3D7FA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcit, a urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
total genus 263
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7fA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7fA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7fA02
2CTBA 1RTQA 1XFOA 2POKA 3SJGA 4NGSA 5K8PA 5CPAA 4MCRA 3SJEA 3TC8A 4F9VA 3KHZA 3HUVA 3V38A 1M4LA 3PB6X 2ZEEA 3IIBA 3PB4X 1IGBA 4P44A 1YW6A 3B3SA 4ZY0A 1DE4C 3PEIA 3NH8A 4UIBA 4UEEA 3KR4A 2AFSA 2PCUA 2AFMA 1Y0RA 1Q7LA 4IHMA 5LYDA 2PE3A 4NJQA 3GLJA 1TF8A 5ELYA 2RB7A 3S9NA 3PB9X 3MRUA 2ZEHA 4ZYQA 1BLLE 3QNVA 2ZENA 5LYFA 2PIZA 2HC9A 4R76A 1Y0YA 3FMCA 4NGNA 5LRGA 1QQ9A 4MCQA 1CPXA 2PVVA 4MXUA 3CT9A 4OKOA 2XEGA 2Q4ZA 4ZY2A 2PJ0A 3V7ZA 2V8HA 2ABZA 5K8NA 1CBXA 3I6SA 3KGQA 2OOTA 3KZWA 1CG2A 3K9TA 2V8DA 2Q51A 1YLOA 1Z5RA 3S9LA 4C8UA 3CPAA 3D4UA 4OC3A 2F8HA 3NH5A 1XRYA 1HDUA 4FAIA 1AMPA 1XMBA 4P4FA 3B3WA 4R7MA 2ZEGA 2V8GA 4PXCA 1YMEA 4C8AA 4KSIA 2IJZA 4IAVA 4NJRA 2PJ3A 4MHYA 1ZLHA 1R43A 1Z2LA 3ICUA 3H8EA 2RFHA 1ARMA 4F8ZA 2HB6A 1VIXA 3BI1A 1F2PA 4TJXA 5CBMA 4OC1A 3FX6A 4EWTA 4R6TA 2C6CA 2XEIA 4O23A 4DJLA 3N5FA 4WJBA 3WC7A 2GU2A 3B3VA 3VARA 3LWUA 3WC5A 4A37A 2NYQA 1EE3P 3IC1A 5JH9A 4ONWA 1ELLP 4P4EA 1UWYA 2PJBA 2FVGA 1TF9A 4PQAA 1AYEA 4PXDA 1LOKA 3FVLA 4C85A 2PJ2A 3DGVA 4JYWA 1BPMA 2C6GA 2XEJA 2OR4A 4MCPA 2V8VA 3PRTA 4C9EA 5LYIA 3VATA 3NFZA 2BCOA 4A94A 2O4HA 4OC0A 4X2TA 2WZNA 2ZEOA 3TX8A 4UEFA 1XF1A 3IEHA 1CX8A 4P6YA 3ISZA 3FJUA 4X8IA 3GUXA 1IY7A 4YWYA 3HLPA 1PYTB 1GYTA 4IK2A 7CPAA 4PPZA 5THWA 1HEEA 3L2NA 4LQGA 4OC5A 3FEEA 5JM6A 1ZG8A 2ZOGA 2C6PA 1H8LA 3FH4A 4ZI6A 2ZEPA 4A39A 1VHOA 2GREA 2AFOA 3D7HA 3WT4A 2IMOA 1JQGA 3KHXA 4EMEA 3BXMA 2CTCA 4H2KA 4C8FA 3IWWA 3B7IA 4C8CA 4YN3A 3KASA 3DLJA 3D7DA 4UF4A 2ZOFA 3H8FA 3KQZA 1F57A 2PJ6A 5D29A 1V6CA 1LANA 4P4IA 3B3TA 4WWVA 5LYLA 4FBEA 3ISXA 2PJAA 5HVGA 5F09A 4FWUA 1TKJA 4AXVA 1FNOA 1TKHA 3NH4A 1ELMP 4K3NA 3B3CA 2I3CA 4YU9A 4C9UA 4OIDA 4PXBA 4MHNA 4F9UA 3B35A 4NGTA 3PFOA 1OBRA 5K8MA 2QYVA 4C8TA 1BAVA 3BHXA 1R3NA 4Z65A 4NGQA 2QVPA 4P4JA 4C99A 5D8NA 2AFUA 5DS0A 1BPNA 1WVMA 3RAMA 2CIJA 3S9MA 4C9VA 2PJ1A 3FECA 4TWEA 3D66A 4CDKA 2EK9A 3SJFA 3FF3A 3CDXA 4G1PA 5HVFA 3KI9A 3IJ3A 3EIFA 2QJ8A 4B6ZA 4OMEA 2JBKA 4MRIA 1ZLIA 8CPAA 1QMUA 3CPXA 1ZG9A 3D67A 1LAPA 1ARLA 1VGYA 4C9AA 2ZEDA 2GLJA 5HVHA 4C86A 2PJCA 2Q43A 4NGPA 3WC6A 2PJ7A 3SI1A 2C1CA 3PBEA 3KR5A 3SJXA 3PB8X 3BI0A 2IQ6A 1CP6A 4JZ0A 2EK8A 1PCAA 3JRUA 4UIAA 2EWBA 1XJOA 5J1QA 1XBUA 4OC4A 1HDQA 1KWMA 3IO1A 1NSAA 2ZELA 4ZX9A 4X3RA 3I1UA 3RZAA 4UEZA 1TKFA 3MN8A 3D68A 4OC2A 2PJ8A 4PXEA 2ZEFA 4NGRA 2AFWA 4DUKA 3VH9A 4A38A 4TJVA 2CF4A 4RUHA 3T8WA 2WYRA 3D7GA 1F2OA 4P4BA 3LMSA 1VHEA 3NA6A 3RBUA 4MCSA 4MMOA 4R8FA 5LRKA 4ZY1A 2DEAA 2AFXA 1YW4A 4TNUA 4NFRA 4P10A 1LFWA 4CDJA 3KQXA 2VL1A 2XEFA 2PJ5A 4CPAA 4C9RA 1FT7A 3SI2A 2AFZA 4W9YA 4Q7AA 5IB9A 3PBBA 5HXDA 4KNGE 4C8PA 5I4MA 2BO9A 4BD9A 1LCPA 1YSJA 2G9DA 4C84A 5JGFA 2V77A 1ZG7A 5LRJA 2PIYA 2PJ9A 2PJ4A 4EFDA 3WABA 3H8GA 2JBJA 4OP4A 2ZEMA 3PFEA 4OIWA 5K8OA 4NGMA 1LAMA 1Y7EA 2PVWA 2BOAA 2J9AA 4DYOA 3VTAA 3FEDA 1CP7A 4MHZA 1Z8LA 4GM5A 3KL9A 4P45A 6CPAA 1DTDA 2JEWA 4ZX8A 2F7VA 3D7FA 3IFEA 4P4DA 2ANPA 2PRQA 4FUUA 3I74A 1TXRA 2O53A 3B2YA 2NSMA 4MHPA 1CPSA 3GB0A 3SI0A 3PB7X 1Y9ZA 2GLFA 3K2KA
chains in the Genus database with same CATH superfamily
2CTBA 3FIXA 4C9RA 1N71A 1RTQA 4CYPA 2ZW4A 4MJXA 2B3VA 1XFOA 5AXIA 4CYQA 2VEZA 2POKA 3SJGA 5F47A 1ZYMA 4NGSA 5K8PA 2FM4A 2ODFA 2X7BA 5CPAA 4E2AA 4L89A 4MCRA 3SJEA 3TC8A 4F9VA 2Q0YA 3QAHA 4LUAA 2OH1A 3SXNA 1EZAA 4UCMA 5EC4A 4MI1A 3KHZA 4CYNA 3HUVA 3V38A 1M4LA 3PB6X 2ZW7A 2P6GA 1Z9EA 1NSLA 2ZEEA 1M4DA 3IIBA 3C26A 3CZXA 1IGBA 3PB4X 4P44A 1KEEB 3B8GA 5H84A 1T36B 1S7LA 1YW6A 3B3SA 3EFAA 3KKWA 1DE4C 3V8IA 4ZY0A 2Q4VA 2FXFA 3NH8A 3PEIA 4UA3A 4KVME 3K2KA 4UIBA 1YK3A 4UEEA 3KR4A 2AFSA 2PCUA 2AFMA 1Y0RA 2PDOA 4E94A 2G3AA 1Q7LA 4IHMA 2EVNA 3DDDA 3F0AA 4QC6A 4A4CA 5LYDA 2FL4A 4C2YA 2PE3A 3RYOA 4NJQA 3GLJA 2CXAA 4KVXA 1TF8A 4M85A 5AG6A 1IYLA 4KUBA 5IV0A 3EZEA 5ELYA 2RB7A 3S9NA 1CM0A 2JDDA 1S5KA 3PB9X 4K30A 3ZZIA 3MRUA 2ZEHA 3EZBA 2Z11A 2XPOA 4ZYQA 3F9KC 3TLZA 2NMTA 1BLLE 2J8MA 3JVNA 3QNVA 2DF5A 2ZENA 5IB0A 2FT0A 4UFWA 5LYFA 3O8ZA 2PIZA 2HC9A 4R76A 3SXOA 1Y0YA 3FMCA 4NGNA 1U6MA 1QQ9A 3GIUA 4FD5A 4U9ZA 5LRGA 4MCQA 2E28A 1CPXA 2PVVA 4KOWA 4L8AA 4PSXA 4MXUA 3FXTA 1WWZA 3S6KA 3CT9A 3T90A 4OKOA 2XEGA 3EO4A 2Q4ZA 2DXQA 4OLLA 4ZY2A 1IU8A 5CNPA 1Q5XA 2PJ0A 3V7ZA 4A95A 4AVBA 3PP9A 3H4QA 4KOYA 2R82A 3TLAA 2V8HA 4LX9A 3VWDA 2ABZA 4R57A 5K8NA 3R9FA 4F0XA 2FE7A 1YVKA 4JLYA 1CBXA 1KC7A 5BY0A 3I6SA 1BO4A 4IIYA 3KGQA 4MFKA 1Z9UA 2OOTA 3KZWA 2PSWA 1CG2A 1QSOA 4BBHA 3K9TA 2V8DA 3BJ7A 5AG5A 2Q51A 1K4JA 4HKFA 1YLOA 4JD6A 1Z5RA 1ZRSA 5H86A 3S9LA 5F9MA 4C8UA 3R9EA 5ISVA 2X0SA 2G3TA 3CPAA 3D4UA 4OC3A 2F8HA 5HMNA 1WK4A 3W91A 1ZL0A 3NH5A 3T0TA 1XRYA 1HDUA 3LODA 3R1KA 4B10A 2HI6A 4FAIA 1IOFA 1AMPA 1XMBA 4C2XA 4P4FA 1B87A 3B3WA 4XPDC 3FBUA 4BPWB 1Y9KA 1XF8A 2KCWA 4CYOA 1QSNA 1R57A 4R7MA 5EMIA 2ZEGA 3S6HA 2V8GA 4JXQA 4PXCA 1YMEA 2BL1A 3G23A 4C8AA 4KSIA 4M8DA 1MK4A 3DSBA 2GIVA 2B3UA 2IJZA 4IAVA 4AG7A 2VI7A 1R61A 3SR3A 5F46A 4IF5A 5F1YA 2OB0A 2H5MA 4NJRA 4H6UA 2PJ3A 2BSWA 4MHYA 1R43A 2CBLA 1Z2LA 1ZLHA 3FRMA 3IU1A 3S6FA 3H8EA 2XPPA 4BMHA 2RFHA 3ICUA 1ARMA 4F8ZA 2HB6A 4M6GA 1VIXA 5IX3A 3T9YA 5A27A 3BI1A 1F2PA 3N7ZA 4A32A 3TO6A 1KUVA 4E0AA 4ZGYB 4TJXA 4YFJA 1RO5A 2YJTA 5CBMA 1XEBA 3TOBA 4F0YA 4OC1A 2WPXA 3FX6A 3TE4A 4Y49C 4R6TA 4EWTA 2C6CA 2XEIA 4MHDA 4O23A 1IB1E 4DJLA 1S60A 2J8NA 4CGOA 3GY9A 3N5FA 4WJBA 2VQYA 2PR1A 3TO9A 3WC7A 2GU2A 4CAFA 3B3VA 3VARA 1QSTA 2FS5A 3PGPA 3OB1B 3VROA 2Z3OA 2O28A 3LWUA 3WC5A 1NBWA 3PFVA 1I12A 4A37A 2NYQA 4C7HA 5C82A 1EE3P 3IC1A 4KOUA 5JH9A 4A2ZA 5KTDA 4ONWA 1ELLP 4P4EA 3OP0A 1NE9A 1UWYA 4XPDB 2PJBA 1KZFA 2FVGA 3IGRA 1M44A 1PUAA 1S3ZA 2HWGA 4R9MA 3BUXB 4EVYA 1C30B 1TF9A 4PQAA 1AYEA 1B6BA 3LD2A 4MY3A 4PXDA 3TLYA 1Y9WA 1A9XB 1LOKA 2PR8A 3FVLA 4KOSA 4ONUA 1FBVA 4C85A 4MI4A 3D3SA 2PJ2A 3DGVA 3VRRA 4JYWA 1BPMA 2C6GA 4XNHC 3LACA 4YGOA 2XEJA 4KSAA 5DWNA 2OR4A 4CAEA 2GE3A 4B5PA 2Z3KA 3IWEA 1M1DA 2Y1NA 4MCPA 2V8VA 3PRTA 4C9EA 1XMTA 2EO8A 5LYIA 3VATA 3NFZA 2DPTA 2BCOA 4A94A 2O4HA 3VRQA 3WR7A 1FY7A 4OC0A 2WPWA 3RO0A 2FIWA 2WZNA 4KLVA 2ZEOA 4X2TA 4UWIA 3TX8A 4UEFA 5HH1A 1XF1A 5JYBA 1NMTA 3IEHA 1CX8A 2I00A 2REFA 3FJUA 3ISZA 4KSFA 4P6YA 4X8IA 4XPLA 2B58A 2HROA 2MP0A 1BXRB 2DLAA 4RN7A 3GUXA 4JXRA 1ZO0A 1IY7A 4YWYA 3HLPA 3ZJ0A 5KTCA 1J3LA 2GP4A 4AVCA 1PYTB 1GYTA 2PQ8A 4IK2A 5AGEA 4C68A 4PK2A 2OU2A 7CPAA 3CXSA 1XOVA 2D0OA 3TLBA 5G22A 4H6ZA 4PPZA 4PK3A 1YGHA 1VBGA 5THWA 1V0CA 4XPKA 2WUUA 1HEEA 1YLEA 3L2NA 4LQGA 4OC5A 3S6GA 5FD8A 2FCKA 3UY5A 3FEEA 5JM6A 1ZG8A 2ZOGA 2C6PA 1H8LA 3FH4A 4KORA 3VRNA 1YQEA 4UFXA 2ZEPA 4A39A 4ZI6A 1VHOA 2VZZA 4ORFA 5F5XA 5JPHA 2GREA 2AFOA 2B0AA 3R95A 3D7HA 3WT4A 2IMOA 1JQGA 3KHXA 1YVOA 5HKWA 5J8CA 4CGLA 4EMEA 3BXMA 2CTCA 3FNCA 1UFHA 5I0CA 4H2KA 2EZAA 3D2MA 5F49A 3SHPA 3BUWB 1EZBA 5J3XA 1VI4A 4C8FA 3IWWA 3A9LA 3MGDA 1X12A 2A4NA 3B7IA 1C3OB 3U88C 4KS9A 1EO0A 3P2FA 4CGMA 4YN3A 4C8CA 5F13A 1JDBC 3KASA 3DLJA 3D7DA 4MFJA 4UF4A 5F48A 2BEIA 2ZOFA 4NF1A 4UWJA 1PU9A 3H8FA 4KOVA 4CRYB 5K99A 1BOBA 3KQZA 1F57A 2PJ6A 2CY2A 4GS4A 4AG9A 1DIKA 5J8FA 2CNTA 2P6EA 3TT2A 1S7KA 5D29A 2Y0MA 1V6CA 1LANA 4F6AA 3VRPA 3EZAA 5IR2A 4P4IA 4A33A 3B3TA 4H89A 3TYXA 2HV2A 4WWVA 2Y1MA 5LYLA 3TO7A 4FBEA 3TLGB 1OZPA 4E5SA 3ISXA 4HNXB 2PJAA 4OAEA 5HVGA 2XPLA 5F09A 4R87A 3DR6A 4JJXA 4FWUA 2AUNA 1TKJA 1WJTA 5E96A 1FNOA 4UCPA 4AXVA 4AB7A 4C2ZA 1TKHA 2EZCA 3TLEA 2Q04A 3NH4A 1ELMP 4K3NA 2AJ6A 3EC4A 3VWEA 1QSMA 1Z8WA 2I3CA 3B3CA 2Z3NA 4YU9A 4C9UA 4OIDA 4RR2B 4PXBA 4KZTA 2D4PA 4MHNA 4B12A 4CGPA 4F9UA 3DNSA 3B35A 4CAVA 2ATRA 4NGTA 1M4IA 3PFOA 2JEVA 2QMLA 1OBRA 1M4GA 2JLMA 4UBRA 4B13A 3W6SA 4INJA 5K8MA 2ARHA 2QYVA 3R9GA 4C8TA 1BAVA 1P4NA 3BHXA 1JWQA 1M6VB 1R3NA 4E8OA 4Z65A 2B5GA 4NGQA 2QVPA 2UV8G 2B4JC 4P4JA 2REEA 4C99A 2Q4YA 3JTKA 4NCZA 2PC1A 5D8NA 2AFUA 2ZPAA 1CS0B 5DS0A 3C8OA 1BPNA 3D8PA 1WVMA 3QB8A 2Z10A 2YNEA 3F5BA 2OZGA 3K4IA 2OLSA 3RAMA 2CIJA 3S9MA 4C9VA 4U9YA 4CGNA 4CS0B 2PJ1A 3FECA 3OAKA 2N3AB 4TWEA 5FVJA 4QB9A 2Z3LA 3D66A 4CAXA 2P6FA 4MFLA 2YNDA 4CDKA 2Q7SA 2CNSA 2EK9A 3SJFA 3FF3A 4A4BA 2AE6A 2QIRA 3CDXA 3KI9A 4G1PA 5HVFA 1KBLA 3IJ3A 3EIFA 3RNZA 1GHEA 2QJ8A 3KRVA 4B6ZA 4JWPA 4UFVA 4OMEA 2JBKA 1IOIA 1YX0A 4MRIA 1ZLIA 4B5PB 1VBHA 4MY0A 8CPAA 2FIAA 1QMUA 5JVLA 3CPXA 1ZG9A 3D67A 2B4DA 1NXJA 2EZBA 1LAPA 1Z8TA 3TOAA 1ARLA 1VGYA 5EBVA 4HPSA 3T5MA 1L0CA 2EBJA 4CRZB 3G8WA 4C9AA 2ZEDA 1SQHA 2GLJA 2C5QA 4ZBGA 4LQ6A 5HVHA 2YNCA 4C86A 4Y49B 1VKCA 2PJCA 2Q43A 4NGPA 3I9SA 4R3LA 3WC6A 5AG4A 2PJ7A 3SI1A 3BUMB 4DNCA 2C1CA 3PBEA 3EXNA 3QAYA 1A2ZA 2BUEA 3KR5A 3R96A 2OZHA 3SJXA 3BJ8A 3PB8X 4A30A 3BI0A 2HUZA 2IQ6A 1CJWA 1CP6A 4HNYB 5C88A 4J0NA 3E0KA 2B4BA 4JZ0A 2EK8A 1PCAA 4UCNA 3JRUA 4IUSA 1GGOA 2D4OA 1QSRA 3NE7A 2Q44A 4UIAA 4M6HA 5HKZA 2I79A 2ZW5A 2EWBA 1XJOA 4MJ8A 4QVTA 4KUAA 2R1IA 5J1QA 3GJZA 1XBUA 4OC4A 5G1ZA 5KTAA 1MJ9A 3VGOA 1HDQA 1KWMA 1Q2YA 1YVHA 1NSAA 3IO1A 4CO9A 2ZELA 3OWCA 2VKZG 3TFYA 1JDEA 3P2HA 4XNHB 4ZX9A 2P0WA 1IICA 4H1HA 2Z3MA 1IYKA 4X3RA 3IWGA 3HPGG 3I1UA 2YJVA 3RZAA 4UEZA 1TKFA 2OZUA 3MN8A 4KOTA 2GANA 1I21A 3D68A 4IIXA 1XIXA 3FYNA 4COGA 4OC2A 2PJ8A 3T05A 4PXEA 3D2PA 2ZEFA 4QBJA 4NGRA 2AFWA 3BUNB 3DR8A 4RI1A 3VH9A 1Y7RA 4A38A 4B11A 4B5OA 4DUKA 4TJVA 1I1DA 1ON0A 2Z0ZA 2DIKA 1RXTA 2C27A 3PLFB 2RC4A 2WSAA 2CF4A 2R98A 4A31A 2VZYA 4HNWB 3T8WA 2WYRA 3D7GA 4RUHA 1F2OA 1MJBA 4P4BA 5GCNA 2XPNA 2VXKA 2AUMA 3LMSA 1VHEA 4MFPA 4GXHA 3NA6A 3NFQA 3RBUA 2R8VA 4M6IA 4C7IA 2EUIA 4MCSA 2DPSA 4MMOA 4R8FA 3G3SA 5LRKA 1Z4EA 4II9A 5BWAB 4ZY1A 1S7NA 2R7HA 2DEAA 3IU2A 2PRBA 1LRZA 1YW4A 1P0HA 2AFXA 1KUYA 1YREA 4TNUA 4NFRA 4P10A 1LFWA 1Z8XA 3I3GA 4CDJA 3KQXA 4MBUA 2VL1A 2XEFA 2PJ5A 4CPAA 1CE8B 1FT7A 3SI2A 2AFZA 4BTFA 4KOXA 1Q2DA 4PSWA 4W9YA 2IL4A 4Q7AA 5G21A 1Q2CA 3HPHE 5IB9A 4KVOE 2HQYA 3PBBA 4MFQA 5HXDA 4KNGE 4C8PA 1J4JA 3BUOB 1XE4A 5I4MA 4KLWA 3TCVA 4J3GA 4CZ1A 2BO9A 4BD9A 4I49A 4RS2A 1LCPA 2JDCA 1YSJA 3H5ZA 4NSQA 4COBA 3CXPA 2G9DA 4R3KA 4C84A 4QUSA 4AVAA 5JGFA 3T07A 1VHSA 1ZG7A 2V77A 5LRJA 1S7FA 3TLGA 2PIYA 4FD4A 2PJ9A 2FSRA 2ZW6A 3CXQA 3F8KA 2F5IA 2PJ4A 3NE8A 4NEXA 5DWMA 3H8GA 3WABA 4EFDA 2YNCC 4Q38A 2JBJA 5JQ4A 1B47A 2B5GB 4OP4A 3K9UA 3NOJA 2Q7BA 4FD7A 2ZEMA 4BINA 3PFEA 4OIWA 5K8OA 4NGMA 3BLNA 1LAMA 1Y7EA 2GFQA 3PZJA 4X5KA 5AG7A 2PVWA 2BOAA 2J9AA 4EYSA 2YGWA 4PV6A 4DYOA 3VTAA 2J8RA 1AUGA 2PCNA 4YRHA 3TLCA 3FEDA 4OADA 1Z4RA 1CP7A 4U5YA 4MHZA 1Z8LA 4GPLB 3GYAA 3JUWA 4P45A 3KL9A 4FD6A 4GM5A 1DTDA 2JEWA 2ZXVA 4Q36A 6CPAA 4MFZA 4ZX8A 4NXYA 3W6XA 5A28A 3OB2B 3PT1A 1YR0A 4BPXB 2F7VA 3D7FA 3IFEA 4P4DA 2K5TA 3GKRA 2ANPA 2CNMA 2D0PA 3FB3A 3HMJG 5G20A 5HKYA 1TIQA 1KUXA 2PRQA 4FUUA 2VBQA 3EY5A 1IIDA 3I74A 4BPUB 4M3SA 1TXRA 4JVOA 2O53A 3B2YA 2NSMA 3TTHA 3U1BA 4MHPA 1CPSA 2B4DB 4B14A 1X10A 3GB0A 2G0BA 2Z3PA 3SI0A 3ZNIA 3PB7X 1Y9ZA 2GLFA 2QECA 4CAWA 1MJAA
chains in the Genus database with same CATH topology
2CTBA 1RTQA 1XFOA 2POKA 3SJGA 4NGSA 5K8PA 5CPAA 4MCRA 3SJEA 3TC8A 4F9VA 3KHZA 3HUVA 3V38A 1M4LA 3PB6X 2ZEEA 3IIBA 3PB4X 1IGBA 4P44A 1YW6A 3B3SA 4ZY0A 1DE4C 3PEIA 3NH8A 4UIBA 4UEEA 3KR4A 2AFSA 2PCUA 2AFMA 1Y0RA 1Q7LA 4IHMA 5LYDA 2PE3A 4NJQA 3GLJA 1TF8A 5ELYA 2RB7A 3S9NA 3PB9X 3MRUA 2ZEHA 4ZYQA 1BLLE 3QNVA 2ZENA 5LYFA 2PIZA 2HC9A 4R76A 1Y0YA 3FMCA 4NGNA 5LRGA 1QQ9A 4MCQA 1CPXA 2PVVA 4MXUA 3CT9A 4OKOA 2XEGA 2Q4ZA 4ZY2A 2PJ0A 3V7ZA 2V8HA 2ABZA 5K8NA 1CBXA 3I6SA 3KGQA 2OOTA 3KZWA 1CG2A 3K9TA 2V8DA 2Q51A 1YLOA 1Z5RA 3S9LA 4C8UA 3CPAA 3D4UA 4OC3A 2F8HA 3NH5A 1XRYA 1HDUA 4FAIA 1AMPA 1XMBA 4P4FA 3B3WA 4R7MA 2ZEGA 2V8GA 4PXCA 1YMEA 4C8AA 4KSIA 2IJZA 4IAVA 4NJRA 2PJ3A 4MHYA 1ZLHA 1R43A 1Z2LA 3ICUA 3H8EA 2RFHA 1ARMA 4F8ZA 2HB6A 1VIXA 3BI1A 1F2PA 4TJXA 5CBMA 4OC1A 3FX6A 4EWTA 4R6TA 2C6CA 2XEIA 4O23A 4DJLA 3N5FA 4WJBA 3WC7A 2GU2A 3B3VA 3VARA 3LWUA 3WC5A 4A37A 2NYQA 1EE3P 3IC1A 5JH9A 4ONWA 1ELLP 4P4EA 1UWYA 2PJBA 2FVGA 1TF9A 4PQAA 1AYEA 4PXDA 1LOKA 3FVLA 4C85A 2PJ2A 3DGVA 4JYWA 1BPMA 2C6GA 2XEJA 2OR4A 4MCPA 2V8VA 3PRTA 4C9EA 5LYIA 3VATA 3NFZA 2BCOA 4A94A 2O4HA 4OC0A 4X2TA 2WZNA 2ZEOA 3TX8A 4UEFA 1XF1A 3IEHA 1CX8A 4P6YA 3ISZA 3FJUA 4X8IA 3GUXA 2GP4A 1IY7A 4YWYA 3HLPA 1PYTB 1GYTA 4IK2A 7CPAA 4PPZA 5THWA 1HEEA 3L2NA 4LQGA 4OC5A 3FEEA 5JM6A 1ZG8A 2ZOGA 2C6PA 1H8LA 3FH4A 4ZI6A 2ZEPA 4A39A 1VHOA 2GREA 2AFOA 3D7HA 3WT4A 2IMOA 1JQGA 3KHXA 4EMEA 3BXMA 2CTCA 4H2KA 4C8FA 3IWWA 3B7IA 4C8CA 4YN3A 3KASA 3DLJA 3D7DA 4UF4A 2ZOFA 3H8FA 3KQZA 1F57A 2PJ6A 5D29A 1V6CA 1LANA 5IR2A 4P4IA 3B3TA 4WWVA 5LYLA 4FBEA 3ISXA 2PJAA 5HVGA 5F09A 4FWUA 1TKJA 4AXVA 1FNOA 1TKHA 3NH4A 1ELMP 4K3NA 3B3CA 2I3CA 4YU9A 4C9UA 4OIDA 4PXBA 4MHNA 4F9UA 3B35A 4NGTA 3PFOA 1OBRA 5K8MA 2QYVA 4C8TA 1BAVA 3BHXA 1R3NA 4Z65A 4NGQA 2QVPA 4P4JA 4C99A 5D8NA 2AFUA 5DS0A 1BPNA 1WVMA 3RAMA 2CIJA 3S9MA 4C9VA 2PJ1A 3FECA 4TWEA 3D66A 4CDKA 2EK9A 3SJFA 3FF3A 3CDXA 4G1PA 5HVFA 3KI9A 3IJ3A 3EIFA 2QJ8A 4B6ZA 4OMEA 2JBKA 4MRIA 1ZLIA 8CPAA 1QMUA 3CPXA 1ZG9A 3D67A 1LAPA 1ARLA 1VGYA 4C9AA 2ZEDA 2GLJA 2C5QA 5HVHA 4C86A 2PJCA 2Q43A 4NGPA 3WC6A 2PJ7A 3SI1A 2C1CA 3PBEA 3KR5A 3SJXA 3PB8X 3BI0A 2IQ6A 1CP6A 4JZ0A 2EK8A 1PCAA 3JRUA 4UIAA 2EWBA 1XJOA 5J1QA 1XBUA 4OC4A 1HDQA 1KWMA 3IO1A 1NSAA 2ZELA 4ZX9A 4X3RA 3I1UA 3RZAA 4UEZA 1TKFA 3MN8A 3D68A 4OC2A 2PJ8A 4PXEA 2ZEFA 4NGRA 2AFWA 4DUKA 3VH9A 4A38A 4TJVA 2CF4A 4RUHA 3T8WA 2WYRA 3D7GA 1F2OA 4P4BA 3LMSA 1VHEA 3NA6A 3RBUA 4MCSA 4MMOA 4R8FA 5LRKA 4ZY1A 2DEAA 2AFXA 1YW4A 4TNUA 4NFRA 4P10A 1LFWA 4CDJA 3KQXA 2VL1A 2XEFA 2PJ5A 4CPAA 4C9RA 1FT7A 3SI2A 2AFZA 4W9YA 4Q7AA 5IB9A 3PBBA 5HXDA 4KNGE 4C8PA 5I4MA 2BO9A 4BD9A 1LCPA 1YSJA 2G9DA 4C84A 5JGFA 2V77A 1ZG7A 5LRJA 2PIYA 2PJ9A 2PJ4A 4EFDA 3WABA 3H8GA 2JBJA 4OP4A 2ZEMA 3PFEA 4OIWA 5K8OA 4NGMA 1LAMA 1Y7EA 2PVWA 2BOAA 2J9AA 4DYOA 3VTAA 3FEDA 1CP7A 4MHZA 1Z8LA 4GM5A 3KL9A 4P45A 6CPAA 1DTDA 2JEWA 4ZX8A 2F7VA 3D7FA 3IFEA 4P4DA 2ANPA 2PRQA 4FUUA 3I74A 1TXRA 2O53A 3B2YA 2NSMA 4MHPA 1CPSA 3GB0A 3SI0A 3PB7X 1Y9ZA 2GLFA 3K2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTB A;  1RTQ A;  1XFO A;  2POK A;  3SJG A;  4NGS A;  5K8P A;  5CPA A;  4MCR A;  3SJE A;  3TC8 A;  4F9V A;  3KHZ A;  3HUV A;  3V38 A;  1M4L A;  3PB6 X;  2ZEE A;  3IIB A;  3PB4 X;  1IGB A;  4P44 A;  1YW6 A;  3B3S A;  4ZY0 A;  1DE4 C;  3PEI A;  3NH8 A;  4UIB A;  4UEE A;  3KR4 A;  2AFS A;  2PCU A;  2AFM A;  1Y0R A;  1Q7L A;  4IHM A;  5LYD A;  2PE3 A;  4NJQ A;  3GLJ A;  1TF8 A;  5ELY A;  2RB7 A;  3S9N A;  3PB9 X;  3MRU A;  2ZEH A;  4ZYQ A;  1BLL E;  3QNV A;  2ZEN A;  5LYF A;  2PIZ A;  2HC9 A;  4R76 A;  1Y0Y A;  3FMC A;  4NGN A;  5LRG A;  1QQ9 A;  4MCQ A;  1CPX A;  2PVV A;  4MXU A;  3CT9 A;  4OKO A;  2XEG A;  2Q4Z A;  4ZY2 A;  2PJ0 A;  3V7Z A;  2V8H A;  2ABZ A;  5K8N A;  1CBX A;  3I6S A;  3KGQ A;  2OOT A;  3KZW A;  1CG2 A;  3K9T A;  2V8D A;  2Q51 A;  1YLO A;  1Z5R A;  3S9L A;  4C8U A;  3CPA A;  3D4U A;  4OC3 A;  2F8H A;  3NH5 A;  1XRY A;  1HDU A;  4FAI A;  1AMP A;  1XMB A;  4P4F A;  3B3W A;  4R7M A;  2ZEG A;  2V8G A;  4PXC A;  1YME A;  4C8A A;  4KSI A;  2IJZ A;  4IAV A;  4NJR A;  2PJ3 A;  4MHY A;  1ZLH A;  1R43 A;  1Z2L A;  3ICU A;  3H8E A;  2RFH A;  1ARM A;  4F8Z A;  2HB6 A;  1VIX A;  3BI1 A;  1F2P A;  4TJX A;  5CBM A;  4OC1 A;  3FX6 A;  4EWT A;  4R6T A;  2C6C A;  2XEI A;  4O23 A;  4DJL A;  3N5F A;  4WJB A;  3WC7 A;  2GU2 A;  3B3V A;  3VAR A;  3LWU A;  3WC5 A;  4A37 A;  2NYQ A;  1EE3 P;  3IC1 A;  5JH9 A;  4ONW A;  1ELL P;  4P4E A;  1UWY A;  2PJB A;  2FVG A;  1TF9 A;  4PQA A;  1AYE A;  4PXD A;  1LOK A;  3FVL A;  4C85 A;  2PJ2 A;  3DGV A;  4JYW A;  1BPM A;  2C6G A;  2XEJ A;  2OR4 A;  4MCP A;  2V8V A;  3PRT A;  4C9E A;  5LYI A;  3VAT A;  3NFZ A;  2BCO A;  4A94 A;  2O4H A;  4OC0 A;  4X2T A;  2WZN A;  2ZEO A;  3TX8 A;  4UEF A;  1XF1 A;  3IEH A;  1CX8 A;  4P6Y A;  3ISZ A;  3FJU A;  4X8I A;  3GUX A;  1IY7 A;  4YWY A;  3HLP A;  1PYT B;  1GYT A;  4IK2 A;  7CPA A;  4PPZ A;  5THW A;  1HEE A;  3L2N A;  4LQG A;  4OC5 A;  3FEE A;  5JM6 A;  1ZG8 A;  2ZOG A;  2C6P A;  1H8L A;  3FH4 A;  4ZI6 A;  2ZEP A;  4A39 A;  1VHO A;  2GRE A;  2AFO A;  3D7H A;  3WT4 A;  2IMO A;  1JQG A;  3KHX A;  4EME A;  3BXM A;  2CTC A;  4H2K A;  4C8F A;  3IWW A;  3B7I A;  4C8C A;  4YN3 A;  3KAS A;  3DLJ A;  3D7D A;  4UF4 A;  2ZOF A;  3H8F A;  3KQZ A;  1F57 A;  2PJ6 A;  5D29 A;  1V6C A;  1LAN A;  4P4I A;  3B3T A;  4WWV A;  5LYL A;  4FBE A;  3ISX A;  2PJA A;  5HVG A;  5F09 A;  4FWU A;  1TKJ A;  4AXV A;  1FNO A;  1TKH A;  3NH4 A;  1ELM P;  4K3N A;  3B3C A;  2I3C A;  4YU9 A;  4C9U A;  4OID A;  4PXB A;  4MHN A;  4F9U A;  3B35 A;  4NGT A;  3PFO A;  1OBR A;  5K8M A;  2QYV A;  4C8T A;  1BAV A;  3BHX A;  1R3N A;  4Z65 A;  4NGQ A;  2QVP A;  4P4J A;  4C99 A;  5D8N A;  2AFU A;  5DS0 A;  1BPN A;  1WVM A;  3RAM A;  2CIJ A;  3S9M A;  4C9V A;  2PJ1 A;  3FEC A;  4TWE A;  3D66 A;  4CDK A;  2EK9 A;  3SJF A;  3FF3 A;  3CDX A;  4G1P A;  5HVF A;  3KI9 A;  3IJ3 A;  3EIF A;  2QJ8 A;  4B6Z A;  4OME A;  2JBK A;  4MRI A;  1ZLI A;  8CPA A;  1QMU A;  3CPX A;  1ZG9 A;  3D67 A;  1LAP A;  1ARL A;  1VGY A;  4C9A A;  2ZED A;  2GLJ A;  5HVH A;  4C86 A;  2PJC A;  2Q43 A;  4NGP A;  3WC6 A;  2PJ7 A;  3SI1 A;  2C1C A;  3PBE A;  3KR5 A;  3SJX A;  3PB8 X;  3BI0 A;  2IQ6 A;  1CP6 A;  4JZ0 A;  2EK8 A;  1PCA A;  3JRU A;  4UIA A;  2EWB A;  1XJO A;  5J1Q A;  1XBU A;  4OC4 A;  1HDQ A;  1KWM A;  3IO1 A;  1NSA A;  2ZEL A;  4ZX9 A;  4X3R A;  3I1U A;  3RZA A;  4UEZ A;  1TKF A;  3MN8 A;  3D68 A;  4OC2 A;  2PJ8 A;  4PXE A;  2ZEF A;  4NGR A;  2AFW A;  4DUK A;  3VH9 A;  4A38 A;  4TJV A;  2CF4 A;  4RUH A;  3T8W A;  2WYR A;  3D7G A;  1F2O A;  4P4B A;  3LMS A;  1VHE A;  3NA6 A;  3RBU A;  4MCS A;  4MMO A;  4R8F A;  5LRK A;  4ZY1 A;  2DEA A;  2AFX A;  1YW4 A;  4TNU A;  4NFR A;  4P10 A;  1LFW A;  4CDJ A;  3KQX A;  2VL1 A;  2XEF A;  2PJ5 A;  4CPA A;  4C9R A;  1FT7 A;  3SI2 A;  2AFZ A;  4W9Y A;  4Q7A A;  5IB9 A;  3PBB A;  5HXD A;  4KNG E;  4C8P A;  5I4M A;  2BO9 A;  4BD9 A;  1LCP A;  1YSJ A;  2G9D A;  4C84 A;  5JGF A;  2V77 A;  1ZG7 A;  5LRJ A;  2PIY A;  2PJ9 A;  2PJ4 A;  4EFD A;  3WAB A;  3H8G A;  2JBJ A;  4OP4 A;  2ZEM A;  3PFE A;  4OIW A;  5K8O A;  4NGM A;  1LAM A;  1Y7E A;  2PVW A;  2BOA A;  2J9A A;  4DYO A;  3VTA A;  3FED A;  1CP7 A;  4MHZ A;  1Z8L A;  4GM5 A;  3KL9 A;  4P45 A;  6CPA A;  1DTD A;  2JEW A;  4ZX8 A;  2F7V A;  3D7F A;  3IFE A;  4P4D A;  2ANP A;  2PRQ A;  4FUU A;  3I74 A;  1TXR A;  2O53 A;  3B2Y A;  2NSM A;  4MHP A;  1CPS A;  3GB0 A;  3SI0 A;  3PB7 X;  1Y9Z A;  2GLF A;  3K2K A; 
#chains in the Genus database with same CATH topology
 2CTB A;  3FIX A;  4C9R A;  1N71 A;  1RTQ A;  4CYP A;  2ZW4 A;  4MJX A;  2B3V A;  1XFO A;  5AXI A;  4CYQ A;  2VEZ A;  2POK A;  3SJG A;  5F47 A;  1ZYM A;  4NGS A;  5K8P A;  2FM4 A;  2ODF A;  2X7B A;  5CPA A;  4E2A A;  4L89 A;  4MCR A;  3SJE A;  3TC8 A;  4F9V A;  2Q0Y A;  3QAH A;  4LUA A;  2OH1 A;  3SXN A;  1EZA A;  4UCM A;  5EC4 A;  4MI1 A;  3KHZ A;  4CYN A;  3HUV A;  3V38 A;  1M4L A;  3PB6 X;  2ZW7 A;  2P6G A;  1Z9E A;  1NSL A;  2ZEE A;  1M4D A;  3IIB A;  3C26 A;  3CZX A;  1IGB A;  3PB4 X;  4P44 A;  1KEE B;  3B8G A;  5H84 A;  1T36 B;  1S7L A;  1YW6 A;  3B3S A;  3EFA A;  3KKW A;  1DE4 C;  3V8I A;  4ZY0 A;  2Q4V A;  2FXF A;  3NH8 A;  3PEI A;  4UA3 A;  4KVM E;  3K2K A;  4UIB A;  1YK3 A;  4UEE A;  3KR4 A;  2AFS A;  2PCU A;  2AFM A;  1Y0R A;  2PDO A;  4E94 A;  2G3A A;  1Q7L A;  4IHM A;  2EVN A;  3DDD A;  3F0A A;  4QC6 A;  4A4C A;  5LYD A;  2FL4 A;  4C2Y A;  2PE3 A;  3RYO A;  4NJQ A;  3GLJ A;  2CXA A;  4KVX A;  1TF8 A;  4M85 A;  5AG6 A;  1IYL A;  4KUB A;  5IV0 A;  3EZE A;  5ELY A;  2RB7 A;  3S9N A;  1CM0 A;  2JDD A;  1S5K A;  3PB9 X;  4K30 A;  3ZZI A;  3MRU A;  2ZEH A;  3EZB A;  2Z11 A;  2XPO A;  4ZYQ A;  3F9K C;  3TLZ A;  2NMT A;  1BLL E;  2J8M A;  3JVN A;  3QNV A;  2DF5 A;  2ZEN A;  5IB0 A;  2FT0 A;  4UFW A;  5LYF A;  3O8Z A;  2PIZ A;  2HC9 A;  4R76 A;  3SXO A;  1Y0Y A;  3FMC A;  4NGN A;  1U6M A;  1QQ9 A;  3GIU A;  4FD5 A;  4U9Z A;  5LRG A;  4MCQ A;  2E28 A;  1CPX A;  2PVV A;  4KOW A;  4L8A A;  4PSX A;  4MXU A;  3FXT A;  1WWZ A;  3S6K A;  3CT9 A;  3T90 A;  4OKO A;  2XEG A;  3EO4 A;  2Q4Z A;  2DXQ A;  4OLL A;  4ZY2 A;  1IU8 A;  5CNP A;  1Q5X A;  2PJ0 A;  3V7Z A;  4A95 A;  4AVB A;  3PP9 A;  3H4Q A;  4KOY A;  2R82 A;  3TLA A;  2V8H A;  4LX9 A;  3VWD A;  2ABZ A;  4R57 A;  5K8N A;  3R9F A;  4F0X A;  2FE7 A;  1YVK A;  4JLY A;  1CBX A;  1KC7 A;  5BY0 A;  3I6S A;  1BO4 A;  4IIY A;  3KGQ A;  4MFK A;  1Z9U A;  2OOT A;  3KZW A;  2PSW A;  1CG2 A;  1QSO A;  4BBH A;  3K9T A;  2V8D A;  3BJ7 A;  5AG5 A;  2Q51 A;  1K4J A;  4HKF A;  1YLO A;  4JD6 A;  1Z5R A;  1ZRS A;  5H86 A;  3S9L A;  5F9M A;  4C8U A;  3R9E A;  5ISV A;  2X0S A;  2G3T A;  3CPA A;  3D4U A;  4OC3 A;  2F8H A;  5HMN A;  1WK4 A;  3W91 A;  1ZL0 A;  3NH5 A;  3T0T A;  1XRY A;  1HDU A;  3LOD A;  3R1K A;  4B10 A;  2HI6 A;  4FAI A;  1IOF A;  1AMP A;  1XMB A;  4C2X A;  4P4F A;  1B87 A;  3B3W A;  4XPD C;  3FBU A;  4BPW B;  1Y9K A;  1XF8 A;  2KCW A;  4CYO A;  1QSN A;  1R57 A;  4R7M A;  5EMI A;  2ZEG A;  3S6H A;  2V8G A;  4JXQ A;  4PXC A;  1YME A;  2BL1 A;  3G23 A;  4C8A A;  4KSI A;  4M8D A;  1MK4 A;  3DSB A;  2GIV A;  2B3U A;  2IJZ A;  4IAV A;  4AG7 A;  2VI7 A;  1R61 A;  3SR3 A;  5F46 A;  4IF5 A;  5F1Y A;  2OB0 A;  2H5M A;  4NJR A;  4H6U A;  2PJ3 A;  2BSW A;  4MHY A;  1R43 A;  2CBL A;  1Z2L A;  1ZLH A;  3FRM A;  3IU1 A;  3S6F A;  3H8E A;  2XPP A;  4BMH A;  2RFH A;  3ICU A;  1ARM A;  4F8Z A;  2HB6 A;  4M6G A;  1VIX A;  5IX3 A;  3T9Y A;  5A27 A;  3BI1 A;  1F2P A;  3N7Z A;  4A32 A;  3TO6 A;  1KUV A;  4E0A A;  4ZGY B;  4TJX A;  4YFJ A;  1RO5 A;  2YJT A;  5CBM A;  1XEB A;  3TOB A;  4F0Y A;  4OC1 A;  2WPX A;  3FX6 A;  3TE4 A;  4Y49 C;  4R6T A;  4EWT A;  2C6C A;  2XEI A;  4MHD A;  4O23 A;  1IB1 E;  4DJL A;  1S60 A;  2J8N A;  4CGO A;  3GY9 A;  3N5F A;  4WJB A;  2VQY A;  2PR1 A;  3TO9 A;  3WC7 A;  2GU2 A;  4CAF A;  3B3V A;  3VAR A;  1QST A;  2FS5 A;  3PGP A;  3OB1 B;  3VRO A;  2Z3O A;  2O28 A;  3LWU A;  3WC5 A;  1NBW A;  3PFV A;  1I12 A;  4A37 A;  2NYQ A;  4C7H A;  5C82 A;  1EE3 P;  3IC1 A;  4KOU A;  5JH9 A;  4A2Z A;  5KTD A;  4ONW A;  1ELL P;  4P4E A;  3OP0 A;  1NE9 A;  1UWY A;  4XPD B;  2PJB A;  1KZF A;  2FVG A;  3IGR A;  1M44 A;  1PUA A;  1S3Z A;  2HWG A;  4R9M A;  3BUX B;  4EVY A;  1C30 B;  1TF9 A;  4PQA A;  1AYE A;  1B6B A;  3LD2 A;  4MY3 A;  4PXD A;  3TLY A;  1Y9W A;  1A9X B;  1LOK A;  2PR8 A;  3FVL A;  4KOS A;  4ONU A;  1FBV A;  4C85 A;  4MI4 A;  3D3S A;  2PJ2 A;  3DGV A;  3VRR A;  4JYW A;  1BPM A;  2C6G A;  4XNH C;  3LAC A;  4YGO A;  2XEJ A;  4KSA A;  5DWN A;  2OR4 A;  4CAE A;  2GE3 A;  4B5P A;  2Z3K A;  3IWE A;  1M1D A;  2Y1N A;  4MCP A;  2V8V A;  3PRT A;  4C9E A;  1XMT A;  2EO8 A;  5LYI A;  3VAT A;  3NFZ A;  2DPT A;  2BCO A;  4A94 A;  2O4H A;  3VRQ A;  3WR7 A;  1FY7 A;  4OC0 A;  2WPW A;  3RO0 A;  2FIW A;  2WZN A;  4KLV A;  2ZEO A;  4X2T A;  4UWI A;  3TX8 A;  4UEF A;  5HH1 A;  1XF1 A;  5JYB A;  1NMT A;  3IEH A;  1CX8 A;  2I00 A;  2REF A;  3FJU A;  3ISZ A;  4KSF A;  4P6Y A;  4X8I A;  4XPL A;  2B58 A;  2HRO A;  2MP0 A;  1BXR B;  2DLA A;  4RN7 A;  3GUX A;  4JXR A;  1ZO0 A;  1IY7 A;  4YWY A;  3HLP A;  3ZJ0 A;  5KTC A;  1J3L A;  2GP4 A;  4AVC A;  1PYT B;  1GYT A;  2PQ8 A;  4IK2 A;  5AGE A;  4C68 A;  4PK2 A;  2OU2 A;  7CPA A;  3CXS A;  1XOV A;  2D0O A;  3TLB A;  5G22 A;  4H6Z A;  4PPZ A;  4PK3 A;  1YGH A;  1VBG A;  5THW A;  1V0C A;  4XPK A;  2WUU A;  1HEE A;  1YLE A;  3L2N A;  4LQG A;  4OC5 A;  3S6G A;  5FD8 A;  2FCK A;  3UY5 A;  3FEE A;  5JM6 A;  1ZG8 A;  2ZOG A;  2C6P A;  1H8L A;  3FH4 A;  4KOR A;  3VRN A;  1YQE A;  4UFX A;  2ZEP A;  4A39 A;  4ZI6 A;  1VHO A;  2VZZ A;  4ORF A;  5F5X A;  5JPH A;  2GRE A;  2AFO A;  2B0A A;  3R95 A;  3D7H A;  3WT4 A;  2IMO A;  1JQG A;  3KHX A;  1YVO A;  5HKW A;  5J8C A;  4CGL A;  4EME A;  3BXM A;  2CTC A;  3FNC A;  1UFH A;  5I0C A;  4H2K A;  2EZA A;  3D2M A;  5F49 A;  3SHP A;  3BUW B;  1EZB A;  5J3X A;  1VI4 A;  4C8F A;  3IWW A;  3A9L A;  3MGD A;  1X12 A;  2A4N A;  3B7I A;  1C3O B;  3U88 C;  4KS9 A;  1EO0 A;  3P2F A;  4CGM A;  4YN3 A;  4C8C A;  5F13 A;  1JDB C;  3KAS A;  3DLJ A;  3D7D A;  4MFJ A;  4UF4 A;  5F48 A;  2BEI A;  2ZOF A;  4NF1 A;  4UWJ A;  1PU9 A;  3H8F A;  4KOV A;  4CRY B;  5K99 A;  1BOB A;  3KQZ A;  1F57 A;  2PJ6 A;  2CY2 A;  4GS4 A;  4AG9 A;  1DIK A;  5J8F A;  2CNT A;  2P6E A;  3TT2 A;  1S7K A;  5D29 A;  2Y0M A;  1V6C A;  1LAN A;  4F6A A;  3VRP A;  3EZA A;  5IR2 A;  4P4I A;  4A33 A;  3B3T A;  4H89 A;  3TYX A;  2HV2 A;  4WWV A;  2Y1M A;  5LYL A;  3TO7 A;  4FBE A;  3TLG B;  1OZP A;  4E5S A;  3ISX A;  4HNX B;  2PJA A;  4OAE A;  5HVG A;  2XPL A;  5F09 A;  4R87 A;  3DR6 A;  4JJX A;  4FWU A;  2AUN A;  1TKJ A;  1WJT A;  5E96 A;  1FNO A;  4UCP A;  4AXV A;  4AB7 A;  4C2Z A;  1TKH A;  2EZC A;  3TLE A;  2Q04 A;  3NH4 A;  1ELM P;  4K3N A;  2AJ6 A;  3EC4 A;  3VWE A;  1QSM A;  1Z8W A;  2I3C A;  3B3C A;  2Z3N A;  4YU9 A;  4C9U A;  4OID A;  4RR2 B;  4PXB A;  4KZT A;  2D4P A;  4MHN A;  4B12 A;  4CGP A;  4F9U A;  3DNS A;  3B35 A;  4CAV A;  2ATR A;  4NGT A;  1M4I A;  3PFO A;  2JEV A;  2QML A;  1OBR A;  1M4G A;  2JLM A;  4UBR A;  4B13 A;  3W6S A;  4INJ A;  5K8M A;  2ARH A;  2QYV A;  3R9G A;  4C8T A;  1BAV A;  1P4N A;  3BHX A;  1JWQ A;  1M6V B;  1R3N A;  4E8O A;  4Z65 A;  2B5G A;  4NGQ A;  2QVP A;  2UV8 G;  2B4J C;  4P4J A;  2REE A;  4C99 A;  2Q4Y A;  3JTK A;  4NCZ A;  2PC1 A;  5D8N A;  2AFU A;  2ZPA A;  1CS0 B;  5DS0 A;  3C8O A;  1BPN A;  3D8P A;  1WVM A;  3QB8 A;  2Z10 A;  2YNE A;  3F5B A;  2OZG A;  3K4I A;  2OLS A;  3RAM A;  2CIJ A;  3S9M A;  4C9V A;  4U9Y A;  4CGN A;  4CS0 B;  2PJ1 A;  3FEC A;  3OAK A;  2N3A B;  4TWE A;  5FVJ A;  4QB9 A;  2Z3L A;  3D66 A;  4CAX A;  2P6F A;  4MFL A;  2YND A;  4CDK A;  2Q7S A;  2CNS A;  2EK9 A;  3SJF A;  3FF3 A;  4A4B A;  2AE6 A;  2QIR A;  3CDX A;  3KI9 A;  4G1P A;  5HVF A;  1KBL A;  3IJ3 A;  3EIF A;  3RNZ A;  1GHE A;  2QJ8 A;  3KRV A;  4B6Z A;  4JWP A;  4UFV A;  4OME A;  2JBK A;  1IOI A;  1YX0 A;  4MRI A;  1ZLI A;  4B5P B;  1VBH A;  4MY0 A;  8CPA A;  2FIA A;  1QMU A;  5JVL A;  3CPX A;  1ZG9 A;  3D67 A;  2B4D A;  1NXJ A;  2EZB A;  1LAP A;  1Z8T A;  3TOA A;  1ARL A;  1VGY A;  5EBV A;  4HPS A;  3T5M A;  1L0C A;  2EBJ A;  4CRZ B;  3G8W A;  4C9A A;  2ZED A;  1SQH A;  2GLJ A;  2C5Q A;  4ZBG A;  4LQ6 A;  5HVH A;  2YNC A;  4C86 A;  4Y49 B;  1VKC A;  2PJC A;  2Q43 A;  4NGP A;  3I9S A;  4R3L A;  3WC6 A;  5AG4 A;  2PJ7 A;  3SI1 A;  3BUM B;  4DNC A;  2C1C A;  3PBE A;  3EXN A;  3QAY A;  1A2Z A;  2BUE A;  3KR5 A;  3R96 A;  2OZH A;  3SJX A;  3BJ8 A;  3PB8 X;  4A30 A;  3BI0 A;  2HUZ A;  2IQ6 A;  1CJW A;  1CP6 A;  4HNY B;  5C88 A;  4J0N A;  3E0K A;  2B4B A;  4JZ0 A;  2EK8 A;  1PCA A;  4UCN A;  3JRU A;  4IUS A;  1GGO A;  2D4O A;  1QSR A;  3NE7 A;  2Q44 A;  4UIA A;  4M6H A;  5HKZ A;  2I79 A;  2ZW5 A;  2EWB A;  1XJO A;  4MJ8 A;  4QVT A;  4KUA A;  2R1I A;  5J1Q A;  3GJZ A;  1XBU A;  4OC4 A;  5G1Z A;  5KTA A;  1MJ9 A;  3VGO A;  1HDQ A;  1KWM A;  1Q2Y A;  1YVH A;  1NSA A;  3IO1 A;  4CO9 A;  2ZEL A;  3OWC A;  2VKZ G;  3TFY A;  1JDE A;  3P2H A;  4XNH B;  4ZX9 A;  2P0W A;  1IIC A;  4H1H A;  2Z3M A;  1IYK A;  4X3R A;  3IWG A;  3HPG G;  3I1U A;  2YJV A;  3RZA A;  4UEZ A;  1TKF A;  2OZU A;  3MN8 A;  4KOT A;  2GAN A;  1I21 A;  3D68 A;  4IIX A;  1XIX A;  3FYN A;  4COG A;  4OC2 A;  2PJ8 A;  3T05 A;  4PXE A;  3D2P A;  2ZEF A;  4QBJ A;  4NGR A;  2AFW A;  3BUN B;  3DR8 A;  4RI1 A;  3VH9 A;  1Y7R A;  4A38 A;  4B11 A;  4B5O A;  4DUK A;  4TJV A;  1I1D A;  1ON0 A;  2Z0Z A;  2DIK A;  1RXT A;  2C27 A;  3PLF B;  2RC4 A;  2WSA A;  2CF4 A;  2R98 A;  4A31 A;  2VZY A;  4HNW B;  3T8W A;  2WYR A;  3D7G A;  4RUH A;  1F2O A;  1MJB A;  4P4B A;  5GCN A;  2XPN A;  2VXK A;  2AUM A;  3LMS A;  1VHE A;  4MFP A;  4GXH A;  3NA6 A;  3NFQ A;  3RBU A;  2R8V A;  4M6I A;  4C7I A;  2EUI A;  4MCS A;  2DPS A;  4MMO A;  4R8F A;  3G3S A;  5LRK A;  1Z4E A;  4II9 A;  5BWA B;  4ZY1 A;  1S7N A;  2R7H A;  2DEA A;  3IU2 A;  2PRB A;  1LRZ A;  1YW4 A;  1P0H A;  2AFX A;  1KUY A;  1YRE A;  4TNU A;  4NFR A;  4P10 A;  1LFW A;  1Z8X A;  3I3G A;  4CDJ A;  3KQX A;  4MBU A;  2VL1 A;  2XEF A;  2PJ5 A;  4CPA A;  1CE8 B;  1FT7 A;  3SI2 A;  2AFZ A;  4BTF A;  4KOX A;  1Q2D A;  4PSW A;  4W9Y A;  2IL4 A;  4Q7A A;  5G21 A;  1Q2C A;  3HPH E;  5IB9 A;  4KVO E;  2HQY A;  3PBB A;  4MFQ A;  5HXD A;  4KNG E;  4C8P A;  1J4J A;  3BUO B;  1XE4 A;  5I4M A;  4KLW A;  3TCV A;  4J3G A;  4CZ1 A;  2BO9 A;  4BD9 A;  4I49 A;  4RS2 A;  1LCP A;  2JDC A;  1YSJ A;  3H5Z A;  4NSQ A;  4COB A;  3CXP A;  2G9D A;  4R3K A;  4C84 A;  4QUS A;  4AVA A;  5JGF A;  3T07 A;  1VHS A;  1ZG7 A;  2V77 A;  5LRJ A;  1S7F A;  3TLG A;  2PIY A;  4FD4 A;  2PJ9 A;  2FSR A;  2ZW6 A;  3CXQ A;  3F8K A;  2F5I A;  2PJ4 A;  3NE8 A;  4NEX A;  5DWM A;  3H8G A;  3WAB A;  4EFD A;  2YNC C;  4Q38 A;  2JBJ A;  5JQ4 A;  1B47 A;  2B5G B;  4OP4 A;  3K9U A;  3NOJ A;  2Q7B A;  4FD7 A;  2ZEM A;  4BIN A;  3PFE A;  4OIW A;  5K8O A;  4NGM A;  3BLN A;  1LAM A;  1Y7E A;  2GFQ A;  3PZJ A;  4X5K A;  5AG7 A;  2PVW A;  2BOA A;  2J9A A;  4EYS A;  2YGW A;  4PV6 A;  4DYO A;  3VTA A;  2J8R A;  1AUG A;  2PCN A;  4YRH A;  3TLC A;  3FED A;  4OAD A;  1Z4R A;  1CP7 A;  4U5Y A;  4MHZ A;  1Z8L A;  4GPL B;  3GYA A;  3JUW A;  4P45 A;  3KL9 A;  4FD6 A;  4GM5 A;  1DTD A;  2JEW A;  2ZXV A;  4Q36 A;  6CPA A;  4MFZ A;  4ZX8 A;  4NXY A;  3W6X A;  5A28 A;  3OB2 B;  3PT1 A;  1YR0 A;  4BPX B;  2F7V A;  3D7F A;  3IFE A;  4P4D A;  2K5T A;  3GKR A;  2ANP A;  2CNM A;  2D0P A;  3FB3 A;  3HMJ G;  5G20 A;  5HKY A;  1TIQ A;  1KUX A;  2PRQ A;  4FUU A;  2VBQ A;  3EY5 A;  1IID A;  3I74 A;  4BPU B;  4M3S A;  1TXR A;  4JVO A;  2O53 A;  3B2Y A;  2NSM A;  3TTH A;  3U1B A;  4MHP A;  1CPS A;  2B4D B;  4B14 A;  1X10 A;  3GB0 A;  2G0B A;  2Z3P A;  3SI0 A;  3ZNI A;  3PB7 X;  1Y9Z A;  2GLF A;  2QEC A;  4CAW A;  1MJA A; 
#chains in the Genus database with same CATH homology
 2CTB A;  1RTQ A;  1XFO A;  2POK A;  3SJG A;  4NGS A;  5K8P A;  5CPA A;  4MCR A;  3SJE A;  3TC8 A;  4F9V A;  3KHZ A;  3HUV A;  3V38 A;  1M4L A;  3PB6 X;  2ZEE A;  3IIB A;  3PB4 X;  1IGB A;  4P44 A;  1YW6 A;  3B3S A;  4ZY0 A;  1DE4 C;  3PEI A;  3NH8 A;  4UIB A;  4UEE A;  3KR4 A;  2AFS A;  2PCU A;  2AFM A;  1Y0R A;  1Q7L A;  4IHM A;  5LYD A;  2PE3 A;  4NJQ A;  3GLJ A;  1TF8 A;  5ELY A;  2RB7 A;  3S9N A;  3PB9 X;  3MRU A;  2ZEH A;  4ZYQ A;  1BLL E;  3QNV A;  2ZEN A;  5LYF A;  2PIZ A;  2HC9 A;  4R76 A;  1Y0Y A;  3FMC A;  4NGN A;  5LRG A;  1QQ9 A;  4MCQ A;  1CPX A;  2PVV A;  4MXU A;  3CT9 A;  4OKO A;  2XEG A;  2Q4Z A;  4ZY2 A;  2PJ0 A;  3V7Z A;  2V8H A;  2ABZ A;  5K8N A;  1CBX A;  3I6S A;  3KGQ A;  2OOT A;  3KZW A;  1CG2 A;  3K9T A;  2V8D A;  2Q51 A;  1YLO A;  1Z5R A;  3S9L A;  4C8U A;  3CPA A;  3D4U A;  4OC3 A;  2F8H A;  3NH5 A;  1XRY A;  1HDU A;  4FAI A;  1AMP A;  1XMB A;  4P4F A;  3B3W A;  4R7M A;  2ZEG A;  2V8G A;  4PXC A;  1YME A;  4C8A A;  4KSI A;  2IJZ A;  4IAV A;  4NJR A;  2PJ3 A;  4MHY A;  1ZLH A;  1R43 A;  1Z2L A;  3ICU A;  3H8E A;  2RFH A;  1ARM A;  4F8Z A;  2HB6 A;  1VIX A;  3BI1 A;  1F2P A;  4TJX A;  5CBM A;  4OC1 A;  3FX6 A;  4EWT A;  4R6T A;  2C6C A;  2XEI A;  4O23 A;  4DJL A;  3N5F A;  4WJB A;  3WC7 A;  2GU2 A;  3B3V A;  3VAR A;  3LWU A;  3WC5 A;  4A37 A;  2NYQ A;  1EE3 P;  3IC1 A;  5JH9 A;  4ONW A;  1ELL P;  4P4E A;  1UWY A;  2PJB A;  2FVG A;  1TF9 A;  4PQA A;  1AYE A;  4PXD A;  1LOK A;  3FVL A;  4C85 A;  2PJ2 A;  3DGV A;  4JYW A;  1BPM A;  2C6G A;  2XEJ A;  2OR4 A;  4MCP A;  2V8V A;  3PRT A;  4C9E A;  5LYI A;  3VAT A;  3NFZ A;  2BCO A;  4A94 A;  2O4H A;  4OC0 A;  4X2T A;  2WZN A;  2ZEO A;  3TX8 A;  4UEF A;  1XF1 A;  3IEH A;  1CX8 A;  4P6Y A;  3ISZ A;  3FJU A;  4X8I A;  3GUX A;  2GP4 A;  1IY7 A;  4YWY A;  3HLP A;  1PYT B;  1GYT A;  4IK2 A;  7CPA A;  4PPZ A;  5THW A;  1HEE A;  3L2N A;  4LQG A;  4OC5 A;  3FEE A;  5JM6 A;  1ZG8 A;  2ZOG A;  2C6P A;  1H8L A;  3FH4 A;  4ZI6 A;  2ZEP A;  4A39 A;  1VHO A;  2GRE A;  2AFO A;  3D7H A;  3WT4 A;  2IMO A;  1JQG A;  3KHX A;  4EME A;  3BXM A;  2CTC A;  4H2K A;  4C8F A;  3IWW A;  3B7I A;  4C8C A;  4YN3 A;  3KAS A;  3DLJ A;  3D7D A;  4UF4 A;  2ZOF A;  3H8F A;  3KQZ A;  1F57 A;  2PJ6 A;  5D29 A;  1V6C A;  1LAN A;  5IR2 A;  4P4I A;  3B3T A;  4WWV A;  5LYL A;  4FBE A;  3ISX A;  2PJA A;  5HVG A;  5F09 A;  4FWU A;  1TKJ A;  4AXV A;  1FNO A;  1TKH A;  3NH4 A;  1ELM P;  4K3N A;  3B3C A;  2I3C A;  4YU9 A;  4C9U A;  4OID A;  4PXB A;  4MHN A;  4F9U A;  3B35 A;  4NGT A;  3PFO A;  1OBR A;  5K8M A;  2QYV A;  4C8T A;  1BAV A;  3BHX A;  1R3N A;  4Z65 A;  4NGQ A;  2QVP A;  4P4J A;  4C99 A;  5D8N A;  2AFU A;  5DS0 A;  1BPN A;  1WVM A;  3RAM A;  2CIJ A;  3S9M A;  4C9V A;  2PJ1 A;  3FEC A;  4TWE A;  3D66 A;  4CDK A;  2EK9 A;  3SJF A;  3FF3 A;  3CDX A;  4G1P A;  5HVF A;  3KI9 A;  3IJ3 A;  3EIF A;  2QJ8 A;  4B6Z A;  4OME A;  2JBK A;  4MRI A;  1ZLI A;  8CPA A;  1QMU A;  3CPX A;  1ZG9 A;  3D67 A;  1LAP A;  1ARL A;  1VGY A;  4C9A A;  2ZED A;  2GLJ A;  2C5Q A;  5HVH A;  4C86 A;  2PJC A;  2Q43 A;  4NGP A;  3WC6 A;  2PJ7 A;  3SI1 A;  2C1C A;  3PBE A;  3KR5 A;  3SJX A;  3PB8 X;  3BI0 A;  2IQ6 A;  1CP6 A;  4JZ0 A;  2EK8 A;  1PCA A;  3JRU A;  4UIA A;  2EWB A;  1XJO A;  5J1Q A;  1XBU A;  4OC4 A;  1HDQ A;  1KWM A;  3IO1 A;  1NSA A;  2ZEL A;  4ZX9 A;  4X3R A;  3I1U A;  3RZA A;  4UEZ A;  1TKF A;  3MN8 A;  3D68 A;  4OC2 A;  2PJ8 A;  4PXE A;  2ZEF A;  4NGR A;  2AFW A;  4DUK A;  3VH9 A;  4A38 A;  4TJV A;  2CF4 A;  4RUH A;  3T8W A;  2WYR A;  3D7G A;  1F2O A;  4P4B A;  3LMS A;  1VHE A;  3NA6 A;  3RBU A;  4MCS A;  4MMO A;  4R8F A;  5LRK A;  4ZY1 A;  2DEA A;  2AFX A;  1YW4 A;  4TNU A;  4NFR A;  4P10 A;  1LFW A;  4CDJ A;  3KQX A;  2VL1 A;  2XEF A;  2PJ5 A;  4CPA A;  4C9R A;  1FT7 A;  3SI2 A;  2AFZ A;  4W9Y A;  4Q7A A;  5IB9 A;  3PBB A;  5HXD A;  4KNG E;  4C8P A;  5I4M A;  2BO9 A;  4BD9 A;  1LCP A;  1YSJ A;  2G9D A;  4C84 A;  5JGF A;  2V77 A;  1ZG7 A;  5LRJ A;  2PIY A;  2PJ9 A;  2PJ4 A;  4EFD A;  3WAB A;  3H8G A;  2JBJ A;  4OP4 A;  2ZEM A;  3PFE A;  4OIW A;  5K8O A;  4NGM A;  1LAM A;  1Y7E A;  2PVW A;  2BOA A;  2J9A A;  4DYO A;  3VTA A;  3FED A;  1CP7 A;  4MHZ A;  1Z8L A;  4GM5 A;  3KL9 A;  4P45 A;  6CPA A;  1DTD A;  2JEW A;  4ZX8 A;  2F7V A;  3D7F A;  3IFE A;  4P4D A;  2ANP A;  2PRQ A;  4FUU A;  3I74 A;  1TXR A;  2O53 A;  3B2Y A;  2NSM A;  4MHP A;  1CPS A;  3GB0 A;  3SI0 A;  3PB7 X;  1Y9Z A;  2GLF A;  3K2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...