4NGRA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
689
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 261
structure length 689
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngrA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngrA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngrA02
2BCOA 3FX6A 1HEEA 3KR4A 4R6TA 3S9LA 4C8FA 2AFSA 2AFMA 1TXRA 2CTBA 2ZOGA 5K8NA 3B3SA 1YSJA 4BD9A 3PB4X 5LYDA 5HVGA 2XEIA 2FVGA 2ZEPA 3PB9X 2ABZA 1AYEA 3H8GA 3PB7X 2PJ1A 2PRQA 3NH4A 1GYTA 1UWYA 3D4UA 3IEHA 3FMCA 4MHZA 4ZX8A 3TC8A 2PVWA 3LWUA 2V8VA 4C8CA 4C9UA 1M4LA 3VH9A 4LQGA 3FJUA 3CPAA 1LAMA 2EK9A 2PJBA 2GLJA 5LRKA 1Y9ZA 2O53A 5JH9A 4FWUA 3NH5A 2EWBA 3B35A 3RAMA 2ZEHA 3IFEA 3FH4A 2CTCA 1ZG7A 3RZAA 5THWA 2XEGA 3H8FA 4P4EA 4A39A 3B3TA 1LAPA 3WC5A 1VHOA 2JBJA 4ZYQA 1QQ9A 3KZWA 4DJLA 4C9EA 4NGNA 4NJRA 4OC3A 5LYIA 1YMEA 1OBRA 1ZLHA 1ARMA 4OC1A 2OR4A 5D29A 3B3VA 4DUKA 4MHPA 3GB0A 2AFZA 4EMEA 1Z2LA 2C6GA 4OC5A 4NFRA 2AFWA 2G9DA 4YN3A 2PJ2A 5HVHA 4UF4A 2Q4ZA 3QNVA 3D7GA 4PQAA 4P44A 3B2YA 4R7MA 3K9TA 2PJCA 2C6PA 4OC4A 3VARA 5LRGA 4P6YA 2GREA 3BI0A 4C8TA 3L2NA 4NGSA 4MHYA 1ELMP 2ZEOA 4C9RA 4NGQA 4UIBA 4KSIA 3DLJA 3WC6A 2PJ0A 4W9YA 2GLFA 2Q43A 4C9VA 1CPXA 4ZX9A 4PXEA 4C99A 5K8OA 1PYTB 2PJ9A 2HC9A 3B3WA 1XF1A 4TJXA 1H8LA 1XMBA 3ISZA 1ZG9A 1IGBA 3B3CA 3GLJA 1KWMA 4MRIA 4X8IA 4JZ0A 2ZENA 4EFDA 2V8DA 2PCUA 4IHMA 4UEEA 1BPNA 1BPMA 2GU2A 2J9AA 3BI1A 3IWWA 1TF8A 2PJ6A 4PXDA 4TWEA 1CG2A 4PPZA 4R8FA 1Y7EA 2AFOA 4C8AA 3D66A 4TNUA 1LCPA 4A37A 3K2KA 2QJ8A 3PB8X 3BXMA 1VIXA 2F7VA 3PFEA 4NJQA 1LFWA 2C1CA 3IJ3A 4MMOA 3SI0A 3WABA 4IAVA 4NGRA 1AMPA 1LANA 2EK8A 1NSAA 3HLPA 2ZEEA 5LYLA 3CPXA 2PJ4A 1ELLP 4H2KA 1Z8LA 3PEIA 2PJ7A 3SJXA 3HUVA 4ZY1A 2ZEMA 2AFXA 3KHXA 1R3NA 4P4JA 2JBKA 2OOTA 2ZELA 3KASA 3KL9A 3IC1A 3PRTA 1Z5RA 4CPAA 3FECA 3KI9A 4DYOA 4ZI6A 2ZEGA 5HXDA 1DTDA 2BO9A 3VTAA 4EWTA 5K8PA 3SJEA 2WZNA 4OC2A 3V7ZA 1BLLE 2AFUA 5JM6A 4P4IA 4ONWA 3SJFA 1HDUA 2HB6A 3SI1A 5DS0A 1R43A 4MCSA 1VGYA 5JGFA 3JRUA 3FVLA 5ELYA 3LMSA 3WC7A 5CBMA 2PVVA 4FAIA 3PB6X 1XRYA 1CP7A 4NGMA 4ZY2A 1Q7LA 3KQXA 8CPAA 4YU9A 4X3RA 5IB9A 5F09A 1RTQA 1QMUA 4B6ZA 2PJAA 2PIZA 2V8GA 3BHXA 2RFHA 2VL1A 4MCQA 4P10A 3D7FA 4P4FA 1YLOA 3D68A 2IJZA 2ZEFA 3I74A 4JYWA 3RBUA 1HDQA 4CDKA 4NGPA 3PFOA 1F2PA 3T8WA 4WJBA 5I4MA 1FT7A 2XEFA 2QVPA 3MN8A 3B7IA 2PJ3A 3GUXA 4O23A 4C8UA 1WVMA 4F8ZA 2RB7A 4P4BA 3V38A 1XJOA 3KR5A 4P4DA 3FEDA 3D7HA 1XFOA 2F8HA 4OKOA 2C6CA 1ZLIA 3IO1A 4C84A 5CPAA 2ANPA 1LOKA 3H8EA 2Q51A 1ZG8A 2I3CA 3PBBA 4MXUA 4OIWA 4KNGE 4C8PA 2DEAA 3N5FA 3D67A 2NYQA 3PBEA 4C86A 2V8HA 1VHEA 3FF3A 5HVFA 1TKHA 2IMOA 2WYRA 3DGVA 2NSMA 6CPAA 4Q7AA 3CDXA 3KHZA 4FBEA 1EE3P 1F2OA 4G1PA 3NA6A 4MHNA 3KGQA 4RUHA 3EIFA 1Y0RA 2PIYA 1ARLA 1FNOA 3KQZA 2BOAA 2XEJA 4FUUA 1V6CA 3I1UA 1YW6A 4C9AA 1BAVA 1TKJA 4MCRA 4A38A 3S9MA 1CPSA 1XBUA 4YWYA 5LRJA 3SJGA 4UIAA 3FEEA 4F9UA 2POKA 4UEZA 4A94A 4OP4A 3MRUA 4PXCA 1Y0YA 1TF9A 1CX8A 4X2TA 7CPAA 3I6SA 4IK2A 1PCAA 5D8NA 3ICUA 3TX8A 4WWVA 4NGTA 4AXVA 2JEWA 2CIJA 3IIBA 4OIDA 2V77A 4R76A 4K3NA 5K8MA 4CDJA 3S9NA 3CT9A 3NFZA 3WT4A 4P45A 4UEFA 5LYFA 2PJ8A 4PXBA 3VATA 2QYVA 4F9VA 4Z65A 1YW4A 2CF4A 1CBXA 1TKFA 3ISXA 2O4HA 1IY7A 2PE3A 3NH8A 1DE4C 1CP6A 3D7DA 2IQ6A 1F57A 4MCPA 4OC0A 1JQGA 4TJVA 5J1QA 4GM5A 2PJ5A 3SI2A 4OMEA 2ZOFA 2ZEDA 4C85A 4ZY0A
chains in the Genus database with same CATH superfamily
1ZO0A 2BCOA 3FX6A 1HEEA 3KR4A 4R6TA 1KEEB 2HUZA 3S9LA 2AJ6A 4QB9A 4BMHA 4BPUB 2AFSA 2AFMA 1TXRA 5J3XA 2CTBA 2ZOGA 4KOXA 3R1KA 5K8NA 4JWPA 2WPWA 4L89A 3B3SA 3R9GA 3SHPA 1IU8A 1YSJA 1OZPA 3V8IA 4RR2B 2R8VA 4BD9A 3PB4X 5LYDA 3GJZA 4B14A 4CZ1A 5HVGA 5HMNA 3T90A 3FIXA 2XEIA 2FVGA 4B11A 1MJBA 5G22A 4XPDB 4IIYA 2ZEPA 4GXHA 3PB9X 4PSWA 2ABZA 4F0XA 1AYEA 3H8GA 5JVLA 3PB7X 4DNCA 2PJ1A 1YGHA 1C30B 2PRQA 2BSWA 1TIQA 1YVHA 3BUOB 4AVBA 3NH4A 3FBUA 3GYAA 2DLAA 1GYTA 1UWYA 2IL4A 3D4UA 4LQ6A 3E0KA 2PCNA 3IEHA 4MHDA 1R61A 3FMCA 4QUSA 4MHZA 1SQHA 3ZNIA 1Z8WA 4JXRA 4B5PA 2FIWA 2O28A 4ZX8A 3TC8A 1YK3A 4RS2A 1EO0A 2PVWA 3JTKA 1CE8B 2D4PA 4R3KA 1M1DA 3LWUA 2V8VA 4C8CA 5FVJA 2D0OA 2B3VA 4C9UA 4NXYA 1M4LA 3VH9A 3K4IA 3U1BA 4LQGA 2C27A 2GP4A 3FJUA 3CPAA 1LAMA 2EK9A 4A30A 1YREA 1V0CA 2PJBA 2GLJA 5LRKA 1NSLA 2PR1A 1Y9ZA 2O53A 3DNSA 5JH9A 2P6FA 2VKZG 3NH5A 4FWUA 2EWBA 3ZZIA 3B35A 5AG6A 2OB0A 2ZEHA 2ZPAA 3RAMA 3IFEA 4R87A 4AVCA 3FH4A 1KUYA 2FM4A 4KORA 4E94A 2REFA 1IOFA 2CTCA 1ZG7A 3RZAA 5THWA 3W6SA 2XEGA 3H8FA 4CDKA 4P4EA 4A39A 5KTAA 3B3TA 1LAPA 1X10A 5HKWA 2I00A 3WC5A 1U6MA 1VHOA 3PT1A 1ZL0A 4I49A 2JBJA 4ZYQA 4M8DA 1QSMA 2H5MA 1QQ9A 3TE4A 1I21A 5I0CA 4YGOA 1MK4A 3KZWA 4DJLA 4QC6A 4C9EA 4MY3A 1A2ZA 4NGNA 3DR8A 3IU1A 1IB1E 4JXQA 4NJRA 1NE9A 5GCNA 4UA3A 4GPLB 4OC3A 2QMLA 1YMEA 1OBRA 1ZLHA 5LYIA 1ARMA 2ZEDA 4OC1A 2OR4A 2CNTA 1A9XB 5D29A 4R3LA 4B13A 2B4JC 2AUNA 3R96A 1Z8XA 1IICA 2Y1MA 2EBJA 3B3VA 3JVNA 4DUKA 5F48A 3OB1B 2PR8A 2Z0ZA 4MHPA 3GB0A 2AFZA 4UFWA 4A33A 3G8WA 1M4GA 4Q38A 4EMEA 1Z2LA 2C6GA 4OC5A 4NFRA 4CGLA 1B87A 1YR0A 2AFWA 2G9DA 4NEXA 2GFQA 1ZYMA 4YN3A 1QSOA 2PJ2A 4BINA 5HVHA 3F0AA 2GANA 1AUGA 4UF4A 4CAXA 2Q4ZA 2Z3PA 3QNVA 3D7GA 3IU2A 4M6GA 3B8GA 2JLMA 3F8KA 4PQAA 4P44A 3B2YA 5HKZA 4R7MA 4KLVA 2J8RA 4BBHA 1Q2YA 3IGRA 3K9TA 2PJCA 2ZW5A 3FXTA 5F46A 2B0AA 2FSRA 4AG9A 3N7ZA 3OWCA 2C6PA 2R82A 4OC4A 3SXNA 3VARA 5LRGA 4P6YA 2GE3A 3EY5A 3LD2A 3P2HA 2GREA 3PZJA 1VKCA 2P6EA 3I9SA 4KUAA 3BI0A 2JEVA 2FS5A 4C8TA 3TLZA 4CGNA 3L2NA 4NGSA 4JJXA 4MHYA 2AUMA 5F49A 4B12A 1YX0A 1ELMP 2ZEOA 3FNCA 4C9RA 2PSWA 1GGOA 1BOBA 4NGQA 4CDJA 4UIBA 4KSIA 3DLJA 3QAYA 4FD4A 2WPXA 4OLLA 4BPWB 4A32A 3WC6A 1CS0B 3BUNB 1S5KA 2PJ0A 3UY5A 4W9YA 3HMJG 4CYQA 2GLFA 2Q43A 4C9VA 4IIXA 5BY0A 1CPXA 4ZX9A 4PXEA 4C99A 5K8OA 3TO9A 1PYTB 2PJ9A 3BJ7A 4AB7A 2DIKA 2OZGA 2HC9A 5A28A 3VGOA 5J8FA 3B3WA 1XF1A 1Z9EA 4TJXA 1XIXA 2D0PA 1H8LA 4RI1A 1VI4A 1XMBA 4ONUA 4HKFA 3ISZA 1YLEA 1ZG9A 1IGBA 4COGA 1MJAA 3B3CA 3GLJA 3TT2A 2EZAA 1KWMA 4M6HA 4R9MA 4MRIA 5FD8A 4KOTA 4X8IA 1J4JA 2ZW4A 1M44A 4JZ0A 1P0HA 3FYNA 2ZENA 4EFDA 2VQYA 2V8DA 4CS0B 2JDDA 3TFYA 4H1HA 2YNEA 2PCUA 4IHMA 1PUAA 1WJTA 4AVAA 4UEEA 1BPNA 4HPSA 1BPMA 3TOBA 3GY9A 2X0SA 3SXOA 2Z11A 2Y0MA 1I1DA 1Z8TA 1Q2CA 2G0BA 2GU2A 2J9AA 4OAEA 4MBUA 4MJ8A 4KSAA 1PU9A 4BPXB 2F5IA 2B4DB 3BI1A 3IWWA 2FCKA 1TF8A 2PJ6A 2ZXVA 1LRZA 4PXDA 2YGWA 1CG2A 4PPZA 4TWEA 2EZBA 1XOVA 3BJ8A 1WWZA 4M85A 2Q7SA 4R8FA 1Y7EA 2AFOA 5IV0A 3NE7A 1JWQA 4C8AA 3D66A 4TNUA 1P4NA 1S7LA 1BO4A 4A31A 1LCPA 2PQ8A 4A37A 3K2KA 1Y9WA 4KZTA 3TLBA 2QJ8A 5DWNA 3PB8X 3BXMA 1KUXA 1VIXA 4JD6A 5AG7A 5E96A 4AG7A 4CO9A 2F7VA 2VBQA 4OADA 3PFEA 1FBVA 1QSRA 2Z3LA 4NJQA 1R57A 1LFWA 3EZBA 2C1CA 3IJ3A 3RNZA 4MMOA 3SI0A 2FXFA 2ZW6A 2AE6A 2FT0A 3D3SA 4IAVA 3WABA 1QSNA 5J8CA 4NGRA 3D8PA 1AMPA 1LANA 2EK8A 3TLEA 2KCWA 5G21A 1NSAA 2WUUA 3HLPA 2B5GA 2BEIA 2ZEEA 4CRZB 5G1ZA 5LYLA 1XMTA 3CPXA 2PJ4A 4M3SA 4MFJA 1ELLP 2YNCC 1Z8LA 1MJ9A 4H2KA 4PSXA 3PEIA 3S6GA 1VBHA 3TYXA 2PJ7A 5EBVA 3SJXA 3HUVA 3TO6A 2ZEMA 2AFXA 3KHXA 1R3NA 2PC1A 4ZY1A 4CRYB 4NF1A 1NBWA 4HNYB 1S7KA 4P4JA 4C2XA 2JBKA 2OOTA 4E2AA 2ZELA 5JYBA 3KASA 4C8FA 2EUIA 3LODA 3VWDA 3KL9A 2FE7A 3IC1A 3PRTA 2Q4YA 2R7HA 3VRNA 1DIKA 1Z5RA 4CPAA 3FECA 3EZEA 3NOJA 3OAKA 3KI9A 1IIDA 5K99A 4DYOA 2D4OA 5KTDA 3R9EA 2ZEGA 5CNPA 4A4CA 1NMTA 1M4DA 1DTDA 3CZXA 4ORFA 3S6FA 4LX9A 5HXDA 4MI1A 4XNHC 2BO9A 5F5XA 2P6GA 2FL4A 2DPTA 4JVOA 3NFQA 3K9UA 4ZGYB 5H84A 3VTAA 2WSAA 2DF5A 4E0AA 1CJWA 4EWTA 3SJEA 5K8PA 2B4DA 2OZUA 3JUWA 2WZNA 3PGPA 2Y1NA 1JDEA 4OC2A 3V7ZA 1BLLE 1IOIA 2AFUA 5AG4A 2UV8G 4E8OA 2XPPA 1VBGA 2XPNA 1L0CA 2YJTA 3PFVA 2QIRA 5JM6A 3C8OA 4P4IA 2OZHA 4J3GA 4ONWA 4CGMA 4B5OA 3TO7A 3LACA 3SJFA 1HDUA 2HB6A 4CGPA 1RO5A 3SI1A 3HPGG 5DS0A 1R43A 3TCVA 4MCSA 3DSBA 4KVOE 1KUVA 3S6KA 3VROA 1VGYA 1IYLA 5JGFA 2I79A 5JPHA 3JRUA 3HPHE 2EZCA 2VXKA 3IWGA 1Z9UA 3FVLA 5ELYA 2Q4VA 3LMSA 1C3OB 2NMTA 3PP9A 4C2YA 2E28A 3RO0A 2HQYA 4CYOA 3WC7A 5F9MA 5CBMA 5IB0A 2PVVA 3D2MA 4FAIA 1T36B 4NCZA 3PB6X 1J3LA 2HWGA 1S7FA 1XRYA 2XPLA 2R98A 4PK2A 4XPKA 4XNHB 3SR3A 1CP7A 2ZW7A 5EMIA 4NGMA 2J8MA 4ZY2A 4F6AA 5C82A 4C2ZA 2B5GB 1Q7LA 2MP0A 4PK3A 3KQXA 2HI6A 3T5MA 8CPAA 4YU9A 1Z4EA 3OP0A 4X3RA 3S6HA 4HNXB 1YVOA 5AG5A 1ON0A 3VRPA 2PDOA 4EVYA 5F09A 3FB3A 4QVTA 4U9ZA 5IB9A 1RTQA 1KC7A 4U9YA 2Q44A 1QMUA 4B6ZA 2PJAA 2PIZA 4MFZA 1RXTA 5ISVA 3A9LA 4UCMA 2EVNA 2Z3MA 2EO8A 2V8GA 3BHXA 1M4IA 2RFHA 2VL1A 2XPOA 4MCQA 4P10A 4R57A 1B47A 2Z3KA 4LUAA 3D7FA 4P4FA 1YLOA 3DR6A 4UWJA 5EC4A 3D68A 4HNWB 3TTHA 5KTCA 2IJZA 2ZEFA 3I74A 2JDCA 1XEBA 4JYWA 3RBUA 4CGOA 1KBLA 2ATRA 1XF8A 3I3GA 4GS4A 2CXAA 1HDQA 3GIUA 3CXPA 4NGPA 3PFOA 4CAVA 3C26A 1F2PA 3NE8A 3QB8A 3T8WA 4WJBA 5I4MA 1FT7A 4UWIA 4KOYA 4J0NA 2XEFA 1ZRSA 2K5TA 1IYKA 2QVPA 2VI7A 3MN8A 4K30A 4KUBA 3B7IA 3P2FA 4PV6A 4KOUA 2PJ3A 2YNCA 3GUXA 4O23A 4C8UA 2N3AB 1WVMA 3BUXB 2REEA 3W6XA 2HV2A 1NXJA 2Z3OA 5JQ4A 3O8ZA 4F8ZA 3EFAA 3ZJ0A 5IR2A 3KRVA 4IUSA 2RB7A 5G20A 4P4BA 1Z4RA 4FD7A 1XJOA 3KR5A 2B4BA 4P4DA 3V38A 4CAEA 5F1YA 3H4QA 1X12A 3IWEA 3F9KC 3D7HA 3FEDA 2B58A 3OB2B 3DDDA 4UCNA 3T9YA 3EZAA 1XFOA 2CNMA 2Z3NA 3W91A 1K4JA 2VEZA 2F8HA 4OKOA 3BUWB 2C6CA 1ZLIA 3IO1A 4C84A 5BWAB 3KKWA 4MJXA 5CPAA 2A4NA 4QBJA 2ANPA 2CY2A 4C68A 4KOWA 4II9A 1LOKA 3H8EA 2Q51A 2QECA 2HROA 4CYNA 1ZG8A 2Q7BA 2I3CA 4C7HA 2VZYA 3PBBA 4JLYA 4MXUA 4OIWA 4KNGE 4C8PA 3G23A 4BTFA 2DEAA 4KLWA 3EC4A 2Q04A 3N5FA 4NSQA 4Y49C 1Q5XA 4EYSA 1YVKA 4UFXA 3EO4A 5F13A 3D67A 2NYQA 3PBEA 2CBLA 4C86A 2Q0YA 2V8HA 1VHEA 4A4BA 3FF3A 3T0TA 4XPLA 5HVFA 1TKHA 2IMOA 2WYRA 4COBA 3GKRA 2FIAA 3DGVA 2NSMA 4U5YA 1B6BA 2P0WA 1CM0A 4KS9A 6CPAA 3TLGB 1WK4A 2OLSA 4Q7AA 1FY7A 3CDXA 3KHZA 2OU2A 4H6UA 1EE3P 4FBEA 4FD6A 1F2OA 1Y9KA 3NA6A 4G1PA 4MHNA 3RYOA 2ODFA 3KGQA 1EZAA 2DXQA 4L8AA 4RUHA 3EIFA 1Y0RA 4KVXA 1KZFA 2PIYA 1ARLA 4KOSA 1FNOA 3KQZA 2BOAA 2XEJA 4FUUA 1V6CA 3VRQA 3I1UA 1YW6A 3TLYA 3BLNA 3VWEA 3VRRA 4C9AA 1BAVA 4RN7A 1TKJA 4MCRA 3TOAA 1EZBA 1S7NA 2Z10A 4A38A 3S9MA 1CPSA 4KVME 3PLFB 1XBUA 4YWYA 3BUMB 4Q36A 5LRJA 3SJGA 3F5BA 1GHEA 4Y49B 5A27A 4UIAA 5IX3A 3FEEA 4CAFA 4F9UA 2POKA 4UEZA 4A94A 4OP4A 4F0YA 2J8NA 3MRUA 4H89A 2G3TA 4PXCA 1Y0YA 1TF9A 1CX8A 4X2TA 1S3ZA 7CPAA 2BUEA 4ZBGA 2YNDA 3I6SA 2OH1A 1Q2DA 4IK2A 1PCAA 3EXNA 5D8NA 1M6VB 3TLAA 1VHSA 5F47A 3ICUA 4CYPA 5H86A 2GIVA 4X5KA 3TX8A 4WWVA 3D2PA 4NGTA 4AXVA 1BXRB 2YJVA 4INJA 2JEWA 2CIJA 3IIBA 4OIDA 2V77A 4R76A 4K3NA 4H6ZA 5HKYA 1QSTA 5K8MA 5C88A 3S9NA 1YQEA 3CT9A 3NFZA 4C7IA 3WT4A 4UCPA 4P45A 1XE4A 4IF5A 3FRMA 4UEFA 2X7BA 4UFVA 4B5PB 5LYFA 1I12A 2CNSA 4YRHA 1JDBC 2PJ8A 4KSFA 4MFQA 4MFKA 4PXBA 3VATA 3WR7A 3R9FA 4A2ZA 3T05A 5HH1A 2QYVA 2R1IA 4F9VA 4Z65A 2RC4A 1YW4A 2CF4A 4MY0A 1CBXA 1TKFA 3ISXA 4MFLA 4XPDC 4ZI6A 3TLGA 2ARHA 2O4HA 1IY7A 2PE3A 4FD5A 4A95A 3NH8A 2DPSA 2G3AA 1DE4C 3R95A 2PRBA 1CP6A 3QAHA 3D7DA 2IQ6A 3G3SA 1Y7RA 1F57A 5AGEA 4YFJA 4MI4A 1N71A 2B3UA 3H5ZA 4B10A 4MCPA 3TLCA 4OC0A 1JQGA 4E5SA 4TJVA 3MGDA 3CXSA 3U88C 4KOVA 2C5QA 5J1QA 4M6IA 4GM5A 2BL1A 2PJ5A 1UFHA 3SI2A 4CAWA 4OMEA 3CXQA 2VZZA 3T07A 5DWMA 2ZOFA 4UBRA 1S60A 4MFPA 4C85A 5AXIA 4ZY0A
chains in the Genus database with same CATH topology
2BCOA 3FX6A 1HEEA 3KR4A 4R6TA 3S9LA 4C8FA 2AFSA 2AFMA 1TXRA 2CTBA 2ZOGA 5K8NA 3B3SA 1YSJA 4BD9A 3PB4X 5LYDA 5HVGA 2XEIA 2FVGA 2ZEPA 3PB9X 2ABZA 1AYEA 3H8GA 3PB7X 2PJ1A 2PRQA 3NH4A 1GYTA 1UWYA 3D4UA 3IEHA 3FMCA 4MHZA 4ZX8A 3TC8A 2PVWA 3LWUA 2V8VA 4C8CA 4C9UA 1M4LA 3VH9A 4LQGA 2GP4A 3FJUA 3CPAA 1LAMA 2EK9A 2PJBA 2GLJA 5LRKA 1Y9ZA 2O53A 5JH9A 4FWUA 3NH5A 2EWBA 3B35A 3RAMA 2ZEHA 3IFEA 3FH4A 2CTCA 1ZG7A 3RZAA 5THWA 2XEGA 3H8FA 4P4EA 4A39A 3B3TA 1LAPA 3WC5A 1VHOA 2JBJA 4ZYQA 1QQ9A 3KZWA 4DJLA 4C9EA 4NGNA 4NJRA 4OC3A 5LYIA 1YMEA 1OBRA 1ZLHA 1ARMA 4OC1A 2OR4A 5D29A 3B3VA 4DUKA 4MHPA 3GB0A 2AFZA 4EMEA 1Z2LA 2C6GA 4OC5A 4NFRA 2AFWA 2G9DA 4YN3A 2PJ2A 5HVHA 4UF4A 2Q4ZA 3QNVA 3D7GA 4PQAA 4P44A 3B2YA 4R7MA 3K9TA 2PJCA 2C6PA 4OC4A 3VARA 5LRGA 4P6YA 2GREA 3BI0A 4C8TA 3L2NA 4NGSA 4MHYA 1ELMP 2ZEOA 4C9RA 4NGQA 4UIBA 4KSIA 3DLJA 3WC6A 2PJ0A 4W9YA 2GLFA 2Q43A 4C9VA 1CPXA 4ZX9A 4PXEA 4C99A 5K8OA 1PYTB 2PJ9A 2HC9A 3B3WA 1XF1A 4TJXA 1H8LA 1XMBA 3ISZA 1ZG9A 1IGBA 3B3CA 3GLJA 1KWMA 4MRIA 4X8IA 4JZ0A 2ZENA 4EFDA 2V8DA 2PCUA 4IHMA 4UEEA 1BPNA 1BPMA 2GU2A 2J9AA 3BI1A 3IWWA 1TF8A 2PJ6A 4PXDA 4TWEA 1CG2A 4PPZA 4R8FA 1Y7EA 2AFOA 4C8AA 3D66A 4TNUA 1LCPA 4A37A 3K2KA 2QJ8A 3PB8X 3BXMA 1VIXA 2F7VA 3PFEA 4NJQA 1LFWA 2C1CA 3IJ3A 4MMOA 3SI0A 3WABA 4IAVA 4NGRA 1AMPA 1LANA 2EK8A 1NSAA 3HLPA 2ZEEA 5LYLA 3CPXA 2PJ4A 1ELLP 4H2KA 1Z8LA 3PEIA 2PJ7A 3SJXA 3HUVA 4ZY1A 2ZEMA 2AFXA 3KHXA 1R3NA 4P4JA 2JBKA 2OOTA 2ZELA 3KASA 3KL9A 3IC1A 3PRTA 1Z5RA 4CPAA 3FECA 3KI9A 4DYOA 4ZI6A 2ZEGA 5HXDA 1DTDA 2BO9A 3VTAA 4EWTA 5K8PA 3SJEA 2WZNA 4OC2A 3V7ZA 1BLLE 2AFUA 5JM6A 4P4IA 4ONWA 3SJFA 1HDUA 2HB6A 3SI1A 5DS0A 1R43A 4MCSA 1VGYA 5JGFA 3JRUA 3FVLA 5ELYA 3LMSA 3WC7A 5CBMA 2PVVA 4FAIA 3PB6X 1XRYA 1CP7A 4NGMA 4ZY2A 1Q7LA 3KQXA 8CPAA 4YU9A 4X3RA 5IB9A 5F09A 1RTQA 1QMUA 4B6ZA 2PJAA 2PIZA 2V8GA 3BHXA 2RFHA 2VL1A 4MCQA 4P10A 3D7FA 4P4FA 1YLOA 3D68A 2IJZA 2ZEFA 3I74A 4JYWA 3RBUA 1HDQA 4CDKA 4NGPA 3PFOA 1F2PA 3T8WA 4WJBA 5I4MA 1FT7A 2XEFA 2QVPA 3MN8A 3B7IA 2PJ3A 3GUXA 4O23A 4C8UA 1WVMA 4F8ZA 5IR2A 2RB7A 4P4BA 3V38A 1XJOA 3KR5A 4P4DA 3FEDA 3D7HA 1XFOA 2F8HA 4OKOA 2C6CA 1ZLIA 3IO1A 4C84A 5CPAA 2ANPA 1LOKA 3H8EA 2Q51A 1ZG8A 2I3CA 3PBBA 4MXUA 4OIWA 4KNGE 4C8PA 2DEAA 3N5FA 3D67A 2NYQA 3PBEA 4C86A 2V8HA 1VHEA 3FF3A 5HVFA 1TKHA 2IMOA 2WYRA 3DGVA 2NSMA 6CPAA 4Q7AA 3CDXA 3KHZA 4FBEA 1EE3P 1F2OA 4G1PA 3NA6A 4MHNA 3KGQA 4RUHA 3EIFA 1Y0RA 2PIYA 1ARLA 1FNOA 3KQZA 2BOAA 2XEJA 4FUUA 1V6CA 3I1UA 1YW6A 4C9AA 1BAVA 1TKJA 4MCRA 4A38A 3S9MA 1CPSA 1XBUA 4YWYA 5LRJA 3SJGA 4UIAA 3FEEA 4F9UA 2POKA 4UEZA 4A94A 4OP4A 3MRUA 4PXCA 1Y0YA 1TF9A 1CX8A 4X2TA 7CPAA 3I6SA 4IK2A 1PCAA 5D8NA 3ICUA 3TX8A 4WWVA 4NGTA 4AXVA 2JEWA 2CIJA 3IIBA 4OIDA 2V77A 4R76A 4K3NA 5K8MA 4CDJA 3S9NA 3CT9A 3NFZA 3WT4A 4P45A 4UEFA 5LYFA 2PJ8A 4PXBA 3VATA 2QYVA 4F9VA 4Z65A 1YW4A 2CF4A 1CBXA 1TKFA 3ISXA 2O4HA 1IY7A 2PE3A 3NH8A 1DE4C 1CP6A 3D7DA 2IQ6A 1F57A 4MCPA 4OC0A 1JQGA 4TJVA 2C5QA 5J1QA 4GM5A 2PJ5A 3SI2A 4OMEA 2ZOFA 2ZEDA 4C85A 4ZY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCO A;  3FX6 A;  1HEE A;  3KR4 A;  4R6T A;  3S9L A;  4C8F A;  2AFS A;  2AFM A;  1TXR A;  2CTB A;  2ZOG A;  5K8N A;  3B3S A;  1YSJ A;  4BD9 A;  3PB4 X;  5LYD A;  5HVG A;  2XEI A;  2FVG A;  2ZEP A;  3PB9 X;  2ABZ A;  1AYE A;  3H8G A;  3PB7 X;  2PJ1 A;  2PRQ A;  3NH4 A;  1GYT A;  1UWY A;  3D4U A;  3IEH A;  3FMC A;  4MHZ A;  4ZX8 A;  3TC8 A;  2PVW A;  3LWU A;  2V8V A;  4C8C A;  4C9U A;  1M4L A;  3VH9 A;  4LQG A;  3FJU A;  3CPA A;  1LAM A;  2EK9 A;  2PJB A;  2GLJ A;  5LRK A;  1Y9Z A;  2O53 A;  5JH9 A;  4FWU A;  3NH5 A;  2EWB A;  3B35 A;  3RAM A;  2ZEH A;  3IFE A;  3FH4 A;  2CTC A;  1ZG7 A;  3RZA A;  5THW A;  2XEG A;  3H8F A;  4P4E A;  4A39 A;  3B3T A;  1LAP A;  3WC5 A;  1VHO A;  2JBJ A;  4ZYQ A;  1QQ9 A;  3KZW A;  4DJL A;  4C9E A;  4NGN A;  4NJR A;  4OC3 A;  5LYI A;  1YME A;  1OBR A;  1ZLH A;  1ARM A;  4OC1 A;  2OR4 A;  5D29 A;  3B3V A;  4DUK A;  4MHP A;  3GB0 A;  2AFZ A;  4EME A;  1Z2L A;  2C6G A;  4OC5 A;  4NFR A;  2AFW A;  2G9D A;  4YN3 A;  2PJ2 A;  5HVH A;  4UF4 A;  2Q4Z A;  3QNV A;  3D7G A;  4PQA A;  4P44 A;  3B2Y A;  4R7M A;  3K9T A;  2PJC A;  2C6P A;  4OC4 A;  3VAR A;  5LRG A;  4P6Y A;  2GRE A;  3BI0 A;  4C8T A;  3L2N A;  4NGS A;  4MHY A;  1ELM P;  2ZEO A;  4C9R A;  4NGQ A;  4UIB A;  4KSI A;  3DLJ A;  3WC6 A;  2PJ0 A;  4W9Y A;  2GLF A;  2Q43 A;  4C9V A;  1CPX A;  4ZX9 A;  4PXE A;  4C99 A;  5K8O A;  1PYT B;  2PJ9 A;  2HC9 A;  3B3W A;  1XF1 A;  4TJX A;  1H8L A;  1XMB A;  3ISZ A;  1ZG9 A;  1IGB A;  3B3C A;  3GLJ A;  1KWM A;  4MRI A;  4X8I A;  4JZ0 A;  2ZEN A;  4EFD A;  2V8D A;  2PCU A;  4IHM A;  4UEE A;  1BPN A;  1BPM A;  2GU2 A;  2J9A A;  3BI1 A;  3IWW A;  1TF8 A;  2PJ6 A;  4PXD A;  4TWE A;  1CG2 A;  4PPZ A;  4R8F A;  1Y7E A;  2AFO A;  4C8A A;  3D66 A;  4TNU A;  1LCP A;  4A37 A;  3K2K A;  2QJ8 A;  3PB8 X;  3BXM A;  1VIX A;  2F7V A;  3PFE A;  4NJQ A;  1LFW A;  2C1C A;  3IJ3 A;  4MMO A;  3SI0 A;  3WAB A;  4IAV A;  4NGR A;  1AMP A;  1LAN A;  2EK8 A;  1NSA A;  3HLP A;  2ZEE A;  5LYL A;  3CPX A;  2PJ4 A;  1ELL P;  4H2K A;  1Z8L A;  3PEI A;  2PJ7 A;  3SJX A;  3HUV A;  4ZY1 A;  2ZEM A;  2AFX A;  3KHX A;  1R3N A;  4P4J A;  2JBK A;  2OOT A;  2ZEL A;  3KAS A;  3KL9 A;  3IC1 A;  3PRT A;  1Z5R A;  4CPA A;  3FEC A;  3KI9 A;  4DYO A;  4ZI6 A;  2ZEG A;  5HXD A;  1DTD A;  2BO9 A;  3VTA A;  4EWT A;  5K8P A;  3SJE A;  2WZN A;  4OC2 A;  3V7Z A;  1BLL E;  2AFU A;  5JM6 A;  4P4I A;  4ONW A;  3SJF A;  1HDU A;  2HB6 A;  3SI1 A;  5DS0 A;  1R43 A;  4MCS A;  1VGY A;  5JGF A;  3JRU A;  3FVL A;  5ELY A;  3LMS A;  3WC7 A;  5CBM A;  2PVV A;  4FAI A;  3PB6 X;  1XRY A;  1CP7 A;  4NGM A;  4ZY2 A;  1Q7L A;  3KQX A;  8CPA A;  4YU9 A;  4X3R A;  5IB9 A;  5F09 A;  1RTQ A;  1QMU A;  4B6Z A;  2PJA A;  2PIZ A;  2V8G A;  3BHX A;  2RFH A;  2VL1 A;  4MCQ A;  4P10 A;  3D7F A;  4P4F A;  1YLO A;  3D68 A;  2IJZ A;  2ZEF A;  3I74 A;  4JYW A;  3RBU A;  1HDQ A;  4CDK A;  4NGP A;  3PFO A;  1F2P A;  3T8W A;  4WJB A;  5I4M A;  1FT7 A;  2XEF A;  2QVP A;  3MN8 A;  3B7I A;  2PJ3 A;  3GUX A;  4O23 A;  4C8U A;  1WVM A;  4F8Z A;  2RB7 A;  4P4B A;  3V38 A;  1XJO A;  3KR5 A;  4P4D A;  3FED A;  3D7H A;  1XFO A;  2F8H A;  4OKO A;  2C6C A;  1ZLI A;  3IO1 A;  4C84 A;  5CPA A;  2ANP A;  1LOK A;  3H8E A;  2Q51 A;  1ZG8 A;  2I3C A;  3PBB A;  4MXU A;  4OIW A;  4KNG E;  4C8P A;  2DEA A;  3N5F A;  3D67 A;  2NYQ A;  3PBE A;  4C86 A;  2V8H A;  1VHE A;  3FF3 A;  5HVF A;  1TKH A;  2IMO A;  2WYR A;  3DGV A;  2NSM A;  6CPA A;  4Q7A A;  3CDX A;  3KHZ A;  4FBE A;  1EE3 P;  1F2O A;  4G1P A;  3NA6 A;  4MHN A;  3KGQ A;  4RUH A;  3EIF A;  1Y0R A;  2PIY A;  1ARL A;  1FNO A;  3KQZ A;  2BOA A;  2XEJ A;  4FUU A;  1V6C A;  3I1U A;  1YW6 A;  4C9A A;  1BAV A;  1TKJ A;  4MCR A;  4A38 A;  3S9M A;  1CPS A;  1XBU A;  4YWY A;  5LRJ A;  3SJG A;  4UIA A;  3FEE A;  4F9U A;  2POK A;  4UEZ A;  4A94 A;  4OP4 A;  3MRU A;  4PXC A;  1Y0Y A;  1TF9 A;  1CX8 A;  4X2T A;  7CPA A;  3I6S A;  4IK2 A;  1PCA A;  5D8N A;  3ICU A;  3TX8 A;  4WWV A;  4NGT A;  4AXV A;  2JEW A;  2CIJ A;  3IIB A;  4OID A;  2V77 A;  4R76 A;  4K3N A;  5K8M A;  4CDJ A;  3S9N A;  3CT9 A;  3NFZ A;  3WT4 A;  4P45 A;  4UEF A;  5LYF A;  2PJ8 A;  4PXB A;  3VAT A;  2QYV A;  4F9V A;  4Z65 A;  1YW4 A;  2CF4 A;  1CBX A;  1TKF A;  3ISX A;  2O4H A;  1IY7 A;  2PE3 A;  3NH8 A;  1DE4 C;  1CP6 A;  3D7D A;  2IQ6 A;  1F57 A;  4MCP A;  4OC0 A;  1JQG A;  4TJV A;  5J1Q A;  4GM5 A;  2PJ5 A;  3SI2 A;  4OME A;  2ZOF A;  2ZED A;  4C85 A;  4ZY0 A; 
#chains in the Genus database with same CATH topology
 1ZO0 A;  2BCO A;  3FX6 A;  1HEE A;  3KR4 A;  4R6T A;  1KEE B;  2HUZ A;  3S9L A;  2AJ6 A;  4QB9 A;  4BMH A;  4BPU B;  2AFS A;  2AFM A;  1TXR A;  5J3X A;  2CTB A;  2ZOG A;  4KOX A;  3R1K A;  5K8N A;  4JWP A;  2WPW A;  4L89 A;  3B3S A;  3R9G A;  3SHP A;  1IU8 A;  1YSJ A;  1OZP A;  3V8I A;  4RR2 B;  2R8V A;  4BD9 A;  3PB4 X;  5LYD A;  3GJZ A;  4B14 A;  4CZ1 A;  5HVG A;  5HMN A;  3T90 A;  3FIX A;  2XEI A;  2FVG A;  4B11 A;  1MJB A;  5G22 A;  4XPD B;  4IIY A;  2ZEP A;  4GXH A;  3PB9 X;  4PSW A;  2ABZ A;  4F0X A;  1AYE A;  3H8G A;  5JVL A;  3PB7 X;  4DNC A;  2PJ1 A;  1YGH A;  1C30 B;  2PRQ A;  2BSW A;  1TIQ A;  1YVH A;  3BUO B;  4AVB A;  3NH4 A;  3FBU A;  3GYA A;  2DLA A;  1GYT A;  1UWY A;  2IL4 A;  3D4U A;  4LQ6 A;  3E0K A;  2PCN A;  3IEH A;  4MHD A;  1R61 A;  3FMC A;  4QUS A;  4MHZ A;  1SQH A;  3ZNI A;  1Z8W A;  4JXR A;  4B5P A;  2FIW A;  2O28 A;  4ZX8 A;  3TC8 A;  1YK3 A;  4RS2 A;  1EO0 A;  2PVW A;  3JTK A;  1CE8 B;  2D4P A;  4R3K A;  1M1D A;  3LWU A;  2V8V A;  4C8C A;  5FVJ A;  2D0O A;  2B3V A;  4C9U A;  4NXY A;  1M4L A;  3VH9 A;  3K4I A;  3U1B A;  4LQG A;  2C27 A;  2GP4 A;  3FJU A;  3CPA A;  1LAM A;  2EK9 A;  4A30 A;  1YRE A;  1V0C A;  2PJB A;  2GLJ A;  5LRK A;  1NSL A;  2PR1 A;  1Y9Z A;  2O53 A;  3DNS A;  5JH9 A;  2P6F A;  2VKZ G;  3NH5 A;  4FWU A;  2EWB A;  3ZZI A;  3B35 A;  5AG6 A;  2OB0 A;  2ZEH A;  2ZPA A;  3RAM A;  3IFE A;  4R87 A;  4AVC A;  3FH4 A;  1KUY A;  2FM4 A;  4KOR A;  4E94 A;  2REF A;  1IOF A;  2CTC A;  1ZG7 A;  3RZA A;  5THW A;  3W6S A;  2XEG A;  3H8F A;  4CDK A;  4P4E A;  4A39 A;  5KTA A;  3B3T A;  1LAP A;  1X10 A;  5HKW A;  2I00 A;  3WC5 A;  1U6M A;  1VHO A;  3PT1 A;  1ZL0 A;  4I49 A;  2JBJ A;  4ZYQ A;  4M8D A;  1QSM A;  2H5M A;  1QQ9 A;  3TE4 A;  1I21 A;  5I0C A;  4YGO A;  1MK4 A;  3KZW A;  4DJL A;  4QC6 A;  4C9E A;  4MY3 A;  1A2Z A;  4NGN A;  3DR8 A;  3IU1 A;  1IB1 E;  4JXQ A;  4NJR A;  1NE9 A;  5GCN A;  4UA3 A;  4GPL B;  4OC3 A;  2QML A;  1YME A;  1OBR A;  1ZLH A;  5LYI A;  1ARM A;  2ZED A;  4OC1 A;  2OR4 A;  2CNT A;  1A9X B;  5D29 A;  4R3L A;  4B13 A;  2B4J C;  2AUN A;  3R96 A;  1Z8X A;  1IIC A;  2Y1M A;  2EBJ A;  3B3V A;  3JVN A;  4DUK A;  5F48 A;  3OB1 B;  2PR8 A;  2Z0Z A;  4MHP A;  3GB0 A;  2AFZ A;  4UFW A;  4A33 A;  3G8W A;  1M4G A;  4Q38 A;  4EME A;  1Z2L A;  2C6G A;  4OC5 A;  4NFR A;  4CGL A;  1B87 A;  1YR0 A;  2AFW A;  2G9D A;  4NEX A;  2GFQ A;  1ZYM A;  4YN3 A;  1QSO A;  2PJ2 A;  4BIN A;  5HVH A;  3F0A A;  2GAN A;  1AUG A;  4UF4 A;  4CAX A;  2Q4Z A;  2Z3P A;  3QNV A;  3D7G A;  3IU2 A;  4M6G A;  3B8G A;  2JLM A;  3F8K A;  4PQA A;  4P44 A;  3B2Y A;  5HKZ A;  4R7M A;  4KLV A;  2J8R A;  4BBH A;  1Q2Y A;  3IGR A;  3K9T A;  2PJC A;  2ZW5 A;  3FXT A;  5F46 A;  2B0A A;  2FSR A;  4AG9 A;  3N7Z A;  3OWC A;  2C6P A;  2R82 A;  4OC4 A;  3SXN A;  3VAR A;  5LRG A;  4P6Y A;  2GE3 A;  3EY5 A;  3LD2 A;  3P2H A;  2GRE A;  3PZJ A;  1VKC A;  2P6E A;  3I9S A;  4KUA A;  3BI0 A;  2JEV A;  2FS5 A;  4C8T A;  3TLZ A;  4CGN A;  3L2N A;  4NGS A;  4JJX A;  4MHY A;  2AUM A;  5F49 A;  4B12 A;  1YX0 A;  1ELM P;  2ZEO A;  3FNC A;  4C9R A;  2PSW A;  1GGO A;  1BOB A;  4NGQ A;  4CDJ A;  4UIB A;  4KSI A;  3DLJ A;  3QAY A;  4FD4 A;  2WPX A;  4OLL A;  4BPW B;  4A32 A;  3WC6 A;  1CS0 B;  3BUN B;  1S5K A;  2PJ0 A;  3UY5 A;  4W9Y A;  3HMJ G;  4CYQ A;  2GLF A;  2Q43 A;  4C9V A;  4IIX A;  5BY0 A;  1CPX A;  4ZX9 A;  4PXE A;  4C99 A;  5K8O A;  3TO9 A;  1PYT B;  2PJ9 A;  3BJ7 A;  4AB7 A;  2DIK A;  2OZG A;  2HC9 A;  5A28 A;  3VGO A;  5J8F A;  3B3W A;  1XF1 A;  1Z9E A;  4TJX A;  1XIX A;  2D0P A;  1H8L A;  4RI1 A;  1VI4 A;  1XMB A;  4ONU A;  4HKF A;  3ISZ A;  1YLE A;  1ZG9 A;  1IGB A;  4COG A;  1MJA A;  3B3C A;  3GLJ A;  3TT2 A;  2EZA A;  1KWM A;  4M6H A;  4R9M A;  4MRI A;  5FD8 A;  4KOT A;  4X8I A;  1J4J A;  2ZW4 A;  1M44 A;  4JZ0 A;  1P0H A;  3FYN A;  2ZEN A;  4EFD A;  2VQY A;  2V8D A;  4CS0 B;  2JDD A;  3TFY A;  4H1H A;  2YNE A;  2PCU A;  4IHM A;  1PUA A;  1WJT A;  4AVA A;  4UEE A;  1BPN A;  4HPS A;  1BPM A;  3TOB A;  3GY9 A;  2X0S A;  3SXO A;  2Z11 A;  2Y0M A;  1I1D A;  1Z8T A;  1Q2C A;  2G0B A;  2GU2 A;  2J9A A;  4OAE A;  4MBU A;  4MJ8 A;  4KSA A;  1PU9 A;  4BPX B;  2F5I A;  2B4D B;  3BI1 A;  3IWW A;  2FCK A;  1TF8 A;  2PJ6 A;  2ZXV A;  1LRZ A;  4PXD A;  2YGW A;  1CG2 A;  4PPZ A;  4TWE A;  2EZB A;  1XOV A;  3BJ8 A;  1WWZ A;  4M85 A;  2Q7S A;  4R8F A;  1Y7E A;  2AFO A;  5IV0 A;  3NE7 A;  1JWQ A;  4C8A A;  3D66 A;  4TNU A;  1P4N A;  1S7L A;  1BO4 A;  4A31 A;  1LCP A;  2PQ8 A;  4A37 A;  3K2K A;  1Y9W A;  4KZT A;  3TLB A;  2QJ8 A;  5DWN A;  3PB8 X;  3BXM A;  1KUX A;  1VIX A;  4JD6 A;  5AG7 A;  5E96 A;  4AG7 A;  4CO9 A;  2F7V A;  2VBQ A;  4OAD A;  3PFE A;  1FBV A;  1QSR A;  2Z3L A;  4NJQ A;  1R57 A;  1LFW A;  3EZB A;  2C1C A;  3IJ3 A;  3RNZ A;  4MMO A;  3SI0 A;  2FXF A;  2ZW6 A;  2AE6 A;  2FT0 A;  3D3S A;  4IAV A;  3WAB A;  1QSN A;  5J8C A;  4NGR A;  3D8P A;  1AMP A;  1LAN A;  2EK8 A;  3TLE A;  2KCW A;  5G21 A;  1NSA A;  2WUU A;  3HLP A;  2B5G A;  2BEI A;  2ZEE A;  4CRZ B;  5G1Z A;  5LYL A;  1XMT A;  3CPX A;  2PJ4 A;  4M3S A;  4MFJ A;  1ELL P;  2YNC C;  1Z8L A;  1MJ9 A;  4H2K A;  4PSX A;  3PEI A;  3S6G A;  1VBH A;  3TYX A;  2PJ7 A;  5EBV A;  3SJX A;  3HUV A;  3TO6 A;  2ZEM A;  2AFX A;  3KHX A;  1R3N A;  2PC1 A;  4ZY1 A;  4CRY B;  4NF1 A;  1NBW A;  4HNY B;  1S7K A;  4P4J A;  4C2X A;  2JBK A;  2OOT A;  4E2A A;  2ZEL A;  5JYB A;  3KAS A;  4C8F A;  2EUI A;  3LOD A;  3VWD A;  3KL9 A;  2FE7 A;  3IC1 A;  3PRT A;  2Q4Y A;  2R7H A;  3VRN A;  1DIK A;  1Z5R A;  4CPA A;  3FEC A;  3EZE A;  3NOJ A;  3OAK A;  3KI9 A;  1IID A;  5K99 A;  4DYO A;  2D4O A;  5KTD A;  3R9E A;  2ZEG A;  5CNP A;  4A4C A;  1NMT A;  1M4D A;  1DTD A;  3CZX A;  4ORF A;  3S6F A;  4LX9 A;  5HXD A;  4MI1 A;  4XNH C;  2BO9 A;  5F5X A;  2P6G A;  2FL4 A;  2DPT A;  4JVO A;  3NFQ A;  3K9U A;  4ZGY B;  5H84 A;  3VTA A;  2WSA A;  2DF5 A;  4E0A A;  1CJW A;  4EWT A;  3SJE A;  5K8P A;  2B4D A;  2OZU A;  3JUW A;  2WZN A;  3PGP A;  2Y1N A;  1JDE A;  4OC2 A;  3V7Z A;  1BLL E;  1IOI A;  2AFU A;  5AG4 A;  2UV8 G;  4E8O A;  2XPP A;  1VBG A;  2XPN A;  1L0C A;  2YJT A;  3PFV A;  2QIR A;  5JM6 A;  3C8O A;  4P4I A;  2OZH A;  4J3G A;  4ONW A;  4CGM A;  4B5O A;  3TO7 A;  3LAC A;  3SJF A;  1HDU A;  2HB6 A;  4CGP A;  1RO5 A;  3SI1 A;  3HPG G;  5DS0 A;  1R43 A;  3TCV A;  4MCS A;  3DSB A;  4KVO E;  1KUV A;  3S6K A;  3VRO A;  1VGY A;  1IYL A;  5JGF A;  2I79 A;  5JPH A;  3JRU A;  3HPH E;  2EZC A;  2VXK A;  3IWG A;  1Z9U A;  3FVL A;  5ELY A;  2Q4V A;  3LMS A;  1C3O B;  2NMT A;  3PP9 A;  4C2Y A;  2E28 A;  3RO0 A;  2HQY A;  4CYO A;  3WC7 A;  5F9M A;  5CBM A;  5IB0 A;  2PVV A;  3D2M A;  4FAI A;  1T36 B;  4NCZ A;  3PB6 X;  1J3L A;  2HWG A;  1S7F A;  1XRY A;  2XPL A;  2R98 A;  4PK2 A;  4XPK A;  4XNH B;  3SR3 A;  1CP7 A;  2ZW7 A;  5EMI A;  4NGM A;  2J8M A;  4ZY2 A;  4F6A A;  5C82 A;  4C2Z A;  2B5G B;  1Q7L A;  2MP0 A;  4PK3 A;  3KQX A;  2HI6 A;  3T5M A;  8CPA A;  4YU9 A;  1Z4E A;  3OP0 A;  4X3R A;  3S6H A;  4HNX B;  1YVO A;  5AG5 A;  1ON0 A;  3VRP A;  2PDO A;  4EVY A;  5F09 A;  3FB3 A;  4QVT A;  4U9Z A;  5IB9 A;  1RTQ A;  1KC7 A;  4U9Y A;  2Q44 A;  1QMU A;  4B6Z A;  2PJA A;  2PIZ A;  4MFZ A;  1RXT A;  5ISV A;  3A9L A;  4UCM A;  2EVN A;  2Z3M A;  2EO8 A;  2V8G A;  3BHX A;  1M4I A;  2RFH A;  2VL1 A;  2XPO A;  4MCQ A;  4P10 A;  4R57 A;  1B47 A;  2Z3K A;  4LUA A;  3D7F A;  4P4F A;  1YLO A;  3DR6 A;  4UWJ A;  5EC4 A;  3D68 A;  4HNW B;  3TTH A;  5KTC A;  2IJZ A;  2ZEF A;  3I74 A;  2JDC A;  1XEB A;  4JYW A;  3RBU A;  4CGO A;  1KBL A;  2ATR A;  1XF8 A;  3I3G A;  4GS4 A;  2CXA A;  1HDQ A;  3GIU A;  3CXP A;  4NGP A;  3PFO A;  4CAV A;  3C26 A;  1F2P A;  3NE8 A;  3QB8 A;  3T8W A;  4WJB A;  5I4M A;  1FT7 A;  4UWI A;  4KOY A;  4J0N A;  2XEF A;  1ZRS A;  2K5T A;  1IYK A;  2QVP A;  2VI7 A;  3MN8 A;  4K30 A;  4KUB A;  3B7I A;  3P2F A;  4PV6 A;  4KOU A;  2PJ3 A;  2YNC A;  3GUX A;  4O23 A;  4C8U A;  2N3A B;  1WVM A;  3BUX B;  2REE A;  3W6X A;  2HV2 A;  1NXJ A;  2Z3O A;  5JQ4 A;  3O8Z A;  4F8Z A;  3EFA A;  3ZJ0 A;  5IR2 A;  3KRV A;  4IUS A;  2RB7 A;  5G20 A;  4P4B A;  1Z4R A;  4FD7 A;  1XJO A;  3KR5 A;  2B4B A;  4P4D A;  3V38 A;  4CAE A;  5F1Y A;  3H4Q A;  1X12 A;  3IWE A;  3F9K C;  3D7H A;  3FED A;  2B58 A;  3OB2 B;  3DDD A;  4UCN A;  3T9Y A;  3EZA A;  1XFO A;  2CNM A;  2Z3N A;  3W91 A;  1K4J A;  2VEZ A;  2F8H A;  4OKO A;  3BUW B;  2C6C A;  1ZLI A;  3IO1 A;  4C84 A;  5BWA B;  3KKW A;  4MJX A;  5CPA A;  2A4N A;  4QBJ A;  2ANP A;  2CY2 A;  4C68 A;  4KOW A;  4II9 A;  1LOK A;  3H8E A;  2Q51 A;  2QEC A;  2HRO A;  4CYN A;  1ZG8 A;  2Q7B A;  2I3C A;  4C7H A;  2VZY A;  3PBB A;  4JLY A;  4MXU A;  4OIW A;  4KNG E;  4C8P A;  3G23 A;  4BTF A;  2DEA A;  4KLW A;  3EC4 A;  2Q04 A;  3N5F A;  4NSQ A;  4Y49 C;  1Q5X A;  4EYS A;  1YVK A;  4UFX A;  3EO4 A;  5F13 A;  3D67 A;  2NYQ A;  3PBE A;  2CBL A;  4C86 A;  2Q0Y A;  2V8H A;  1VHE A;  4A4B A;  3FF3 A;  3T0T A;  4XPL A;  5HVF A;  1TKH A;  2IMO A;  2WYR A;  4COB A;  3GKR A;  2FIA A;  3DGV A;  2NSM A;  4U5Y A;  1B6B A;  2P0W A;  1CM0 A;  4KS9 A;  6CPA A;  3TLG B;  1WK4 A;  2OLS A;  4Q7A A;  1FY7 A;  3CDX A;  3KHZ A;  2OU2 A;  4H6U A;  1EE3 P;  4FBE A;  4FD6 A;  1F2O A;  1Y9K A;  3NA6 A;  4G1P A;  4MHN A;  3RYO A;  2ODF A;  3KGQ A;  1EZA A;  2DXQ A;  4L8A A;  4RUH A;  3EIF A;  1Y0R A;  4KVX A;  1KZF A;  2PIY A;  1ARL A;  4KOS A;  1FNO A;  3KQZ A;  2BOA A;  2XEJ A;  4FUU A;  1V6C A;  3VRQ A;  3I1U A;  1YW6 A;  3TLY A;  3BLN A;  3VWE A;  3VRR A;  4C9A A;  1BAV A;  4RN7 A;  1TKJ A;  4MCR A;  3TOA A;  1EZB A;  1S7N A;  2Z10 A;  4A38 A;  3S9M A;  1CPS A;  4KVM E;  3PLF B;  1XBU A;  4YWY A;  3BUM B;  4Q36 A;  5LRJ A;  3SJG A;  3F5B A;  1GHE A;  4Y49 B;  5A27 A;  4UIA A;  5IX3 A;  3FEE A;  4CAF A;  4F9U A;  2POK A;  4UEZ A;  4A94 A;  4OP4 A;  4F0Y A;  2J8N A;  3MRU A;  4H89 A;  2G3T A;  4PXC A;  1Y0Y A;  1TF9 A;  1CX8 A;  4X2T A;  1S3Z A;  7CPA A;  2BUE A;  4ZBG A;  2YND A;  3I6S A;  2OH1 A;  1Q2D A;  4IK2 A;  1PCA A;  3EXN A;  5D8N A;  1M6V B;  3TLA A;  1VHS A;  5F47 A;  3ICU A;  4CYP A;  5H86 A;  2GIV A;  4X5K A;  3TX8 A;  4WWV A;  3D2P A;  4NGT A;  4AXV A;  1BXR B;  2YJV A;  4INJ A;  2JEW A;  2CIJ A;  3IIB A;  4OID A;  2V77 A;  4R76 A;  4K3N A;  4H6Z A;  5HKY A;  1QST A;  5K8M A;  5C88 A;  3S9N A;  1YQE A;  3CT9 A;  3NFZ A;  4C7I A;  3WT4 A;  4UCP A;  4P45 A;  1XE4 A;  4IF5 A;  3FRM A;  4UEF A;  2X7B A;  4UFV A;  4B5P B;  5LYF A;  1I12 A;  2CNS A;  4YRH A;  1JDB C;  2PJ8 A;  4KSF A;  4MFQ A;  4MFK A;  4PXB A;  3VAT A;  3WR7 A;  3R9F A;  4A2Z A;  3T05 A;  5HH1 A;  2QYV A;  2R1I A;  4F9V A;  4Z65 A;  2RC4 A;  1YW4 A;  2CF4 A;  4MY0 A;  1CBX A;  1TKF A;  3ISX A;  4MFL A;  4XPD C;  4ZI6 A;  3TLG A;  2ARH A;  2O4H A;  1IY7 A;  2PE3 A;  4FD5 A;  4A95 A;  3NH8 A;  2DPS A;  2G3A A;  1DE4 C;  3R95 A;  2PRB A;  1CP6 A;  3QAH A;  3D7D A;  2IQ6 A;  3G3S A;  1Y7R A;  1F57 A;  5AGE A;  4YFJ A;  4MI4 A;  1N71 A;  2B3U A;  3H5Z A;  4B10 A;  4MCP A;  3TLC A;  4OC0 A;  1JQG A;  4E5S A;  4TJV A;  3MGD A;  3CXS A;  3U88 C;  4KOV A;  2C5Q A;  5J1Q A;  4M6I A;  4GM5 A;  2BL1 A;  2PJ5 A;  1UFH A;  3SI2 A;  4CAW A;  4OME A;  3CXQ A;  2VZZ A;  3T07 A;  5DWM A;  2ZOF A;  4UBR A;  1S60 A;  4MFP A;  4C85 A;  5AXI A;  4ZY0 A; 
#chains in the Genus database with same CATH homology
 2BCO A;  3FX6 A;  1HEE A;  3KR4 A;  4R6T A;  3S9L A;  4C8F A;  2AFS A;  2AFM A;  1TXR A;  2CTB A;  2ZOG A;  5K8N A;  3B3S A;  1YSJ A;  4BD9 A;  3PB4 X;  5LYD A;  5HVG A;  2XEI A;  2FVG A;  2ZEP A;  3PB9 X;  2ABZ A;  1AYE A;  3H8G A;  3PB7 X;  2PJ1 A;  2PRQ A;  3NH4 A;  1GYT A;  1UWY A;  3D4U A;  3IEH A;  3FMC A;  4MHZ A;  4ZX8 A;  3TC8 A;  2PVW A;  3LWU A;  2V8V A;  4C8C A;  4C9U A;  1M4L A;  3VH9 A;  4LQG A;  2GP4 A;  3FJU A;  3CPA A;  1LAM A;  2EK9 A;  2PJB A;  2GLJ A;  5LRK A;  1Y9Z A;  2O53 A;  5JH9 A;  4FWU A;  3NH5 A;  2EWB A;  3B35 A;  3RAM A;  2ZEH A;  3IFE A;  3FH4 A;  2CTC A;  1ZG7 A;  3RZA A;  5THW A;  2XEG A;  3H8F A;  4P4E A;  4A39 A;  3B3T A;  1LAP A;  3WC5 A;  1VHO A;  2JBJ A;  4ZYQ A;  1QQ9 A;  3KZW A;  4DJL A;  4C9E A;  4NGN A;  4NJR A;  4OC3 A;  5LYI A;  1YME A;  1OBR A;  1ZLH A;  1ARM A;  4OC1 A;  2OR4 A;  5D29 A;  3B3V A;  4DUK A;  4MHP A;  3GB0 A;  2AFZ A;  4EME A;  1Z2L A;  2C6G A;  4OC5 A;  4NFR A;  2AFW A;  2G9D A;  4YN3 A;  2PJ2 A;  5HVH A;  4UF4 A;  2Q4Z A;  3QNV A;  3D7G A;  4PQA A;  4P44 A;  3B2Y A;  4R7M A;  3K9T A;  2PJC A;  2C6P A;  4OC4 A;  3VAR A;  5LRG A;  4P6Y A;  2GRE A;  3BI0 A;  4C8T A;  3L2N A;  4NGS A;  4MHY A;  1ELM P;  2ZEO A;  4C9R A;  4NGQ A;  4UIB A;  4KSI A;  3DLJ A;  3WC6 A;  2PJ0 A;  4W9Y A;  2GLF A;  2Q43 A;  4C9V A;  1CPX A;  4ZX9 A;  4PXE A;  4C99 A;  5K8O A;  1PYT B;  2PJ9 A;  2HC9 A;  3B3W A;  1XF1 A;  4TJX A;  1H8L A;  1XMB A;  3ISZ A;  1ZG9 A;  1IGB A;  3B3C A;  3GLJ A;  1KWM A;  4MRI A;  4X8I A;  4JZ0 A;  2ZEN A;  4EFD A;  2V8D A;  2PCU A;  4IHM A;  4UEE A;  1BPN A;  1BPM A;  2GU2 A;  2J9A A;  3BI1 A;  3IWW A;  1TF8 A;  2PJ6 A;  4PXD A;  4TWE A;  1CG2 A;  4PPZ A;  4R8F A;  1Y7E A;  2AFO A;  4C8A A;  3D66 A;  4TNU A;  1LCP A;  4A37 A;  3K2K A;  2QJ8 A;  3PB8 X;  3BXM A;  1VIX A;  2F7V A;  3PFE A;  4NJQ A;  1LFW A;  2C1C A;  3IJ3 A;  4MMO A;  3SI0 A;  3WAB A;  4IAV A;  4NGR A;  1AMP A;  1LAN A;  2EK8 A;  1NSA A;  3HLP A;  2ZEE A;  5LYL A;  3CPX A;  2PJ4 A;  1ELL P;  4H2K A;  1Z8L A;  3PEI A;  2PJ7 A;  3SJX A;  3HUV A;  4ZY1 A;  2ZEM A;  2AFX A;  3KHX A;  1R3N A;  4P4J A;  2JBK A;  2OOT A;  2ZEL A;  3KAS A;  3KL9 A;  3IC1 A;  3PRT A;  1Z5R A;  4CPA A;  3FEC A;  3KI9 A;  4DYO A;  4ZI6 A;  2ZEG A;  5HXD A;  1DTD A;  2BO9 A;  3VTA A;  4EWT A;  5K8P A;  3SJE A;  2WZN A;  4OC2 A;  3V7Z A;  1BLL E;  2AFU A;  5JM6 A;  4P4I A;  4ONW A;  3SJF A;  1HDU A;  2HB6 A;  3SI1 A;  5DS0 A;  1R43 A;  4MCS A;  1VGY A;  5JGF A;  3JRU A;  3FVL A;  5ELY A;  3LMS A;  3WC7 A;  5CBM A;  2PVV A;  4FAI A;  3PB6 X;  1XRY A;  1CP7 A;  4NGM A;  4ZY2 A;  1Q7L A;  3KQX A;  8CPA A;  4YU9 A;  4X3R A;  5IB9 A;  5F09 A;  1RTQ A;  1QMU A;  4B6Z A;  2PJA A;  2PIZ A;  2V8G A;  3BHX A;  2RFH A;  2VL1 A;  4MCQ A;  4P10 A;  3D7F A;  4P4F A;  1YLO A;  3D68 A;  2IJZ A;  2ZEF A;  3I74 A;  4JYW A;  3RBU A;  1HDQ A;  4CDK A;  4NGP A;  3PFO A;  1F2P A;  3T8W A;  4WJB A;  5I4M A;  1FT7 A;  2XEF A;  2QVP A;  3MN8 A;  3B7I A;  2PJ3 A;  3GUX A;  4O23 A;  4C8U A;  1WVM A;  4F8Z A;  5IR2 A;  2RB7 A;  4P4B A;  3V38 A;  1XJO A;  3KR5 A;  4P4D A;  3FED A;  3D7H A;  1XFO A;  2F8H A;  4OKO A;  2C6C A;  1ZLI A;  3IO1 A;  4C84 A;  5CPA A;  2ANP A;  1LOK A;  3H8E A;  2Q51 A;  1ZG8 A;  2I3C A;  3PBB A;  4MXU A;  4OIW A;  4KNG E;  4C8P A;  2DEA A;  3N5F A;  3D67 A;  2NYQ A;  3PBE A;  4C86 A;  2V8H A;  1VHE A;  3FF3 A;  5HVF A;  1TKH A;  2IMO A;  2WYR A;  3DGV A;  2NSM A;  6CPA A;  4Q7A A;  3CDX A;  3KHZ A;  4FBE A;  1EE3 P;  1F2O A;  4G1P A;  3NA6 A;  4MHN A;  3KGQ A;  4RUH A;  3EIF A;  1Y0R A;  2PIY A;  1ARL A;  1FNO A;  3KQZ A;  2BOA A;  2XEJ A;  4FUU A;  1V6C A;  3I1U A;  1YW6 A;  4C9A A;  1BAV A;  1TKJ A;  4MCR A;  4A38 A;  3S9M A;  1CPS A;  1XBU A;  4YWY A;  5LRJ A;  3SJG A;  4UIA A;  3FEE A;  4F9U A;  2POK A;  4UEZ A;  4A94 A;  4OP4 A;  3MRU A;  4PXC A;  1Y0Y A;  1TF9 A;  1CX8 A;  4X2T A;  7CPA A;  3I6S A;  4IK2 A;  1PCA A;  5D8N A;  3ICU A;  3TX8 A;  4WWV A;  4NGT A;  4AXV A;  2JEW A;  2CIJ A;  3IIB A;  4OID A;  2V77 A;  4R76 A;  4K3N A;  5K8M A;  4CDJ A;  3S9N A;  3CT9 A;  3NFZ A;  3WT4 A;  4P45 A;  4UEF A;  5LYF A;  2PJ8 A;  4PXB A;  3VAT A;  2QYV A;  4F9V A;  4Z65 A;  1YW4 A;  2CF4 A;  1CBX A;  1TKF A;  3ISX A;  2O4H A;  1IY7 A;  2PE3 A;  3NH8 A;  1DE4 C;  1CP6 A;  3D7D A;  2IQ6 A;  1F57 A;  4MCP A;  4OC0 A;  1JQG A;  4TJV A;  2C5Q A;  5J1Q A;  4GM5 A;  2PJ5 A;  3SI2 A;  4OME A;  2ZOF A;  2ZED A;  4C85 A;  4ZY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...