3D7FA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcit, a urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 263
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7fA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7fA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7fA02
4R76A 1HDQA 1YW6A 2NYQA 2CIJA 4PXBA 3SJXA 2PE3A 1BLLE 4C8AA 2GLFA 3FEDA 2PCUA 4ZY0A 1EE3P 1M4LA 2AFWA 4O23A 3WC5A 2ZEDA 5K8NA 5CPAA 1XRYA 3D68A 4P44A 3SI2A 3KHXA 2RB7A 3H8FA 4DUKA 3VATA 3WT4A 4PXCA 3IO1A 3N5FA 3FECA 2Q43A 2ZEHA 2ZOGA 2C6PA 3PEIA 2PJ4A 4F8ZA 3BHXA 2ZOFA 2PRQA 1H8LA 4Q7AA 1HDUA 2O4HA 3CPAA 4B6ZA 3SJEA 4MCPA 1LCPA 3IWWA 4ZY2A 2HC9A 3D4UA 4C84A 2C6GA 4OIDA 2PVVA 3FJUA 4OC1A 1F2OA 2BCOA 1FT7A 3K9TA 3CPXA 2PIZA 3PBEA 1LAMA 5K8PA 4Z65A 3RBUA 5F09A 1ZLHA 2ABZA 3GB0A 4DJLA 5JH9A 3PFOA 4P4FA 4TNUA 1RTQA 3PB4X 4OKOA 3KI9A 2VL1A 1DE4C 1R3NA 4NGRA 3GLJA 3K2KA 4X2TA 2PJ7A 4PPZA 3KZWA 5LRKA 1Y0RA 3KHZA 1CG2A 4NGTA 4ZYQA 2OOTA 2OR4A 4UIBA 3I6SA 2IQ6A 3FEEA 2F8HA 3KR4A 2V8DA 3KR5A 2DEAA 3KQXA 4A38A 3PB6X 4MHPA 3BI0A 4F9VA 2FVGA 1TF9A 3I74A 3PB8X 1UWYA 3ISZA 3B35A 2JEWA 3S9LA 4NJRA 7CPAA 3VTAA 4X3RA 1ARMA 2ZELA 2AFSA 4R6TA 4ZX8A 2V8GA 4MCQA 3B2YA 1ZLIA 4EFDA 4UEEA 1LOKA 2PJ0A 5K8OA 3NH4A 4JZ0A 4NGQA 3B7IA 4LQGA 1VHOA 4UEZA 5LRJA 3D67A 4P6YA 2HB6A 1V6CA 6CPAA 3IJ3A 2XEJA 3DLJA 4UIAA 2AFXA 4OC3A 4OC5A 5LYDA 3HLPA 2PVWA 1AYEA 1XFOA 3RZAA 5ELYA 2JBJA 4FBEA 4OC4A 2ZEPA 3H8EA 2PJ5A 2O53A 2V77A 2CF4A 3S9NA 1DTDA 2XEFA 3ICUA 1TKHA 1ARLA 3D7GA 3KASA 2JBKA 3NFZA 4FWUA 1VIXA 3IFEA 4IK2A 1KWMA 1LAPA 2V8VA 4MRIA 4DYOA 1YSJA 3IC1A 4NGSA 4OC2A 3CDXA 4YU9A 3WABA 5LYFA 2BOAA 4PXDA 2CTBA 1ZG9A 1ZG8A 4R7MA 3PRTA 2EK9A 4NJQA 5CBMA 3H8GA 3JRUA 1Q7LA 1Z5RA 1QMUA 4OP4A 3D7HA 3KGQA 2J9AA 2WZNA 3FX6A 1Z2LA 4K3NA 4PXEA 3KL9A 1TF8A 4MCSA 3I1UA 4MHNA 4C8UA 4C9UA 4WWVA 4P45A 4NGPA 4CPAA 1Y9ZA 4P4EA 3V38A 3D7DA 2G9DA 5IB9A 1QQ9A 5HVGA 4YN3A 1YMEA 4C8CA 5HVFA 4P4BA 2PJ8A 4ONWA 3SI0A 2BO9A 1ELLP 4KNGE 3SI1A 2XEIA 4NGMA 4C9RA 5LRGA 4C86A 2IMOA 2Q51A 2AFZA 5HXDA 3TX8A 3LMSA 1IY7A 4BD9A 1ELMP 1R43A 4H2KA 2PJ9A 4MCRA 3TC8A 4F9UA 2QYVA 1XJOA 3B3CA 3PBBA 3QNVA 2GU2A 1LANA 1TXRA 3NH8A 3IIBA 4UEFA 4WJBA 3V7ZA 1FNOA 4RUHA 3VARA 2QVPA 3GUXA 2ZEFA 1XMBA 3HUVA 4YWYA 4MHYA 4TJVA 1HEEA 3NA6A 2IJZA 1LFWA 1VGYA 5K8MA 4OC0A 1WVMA 1F57A 3S9MA 5JM6A 5LYLA 1TKJA 4OIWA 4A37A 5D29A 1CP7A 2CTCA 3FH4A 3DGVA 3KQZA 4TJXA 4CDJA 2PJ1A 4NFRA 2Q4ZA 1Z8LA 3EIFA 2EWBA 3SJGA 2RFHA 5I4MA 2I3CA 1BAVA 2PJ6A 4C8TA 4C85A 2PJBA 1PCAA 3ISXA 4UF4A 4P4JA 3FMCA 4C8PA 2C6CA 5THWA 4P10A 2PJ3A 1XBUA 3D66A 2V8HA 3PB7X 1VHEA 3CT9A 4NGNA 2PIYA 1CP6A 3B3TA 2QJ8A 4IHMA 3FF3A 3T8WA 4A94A 4G1PA 3BXMA 4MHZA 2GREA 2C1CA 4W9YA 2EK8A 4AXVA 5LYIA 2F7VA 1CPXA 1CX8A 3MN8A 5DS0A 1YLOA 4C9EA 1F2PA 2POKA 4ZX9A 4FUUA 8CPAA 3PB9X 4A39A 3VH9A 1Y7EA 5JGFA 1OBRA 4R8FA 4C8FA 3BI1A 4EMEA 4MXUA 3WC6A 2ZENA 3D7FA 3LWUA 4P4IA 2ANPA 3RAMA 5HVHA 3SJFA 3B3WA 5J1QA 5D8NA 4P4DA 1TKFA 1YW4A 1XF1A 3L2NA 2AFOA 3IEHA 2PJCA 1JQGA 2AFMA 3B3VA 1GYTA 2ZEEA 4ZI6A 1BPMA 4TWEA 3MRUA 4CDKA 1PYTB 3NH5A 1Y0YA 4X8IA 4ZY1A 3PFEA 4EWTA 4IAVA 2PJ2A 1BPNA 2ZEMA 4MMOA 2NSMA 4PQAA 3WC7A 2GLJA 1CBXA 1AMPA 2AFUA 2WYRA 1NSAA 4C9VA 4C99A 4C9AA 2ZEOA 2ZEGA 2PJAA 1ZG7A 1IGBA 4OMEA 3B3SA 4GM5A 4JYWA 3FVLA 4FAIA 2XEGA 1CPSA 4KSIA
chains in the Genus database with same CATH superfamily
4R76A 1YGHA 2VZZA 1Q2DA 4A95A 1HDQA 3R9FA 3T5MA 4CZ1A 4EYSA 4ZBGA 4KUAA 1YW6A 4OADA 4C7IA 4MJ8A 2NYQA 4E94A 4U5YA 2EZCA 2CIJA 4PXBA 3SJXA 2PE3A 1BLLE 3SHPA 4C8AA 4R3KA 2GLFA 4MFKA 1KBLA 4YFJA 3A9LA 4CYPA 3FEDA 3VRNA 2PCUA 4MFLA 5AG7A 1EE3P 4ZY0A 5IV0A 2FCKA 1VHSA 2FM4A 3F8KA 1M4LA 4UWJA 2GE3A 1VKCA 2EBJA 3GKRA 3EFAA 1QSNA 1ZO0A 2AFWA 4O23A 2QMLA 2REFA 2ZEDA 3WC5A 5K8NA 4E0AA 2PC1A 3CXSA 4B11A 4XPKA 5KTDA 1NE9A 1Y9KA 1YR0A 1XRYA 2VBQA 3D68A 4KORA 4P44A 5CPAA 2REEA 3SI2A 2HV2A 3ZJ0A 4CAVA 5IR2A 3KHXA 2RB7A 1IB1E 4OLLA 1YREA 3H8FA 4DUKA 1M4IA 4X5KA 2VZYA 2Z3OA 3VATA 4UA3A 3WT4A 3P2FA 4PXCA 3K9UA 1Q5XA 2Z3LA 4KOTA 3IO1A 2JDCA 3N5FA 3FECA 3VWEA 3EY5A 3T0TA 2Q44A 2Q43A 2ZEHA 2ZOGA 2C6PA 3PEIA 4AG9A 3R9EA 2PJ4A 5HH1A 5ISVA 3R9GA 3G23A 4F8ZA 4KUBA 3BHXA 1Y7RA 2ZOFA 3EZEA 2PRQA 1IIDA 3JVNA 1Z8WA 1H8LA 4Q7AA 4HNXB 4B10A 4R3LA 2D0OA 2HUZA 3BUWB 1HDUA 5J3XA 2O4HA 4A31A 3BUNB 3CPAA 4B6ZA 3SJEA 3EIFA 4MCPA 2NMTA 1LCPA 3IWWA 4C2ZA 4ORFA 3BUOB 1I1DA 1XMTA 2HC9A 3D4UA 4HNWB 4ZY2A 4EVYA 3NOJA 2C6GA 4OIDA 4C84A 2PVVA 1Z9EA 3EZBA 3FJUA 4Q36A 1X12A 5F9MA 1VBHA 1B6BA 2FT0A 4OC1A 3TT2A 2X0SA 4IIYA 1F2OA 2DIKA 2BCOA 3TLAA 1FT7A 3K9TA 2G0BA 4KLWA 2B5GB 2ZPAA 3CPXA 2PIZA 1YLEA 3PBEA 1LAMA 3D2PA 4MFZA 5K8PA 4Z65A 4QVTA 3LACA 3RBUA 5F09A 1ZLHA 2ABZA 3GB0A 3OB2B 4PK2A 4DJLA 5JH9A 2VEZA 4P4FA 3PFOA 4TNUA 5H86A 1RTQA 4II9A 3PB4X 3R95A 1YX0A 1S7NA 3TO6A 4OKOA 2VL1A 3KI9A 5JPHA 1DE4C 1R3NA 4NGRA 3GLJA 3TLGA 3K2KA 4B5PA 4X2TA 1Z4EA 4YGOA 2PJ7A 1MJAA 2AJ6A 2FSRA 3KZWA 2A4NA 1Z8XA 4HPSA 4PPZA 2ZW4A 5LRKA 5AXIA 1Y0RA 4B5PB 3PFVA 3KHZA 1CG2A 4M6IA 4NGTA 3TTHA 4DNCA 4ZYQA 1YK3A 2OOTA 2J8RA 5F1YA 1XE4A 2OR4A 2EVNA 1S5KA 4UIBA 5BWAB 3I6SA 2OB0A 2IQ6A 2P6FA 4UBRA 3FEEA 2F8HA 3KR4A 1XF8A 4A32A 2V8DA 3VRRA 4QB9A 1UFHA 1S7LA 3VROA 3KR5A 5F5XA 2DEAA 4XPDB 4RI1A 5BY0A 1XEBA 1WWZA 2EO8A 3KQXA 2VQYA 5KTCA 2HI6A 2D4PA 2CNMA 4A38A 3OAKA 3PB6X 4MHPA 3BI0A 1WK4A 2C27A 5G20A 2YGWA 2B4DA 4FD4A 4M6HA 4F0XA 2WPXA 4CRZB 4F9VA 2FVGA 1TF9A 4A2ZA 3I74A 2J8MA 3PB8X 2QIRA 3MGDA 4CAXA 1BXRB 4CGLA 1UWYA 2YNCA 2G3AA 3FXTA 3ISZA 3TO7A 2HROA 3TLBA 3KRVA 4F0YA 4K30A 3B35A 1FBVA 2JEWA 1J4JA 3S9LA 4CGPA 2I00A 1KUYA 4H6UA 4NJRA 4BPUB 5EC4A 2CY2A 3C26A 5FVJA 1Q2YA 2CNTA 4M3SA 3TCVA 7CPAA 1AUGA 3VTAA 4COGA 4JXRA 4X3RA 4IF5A 2WSAA 1B47A 1ARMA 1I21A 3BJ8A 4KVME 4UCMA 3V8IA 2B0AA 5HKYA 1B87A 2ZELA 2AFSA 4R6TA 4ZX8A 4A30A 2B3UA 2V8GA 1I12A 1N71A 2PDOA 3CZXA 5EMIA 4E2AA 1M1DA 4Y49B 1LRZA 4MCQA 3B2YA 1ZYMA 1ZLIA 1BOBA 4BPWB 2AUNA 3KKWA 4EFDA 4UEEA 1KC7A 2Z0ZA 3IGRA 2RC4A 4MFJA 1LOKA 1M44A 4QBJA 1T36B 2OZUA 1Z8TA 2PJ0A 3NH4A 4JZ0A 4NGQA 3S6HA 3B7IA 4CGOA 4LQGA 5K8OA 1VBGA 4CO9A 1VHOA 4UEZA 3FIXA 3D67A 4P6YA 5LRJA 5LYDA 4YRHA 4MI1A 3CXQA 4H89A 2K5TA 2ZW5A 2HB6A 1V6CA 6CPAA 3DLJA 2XEJA 3IJ3A 4CYOA 4UIAA 3HPHE 2AFXA 2VI7A 2H5MA 4OC3A 4KS9A 3P2HA 4OC5A 4BTFA 1ON0A 2PVWA 3HLPA 4RS2A 2EUIA 2N3AB 1AYEA 1XFOA 2BUEA 1OZPA 3RNZA 3RZAA 4B12A 2R82A 4CGMA 1C3OB 5ELYA 5JQ4A 4KLVA 2X7BA 2JBJA 5F49A 4FBEA 5H84A 4OC4A 2ZEPA 3PP9A 2PSWA 4KSFA 5G21A 2Z10A 4M8DA 3GYAA 4E8OA 2JEVA 4MFQA 3H8EA 2PJ5A 2O53A 2P6GA 2V77A 3SXOA 4Q38A 1GGOA 1BO4A 2CF4A 2C5QA 3S9NA 3E0KA 4A4BA 1DTDA 4IIXA 2XEFA 4L8AA 2I79A 3K4IA 3H5ZA 4L89A 4M6GA 3ICUA 1TKHA 1ARLA 5DWMA 3D7GA 1PU9A 3KASA 2JBKA 3EO4A 3NFZA 4FWUA 4KOUA 4KOWA 3QAYA 1IOFA 3ZNIA 1VIXA 2GIVA 3FRMA 3IFEA 4IK2A 4KOXA 1KWMA 4R9MA 2R98A 4XPLA 4CS0B 4LUAA 2EZAA 1ZRSA 1LAPA 3NE7A 2V8VA 2O28A 4MRIA 5JYBA 4DYOA 1YSJA 3IC1A 1XIXA 4NGSA 4OC2A 3CDXA 4UFVA 4YU9A 4LX9A 4NF1A 5F46A 5HKWA 3WABA 2B5GA 3PT1A 1QSTA 5LYFA 1NSLA 1M6VB 2Y1MA 3T90A 5AG4A 2B58A 2BOAA 4PXDA 2CTBA 1ZG9A 1ZG8A 4R7MA 2PQ8A 3B8GA 3PRTA 4XNHB 5A28A 4BMHA 1DIKA 2EK9A 4NJQA 2WUUA 2Z3MA 5JVLA 4A4CA 3T05A 1KZFA 2FL4A 3VGOA 1IOIA 5CBMA 1JDEA 3H8GA 4OAEA 4R57A 3JRUA 1Q7LA 1Z5RA 1QMUA 5KTAA 2YJVA 4OP4A 5F47A 2FS5A 3D7HA 2D4OA 3BUXB 3KGQA 3OP0A 2J9AA 3JTKA 2WZNA 3FX6A 4MHDA 1KUXA 2B3VA 1Z2LA 4XPDC 4K3NA 3RO0A 4PXEA 4MJXA 3KL9A 1TF8A 4MCSA 3WR7A 3I1UA 4CYNA 5A27A 2Q0YA 4MHNA 4NXYA 4C8UA 4C9UA 4WWVA 4P45A 1FY7A 3EZAA 1PUAA 4NGPA 2KCWA 4H6ZA 4BBHA 4CPAA 2VKZG 2CXAA 2JLMA 4JD6A 4P4EA 4AVCA 3V38A 1VI4A 1Y9ZA 3D7DA 2OU2A 3F5BA 2G9DA 2OZGA 1QQ9A 5IB9A 2MP0A 4PV6A 5HVGA 2Y0MA 2B4BA 4YN3A 1YMEA 2J8NA 4KVXA 4C8CA 2YNCC 5HVFA 4P4BA 3CXPA 3PLFB 2PJ8A 3W91A 2QECA 4AVAA 4ONWA 3TOBA 3IU1A 1P0HA 2OH1A 4R87A 3SI0A 2BO9A 1ELLP 4KNGE 3SI1A 1YQEA 3TFYA 3GY9A 1P4NA 1QSOA 1R57A 2XEIA 4CRYB 4NGMA 3I3GA 5LRGA 3TE4A 2EZBA 4C9RA 4C86A 2IMOA 2Q51A 2AFZA 3IU2A 2Q7SA 4PK3A 5HXDA 3TX8A 3LMSA 2E28A 2YJTA 3QAHA 1IY7A 4U9ZA 3W6XA 5J8FA 4BD9A 3FNCA 1QSMA 1ELMP 1R43A 2IL4A 2PJ9A 4H2KA 4MCRA 4IUSA 4JWPA 2Q7BA 3TC8A 4F9UA 2QYVA 1S7FA 1XJOA 2WPWA 4QUSA 3B3CA 3H4QA 3PBBA 3BJ7A 3JUWA 3QNVA 1CE8B 5CNPA 3RYOA 4I49A 3DDDA 2JDDA 3T9YA 3VWDA 3BLNA 1MJ9A 2DF5A 2GU2A 3S6GA 3ZZIA 1LANA 1TXRA 3LODA 3NH8A 5G22A 3U1BA 1Z4RA 4U9YA 3IIBA 5HMNA 4UEFA 4WJBA 3V7ZA 2BEIA 1XOVA 1FNOA 5AGEA 1CM0A 2FE7A 4RUHA 3F9KC 3G8WA 3I9SA 4B13A 1YVKA 3VARA 2QVPA 3GUXA 4JJXA 4A33A 2ZEFA 1XMBA 2CBLA 3HUVA 4FD5A 4AG7A 4PSXA 4PSWA 4YWYA 4UFXA 3W6SA 2Y1NA 5FD8A 2Q4VA 4MHYA 4AB7A 4INJA 4TJVA 1HEEA 3NA6A 2IJZA 1LFWA 1VGYA 3OWCA 5K8MA 4OC0A 1WVMA 4NSQA 4C2YA 1F57A 3S9MA 3SXNA 5JM6A 5LYLA 1R61A 1Q2CA 1TKJA 1Y9WA 4OIWA 5HKZA 5IB0A 4FD6A 4A37A 5D29A 3BUMB 1CP7A 2CTCA 3FH4A 3TLCA 2P6EA 3EXNA 3DGVA 2Z3PA 3KQZA 3D8PA 1S60A 4TJXA 2PR1A 1YVHA 4CDJA 1L0CA 2PJ1A 2R8VA 1M4DA 2FIAA 1EO0A 2D0PA 4NFRA 2Q4ZA 1Z8LA 2PCNA 4UCNA 2UV8G 3HMJG 2EWBA 2R1IA 3SJGA 3FBUA 3UY5A 4AVBA 3TLYA 2R7HA 2RFHA 1RO5A 3PZJA 2OZHA 4KOVA 5I4MA 2I3CA 1BAVA 1NXJA 2HWGA 2PJ6A 4C8TA 4C85A 2PJBA 2Q4YA 1PCAA 4KVOE 3ISXA 2ODFA 1ZL0A 2GP4A 5E96A 4UF4A 2Z3KA 4P4JA 3FMCA 4J0NA 2C6CA 5THWA 4CAEA 4C8PA 4COBA 4P10A 1MK4A 2PJ3A 1XBUA 3D66A 5GCNA 5F48A 2V8HA 2YNEA 3HPGG 1YVOA 3PB7X 3VRPA 1KUVA 3F0AA 4E5SA 4CYQA 5IX3A 4C68A 4XNHC 1VHEA 4HNYB 3CT9A 3DNSA 4NGNA 2PIYA 3TO9A 4BPXB 1CP6A 2F5IA 2VXKA 2G3TA 2QJ8A 1K4JA 1TIQA 1V0CA 3FF3A 3B3TA 3GIUA 4IHMA 3FYNA 4MI4A 4ZGYB 3O8ZA 3T8WA 5I0CA 2Z3NA 4A94A 3FB3A 4C7HA 4G1PA 3BXMA 4GXHA 1JWQA 1Z9UA 4KOSA 4MHZA 1QSRA 2GREA 2C1CA 4W9YA 2YNDA 3EC4A 1SQHA 2EK8A 2GFQA 4AXVA 5LYIA 3NE8A 5C82A 2F7VA 1NMTA 3PGPA 1CPXA 2HQYA 1NBWA 1CX8A 3TLEA 5AG6A 4MBUA 3R1KA 3S6KA 3T07A 1MJBA 2B4JC 1S3ZA 3DR6A 3MN8A 3N7ZA 4LQ6A 5DS0A 5EBVA 5F13A 1C30B 1YLOA 4C9EA 1F2PA 2ATRA 2POKA 4GS4A 4ZX9A 3C8OA 4FUUA 8CPAA 4J3GA 3NFQA 3PB9X 3GJZA 4A39A 2GANA 3VH9A 4UWIA 3TYXA 1Y7EA 5JGFA 3D3SA 1OBRA 1S7KA 4R8FA 2FIWA 4C8FA 3BI1A 4CAFA 1CS0B 4EMEA 2ZXVA 4MXUA 2AUMA 3WC6A 2XPLA 2ZENA 3D7FA 4C2XA 4KOYA 3LWUA 4P4IA 2ANPA 3RAMA 5HVHA 3SJFA 3B3WA 4MY0A 5J1QA 1IU8A 5D8NA 4P4DA 1IICA 1TKFA 2PR8A 2ZW7A 5G1ZA 5J8CA 2OLSA 1EZBA 2AE6A 2CNSA 1YW4A 3S6FA 1XF1A 3TLZA 3L2NA 2Z11A 4MFPA 3LD2A 2AFOA 3D2MA 4RN7A 4JXQA 4NEXA 4UCPA 3TLGB 4CAWA 2PJCA 3B3VA 1JQGA 2AFMA 3IEHA 5AG5A 1GYTA 4JVOA 4UFWA 3TOAA 4H1HA 2ZEEA 4ZI6A 3IWEA 4FD7A 1BPMA 1GHEA 4TWEA 2XPNA 3DR8A 3MRUA 2BSWA 4CDKA 1PYTB 4M85A 3NH5A 5K99A 1Y0YA 4QC6A 1M4GA 4X8IA 4B5OA 4BINA 2DPTA 2Q04A 3PFEA 4EWTA 4ZY1A 4IAVA 4KSAA 2PJ2A 3IWGA 1A2ZA 1BPNA 4Y49C 3VRQA 3U88C 4B14A 4GPLB 2DXQA 2ZEMA 4MMOA 1RXTA 3OB1B 4CGNA 3QB8A 3DSBA 1X10A 2NSMA 4PQAA 3WC7A 2XPOA 2GLJA 2BL1A 4MY3A 2B4DB 4JLYA 2DLAA 5C88A 4RR2B 1CBXA 1AMPA 1J3LA 4ONUA 2AFUA 4HKFA 2WYRA 2ZW6A 1WJTA 1NSAA 4C9VA 4C99A 4C9AA 2ZEOA 2ZEGA 2XPPA 1CJWA 1ZG7A 2DPSA 2PJAA 1IYLA 1EZAA 5DWNA 1U6MA 1IGBA 3R96A 2FXFA 1IYKA 3G3SA 2P0WA 4OMEA 3B3SA 4NCZA 1A9XB 1KEEB 2ARHA 4GM5A 2PRBA 4JYWA 3FVLA 4F6AA 3SR3A 4KZTA 4FAIA 2XEGA 1CPSA 1JDBC 4KSIA
chains in the Genus database with same CATH topology
4R76A 1HDQA 1YW6A 2NYQA 2CIJA 4PXBA 3SJXA 2PE3A 1BLLE 4C8AA 2GLFA 3FEDA 2PCUA 4ZY0A 1EE3P 1M4LA 2AFWA 4O23A 3WC5A 2ZEDA 5K8NA 5CPAA 1XRYA 3D68A 5IR2A 4P44A 3SI2A 3KHXA 2RB7A 3H8FA 4DUKA 3VATA 3WT4A 4PXCA 3IO1A 3N5FA 3FECA 2Q43A 2ZEHA 2ZOGA 2C6PA 3PEIA 2PJ4A 4F8ZA 3BHXA 2ZOFA 2PRQA 1H8LA 4Q7AA 1HDUA 2O4HA 3CPAA 4B6ZA 3SJEA 4MCPA 1LCPA 3IWWA 4ZY2A 2HC9A 3D4UA 4C84A 2C6GA 4OIDA 2PVVA 3FJUA 4OC1A 1F2OA 2BCOA 1FT7A 3K9TA 3CPXA 2PIZA 3PBEA 1LAMA 5K8PA 4Z65A 3RBUA 5F09A 1ZLHA 2ABZA 3GB0A 4DJLA 5JH9A 3PFOA 4P4FA 4TNUA 1RTQA 3PB4X 4OKOA 3KI9A 2VL1A 1DE4C 1R3NA 4NGRA 3GLJA 3K2KA 4X2TA 2PJ7A 4PPZA 3KZWA 5LRKA 1Y0RA 3KHZA 1CG2A 4NGTA 4ZYQA 2OOTA 2OR4A 4UIBA 3I6SA 2IQ6A 3FEEA 2F8HA 3KR4A 2V8DA 3KR5A 2DEAA 3KQXA 4A38A 3PB6X 4MHPA 3BI0A 4F9VA 2FVGA 1TF9A 3I74A 3PB8X 1UWYA 3ISZA 3B35A 2JEWA 3S9LA 4NJRA 7CPAA 3VTAA 4X3RA 1ARMA 2ZELA 2AFSA 4R6TA 4ZX8A 2V8GA 4MCQA 3B2YA 1ZLIA 4EFDA 4UEEA 1LOKA 2PJ0A 5K8OA 3NH4A 4JZ0A 4NGQA 3B7IA 4LQGA 1VHOA 4UEZA 5LRJA 3D67A 4P6YA 2HB6A 1V6CA 6CPAA 3IJ3A 2XEJA 3DLJA 4UIAA 2AFXA 4OC3A 4OC5A 5LYDA 3HLPA 2PVWA 1AYEA 1XFOA 3RZAA 5ELYA 2JBJA 4FBEA 4OC4A 2ZEPA 3H8EA 2PJ5A 2O53A 2V77A 2CF4A 2C5QA 3S9NA 1DTDA 2XEFA 3ICUA 1TKHA 1ARLA 3D7GA 3KASA 2JBKA 3NFZA 4FWUA 1VIXA 3IFEA 4IK2A 1KWMA 1LAPA 2V8VA 4MRIA 4DYOA 1YSJA 3IC1A 4NGSA 4OC2A 3CDXA 4YU9A 3WABA 5LYFA 2BOAA 4PXDA 2CTBA 1ZG9A 1ZG8A 4R7MA 3PRTA 2EK9A 4NJQA 5CBMA 3H8GA 3JRUA 1Q7LA 1Z5RA 1QMUA 4OP4A 3D7HA 3KGQA 2J9AA 2WZNA 3FX6A 1Z2LA 4K3NA 4PXEA 3KL9A 1TF8A 4MCSA 3I1UA 4MHNA 4C8UA 4C9UA 4WWVA 4P45A 4NGPA 4CPAA 1Y9ZA 4P4EA 3V38A 3D7DA 2G9DA 5IB9A 1QQ9A 5HVGA 4YN3A 1YMEA 4C8CA 5HVFA 4P4BA 2PJ8A 4ONWA 3SI0A 2BO9A 1ELLP 4KNGE 3SI1A 2XEIA 4NGMA 4C9RA 5LRGA 4C86A 2IMOA 2Q51A 2AFZA 5HXDA 3TX8A 3LMSA 1IY7A 4BD9A 1ELMP 1R43A 4H2KA 2PJ9A 4MCRA 3TC8A 4F9UA 2QYVA 1XJOA 3B3CA 3PBBA 3QNVA 2GU2A 1LANA 1TXRA 3NH8A 3IIBA 4UEFA 4WJBA 3V7ZA 1FNOA 4RUHA 3VARA 2QVPA 3GUXA 2ZEFA 1XMBA 3HUVA 4YWYA 4MHYA 4TJVA 1HEEA 3NA6A 2IJZA 1LFWA 1VGYA 5K8MA 4OC0A 1WVMA 1F57A 3S9MA 5JM6A 5LYLA 1TKJA 4OIWA 4A37A 5D29A 1CP7A 2CTCA 3FH4A 3DGVA 3KQZA 4TJXA 4CDJA 2PJ1A 4NFRA 2Q4ZA 1Z8LA 3EIFA 2EWBA 3SJGA 2RFHA 5I4MA 2I3CA 1BAVA 2PJ6A 4C8TA 4C85A 2PJBA 1PCAA 3ISXA 2GP4A 4UF4A 4P4JA 3FMCA 4C8PA 2C6CA 5THWA 4P10A 2PJ3A 1XBUA 3D66A 2V8HA 3PB7X 1VHEA 3CT9A 4NGNA 2PIYA 1CP6A 3B3TA 2QJ8A 4IHMA 3FF3A 3T8WA 4A94A 4G1PA 3BXMA 4MHZA 2GREA 2C1CA 4W9YA 2EK8A 4AXVA 5LYIA 2F7VA 1CPXA 1CX8A 3MN8A 5DS0A 1YLOA 4C9EA 1F2PA 2POKA 4ZX9A 4FUUA 8CPAA 3PB9X 4A39A 3VH9A 1Y7EA 5JGFA 1OBRA 4R8FA 4C8FA 3BI1A 4EMEA 4MXUA 3WC6A 2ZENA 3D7FA 3LWUA 4P4IA 2ANPA 3RAMA 5HVHA 3SJFA 3B3WA 5J1QA 5D8NA 4P4DA 1TKFA 1YW4A 1XF1A 3L2NA 2AFOA 3IEHA 2PJCA 1JQGA 2AFMA 3B3VA 1GYTA 2ZEEA 4ZI6A 1BPMA 4TWEA 3MRUA 4CDKA 1PYTB 3NH5A 1Y0YA 4X8IA 4ZY1A 3PFEA 4EWTA 4IAVA 2PJ2A 1BPNA 2ZEMA 4MMOA 2NSMA 4PQAA 3WC7A 2GLJA 1CBXA 1AMPA 2AFUA 2WYRA 1NSAA 4C9VA 4C99A 4C9AA 2ZEOA 2ZEGA 2PJAA 1ZG7A 1IGBA 4OMEA 3B3SA 4GM5A 4JYWA 3FVLA 4FAIA 2XEGA 1CPSA 4KSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R76 A;  1HDQ A;  1YW6 A;  2NYQ A;  2CIJ A;  4PXB A;  3SJX A;  2PE3 A;  1BLL E;  4C8A A;  2GLF A;  3FED A;  2PCU A;  4ZY0 A;  1EE3 P;  1M4L A;  2AFW A;  4O23 A;  3WC5 A;  2ZED A;  5K8N A;  5CPA A;  1XRY A;  3D68 A;  4P44 A;  3SI2 A;  3KHX A;  2RB7 A;  3H8F A;  4DUK A;  3VAT A;  3WT4 A;  4PXC A;  3IO1 A;  3N5F A;  3FEC A;  2Q43 A;  2ZEH A;  2ZOG A;  2C6P A;  3PEI A;  2PJ4 A;  4F8Z A;  3BHX A;  2ZOF A;  2PRQ A;  1H8L A;  4Q7A A;  1HDU A;  2O4H A;  3CPA A;  4B6Z A;  3SJE A;  4MCP A;  1LCP A;  3IWW A;  4ZY2 A;  2HC9 A;  3D4U A;  4C84 A;  2C6G A;  4OID A;  2PVV A;  3FJU A;  4OC1 A;  1F2O A;  2BCO A;  1FT7 A;  3K9T A;  3CPX A;  2PIZ A;  3PBE A;  1LAM A;  5K8P A;  4Z65 A;  3RBU A;  5F09 A;  1ZLH A;  2ABZ A;  3GB0 A;  4DJL A;  5JH9 A;  3PFO A;  4P4F A;  4TNU A;  1RTQ A;  3PB4 X;  4OKO A;  3KI9 A;  2VL1 A;  1DE4 C;  1R3N A;  4NGR A;  3GLJ A;  3K2K A;  4X2T A;  2PJ7 A;  4PPZ A;  3KZW A;  5LRK A;  1Y0R A;  3KHZ A;  1CG2 A;  4NGT A;  4ZYQ A;  2OOT A;  2OR4 A;  4UIB A;  3I6S A;  2IQ6 A;  3FEE A;  2F8H A;  3KR4 A;  2V8D A;  3KR5 A;  2DEA A;  3KQX A;  4A38 A;  3PB6 X;  4MHP A;  3BI0 A;  4F9V A;  2FVG A;  1TF9 A;  3I74 A;  3PB8 X;  1UWY A;  3ISZ A;  3B35 A;  2JEW A;  3S9L A;  4NJR A;  7CPA A;  3VTA A;  4X3R A;  1ARM A;  2ZEL A;  2AFS A;  4R6T A;  4ZX8 A;  2V8G A;  4MCQ A;  3B2Y A;  1ZLI A;  4EFD A;  4UEE A;  1LOK A;  2PJ0 A;  5K8O A;  3NH4 A;  4JZ0 A;  4NGQ A;  3B7I A;  4LQG A;  1VHO A;  4UEZ A;  5LRJ A;  3D67 A;  4P6Y A;  2HB6 A;  1V6C A;  6CPA A;  3IJ3 A;  2XEJ A;  3DLJ A;  4UIA A;  2AFX A;  4OC3 A;  4OC5 A;  5LYD A;  3HLP A;  2PVW A;  1AYE A;  1XFO A;  3RZA A;  5ELY A;  2JBJ A;  4FBE A;  4OC4 A;  2ZEP A;  3H8E A;  2PJ5 A;  2O53 A;  2V77 A;  2CF4 A;  3S9N A;  1DTD A;  2XEF A;  3ICU A;  1TKH A;  1ARL A;  3D7G A;  3KAS A;  2JBK A;  3NFZ A;  4FWU A;  1VIX A;  3IFE A;  4IK2 A;  1KWM A;  1LAP A;  2V8V A;  4MRI A;  4DYO A;  1YSJ A;  3IC1 A;  4NGS A;  4OC2 A;  3CDX A;  4YU9 A;  3WAB A;  5LYF A;  2BOA A;  4PXD A;  2CTB A;  1ZG9 A;  1ZG8 A;  4R7M A;  3PRT A;  2EK9 A;  4NJQ A;  5CBM A;  3H8G A;  3JRU A;  1Q7L A;  1Z5R A;  1QMU A;  4OP4 A;  3D7H A;  3KGQ A;  2J9A A;  2WZN A;  3FX6 A;  1Z2L A;  4K3N A;  4PXE A;  3KL9 A;  1TF8 A;  4MCS A;  3I1U A;  4MHN A;  4C8U A;  4C9U A;  4WWV A;  4P45 A;  4NGP A;  4CPA A;  1Y9Z A;  4P4E A;  3V38 A;  3D7D A;  2G9D A;  5IB9 A;  1QQ9 A;  5HVG A;  4YN3 A;  1YME A;  4C8C A;  5HVF A;  4P4B A;  2PJ8 A;  4ONW A;  3SI0 A;  2BO9 A;  1ELL P;  4KNG E;  3SI1 A;  2XEI A;  4NGM A;  4C9R A;  5LRG A;  4C86 A;  2IMO A;  2Q51 A;  2AFZ A;  5HXD A;  3TX8 A;  3LMS A;  1IY7 A;  4BD9 A;  1ELM P;  1R43 A;  4H2K A;  2PJ9 A;  4MCR A;  3TC8 A;  4F9U A;  2QYV A;  1XJO A;  3B3C A;  3PBB A;  3QNV A;  2GU2 A;  1LAN A;  1TXR A;  3NH8 A;  3IIB A;  4UEF A;  4WJB A;  3V7Z A;  1FNO A;  4RUH A;  3VAR A;  2QVP A;  3GUX A;  2ZEF A;  1XMB A;  3HUV A;  4YWY A;  4MHY A;  4TJV A;  1HEE A;  3NA6 A;  2IJZ A;  1LFW A;  1VGY A;  5K8M A;  4OC0 A;  1WVM A;  1F57 A;  3S9M A;  5JM6 A;  5LYL A;  1TKJ A;  4OIW A;  4A37 A;  5D29 A;  1CP7 A;  2CTC A;  3FH4 A;  3DGV A;  3KQZ A;  4TJX A;  4CDJ A;  2PJ1 A;  4NFR A;  2Q4Z A;  1Z8L A;  3EIF A;  2EWB A;  3SJG A;  2RFH A;  5I4M A;  2I3C A;  1BAV A;  2PJ6 A;  4C8T A;  4C85 A;  2PJB A;  1PCA A;  3ISX A;  4UF4 A;  4P4J A;  3FMC A;  4C8P A;  2C6C A;  5THW A;  4P10 A;  2PJ3 A;  1XBU A;  3D66 A;  2V8H A;  3PB7 X;  1VHE A;  3CT9 A;  4NGN A;  2PIY A;  1CP6 A;  3B3T A;  2QJ8 A;  4IHM A;  3FF3 A;  3T8W A;  4A94 A;  4G1P A;  3BXM A;  4MHZ A;  2GRE A;  2C1C A;  4W9Y A;  2EK8 A;  4AXV A;  5LYI A;  2F7V A;  1CPX A;  1CX8 A;  3MN8 A;  5DS0 A;  1YLO A;  4C9E A;  1F2P A;  2POK A;  4ZX9 A;  4FUU A;  8CPA A;  3PB9 X;  4A39 A;  3VH9 A;  1Y7E A;  5JGF A;  1OBR A;  4R8F A;  4C8F A;  3BI1 A;  4EME A;  4MXU A;  3WC6 A;  2ZEN A;  3D7F A;  3LWU A;  4P4I A;  2ANP A;  3RAM A;  5HVH A;  3SJF A;  3B3W A;  5J1Q A;  5D8N A;  4P4D A;  1TKF A;  1YW4 A;  1XF1 A;  3L2N A;  2AFO A;  3IEH A;  2PJC A;  1JQG A;  2AFM A;  3B3V A;  1GYT A;  2ZEE A;  4ZI6 A;  1BPM A;  4TWE A;  3MRU A;  4CDK A;  1PYT B;  3NH5 A;  1Y0Y A;  4X8I A;  4ZY1 A;  3PFE A;  4EWT A;  4IAV A;  2PJ2 A;  1BPN A;  2ZEM A;  4MMO A;  2NSM A;  4PQA A;  3WC7 A;  2GLJ A;  1CBX A;  1AMP A;  2AFU A;  2WYR A;  1NSA A;  4C9V A;  4C99 A;  4C9A A;  2ZEO A;  2ZEG A;  2PJA A;  1ZG7 A;  1IGB A;  4OME A;  3B3S A;  4GM5 A;  4JYW A;  3FVL A;  4FAI A;  2XEG A;  1CPS A;  4KSI A; 
#chains in the Genus database with same CATH topology
 4R76 A;  1YGH A;  2VZZ A;  1Q2D A;  4A95 A;  1HDQ A;  3R9F A;  3T5M A;  4CZ1 A;  4EYS A;  4ZBG A;  4KUA A;  1YW6 A;  4OAD A;  4C7I A;  4MJ8 A;  2NYQ A;  4E94 A;  4U5Y A;  2EZC A;  2CIJ A;  4PXB A;  3SJX A;  2PE3 A;  1BLL E;  3SHP A;  4C8A A;  4R3K A;  2GLF A;  4MFK A;  1KBL A;  4YFJ A;  3A9L A;  4CYP A;  3FED A;  3VRN A;  2PCU A;  4MFL A;  5AG7 A;  1EE3 P;  4ZY0 A;  5IV0 A;  2FCK A;  1VHS A;  2FM4 A;  3F8K A;  1M4L A;  4UWJ A;  2GE3 A;  1VKC A;  2EBJ A;  3GKR A;  3EFA A;  1QSN A;  1ZO0 A;  2AFW A;  4O23 A;  2QML A;  2REF A;  2ZED A;  3WC5 A;  5K8N A;  4E0A A;  2PC1 A;  3CXS A;  4B11 A;  4XPK A;  5KTD A;  1NE9 A;  1Y9K A;  1YR0 A;  1XRY A;  2VBQ A;  3D68 A;  4KOR A;  4P44 A;  5CPA A;  2REE A;  3SI2 A;  2HV2 A;  3ZJ0 A;  4CAV A;  5IR2 A;  3KHX A;  2RB7 A;  1IB1 E;  4OLL A;  1YRE A;  3H8F A;  4DUK A;  1M4I A;  4X5K A;  2VZY A;  2Z3O A;  3VAT A;  4UA3 A;  3WT4 A;  3P2F A;  4PXC A;  3K9U A;  1Q5X A;  2Z3L A;  4KOT A;  3IO1 A;  2JDC A;  3N5F A;  3FEC A;  3VWE A;  3EY5 A;  3T0T A;  2Q44 A;  2Q43 A;  2ZEH A;  2ZOG A;  2C6P A;  3PEI A;  4AG9 A;  3R9E A;  2PJ4 A;  5HH1 A;  5ISV A;  3R9G A;  3G23 A;  4F8Z A;  4KUB A;  3BHX A;  1Y7R A;  2ZOF A;  3EZE A;  2PRQ A;  1IID A;  3JVN A;  1Z8W A;  1H8L A;  4Q7A A;  4HNX B;  4B10 A;  4R3L A;  2D0O A;  2HUZ A;  3BUW B;  1HDU A;  5J3X A;  2O4H A;  4A31 A;  3BUN B;  3CPA A;  4B6Z A;  3SJE A;  3EIF A;  4MCP A;  2NMT A;  1LCP A;  3IWW A;  4C2Z A;  4ORF A;  3BUO B;  1I1D A;  1XMT A;  2HC9 A;  3D4U A;  4HNW B;  4ZY2 A;  4EVY A;  3NOJ A;  2C6G A;  4OID A;  4C84 A;  2PVV A;  1Z9E A;  3EZB A;  3FJU A;  4Q36 A;  1X12 A;  5F9M A;  1VBH A;  1B6B A;  2FT0 A;  4OC1 A;  3TT2 A;  2X0S A;  4IIY A;  1F2O A;  2DIK A;  2BCO A;  3TLA A;  1FT7 A;  3K9T A;  2G0B A;  4KLW A;  2B5G B;  2ZPA A;  3CPX A;  2PIZ A;  1YLE A;  3PBE A;  1LAM A;  3D2P A;  4MFZ A;  5K8P A;  4Z65 A;  4QVT A;  3LAC A;  3RBU A;  5F09 A;  1ZLH A;  2ABZ A;  3GB0 A;  3OB2 B;  4PK2 A;  4DJL A;  5JH9 A;  2VEZ A;  4P4F A;  3PFO A;  4TNU A;  5H86 A;  1RTQ A;  4II9 A;  3PB4 X;  3R95 A;  1YX0 A;  1S7N A;  3TO6 A;  4OKO A;  2VL1 A;  3KI9 A;  5JPH A;  1DE4 C;  1R3N A;  4NGR A;  3GLJ A;  3TLG A;  3K2K A;  4B5P A;  4X2T A;  1Z4E A;  4YGO A;  2PJ7 A;  1MJA A;  2AJ6 A;  2FSR A;  3KZW A;  2A4N A;  1Z8X A;  4HPS A;  4PPZ A;  2ZW4 A;  5LRK A;  5AXI A;  1Y0R A;  4B5P B;  3PFV A;  3KHZ A;  1CG2 A;  4M6I A;  4NGT A;  3TTH A;  4DNC A;  4ZYQ A;  1YK3 A;  2OOT A;  2J8R A;  5F1Y A;  1XE4 A;  2OR4 A;  2EVN A;  1S5K A;  4UIB A;  5BWA B;  3I6S A;  2OB0 A;  2IQ6 A;  2P6F A;  4UBR A;  3FEE A;  2F8H A;  3KR4 A;  1XF8 A;  4A32 A;  2V8D A;  3VRR A;  4QB9 A;  1UFH A;  1S7L A;  3VRO A;  3KR5 A;  5F5X A;  2DEA A;  4XPD B;  4RI1 A;  5BY0 A;  1XEB A;  1WWZ A;  2EO8 A;  3KQX A;  2VQY A;  5KTC A;  2HI6 A;  2D4P A;  2CNM A;  4A38 A;  3OAK A;  3PB6 X;  4MHP A;  3BI0 A;  1WK4 A;  2C27 A;  5G20 A;  2YGW A;  2B4D A;  4FD4 A;  4M6H A;  4F0X A;  2WPX A;  4CRZ B;  4F9V A;  2FVG A;  1TF9 A;  4A2Z A;  3I74 A;  2J8M A;  3PB8 X;  2QIR A;  3MGD A;  4CAX A;  1BXR B;  4CGL A;  1UWY A;  2YNC A;  2G3A A;  3FXT A;  3ISZ A;  3TO7 A;  2HRO A;  3TLB A;  3KRV A;  4F0Y A;  4K30 A;  3B35 A;  1FBV A;  2JEW A;  1J4J A;  3S9L A;  4CGP A;  2I00 A;  1KUY A;  4H6U A;  4NJR A;  4BPU B;  5EC4 A;  2CY2 A;  3C26 A;  5FVJ A;  1Q2Y A;  2CNT A;  4M3S A;  3TCV A;  7CPA A;  1AUG A;  3VTA A;  4COG A;  4JXR A;  4X3R A;  4IF5 A;  2WSA A;  1B47 A;  1ARM A;  1I21 A;  3BJ8 A;  4KVM E;  4UCM A;  3V8I A;  2B0A A;  5HKY A;  1B87 A;  2ZEL A;  2AFS A;  4R6T A;  4ZX8 A;  4A30 A;  2B3U A;  2V8G A;  1I12 A;  1N71 A;  2PDO A;  3CZX A;  5EMI A;  4E2A A;  1M1D A;  4Y49 B;  1LRZ A;  4MCQ A;  3B2Y A;  1ZYM A;  1ZLI A;  1BOB A;  4BPW B;  2AUN A;  3KKW A;  4EFD A;  4UEE A;  1KC7 A;  2Z0Z A;  3IGR A;  2RC4 A;  4MFJ A;  1LOK A;  1M44 A;  4QBJ A;  1T36 B;  2OZU A;  1Z8T A;  2PJ0 A;  3NH4 A;  4JZ0 A;  4NGQ A;  3S6H A;  3B7I A;  4CGO A;  4LQG A;  5K8O A;  1VBG A;  4CO9 A;  1VHO A;  4UEZ A;  3FIX A;  3D67 A;  4P6Y A;  5LRJ A;  5LYD A;  4YRH A;  4MI1 A;  3CXQ A;  4H89 A;  2K5T A;  2ZW5 A;  2HB6 A;  1V6C A;  6CPA A;  3DLJ A;  2XEJ A;  3IJ3 A;  4CYO A;  4UIA A;  3HPH E;  2AFX A;  2VI7 A;  2H5M A;  4OC3 A;  4KS9 A;  3P2H A;  4OC5 A;  4BTF A;  1ON0 A;  2PVW A;  3HLP A;  4RS2 A;  2EUI A;  2N3A B;  1AYE A;  1XFO A;  2BUE A;  1OZP A;  3RNZ A;  3RZA A;  4B12 A;  2R82 A;  4CGM A;  1C3O B;  5ELY A;  5JQ4 A;  4KLV A;  2X7B A;  2JBJ A;  5F49 A;  4FBE A;  5H84 A;  4OC4 A;  2ZEP A;  3PP9 A;  2PSW A;  4KSF A;  5G21 A;  2Z10 A;  4M8D A;  3GYA A;  4E8O A;  2JEV A;  4MFQ A;  3H8E A;  2PJ5 A;  2O53 A;  2P6G A;  2V77 A;  3SXO A;  4Q38 A;  1GGO A;  1BO4 A;  2CF4 A;  2C5Q A;  3S9N A;  3E0K A;  4A4B A;  1DTD A;  4IIX A;  2XEF A;  4L8A A;  2I79 A;  3K4I A;  3H5Z A;  4L89 A;  4M6G A;  3ICU A;  1TKH A;  1ARL A;  5DWM A;  3D7G A;  1PU9 A;  3KAS A;  2JBK A;  3EO4 A;  3NFZ A;  4FWU A;  4KOU A;  4KOW A;  3QAY A;  1IOF A;  3ZNI A;  1VIX A;  2GIV A;  3FRM A;  3IFE A;  4IK2 A;  4KOX A;  1KWM A;  4R9M A;  2R98 A;  4XPL A;  4CS0 B;  4LUA A;  2EZA A;  1ZRS A;  1LAP A;  3NE7 A;  2V8V A;  2O28 A;  4MRI A;  5JYB A;  4DYO A;  1YSJ A;  3IC1 A;  1XIX A;  4NGS A;  4OC2 A;  3CDX A;  4UFV A;  4YU9 A;  4LX9 A;  4NF1 A;  5F46 A;  5HKW A;  3WAB A;  2B5G A;  3PT1 A;  1QST A;  5LYF A;  1NSL A;  1M6V B;  2Y1M A;  3T90 A;  5AG4 A;  2B58 A;  2BOA A;  4PXD A;  2CTB A;  1ZG9 A;  1ZG8 A;  4R7M A;  2PQ8 A;  3B8G A;  3PRT A;  4XNH B;  5A28 A;  4BMH A;  1DIK A;  2EK9 A;  4NJQ A;  2WUU A;  2Z3M A;  5JVL A;  4A4C A;  3T05 A;  1KZF A;  2FL4 A;  3VGO A;  1IOI A;  5CBM A;  1JDE A;  3H8G A;  4OAE A;  4R57 A;  3JRU A;  1Q7L A;  1Z5R A;  1QMU A;  5KTA A;  2YJV A;  4OP4 A;  5F47 A;  2FS5 A;  3D7H A;  2D4O A;  3BUX B;  3KGQ A;  3OP0 A;  2J9A A;  3JTK A;  2WZN A;  3FX6 A;  4MHD A;  1KUX A;  2B3V A;  1Z2L A;  4XPD C;  4K3N A;  3RO0 A;  4PXE A;  4MJX A;  3KL9 A;  1TF8 A;  4MCS A;  3WR7 A;  3I1U A;  4CYN A;  5A27 A;  2Q0Y A;  4MHN A;  4NXY A;  4C8U A;  4C9U A;  4WWV A;  4P45 A;  1FY7 A;  3EZA A;  1PUA A;  4NGP A;  2KCW A;  4H6Z A;  4BBH A;  4CPA A;  2VKZ G;  2CXA A;  2JLM A;  4JD6 A;  4P4E A;  4AVC A;  3V38 A;  1VI4 A;  1Y9Z A;  3D7D A;  2OU2 A;  3F5B A;  2G9D A;  2OZG A;  1QQ9 A;  5IB9 A;  2MP0 A;  4PV6 A;  5HVG A;  2Y0M A;  2B4B A;  4YN3 A;  1YME A;  2J8N A;  4KVX A;  4C8C A;  2YNC C;  5HVF A;  4P4B A;  3CXP A;  3PLF B;  2PJ8 A;  3W91 A;  2QEC A;  4AVA A;  4ONW A;  3TOB A;  3IU1 A;  1P0H A;  2OH1 A;  4R87 A;  3SI0 A;  2BO9 A;  1ELL P;  4KNG E;  3SI1 A;  1YQE A;  3TFY A;  3GY9 A;  1P4N A;  1QSO A;  1R57 A;  2XEI A;  4CRY B;  4NGM A;  3I3G A;  5LRG A;  3TE4 A;  2EZB A;  4C9R A;  4C86 A;  2IMO A;  2Q51 A;  2AFZ A;  3IU2 A;  2Q7S A;  4PK3 A;  5HXD A;  3TX8 A;  3LMS A;  2E28 A;  2YJT A;  3QAH A;  1IY7 A;  4U9Z A;  3W6X A;  5J8F A;  4BD9 A;  3FNC A;  1QSM A;  1ELM P;  1R43 A;  2IL4 A;  2PJ9 A;  4H2K A;  4MCR A;  4IUS A;  4JWP A;  2Q7B A;  3TC8 A;  4F9U A;  2QYV A;  1S7F A;  1XJO A;  2WPW A;  4QUS A;  3B3C A;  3H4Q A;  3PBB A;  3BJ7 A;  3JUW A;  3QNV A;  1CE8 B;  5CNP A;  3RYO A;  4I49 A;  3DDD A;  2JDD A;  3T9Y A;  3VWD A;  3BLN A;  1MJ9 A;  2DF5 A;  2GU2 A;  3S6G A;  3ZZI A;  1LAN A;  1TXR A;  3LOD A;  3NH8 A;  5G22 A;  3U1B A;  1Z4R A;  4U9Y A;  3IIB A;  5HMN A;  4UEF A;  4WJB A;  3V7Z A;  2BEI A;  1XOV A;  1FNO A;  5AGE A;  1CM0 A;  2FE7 A;  4RUH A;  3F9K C;  3G8W A;  3I9S A;  4B13 A;  1YVK A;  3VAR A;  2QVP A;  3GUX A;  4JJX A;  4A33 A;  2ZEF A;  1XMB A;  2CBL A;  3HUV A;  4FD5 A;  4AG7 A;  4PSX A;  4PSW A;  4YWY A;  4UFX A;  3W6S A;  2Y1N A;  5FD8 A;  2Q4V A;  4MHY A;  4AB7 A;  4INJ A;  4TJV A;  1HEE A;  3NA6 A;  2IJZ A;  1LFW A;  1VGY A;  3OWC A;  5K8M A;  4OC0 A;  1WVM A;  4NSQ A;  4C2Y A;  1F57 A;  3S9M A;  3SXN A;  5JM6 A;  5LYL A;  1R61 A;  1Q2C A;  1TKJ A;  1Y9W A;  4OIW A;  5HKZ A;  5IB0 A;  4FD6 A;  4A37 A;  5D29 A;  3BUM B;  1CP7 A;  2CTC A;  3FH4 A;  3TLC A;  2P6E A;  3EXN A;  3DGV A;  2Z3P A;  3KQZ A;  3D8P A;  1S60 A;  4TJX A;  2PR1 A;  1YVH A;  4CDJ A;  1L0C A;  2PJ1 A;  2R8V A;  1M4D A;  2FIA A;  1EO0 A;  2D0P A;  4NFR A;  2Q4Z A;  1Z8L A;  2PCN A;  4UCN A;  2UV8 G;  3HMJ G;  2EWB A;  2R1I A;  3SJG A;  3FBU A;  3UY5 A;  4AVB A;  3TLY A;  2R7H A;  2RFH A;  1RO5 A;  3PZJ A;  2OZH A;  4KOV A;  5I4M A;  2I3C A;  1BAV A;  1NXJ A;  2HWG A;  2PJ6 A;  4C8T A;  4C85 A;  2PJB A;  2Q4Y A;  1PCA A;  4KVO E;  3ISX A;  2ODF A;  1ZL0 A;  2GP4 A;  5E96 A;  4UF4 A;  2Z3K A;  4P4J A;  3FMC A;  4J0N A;  2C6C A;  5THW A;  4CAE A;  4C8P A;  4COB A;  4P10 A;  1MK4 A;  2PJ3 A;  1XBU A;  3D66 A;  5GCN A;  5F48 A;  2V8H A;  2YNE A;  3HPG G;  1YVO A;  3PB7 X;  3VRP A;  1KUV A;  3F0A A;  4E5S A;  4CYQ A;  5IX3 A;  4C68 A;  4XNH C;  1VHE A;  4HNY B;  3CT9 A;  3DNS A;  4NGN A;  2PIY A;  3TO9 A;  4BPX B;  1CP6 A;  2F5I A;  2VXK A;  2G3T A;  2QJ8 A;  1K4J A;  1TIQ A;  1V0C A;  3FF3 A;  3B3T A;  3GIU A;  4IHM A;  3FYN A;  4MI4 A;  4ZGY B;  3O8Z A;  3T8W A;  5I0C A;  2Z3N A;  4A94 A;  3FB3 A;  4C7H A;  4G1P A;  3BXM A;  4GXH A;  1JWQ A;  1Z9U A;  4KOS A;  4MHZ A;  1QSR A;  2GRE A;  2C1C A;  4W9Y A;  2YND A;  3EC4 A;  1SQH A;  2EK8 A;  2GFQ A;  4AXV A;  5LYI A;  3NE8 A;  5C82 A;  2F7V A;  1NMT A;  3PGP A;  1CPX A;  2HQY A;  1NBW A;  1CX8 A;  3TLE A;  5AG6 A;  4MBU A;  3R1K A;  3S6K A;  3T07 A;  1MJB A;  2B4J C;  1S3Z A;  3DR6 A;  3MN8 A;  3N7Z A;  4LQ6 A;  5DS0 A;  5EBV A;  5F13 A;  1C30 B;  1YLO A;  4C9E A;  1F2P A;  2ATR A;  2POK A;  4GS4 A;  4ZX9 A;  3C8O A;  4FUU A;  8CPA A;  4J3G A;  3NFQ A;  3PB9 X;  3GJZ A;  4A39 A;  2GAN A;  3VH9 A;  4UWI A;  3TYX A;  1Y7E A;  5JGF A;  3D3S A;  1OBR A;  1S7K A;  4R8F A;  2FIW A;  4C8F A;  3BI1 A;  4CAF A;  1CS0 B;  4EME A;  2ZXV A;  4MXU A;  2AUM A;  3WC6 A;  2XPL A;  2ZEN A;  3D7F A;  4C2X A;  4KOY A;  3LWU A;  4P4I A;  2ANP A;  3RAM A;  5HVH A;  3SJF A;  3B3W A;  4MY0 A;  5J1Q A;  1IU8 A;  5D8N A;  4P4D A;  1IIC A;  1TKF A;  2PR8 A;  2ZW7 A;  5G1Z A;  5J8C A;  2OLS A;  1EZB A;  2AE6 A;  2CNS A;  1YW4 A;  3S6F A;  1XF1 A;  3TLZ A;  3L2N A;  2Z11 A;  4MFP A;  3LD2 A;  2AFO A;  3D2M A;  4RN7 A;  4JXQ A;  4NEX A;  4UCP A;  3TLG B;  4CAW A;  2PJC A;  3B3V A;  1JQG A;  2AFM A;  3IEH A;  5AG5 A;  1GYT A;  4JVO A;  4UFW A;  3TOA A;  4H1H A;  2ZEE A;  4ZI6 A;  3IWE A;  4FD7 A;  1BPM A;  1GHE A;  4TWE A;  2XPN A;  3DR8 A;  3MRU A;  2BSW A;  4CDK A;  1PYT B;  4M85 A;  3NH5 A;  5K99 A;  1Y0Y A;  4QC6 A;  1M4G A;  4X8I A;  4B5O A;  4BIN A;  2DPT A;  2Q04 A;  3PFE A;  4EWT A;  4ZY1 A;  4IAV A;  4KSA A;  2PJ2 A;  3IWG A;  1A2Z A;  1BPN A;  4Y49 C;  3VRQ A;  3U88 C;  4B14 A;  4GPL B;  2DXQ A;  2ZEM A;  4MMO A;  1RXT A;  3OB1 B;  4CGN A;  3QB8 A;  3DSB A;  1X10 A;  2NSM A;  4PQA A;  3WC7 A;  2XPO A;  2GLJ A;  2BL1 A;  4MY3 A;  2B4D B;  4JLY A;  2DLA A;  5C88 A;  4RR2 B;  1CBX A;  1AMP A;  1J3L A;  4ONU A;  2AFU A;  4HKF A;  2WYR A;  2ZW6 A;  1WJT A;  1NSA A;  4C9V A;  4C99 A;  4C9A A;  2ZEO A;  2ZEG A;  2XPP A;  1CJW A;  1ZG7 A;  2DPS A;  2PJA A;  1IYL A;  1EZA A;  5DWN A;  1U6M A;  1IGB A;  3R96 A;  2FXF A;  1IYK A;  3G3S A;  2P0W A;  4OME A;  3B3S A;  4NCZ A;  1A9X B;  1KEE B;  2ARH A;  4GM5 A;  2PRB A;  4JYW A;  3FVL A;  4F6A A;  3SR3 A;  4KZT A;  4FAI A;  2XEG A;  1CPS A;  1JDB C;  4KSI A; 
#chains in the Genus database with same CATH homology
 4R76 A;  1HDQ A;  1YW6 A;  2NYQ A;  2CIJ A;  4PXB A;  3SJX A;  2PE3 A;  1BLL E;  4C8A A;  2GLF A;  3FED A;  2PCU A;  4ZY0 A;  1EE3 P;  1M4L A;  2AFW A;  4O23 A;  3WC5 A;  2ZED A;  5K8N A;  5CPA A;  1XRY A;  3D68 A;  5IR2 A;  4P44 A;  3SI2 A;  3KHX A;  2RB7 A;  3H8F A;  4DUK A;  3VAT A;  3WT4 A;  4PXC A;  3IO1 A;  3N5F A;  3FEC A;  2Q43 A;  2ZEH A;  2ZOG A;  2C6P A;  3PEI A;  2PJ4 A;  4F8Z A;  3BHX A;  2ZOF A;  2PRQ A;  1H8L A;  4Q7A A;  1HDU A;  2O4H A;  3CPA A;  4B6Z A;  3SJE A;  4MCP A;  1LCP A;  3IWW A;  4ZY2 A;  2HC9 A;  3D4U A;  4C84 A;  2C6G A;  4OID A;  2PVV A;  3FJU A;  4OC1 A;  1F2O A;  2BCO A;  1FT7 A;  3K9T A;  3CPX A;  2PIZ A;  3PBE A;  1LAM A;  5K8P A;  4Z65 A;  3RBU A;  5F09 A;  1ZLH A;  2ABZ A;  3GB0 A;  4DJL A;  5JH9 A;  3PFO A;  4P4F A;  4TNU A;  1RTQ A;  3PB4 X;  4OKO A;  3KI9 A;  2VL1 A;  1DE4 C;  1R3N A;  4NGR A;  3GLJ A;  3K2K A;  4X2T A;  2PJ7 A;  4PPZ A;  3KZW A;  5LRK A;  1Y0R A;  3KHZ A;  1CG2 A;  4NGT A;  4ZYQ A;  2OOT A;  2OR4 A;  4UIB A;  3I6S A;  2IQ6 A;  3FEE A;  2F8H A;  3KR4 A;  2V8D A;  3KR5 A;  2DEA A;  3KQX A;  4A38 A;  3PB6 X;  4MHP A;  3BI0 A;  4F9V A;  2FVG A;  1TF9 A;  3I74 A;  3PB8 X;  1UWY A;  3ISZ A;  3B35 A;  2JEW A;  3S9L A;  4NJR A;  7CPA A;  3VTA A;  4X3R A;  1ARM A;  2ZEL A;  2AFS A;  4R6T A;  4ZX8 A;  2V8G A;  4MCQ A;  3B2Y A;  1ZLI A;  4EFD A;  4UEE A;  1LOK A;  2PJ0 A;  5K8O A;  3NH4 A;  4JZ0 A;  4NGQ A;  3B7I A;  4LQG A;  1VHO A;  4UEZ A;  5LRJ A;  3D67 A;  4P6Y A;  2HB6 A;  1V6C A;  6CPA A;  3IJ3 A;  2XEJ A;  3DLJ A;  4UIA A;  2AFX A;  4OC3 A;  4OC5 A;  5LYD A;  3HLP A;  2PVW A;  1AYE A;  1XFO A;  3RZA A;  5ELY A;  2JBJ A;  4FBE A;  4OC4 A;  2ZEP A;  3H8E A;  2PJ5 A;  2O53 A;  2V77 A;  2CF4 A;  2C5Q A;  3S9N A;  1DTD A;  2XEF A;  3ICU A;  1TKH A;  1ARL A;  3D7G A;  3KAS A;  2JBK A;  3NFZ A;  4FWU A;  1VIX A;  3IFE A;  4IK2 A;  1KWM A;  1LAP A;  2V8V A;  4MRI A;  4DYO A;  1YSJ A;  3IC1 A;  4NGS A;  4OC2 A;  3CDX A;  4YU9 A;  3WAB A;  5LYF A;  2BOA A;  4PXD A;  2CTB A;  1ZG9 A;  1ZG8 A;  4R7M A;  3PRT A;  2EK9 A;  4NJQ A;  5CBM A;  3H8G A;  3JRU A;  1Q7L A;  1Z5R A;  1QMU A;  4OP4 A;  3D7H A;  3KGQ A;  2J9A A;  2WZN A;  3FX6 A;  1Z2L A;  4K3N A;  4PXE A;  3KL9 A;  1TF8 A;  4MCS A;  3I1U A;  4MHN A;  4C8U A;  4C9U A;  4WWV A;  4P45 A;  4NGP A;  4CPA A;  1Y9Z A;  4P4E A;  3V38 A;  3D7D A;  2G9D A;  5IB9 A;  1QQ9 A;  5HVG A;  4YN3 A;  1YME A;  4C8C A;  5HVF A;  4P4B A;  2PJ8 A;  4ONW A;  3SI0 A;  2BO9 A;  1ELL P;  4KNG E;  3SI1 A;  2XEI A;  4NGM A;  4C9R A;  5LRG A;  4C86 A;  2IMO A;  2Q51 A;  2AFZ A;  5HXD A;  3TX8 A;  3LMS A;  1IY7 A;  4BD9 A;  1ELM P;  1R43 A;  4H2K A;  2PJ9 A;  4MCR A;  3TC8 A;  4F9U A;  2QYV A;  1XJO A;  3B3C A;  3PBB A;  3QNV A;  2GU2 A;  1LAN A;  1TXR A;  3NH8 A;  3IIB A;  4UEF A;  4WJB A;  3V7Z A;  1FNO A;  4RUH A;  3VAR A;  2QVP A;  3GUX A;  2ZEF A;  1XMB A;  3HUV A;  4YWY A;  4MHY A;  4TJV A;  1HEE A;  3NA6 A;  2IJZ A;  1LFW A;  1VGY A;  5K8M A;  4OC0 A;  1WVM A;  1F57 A;  3S9M A;  5JM6 A;  5LYL A;  1TKJ A;  4OIW A;  4A37 A;  5D29 A;  1CP7 A;  2CTC A;  3FH4 A;  3DGV A;  3KQZ A;  4TJX A;  4CDJ A;  2PJ1 A;  4NFR A;  2Q4Z A;  1Z8L A;  3EIF A;  2EWB A;  3SJG A;  2RFH A;  5I4M A;  2I3C A;  1BAV A;  2PJ6 A;  4C8T A;  4C85 A;  2PJB A;  1PCA A;  3ISX A;  2GP4 A;  4UF4 A;  4P4J A;  3FMC A;  4C8P A;  2C6C A;  5THW A;  4P10 A;  2PJ3 A;  1XBU A;  3D66 A;  2V8H A;  3PB7 X;  1VHE A;  3CT9 A;  4NGN A;  2PIY A;  1CP6 A;  3B3T A;  2QJ8 A;  4IHM A;  3FF3 A;  3T8W A;  4A94 A;  4G1P A;  3BXM A;  4MHZ A;  2GRE A;  2C1C A;  4W9Y A;  2EK8 A;  4AXV A;  5LYI A;  2F7V A;  1CPX A;  1CX8 A;  3MN8 A;  5DS0 A;  1YLO A;  4C9E A;  1F2P A;  2POK A;  4ZX9 A;  4FUU A;  8CPA A;  3PB9 X;  4A39 A;  3VH9 A;  1Y7E A;  5JGF A;  1OBR A;  4R8F A;  4C8F A;  3BI1 A;  4EME A;  4MXU A;  3WC6 A;  2ZEN A;  3D7F A;  3LWU A;  4P4I A;  2ANP A;  3RAM A;  5HVH A;  3SJF A;  3B3W A;  5J1Q A;  5D8N A;  4P4D A;  1TKF A;  1YW4 A;  1XF1 A;  3L2N A;  2AFO A;  3IEH A;  2PJC A;  1JQG A;  2AFM A;  3B3V A;  1GYT A;  2ZEE A;  4ZI6 A;  1BPM A;  4TWE A;  3MRU A;  4CDK A;  1PYT B;  3NH5 A;  1Y0Y A;  4X8I A;  4ZY1 A;  3PFE A;  4EWT A;  4IAV A;  2PJ2 A;  1BPN A;  2ZEM A;  4MMO A;  2NSM A;  4PQA A;  3WC7 A;  2GLJ A;  1CBX A;  1AMP A;  2AFU A;  2WYR A;  1NSA A;  4C9V A;  4C99 A;  4C9A A;  2ZEO A;  2ZEG A;  2PJA A;  1ZG7 A;  1IGB A;  4OME A;  3B3S A;  4GM5 A;  4JYW A;  3FVL A;  4FAI A;  2XEG A;  1CPS A;  4KSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...