE A;  1EE3 P;  6CPA A;  2ABZ A;  3FH4 A;  4UIB A;  1GYT A;  2BO9 A;  2HC9 A;  1YW4 A;  3FJU A;  1HDQ A;  4C9R A;  2CF4 A;  3SJX A;  1CX8 A;  4NGN A;  2GRE A;  4C8T A;  2C6G A;  1PCA A;  5JM6 A;  4BD9 A;  2WYR A;  2GU2 A;  2AFS A;  4PQA A;  2ZOF A;  4MCS A;  3KQZ A;  3B2Y A;  2ZEL A;  2ZOG A;  3PFE A;  2JBJ A;  2PJ7 A;  3WC6 A;  3FX6 A;  4ZX8 A;  2O4H A;  4KSI A;  2V77 A;  2C6C A;  3D7D A;  3D66 A;  2AFU A;  3NH4 A;  4OC4 A;  4UEE A;  1ARM A;  4C8U A;  3H8E A;  5CPA A;  3VAR A;  4A37 A;  2AFX A;  1RTQ A;  4P6Y A;  1XMB A;  3I6S A;  1CBX A;  2VL1 A;  4P4I A;  5DS0 A;  2GLJ A;  4WWV A;  4X3R A;  4MMO A;  4JYW A;  2PJ2 A;  1LCP A;  3B3W A;  3PFO A;  1IGB A;  2POK A;  3CT9 A;  3SJE A;  4PXE A;  4CDJ A;  2ZEP A;  4ZY2 A;  3PB4 X;  2EK9 A;  4R7M A;  4ZX9 A;  4IHM A;  2NSM A;  2ZEF A;  3LMS A;  2PJB A;  5LYF A;  1FT7 A;  2PCU A;  4LQG A;  2PRQ A;  4NGQ A;  2AFZ A;  1TXR A;  1XFO A;  4EFD A;  5K8O A;  1FNO A;  1CPX A;  5HVF A;  3RZA A;  1YLO A;  4C9E A;  4CDK A;  3WC5 A;  4MHZ A;  4PXB A;  3KAS A;  5LYL A;  4RUH A;  2ZEH A;  2RFH A;  3B7I A;  3D7G A;  4EME A;  4C86 A;  3BHX A;  3IEH A;  1TF9 A;  3WT4 A;  4W9Y A;  4F9U A;  4ONW A;  3B3S A;  4TWE A;  4MCP A;  5LYD A;  4CPA A;  3TX8 A;  3EIF A;  2PJ5 A;  1F2P A;  1LOK A;  4F9V A;  1Y0R A;  3SI2 A;  3GUX A;  3PB7 X;  1NSA A;  2ZEN A;  3DLJ A;  2PJ6 A;  1Y0Y A;  3I74 A;  3SJF A;  1DE4 C;  3CPA A;  1BAV A;  4MRI A;  3PRT A;  1WVM A;  4OIW A;  2V8H A;  3KI9 A;  3ISZ A;  1CP6 A;  4P10 A;  3LWU A;  3FF3 A;  2IQ6 A;  5D29 A;  1V6C A;  1DTD A;  4A38 A;  3PB8 X;  3FMC A;  1VHE A;  3B3C A;  1ELL P;  4NGM A;  2XEI A;  3D4U A;  1HEE A;  5K8N A;  3HUV A;  3V38 A;  2PJ4 A;  4P45 A;  2G9D A;  4DYO A;  5K8P A;  1VGY A;  2GLF A;  1R3N A;  4ZY1 A;  2PJ9 A;  3KL9 A;  4UIA A;  4NGT A;  4GM5 A;  3H8G A;  2OR4 A;  1AYE A;  4C9V A;  3I1U A;  1IY7 A;  1HDU A;  2PIY A;  3KZW A;  4C9A A;  2V8V A;  3FEE A;  1BLL E;  1LFW A;  1ZLI A;  4ZYQ A;  1TKF A;  3VH9 A;  8CPA A;  4PXC A;  4R76 A;  3IO1 A;  3QNV A;  2PJA A;  3WC7 A;  3HLP A;  1R43 A;  1YSJ A;  2Q51 A;  3NH5 A;  4A39 A;  3B3T A;  4O23 A;  1ELM P;  4P4E A;  2PJC A;  4OC0 A;  2PJ0 A;  5LRG A;  2Q4Z A;  4MXU A;  4MHP A;  2PJ8 A;  2ZEG A;  2IJZ A;  4OKO A;  2EWB A;  2CTB A;  2V8G A;  3KR5 A;  5IB9 A;  1JQG A;  2RB7 A;  2JEW A;  4C9U A;  2JBK A;  4OC3 A;  2QVP A;  4OID A;  3BI1 A;  2CIJ A;  1ARL A;  3NFZ A;  3FVL A;  4Q7A A;  4P4D A;  3K9T A;  4NFR A;  3IFE A;  1XBU A;  3KHZ A;  5HVH A;  3SJG A;  3B3V A;  4YWY A;  1M4L A;  2ZEO A;  3PB6 X;  1PYT B;  5ELY A;  4R6T A;  3NH8 A;  3D68 A;  4OP4 A;  4OC1 A;  3TC8 A;  1LAP A;  2PIZ A;  4P4J A;  2V8D A;  4MHY A;  2PJ1 A;  1VIX A;  2DEA A;  3SI1 A;  1OBR A;  3VTA A;  4PPZ A;  4IK2 A;  5D8N A;  4NGS A;  1KWM A;  2OOT A;  5F09 A;  3V7Z A;  5HVG A;  3PB9 X;  1YME A;  1XF1 A;  1LAN A;  4FAI A;  2Q43 A;  4TJV A;  4FBE A;  2EK8 A;  3L2N A;  4OME A;  3S9L A;  2AFM A;  4OC5 A;  4MHN A;  4Z65 A;  4C8A A;  4JZ0 A;  1QMU A;  2PVV A;  1XRY A;  3CDX A;  4TJX A;  1CP7 A;  4NJR A;  5LRK A;  1QQ9 A;  1UWY A;  3ISX A;  4YN3 A;  1CPS A;  3KHX A;  2ZEE A;  5JH9 A;  3IIB A;  1AMP A;  4EWT A;  3KGQ A;  4G1P A;  4TNU A;  3GB0 A;  5LRJ A;  3B35 A;  4UEF A;  2WZN A;  1F57 A;  2QJ8 A;  1ZG9 A;  2AFW A;  1Y7E A;  1Y9Z A;  1LAM A;  3D67 A;  4C8F A;  4YU9 A;  4A94 A;  4NGR A;  1F2O A;  2XEG A;  2J9A A;  2IMO A;  3S9N A;  1TKJ A;  3RAM A;  3FEC A;  3MN8 A; 
#chains in the Genus database with same CATH topology
 2F8H A;  2I3C A;  4C2X A;  3K4I A;  2C1C A;  1EO0 A;  4ZY0 A;  4WJB A;  4A4C A;  3R95 A;  1QSN A;  4CGM A;  1R61 A;  3ICU A;  1Q7L A;  3TLY A;  3GLJ A;  3VAT A;  5CBM A;  1QST A;  2Q7B A;  4OC2 A;  1MJ9 A;  1ZG7 A;  2FSR A;  2HV2 A;  3N5F A;  4HNX B;  4NGP A;  3WAB A;  3DR8 A;  2VQY A;  3R9F A;  3D7F A;  5HH1 A;  1JDB C;  4PK2 A;  2XPN A;  3JRU A;  5F49 A;  1FBV A;  5HKW A;  2BOA A;  4GXH A;  2ZPA A;  2O53 A;  4JD6 A;  3RBU A;  4MY3 A;  5KTC A;  4LQ6 A;  4NJQ A;  4LX9 A;  3BJ7 A;  3EFA A;  4PSW A;  2ZW7 A;  4MCR A;  4BPW B;  3U88 C;  3I9S A;  4JXR A;  1TF8 A;  3IJ3 A;  3G23 A;  1A2Z A;  3KQX A;  2AFO A;  4P4B A;  4KVX A;  4PXD A;  5LYI A;  2HB6 A;  4OAD A;  5G20 A;  4E8O A;  2G3T A;  4J3G A;  1JDE A;  2EZA A;  2VEZ A;  4KLW A;  4BPX B;  2P0W A;  4X8I A;  1WWZ A;  1Z2L A;  2DXQ A;  2F5I A;  5J8C A;  4UBR A;  5J1Q A;  3TYX A;  4CGN A;  4NF1 A;  4MI1 A;  3S9M A;  1M6V B;  3T8W A;  3OP0 A;  5I4M A;  3LOD A;  1IOF A;  3OB1 B;  4AXV A;  4K3N A;  4R8F A;  4FUU A;  2FL4 A;  2PR1 A;  4XNH C;  3OB2 B;  5G1Z A;  2H5M A;  2Z0Z A;  4A32 A;  1Z5R A;  4PV6 A;  4C8P A;  4UEZ A;  4KOT A;  4FWU A;  2F7V A;  2Q4Y A;  2Z3L A;  4U9Y A;  3MRU A;  2CTC A;  4Q36 A;  3BLN A;  2XEF A;  4JLY A;  3IC1 A;  3PEI A;  2PJ3 A;  2XEJ A;  2GAN A;  3D7H A;  4KLV A;  4L8A A;  4Q38 A;  2YNC A;  3PLF B;  1AUG A;  1YW6 A;  4ZBG A;  4MJX A;  1M1D A;  3H8F A;  2C5Q A;  2PVW A;  2C6P A;  1CM0 A;  2JEV A;  1A9X B;  3CPX A;  3EO4 A;  2Z3N A;  2NYQ A;  4QBJ A;  4B6Z A;  1ZG8 A;  3SI0 A;  3W91 A;  5THW A;  2DPS A;  2BCO A;  4INJ A;  1Z8X A;  3T0T A;  4H2K A;  2YJV A;  4C7H A;  4JWP A;  1X12 A;  4XPD C;  1VHO A;  3NA6 A;  5AGE A;  3T07 A;  4MJ8 A;  4DUK A;  3IWW A;  3FB3 A;  4B10 A;  1Z8L A;  1TKH A;  3KR4 A;  4C2Y A;  4P44 A;  1CJW A;  5A28 A;  2QEC A;  2ZEM A;  4DJL A;  1Q5X A;  4C99 A;  2FVG A;  3PT1 A;  4KOR A;  3JTK A;  1YVH A;  4KOW A;  4EYS A;  3BXM A;  2DLA A;  2Z3P A;  2ZED A;  2CNS A;  1IB1 E;  4IAV A;  4X2T A;  4F8Z A;  2GIV A;  1H8L A;  3DGV A;  4ZI6 A;  3T5M A;  5JGF A;  4C8C A;  3K2K A;  1C3O B;  2PDO A;  2QYV A;  3PBB A;  4HNW B;  1BPM A;  4BIN A;  5K8M A;  2PE3 A;  1DIK A;  4R9M A;  2FM4 A;  4COB A;  1ZLH A;  4C85 A;  4MCQ A;  2EUI A;  5HXD A;  1B47 A;  3FED A;  4MY0 A;  4XNH B;  4C7I A;  1XJO A;  4OAE A;  4UF4 A;  4R57 A;  3IU2 A;  2K5T A;  3D2M A;  2JLM A;  2DF5 A;  1BPN A;  3BI0 A;  1CG2 A;  7CPA A;  4IIX A;  4P4F A;  2ANP A;  1GHE A;  4KNG E;  3PBE A;  1EE3 P;  4MFL A;  1KZF A;  6CPA A;  2ABZ A;  2R7H A;  3PFV A;  4F6A A;  2D0O A;  3JUW A;  5DWN A;  1CS0 B;  3BUW B;  3FH4 A;  5C82 A;  4KOS A;  4UIB A;  4PK3 A;  2Y0M A;  2B4J C;  1GYT A;  2BO9 A;  2HC9 A;  1YW4 A;  3FJU A;  4CYO A;  4UFX A;  1HDQ A;  4KSF A;  3ZZI A;  4ONU A;  3KRV A;  4M8D A;  2XPO A;  3H5Z A;  4C9R A;  3NOJ A;  2MP0 A;  1S7K A;  2CF4 A;  3SJX A;  1CX8 A;  4NGN A;  2HI6 A;  2GRE A;  4XPD B;  2C6G A;  3O8Z A;  1VHS A;  4C8T A;  1EZB A;  3TCV A;  4UCP A;  1PCA A;  1Y9K A;  1ZRS A;  5JM6 A;  4BD9 A;  1MJB A;  1RXT A;  1YVK A;  2GU2 A;  2R1I A;  2WYR A;  5FD8 A;  4BTF A;  4EVY A;  2AFS A;  2BL1 A;  4QC6 A;  3CXS A;  3VRO A;  2FS5 A;  3IWG A;  3EZA A;  2BUE A;  2J8N A;  4PQA A;  2FXF A;  5GCN A;  2ZOF A;  4AG7 A;  4MCS A;  3TO7 A;  4J0N A;  2Z3O A;  3KQZ A;  4KOY A;  3B2Y A;  4QVT A;  1VI4 A;  2ZEL A;  2B3U A;  4RN7 A;  3HPH E;  1TIQ A;  2Q04 A;  2ZOG A;  3PFE A;  1Z4R A;  3TTH A;  1CE8 B;  2JBJ A;  2PJ7 A;  4QB9 A;  3WC6 A;  2WUU A;  4C84 A;  1PU9 A;  1ZYM A;  1OZP A;  3FX6 A;  4ZX8 A;  3R9G A;  5HMN A;  2O4H A;  1M4D A;  4KSI A;  1KUY A;  4II9 A;  2V77 A;  4KUB A;  2B4D B;  2C6C A;  3D7D A;  3VGO A;  3D66 A;  2IL4 A;  2AFU A;  3NH4 A;  1I1D A;  4NCZ A;  4OC4 A;  4UEE A;  1NMT A;  1ARM A;  4XPK A;  4C8U A;  2R8V A;  3H8E A;  5CPA A;  3RO0 A;  3VAR A;  1YGH A;  4UFW A;  2AE6 A;  3TLA A;  3K9U A;  3TOB A;  4A37 A;  2AFX A;  1RTQ A;  3EXN A;  2BEI A;  4P6Y A;  4NSQ A;  3RYO A;  4CO9 A;  1XMB A;  4M3S A;  3I6S A;  4A30 A;  1CBX A;  2VL1 A;  4P4I A;  3QB8 A;  5DS0 A;  2Y1M A;  3LD2 A;  1Q2Y A;  4K30 A;  5IB0 A;  1M4I A;  3BUX B;  2GLJ A;  4WWV A;  4X3R A;  4MMO A;  3S6K A;  3G8W A;  4F0Y A;  4JYW A;  2OZU A;  2PJ2 A;  4CYN A;  2PRB A;  1LCP A;  4AB7 A;  2JDC A;  3F9K C;  3B3W A;  2R82 A;  2XPL A;  1IGB A;  3PFO A;  1I12 A;  2POK A;  2VZY A;  2D4O A;  3OWC A;  3CT9 A;  2J8R A;  1KUX A;  4AG9 A;  4CAW A;  1GGO A;  3SJE A;  4UCM A;  3FXT A;  4PXE A;  4FD4 A;  2ZEP A;  4CDJ A;  1S7F A;  4ZY2 A;  3EZE A;  2B0A A;  3PB4 X;  2EK9 A;  4R7M A;  2PR8 A;  5JYB A;  4ZX9 A;  2FT0 A;  3NE8 A;  4IHM A;  2NSM A;  2ZEF A;  3LMS A;  3PP9 A;  2NMT A;  1Z9E A;  4B5P B;  1NBW A;  2PJB A;  3GKR A;  3FYN A;  4CAX A;  3C8O A;  1V0C A;  4CAF A;  1FT7 A;  5LYF A;  4FD5 A;  3H4Q A;  4CGP A;  2PCU A;  4HPS A;  1BXR B;  4LQG A;  1XF8 A;  2Y1N A;  2PRQ A;  1ZL0 A;  4NGQ A;  1B6B A;  2AFZ A;  4KOU A;  1TXR A;  1XFO A;  2PQ8 A;  4EFD A;  5K8O A;  1FNO A;  1CPX A;  5HVF A;  3QAY A;  3IGR A;  1YLO A;  3RZA A;  3SXO A;  4C9E A;  2P6E A;  2HRO A;  3BUM B;  2OZH A;  4GPL B;  3E0K A;  3SXN A;  3W6X A;  1RO5 A;  1VBG A;  4CDK A;  2VXK A;  3D8P A;  4YRH A;  4E2A A;  5AG7 A;  4MFP A;  1Q2D A;  4MFK A;  3V8I A;  5IR2 A;  3WC5 A;  2PC1 A;  2Q4V A;  2Z3K A;  1WJT A;  4MHZ A;  3KAS A;  4PXB A;  5LYL A;  4E94 A;  4RUH A;  2ZEH A;  3PGP A;  2RFH A;  2EO8 A;  1SQH A;  3EZB A;  3B7I A;  2FIA A;  4U5Y A;  3D7G A;  5AG4 A;  5F5X A;  3P2H A;  1YQE A;  1YR0 A;  4EME A;  4C86 A;  3BHX A;  1Z8W A;  3CZX A;  3IEH A;  3TO9 A;  1IIC A;  3NFQ A;  1TF9 A;  3WT4 A;  1YLE A;  4W9Y A;  3DDD A;  4CYP A;  1T36 B;  2WPX A;  1MJA A;  1P0H A;  2Z10 A;  3QAH A;  4F9U A;  1VKC A;  2ATR A;  4UWI A;  5J3X A;  4RR2 B;  1WK4 A;  4ONW A;  3GYA A;  4KVO E;  4F0X A;  3FBU A;  2AUM A;  4MBU A;  1N71 A;  3B3S A;  3DNS A;  4TWE A;  3TLB A;  2UV8 G;  4MCP A;  1YK3 A;  4IUS A;  5LYD A;  4CPA A;  3BUN B;  2GFQ A;  3TX8 A;  4X5K A;  2C27 A;  4BBH A;  5KTD A;  1BOB A;  3TFY A;  2B5G B;  4KZT A;  2A4N A;  4E5S A;  3EY5 A;  1S3Z A;  3EIF A;  3GJZ A;  2PJ5 A;  5G22 A;  1F2P A;  1LOK A;  4F9V A;  1Y0R A;  3SI2 A;  3GUX A;  4CAE A;  3PB7 X;  2E28 A;  3JVN A;  3VRQ A;  4GS4 A;  1S7L A;  5H84 A;  1NSA A;  2ZEN A;  3DLJ A;  3A9L A;  2PJ6 A;  1Y0Y A;  3I74 A;  3VWE A;  5F46 A;  3SJF A;  4JXQ A;  4NEX A;  1KBL A;  1DE4 C;  4LUA A;  4HKF A;  3CPA A;  1BAV A;  2EVN A;  3PRT A;  3BUO B;  4M85 A;  4MRI A;  1WVM A;  3TLG B;  4MI4 A;  2X0S A;  4OIW A;  2V8H A;  3TLZ A;  3KI9 A;  5CNP A;  4B12 A;  3S6G A;  2Z11 A;  1CP6 A;  3ISZ A;  4P10 A;  3R9E A;  3SR3 A;  3VRN A;  2DPT A;  3LWU A;  3FF3 A;  2Q44 A;  2IQ6 A;  5D29 A;  5EMI A;  1NSL A;  1C30 B;  1DTD A;  1V6C A;  3GY9 A;  4A38 A;  2Q0Y A;  3PB8 X;  2B4B A;  1XOV A;  4CZ1 A;  1ON0 A;  3TLE A;  3FMC A;  5JPH A;  1VHE A;  4COG A;  1Z9U A;  3B3C A;  1ELL P;  3VRR A;  4NGM A;  3IU1 A;  4HNY B;  2ZXV A;  3R1K A;  5F13 A;  2XEI A;  3D4U A;  1HEE A;  4CGO A;  1FY7 A;  3GIU A;  4C2Z A;  5K8N A;  3HUV A;  3V38 A;  5JVL A;  2OU2 A;  2FE7 A;  2PJ4 A;  2B58 A;  1X10 A;  4P45 A;  2CY2 A;  2G9D A;  5F1Y A;  4DYO A;  4B14 A;  5IV0 A;  5K8P A;  1VGY A;  2GLF A;  1R3N A;  2FIW A;  4ZY1 A;  4M6I A;  1B87 A;  4UWJ A;  2Z3M A;  3DSB A;  4M6G A;  4ORF A;  1XMT A;  4BMH A;  2PJ9 A;  1IID A;  5H86 A;  2EZB A;  2YNC C;  3KL9 A;  4PSX A;  1Z4E A;  4UIA A;  4NGT A;  4GM5 A;  3H8G A;  2J8M A;  2OR4 A;  1AYE A;  2QIR A;  4R3K A;  3NE7 A;  2YGW A;  4C9V A;  3I1U A;  2RC4 A;  4DNC A;  1IY7 A;  3W6S A;  3F5B A;  1HDU A;  4BPU B;  5K99 A;  2PIY A;  5F47 A;  1KC7 A;  3KZW A;  4C9A A;  4KOX A;  3UY5 A;  4NXY A;  1UFH A;  5HKY A;  2V8V A;  3FEE A;  1NXJ A;  1VBH A;  1BLL E;  3C26 A;  1Y9W A;  1LFW A;  4CYQ A;  2AUN A;  2EZC A;  3I3G A;  1ZLI A;  3LAC A;  4E0A A;  2ZW6 A;  4ZYQ A;  5I0C A;  2B4D A;  1TKF A;  3VH9 A;  8CPA A;  1J4J A;  4PXC A;  4R76 A;  2P6G A;  3FNC A;  3IO1 A;  3S6H A;  2YND A;  3QNV A;  2GE3 A;  4CAV A;  3OAK A;  3VRP A;  2PJA A;  3EC4 A;  4B5O A;  5F9M A;  2I79 A;  2REE A;  3WC7 A;  3HLP A;  5F48 A;  1IYK A;  1IU8 A;  1QSR A;  4TJV A;  5IX3 A;  1KEE B;  1R43 A;  3MGD A;  1YSJ A;  2Q51 A;  2OH1 A;  3NH5 A;  4KVM E;  4FD7 A;  4L89 A;  4KOV A;  3B3T A;  4UA3 A;  4O23 A;  4A39 A;  1ELM P;  4P4E A;  2PJC A;  4OC0 A;  2QML A;  1MK4 A;  2REF A;  2OZG A;  2PJ0 A;  4RI1 A;  5LRG A;  1NE9 A;  2Q4Z A;  2FCK A;  4MHP A;  4MXU A;  3R96 A;  2PJ8 A;  2R98 A;  2ZEG A;  2IJZ A;  4OKO A;  2EWB A;  4H89 A;  2CTB A;  3F8K A;  1IYL A;  2V8G A;  3KR5 A;  4MHD A;  1BO4 A;  3SHP A;  1JQG A;  1IOI A;  1M44 A;  3T9Y A;  5IB9 A;  2RB7 A;  3TLC A;  4CS0 B;  2VKZ G;  2JEW A;  2OB0 A;  4C9U A;  2JBK A;  4OC3 A;  2QVP A;  1LRZ A;  1U6M A;  3P2F A;  4R3L A;  4OID A;  3BI1 A;  2CIJ A;  1ARL A;  3DR6 A;  3TE4 A;  1QSM A;  3NFZ A;  4B5P A;  3FVL A;  4Q7A A;  4P4D A;  3K9T A;  1XIX A;  3TO6 A;  1ZO0 A;  1YX0 A;  4NFR A;  4B13 A;  3T05 A;  1KUV A;  3IFE A;  4KUA A;  4UCN A;  4A2Z A;  1L0C A;  1XBU A;  2D4P A;  3D3S A;  3TOA A;  3KHZ A;  5HVH A;  5C88 A;  4CRZ B;  3SJG A;  1Y7R A;  3B3V A;  4XPL A;  4YWY A;  4CGL A;  3CXP A;  1M4L A;  3B8G A;  2ZEO A;  4M6H A;  4MFJ A;  2VI7 A;  2X7B A;  3PB6 X;  3WR7 A;  1PYT B;  5ELY A;  2EBJ A;  3CXQ A;  3N7Z A;  4R6T A;  3NH8 A;  3D68 A;  2CNT A;  4OP4 A;  4OC1 A;  2CBL A;  3TC8 A;  4B11 A;  1LAP A;  3T90 A;  2PIZ A;  4P4J A;  1M4G A;  1EZA A;  3G3S A;  1R57 A;  1J3L A;  1S5K A;  2JDD A;  2VBQ A;  4QUS A;  4AVB A;  5EC4 A;  4A95 A;  4JVO A;  4H6U A;  5J8F A;  5JQ4 A;  2V8D A;  2PSW A;  3ZJ0 A;  1YVO A;  4MHY A;  5AG5 A;  2PJ1 A;  1VIX A;  2DEA A;  4MFQ A;  3FIX A;  3VWD A;  2YNE A;  2OLS A;  2G3A A;  4KSA A;  3KKW A;  5DWM A;  1S60 A;  3SI1 A;  1PUA A;  1OBR A;  4AVC A;  3VTA A;  2ODF A;  2AJ6 A;  4IK2 A;  4PPZ A;  5D8N A;  5FVJ A;  4NGS A;  3S6F A;  4A33 A;  5AXI A;  5AG6 A;  2ARH A;  1KWM A;  2OOT A;  5F09 A;  2CNM A;  4I49 A;  5E96 A;  3V7Z A;  5HVG A;  3PZJ A;  2ZW4 A;  3HPG G;  1YME A;  1LAN A;  3PB9 X;  2Q43 A;  1YRE A;  4H6Z A;  4FAI A;  3ZNI A;  1XF1 A;  4FBE A;  2EK8 A;  3L2N A;  4OME A;  2HWG A;  4RS2 A;  3S9L A;  2AFM A;  2HUZ A;  2N3A B;  2B5G A;  4OC5 A;  2P6F A;  4MHN A;  3RNZ A;  4Z65 A;  4C8A A;  4JZ0 A;  4Y49 C;  3U1B A;  1QMU A;  2PVV A;  4YGO A;  1XRY A;  3TT2 A;  3CDX A;  5BY0 A;  4U9Z A;  4TJX A;  1CP7 A;  4NJR A;  5G21 A;  2Q7S A;  5KTA A;  2WPW A;  4OLL A;  4R87 A;  5EBV A;  1QSO A;  2GP4 A;  5LRK A;  1QQ9 A;  1UWY A;  4A4B A;  2B3V A;  2VZZ A;  4JJX A;  3ISX A;  4YFJ A;  5A27 A;  2CXA A;  4IIY A;  1XEB A;  4YN3 A;  2I00 A;  1CPS A;  3KHX A;  4AVA A;  3FRM A;  1I21 A;  2ZEE A;  4CRY B;  3IIB A;  5BWA B;  1JWQ A;  5JH9 A;  2YJT A;  3TLG A;  4IF5 A;  1AMP A;  4EWT A;  2HQY A;  1Z8T A;  1XE4 A;  3KGQ A;  2D0P A;  2O28 A;  1Q2C A;  4G1P A;  4TNU A;  3IWE A;  3GB0 A;  4H1H A;  3HMJ G;  5LRJ A;  3B35 A;  4KS9 A;  3D2P A;  4MFZ A;  2KCW A;  2WZN A;  4UEF A;  2DIK A;  1F57 A;  2QJ8 A;  1P4N A;  1ZG9 A;  2G0B A;  2PCN A;  2AFW A;  1Y7E A;  1Y9Z A;  1LAM A;  3D67 A;  4ZGY B;  2BSW A;  4C8F A;  5HKZ A;  1K4J A;  4YU9 A;  4FD6 A;  4NGR A;  1F2O A;  3BJ8 A;  4A94 A;  5ISV A;  1S7N A;  2XEG A;  2J9A A;  2IMO A;  2ZW5 A;  2XPP A;  3S9N A;  4UFV A;  1TKJ A;  3F0A A;  2WSA A;  3RAM A;  4A31 A;  3FEC A;  4Y49 B;  3MN8 A;  4C68 A; 
#chains in the Genus database with same CATH homology
 2F8H A;  2I3C A;  2C1C A;  4ZY0 A;  4WJB A;  3ICU A;  1Q7L A;  3GLJ A;  3VAT A;  5CBM A;  4OC2 A;  1ZG7 A;  3N5F A;  4NGP A;  3WAB A;  3D7F A;  3JRU A;  2BOA A;  2O53 A;  3RBU A;  4NJQ A;  4MCR A;  1TF8 A;  3IJ3 A;  3KQX A;  2AFO A;  4P4B A;  4PXD A;  5LYI A;  2HB6 A;  4X8I A;  1Z2L A;  5J1Q A;  3S9M A;  3T8W A;  5I4M A;  4AXV A;  4K3N A;  4R8F A;  4FUU A;  1Z5R A;  4C8P A;  4UEZ A;  4FWU A;  2F7V A;  3MRU A;  2CTC A;  2XEF A;  3IC1 A;  3PEI A;  2PJ3 A;  2XEJ A;  3D7H A;  1YW6 A;  3H8F A;  2PVW A;  2C6P A;  3CPX A;  2NYQ A;  4B6Z A;  1ZG8 A;  3SI0 A;  5THW A;  2BCO A;  4H2K A;  1VHO A;  3NA6 A;  4DUK A;  4C84 A;  3IWW A;  1Z8L A;  1TKH A;  3KR4 A;  4P44 A;  4DJL A;  2ZEM A;  4C99 A;  2FVG A;  3BXM A;  2ZED A;  4IAV A;  4X2T A;  4F8Z A;  1H8L A;  3DGV A;  4ZI6 A;  5JGF A;  4C8C A;  3K2K A;  2QYV A;  3PBB A;  1BPM A;  5K8M A;  2PE3 A;  1ZLH A;  4C85 A;  4MCQ A;  5HXD A;  3FED A;  1XJO A;  4UF4 A;  7CPA A;  1BPN A;  3BI0 A;  1CG2 A;  4P4F A;  2ANP A;  4KNG E;  3PBE A;  1EE3 P;  6CPA A;  2ABZ A;  3FH4 A;  4UIB A;  1GYT A;  2BO9 A;  2HC9 A;  1YW4 A;  3FJU A;  1HDQ A;  4C9R A;  2CF4 A;  3SJX A;  1CX8 A;  4NGN A;  2GRE A;  4C8T A;  2C6G A;  1PCA A;  5JM6 A;  4BD9 A;  2WYR A;  2GU2 A;  2AFS A;  4PQA A;  2ZOF A;  4MCS A;  3KQZ A;  3B2Y A;  2ZEL A;  2ZOG A;  3PFE A;  2JBJ A;  2PJ7 A;  3WC6 A;  3FX6 A;  4ZX8 A;  2O4H A;  4KSI A;  2V77 A;  2C6C A;  3D7D A;  3D66 A;  2AFU A;  3NH4 A;  4OC4 A;  4UEE A;  1ARM A;  4C8U A;  3H8E A;  5CPA A;  3VAR A;  4A37 A;  2AFX A;  1RTQ A;  4P6Y A;  1XMB A;  3I6S A;  1CBX A;  2VL1 A;  4P4I A;  5DS0 A;  2GLJ A;  4WWV A;  4X3R A;  4MMO A;  4JYW A;  2PJ2 A;  1LCP A;  3B3W A;  3PFO A;  1IGB A;  2POK A;  3CT9 A;  3SJE A;  4PXE A;  4CDJ A;  2ZEP A;  4ZY2 A;  3PB4 X;  2EK9 A;  4R7M A;  4ZX9 A;  4IHM A;  2NSM A;  2ZEF A;  3LMS A;  2PJB A;  5LYF A;  1FT7 A;  2PCU A;  4LQG A;  2C5Q A;  2PRQ A;  4NGQ A;  2AFZ A;  1TXR A;  1XFO A;  4EFD A;  5K8O A;  1FNO A;  1CPX A;  5HVF A;  3RZA A;  1YLO A;  4C9E A;  4CDK A;  5IR2 A;  3WC5 A;  4MHZ A;  4PXB A;  3KAS A;  5LYL A;  4RUH A;  2ZEH A;  2RFH A;  3B7I A;  3D7G A;  4EME A;  4C86 A;  3BHX A;  3IEH A;  1TF9 A;  3WT4 A;  4W9Y A;  4F9U A;  4ONW A;  3B3S A;  4TWE A;  4MCP A;  5LYD A;  4CPA A;  3TX8 A;  3EIF A;  2PJ5 A;  1F2P A;  1LOK A;  4F9V A;  1Y0R A;  3SI2 A;  3GUX A;  3PB7 X;  1NSA A;  2ZEN A;  3DLJ A;  2PJ6 A;  1Y0Y A;  3I74 A;  3SJF A;  1DE4 C;  3CPA A;  1BAV A;  4MRI A;  3PRT A;  1WVM A;  4OIW A;  2V8H A;  3KI9 A;  3ISZ A;  1CP6 A;  4P10 A;  3LWU A;  3FF3 A;  2IQ6 A;  5D29 A;  1V6C A;  1DTD A;  4A38 A;  3PB8 X;  3FMC A;  1VHE A;  3B3C A;  1ELL P;  4NGM A;  2XEI A;  3D4U A;  1HEE A;  5K8N A;  3HUV A;  3V38 A;  2PJ4 A;  4P45 A;  2G9D A;  4DYO A;  5K8P A;  1VGY A;  2GLF A;  1R3N A;  4ZY1 A;  2PJ9 A;  3KL9 A;  4UIA A;  4NGT A;  4GM5 A;  3H8G A;  2OR4 A;  1AYE A;  4C9V A;  3I1U A;  1IY7 A;  1HDU A;  2PIY A;  3KZW A;  4C9A A;  2V8V A;  3FEE A;  1BLL E;  1LFW A;  1ZLI A;  4ZYQ A;  1TKF A;  3VH9 A;  8CPA A;  4PXC A;  4R76 A;  3IO1 A;  3QNV A;  2PJA A;  3WC7 A;  3HLP A;  1R43 A;  1YSJ A;  2Q51 A;  3NH5 A;  4A39 A;  3B3T A;  4O23 A;  1ELM P;  4P4E A;  2PJC A;  4OC0 A;  2PJ0 A;  5LRG A;  2Q4Z A;  4MXU A;  4MHP A;  2PJ8 A;  2ZEG A;  2IJZ A;  4OKO A;  2EWB A;  2CTB A;  2V8G A;  3KR5 A;  5IB9 A;  1JQG A;  2RB7 A;  2JEW A;  4C9U A;  2JBK A;  4OC3 A;  2QVP A;  4OID A;  3BI1 A;  2CIJ A;  1ARL A;  3NFZ A;  3FVL A;  4Q7A A;  4P4D A;  3K9T A;  4NFR A;  3IFE A;  1XBU A;  3KHZ A;  5HVH A;  3SJG A;  3B3V A;  4YWY A;  1M4L A;  2ZEO A;  3PB6 X;  1PYT B;  5ELY A;  4R6T A;  3NH8 A;  3D68 A;  4OP4 A;  4OC1 A;  3TC8 A;  1LAP A;  2PIZ A;  4P4J A;  2V8D A;  4MHY A;  2PJ1 A;  1VIX A;  2DEA A;  3SI1 A;  1OBR A;  3VTA A;  4PPZ A;  4IK2 A;  5D8N A;  4NGS A;  1KWM A;  2OOT A;  5F09 A;  3V7Z A;  5HVG A;  3PB9 X;  1YME A;  1XF1 A;  1LAN A;  4FAI A;  2Q43 A;  4TJV A;  4FBE A;  2EK8 A;  3L2N A;  4OME A;  3S9L A;  2AFM A;  4OC5 A;  4MHN A;  4Z65 A;  4C8A A;  4JZ0 A;  1QMU A;  2PVV A;  1XRY A;  3CDX A;  4TJX A;  1CP7 A;  4NJR A;  2GP4 A;  5LRK A;  1QQ9 A;  1UWY A;  3ISX A;  4YN3 A;  1CPS A;  3KHX A;  2ZEE A;  5JH9 A;  3IIB A;  1AMP A;  4EWT A;  3KGQ A;  4G1P A;  4TNU A;  3GB0 A;  5LRJ A;  3B35 A;  4UEF A;  2WZN A;  1F57 A;  2QJ8 A;  1ZG9 A;  2AFW A;  1Y7E A;  1Y9Z A;  1LAM A;  3D67 A;  4C8F A;  4YU9 A;  4A94 A;  4NGR A;  1F2O A;  2XEG A;  2J9A A;  2IMO A;  3S9N A;  1TKJ A;  3RAM A;  3FEC A;  3MN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...