2CIJA

Membrane-bound glutamate carboxypeptidase ii (gcpii) with bound methionine
Total Genus 244
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
244
sequence length
694
structure length
687
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
publication title Glutamate Carboxypeptidase II
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 244
structure length 687
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2cijA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2cijA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2cijA02
2PJCA 1XRYA 3QNVA 1AMPA 3FEDA 3LWUA 3KASA 2Q43A 3PB4X 4MRIA 5K8NA 3FMCA 4P10A 4TWEA 2V8GA 3B3SA 2VL1A 2PIYA 3FVLA 3WC6A 4R6TA 3I74A 2AFSA 3KQXA 2I3CA 1UWYA 1Z5RA 3KR5A 2OR4A 4P4EA 2JEWA 3PB6X 2O4HA 1QMUA 4C84A 1XJOA 2GU2A 4H2KA 3IJ3A 3PEIA 2NYQA 4MCPA 1CP6A 3K9TA 4TJVA 5K8PA 4MCRA 2AFXA 1CBXA 2XEGA 3KZWA 3ISXA 2F8HA 3IWWA 3I6SA 8CPAA 3VARA 2EK9A 1R43A 2F7VA 4OC1A 3KHXA 4C9UA 3D7DA 4ZY0A 2V77A 4DUKA 3B3TA 2CTCA 4UEZA 4MHZA 1XBUA 4F8ZA 2V8HA 3NH5A 1BPNA 1TKHA 4C9RA 4G1PA 4PXEA 3V7ZA 2IJZA 4PQAA 4UIBA 4B6ZA 5LRJA 4EFDA 3KHZA 2ZEFA 4X3RA 3VATA 4C8TA 4FAIA 5LRKA 4NGNA 4MCQA 4JYWA 4OC0A 4X8IA 2PJ7A 4P4IA 2PJ6A 4A39A 2ZOGA 3FJUA 3SI0A 3D7GA 2GREA 4ZYQA 3ISZA 2ZEOA 1FNOA 3CPAA 4A37A 1AYEA 3VTAA 2WZNA 5CBMA 4NGMA 3SJXA 1ELMP 4UEFA 4P4DA 5K8MA 5HVFA 1DTDA 2PVVA 3B35A 3S9MA 1ARMA 3NFZA 4UEEA 4O23A 4IAVA 4UIAA 3WT4A 1LOKA 3ICUA 2ZEMA 5F09A 3SJEA 3NA6A 3D4UA 4F9VA 2OOTA 7CPAA 2JBJA 2PJBA 2PE3A 1Y0YA 2QJ8A 2EK8A 4C9EA 4NFRA 3FF3A 4R76A 5IB9A 1YMEA 2HC9A 1LCPA 2AFUA 1BPMA 2AFMA 4W9YA 2QYVA 3FX6A 2PCUA 3DLJA 2PJ8A 4A94A 2CTBA 3BHXA 1KWMA 4LQGA 3LMSA 3VH9A 1IGBA 2O53A 4MHYA 1Y0RA 3D7HA 3KQZA 2ZENA 4ZY2A 4C8AA 2V8VA 1CPSA 3RAMA 2PJ3A 4FBEA 1LAPA 2BO9A 1YW6A 1OBRA 4TNUA 4P6YA 3TC8A 4NGQA 2C6PA 3B3WA 4AXVA 3DGVA 3CPXA 5D8NA 1R3NA 1Y7EA 1YSJA 4WJBA 2Q4ZA 2XEIA 2GLJA 5JH9A 3SI2A 1LFWA 4NGRA 4P4JA 3PBBA 1F2PA 4C8PA 5K8OA 3BI1A 3HLPA 4KSIA 1BLLE 1TF9A 4OC5A 1YLOA 4TJXA 4C9AA 2PJ2A 4R7MA 3IEHA 1EE3P 5HVHA 4C8FA 3KR4A 3WABA 4R8FA 1RTQA 1CG2A 1VIXA 3SI1A 1GYTA 1F2OA 4P44A 2RB7A 1VHOA 1HDQA 3K2KA 5HVGA 2IMOA 4ONWA 3FEEA 1PCAA 4OMEA 1CPXA 2FVGA 3B3CA 4OP4A 2WYRA 3T8WA 5HXDA 4C8CA 5ELYA 4ZX9A 3RZAA 2PIZA 4OC3A 4DYOA 2AFZA 3S9NA 4IK2A 5LYFA 2PJ4A 1TKFA 4NJRA 1Z8LA 1PYTB 3NH4A 5JM6A 3D66A 4MHPA 3GUXA 4IHMA 5I4MA 2EWBA 4YN3A 3H8EA 1TXRA 3WC7A 3WC5A 3PB8X 4NGSA 3PFEA 1IY7A 5LYIA 3KGQA 2GLFA 1XMBA 1QQ9A 3NH8A 4C99A 1ZG7A 4P4FA 3TX8A 3PB7X 2ZEHA 5DS0A 2C6GA 1VGYA 3GLJA 4ZX8A 4CDKA 4C86A 4WWVA 4FUUA 2XEJA 1VHEA 3KL9A 4PXDA 3B2YA 4MXUA 1WVMA 4JZ0A 4BD9A 1V6CA 2ZELA 5JGFA 4YWYA 4X2TA 2AFOA 2ANPA 2C1CA 4PPZA 1Y9ZA 1ELLP 2ZEPA 1LAMA 4DJLA 2C6CA 2IQ6A 1Q7LA 4FWUA 1BAVA 3N5FA 1CP7A 3D67A 4ZI6A 3PB9X 2HB6A 6CPAA 3CT9A 3MN8A 1H8LA 3S9LA 4NGPA 2QVPA 1DE4C 3SJGA 2Q51A 4EWTA 3H8GA 3V38A 1HEEA 3D7FA 1ARLA 2BCOA 3B7IA 2ZEEA 3L2NA 4A38A 3B3VA 3IIBA 2ABZA 3RBUA 4PXBA 1XFOA 4K3NA 4P4BA 3D68A 5LRGA 5CPAA 1ZLHA 4P45A 1HDUA 1TKJA 4Q7AA 4CDJA 3SJFA 2ZEDA 4YU9A 4C9VA 1Z2LA 2PJ9A 3IFEA 3BI0A 4OC2A 4MCSA 2J9AA 1JQGA 4OKOA 2CF4A 3KI9A 1LANA 3EIFA 4MHNA 5LYDA 4CPAA 2ZOFA 3GB0A 4OC4A 1NSAA 1ZG9A 3JRUA 3PFOA 4Z65A 2PJAA 2ZEGA 5LYLA 3MRUA 2AFWA 3I1UA 4OIWA 4GM5A 4RUHA 4UF4A 2JBKA 4F9UA 2XEFA 3IC1A 3IO1A 5THWA 2DEAA 2PVWA 1ZG8A 3BXMA 4C85A 3CDXA 2PRQA 4MMOA 2BOAA 3FH4A 3PRTA 4EMEA 4PXCA 5J1QA 4KNGE 4ZY1A 5D29A 4NGTA 1TF8A 2POKA 1ZLIA 1YW4A 4NJQA 1CX8A 2V8DA 1F57A 2PJ1A 3FECA 2RFHA 3PBEA 1FT7A 1M4LA 3H8FA 3HUVA 2G9DA 2NSMA 4OIDA 2PJ0A 1XF1A 4C8UA 2PJ5A 2CIJA
chains in the Genus database with same CATH superfamily
2PJCA 4CRYB 1KUVA 1QSRA 1XRYA 2B4BA 3FNCA 1Z8TA 2B5GB 3DSBA 3QNVA 1AMPA 2Y1NA 4NSQA 4OLLA 3FEDA 3LWUA 2REEA 4A4CA 1NBWA 3KASA 2Q43A 4K30A 5JPHA 1X12A 3PB4X 4R3KA 3TLZA 4MRIA 4QC6A 5K8NA 3FMCA 2CY2A 4P10A 4TWEA 2V8GA 2FIAA 2ZW4A 1Z8WA 2ZW7A 2VL1A 3B3SA 4MFJA 3CXQA 3ZJ0A 5IR2A 2PIYA 2PR8A 3FVLA 2Z0ZA 2X0SA 3NE7A 3WC6A 3T05A 4R6TA 4INJA 3TLEA 1M4DA 4FD4A 2IL4A 2OZHA 2EZBA 3TYXA 3K9UA 5HKYA 1N71A 4ONUA 3I74A 2AFSA 4BBHA 4IIYA 4U9YA 4UCNA 5G1ZA 3T07A 3KQXA 1Z4RA 4MY3A 1S7FA 2I3CA 4KOXA 1UWYA 5F1YA 1Z5RA 3KR5A 2OR4A 4P4EA 2JEWA 4C2XA 4LQ6A 4C7IA 3PB6X 3ZZIA 2O4HA 1Z9EA 1QMUA 2P6GA 1XJOA 5CNPA 2GU2A 1QSTA 4C84A 4PSWA 3D3SA 4H2KA 4CAVA 2EZCA 4R57A 3OP0A 3IJ3A 3TO9A 3PEIA 1XMTA 2NYQA 2FM4A 4YRHA 4MCPA 5F46A 4KLWA 3EZAA 3ZNIA 4Q38A 1CP6A 3K9TA 3EFAA 4FD6A 2VQYA 4TJVA 1EZBA 4AG9A 3NE8A 4RI1A 2G0BA 5K8PA 1IOFA 2PC1A 2VKZG 3GKRA 4MCRA 5H84A 2AFXA 4C7HA 1CBXA 2F5IA 4XNHC 2XEGA 2WPWA 2Y0MA 2UV8G 1Q2YA 3KZWA 5G20A 2HI6A 1YGHA 4CAXA 3ISXA 1BOBA 2B4DB 3IWWA 2F8HA 3DR8A 3G23A 3I6SA 8CPAA 2DXQA 4CO9A 1KC7A 3VARA 3BUWB 2EK9A 2XPLA 1R43A 4OC1A 2F7VA 3KHXA 4UCPA 3D7DA 4A31A 4C9UA 2OLSA 2Z3PA 4ZY0A 2V77A 4UCMA 3B3TA 2CTCA 4DUKA 3B8GA 4UEZA 1Z4EA 4MHZA 4YGOA 2B4JC 1XBUA 4F8ZA 2V8HA 3NH5A 4B5OA 1BPNA 1TKHA 2ATRA 3JTKA 4C9RA 4G1PA 4PXEA 1IICA 3V7ZA 4R87A 3W6SA 2IJZA 4PQAA 4UIBA 1YVKA 4B6ZA 4Y49C 4MY0A 5LRJA 4EFDA 4XNHB 5HKWA 3KHZA 3F8KA 2R8VA 2ZEFA 4X3RA 1S60A 3VATA 4C8TA 4A4BA 2WSAA 4FAIA 2DLAA 4LX9A 1KBLA 5LRKA 4NGNA 4JLYA 4MCQA 4NCZA 1M1DA 1NXJA 4NF1A 1MJ9A 3TLCA 2GE3A 4JYWA 4OC0A 1Q2CA 2ODFA 2PJ7A 3VRPA 4FD5A 3IGRA 2OB0A 4X8IA 5I0CA 4P4IA 3D2MA 2JDDA 1YVHA 2PJ6A 2G3AA 4A39A 2ZOGA 3FJUA 1FBVA 2FXFA 1CE8B 3SI0A 3D7GA 2GREA 3C26A 4ZYQA 3ISZA 3A9LA 2Q4VA 2ZEOA 2GANA 4UFVA 2EUIA 1S5KA 3PZJA 5AGEA 4JD6A 1VBHA 2DIKA 3VROA 3PP9A 2Z3OA 3TLYA 1FNOA 3CXPA 3CPAA 4A37A 3T5MA 4MI1A 1AYEA 3VTAA 2WZNA 5CBMA 3RYOA 4J0NA 4RN7A 4NGMA 3SJXA 1ELMP 1Z8XA 2JLMA 4P4DA 2ZPAA 4UEFA 5K8MA 5HKZA 2YJTA 4UFWA 5HVFA 1R61A 4COBA 5A27A 1DTDA 1L0CA 2OZGA 2PVVA 3B35A 4L89A 4CGOA 4CYQA 5C82A 3S9MA 1ARMA 2D4PA 2Z10A 3NFZA 1S7NA 4UEEA 3W91A 2P6FA 5EMIA 4O23A 5AXIA 4PV6A 4IAVA 4ZBGA 4LUAA 1KZFA 1ZL0A 5E96A 4UIAA 2VZZA 3WT4A 3EXNA 1LOKA 2R82A 3ICUA 2ZEMA 2QMLA 2B4DA 5F09A 3SJEA 1B6BA 3D4UA 3NA6A 4F9VA 2OOTA 7CPAA 2JBJA 2PJBA 2PE3A 4EVYA 2I00A 3G8WA 4CGMA 1JWQA 1MJBA 4YFJA 1Y0YA 4HPSA 2WPXA 1CS0B 1XOVA 5J3XA 2QJ8A 2EK8A 4C9EA 4COGA 4MBUA 3FF3A 4NFRA 4R76A 4F0XA 5IB9A 1YMEA 2HC9A 1IYLA 1LCPA 2P6EA 2AFUA 4CZ1A 1U6MA 4CAFA 1BPMA 3RNZA 2XPOA 5FD8A 2AFMA 4W9YA 3KKWA 4KOTA 2HROA 1VI4A 3OAKA 5EBVA 4BMHA 2QYVA 2HUZA 3FX6A 4KSAA 5F13A 4HKFA 1I12A 1ON0A 2PCUA 4MJ8A 3DLJA 2PJ8A 4E0AA 3JVNA 3K4IA 2DPSA 4KVOE 4A94A 2VXKA 2CTBA 1SQHA 3BHXA 3EY5A 4M6IA 1KWMA 4LQGA 3TO7A 3LMSA 3VH9A 3H5ZA 2YNCA 2VEZA 1IGBA 4MFLA 2FT0A 2O53A 1S7LA 3BLNA 3FB3A 4JXRA 3HPGG 2BUEA 4MHYA 1Y0RA 3D7HA 3KQZA 2ZENA 3QB8A 4ZY2A 4MFZA 2V8VA 4C8AA 1CPSA 4M6GA 3RAMA 2D4OA 3VWEA 2PJ3A 4AB7A 4QVTA 4KOSA 4FBEA 2H5MA 2O28A 4C2ZA 1WJTA 2N3AB 1LAPA 2VI7A 3D8PA 2BO9A 4BPUB 1YW6A 3TLBA 1OBRA 3T9YA 4B13A 4UWIA 4TNUA 4CGLA 4P6YA 3TC8A 4GS4A 4NGQA 1MK4A 2C6PA 1XF8A 3S6GA 3B3WA 5ISVA 5KTDA 4BPWB 4AXVA 3SXOA 3DGVA 4QUSA 3CPXA 5D8NA 1R3NA 1Y7EA 1YSJA 1TIQA 2YNEA 1MJAA 2REFA 4WJBA 2DF5A 2Q4ZA 3TLGA 2XEIA 4HNXB 2GLJA 4CGNA 2FE7A 2GIVA 2J8RA 4AVBA 5JH9A 3SI2A 1YK3A 1LFWA 3TFYA 2Q4YA 1Y9WA 4NGRA 4P4JA 1CM0A 2Z3NA 4MFPA 3FRMA 2VZYA 2Q7SA 3VRQA 1I21A 4BPXB 3I9SA 4UA3A 1BXRB 4KS9A 1GGOA 3PBBA 4A32A 1F2PA 2PDOA 4R3LA 4C8PA 5K8OA 4E5SA 2QIRA 2BEIA 3BI1A 3QAHA 1KEEB 3IU1A 2PR1A 2B5GA 4NXYA 3HLPA 4KSIA 1BLLE 1TF9A 4OC5A 1YLOA 4TJXA 4C9AA 3FBUA 2XPNA 2PJ2A 1XEBA 4R7MA 2PSWA 3IEHA 1ZYMA 3SHPA 1FY7A 2HV2A 4UFXA 1EE3P 4KZTA 4J3GA 5HVHA 4KORA 4OADA 4C8FA 1QSMA 3BUXB 3KR4A 3WABA 4R8FA 1RTQA 1CG2A 4H89A 2OZUA 1A9XB 1KUYA 1VIXA 3SI1A 4HNYB 4DNCA 2ZW5A 3QAYA 3EZEA 1GYTA 1F2OA 3O8ZA 1EZAA 4P44A 2RB7A 1C3OB 3PFVA 4JVOA 1VHSA 2C5QA 1VHOA 1HDQA 3OWCA 4F6AA 3TCVA 3K2KA 5HVGA 1YX0A 2IMOA 4ONWA 3FEEA 3VWDA 1PCAA 5BY0A 2B3UA 4OMEA 1IB1E 3DR6A 1J3LA 5DWNA 4Y49B 1CPXA 4KVXA 5EC4A 2FVGA 1K4JA 4HNWB 2J8MA 1R57A 3B3CA 2WYRA 4OP4A 3BUNB 3T8WA 1RO5A 5HXDA 2CBLA 4C8CA 5ELYA 4ZX9A 2EVNA 4B10A 3RZAA 5KTCA 2J8NA 2PIZA 2Z3LA 5AG7A 3BJ7A 3PLFB 4OC3A 2GP4A 4DYOA 2AFZA 4C68A 3C8OA 3HMJG 3S9NA 1CJWA 4H6ZA 4PK2A 4UWJA 3RO0A 4IK2A 4R9MA 4CAEA 2PJ4A 5LYFA 1TKFA 4NJRA 5JQ4A 3VRRA 3F9KC 2I79A 1Z8LA 3LODA 1PYTB 2X7BA 3NH4A 2PRBA 3LD2A 5JM6A 5A28A 5F5XA 4KVME 3D66A 1P0HA 1S3ZA 4EYSA 4MHPA 4XPDC 4GXHA 3BUOB 4MFKA 3FYNA 4QBJA 4X5KA 1M4GA 2E28A 4JXQA 3GUXA 4IHMA 1OZPA 4KUBA 5I4MA 2EWBA 2EBJA 4YN3A 3H8EA 1TXRA 2P0WA 3WC5A 3WC7A 4M8DA 5JVLA 4M85A 2YGWA 3PB8X 4NGSA 3PFEA 4MJXA 1IY7A 1EO0A 5LYIA 3WR7A 3FXTA 3KGQA 2GLFA 5H86A 1XMBA 4A33A 1QQ9A 3NH8A 4ZGYB 4C99A 3F0AA 1RXTA 1ZG7A 2JEVA 2YJVA 4P4FA 2AE6A 2JDCA 1NE9A 4BINA 4KOUA 2DPTA 3TX8A 3U88C 4B5PB 3GJZA 3PB7X 2ZEHA 1A2ZA 4B14A 1Y9KA 3PT1A 3I3GA 2C6GA 1VGYA 3GLJA 5DS0A 2AUNA 4ZX8A 4XPDB 3TTHA 4CDKA 2ARHA 1YREA 4F0YA 2FL4A 4IUSA 4WWVA 4C86A 4IF5A 5HH1A 3E0KA 4FUUA 2BSWA 2OH1A 2XEJA 1VHEA 2CXAA 2ZW6A 3KL9A 4PXDA 3R9EA 2R1IA 4U9ZA 2G3TA 3B2YA 4MXUA 3SXNA 1WVMA 4JZ0A 4BD9A 3SR3A 1V6CA 2Y1MA 2ZELA 5JGFA 4A30A 1ZO0A 4YWYA 4X2TA 3BJ8A 1Q5XA 1M4IA 2AFOA 2KCWA 5AG6A 2ANPA 3TT2A 3S6FA 2C1CA 3D2PA 2FCKA 4PPZA 1X10A 2WUUA 5AG5A 4A95A 4KOWA 5GCNA 1Y9ZA 4L8AA 4AG7A 1B87A 1ELLP 1LRZA 5IX3A 2ZEPA 5C88A 1LAMA 2B58A 1M44A 4XPLA 2C6CA 3G3SA 4DJLA 4PK3A 3S6HA 1IIDA 1Q7LA 2IQ6A 4AVCA 2GFQA 1IOIA 1XE4A 3V8IA 3MGDA 4FWUA 1BAVA 5F9MA 3S6KA 2CNTA 5G21A 1QSOA 3N5FA 1CP7A 3D67A 3IU2A 4MHDA 4QB9A 3HPHE 2FSRA 4ZI6A 4KOVA 2Q0YA 3R95A 1VBGA 3PB9X 2HB6A 4KSFA 6CPAA 4H6UA 4C2YA 3JUWA 2Z11A 5BWAB 3CT9A 3MN8A 1H8LA 3W6XA 3S9LA 4NGPA 2QVPA 2D0OA 1DE4C 3TLAA 2BL1A 4IIXA 1YQEA 3SJGA 2Q51A 4PSXA 4UBRA 4EWTA 3H8GA 3V38A 3DNSA 5JYBA 1HEEA 3GYAA 3D7FA 1ARLA 5KTAA 2AJ6A 2BCOA 3B7IA 2ZEEA 3L2NA 3KRVA 2B3VA 4A38A 3B3VA 3IIBA 2ABZA 4CGPA 5AG4A 2ZXVA 1VKCA 3CZXA 4KOYA 4CYNA 1Z9UA 3RBUA 3TE4A 5FVJA 2QECA 4PXBA 2AUMA 1PUAA 3NOJA 5HMNA 1XFOA 4K3NA 4P4BA 3R9GA 3UY5A 1I1DA 1P4NA 3D68A 5CPAA 1ZLHA 4P45A 5F48A 5LRGA 4B12A 5K99A 1HDUA 2YNCC 1TKJA 4Q7AA 3TOBA 3T0TA 3SJFA 4CDJA 4B5PA 4E8OA 1J4JA 2ZEDA 4YU9A 4Q36A 4U5YA 2D0PA 3EC4A 4C9VA 1QSNA 2OU2A 1Z2LA 2EO8A 2PJ9A 2Z3MA 1GHEA 3OB1B 3IFEA 5J8CA 4RR2B 3VGOA 4AVAA 3BI0A 4OC2A 4MCSA 2J9AA 1JQGA 2PJ5A 3N7ZA 4FD7A 3BUMB 2CF4A 3KI9A 4OKOA 1LANA 4CS0B 1C30B 3EIFA 4MHNA 5LYDA 4E94A 2MP0A 2NMTA 4CPAA 2ZOFA 3GB0A 1NMTA 1M6VB 4OC4A 1NSAA 1ZG9A 3JRUA 3H4QA 3PFOA 4Z65A 2PJAA 2ZEGA 5LYLA 3MRUA 2AFWA 4KLVA 1PU9A 3F5BA 3I1UA 4OIWA 4GM5A 3EO4A 4RUHA 4H1HA 2HQYA 4GPLB 1XIXA 1IU8A 5G22A 5IB0A 3TO6A 4UF4A 2JBKA 4M3SA 3OB2B 3T90A 4F9UA 2PCNA 2R98A 1DIKA 2EZAA 2XEFA 4MI4A 3IC1A 2XPPA 2Z3KA 3IO1A 1V0CA 2K5TA 5THWA 2DEAA 5IV0A 4JWPA 2PVWA 4KUAA 5F47A 4XPKA 1ZG8A 2B0AA 1S7KA 3BXMA 3P2FA 3TOAA 1T36B 1UFHA 1B47A 4C85A 2CNMA 2FS5A 3U1BA 3CDXA 2PRQA 3VRNA 3NFQA 4MFQA 4MMOA 5J8FA 2BOAA 3FH4A 3LACA 3PRTA 4EMEA 1YLEA 2HWGA 1KUXA 4CAWA 2PQ8A 3GY9A 4BTFA 1IYKA 4PXCA 4CRZB 5J1QA 4KNGE 4II9A 2YNDA 4ZY1A 4NEXA 3R1KA 5D29A 4NGTA 4CYPA 1TF8A 1Y7RA 2POKA 3R96A 2Q04A 3IWEA 1ZLIA 1ZRSA 1YVOA 1YW4A 2FIWA 4B11A 2CNSA 4NJQA 1AUGA 1CX8A 2V8DA 3TLGB 1F57A 3DDDA 2PJ1A 3GIUA 4ORFA 3FECA 1WK4A 3FIXA 4OAEA 5F49A 3R9FA 5DWMA 2RFHA 1JDEA 3EZBA 1WWZA 3P2HA 3PBEA 4E2AA 1FT7A 4RS2A 1Q2DA 2Q7BA 1NSLA 4CYOA 3CXSA 1M4LA 3H8FA 4I49A 1JDBC 3HUVA 2G9DA 2R7HA 2RC4A 2NSMA 3PGPA 2PJ0A 4JJXA 4OIDA 4M6HA 1XF1A 4C8UA 2VBQA 1YR0A 4A2ZA 2C27A 2Q44A 3IWGA 2A4NA 2CIJA 1BO4A
chains in the Genus database with same CATH topology
2PJCA 1XRYA 3QNVA 1AMPA 3FEDA 3LWUA 3KASA 2Q43A 3PB4X 4MRIA 5K8NA 3FMCA 4P10A 4TWEA 2V8GA 3B3SA 2VL1A 5IR2A 2PIYA 3FVLA 3WC6A 4R6TA 3I74A 2AFSA 3KQXA 2I3CA 1UWYA 1Z5RA 3KR5A 2OR4A 4P4EA 2JEWA 3PB6X 2O4HA 1QMUA 4C84A 1XJOA 2GU2A 4H2KA 3IJ3A 3PEIA 2NYQA 4MCPA 1CP6A 3K9TA 4TJVA 5K8PA 4MCRA 2AFXA 1CBXA 2XEGA 3KZWA 3ISXA 2F8HA 3IWWA 3I6SA 8CPAA 3VARA 2EK9A 1R43A 2F7VA 4OC1A 3KHXA 4C9UA 3D7DA 4ZY0A 2V77A 4DUKA 3B3TA 2CTCA 4UEZA 4MHZA 1XBUA 4F8ZA 2V8HA 3NH5A 1BPNA 1TKHA 4C9RA 4G1PA 4PXEA 3V7ZA 2IJZA 4PQAA 4UIBA 4B6ZA 5LRJA 4EFDA 3KHZA 2ZEFA 4X3RA 3VATA 4C8TA 4FAIA 5LRKA 4NGNA 4MCQA 4JYWA 4OC0A 4X8IA 2PJ7A 4P4IA 2PJ6A 4A39A 2ZOGA 3FJUA 3SI0A 3D7GA 2GREA 4ZYQA 3ISZA 2ZEOA 1FNOA 3CPAA 4A37A 1AYEA 3VTAA 2WZNA 5CBMA 4NGMA 3SJXA 1ELMP 4UEFA 4P4DA 5K8MA 5HVFA 1DTDA 2PVVA 3B35A 3S9MA 1ARMA 3NFZA 4UEEA 4O23A 4IAVA 4UIAA 3WT4A 1LOKA 3ICUA 2ZEMA 5F09A 3SJEA 3NA6A 3D4UA 4F9VA 2OOTA 7CPAA 2JBJA 2PJBA 2PE3A 1Y0YA 2QJ8A 2EK8A 4C9EA 4NFRA 3FF3A 4R76A 5IB9A 1YMEA 2HC9A 1LCPA 2AFUA 1BPMA 2AFMA 4W9YA 2QYVA 3FX6A 2PCUA 3DLJA 2PJ8A 4A94A 2CTBA 3BHXA 1KWMA 4LQGA 3LMSA 3VH9A 1IGBA 2O53A 4MHYA 1Y0RA 3D7HA 3KQZA 2ZENA 4ZY2A 4C8AA 2V8VA 1CPSA 3RAMA 2PJ3A 4FBEA 1LAPA 2BO9A 1YW6A 1OBRA 4TNUA 4P6YA 3TC8A 4NGQA 2C6PA 3B3WA 4AXVA 3DGVA 3CPXA 5D8NA 1R3NA 1Y7EA 1YSJA 4WJBA 2Q4ZA 2XEIA 2GLJA 5JH9A 3SI2A 1LFWA 4NGRA 4P4JA 3PBBA 1F2PA 4C8PA 5K8OA 3BI1A 3HLPA 4KSIA 1BLLE 1TF9A 4OC5A 1YLOA 4TJXA 4C9AA 2PJ2A 4R7MA 3IEHA 1EE3P 5HVHA 4C8FA 3KR4A 3WABA 4R8FA 1RTQA 1CG2A 1VIXA 3SI1A 1GYTA 1F2OA 4P44A 2RB7A 2C5QA 1VHOA 1HDQA 3K2KA 5HVGA 2IMOA 4ONWA 3FEEA 1PCAA 4OMEA 1CPXA 2FVGA 3B3CA 4OP4A 2WYRA 3T8WA 5HXDA 4C8CA 5ELYA 4ZX9A 3RZAA 2PIZA 2GP4A 4OC3A 4DYOA 2AFZA 3S9NA 4IK2A 5LYFA 2PJ4A 1TKFA 4NJRA 1Z8LA 1PYTB 3NH4A 5JM6A 3D66A 4MHPA 3GUXA 4IHMA 5I4MA 2EWBA 4YN3A 3H8EA 1TXRA 3WC7A 3WC5A 3PB8X 4NGSA 3PFEA 1IY7A 5LYIA 3KGQA 2GLFA 1XMBA 1QQ9A 3NH8A 4C99A 1ZG7A 4P4FA 3TX8A 3PB7X 2ZEHA 5DS0A 2C6GA 1VGYA 3GLJA 4ZX8A 4CDKA 4C86A 4WWVA 4FUUA 2XEJA 1VHEA 3KL9A 4PXDA 3B2YA 4MXUA 1WVMA 4JZ0A 4BD9A 1V6CA 2ZELA 5JGFA 4YWYA 4X2TA 2AFOA 2ANPA 2C1CA 4PPZA 1Y9ZA 1ELLP 2ZEPA 1LAMA 4DJLA 2C6CA 2IQ6A 1Q7LA 4FWUA 1BAVA 3N5FA 1CP7A 3D67A 4ZI6A 3PB9X 2HB6A 6CPAA 3CT9A 3MN8A 1H8LA 3S9LA 4NGPA 2QVPA 1DE4C 3SJGA 2Q51A 4EWTA 3H8GA 3V38A 1HEEA 3D7FA 1ARLA 2BCOA 3B7IA 2ZEEA 3L2NA 4A38A 3B3VA 3IIBA 2ABZA 3RBUA 4PXBA 1XFOA 4K3NA 4P4BA 3D68A 5LRGA 5CPAA 1ZLHA 4P45A 1HDUA 1TKJA 4Q7AA 4CDJA 3SJFA 2ZEDA 4YU9A 4C9VA 1Z2LA 2PJ9A 3IFEA 3BI0A 4OC2A 4MCSA 2J9AA 1JQGA 4OKOA 2CF4A 3KI9A 1LANA 3EIFA 4MHNA 5LYDA 4CPAA 2ZOFA 3GB0A 4OC4A 1NSAA 1ZG9A 3JRUA 3PFOA 4Z65A 2PJAA 2ZEGA 5LYLA 3MRUA 2AFWA 3I1UA 4OIWA 4GM5A 4RUHA 4UF4A 2JBKA 4F9UA 2XEFA 3IC1A 3IO1A 5THWA 2DEAA 2PVWA 1ZG8A 3BXMA 4C85A 3CDXA 2PRQA 4MMOA 2BOAA 3FH4A 3PRTA 4EMEA 4PXCA 5J1QA 4KNGE 4ZY1A 5D29A 4NGTA 1TF8A 2POKA 1ZLIA 1YW4A 4NJQA 1CX8A 2V8DA 1F57A 2PJ1A 3FECA 2RFHA 3PBEA 1FT7A 1M4LA 3H8FA 3HUVA 2G9DA 2NSMA 4OIDA 2PJ0A 1XF1A 4C8UA 2PJ5A 2CIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJC A;  1XRY A;  3QNV A;  1AMP A;  3FED A;  3LWU A;  3KAS A;  2Q43 A;  3PB4 X;  4MRI A;  5K8N A;  3FMC A;  4P10 A;  4TWE A;  2V8G A;  3B3S A;  2VL1 A;  2PIY A;  3FVL A;  3WC6 A;  4R6T A;  3I74 A;  2AFS A;  3KQX A;  2I3C A;  1UWY A;  1Z5R A;  3KR5 A;  2OR4 A;  4P4E A;  2JEW A;  3PB6 X;  2O4H A;  1QMU A;  4C84 A;  1XJO A;  2GU2 A;  4H2K A;  3IJ3 A;  3PEI A;  2NYQ A;  4MCP A;  1CP6 A;  3K9T A;  4TJV A;  5K8P A;  4MCR A;  2AFX A;  1CBX A;  2XEG A;  3KZW A;  3ISX A;  2F8H A;  3IWW A;  3I6S A;  8CPA A;  3VAR A;  2EK9 A;  1R43 A;  2F7V A;  4OC1 A;  3KHX A;  4C9U A;  3D7D A;  4ZY0 A;  2V77 A;  4DUK A;  3B3T A;  2CTC A;  4UEZ A;  4MHZ A;  1XBU A;  4F8Z A;  2V8H A;  3NH5 A;  1BPN A;  1TKH A;  4C9R A;  4G1P A;  4PXE A;  3V7Z A;  2IJZ A;  4PQA A;  4UIB A;  4B6Z A;  5LRJ A;  4EFD A;  3KHZ A;  2ZEF A;  4X3R A;  3VAT A;  4C8T A;  4FAI A;  5LRK A;  4NGN A;  4MCQ A;  4JYW A;  4OC0 A;  4X8I A;  2PJ7 A;  4P4I A;  2PJ6 A;  4A39 A;  2ZOG A;  3FJU A;  3SI0 A;  3D7G A;  2GRE A;  4ZYQ A;  3ISZ A;  2ZEO A;  1FNO A;  3CPA A;  4A37 A;  1AYE A;  3VTA A;  2WZN A;  5CBM A;  4NGM A;  3SJX A;  1ELM P;  4UEF A;  4P4D A;  5K8M A;  5HVF A;  1DTD A;  2PVV A;  3B35 A;  3S9M A;  1ARM A;  3NFZ A;  4UEE A;  4O23 A;  4IAV A;  4UIA A;  3WT4 A;  1LOK A;  3ICU A;  2ZEM A;  5F09 A;  3SJE A;  3NA6 A;  3D4U A;  4F9V A;  2OOT A;  7CPA A;  2JBJ A;  2PJB A;  2PE3 A;  1Y0Y A;  2QJ8 A;  2EK8 A;  4C9E A;  4NFR A;  3FF3 A;  4R76 A;  5IB9 A;  1YME A;  2HC9 A;  1LCP A;  2AFU A;  1BPM A;  2AFM A;  4W9Y A;  2QYV A;  3FX6 A;  2PCU A;  3DLJ A;  2PJ8 A;  4A94 A;  2CTB A;  3BHX A;  1KWM A;  4LQG A;  3LMS A;  3VH9 A;  1IGB A;  2O53 A;  4MHY A;  1Y0R A;  3D7H A;  3KQZ A;  2ZEN A;  4ZY2 A;  4C8A A;  2V8V A;  1CPS A;  3RAM A;  2PJ3 A;  4FBE A;  1LAP A;  2BO9 A;  1YW6 A;  1OBR A;  4TNU A;  4P6Y A;  3TC8 A;  4NGQ A;  2C6P A;  3B3W A;  4AXV A;  3DGV A;  3CPX A;  5D8N A;  1R3N A;  1Y7E A;  1YSJ A;  4WJB A;  2Q4Z A;  2XEI A;  2GLJ A;  5JH9 A;  3SI2 A;  1LFW A;  4NGR A;  4P4J A;  3PBB A;  1F2P A;  4C8P A;  5K8O A;  3BI1 A;  3HLP A;  4KSI A;  1BLL E;  1TF9 A;  4OC5 A;  1YLO A;  4TJX A;  4C9A A;  2PJ2 A;  4R7M A;  3IEH A;  1EE3 P;  5HVH A;  4C8F A;  3KR4 A;  3WAB A;  4R8F A;  1RTQ A;  1CG2 A;  1VIX A;  3SI1 A;  1GYT A;  1F2O A;  4P44 A;  2RB7 A;  1VHO A;  1HDQ A;  3K2K A;  5HVG A;  2IMO A;  4ONW A;  3FEE A;  1PCA A;  4OME A;  1CPX A;  2FVG A;  3B3C A;  4OP4 A;  2WYR A;  3T8W A;  5HXD A;  4C8C A;  5ELY A;  4ZX9 A;  3RZA A;  2PIZ A;  4OC3 A;  4DYO A;  2AFZ A;  3S9N A;  4IK2 A;  5LYF A;  2PJ4 A;  1TKF A;  4NJR A;  1Z8L A;  1PYT B;  3NH4 A;  5JM6 A;  3D66 A;  4MHP A;  3GUX A;  4IHM A;  5I4M A;  2EWB A;  4YN3 A;  3H8E A;  1TXR A;  3WC7 A;  3WC5 A;  3PB8 X;  4NGS A;  3PFE A;  1IY7 A;  5LYI A;  3KGQ A;  2GLF A;  1XMB A;  1QQ9 A;  3NH8 A;  4C99 A;  1ZG7 A;  4P4F A;  3TX8 A;  3PB7 X;  2ZEH A;  5DS0 A;  2C6G A;  1VGY A;  3GLJ A;  4ZX8 A;  4CDK A;  4C86 A;  4WWV A;  4FUU A;  2XEJ A;  1VHE A;  3KL9 A;  4PXD A;  3B2Y A;  4MXU A;  1WVM A;  4JZ0 A;  4BD9 A;  1V6C A;  2ZEL A;  5JGF A;  4YWY A;  4X2T A;  2AFO A;  2ANP A;  2C1C A;  4PPZ A;  1Y9Z A;  1ELL P;  2ZEP A;  1LAM A;  4DJL A;  2C6C A;  2IQ6 A;  1Q7L A;  4FWU A;  1BAV A;  3N5F A;  1CP7 A;  3D67 A;  4ZI6 A;  3PB9 X;  2HB6 A;  6CPA A;  3CT9 A;  3MN8 A;  1H8L A;  3S9L A;  4NGP A;  2QVP A;  1DE4 C;  3SJG A;  2Q51 A;  4EWT A;  3H8G A;  3V38 A;  1HEE A;  3D7F A;  1ARL A;  2BCO A;  3B7I A;  2ZEE A;  3L2N A;  4A38 A;  3B3V A;  3IIB A;  2ABZ A;  3RBU A;  4PXB A;  1XFO A;  4K3N A;  4P4B A;  3D68 A;  5LRG A;  5CPA A;  1ZLH A;  4P45 A;  1HDU A;  1TKJ A;  4Q7A A;  4CDJ A;  3SJF A;  2ZED A;  4YU9 A;  4C9V A;  1Z2L A;  2PJ9 A;  3IFE A;  3BI0 A;  4OC2 A;  4MCS A;  2J9A A;  1JQG A;  4OKO A;  2CF4 A;  3KI9 A;  1LAN A;  3EIF A;  4MHN A;  5LYD A;  4CPA A;  2ZOF A;  3GB0 A;  4OC4 A;  1NSA A;  1ZG9 A;  3JRU A;  3PFO A;  4Z65 A;  2PJA A;  2ZEG A;  5LYL A;  3MRU A;  2AFW A;  3I1U A;  4OIW A;  4GM5 A;  4RUH A;  4UF4 A;  2JBK A;  4F9U A;  2XEF A;  3IC1 A;  3IO1 A;  5THW A;  2DEA A;  2PVW A;  1ZG8 A;  3BXM A;  4C85 A;  3CDX A;  2PRQ A;  4MMO A;  2BOA A;  3FH4 A;  3PRT A;  4EME A;  4PXC A;  5J1Q A;  4KNG E;  4ZY1 A;  5D29 A;  4NGT A;  1TF8 A;  2POK A;  1ZLI A;  1YW4 A;  4NJQ A;  1CX8 A;  2V8D A;  1F57 A;  2PJ1 A;  3FEC A;  2RFH A;  3PBE A;  1FT7 A;  1M4L A;  3H8F A;  3HUV A;  2G9D A;  2NSM A;  4OID A;  2PJ0 A;  1XF1 A;  4C8U A;  2PJ5 A;  2CIJ A; 
#chains in the Genus database with same CATH topology
 2PJC A;  4CRY B;  1KUV A;  1QSR A;  1XRY A;  2B4B A;  3FNC A;  1Z8T A;  2B5G B;  3DSB A;  3QNV A;  1AMP A;  2Y1N A;  4NSQ A;  4OLL A;  3FED A;  3LWU A;  2REE A;  4A4C A;  1NBW A;  3KAS A;  2Q43 A;  4K30 A;  5JPH A;  1X12 A;  3PB4 X;  4R3K A;  3TLZ A;  4MRI A;  4QC6 A;  5K8N A;  3FMC A;  2CY2 A;  4P10 A;  4TWE A;  2V8G A;  2FIA A;  2ZW4 A;  1Z8W A;  2ZW7 A;  2VL1 A;  3B3S A;  4MFJ A;  3CXQ A;  3ZJ0 A;  5IR2 A;  2PIY A;  2PR8 A;  3FVL A;  2Z0Z A;  2X0S A;  3NE7 A;  3WC6 A;  3T05 A;  4R6T A;  4INJ A;  3TLE A;  1M4D A;  4FD4 A;  2IL4 A;  2OZH A;  2EZB A;  3TYX A;  3K9U A;  5HKY A;  1N71 A;  4ONU A;  3I74 A;  2AFS A;  4BBH A;  4IIY A;  4U9Y A;  4UCN A;  5G1Z A;  3T07 A;  3KQX A;  1Z4R A;  4MY3 A;  1S7F A;  2I3C A;  4KOX A;  1UWY A;  5F1Y A;  1Z5R A;  3KR5 A;  2OR4 A;  4P4E A;  2JEW A;  4C2X A;  4LQ6 A;  4C7I A;  3PB6 X;  3ZZI A;  2O4H A;  1Z9E A;  1QMU A;  2P6G A;  1XJO A;  5CNP A;  2GU2 A;  1QST A;  4C84 A;  4PSW A;  3D3S A;  4H2K A;  4CAV A;  2EZC A;  4R57 A;  3OP0 A;  3IJ3 A;  3TO9 A;  3PEI A;  1XMT A;  2NYQ A;  2FM4 A;  4YRH A;  4MCP A;  5F46 A;  4KLW A;  3EZA A;  3ZNI A;  4Q38 A;  1CP6 A;  3K9T A;  3EFA A;  4FD6 A;  2VQY A;  4TJV A;  1EZB A;  4AG9 A;  3NE8 A;  4RI1 A;  2G0B A;  5K8P A;  1IOF A;  2PC1 A;  2VKZ G;  3GKR A;  4MCR A;  5H84 A;  2AFX A;  4C7H A;  1CBX A;  2F5I A;  4XNH C;  2XEG A;  2WPW A;  2Y0M A;  2UV8 G;  1Q2Y A;  3KZW A;  5G20 A;  2HI6 A;  1YGH A;  4CAX A;  3ISX A;  1BOB A;  2B4D B;  3IWW A;  2F8H A;  3DR8 A;  3G23 A;  3I6S A;  8CPA A;  2DXQ A;  4CO9 A;  1KC7 A;  3VAR A;  3BUW B;  2EK9 A;  2XPL A;  1R43 A;  4OC1 A;  2F7V A;  3KHX A;  4UCP A;  3D7D A;  4A31 A;  4C9U A;  2OLS A;  2Z3P A;  4ZY0 A;  2V77 A;  4UCM A;  3B3T A;  2CTC A;  4DUK A;  3B8G A;  4UEZ A;  1Z4E A;  4MHZ A;  4YGO A;  2B4J C;  1XBU A;  4F8Z A;  2V8H A;  3NH5 A;  4B5O A;  1BPN A;  1TKH A;  2ATR A;  3JTK A;  4C9R A;  4G1P A;  4PXE A;  1IIC A;  3V7Z A;  4R87 A;  3W6S A;  2IJZ A;  4PQA A;  4UIB A;  1YVK A;  4B6Z A;  4Y49 C;  4MY0 A;  5LRJ A;  4EFD A;  4XNH B;  5HKW A;  3KHZ A;  3F8K A;  2R8V A;  2ZEF A;  4X3R A;  1S60 A;  3VAT A;  4C8T A;  4A4B A;  2WSA A;  4FAI A;  2DLA A;  4LX9 A;  1KBL A;  5LRK A;  4NGN A;  4JLY A;  4MCQ A;  4NCZ A;  1M1D A;  1NXJ A;  4NF1 A;  1MJ9 A;  3TLC A;  2GE3 A;  4JYW A;  4OC0 A;  1Q2C A;  2ODF A;  2PJ7 A;  3VRP A;  4FD5 A;  3IGR A;  2OB0 A;  4X8I A;  5I0C A;  4P4I A;  3D2M A;  2JDD A;  1YVH A;  2PJ6 A;  2G3A A;  4A39 A;  2ZOG A;  3FJU A;  1FBV A;  2FXF A;  1CE8 B;  3SI0 A;  3D7G A;  2GRE A;  3C26 A;  4ZYQ A;  3ISZ A;  3A9L A;  2Q4V A;  2ZEO A;  2GAN A;  4UFV A;  2EUI A;  1S5K A;  3PZJ A;  5AGE A;  4JD6 A;  1VBH A;  2DIK A;  3VRO A;  3PP9 A;  2Z3O A;  3TLY A;  1FNO A;  3CXP A;  3CPA A;  4A37 A;  3T5M A;  4MI1 A;  1AYE A;  3VTA A;  2WZN A;  5CBM A;  3RYO A;  4J0N A;  4RN7 A;  4NGM A;  3SJX A;  1ELM P;  1Z8X A;  2JLM A;  4P4D A;  2ZPA A;  4UEF A;  5K8M A;  5HKZ A;  2YJT A;  4UFW A;  5HVF A;  1R61 A;  4COB A;  5A27 A;  1DTD A;  1L0C A;  2OZG A;  2PVV A;  3B35 A;  4L89 A;  4CGO A;  4CYQ A;  5C82 A;  3S9M A;  1ARM A;  2D4P A;  2Z10 A;  3NFZ A;  1S7N A;  4UEE A;  3W91 A;  2P6F A;  5EMI A;  4O23 A;  5AXI A;  4PV6 A;  4IAV A;  4ZBG A;  4LUA A;  1KZF A;  1ZL0 A;  5E96 A;  4UIA A;  2VZZ A;  3WT4 A;  3EXN A;  1LOK A;  2R82 A;  3ICU A;  2ZEM A;  2QML A;  2B4D A;  5F09 A;  3SJE A;  1B6B A;  3D4U A;  3NA6 A;  4F9V A;  2OOT A;  7CPA A;  2JBJ A;  2PJB A;  2PE3 A;  4EVY A;  2I00 A;  3G8W A;  4CGM A;  1JWQ A;  1MJB A;  4YFJ A;  1Y0Y A;  4HPS A;  2WPX A;  1CS0 B;  1XOV A;  5J3X A;  2QJ8 A;  2EK8 A;  4C9E A;  4COG A;  4MBU A;  3FF3 A;  4NFR A;  4R76 A;  4F0X A;  5IB9 A;  1YME A;  2HC9 A;  1IYL A;  1LCP A;  2P6E A;  2AFU A;  4CZ1 A;  1U6M A;  4CAF A;  1BPM A;  3RNZ A;  2XPO A;  5FD8 A;  2AFM A;  4W9Y A;  3KKW A;  4KOT A;  2HRO A;  1VI4 A;  3OAK A;  5EBV A;  4BMH A;  2QYV A;  2HUZ A;  3FX6 A;  4KSA A;  5F13 A;  4HKF A;  1I12 A;  1ON0 A;  2PCU A;  4MJ8 A;  3DLJ A;  2PJ8 A;  4E0A A;  3JVN A;  3K4I A;  2DPS A;  4KVO E;  4A94 A;  2VXK A;  2CTB A;  1SQH A;  3BHX A;  3EY5 A;  4M6I A;  1KWM A;  4LQG A;  3TO7 A;  3LMS A;  3VH9 A;  3H5Z A;  2YNC A;  2VEZ A;  1IGB A;  4MFL A;  2FT0 A;  2O53 A;  1S7L A;  3BLN A;  3FB3 A;  4JXR A;  3HPG G;  2BUE A;  4MHY A;  1Y0R A;  3D7H A;  3KQZ A;  2ZEN A;  3QB8 A;  4ZY2 A;  4MFZ A;  2V8V A;  4C8A A;  1CPS A;  4M6G A;  3RAM A;  2D4O A;  3VWE A;  2PJ3 A;  4AB7 A;  4QVT A;  4KOS A;  4FBE A;  2H5M A;  2O28 A;  4C2Z A;  1WJT A;  2N3A B;  1LAP A;  2VI7 A;  3D8P A;  2BO9 A;  4BPU B;  1YW6 A;  3TLB A;  1OBR A;  3T9Y A;  4B13 A;  4UWI A;  4TNU A;  4CGL A;  4P6Y A;  3TC8 A;  4GS4 A;  4NGQ A;  1MK4 A;  2C6P A;  1XF8 A;  3S6G A;  3B3W A;  5ISV A;  5KTD A;  4BPW B;  4AXV A;  3SXO A;  3DGV A;  4QUS A;  3CPX A;  5D8N A;  1R3N A;  1Y7E A;  1YSJ A;  1TIQ A;  2YNE A;  1MJA A;  2REF A;  4WJB A;  2DF5 A;  2Q4Z A;  3TLG A;  2XEI A;  4HNX B;  2GLJ A;  4CGN A;  2FE7 A;  2GIV A;  2J8R A;  4AVB A;  5JH9 A;  3SI2 A;  1YK3 A;  1LFW A;  3TFY A;  2Q4Y A;  1Y9W A;  4NGR A;  4P4J A;  1CM0 A;  2Z3N A;  4MFP A;  3FRM A;  2VZY A;  2Q7S A;  3VRQ A;  1I21 A;  4BPX B;  3I9S A;  4UA3 A;  1BXR B;  4KS9 A;  1GGO A;  3PBB A;  4A32 A;  1F2P A;  2PDO A;  4R3L A;  4C8P A;  5K8O A;  4E5S A;  2QIR A;  2BEI A;  3BI1 A;  3QAH A;  1KEE B;  3IU1 A;  2PR1 A;  2B5G A;  4NXY A;  3HLP A;  4KSI A;  1BLL E;  1TF9 A;  4OC5 A;  1YLO A;  4TJX A;  4C9A A;  3FBU A;  2XPN A;  2PJ2 A;  1XEB A;  4R7M A;  2PSW A;  3IEH A;  1ZYM A;  3SHP A;  1FY7 A;  2HV2 A;  4UFX A;  1EE3 P;  4KZT A;  4J3G A;  5HVH A;  4KOR A;  4OAD A;  4C8F A;  1QSM A;  3BUX B;  3KR4 A;  3WAB A;  4R8F A;  1RTQ A;  1CG2 A;  4H89 A;  2OZU A;  1A9X B;  1KUY A;  1VIX A;  3SI1 A;  4HNY B;  4DNC A;  2ZW5 A;  3QAY A;  3EZE A;  1GYT A;  1F2O A;  3O8Z A;  1EZA A;  4P44 A;  2RB7 A;  1C3O B;  3PFV A;  4JVO A;  1VHS A;  2C5Q A;  1VHO A;  1HDQ A;  3OWC A;  4F6A A;  3TCV A;  3K2K A;  5HVG A;  1YX0 A;  2IMO A;  4ONW A;  3FEE A;  3VWD A;  1PCA A;  5BY0 A;  2B3U A;  4OME A;  1IB1 E;  3DR6 A;  1J3L A;  5DWN A;  4Y49 B;  1CPX A;  4KVX A;  5EC4 A;  2FVG A;  1K4J A;  4HNW B;  2J8M A;  1R57 A;  3B3C A;  2WYR A;  4OP4 A;  3BUN B;  3T8W A;  1RO5 A;  5HXD A;  2CBL A;  4C8C A;  5ELY A;  4ZX9 A;  2EVN A;  4B10 A;  3RZA A;  5KTC A;  2J8N A;  2PIZ A;  2Z3L A;  5AG7 A;  3BJ7 A;  3PLF B;  4OC3 A;  2GP4 A;  4DYO A;  2AFZ A;  4C68 A;  3C8O A;  3HMJ G;  3S9N A;  1CJW A;  4H6Z A;  4PK2 A;  4UWJ A;  3RO0 A;  4IK2 A;  4R9M A;  4CAE A;  2PJ4 A;  5LYF A;  1TKF A;  4NJR A;  5JQ4 A;  3VRR A;  3F9K C;  2I79 A;  1Z8L A;  3LOD A;  1PYT B;  2X7B A;  3NH4 A;  2PRB A;  3LD2 A;  5JM6 A;  5A28 A;  5F5X A;  4KVM E;  3D66 A;  1P0H A;  1S3Z A;  4EYS A;  4MHP A;  4XPD C;  4GXH A;  3BUO B;  4MFK A;  3FYN A;  4QBJ A;  4X5K A;  1M4G A;  2E28 A;  4JXQ A;  3GUX A;  4IHM A;  1OZP A;  4KUB A;  5I4M A;  2EWB A;  2EBJ A;  4YN3 A;  3H8E A;  1TXR A;  2P0W A;  3WC5 A;  3WC7 A;  4M8D A;  5JVL A;  4M85 A;  2YGW A;  3PB8 X;  4NGS A;  3PFE A;  4MJX A;  1IY7 A;  1EO0 A;  5LYI A;  3WR7 A;  3FXT A;  3KGQ A;  2GLF A;  5H86 A;  1XMB A;  4A33 A;  1QQ9 A;  3NH8 A;  4ZGY B;  4C99 A;  3F0A A;  1RXT A;  1ZG7 A;  2JEV A;  2YJV A;  4P4F A;  2AE6 A;  2JDC A;  1NE9 A;  4BIN A;  4KOU A;  2DPT A;  3TX8 A;  3U88 C;  4B5P B;  3GJZ A;  3PB7 X;  2ZEH A;  1A2Z A;  4B14 A;  1Y9K A;  3PT1 A;  3I3G A;  2C6G A;  1VGY A;  3GLJ A;  5DS0 A;  2AUN A;  4ZX8 A;  4XPD B;  3TTH A;  4CDK A;  2ARH A;  1YRE A;  4F0Y A;  2FL4 A;  4IUS A;  4WWV A;  4C86 A;  4IF5 A;  5HH1 A;  3E0K A;  4FUU A;  2BSW A;  2OH1 A;  2XEJ A;  1VHE A;  2CXA A;  2ZW6 A;  3KL9 A;  4PXD A;  3R9E A;  2R1I A;  4U9Z A;  2G3T A;  3B2Y A;  4MXU A;  3SXN A;  1WVM A;  4JZ0 A;  4BD9 A;  3SR3 A;  1V6C A;  2Y1M A;  2ZEL A;  5JGF A;  4A30 A;  1ZO0 A;  4YWY A;  4X2T A;  3BJ8 A;  1Q5X A;  1M4I A;  2AFO A;  2KCW A;  5AG6 A;  2ANP A;  3TT2 A;  3S6F A;  2C1C A;  3D2P A;  2FCK A;  4PPZ A;  1X10 A;  2WUU A;  5AG5 A;  4A95 A;  4KOW A;  5GCN A;  1Y9Z A;  4L8A A;  4AG7 A;  1B87 A;  1ELL P;  1LRZ A;  5IX3 A;  2ZEP A;  5C88 A;  1LAM A;  2B58 A;  1M44 A;  4XPL A;  2C6C A;  3G3S A;  4DJL A;  4PK3 A;  3S6H A;  1IID A;  1Q7L A;  2IQ6 A;  4AVC A;  2GFQ A;  1IOI A;  1XE4 A;  3V8I A;  3MGD A;  4FWU A;  1BAV A;  5F9M A;  3S6K A;  2CNT A;  5G21 A;  1QSO A;  3N5F A;  1CP7 A;  3D67 A;  3IU2 A;  4MHD A;  4QB9 A;  3HPH E;  2FSR A;  4ZI6 A;  4KOV A;  2Q0Y A;  3R95 A;  1VBG A;  3PB9 X;  2HB6 A;  4KSF A;  6CPA A;  4H6U A;  4C2Y A;  3JUW A;  2Z11 A;  5BWA B;  3CT9 A;  3MN8 A;  1H8L A;  3W6X A;  3S9L A;  4NGP A;  2QVP A;  2D0O A;  1DE4 C;  3TLA A;  2BL1 A;  4IIX A;  1YQE A;  3SJG A;  2Q51 A;  4PSX A;  4UBR A;  4EWT A;  3H8G A;  3V38 A;  3DNS A;  5JYB A;  1HEE A;  3GYA A;  3D7F A;  1ARL A;  5KTA A;  2AJ6 A;  2BCO A;  3B7I A;  2ZEE A;  3L2N A;  3KRV A;  2B3V A;  4A38 A;  3B3V A;  3IIB A;  2ABZ A;  4CGP A;  5AG4 A;  2ZXV A;  1VKC A;  3CZX A;  4KOY A;  4CYN A;  1Z9U A;  3RBU A;  3TE4 A;  5FVJ A;  2QEC A;  4PXB A;  2AUM A;  1PUA A;  3NOJ A;  5HMN A;  1XFO A;  4K3N A;  4P4B A;  3R9G A;  3UY5 A;  1I1D A;  1P4N A;  3D68 A;  5CPA A;  1ZLH A;  4P45 A;  5F48 A;  5LRG A;  4B12 A;  5K99 A;  1HDU A;  2YNC C;  1TKJ A;  4Q7A A;  3TOB A;  3T0T A;  3SJF A;  4CDJ A;  4B5P A;  4E8O A;  1J4J A;  2ZED A;  4YU9 A;  4Q36 A;  4U5Y A;  2D0P A;  3EC4 A;  4C9V A;  1QSN A;  2OU2 A;  1Z2L A;  2EO8 A;  2PJ9 A;  2Z3M A;  1GHE A;  3OB1 B;  3IFE A;  5J8C A;  4RR2 B;  3VGO A;  4AVA A;  3BI0 A;  4OC2 A;  4MCS A;  2J9A A;  1JQG A;  2PJ5 A;  3N7Z A;  4FD7 A;  3BUM B;  2CF4 A;  3KI9 A;  4OKO A;  1LAN A;  4CS0 B;  1C30 B;  3EIF A;  4MHN A;  5LYD A;  4E94 A;  2MP0 A;  2NMT A;  4CPA A;  2ZOF A;  3GB0 A;  1NMT A;  1M6V B;  4OC4 A;  1NSA A;  1ZG9 A;  3JRU A;  3H4Q A;  3PFO A;  4Z65 A;  2PJA A;  2ZEG A;  5LYL A;  3MRU A;  2AFW A;  4KLV A;  1PU9 A;  3F5B A;  3I1U A;  4OIW A;  4GM5 A;  3EO4 A;  4RUH A;  4H1H A;  2HQY A;  4GPL B;  1XIX A;  1IU8 A;  5G22 A;  5IB0 A;  3TO6 A;  4UF4 A;  2JBK A;  4M3S A;  3OB2 B;  3T90 A;  4F9U A;  2PCN A;  2R98 A;  1DIK A;  2EZA A;  2XEF A;  4MI4 A;  3IC1 A;  2XPP A;  2Z3K A;  3IO1 A;  1V0C A;  2K5T A;  5THW A;  2DEA A;  5IV0 A;  4JWP A;  2PVW A;  4KUA A;  5F47 A;  4XPK A;  1ZG8 A;  2B0A A;  1S7K A;  3BXM A;  3P2F A;  3TOA A;  1T36 B;  1UFH A;  1B47 A;  4C85 A;  2CNM A;  2FS5 A;  3U1B A;  3CDX A;  2PRQ A;  3VRN A;  3NFQ A;  4MFQ A;  4MMO A;  5J8F A;  2BOA A;  3FH4 A;  3LAC A;  3PRT A;  4EME A;  1YLE A;  2HWG A;  1KUX A;  4CAW A;  2PQ8 A;  3GY9 A;  4BTF A;  1IYK A;  4PXC A;  4CRZ B;  5J1Q A;  4KNG E;  4II9 A;  2YND A;  4ZY1 A;  4NEX A;  3R1K A;  5D29 A;  4NGT A;  4CYP A;  1TF8 A;  1Y7R A;  2POK A;  3R96 A;  2Q04 A;  3IWE A;  1ZLI A;  1ZRS A;  1YVO A;  1YW4 A;  2FIW A;  4B11 A;  2CNS A;  4NJQ A;  1AUG A;  1CX8 A;  2V8D A;  3TLG B;  1F57 A;  3DDD A;  2PJ1 A;  3GIU A;  4ORF A;  3FEC A;  1WK4 A;  3FIX A;  4OAE A;  5F49 A;  3R9F A;  5DWM A;  2RFH A;  1JDE A;  3EZB A;  1WWZ A;  3P2H A;  3PBE A;  4E2A A;  1FT7 A;  4RS2 A;  1Q2D A;  2Q7B A;  1NSL A;  4CYO A;  3CXS A;  1M4L A;  3H8F A;  4I49 A;  1JDB C;  3HUV A;  2G9D A;  2R7H A;  2RC4 A;  2NSM A;  3PGP A;  2PJ0 A;  4JJX A;  4OID A;  4M6H A;  1XF1 A;  4C8U A;  2VBQ A;  1YR0 A;  4A2Z A;  2C27 A;  2Q44 A;  3IWG A;  2A4N A;  2CIJ A;  1BO4 A; 
#chains in the Genus database with same CATH homology
 2PJC A;  1XRY A;  3QNV A;  1AMP A;  3FED A;  3LWU A;  3KAS A;  2Q43 A;  3PB4 X;  4MRI A;  5K8N A;  3FMC A;  4P10 A;  4TWE A;  2V8G A;  3B3S A;  2VL1 A;  5IR2 A;  2PIY A;  3FVL A;  3WC6 A;  4R6T A;  3I74 A;  2AFS A;  3KQX A;  2I3C A;  1UWY A;  1Z5R A;  3KR5 A;  2OR4 A;  4P4E A;  2JEW A;  3PB6 X;  2O4H A;  1QMU A;  4C84 A;  1XJO A;  2GU2 A;  4H2K A;  3IJ3 A;  3PEI A;  2NYQ A;  4MCP A;  1CP6 A;  3K9T A;  4TJV A;  5K8P A;  4MCR A;  2AFX A;  1CBX A;  2XEG A;  3KZW A;  3ISX A;  2F8H A;  3IWW A;  3I6S A;  8CPA A;  3VAR A;  2EK9 A;  1R43 A;  2F7V A;  4OC1 A;  3KHX A;  4C9U A;  3D7D A;  4ZY0 A;  2V77 A;  4DUK A;  3B3T A;  2CTC A;  4UEZ A;  4MHZ A;  1XBU A;  4F8Z A;  2V8H A;  3NH5 A;  1BPN A;  1TKH A;  4C9R A;  4G1P A;  4PXE A;  3V7Z A;  2IJZ A;  4PQA A;  4UIB A;  4B6Z A;  5LRJ A;  4EFD A;  3KHZ A;  2ZEF A;  4X3R A;  3VAT A;  4C8T A;  4FAI A;  5LRK A;  4NGN A;  4MCQ A;  4JYW A;  4OC0 A;  4X8I A;  2PJ7 A;  4P4I A;  2PJ6 A;  4A39 A;  2ZOG A;  3FJU A;  3SI0 A;  3D7G A;  2GRE A;  4ZYQ A;  3ISZ A;  2ZEO A;  1FNO A;  3CPA A;  4A37 A;  1AYE A;  3VTA A;  2WZN A;  5CBM A;  4NGM A;  3SJX A;  1ELM P;  4UEF A;  4P4D A;  5K8M A;  5HVF A;  1DTD A;  2PVV A;  3B35 A;  3S9M A;  1ARM A;  3NFZ A;  4UEE A;  4O23 A;  4IAV A;  4UIA A;  3WT4 A;  1LOK A;  3ICU A;  2ZEM A;  5F09 A;  3SJE A;  3NA6 A;  3D4U A;  4F9V A;  2OOT A;  7CPA A;  2JBJ A;  2PJB A;  2PE3 A;  1Y0Y A;  2QJ8 A;  2EK8 A;  4C9E A;  4NFR A;  3FF3 A;  4R76 A;  5IB9 A;  1YME A;  2HC9 A;  1LCP A;  2AFU A;  1BPM A;  2AFM A;  4W9Y A;  2QYV A;  3FX6 A;  2PCU A;  3DLJ A;  2PJ8 A;  4A94 A;  2CTB A;  3BHX A;  1KWM A;  4LQG A;  3LMS A;  3VH9 A;  1IGB A;  2O53 A;  4MHY A;  1Y0R A;  3D7H A;  3KQZ A;  2ZEN A;  4ZY2 A;  4C8A A;  2V8V A;  1CPS A;  3RAM A;  2PJ3 A;  4FBE A;  1LAP A;  2BO9 A;  1YW6 A;  1OBR A;  4TNU A;  4P6Y A;  3TC8 A;  4NGQ A;  2C6P A;  3B3W A;  4AXV A;  3DGV A;  3CPX A;  5D8N A;  1R3N A;  1Y7E A;  1YSJ A;  4WJB A;  2Q4Z A;  2XEI A;  2GLJ A;  5JH9 A;  3SI2 A;  1LFW A;  4NGR A;  4P4J A;  3PBB A;  1F2P A;  4C8P A;  5K8O A;  3BI1 A;  3HLP A;  4KSI A;  1BLL E;  1TF9 A;  4OC5 A;  1YLO A;  4TJX A;  4C9A A;  2PJ2 A;  4R7M A;  3IEH A;  1EE3 P;  5HVH A;  4C8F A;  3KR4 A;  3WAB A;  4R8F A;  1RTQ A;  1CG2 A;  1VIX A;  3SI1 A;  1GYT A;  1F2O A;  4P44 A;  2RB7 A;  2C5Q A;  1VHO A;  1HDQ A;  3K2K A;  5HVG A;  2IMO A;  4ONW A;  3FEE A;  1PCA A;  4OME A;  1CPX A;  2FVG A;  3B3C A;  4OP4 A;  2WYR A;  3T8W A;  5HXD A;  4C8C A;  5ELY A;  4ZX9 A;  3RZA A;  2PIZ A;  2GP4 A;  4OC3 A;  4DYO A;  2AFZ A;  3S9N A;  4IK2 A;  5LYF A;  2PJ4 A;  1TKF A;  4NJR A;  1Z8L A;  1PYT B;  3NH4 A;  5JM6 A;  3D66 A;  4MHP A;  3GUX A;  4IHM A;  5I4M A;  2EWB A;  4YN3 A;  3H8E A;  1TXR A;  3WC7 A;  3WC5 A;  3PB8 X;  4NGS A;  3PFE A;  1IY7 A;  5LYI A;  3KGQ A;  2GLF A;  1XMB A;  1QQ9 A;  3NH8 A;  4C99 A;  1ZG7 A;  4P4F A;  3TX8 A;  3PB7 X;  2ZEH A;  5DS0 A;  2C6G A;  1VGY A;  3GLJ A;  4ZX8 A;  4CDK A;  4C86 A;  4WWV A;  4FUU A;  2XEJ A;  1VHE A;  3KL9 A;  4PXD A;  3B2Y A;  4MXU A;  1WVM A;  4JZ0 A;  4BD9 A;  1V6C A;  2ZEL A;  5JGF A;  4YWY A;  4X2T A;  2AFO A;  2ANP A;  2C1C A;  4PPZ A;  1Y9Z A;  1ELL P;  2ZEP A;  1LAM A;  4DJL A;  2C6C A;  2IQ6 A;  1Q7L A;  4FWU A;  1BAV A;  3N5F A;  1CP7 A;  3D67 A;  4ZI6 A;  3PB9 X;  2HB6 A;  6CPA A;  3CT9 A;  3MN8 A;  1H8L A;  3S9L A;  4NGP A;  2QVP A;  1DE4 C;  3SJG A;  2Q51 A;  4EWT A;  3H8G A;  3V38 A;  1HEE A;  3D7F A;  1ARL A;  2BCO A;  3B7I A;  2ZEE A;  3L2N A;  4A38 A;  3B3V A;  3IIB A;  2ABZ A;  3RBU A;  4PXB A;  1XFO A;  4K3N A;  4P4B A;  3D68 A;  5LRG A;  5CPA A;  1ZLH A;  4P45 A;  1HDU A;  1TKJ A;  4Q7A A;  4CDJ A;  3SJF A;  2ZED A;  4YU9 A;  4C9V A;  1Z2L A;  2PJ9 A;  3IFE A;  3BI0 A;  4OC2 A;  4MCS A;  2J9A A;  1JQG A;  4OKO A;  2CF4 A;  3KI9 A;  1LAN A;  3EIF A;  4MHN A;  5LYD A;  4CPA A;  2ZOF A;  3GB0 A;  4OC4 A;  1NSA A;  1ZG9 A;  3JRU A;  3PFO A;  4Z65 A;  2PJA A;  2ZEG A;  5LYL A;  3MRU A;  2AFW A;  3I1U A;  4OIW A;  4GM5 A;  4RUH A;  4UF4 A;  2JBK A;  4F9U A;  2XEF A;  3IC1 A;  3IO1 A;  5THW A;  2DEA A;  2PVW A;  1ZG8 A;  3BXM A;  4C85 A;  3CDX A;  2PRQ A;  4MMO A;  2BOA A;  3FH4 A;  3PRT A;  4EME A;  4PXC A;  5J1Q A;  4KNG E;  4ZY1 A;  5D29 A;  4NGT A;  1TF8 A;  2POK A;  1ZLI A;  1YW4 A;  4NJQ A;  1CX8 A;  2V8D A;  1F57 A;  2PJ1 A;  3FEC A;  2RFH A;  3PBE A;  1FT7 A;  1M4L A;  3H8F A;  3HUV A;  2G9D A;  2NSM A;  4OID A;  2PJ0 A;  1XF1 A;  4C8U A;  2PJ5 A;  2CIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...