4NGRA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
689
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 261
structure length 689
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngrA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngrA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngrA02
3PB8X 1DE4C 2Q51A 4IK2A 2ZEDA 4A38A 4DJLA 3FECA 2IJZA 5HVHA 1ARLA 1R3NA 3EIFA 2ANPA 2ZEFA 4FAIA 4UIBA 2F8HA 2HC9A 2NYQA 1GYTA 1PYTB 3S9MA 2PJ0A 3B35A 4A94A 1CX8A 4OC4A 4ZI6A 1NSAA 1IY7A 4PXDA 2V8HA 4MHYA 3PB7X 3PEIA 3B3TA 4C9UA 4AXVA 5J1QA 3PBEA 2PJBA 4UF4A 4OC2A 3NFZA 1F57A 1XMBA 3RAMA 1ZG8A 5LRKA 5ELYA 4ZY1A 2HB6A 1Y7EA 4MHZA 4C85A 7CPAA 4C8FA 4EMEA 3FH4A 3NH8A 1LOKA 1ZLHA 2C6CA 3BI0A 4X2TA 2ZOGA 3B3VA 1CP7A 2XEIA 1DTDA 2PJ7A 4B6ZA 4UEEA 4MCSA 4C8AA 1FT7A 4G1PA 1WVMA 2EK8A 4MCQA 4UEZA 3ICUA 4IHMA 3BHXA 2BCOA 2PIYA 5LRJA 3DLJA 1VHOA 1LANA 3BXMA 3FVLA 4OC5A 3D4UA 3KL9A 2ZEMA 1KWMA 1TF9A 4OMEA 1XRYA 2DEAA 4R76A 2XEGA 3WC6A 2ZOFA 2PE3A 5K8OA 4P4EA 5HVGA 2AFWA 4FBEA 3PRTA 4Z65A 2PJ9A 1LFWA 2FVGA 5HVFA 2ZEHA 1ELLP 4UIAA 4CPAA 2BO9A 2BOAA 2ZELA 1V6CA 4IAVA 1F2OA 3PB6X 3ISZA 4H2KA 2PJAA 3K2KA 1CPSA 1HDQA 4WJBA 4UEFA 1EE3P 4TJXA 5I4MA 2AFZA 3SJFA 4NGRA 2CIJA 2AFOA 2QYVA 3HLPA 3ISXA 5F09A 3D7FA 5CPAA 3RBUA 4OC1A 3NH4A 3D7HA 4NJRA 3I74A 2C6GA 4GM5A 3KQXA 4C9AA 3DGVA 3D7DA 3SI2A 1IGBA 2CTCA 3K9TA 3B2YA 4OC0A 3B7IA 4PXCA 3L2NA 4ZY0A 4LQGA 2CF4A 5HXDA 1OBRA 1TKHA 2V8DA 1BPNA 3SJEA 4DYOA 4KSIA 3NH5A 4F9VA 2VL1A 3GB0A 3B3SA 2C1CA 3GUXA 5DS0A 4MCRA 1R43A 5CBMA 2J9AA 2PJ2A 1RTQA 4TNUA 4K3NA 4ZY2A 4C9RA 2ZEOA 3SI1A 4JYWA 4Q7AA 5THWA 2RB7A 4P6YA 4TWEA 2POKA 3CPXA 3SI0A 2C6PA 2ZENA 2PJCA 3FX6A 3V7ZA 3KQZA 3QNVA 4NGMA 2GLJA 1M4LA 4NGQA 3VARA 3B3WA 1Y0YA 1Y0RA 3FEEA 1BPMA 1BAVA 2RFHA 3FJUA 5LYDA 4P4DA 4C9EA 3MRUA 3FEDA 3PBBA 4NJQA 3SJXA 2ZEPA 2AFSA 3GLJA 4JZ0A 4OP4A 4NGTA 1HDUA 4P4JA 2IMOA 1H8LA 4KNGE 1LAMA 3CPAA 3LMSA 1TKJA 4P44A 3H8EA 1ELMP 2PJ1A 4MRIA 4C99A 2GREA 2V8GA 2OR4A 2O53A 4NFRA 2PJ8A 4YWYA 1YW4A 8CPAA 1LCPA 2QJ8A 3D66A 1ZG7A 4A39A 1BLLE 2EWBA 3IEHA 5IB9A 4C9VA 1XJOA 3WC5A 1Z5RA 1YMEA 2PRQA 4CDKA 4NGSA 2V8VA 1Z8LA 2ZEEA 4MHNA 3WABA 3T8WA 1VHEA 5LYFA 3PB9X 2AFUA 1CPXA 3KR5A 5LRGA 4NGNA 3B3CA 3PB4X 4NGPA 2PVWA 5K8PA 1YLOA 1LAPA 4OIWA 4P10A 3N5FA 5K8NA 2CTBA 4FWUA 2PJ3A 3RZAA 2JBKA 3I1UA 1PCAA 1TKFA 3WT4A 2JBJA 1ZLIA 3KHZA 4BD9A 2G9DA 3LWUA 3D7GA 4MMOA 4PXBA 4F9UA 1Q7LA 2PJ6A 4R8FA 1AYEA 4C8UA 1ZG9A 3KASA 4MHPA 3CDXA 4ZX8A 2QVPA 5JM6A 1XBUA 4OC3A 3IWWA 4ZYQA 1AMPA 1YSJA 3KGQA 4P4FA 3KZWA 3IO1A 4C8TA 3NA6A 3FMCA 3VH9A 4PPZA 4PXEA 1Y9ZA 3KHXA 1QQ9A 1FNOA 4WWVA 2V77A 1QMUA 3TC8A 4P4BA 4YN3A 2I3CA 3PFEA 6CPAA 4C86A 4OKOA 4X8IA 4F8ZA 3CT9A 3D67A 3KI9A 4TJVA 3S9NA 4X3RA 3VTAA 2AFXA 3S9LA 2PVVA 1CG2A 2EK9A 1XFOA 2GLFA 2OOTA 2AFMA 3TX8A 2GU2A 3V38A 2PCUA 3BI1A 2ZEGA 5LYIA 2ABZA 3MN8A 1CBXA 1XF1A 1UWYA 1ARMA 2WZNA 3D68A 3KR4A 4C8CA 3SJGA 3HUVA 1CP6A 4R6TA 4PQAA 2O4HA 5JH9A 4YU9A 1Z2LA 1VGYA 1TF8A 2WYRA 4CDJA 2XEJA 5JGFA 4OIDA 1YW6A 4C84A 4C8PA 3JRUA 3IIBA 5D29A 3IJ3A 1TXRA 4W9YA 2PIZA 2Q4ZA 4ONWA 5LYLA 5K8MA 4EFDA 3PFOA 1F2PA 4EWTA 1HEEA 2PJ5A 4RUHA 4A37A 3IC1A 4P45A 4P4IA 2NSMA 3H8GA 4O23A 2JEWA 4DUKA 4R7MA 2Q43A 4MXUA 4FUUA 5D8NA 1VIXA 3FF3A 3WC7A 2PJ4A 4MCPA 3IFEA 2F7VA 2IQ6A 4ZX9A 3VATA 1JQGA 2XEFA 3H8FA 3I6SA
chains in the Genus database with same CATH superfamily
3PB8X 1DE4C 1TIQA 3OB2B 2Q51A 2PQ8A 5DWMA 4IK2A 2B4BA 2ZEDA 4A38A 4DJLA 3U88C 3FECA 2B5GA 3H4QA 3KRVA 2IJZA 3R9GA 5HVHA 1ARLA 2D0OA 4B12A 1R3NA 3EIFA 5AG7A 2ANPA 3O8ZA 2GANA 2ZEFA 4NCZA 4CYPA 5KTDA 1R61A 4FAIA 4M6GA 1PU9A 2YNCA 4UIBA 2D0PA 2DLAA 5HKZA 2F8HA 2HC9A 5E96A 2NYQA 3S6KA 3EZAA 4COBA 1GYTA 3PZJA 1PYTB 3S9MA 5GCNA 2PJ0A 3B35A 3BLNA 4A94A 2FM4A 4CGNA 3IWGA 4IIYA 1CX8A 4OC4A 4ZI6A 2ARHA 1Q2DA 1NSAA 1IY7A 4PXDA 3TOBA 3D8PA 2V8HA 4MHYA 1CS0B 5AG4A 3PB7X 1IYKA 1XOVA 3PEIA 3B3TA 4C9UA 4AXVA 2D4PA 5J1QA 4BPXB 5F5XA 3PBEA 2PJBA 4UF4A 4A31A 2PR8A 4OC2A 3HPGG 1F57A 1XMBA 3NFZA 1ZG8A 3RAMA 5LRKA 3TLYA 1KZFA 5ELYA 4ZY1A 2AUNA 2HB6A 1Z9EA 1Y7EA 4MHZA 4KUBA 3V8IA 7CPAA 2JEVA 4C85A 4C7IA 1AUGA 1X10A 5H86A 3W91A 4CGOA 3GIUA 4DNCA 4EMEA 3TLEA 3FH4A 1YVKA 3OB1B 1KUXA 3VWEA 2B3UA 3NH8A 3QAHA 2FT0A 4CYNA 2G0BA 2XPLA 1L0CA 1LOKA 2C6CA 3BI0A 1ZLHA 2FS5A 4X2TA 3WR7A 4U9YA 1WWZA 2ZOGA 3IU2A 3B3VA 1CP7A 2XEIA 3P2HA 1QSTA 1DTDA 2PJ7A 4B6ZA 1ZO0A 4KUAA 4UEEA 4MCSA 3OWCA 4NEXA 1JWQA 4C8AA 2Q4YA 2Z11A 2PCNA 1FT7A 4G1PA 1WVMA 4KSAA 1S7FA 1ZL0A 2EK8A 4PK2A 5J8FA 4MCQA 3R9FA 4UEZA 2Z3NA 5IV0A 5ISVA 5JQ4A 4IHMA 1KUYA 3BHXA 1CE8B 2BCOA 2CNTA 2PIYA 3DR6A 4UCNA 5LRJA 1KUVA 4QC6A 3DLJA 4NXYA 4HKFA 1VHOA 1LANA 3BXMA 3CXQA 1M1DA 3FVLA 2P6GA 2OZUA 4OC5A 4AVBA 2VI7A 3D4UA 4BTFA 1CJWA 2EZBA 3S6GA 3KL9A 2ZEMA 1KWMA 1TF9A 2YGWA 3VRRA 4OMEA 4Y49B 3T9YA 4F0YA 1XRYA 1EZAA 2CXAA 2JLMA 2DEAA 4KS9A 4R76A 4UWJA 2XEGA 3PGPA 3WC6A 2ZOFA 4RN7A 2PE3A 3VROA 2ZW5A 1CM0A 5K8OA 1ZYMA 1FBVA 4P4EA 4R57A 5HVGA 2OU2A 4UFWA 5KTAA 3NE7A 2FIAA 2AFWA 2Z3MA 3PRTA 4FBEA 4H89A 3R95A 4Z65A 5F47A 2PJ9A 4KOWA 1PUAA 4CAXA 4FD6A 1S60A 1LFWA 2FVGA 1SQHA 5HVFA 2ZEHA 1ELLP 4UIAA 3JVNA 5C88A 4CPAA 2BO9A 2BOAA 4CRZB 2WPWA 4FD4A 4QBJA 2ZELA 3PT1A 4A2ZA 1V6CA 4IAVA 1XMTA 2XPPA 1NE9A 4CGLA 1F2OA 1XE4A 4B14A 3PB6X 2GE3A 3ISZA 2EVNA 3TLGA 4MFJA 4H2KA 4CS0B 2PJAA 4UA3A 1CPSA 3K2KA 4KOYA 2QIRA 1HDQA 4WJBA 2C27A 3LACA 2BEIA 2FSRA 1EE3P 4UEFA 1RO5A 5G21A 3FNCA 2HROA 1XIXA 3ZZIA 4MI1A 4TJXA 3TLAA 2J8MA 2R8VA 5AG6A 5I4MA 4PSWA 3SXNA 4B5PB 4MY3A 5KTCA 3T0TA 1YREA 2AFZA 3SJFA 5J3XA 5EMIA 4NGRA 1YQEA 4YFJA 2B4JC 2CIJA 2AFOA 1NXJA 4NSQA 4J3GA 2QYVA 3HLPA 4KVXA 4C2XA 1NBWA 3ISXA 5F09A 4CO9A 4XPLA 3D7FA 4HNYB 5CPAA 3EXNA 1V0CA 3RBUA 2K5TA 4K30A 4KVME 4UFVA 4OC1A 1NSLA 3C8OA 5F9MA 4MHDA 2UV8G 2DIKA 4H1HA 3NH4A 4CGMA 3D7HA 2EBJA 4NJRA 4C2YA 3I74A 4EYSA 2C6GA 3D2PA 4GM5A 4OAEA 2MP0A 4B10A 3I9SA 4CAEA 3KQXA 4C9AA 4MI4A 3DGVA 1J4JA 3BUMB 3W6SA 3D7DA 2X7BA 4Y49C 4IUSA 1IGBA 3FB3A 4LX9A 3SI2A 4A95A 2CTCA 5G1ZA 3K9TA 4CYQA 3VARA 4NF1A 3B2YA 4OC0A 3B7IA 1XEBA 4PXCA 2I79A 3L2NA 4LQGA 2CF4A 3R1KA 4A33A 4A32A 4ZY0A 1M4IA 3F5BA 4JD6A 1QSNA 5HXDA 2REFA 4YGOA 3PLFB 4JWPA 3D2MA 1OBRA 1TKHA 4IIXA 2V8DA 1BPNA 3G3SA 3H5ZA 3SJEA 2OZGA 2QMLA 2Z0ZA 4U5YA 1IYLA 4DYOA 4KSIA 3VGOA 2FXFA 3NH5A 4ORFA 4ZGYB 1YLEA 2B3VA 4RR2B 5H84A 5I0CA 4F9VA 4E94A 2VL1A 3GB0A 3B3SA 2C1CA 2CNMA 3GUXA 5DS0A 4MCRA 5FD8A 4AG9A 3T07A 3EY5A 1R43A 5CBMA 1M4GA 2OLSA 2J9AA 3IWEA 2PJ2A 4M3SA 1RTQA 2AJ6A 4TNUA 1KC7A 3BUNB 4K3NA 2HI6A 3F0AA 1B87A 1U6MA 4ZY2A 4C9RA 2ZEOA 3SI1A 4JYWA 4C7HA 4Q7AA 5THWA 4KOSA 2RB7A 2AE6A 3CZXA 4P6YA 4TWEA 4E2AA 4INJA 2POKA 4X5KA 5HMNA 3CPXA 2OZHA 3SI0A 4KOVA 1P0HA 2C6PA 2XPOA 2HUZA 2Q7SA 2ZENA 2CY2A 2PJCA 4M8DA 5IR2A 3FX6A 3V7ZA 5HKYA 2YNDA 3KQZA 1Z4EA 3G8WA 3QNVA 2DPSA 4NGMA 2EO8A 1B6BA 1M4LA 1BOBA 4NGQA 2GLJA 1BO4A 2J8RA 2O28A 1I21A 3FIXA 3B3WA 4HNXB 1VKCA 1X12A 1IIDA 4XPDB 2Z3OA 3TCVA 1Y0YA 1Y0RA 3FEEA 1BPMA 4F0XA 1BAVA 2RFHA 2R1IA 3FJUA 4XNHB 2Q4VA 4YRHA 5LYDA 3TLCA 3IGRA 4P4DA 4L8AA 4C9EA 3MRUA 4CGPA 3RNZA 5IB0A 3FEDA 1ZRSA 3PBBA 2E28A 4NJQA 3NE8A 3T90A 2B4DA 3SJXA 2Z3PA 2ZEPA 4KOUA 3TT2A 2AFSA 2H5MA 3T05A 3GLJA 4JZ0A 1YGHA 3JUWA 4OP4A 4NGTA 2ATRA 1HDUA 4P4JA 3E0KA 4MJ8A 2IMOA 4BMHA 3DSBA 2G3AA 1M44A 3HPHE 1WK4A 1H8LA 2Z3KA 2PR1A 2ZXVA 4KNGE 3F9KC 1LAMA 1A2ZA 3CPAA 3LMSA 1A9XB 1TKJA 4ZBGA 4B13A 2EZAA 4P44A 3S6FA 5BY0A 3H8EA 2ODFA 1ELMP 4COGA 2PJ1A 2Q0YA 4MRIA 3IU1A 2VZZA 4C99A 2GREA 2V8GA 2OR4A 2N3AB 2OB0A 2PC1A 4JJXA 4QUSA 2VQYA 3TTHA 2O53A 1Y7RA 2Q7BA 1XF8A 4NFRA 2PJ8A 4JXQA 4YWYA 1YW4A 2ZW6A 8CPAA 3C26A 3KKWA 2C5QA 1LCPA 2QJ8A 3OP0A 2RC4A 3D66A 1ZG7A 4A39A 1BLLE 2EWBA 3IEHA 3W6XA 5IB9A 4C9VA 1XJOA 3WC5A 3ZJ0A 1Z5RA 3FRMA 3VWDA 4KZTA 5AXIA 1YMEA 2Y0MA 4MFLA 4KLWA 3TLGB 2NMTA 2PRQA 1VI4A 4CDKA 5G22A 4NGSA 2GIVA 1YVOA 2V8VA 4Q38A 1Z8LA 2ZEEA 3CXSA 4KOXA 4MHNA 4QVTA 5EBVA 2B0AA 3WABA 3T8WA 5AG5A 4KSFA 1QSOA 1VHEA 2DF5A 5LYFA 1P4NA 1VBGA 3G23A 3PB9X 2AFUA 2REEA 1CPXA 2EUIA 3KR5A 4MFPA 4NGNA 3B3CA 3GKRA 5LRGA 3BUWB 5JVLA 3PB4X 2WSAA 4NGPA 2PVWA 4RI1A 2VEZA 4XPDC 5K8PA 1JDBC 1YLOA 4B5OA 1J3LA 3EC4A 1LAPA 4MY0A 4PV6A 2ZPAA 4OIWA 4BBHA 3TO7A 1B47A 4P10A 3N5FA 4CYOA 5K8NA 4PK3A 2CTBA 2VKZG 4FWUA 3EZBA 2G3TA 2PJ3A 4UWIA 4MJXA 3RZAA 2JBKA 2J8NA 3I1UA 3GY9A 3SR3A 2PSWA 4IF5A 4E8OA 1PCAA 4F6AA 2VZYA 1TKFA 3WT4A 3VRQA 2JBJA 1ZLIA 3KHZA 3BUXB 1RXTA 2G9DA 3BJ8A 3LWUA 1R57A 4L89A 4BD9A 5JPHA 3GJZA 3D7GA 1IOFA 5K99A 1IU8A 1Z8WA 2DXQA 4CRYB 5A28A 3T5MA 4MMOA 1Z9UA 4PXBA 5JYBA 4Q36A 2B5GB 4H6ZA 4JVOA 5G20A 4F9UA 1IB1E 1IOIA 2X0SA 3TO9A 4MFZA 4E0AA 2QECA 2HQYA 3QB8A 1QSRA 4E5SA 4A4CA 1Q7LA 3N7ZA 2PJ6A 4R8FA 2DPTA 1AYEA 4C8UA 1ZG9A 1M6VB 3KASA 1YR0A 3MGDA 4UFXA 2PRBA 4GS4A 4MHPA 3VRNA 1JDEA 2EZCA 1I12A 1C30B 4GXHA 3BJ7A 3CDXA 4ZX8A 5FVJA 2QVPA 5JM6A 5F1YA 1MK4A 3CXPA 5F48A 2ZW4A 4MFQA 4UCPA 3FBUA 3SHPA 3UY5A 4CAFA 1XBUA 4OC3A 3HMJG 3IWWA 3LODA 4C2ZA 1UFHA 1KEEB 1OZPA 4ZYQA 1AMPA 3P2FA 4R87A 1YSJA 3KGQA 3F8KA 1Z4RA 4P4FA 5F46A 2YJVA 3KZWA 4KVOE 5C82A 2BUEA 2GFQA 3R96A 4CAWA 3IO1A 4A30A 3B8GA 3DNSA 4C8TA 3TO6A 2FIWA 3NA6A 3GYAA 3FMCA 3VH9A 1GGOA 3EFAA 4PPZA 4AVAA 1I1DA 4GPLB 2JDCA 2OH1A 4PXEA 3PP9A 5EC4A 1Y9ZA 3KHXA 1QQ9A 3TLZA 2IL4A 1FNOA 3LD2A 4WWVA 5HKWA 1QSMA 2V77A 4JLYA 1QMUA 3TC8A 4P4BA 4YN3A 2I3CA 4AB7A 4CZ1A 3PFEA 5F13A 4C68A 6CPAA 4U9ZA 4M85A 4KOTA 4C86A 1Z8XA 2YNEA 1Z8TA 2ZW7A 2B4DB 3FYNA 2VXKA 3DDDA 4OKOA 4X8IA 4AG7A 4F8ZA 4C8FA 3CT9A 4UCMA 3D3SA 1K4JA 3D67A 3KI9A 4H6UA 4I49A 4ONUA 4II9A 4TJVA 3S9NA 4X3RA 3JTKA 4LQ6A 2YNCC 3VTAA 2AFXA 3S9LA 5HH1A 2P0WA 3EO4A 5DWNA 2PVVA 1CG2A 2EK9A 1Q2CA 1XFOA 2GLFA 4FD7A 3EZEA 2R82A 2OOTA 2AFMA 1MJ9A 3TLBA 3TFYA 2PDOA 3K4IA 4KLVA 3TYXA 3TX8A 1S7KA 1IICA 2GU2A 3BUOB 4HPSA 2PCUA 3V38A 1C3OB 2VBQA 3BI1A 4M6IA 3NFQA 2D4OA 2ZEGA 5LYIA 1KBLA 4BPWB 3K9UA 5J8CA 2ABZA 2P6EA 3MN8A 1CBXA 5CNPA 1UWYA 1XF1A 3VRPA 1EO0A 4BPUB 1ARMA 3QAYA 3TE4A 2WZNA 2Q04A 3D68A 3KR4A 5BWAB 4C8CA 1Q2YA 4J0NA 2F5IA 3SJGA 2HV2A 2BL1A 5A27A 1DIKA 4CAVA 1GHEA 1CP6A 3HUVA 4HNWB 4R6TA 4PQAA 2Y1MA 2O4HA 4LUAA 4EVYA 1Q5XA 1FY7A 3A9LA 2R98A 1ON0A 5JH9A 1VHSA 4KORA 2FCKA 1NMTA 2Z3LA 4YU9A 1BXRB 1MJAA 4BINA 1Z2LA 1VGYA 3OAKA 1TF8A 3RO0A 1Y9WA 4R3LA 4RS2A 2WYRA 2GP4A 4CDJA 2XEJA 2XPNA 2B58A 5JGFA 1MJBA 4OIDA 1YW6A 2A4NA 5IX3A 1M4DA 4C84A 3ZNIA 1EZBA 4M6HA 4C8PA 3JRUA 3IIBA 4AVCA 2YJTA 1WJTA 5D29A 2BSWA 1N71A 3IJ3A 4FD5A 1TXRA 4XNHC 4W9YA 2PIZA 2AUMA 2Q4ZA 4ONWA 1S7LA 2HWGA 5LYLA 3NOJA 3U1BA 5K8MA 1YX0A 2JDDA 5F49A 4EFDA 1T36B 4R3KA 3PFOA 1F2PA 2Z10A 4EWTA 2I00A 3RYOA 1HEEA 4OADA 3SXOA 1YK3A 2PJ5A 3S6HA 4MBUA 4RUHA 1Y9KA 4UBRA 2WPXA 2FL4A 4OLLA 2P6FA 2Y1NA 1LRZA 2R7HA 4A37A 3ICUA 3IC1A 4P45A 4P4IA 4A4BA 2FE7A 2NSMA 4B11A 3H8GA 1S5KA 4QB9A 3I3GA 4O23A 2JEWA 4DUKA 5AGEA 4R7MA 4B5PA 4R9MA 2Q43A 4MXUA 3R9EA 2WUUA 2KCWA 3FXTA 2CNSA 4PSXA 3TOAA 4MFKA 4FUUA 5D8NA 1VIXA 3FF3A 3WC7A 2PJ4A 4MCPA 3IFEA 2CBLA 2F7VA 2IQ6A 4ZX9A 3VATA 1JQGA 1YVHA 4XPKA 1S7NA 4JXRA 2XEFA 2Q44A 3H8FA 3DR8A 1VBHA 1S3ZA 3I6SA 3PFVA
chains in the Genus database with same CATH topology
3PB8X 1DE4C 2Q51A 4IK2A 2ZEDA 4A38A 4DJLA 3FECA 2IJZA 5HVHA 1ARLA 1R3NA 3EIFA 2ANPA 2ZEFA 4FAIA 4UIBA 2F8HA 2HC9A 2NYQA 1GYTA 1PYTB 3S9MA 2PJ0A 3B35A 4A94A 1CX8A 4OC4A 4ZI6A 1NSAA 1IY7A 4PXDA 2V8HA 4MHYA 3PB7X 3PEIA 3B3TA 4C9UA 4AXVA 5J1QA 3PBEA 2PJBA 4UF4A 4OC2A 3NFZA 1F57A 1XMBA 3RAMA 1ZG8A 5LRKA 5ELYA 4ZY1A 2HB6A 1Y7EA 4MHZA 4C85A 7CPAA 4C8FA 4EMEA 3FH4A 3NH8A 1LOKA 1ZLHA 2C6CA 3BI0A 4X2TA 2GP4A 2ZOGA 3B3VA 1CP7A 2XEIA 1DTDA 2PJ7A 4B6ZA 4UEEA 4MCSA 4C8AA 1FT7A 4G1PA 1WVMA 2EK8A 4MCQA 4UEZA 3ICUA 4IHMA 3BHXA 2BCOA 2PIYA 5LRJA 3DLJA 1VHOA 1LANA 3BXMA 3FVLA 4OC5A 3D4UA 3KL9A 2ZEMA 1KWMA 1TF9A 4OMEA 1XRYA 2DEAA 4R76A 2XEGA 3WC6A 2ZOFA 2PE3A 5K8OA 4P4EA 5HVGA 2AFWA 4FBEA 3PRTA 4Z65A 2PJ9A 1LFWA 2FVGA 5HVFA 2ZEHA 1ELLP 4UIAA 4CPAA 2BO9A 2BOAA 2ZELA 1V6CA 4IAVA 1F2OA 3PB6X 3ISZA 4H2KA 2PJAA 3K2KA 1CPSA 1HDQA 4WJBA 4UEFA 1EE3P 4TJXA 5I4MA 2AFZA 3SJFA 4NGRA 2CIJA 2AFOA 2QYVA 3HLPA 3ISXA 5F09A 3D7FA 5CPAA 3RBUA 4OC1A 3NH4A 3D7HA 4NJRA 3I74A 2C6GA 4GM5A 3KQXA 4C9AA 3DGVA 3D7DA 3SI2A 1IGBA 2CTCA 3K9TA 3B2YA 4OC0A 3B7IA 4PXCA 3L2NA 4ZY0A 4LQGA 2CF4A 5HXDA 1OBRA 1TKHA 2V8DA 1BPNA 3SJEA 4DYOA 4KSIA 3NH5A 4F9VA 2VL1A 3GB0A 3B3SA 2C1CA 3GUXA 5DS0A 4MCRA 1R43A 5CBMA 2J9AA 2PJ2A 1RTQA 4TNUA 4K3NA 4ZY2A 4C9RA 2ZEOA 3SI1A 4JYWA 4Q7AA 5THWA 2RB7A 4P6YA 4TWEA 2POKA 3CPXA 3SI0A 2C6PA 5IR2A 2ZENA 2PJCA 3FX6A 3V7ZA 3KQZA 3QNVA 4NGMA 2GLJA 1M4LA 4NGQA 3VARA 3B3WA 1Y0YA 1Y0RA 3FEEA 1BPMA 1BAVA 2RFHA 3FJUA 5LYDA 4P4DA 4C9EA 3MRUA 3FEDA 3PBBA 4NJQA 3SJXA 2ZEPA 2AFSA 3GLJA 4JZ0A 4OP4A 4NGTA 1HDUA 4P4JA 2IMOA 1H8LA 4KNGE 1LAMA 3CPAA 3LMSA 1TKJA 4P44A 3H8EA 1ELMP 2PJ1A 4MRIA 4C99A 2GREA 2V8GA 2OR4A 2O53A 4NFRA 2PJ8A 4YWYA 1YW4A 8CPAA 2C5QA 1LCPA 2QJ8A 3D66A 1ZG7A 4A39A 1BLLE 2EWBA 3IEHA 5IB9A 4C9VA 1XJOA 3WC5A 1Z5RA 1YMEA 2PRQA 4CDKA 4NGSA 2V8VA 1Z8LA 2ZEEA 4MHNA 3WABA 3T8WA 1VHEA 5LYFA 3PB9X 2AFUA 1CPXA 3KR5A 5LRGA 4NGNA 3B3CA 3PB4X 4NGPA 2PVWA 5K8PA 1YLOA 1LAPA 4OIWA 4P10A 3N5FA 5K8NA 2CTBA 4FWUA 2PJ3A 3RZAA 2JBKA 3I1UA 1PCAA 1TKFA 3WT4A 2JBJA 1ZLIA 3KHZA 4BD9A 2G9DA 3LWUA 3D7GA 4MMOA 4PXBA 4F9UA 1Q7LA 2PJ6A 4R8FA 1AYEA 4C8UA 1ZG9A 3KASA 4MHPA 3CDXA 4ZX8A 2QVPA 5JM6A 1XBUA 4OC3A 3IWWA 4ZYQA 1AMPA 1YSJA 3KGQA 4P4FA 3KZWA 3IO1A 4C8TA 3NA6A 3FMCA 3VH9A 4PPZA 4PXEA 1Y9ZA 3KHXA 1QQ9A 1FNOA 4WWVA 2V77A 1QMUA 3TC8A 4P4BA 4YN3A 2I3CA 3PFEA 6CPAA 4C86A 4OKOA 4X8IA 4F8ZA 3CT9A 3D67A 3KI9A 4TJVA 3S9NA 4X3RA 3VTAA 2AFXA 3S9LA 2PVVA 1CG2A 2EK9A 1XFOA 2GLFA 2OOTA 2AFMA 3TX8A 2GU2A 3V38A 2PCUA 3BI1A 2ZEGA 5LYIA 2ABZA 3MN8A 1CBXA 1XF1A 1UWYA 1ARMA 2WZNA 3D68A 3KR4A 4C8CA 3SJGA 3HUVA 1CP6A 4R6TA 4PQAA 2O4HA 5JH9A 4YU9A 1Z2LA 1VGYA 1TF8A 2WYRA 4CDJA 2XEJA 5JGFA 4OIDA 1YW6A 4C84A 4C8PA 3JRUA 3IIBA 5D29A 3IJ3A 1TXRA 4W9YA 2PIZA 2Q4ZA 4ONWA 5LYLA 5K8MA 4EFDA 3PFOA 1F2PA 4EWTA 1HEEA 2PJ5A 4RUHA 4A37A 3IC1A 4P45A 4P4IA 2NSMA 3H8GA 4O23A 2JEWA 4DUKA 4R7MA 2Q43A 4MXUA 4FUUA 5D8NA 1VIXA 3FF3A 3WC7A 2PJ4A 4MCPA 3IFEA 2F7VA 2IQ6A 4ZX9A 3VATA 1JQGA 2XEFA 3H8FA 3I6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PB8 X;  1DE4 C;  2Q51 A;  4IK2 A;  2ZED A;  4A38 A;  4DJL A;  3FEC A;  2IJZ A;  5HVH A;  1ARL A;  1R3N A;  3EIF A;  2ANP A;  2ZEF A;  4FAI A;  4UIB A;  2F8H A;  2HC9 A;  2NYQ A;  1GYT A;  1PYT B;  3S9M A;  2PJ0 A;  3B35 A;  4A94 A;  1CX8 A;  4OC4 A;  4ZI6 A;  1NSA A;  1IY7 A;  4PXD A;  2V8H A;  4MHY A;  3PB7 X;  3PEI A;  3B3T A;  4C9U A;  4AXV A;  5J1Q A;  3PBE A;  2PJB A;  4UF4 A;  4OC2 A;  3NFZ A;  1F57 A;  1XMB A;  3RAM A;  1ZG8 A;  5LRK A;  5ELY A;  4ZY1 A;  2HB6 A;  1Y7E A;  4MHZ A;  4C85 A;  7CPA A;  4C8F A;  4EME A;  3FH4 A;  3NH8 A;  1LOK A;  1ZLH A;  2C6C A;  3BI0 A;  4X2T A;  2ZOG A;  3B3V A;  1CP7 A;  2XEI A;  1DTD A;  2PJ7 A;  4B6Z A;  4UEE A;  4MCS A;  4C8A A;  1FT7 A;  4G1P A;  1WVM A;  2EK8 A;  4MCQ A;  4UEZ A;  3ICU A;  4IHM A;  3BHX A;  2BCO A;  2PIY A;  5LRJ A;  3DLJ A;  1VHO A;  1LAN A;  3BXM A;  3FVL A;  4OC5 A;  3D4U A;  3KL9 A;  2ZEM A;  1KWM A;  1TF9 A;  4OME A;  1XRY A;  2DEA A;  4R76 A;  2XEG A;  3WC6 A;  2ZOF A;  2PE3 A;  5K8O A;  4P4E A;  5HVG A;  2AFW A;  4FBE A;  3PRT A;  4Z65 A;  2PJ9 A;  1LFW A;  2FVG A;  5HVF A;  2ZEH A;  1ELL P;  4UIA A;  4CPA A;  2BO9 A;  2BOA A;  2ZEL A;  1V6C A;  4IAV A;  1F2O A;  3PB6 X;  3ISZ A;  4H2K A;  2PJA A;  3K2K A;  1CPS A;  1HDQ A;  4WJB A;  4UEF A;  1EE3 P;  4TJX A;  5I4M A;  2AFZ A;  3SJF A;  4NGR A;  2CIJ A;  2AFO A;  2QYV A;  3HLP A;  3ISX A;  5F09 A;  3D7F A;  5CPA A;  3RBU A;  4OC1 A;  3NH4 A;  3D7H A;  4NJR A;  3I74 A;  2C6G A;  4GM5 A;  3KQX A;  4C9A A;  3DGV A;  3D7D A;  3SI2 A;  1IGB A;  2CTC A;  3K9T A;  3B2Y A;  4OC0 A;  3B7I A;  4PXC A;  3L2N A;  4ZY0 A;  4LQG A;  2CF4 A;  5HXD A;  1OBR A;  1TKH A;  2V8D A;  1BPN A;  3SJE A;  4DYO A;  4KSI A;  3NH5 A;  4F9V A;  2VL1 A;  3GB0 A;  3B3S A;  2C1C A;  3GUX A;  5DS0 A;  4MCR A;  1R43 A;  5CBM A;  2J9A A;  2PJ2 A;  1RTQ A;  4TNU A;  4K3N A;  4ZY2 A;  4C9R A;  2ZEO A;  3SI1 A;  4JYW A;  4Q7A A;  5THW A;  2RB7 A;  4P6Y A;  4TWE A;  2POK A;  3CPX A;  3SI0 A;  2C6P A;  2ZEN A;  2PJC A;  3FX6 A;  3V7Z A;  3KQZ A;  3QNV A;  4NGM A;  2GLJ A;  1M4L A;  4NGQ A;  3VAR A;  3B3W A;  1Y0Y A;  1Y0R A;  3FEE A;  1BPM A;  1BAV A;  2RFH A;  3FJU A;  5LYD A;  4P4D A;  4C9E A;  3MRU A;  3FED A;  3PBB A;  4NJQ A;  3SJX A;  2ZEP A;  2AFS A;  3GLJ A;  4JZ0 A;  4OP4 A;  4NGT A;  1HDU A;  4P4J A;  2IMO A;  1H8L A;  4KNG E;  1LAM A;  3CPA A;  3LMS A;  1TKJ A;  4P44 A;  3H8E A;  1ELM P;  2PJ1 A;  4MRI A;  4C99 A;  2GRE A;  2V8G A;  2OR4 A;  2O53 A;  4NFR A;  2PJ8 A;  4YWY A;  1YW4 A;  8CPA A;  1LCP A;  2QJ8 A;  3D66 A;  1ZG7 A;  4A39 A;  1BLL E;  2EWB A;  3IEH A;  5IB9 A;  4C9V A;  1XJO A;  3WC5 A;  1Z5R A;  1YME A;  2PRQ A;  4CDK A;  4NGS A;  2V8V A;  1Z8L A;  2ZEE A;  4MHN A;  3WAB A;  3T8W A;  1VHE A;  5LYF A;  3PB9 X;  2AFU A;  1CPX A;  3KR5 A;  5LRG A;  4NGN A;  3B3C A;  3PB4 X;  4NGP A;  2PVW A;  5K8P A;  1YLO A;  1LAP A;  4OIW A;  4P10 A;  3N5F A;  5K8N A;  2CTB A;  4FWU A;  2PJ3 A;  3RZA A;  2JBK A;  3I1U A;  1PCA A;  1TKF A;  3WT4 A;  2JBJ A;  1ZLI A;  3KHZ A;  4BD9 A;  2G9D A;  3LWU A;  3D7G A;  4MMO A;  4PXB A;  4F9U A;  1Q7L A;  2PJ6 A;  4R8F A;  1AYE A;  4C8U A;  1ZG9 A;  3KAS A;  4MHP A;  3CDX A;  4ZX8 A;  2QVP A;  5JM6 A;  1XBU A;  4OC3 A;  3IWW A;  4ZYQ A;  1AMP A;  1YSJ A;  3KGQ A;  4P4F A;  3KZW A;  3IO1 A;  4C8T A;  3NA6 A;  3FMC A;  3VH9 A;  4PPZ A;  4PXE A;  1Y9Z A;  3KHX A;  1QQ9 A;  1FNO A;  4WWV A;  2V77 A;  1QMU A;  3TC8 A;  4P4B A;  4YN3 A;  2I3C A;  3PFE A;  6CPA A;  4C86 A;  4OKO A;  4X8I A;  4F8Z A;  3CT9 A;  3D67 A;  3KI9 A;  4TJV A;  3S9N A;  4X3R A;  3VTA A;  2AFX A;  3S9L A;  2PVV A;  1CG2 A;  2EK9 A;  1XFO A;  2GLF A;  2OOT A;  2AFM A;  3TX8 A;  2GU2 A;  3V38 A;  2PCU A;  3BI1 A;  2ZEG A;  5LYI A;  2ABZ A;  3MN8 A;  1CBX A;  1XF1 A;  1UWY A;  1ARM A;  2WZN A;  3D68 A;  3KR4 A;  4C8C A;  3SJG A;  3HUV A;  1CP6 A;  4R6T A;  4PQA A;  2O4H A;  5JH9 A;  4YU9 A;  1Z2L A;  1VGY A;  1TF8 A;  2WYR A;  4CDJ A;  2XEJ A;  5JGF A;  4OID A;  1YW6 A;  4C84 A;  4C8P A;  3JRU A;  3IIB A;  5D29 A;  3IJ3 A;  1TXR A;  4W9Y A;  2PIZ A;  2Q4Z A;  4ONW A;  5LYL A;  5K8M A;  4EFD A;  3PFO A;  1F2P A;  4EWT A;  1HEE A;  2PJ5 A;  4RUH A;  4A37 A;  3IC1 A;  4P45 A;  4P4I A;  2NSM A;  3H8G A;  4O23 A;  2JEW A;  4DUK A;  4R7M A;  2Q43 A;  4MXU A;  4FUU A;  5D8N A;  1VIX A;  3FF3 A;  3WC7 A;  2PJ4 A;  4MCP A;  3IFE A;  2F7V A;  2IQ6 A;  4ZX9 A;  3VAT A;  1JQG A;  2XEF A;  3H8F A;  3I6S A; 
#chains in the Genus database with same CATH topology
 3PB8 X;  1DE4 C;  1TIQ A;  3OB2 B;  2Q51 A;  2PQ8 A;  5DWM A;  4IK2 A;  2B4B A;  2ZED A;  4A38 A;  4DJL A;  3U88 C;  3FEC A;  2B5G A;  3H4Q A;  3KRV A;  2IJZ A;  3R9G A;  5HVH A;  1ARL A;  2D0O A;  4B12 A;  1R3N A;  3EIF A;  5AG7 A;  2ANP A;  3O8Z A;  2GAN A;  2ZEF A;  4NCZ A;  4CYP A;  5KTD A;  1R61 A;  4FAI A;  4M6G A;  1PU9 A;  2YNC A;  4UIB A;  2D0P A;  2DLA A;  5HKZ A;  2F8H A;  2HC9 A;  5E96 A;  2NYQ A;  3S6K A;  3EZA A;  4COB A;  1GYT A;  3PZJ A;  1PYT B;  3S9M A;  5GCN A;  2PJ0 A;  3B35 A;  3BLN A;  4A94 A;  2FM4 A;  4CGN A;  3IWG A;  4IIY A;  1CX8 A;  4OC4 A;  4ZI6 A;  2ARH A;  1Q2D A;  1NSA A;  1IY7 A;  4PXD A;  3TOB A;  3D8P A;  2V8H A;  4MHY A;  1CS0 B;  5AG4 A;  3PB7 X;  1IYK A;  1XOV A;  3PEI A;  3B3T A;  4C9U A;  4AXV A;  2D4P A;  5J1Q A;  4BPX B;  5F5X A;  3PBE A;  2PJB A;  4UF4 A;  4A31 A;  2PR8 A;  4OC2 A;  3HPG G;  1F57 A;  1XMB A;  3NFZ A;  1ZG8 A;  3RAM A;  5LRK A;  3TLY A;  1KZF A;  5ELY A;  4ZY1 A;  2AUN A;  2HB6 A;  1Z9E A;  1Y7E A;  4MHZ A;  4KUB A;  3V8I A;  7CPA A;  2JEV A;  4C85 A;  4C7I A;  1AUG A;  1X10 A;  5H86 A;  3W91 A;  4CGO A;  3GIU A;  4DNC A;  4EME A;  3TLE A;  3FH4 A;  1YVK A;  3OB1 B;  1KUX A;  3VWE A;  2B3U A;  3NH8 A;  3QAH A;  2FT0 A;  4CYN A;  2G0B A;  2XPL A;  1L0C A;  1LOK A;  2C6C A;  3BI0 A;  1ZLH A;  2FS5 A;  4X2T A;  3WR7 A;  4U9Y A;  1WWZ A;  2ZOG A;  3IU2 A;  3B3V A;  1CP7 A;  2XEI A;  3P2H A;  1QST A;  1DTD A;  2PJ7 A;  4B6Z A;  1ZO0 A;  4KUA A;  4UEE A;  4MCS A;  3OWC A;  4NEX A;  1JWQ A;  4C8A A;  2Q4Y A;  2Z11 A;  2PCN A;  1FT7 A;  4G1P A;  1WVM A;  4KSA A;  1S7F A;  1ZL0 A;  2EK8 A;  4PK2 A;  5J8F A;  4MCQ A;  3R9F A;  4UEZ A;  2Z3N A;  5IV0 A;  5ISV A;  5JQ4 A;  4IHM A;  1KUY A;  3BHX A;  1CE8 B;  2BCO A;  2CNT A;  2PIY A;  3DR6 A;  4UCN A;  5LRJ A;  1KUV A;  4QC6 A;  3DLJ A;  4NXY A;  4HKF A;  1VHO A;  1LAN A;  3BXM A;  3CXQ A;  1M1D A;  3FVL A;  2P6G A;  2OZU A;  4OC5 A;  4AVB A;  2VI7 A;  3D4U A;  4BTF A;  1CJW A;  2EZB A;  3S6G A;  3KL9 A;  2ZEM A;  1KWM A;  1TF9 A;  2YGW A;  3VRR A;  4OME A;  4Y49 B;  3T9Y A;  4F0Y A;  1XRY A;  1EZA A;  2CXA A;  2JLM A;  2DEA A;  4KS9 A;  4R76 A;  4UWJ A;  2XEG A;  3PGP A;  3WC6 A;  2ZOF A;  4RN7 A;  2PE3 A;  3VRO A;  2ZW5 A;  1CM0 A;  5K8O A;  1ZYM A;  1FBV A;  4P4E A;  4R57 A;  5HVG A;  2OU2 A;  4UFW A;  5KTA A;  3NE7 A;  2FIA A;  2AFW A;  2Z3M A;  3PRT A;  4FBE A;  4H89 A;  3R95 A;  4Z65 A;  5F47 A;  2PJ9 A;  4KOW A;  1PUA A;  4CAX A;  4FD6 A;  1S60 A;  1LFW A;  2FVG A;  1SQH A;  5HVF A;  2ZEH A;  1ELL P;  4UIA A;  3JVN A;  5C88 A;  4CPA A;  2BO9 A;  2BOA A;  4CRZ B;  2WPW A;  4FD4 A;  4QBJ A;  2ZEL A;  3PT1 A;  4A2Z A;  1V6C A;  4IAV A;  1XMT A;  2XPP A;  1NE9 A;  4CGL A;  1F2O A;  1XE4 A;  4B14 A;  3PB6 X;  2GE3 A;  3ISZ A;  2EVN A;  3TLG A;  4MFJ A;  4H2K A;  4CS0 B;  2PJA A;  4UA3 A;  1CPS A;  3K2K A;  4KOY A;  2QIR A;  1HDQ A;  4WJB A;  2C27 A;  3LAC A;  2BEI A;  2FSR A;  1EE3 P;  4UEF A;  1RO5 A;  5G21 A;  3FNC A;  2HRO A;  1XIX A;  3ZZI A;  4MI1 A;  4TJX A;  3TLA A;  2J8M A;  2R8V A;  5AG6 A;  5I4M A;  4PSW A;  3SXN A;  4B5P B;  4MY3 A;  5KTC A;  3T0T A;  1YRE A;  2AFZ A;  3SJF A;  5J3X A;  5EMI A;  4NGR A;  1YQE A;  4YFJ A;  2B4J C;  2CIJ A;  2AFO A;  1NXJ A;  4NSQ A;  4J3G A;  2QYV A;  3HLP A;  4KVX A;  4C2X A;  1NBW A;  3ISX A;  5F09 A;  4CO9 A;  4XPL A;  3D7F A;  4HNY B;  5CPA A;  3EXN A;  1V0C A;  3RBU A;  2K5T A;  4K30 A;  4KVM E;  4UFV A;  4OC1 A;  1NSL A;  3C8O A;  5F9M A;  4MHD A;  2UV8 G;  2DIK A;  4H1H A;  3NH4 A;  4CGM A;  3D7H A;  2EBJ A;  4NJR A;  4C2Y A;  3I74 A;  4EYS A;  2C6G A;  3D2P A;  4GM5 A;  4OAE A;  2MP0 A;  4B10 A;  3I9S A;  4CAE A;  3KQX A;  4C9A A;  4MI4 A;  3DGV A;  1J4J A;  3BUM B;  3W6S A;  3D7D A;  2X7B A;  4Y49 C;  4IUS A;  1IGB A;  3FB3 A;  4LX9 A;  3SI2 A;  4A95 A;  2CTC A;  5G1Z A;  3K9T A;  4CYQ A;  3VAR A;  4NF1 A;  3B2Y A;  4OC0 A;  3B7I A;  1XEB A;  4PXC A;  2I79 A;  3L2N A;  4LQG A;  2CF4 A;  3R1K A;  4A33 A;  4A32 A;  4ZY0 A;  1M4I A;  3F5B A;  4JD6 A;  1QSN A;  5HXD A;  2REF A;  4YGO A;  3PLF B;  4JWP A;  3D2M A;  1OBR A;  1TKH A;  4IIX A;  2V8D A;  1BPN A;  3G3S A;  3H5Z A;  3SJE A;  2OZG A;  2QML A;  2Z0Z A;  4U5Y A;  1IYL A;  4DYO A;  4KSI A;  3VGO A;  2FXF A;  3NH5 A;  4ORF A;  4ZGY B;  1YLE A;  2B3V A;  4RR2 B;  5H84 A;  5I0C A;  4F9V A;  4E94 A;  2VL1 A;  3GB0 A;  3B3S A;  2C1C A;  2CNM A;  3GUX A;  5DS0 A;  4MCR A;  5FD8 A;  4AG9 A;  3T07 A;  3EY5 A;  1R43 A;  5CBM A;  1M4G A;  2OLS A;  2J9A A;  3IWE A;  2PJ2 A;  4M3S A;  1RTQ A;  2AJ6 A;  4TNU A;  1KC7 A;  3BUN B;  4K3N A;  2HI6 A;  3F0A A;  1B87 A;  1U6M A;  4ZY2 A;  4C9R A;  2ZEO A;  3SI1 A;  4JYW A;  4C7H A;  4Q7A A;  5THW A;  4KOS A;  2RB7 A;  2AE6 A;  3CZX A;  4P6Y A;  4TWE A;  4E2A A;  4INJ A;  2POK A;  4X5K A;  5HMN A;  3CPX A;  2OZH A;  3SI0 A;  4KOV A;  1P0H A;  2C6P A;  2XPO A;  2HUZ A;  2Q7S A;  2ZEN A;  2CY2 A;  2PJC A;  4M8D A;  5IR2 A;  3FX6 A;  3V7Z A;  5HKY A;  2YND A;  3KQZ A;  1Z4E A;  3G8W A;  3QNV A;  2DPS A;  4NGM A;  2EO8 A;  1B6B A;  1M4L A;  1BOB A;  4NGQ A;  2GLJ A;  1BO4 A;  2J8R A;  2O28 A;  1I21 A;  3FIX A;  3B3W A;  4HNX B;  1VKC A;  1X12 A;  1IID A;  4XPD B;  2Z3O A;  3TCV A;  1Y0Y A;  1Y0R A;  3FEE A;  1BPM A;  4F0X A;  1BAV A;  2RFH A;  2R1I A;  3FJU A;  4XNH B;  2Q4V A;  4YRH A;  5LYD A;  3TLC A;  3IGR A;  4P4D A;  4L8A A;  4C9E A;  3MRU A;  4CGP A;  3RNZ A;  5IB0 A;  3FED A;  1ZRS A;  3PBB A;  2E28 A;  4NJQ A;  3NE8 A;  3T90 A;  2B4D A;  3SJX A;  2Z3P A;  2ZEP A;  4KOU A;  3TT2 A;  2AFS A;  2H5M A;  3T05 A;  3GLJ A;  4JZ0 A;  1YGH A;  3JUW A;  4OP4 A;  4NGT A;  2ATR A;  1HDU A;  4P4J A;  3E0K A;  4MJ8 A;  2IMO A;  4BMH A;  3DSB A;  2G3A A;  1M44 A;  3HPH E;  1WK4 A;  1H8L A;  2Z3K A;  2PR1 A;  2ZXV A;  4KNG E;  3F9K C;  1LAM A;  1A2Z A;  3CPA A;  3LMS A;  1A9X B;  1TKJ A;  4ZBG A;  4B13 A;  2EZA A;  4P44 A;  3S6F A;  5BY0 A;  3H8E A;  2ODF A;  1ELM P;  4COG A;  2PJ1 A;  2Q0Y A;  4MRI A;  3IU1 A;  2VZZ A;  4C99 A;  2GRE A;  2V8G A;  2OR4 A;  2N3A B;  2OB0 A;  2PC1 A;  4JJX A;  4QUS A;  2VQY A;  3TTH A;  2O53 A;  1Y7R A;  2Q7B A;  1XF8 A;  4NFR A;  2PJ8 A;  4JXQ A;  4YWY A;  1YW4 A;  2ZW6 A;  8CPA A;  3C26 A;  3KKW A;  2C5Q A;  1LCP A;  2QJ8 A;  3OP0 A;  2RC4 A;  3D66 A;  1ZG7 A;  4A39 A;  1BLL E;  2EWB A;  3IEH A;  3W6X A;  5IB9 A;  4C9V A;  1XJO A;  3WC5 A;  3ZJ0 A;  1Z5R A;  3FRM A;  3VWD A;  4KZT A;  5AXI A;  1YME A;  2Y0M A;  4MFL A;  4KLW A;  3TLG B;  2NMT A;  2PRQ A;  1VI4 A;  4CDK A;  5G22 A;  4NGS A;  2GIV A;  1YVO A;  2V8V A;  4Q38 A;  1Z8L A;  2ZEE A;  3CXS A;  4KOX A;  4MHN A;  4QVT A;  5EBV A;  2B0A A;  3WAB A;  3T8W A;  5AG5 A;  4KSF A;  1QSO A;  1VHE A;  2DF5 A;  5LYF A;  1P4N A;  1VBG A;  3G23 A;  3PB9 X;  2AFU A;  2REE A;  1CPX A;  2EUI A;  3KR5 A;  4MFP A;  4NGN A;  3B3C A;  3GKR A;  5LRG A;  3BUW B;  5JVL A;  3PB4 X;  2WSA A;  4NGP A;  2PVW A;  4RI1 A;  2VEZ A;  4XPD C;  5K8P A;  1JDB C;  1YLO A;  4B5O A;  1J3L A;  3EC4 A;  1LAP A;  4MY0 A;  4PV6 A;  2ZPA A;  4OIW A;  4BBH A;  3TO7 A;  1B47 A;  4P10 A;  3N5F A;  4CYO A;  5K8N A;  4PK3 A;  2CTB A;  2VKZ G;  4FWU A;  3EZB A;  2G3T A;  2PJ3 A;  4UWI A;  4MJX A;  3RZA A;  2JBK A;  2J8N A;  3I1U A;  3GY9 A;  3SR3 A;  2PSW A;  4IF5 A;  4E8O A;  1PCA A;  4F6A A;  2VZY A;  1TKF A;  3WT4 A;  3VRQ A;  2JBJ A;  1ZLI A;  3KHZ A;  3BUX B;  1RXT A;  2G9D A;  3BJ8 A;  3LWU A;  1R57 A;  4L89 A;  4BD9 A;  5JPH A;  3GJZ A;  3D7G A;  1IOF A;  5K99 A;  1IU8 A;  1Z8W A;  2DXQ A;  4CRY B;  5A28 A;  3T5M A;  4MMO A;  1Z9U A;  4PXB A;  5JYB A;  4Q36 A;  2B5G B;  4H6Z A;  4JVO A;  5G20 A;  4F9U A;  1IB1 E;  1IOI A;  2X0S A;  3TO9 A;  4MFZ A;  4E0A A;  2QEC A;  2HQY A;  3QB8 A;  1QSR A;  4E5S A;  4A4C A;  1Q7L A;  3N7Z A;  2PJ6 A;  4R8F A;  2DPT A;  1AYE A;  4C8U A;  1ZG9 A;  1M6V B;  3KAS A;  1YR0 A;  3MGD A;  4UFX A;  2PRB A;  4GS4 A;  4MHP A;  3VRN A;  1JDE A;  2EZC A;  1I12 A;  1C30 B;  4GXH A;  3BJ7 A;  3CDX A;  4ZX8 A;  5FVJ A;  2QVP A;  5JM6 A;  5F1Y A;  1MK4 A;  3CXP A;  5F48 A;  2ZW4 A;  4MFQ A;  4UCP A;  3FBU A;  3SHP A;  3UY5 A;  4CAF A;  1XBU A;  4OC3 A;  3HMJ G;  3IWW A;  3LOD A;  4C2Z A;  1UFH A;  1KEE B;  1OZP A;  4ZYQ A;  1AMP A;  3P2F A;  4R87 A;  1YSJ A;  3KGQ A;  3F8K A;  1Z4R A;  4P4F A;  5F46 A;  2YJV A;  3KZW A;  4KVO E;  5C82 A;  2BUE A;  2GFQ A;  3R96 A;  4CAW A;  3IO1 A;  4A30 A;  3B8G A;  3DNS A;  4C8T A;  3TO6 A;  2FIW A;  3NA6 A;  3GYA A;  3FMC A;  3VH9 A;  1GGO A;  3EFA A;  4PPZ A;  4AVA A;  1I1D A;  4GPL B;  2JDC A;  2OH1 A;  4PXE A;  3PP9 A;  5EC4 A;  1Y9Z A;  3KHX A;  1QQ9 A;  3TLZ A;  2IL4 A;  1FNO A;  3LD2 A;  4WWV A;  5HKW A;  1QSM A;  2V77 A;  4JLY A;  1QMU A;  3TC8 A;  4P4B A;  4YN3 A;  2I3C A;  4AB7 A;  4CZ1 A;  3PFE A;  5F13 A;  4C68 A;  6CPA A;  4U9Z A;  4M85 A;  4KOT A;  4C86 A;  1Z8X A;  2YNE A;  1Z8T A;  2ZW7 A;  2B4D B;  3FYN A;  2VXK A;  3DDD A;  4OKO A;  4X8I A;  4AG7 A;  4F8Z A;  4C8F A;  3CT9 A;  4UCM A;  3D3S A;  1K4J A;  3D67 A;  3KI9 A;  4H6U A;  4I49 A;  4ONU A;  4II9 A;  4TJV A;  3S9N A;  4X3R A;  3JTK A;  4LQ6 A;  2YNC C;  3VTA A;  2AFX A;  3S9L A;  5HH1 A;  2P0W A;  3EO4 A;  5DWN A;  2PVV A;  1CG2 A;  2EK9 A;  1Q2C A;  1XFO A;  2GLF A;  4FD7 A;  3EZE A;  2R82 A;  2OOT A;  2AFM A;  1MJ9 A;  3TLB A;  3TFY A;  2PDO A;  3K4I A;  4KLV A;  3TYX A;  3TX8 A;  1S7K A;  1IIC A;  2GU2 A;  3BUO B;  4HPS A;  2PCU A;  3V38 A;  1C3O B;  2VBQ A;  3BI1 A;  4M6I A;  3NFQ A;  2D4O A;  2ZEG A;  5LYI A;  1KBL A;  4BPW B;  3K9U A;  5J8C A;  2ABZ A;  2P6E A;  3MN8 A;  1CBX A;  5CNP A;  1UWY A;  1XF1 A;  3VRP A;  1EO0 A;  4BPU B;  1ARM A;  3QAY A;  3TE4 A;  2WZN A;  2Q04 A;  3D68 A;  3KR4 A;  5BWA B;  4C8C A;  1Q2Y A;  4J0N A;  2F5I A;  3SJG A;  2HV2 A;  2BL1 A;  5A27 A;  1DIK A;  4CAV A;  1GHE A;  1CP6 A;  3HUV A;  4HNW B;  4R6T A;  4PQA A;  2Y1M A;  2O4H A;  4LUA A;  4EVY A;  1Q5X A;  1FY7 A;  3A9L A;  2R98 A;  1ON0 A;  5JH9 A;  1VHS A;  4KOR A;  2FCK A;  1NMT A;  2Z3L A;  4YU9 A;  1BXR B;  1MJA A;  4BIN A;  1Z2L A;  1VGY A;  3OAK A;  1TF8 A;  3RO0 A;  1Y9W A;  4R3L A;  4RS2 A;  2WYR A;  2GP4 A;  4CDJ A;  2XEJ A;  2XPN A;  2B58 A;  5JGF A;  1MJB A;  4OID A;  1YW6 A;  2A4N A;  5IX3 A;  1M4D A;  4C84 A;  3ZNI A;  1EZB A;  4M6H A;  4C8P A;  3JRU A;  3IIB A;  4AVC A;  2YJT A;  1WJT A;  5D29 A;  2BSW A;  1N71 A;  3IJ3 A;  4FD5 A;  1TXR A;  4XNH C;  4W9Y A;  2PIZ A;  2AUM A;  2Q4Z A;  4ONW A;  1S7L A;  2HWG A;  5LYL A;  3NOJ A;  3U1B A;  5K8M A;  1YX0 A;  2JDD A;  5F49 A;  4EFD A;  1T36 B;  4R3K A;  3PFO A;  1F2P A;  2Z10 A;  4EWT A;  2I00 A;  3RYO A;  1HEE A;  4OAD A;  3SXO A;  1YK3 A;  2PJ5 A;  3S6H A;  4MBU A;  4RUH A;  1Y9K A;  4UBR A;  2WPX A;  2FL4 A;  4OLL A;  2P6F A;  2Y1N A;  1LRZ A;  2R7H A;  4A37 A;  3ICU A;  3IC1 A;  4P45 A;  4P4I A;  4A4B A;  2FE7 A;  2NSM A;  4B11 A;  3H8G A;  1S5K A;  4QB9 A;  3I3G A;  4O23 A;  2JEW A;  4DUK A;  5AGE A;  4R7M A;  4B5P A;  4R9M A;  2Q43 A;  4MXU A;  3R9E A;  2WUU A;  2KCW A;  3FXT A;  2CNS A;  4PSX A;  3TOA A;  4MFK A;  4FUU A;  5D8N A;  1VIX A;  3FF3 A;  3WC7 A;  2PJ4 A;  4MCP A;  3IFE A;  2CBL A;  2F7V A;  2IQ6 A;  4ZX9 A;  3VAT A;  1JQG A;  1YVH A;  4XPK A;  1S7N A;  4JXR A;  2XEF A;  2Q44 A;  3H8F A;  3DR8 A;  1VBH A;  1S3Z A;  3I6S A;  3PFV A; 
#chains in the Genus database with same CATH homology
 3PB8 X;  1DE4 C;  2Q51 A;  4IK2 A;  2ZED A;  4A38 A;  4DJL A;  3FEC A;  2IJZ A;  5HVH A;  1ARL A;  1R3N A;  3EIF A;  2ANP A;  2ZEF A;  4FAI A;  4UIB A;  2F8H A;  2HC9 A;  2NYQ A;  1GYT A;  1PYT B;  3S9M A;  2PJ0 A;  3B35 A;  4A94 A;  1CX8 A;  4OC4 A;  4ZI6 A;  1NSA A;  1IY7 A;  4PXD A;  2V8H A;  4MHY A;  3PB7 X;  3PEI A;  3B3T A;  4C9U A;  4AXV A;  5J1Q A;  3PBE A;  2PJB A;  4UF4 A;  4OC2 A;  3NFZ A;  1F57 A;  1XMB A;  3RAM A;  1ZG8 A;  5LRK A;  5ELY A;  4ZY1 A;  2HB6 A;  1Y7E A;  4MHZ A;  4C85 A;  7CPA A;  4C8F A;  4EME A;  3FH4 A;  3NH8 A;  1LOK A;  1ZLH A;  2C6C A;  3BI0 A;  4X2T A;  2GP4 A;  2ZOG A;  3B3V A;  1CP7 A;  2XEI A;  1DTD A;  2PJ7 A;  4B6Z A;  4UEE A;  4MCS A;  4C8A A;  1FT7 A;  4G1P A;  1WVM A;  2EK8 A;  4MCQ A;  4UEZ A;  3ICU A;  4IHM A;  3BHX A;  2BCO A;  2PIY A;  5LRJ A;  3DLJ A;  1VHO A;  1LAN A;  3BXM A;  3FVL A;  4OC5 A;  3D4U A;  3KL9 A;  2ZEM A;  1KWM A;  1TF9 A;  4OME A;  1XRY A;  2DEA A;  4R76 A;  2XEG A;  3WC6 A;  2ZOF A;  2PE3 A;  5K8O A;  4P4E A;  5HVG A;  2AFW A;  4FBE A;  3PRT A;  4Z65 A;  2PJ9 A;  1LFW A;  2FVG A;  5HVF A;  2ZEH A;  1ELL P;  4UIA A;  4CPA A;  2BO9 A;  2BOA A;  2ZEL A;  1V6C A;  4IAV A;  1F2O A;  3PB6 X;  3ISZ A;  4H2K A;  2PJA A;  3K2K A;  1CPS A;  1HDQ A;  4WJB A;  4UEF A;  1EE3 P;  4TJX A;  5I4M A;  2AFZ A;  3SJF A;  4NGR A;  2CIJ A;  2AFO A;  2QYV A;  3HLP A;  3ISX A;  5F09 A;  3D7F A;  5CPA A;  3RBU A;  4OC1 A;  3NH4 A;  3D7H A;  4NJR A;  3I74 A;  2C6G A;  4GM5 A;  3KQX A;  4C9A A;  3DGV A;  3D7D A;  3SI2 A;  1IGB A;  2CTC A;  3K9T A;  3B2Y A;  4OC0 A;  3B7I A;  4PXC A;  3L2N A;  4ZY0 A;  4LQG A;  2CF4 A;  5HXD A;  1OBR A;  1TKH A;  2V8D A;  1BPN A;  3SJE A;  4DYO A;  4KSI A;  3NH5 A;  4F9V A;  2VL1 A;  3GB0 A;  3B3S A;  2C1C A;  3GUX A;  5DS0 A;  4MCR A;  1R43 A;  5CBM A;  2J9A A;  2PJ2 A;  1RTQ A;  4TNU A;  4K3N A;  4ZY2 A;  4C9R A;  2ZEO A;  3SI1 A;  4JYW A;  4Q7A A;  5THW A;  2RB7 A;  4P6Y A;  4TWE A;  2POK A;  3CPX A;  3SI0 A;  2C6P A;  5IR2 A;  2ZEN A;  2PJC A;  3FX6 A;  3V7Z A;  3KQZ A;  3QNV A;  4NGM A;  2GLJ A;  1M4L A;  4NGQ A;  3VAR A;  3B3W A;  1Y0Y A;  1Y0R A;  3FEE A;  1BPM A;  1BAV A;  2RFH A;  3FJU A;  5LYD A;  4P4D A;  4C9E A;  3MRU A;  3FED A;  3PBB A;  4NJQ A;  3SJX A;  2ZEP A;  2AFS A;  3GLJ A;  4JZ0 A;  4OP4 A;  4NGT A;  1HDU A;  4P4J A;  2IMO A;  1H8L A;  4KNG E;  1LAM A;  3CPA A;  3LMS A;  1TKJ A;  4P44 A;  3H8E A;  1ELM P;  2PJ1 A;  4MRI A;  4C99 A;  2GRE A;  2V8G A;  2OR4 A;  2O53 A;  4NFR A;  2PJ8 A;  4YWY A;  1YW4 A;  8CPA A;  2C5Q A;  1LCP A;  2QJ8 A;  3D66 A;  1ZG7 A;  4A39 A;  1BLL E;  2EWB A;  3IEH A;  5IB9 A;  4C9V A;  1XJO A;  3WC5 A;  1Z5R A;  1YME A;  2PRQ A;  4CDK A;  4NGS A;  2V8V A;  1Z8L A;  2ZEE A;  4MHN A;  3WAB A;  3T8W A;  1VHE A;  5LYF A;  3PB9 X;  2AFU A;  1CPX A;  3KR5 A;  5LRG A;  4NGN A;  3B3C A;  3PB4 X;  4NGP A;  2PVW A;  5K8P A;  1YLO A;  1LAP A;  4OIW A;  4P10 A;  3N5F A;  5K8N A;  2CTB A;  4FWU A;  2PJ3 A;  3RZA A;  2JBK A;  3I1U A;  1PCA A;  1TKF A;  3WT4 A;  2JBJ A;  1ZLI A;  3KHZ A;  4BD9 A;  2G9D A;  3LWU A;  3D7G A;  4MMO A;  4PXB A;  4F9U A;  1Q7L A;  2PJ6 A;  4R8F A;  1AYE A;  4C8U A;  1ZG9 A;  3KAS A;  4MHP A;  3CDX A;  4ZX8 A;  2QVP A;  5JM6 A;  1XBU A;  4OC3 A;  3IWW A;  4ZYQ A;  1AMP A;  1YSJ A;  3KGQ A;  4P4F A;  3KZW A;  3IO1 A;  4C8T A;  3NA6 A;  3FMC A;  3VH9 A;  4PPZ A;  4PXE A;  1Y9Z A;  3KHX A;  1QQ9 A;  1FNO A;  4WWV A;  2V77 A;  1QMU A;  3TC8 A;  4P4B A;  4YN3 A;  2I3C A;  3PFE A;  6CPA A;  4C86 A;  4OKO A;  4X8I A;  4F8Z A;  3CT9 A;  3D67 A;  3KI9 A;  4TJV A;  3S9N A;  4X3R A;  3VTA A;  2AFX A;  3S9L A;  2PVV A;  1CG2 A;  2EK9 A;  1XFO A;  2GLF A;  2OOT A;  2AFM A;  3TX8 A;  2GU2 A;  3V38 A;  2PCU A;  3BI1 A;  2ZEG A;  5LYI A;  2ABZ A;  3MN8 A;  1CBX A;  1XF1 A;  1UWY A;  1ARM A;  2WZN A;  3D68 A;  3KR4 A;  4C8C A;  3SJG A;  3HUV A;  1CP6 A;  4R6T A;  4PQA A;  2O4H A;  5JH9 A;  4YU9 A;  1Z2L A;  1VGY A;  1TF8 A;  2WYR A;  4CDJ A;  2XEJ A;  5JGF A;  4OID A;  1YW6 A;  4C84 A;  4C8P A;  3JRU A;  3IIB A;  5D29 A;  3IJ3 A;  1TXR A;  4W9Y A;  2PIZ A;  2Q4Z A;  4ONW A;  5LYL A;  5K8M A;  4EFD A;  3PFO A;  1F2P A;  4EWT A;  1HEE A;  2PJ5 A;  4RUH A;  4A37 A;  3IC1 A;  4P45 A;  4P4I A;  2NSM A;  3H8G A;  4O23 A;  2JEW A;  4DUK A;  4R7M A;  2Q43 A;  4MXU A;  4FUU A;  5D8N A;  1VIX A;  3FF3 A;  3WC7 A;  2PJ4 A;  4MCP A;  3IFE A;  2F7V A;  2IQ6 A;  4ZX9 A;  3VAT A;  1JQG A;  2XEF A;  3H8F A;  3I6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...