4NGRA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
689
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 261
structure length 689
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngrA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngrA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngrA02
2AFXA 3GLJA 3KHZA 3D7HA 4NGRA 4MHNA 2GLJA 3B3CA 4MHZA 3JRUA 4FAIA 3KL9A 3BI0A 2ZENA 2QVPA 3PB7X 3SJFA 3ISXA 2ABZA 2ZEEA 4P4IA 5JGFA 1V6CA 4B6ZA 3FJUA 4UEFA 1HDUA 1CG2A 1R43A 1ZG9A 3EIFA 4FBEA 1BPMA 4C8AA 2ZEFA 3DLJA 4P4DA 1XJOA 3BHXA 4A39A 3I1UA 4ZY2A 2CF4A 1LFWA 1CPXA 4C84A 2ZEMA 1RTQA 4K3NA 4C85A 4P4JA 2AFSA 4OIWA 2V8DA 1ZG8A 4MCQA 2AFUA 1ARMA 1UWYA 3KASA 5THWA 4CPAA 1QMUA 3HLPA 3SI2A 3V7ZA 4X8IA 1WVMA 2PVVA 2J9AA 4ZYQA 2PJ5A 4UF4A 2QYVA 4NGQA 3FMCA 2EWBA 3KQZA 2HB6A 1ELLP 4NFRA 3N5FA 2ZOFA 1TKJA 4KNGE 1LOKA 2PJ9A 3BXMA 4YU9A 3I6SA 4MMOA 1BLLE 3VH9A 3IIBA 5HVGA 4DJLA 4UEEA 4OC2A 1H8LA 2JBJA 5LRJA 2JEWA 2XEFA 3ISZA 5HVFA 1JQGA 2POKA 3PB8X 4OC3A 3IJ3A 5CPAA 4C8FA 3PB4X 2O4HA 3RAMA 1VHEA 4RUHA 2XEGA 2ZELA 3HUVA 5DS0A 3SI1A 4PXEA 4C9RA 4IAVA 4YWYA 2WZNA 2CTCA 2C6GA 1VGYA 4PXDA 1CPSA 5HXDA 3S9NA 5J1QA 4C8CA 1F2PA 4JYWA 5JM6A 2BO9A 2XEJA 1LAPA 3NH5A 1ZLHA 2PIYA 2ZEGA 3CDXA 3B3VA 1NSAA 1Y9ZA 4A38A 2PJAA 3D68A 2DEAA 4LQGA 4C9EA 2PJ2A 1Y0RA 1TKFA 3K9TA 5K8PA 4C9VA 4NGTA 3H8GA 3KGQA 1XF1A 1Y7EA 2IJZA 5CBMA 5LYDA 4C8TA 3FEDA 1HDQA 4G1PA 3D7FA 4FWUA 3D7GA 2RFHA 4P6YA 3S9MA 1F2OA 2ZEHA 4MCRA 1ARLA 2AFMA 3V38A 2PE3A 1IY7A 2Q51A 4CDKA 3PRTA 3SI0A 3FVLA 5HVHA 2F8HA 2AFWA 3CPXA 3B3WA 2PIZA 2Q4ZA 4R7MA 1DE4C 4MRIA 4OIDA 1Y0YA 4TWEA 4NGMA 3CT9A 2QJ8A 4OMEA 3PBBA 4X2TA 2CIJA 2WYRA 4OC4A 2BCOA 4EMEA 1IGBA 1HEEA 4X3RA 1YW6A 2PJ1A 2V8VA 4MHYA 2PJBA 3VARA 1R3NA 3KZWA 3KR5A 3FEEA 4ZX9A 3NH8A 1LCPA 3WC7A 4TNUA 2JBKA 4MXUA 4O23A 2AFZA 2O53A 3ICUA 5LYIA 3L2NA 4R6TA 3KHXA 5K8MA 3WC5A 2PJ7A 4P4BA 2PJCA 4OKOA 4EWTA 2ZEPA 2BOAA 2PJ0A 4C8PA 4TJVA 1TXRA 4NGNA 2ZOGA 4PXBA 2GREA 1Z5RA 2G9DA 1ZG7A 3IC1A 3H8FA 4UEZA 5LYLA 1CP7A 3GB0A 5K8NA 2F7VA 4FUUA 4P4FA 1XRYA 1YW4A 3SJXA 4MCPA 3D67A 2AFOA 2PCUA 2Q43A 3NFZA 4P10A 4IHMA 2NSMA 4P4EA 2C6CA 3BI1A 1KWMA 3FX6A 1TKHA 1QQ9A 3TC8A 3RBUA 4ZY0A 4OC1A 3SJEA 1AYEA 4WWVA 4OC5A 5F09A 4ZY1A 1BPNA 4P45A 5K8OA 3B2YA 1Z2LA 5JH9A 1DTDA 2EK8A 1GYTA 1TF8A 1CBXA 4R76A 1BAVA 3D7DA 4Q7AA 1OBRA 2GLFA 2PJ4A 3KI9A 5I4MA 8CPAA 4P44A 4NGPA 1LAMA 4BD9A 3B35A 4YN3A 4F9VA 3PEIA 4MCSA 3LWUA 3H8EA 4WJBA 3WT4A 2PJ6A 4A94A 4ZI6A 3B3SA 2FVGA 4NJQA 3D4UA 5LRKA 3MN8A 3K2KA 1YSJA 7CPAA 2OR4A 5ELYA 1PCAA 1YLOA 3LMSA 4ZX8A 4C9UA 1LANA 4Z65A 2C1CA 1VIXA 5D8NA 4IK2A 2NYQA 2ANPA 2PVWA 2GU2A 3IO1A 1CX8A 2V8GA 3PB9X 4KSIA 2IMOA 1AMPA 2ZEOA 2ZEDA 1ZLIA 4TJXA 3PFOA 2EK9A 3QNVA 3WABA 3MRUA 2RB7A 4F8ZA 4DUKA 1VHOA 1XFOA 4R8FA 5LYFA 3IFEA 3WC6A 3VTAA 1TF9A 2IQ6A 1XBUA 3B7IA 4DYOA 3D66A 4GM5A 4JZ0A 4F9UA 3RZAA 1YMEA 3CPAA 1Z8LA 3FF3A 4C9AA 2I3CA 3SJGA 6CPAA 4PXCA 3FECA 3KQXA 1Q7LA 3VATA 2PRQA 1PYTB 4AXVA 1F57A 2HC9A 4UIAA 3DGVA 1FT7A 5IB9A 2VL1A 4H2KA 2C6PA 2XEIA 3IWWA 4C99A 3PB6X 5LRGA 4MHPA 4NGSA 3FH4A 3S9LA 2PJ8A 4OP4A 3GUXA 4C86A 3I74A 3TX8A 3PBEA 2CTBA 1EE3P 2OOTA 3NA6A 3IEHA 5D29A 1XMBA 4PPZA 4OC0A 1M4LA 3NH4A 1FNOA 4EFDA 2PJ3A 4UIBA 3T8WA 4C8UA 3B3TA 2V77A 2V8HA 4CDJA 4NJRA 4W9YA 3PFEA 4ONWA 1ELMP 4A37A 4PQAA 3KR4A 1CP6A
chains in the Genus database with same CATH superfamily
2AFXA 2A4NA 3GLJA 4QC6A 3S6GA 3QAHA 2O28A 3KHZA 2YNCC 3D7HA 3PLFB 4NGRA 2DF5A 4M85A 2GLJA 3B3CA 4MHNA 3JRUA 4MHZA 1FY7A 2B4DA 3KL9A 3BI0A 4E2AA 4FAIA 2ZENA 1MJ9A 2QVPA 4K30A 4MFPA 1CE8B 2MP0A 3T05A 3VRNA 3SJFA 3ISXA 3PB7X 2ABZA 4F6AA 2ZEEA 2B4BA 4P4IA 5JGFA 4M3SA 3HPGG 3FJUA 4B6ZA 1V6CA 2HWGA 2J8MA 1VKCA 1HDUA 1CG2A 4UEFA 1TIQA 1R43A 1ZG9A 3EIFA 2FE7A 4FBEA 5F5XA 4CGOA 1BPMA 4C8AA 2EZCA 5KTDA 2ZEFA 2Y0MA 3V8IA 1VHSA 3DLJA 5AG6A 1QSMA 4KOSA 2ZPAA 4PK2A 5IB0A 4PSXA 4P4DA 1XJOA 3BHXA 4A30A 1SQHA 4H1HA 2YNDA 4A39A 3B8GA 4KVOE 4MJXA 3I1UA 4ZY2A 2CF4A 2Z3PA 1LFWA 4A4BA 4ORFA 1CPXA 3IU2A 2D4PA 2ZEMA 1RTQA 4K3NA 4U9ZA 3GY9A 4RN7A 1CM0A 4RS2A 2D0OA 3G23A 4C85A 1N71A 4KOTA 4P4JA 5HKYA 1MK4A 1Y7RA 2AFSA 4OIWA 2OLSA 3DR6A 2V8DA 1ZG8A 4MCQA 4UCNA 2AFUA 4IF5A 1ARMA 4NF1A 1UWYA 2XPNA 3KASA 5THWA 4CPAA 3BUOB 1QMUA 4KVME 2REEA 4YFJA 1M1DA 3HLPA 3SI2A 3RO0A 3V7ZA 4BINA 4CGNA 4X8IA 1BXRB 4KSAA 2PVVA 3SHPA 5BY0A 3NFQA 2J9AA 2Q7BA 2PJ5A 3W6SA 4ZYQA 2R8VA 3G8WA 4B13A 4UF4A 2QYVA 1VBHA 2DIKA 4COBA 2G3TA 4NGQA 4XPKA 2CNSA 3QAYA 2DLAA 3FMCA 3OWCA 2EWBA 1GHEA 3OB2B 3IU1A 3KQZA 2HB6A 1ELLP 4BPXB 4NFRA 3BUWB 3VGOA 3N5FA 2ZOFA 2Q7SA 4OAEA 4ZBGA 1TKJA 2FIAA 2R7HA 4KNGE 1LOKA 2I79A 3BXMA 2PJ9A 4YU9A 3I6SA 4MMOA 3O8ZA 1BLLE 3W6XA 3VH9A 3IIBA 5EBVA 5HVGA 1KEEB 4DJLA 4C7HA 5BWAB 2CY2A 2OB0A 4B10A 3TTHA 3MGDA 5IX3A 2R98A 4B12A 2EUIA 3GIUA 4I49A 4OC2A 1H8LA 2Z3LA 2JBJA 4MY3A 2BL1A 3NE8A 4UEEA 5AGEA 1IICA 1Y9WA 2Q4YA 4KOWA 4OADA 3T90A 3ZZIA 5LRJA 2JEWA 3TYXA 2XEFA 3ISZA 2CBLA 4UWJA 5HVFA 4KVXA 4EYSA 1IYLA 1JQGA 2POKA 3PB8X 3FIXA 1CJWA 4OC3A 2VZYA 3IJ3A 5CPAA 4CAVA 4C8FA 4UCPA 3VTAA 3PB4X 4XNHB 2O4HA 3RAMA 4YRHA 2EZAA 3PFVA 1LRZA 1VHEA 4RUHA 3T07A 2XEGA 4H6UA 2ZELA 1PUAA 3HUVA 5E96A 2OH1A 4QB9A 1KC7A 4R57A 5DS0A 3SI1A 2H5MA 4PXEA 3T9YA 2B3UA 4C9RA 4F0XA 2OZUA 4R87A 4IAVA 4YWYA 2WZNA 4FD7A 4UFVA 3OB1B 1IYKA 1KUXA 1XEBA 2CTCA 2QECA 5FVJA 1S5KA 4CRZB 1Q2CA 2P6GA 3TLEA 2C6GA 1VGYA 4PXDA 2IL4A 3KRVA 2B5GA 1CPSA 5HXDA 5KTCA 4LUAA 3VROA 3S9NA 1BO4A 5J1QA 2VZZA 4BTFA 1Q2YA 4C8CA 4ZGYB 5HMNA 2UV8G 1F2PA 4MY0A 2X7BA 4JYWA 3S6FA 2B4JC 3RNZA 5AG7A 3F8KA 5HKWA 2BUEA 2BO9A 3EO4A 4X5KA 2XEJA 2C27A 3FB3A 1LAPA 1XMTA 1WVMA 5A28A 2JDDA 4GXHA 4AG7A 3QB8A 1QSTA 1Z4EA 3NH5A 3S6KA 1ZLHA 4COGA 2PIYA 2ZEGA 2Z3NA 3CDXA 3VWDA 3B3VA 1P0HA 1NSAA 4M6IA 2B58A 1Y9ZA 2I00A 4A38A 2PJAA 3D68A 2ARHA 2DEAA 2HUZA 3BLNA 3D2MA 2EO8A 4LQGA 3SXOA 1J4JA 4C9EA 4HPSA 5EMIA 2PJ2A 4R9MA 2B0AA 2FT0A 1IIDA 4E5SA 1Y0RA 4DNCA 1TKFA 1YVKA 3K9TA 5K8PA 1CS0B 4C9VA 4NGTA 2REFA 3H8GA 3KGQA 5IR2A 1XF1A 4GPLB 4PK3A 4IIYA 1Y7EA 4JD6A 2DPTA 3JUWA 3IWEA 4JXQA 2IJZA 5KTAA 3VWEA 2Y1MA 3GJZA 5CBMA 5LYDA 4C8TA 4AG9A 5JM6A 3FEDA 2OU2A 1HDQA 1X10A 2Q44A 3D3SA 4G1PA 5G1ZA 4CYNA 3TE4A 2XPPA 3D7FA 4HKFA 4C84A 1YX0A 4MFJA 2EVNA 3D7GA 2RFHA 4FWUA 4P6YA 3S9MA 3CXSA 4CGPA 4A33A 1F2OA 3SR3A 2ZEHA 1KBLA 4MCRA 1ARLA 2AFMA 3R9EA 2KCWA 3V38A 1T36B 4AVAA 4MI1A 2PE3A 1IY7A 2N3AB 3CZXA 2BEIA 2Q51A 3DR8A 3PRTA 4KS9A 3R9FA 3SI0A 1Q5XA 4CDKA 3K9UA 3FVLA 3TLGB 5HVHA 4MFQA 2F8HA 2AFWA 2R82A 3TLYA 1YREA 3CPXA 1MJBA 2K5TA 3B3WA 4J3GA 3F0AA 2PIZA 1ZO0A 2Q4ZA 4M8DA 3TCVA 4R7MA 1DE4C 1L0CA 4MRIA 4OIDA 1YK3A 4MFLA 4XPDB 1Y0YA 2B4DB 1R61A 2Z3MA 5F1YA 4TWEA 5CNPA 1ON0A 4NGMA 3CT9A 1NSLA 1S7FA 2QJ8A 2Z0ZA 4OMEA 3PBBA 4MJ8A 4MBUA 4JVOA 4X2TA 2VQYA 3U1BA 2CIJA 2WYRA 4OC4A 2BCOA 4EMEA 1IGBA 1A9XB 1HEEA 4X3RA 4BPUB 1YW6A 5A27A 2PJ1A 2V8VA 5HKZA 4MHYA 2YGWA 2J8NA 2PJBA 4ONUA 1KZFA 5J3XA 3VARA 1R3NA 4KZTA 2D4OA 4L8AA 3KZWA 3KR5A 3FEEA 4UFXA 4ZX9A 3NH8A 1LCPA 2Z3OA 3WC7A 1I12A 4TNUA 4A31A 4EVYA 3EFAA 2PSWA 2JBKA 2G3AA 4MXUA 3TO7A 3GYAA 4O23A 5C88A 2AFZA 2O53A 3ICUA 2GE3A 2P0WA 2ZW5A 3L2NA 1KUYA 3F9KC 1QSNA 4JWPA 4R6TA 4XPLA 2Q0YA 3KHXA 5G21A 5K99A 5DWNA 1Z9UA 5K8MA 3WC5A 4CO9A 1Z8XA 2PJ7A 4NEXA 4P4BA 4B5PA 5JQ4A 1XOVA 2PJCA 4B5OA 1B87A 2VEZA 2ZEPA 3BUNB 4OKOA 4EWTA 1VI4A 1XIXA 4NCZA 2BOAA 2PJ0A 3TT2A 4C8PA 4TJVA 1TXRA 4NGNA 2ZOGA 3DSBA 2GREA 4PXBA 3T0TA 3IGRA 1Z5RA 3PP9A 2G9DA 2ODFA 4UA3A 1XE4A 5G22A 1ZG7A 2P6FA 5H86A 2FIWA 3IC1A 2EZBA 3H8FA 3FBUA 4R3KA 5I0CA 4IUSA 1YR0A 4UEZA 5LYLA 2HROA 1CP7A 1A2ZA 3GB0A 4LQ6A 4XNHC 2F7VA 4CYOA 5K8NA 4FUUA 4P4FA 2VKZG 4JJXA 1XRYA 1YW4A 3R96A 4F0YA 5F49A 3K4IA 2X0SA 2DPSA 3SJXA 4MCPA 1IOIA 3CXQA 4JXRA 3D67A 4NXYA 2VXKA 3D2PA 3EC4A 1EZBA 3G3SA 3OP0A 1C30B 3A9LA 2AFOA 2PCUA 4MFKA 2Q43A 4BMHA 4CGMA 2Y1NA 3VRQA 3HPHE 3NFZA 4P10A 3R1KA 1NXJA 2E28A 4IHMA 1JDEA 1YGHA 2NSMA 2PR8A 4BPWB 3BJ8A 4P4EA 3I3GA 4Y49B 4RR2B 4CAFA 2C6CA 4CS0B 4J0NA 3BI1A 1KWMA 1B47A 1TKHA 3FX6A 3TFYA 1QQ9A 3TC8A 1S7KA 2QMLA 3RBUA 1S7NA 5FD8A 3H5ZA 4ZY0A 4OC1A 3PGPA 3SJEA 3TLBA 2CNTA 2Z3KA 4E8OA 3HMJG 5AG5A 1AYEA 4WWVA 3C8OA 4OC5A 4LX9A 4KUBA 4C2ZA 2JDCA 4KLWA 5H84A 4A32A 5AG4A 3JVNA 2YNCA 5F09A 1Y9KA 4ZY1A 1BPNA 2G0BA 4P45A 5K8OA 3D8PA 3B2YA 1Z2LA 1AUGA 2EBJA 5LYFA 1PU9A 4BBHA 3EY5A 5JH9A 1DTDA 2HI6A 2EK8A 3ZJ0A 2Q04A 4H89A 1GYTA 4KSFA 1DIKA 1U6MA 3GKRA 1TF8A 1CBXA 4R76A 1BAVA 3D7DA 4Q7AA 1JDBC 4IIXA 1JWQA 1OBRA 2GFQA 2GLFA 2PJ4A 2WPXA 3KI9A 2PC1A 3U88C 5I4MA 8CPAA 4P44A 5G20A 3W91A 2ATRA 4KOYA 4NGPA 1LAMA 4BD9A 2PR1A 3SXNA 3B35A 1EZAA 4YN3A 4CYPA 3BJ7A 1M4GA 4C7IA 4F9VA 3PEIA 4MCSA 3LWUA 3H8EA 5JPHA 1I1DA 4WJBA 3UY5A 2PJ6A 3WT4A 4FD4A 4HNYB 4A94A 3B3SA 4ZI6A 2FVGA 3LODA 4KOUA 4NJQA 1Z4RA 3TO9A 3KKWA 2FCKA 4M6GA 3D4UA 5LRKA 1OZPA 1BOBA 2Z11A 4AVBA 3CXPA 3MN8A 3FXTA 3K2KA 1EO0A 3EZAA 5AXIA 1YSJA 5GCNA 1S3ZA 5LYIA 4XPDC 3TLAA 3ZNIA 7CPAA 5F47A 5F46A 1IOFA 3LD2A 2OR4A 5ELYA 5F13A 1PCAA 1YLOA 2NMTA 3JTKA 3LMSA 1LANA 4ZX8A 2AUMA 4Z65A 4C9UA 2CNMA 4UBRA 2C1CA 1VIXA 5D8NA 2D0PA 4IK2A 2Q4VA 2NYQA 1WWZA 5J8FA 1C3OB 2ANPA 3C26A 2PVWA 2GU2A 1CX8A 3IO1A 4B11A 2V8GA 3PB9X 2WUUA 4KSIA 2ZW6A 3OAKA 2JLMA 2VI7A 2IMOA 4FD6A 1AMPA 4Q36A 5DWMA 5EC4A 3RYOA 4A95A 2AE6A 4II9A 4AB7A 2ZEOA 1V0CA 2ZEDA 3P2HA 1ZLIA 4M6HA 4Q38A 1ZYMA 4TJXA 5JYBA 1QSOA 3PFOA 4R3LA 3R95A 2EK9A 3QNVA 4HNWB 3WABA 3H4QA 4L89A 3MRUA 3WR7A 1NBWA 2GIVA 1M44A 2RB7A 4F8ZA 2FSRA 4DUKA 3EZBA 1M4IA 1VHOA 1XFOA 4R8FA 4H6ZA 3IFEA 5HH1A 2F5IA 3S6HA 3WC6A 1M6VB 4JLYA 1UFHA 2WPWA 3VRRA 4A4CA 2BSWA 2J8RA 2PQ8A 1KUVA 1TF9A 2IQ6A 2ZXVA 1XBUA 4QBJA 2WSAA 4AVCA 2C5QA 3B7IA 3TO6A 1Z9EA 4DYOA 2ZW4A 1NE9A 3FYNA 1NMTA 4CGLA 3D66A 4GM5A 2B3VA 4NSQA 4JZ0A 4F9UA 3RZAA 1WJTA 1RXTA 1Z8WA 4E0AA 1YMEA 1GGOA 3CPAA 2FM4A 1Z8LA 4OLLA 3FF3A 4C9AA 1YVHA 1S7LA 1B6BA 2I3CA 2GANA 4QVTA 1R57A 2R1IA 3SJGA 2PRBA 6CPAA 1S60A 5F9MA 4CYQA 4U5YA 5ISVA 4PXCA 3FECA 3KQXA 1Q7LA 3VATA 3BUMB 1M4DA 2XPLA 3R9GA 2PRQA 4CAWA 4MFZA 4C2YA 2FS5A 3FNCA 1PYTB 4C68A 3E0KA 4AXVA 4CAEA 4CZ1A 3P2FA 1F57A 1ZRSA 2HC9A 4UIAA 4CAXA 1MJAA 1Z8TA 3DGVA 2P6EA 3EXNA 4PV6A 1FT7A 3N7ZA 4C2XA 5IB9A 1J3LA 4KUAA 2GP4A 3NE7A 2VL1A 4HNXB 4H2KA 2C6PA 2YNEA 1P4NA 1YVOA 2FL4A 2YJVA 3TLCA 3DNSA 4CRYB 2XEIA 4B5PB 4MI4A 4KORA 3IWWA 2RC4A 4C99A 1XF8A 3F5BA 3PB6X 4UWIA 4Y49C 2OZGA 5LRGA 1ZL0A 4MHPA 4NGSA 2VBQA 3FH4A 3S9LA 5IV0A 3PT1A 1YLEA 2PJ8A 1IB1E 4RI1A 4OP4A 3GUXA 1QSRA 1IU8A 5J8CA 5JVLA 3IWGA 4C86A 1Q2DA 4E94A 3I74A 3TX8A 4YGOA 3PBEA 4INJA 3LACA 1I21A 2CTBA 2HV2A 3BUXB 2HQYA 4U9YA 3TLZA 1EE3P 2OOTA 3NA6A 2FXFA 2PCNA 1YQEA 5D29A 3IEHA 3T5MA 1WK4A 4KOXA 1XMBA 4PPZA 3DDDA 2JEVA 1K4JA 4QUSA 2AJ6A 3I9SA 4FD5A 3PZJA 4OC0A 5C82A 5F48A 2YJTA 4UCMA 2OZHA 4GS4A 1M4LA 3NH4A 1FNOA 4EFDA 2PJ3A 4UIBA 3T8WA 4C8UA 3B3TA 2B5GB 2CXAA 2V77A 2V8HA 4KLVA 1FBVA 2AUNA 3TOBA 4UFWA 3TOAA 4KOVA 3VRPA 2DXQA 4CDJA 4NJRA 4PSWA 3FRMA 1X12A 4W9YA 3EZEA 3PFEA 3NOJA 4ONWA 2QIRA 2ZW7A 1RO5A 4A2ZA 4B14A 1VBGA 1ELMP 2PDOA 4MHDA 4A37A 4PQAA 2XPOA 3TLGA 2Z10A 3KR4A 1CP6A
chains in the Genus database with same CATH topology
2AFXA 3GLJA 3KHZA 3D7HA 4NGRA 4MHNA 2GLJA 3B3CA 4MHZA 3JRUA 4FAIA 3KL9A 3BI0A 2ZENA 2QVPA 3PB7X 3SJFA 3ISXA 2ABZA 2ZEEA 4P4IA 5JGFA 1V6CA 4B6ZA 3FJUA 4UEFA 1HDUA 1CG2A 1R43A 1ZG9A 3EIFA 4FBEA 1BPMA 4C8AA 2ZEFA 3DLJA 4P4DA 1XJOA 3BHXA 4A39A 3I1UA 4ZY2A 2CF4A 1LFWA 1CPXA 4C84A 2ZEMA 1RTQA 4K3NA 4C85A 4P4JA 2AFSA 4OIWA 2V8DA 1ZG8A 4MCQA 2AFUA 1ARMA 1UWYA 3KASA 5THWA 4CPAA 1QMUA 3HLPA 3SI2A 3V7ZA 4X8IA 1WVMA 2PVVA 2J9AA 4ZYQA 2PJ5A 4UF4A 2QYVA 4NGQA 3FMCA 2EWBA 3KQZA 2HB6A 1ELLP 4NFRA 2C5QA 3N5FA 2ZOFA 1TKJA 4KNGE 1LOKA 2PJ9A 3BXMA 4YU9A 3I6SA 4MMOA 1BLLE 3VH9A 3IIBA 5HVGA 4DJLA 4UEEA 4OC2A 1H8LA 2JBJA 5LRJA 2JEWA 2XEFA 3ISZA 5HVFA 1JQGA 2POKA 3PB8X 4OC3A 3IJ3A 5CPAA 4C8FA 3PB4X 2O4HA 3RAMA 1VHEA 4RUHA 2XEGA 2ZELA 3HUVA 5DS0A 3SI1A 4PXEA 4C9RA 4IAVA 4YWYA 2WZNA 2CTCA 2C6GA 1VGYA 4PXDA 1CPSA 5HXDA 3S9NA 5J1QA 4C8CA 1F2PA 4JYWA 5JM6A 2BO9A 2XEJA 1LAPA 3NH5A 1ZLHA 2PIYA 2ZEGA 3CDXA 3B3VA 1NSAA 1Y9ZA 4A38A 2PJAA 3D68A 2DEAA 4LQGA 4C9EA 2PJ2A 1Y0RA 1TKFA 3K9TA 5K8PA 4C9VA 4NGTA 3H8GA 3KGQA 5IR2A 1XF1A 1Y7EA 2IJZA 5CBMA 5LYDA 4C8TA 3FEDA 1HDQA 4G1PA 3D7FA 4FWUA 3D7GA 2RFHA 4P6YA 3S9MA 1F2OA 2ZEHA 4MCRA 1ARLA 2AFMA 3V38A 2PE3A 1IY7A 2Q51A 4CDKA 3PRTA 3SI0A 3FVLA 5HVHA 2F8HA 2AFWA 3CPXA 3B3WA 2PIZA 2Q4ZA 4R7MA 1DE4C 4MRIA 4OIDA 1Y0YA 4TWEA 4NGMA 3CT9A 2QJ8A 4OMEA 3PBBA 4X2TA 2CIJA 2WYRA 4OC4A 2BCOA 4EMEA 1IGBA 1HEEA 4X3RA 1YW6A 2PJ1A 2V8VA 4MHYA 2PJBA 3VARA 1R3NA 3KZWA 3KR5A 3FEEA 4ZX9A 3NH8A 1LCPA 3WC7A 4TNUA 2JBKA 4MXUA 4O23A 2AFZA 2O53A 3ICUA 5LYIA 3L2NA 4R6TA 3KHXA 5K8MA 3WC5A 2PJ7A 4P4BA 2PJCA 4OKOA 4EWTA 2ZEPA 2BOAA 2PJ0A 4C8PA 4TJVA 1TXRA 4NGNA 2ZOGA 4PXBA 2GREA 1Z5RA 2G9DA 1ZG7A 3IC1A 3H8FA 4UEZA 5LYLA 1CP7A 3GB0A 5K8NA 2F7VA 4FUUA 4P4FA 1XRYA 1YW4A 3SJXA 4MCPA 3D67A 2AFOA 2PCUA 2Q43A 3NFZA 4P10A 4IHMA 2NSMA 4P4EA 2C6CA 3BI1A 1KWMA 3FX6A 1TKHA 1QQ9A 3TC8A 3RBUA 4ZY0A 4OC1A 3SJEA 1AYEA 4WWVA 4OC5A 5F09A 4ZY1A 1BPNA 4P45A 5K8OA 3B2YA 1Z2LA 5JH9A 1DTDA 2EK8A 1GYTA 1TF8A 1CBXA 4R76A 1BAVA 3D7DA 4Q7AA 1OBRA 2GLFA 2PJ4A 3KI9A 5I4MA 8CPAA 4P44A 4NGPA 1LAMA 4BD9A 3B35A 4YN3A 4F9VA 3PEIA 4MCSA 3LWUA 3H8EA 4WJBA 3WT4A 2PJ6A 4A94A 4ZI6A 3B3SA 2FVGA 4NJQA 3D4UA 5LRKA 3MN8A 3K2KA 1YSJA 7CPAA 2OR4A 5ELYA 1PCAA 1YLOA 3LMSA 4ZX8A 4C9UA 1LANA 4Z65A 2C1CA 1VIXA 5D8NA 4IK2A 2NYQA 2ANPA 2PVWA 2GU2A 3IO1A 1CX8A 2V8GA 3PB9X 4KSIA 2IMOA 1AMPA 2ZEOA 2ZEDA 1ZLIA 4TJXA 3PFOA 2EK9A 3QNVA 3WABA 3MRUA 2RB7A 4F8ZA 4DUKA 1VHOA 1XFOA 4R8FA 5LYFA 3IFEA 3WC6A 3VTAA 1TF9A 2IQ6A 1XBUA 3B7IA 4DYOA 3D66A 4GM5A 4JZ0A 4F9UA 3RZAA 1YMEA 3CPAA 1Z8LA 3FF3A 4C9AA 2I3CA 3SJGA 6CPAA 4PXCA 3FECA 3KQXA 1Q7LA 3VATA 2PRQA 1PYTB 4AXVA 1F57A 2HC9A 4UIAA 3DGVA 1FT7A 5IB9A 2GP4A 2VL1A 4H2KA 2C6PA 2XEIA 3IWWA 4C99A 3PB6X 5LRGA 4MHPA 4NGSA 3FH4A 3S9LA 2PJ8A 4OP4A 3GUXA 4C86A 3I74A 3TX8A 3PBEA 2CTBA 1EE3P 2OOTA 3NA6A 3IEHA 5D29A 1XMBA 4PPZA 4OC0A 1M4LA 3NH4A 1FNOA 4EFDA 2PJ3A 4UIBA 3T8WA 4C8UA 3B3TA 2V77A 2V8HA 4CDJA 4NJRA 4W9YA 3PFEA 4ONWA 1ELMP 4A37A 4PQAA 3KR4A 1CP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFX A;  3GLJ A;  3KHZ A;  3D7H A;  4NGR A;  4MHN A;  2GLJ A;  3B3C A;  4MHZ A;  3JRU A;  4FAI A;  3KL9 A;  3BI0 A;  2ZEN A;  2QVP A;  3PB7 X;  3SJF A;  3ISX A;  2ABZ A;  2ZEE A;  4P4I A;  5JGF A;  1V6C A;  4B6Z A;  3FJU A;  4UEF A;  1HDU A;  1CG2 A;  1R43 A;  1ZG9 A;  3EIF A;  4FBE A;  1BPM A;  4C8A A;  2ZEF A;  3DLJ A;  4P4D A;  1XJO A;  3BHX A;  4A39 A;  3I1U A;  4ZY2 A;  2CF4 A;  1LFW A;  1CPX A;  4C84 A;  2ZEM A;  1RTQ A;  4K3N A;  4C85 A;  4P4J A;  2AFS A;  4OIW A;  2V8D A;  1ZG8 A;  4MCQ A;  2AFU A;  1ARM A;  1UWY A;  3KAS A;  5THW A;  4CPA A;  1QMU A;  3HLP A;  3SI2 A;  3V7Z A;  4X8I A;  1WVM A;  2PVV A;  2J9A A;  4ZYQ A;  2PJ5 A;  4UF4 A;  2QYV A;  4NGQ A;  3FMC A;  2EWB A;  3KQZ A;  2HB6 A;  1ELL P;  4NFR A;  3N5F A;  2ZOF A;  1TKJ A;  4KNG E;  1LOK A;  2PJ9 A;  3BXM A;  4YU9 A;  3I6S A;  4MMO A;  1BLL E;  3VH9 A;  3IIB A;  5HVG A;  4DJL A;  4UEE A;  4OC2 A;  1H8L A;  2JBJ A;  5LRJ A;  2JEW A;  2XEF A;  3ISZ A;  5HVF A;  1JQG A;  2POK A;  3PB8 X;  4OC3 A;  3IJ3 A;  5CPA A;  4C8F A;  3PB4 X;  2O4H A;  3RAM A;  1VHE A;  4RUH A;  2XEG A;  2ZEL A;  3HUV A;  5DS0 A;  3SI1 A;  4PXE A;  4C9R A;  4IAV A;  4YWY A;  2WZN A;  2CTC A;  2C6G A;  1VGY A;  4PXD A;  1CPS A;  5HXD A;  3S9N A;  5J1Q A;  4C8C A;  1F2P A;  4JYW A;  5JM6 A;  2BO9 A;  2XEJ A;  1LAP A;  3NH5 A;  1ZLH A;  2PIY A;  2ZEG A;  3CDX A;  3B3V A;  1NSA A;  1Y9Z A;  4A38 A;  2PJA A;  3D68 A;  2DEA A;  4LQG A;  4C9E A;  2PJ2 A;  1Y0R A;  1TKF A;  3K9T A;  5K8P A;  4C9V A;  4NGT A;  3H8G A;  3KGQ A;  1XF1 A;  1Y7E A;  2IJZ A;  5CBM A;  5LYD A;  4C8T A;  3FED A;  1HDQ A;  4G1P A;  3D7F A;  4FWU A;  3D7G A;  2RFH A;  4P6Y A;  3S9M A;  1F2O A;  2ZEH A;  4MCR A;  1ARL A;  2AFM A;  3V38 A;  2PE3 A;  1IY7 A;  2Q51 A;  4CDK A;  3PRT A;  3SI0 A;  3FVL A;  5HVH A;  2F8H A;  2AFW A;  3CPX A;  3B3W A;  2PIZ A;  2Q4Z A;  4R7M A;  1DE4 C;  4MRI A;  4OID A;  1Y0Y A;  4TWE A;  4NGM A;  3CT9 A;  2QJ8 A;  4OME A;  3PBB A;  4X2T A;  2CIJ A;  2WYR A;  4OC4 A;  2BCO A;  4EME A;  1IGB A;  1HEE A;  4X3R A;  1YW6 A;  2PJ1 A;  2V8V A;  4MHY A;  2PJB A;  3VAR A;  1R3N A;  3KZW A;  3KR5 A;  3FEE A;  4ZX9 A;  3NH8 A;  1LCP A;  3WC7 A;  4TNU A;  2JBK A;  4MXU A;  4O23 A;  2AFZ A;  2O53 A;  3ICU A;  5LYI A;  3L2N A;  4R6T A;  3KHX A;  5K8M A;  3WC5 A;  2PJ7 A;  4P4B A;  2PJC A;  4OKO A;  4EWT A;  2ZEP A;  2BOA A;  2PJ0 A;  4C8P A;  4TJV A;  1TXR A;  4NGN A;  2ZOG A;  4PXB A;  2GRE A;  1Z5R A;  2G9D A;  1ZG7 A;  3IC1 A;  3H8F A;  4UEZ A;  5LYL A;  1CP7 A;  3GB0 A;  5K8N A;  2F7V A;  4FUU A;  4P4F A;  1XRY A;  1YW4 A;  3SJX A;  4MCP A;  3D67 A;  2AFO A;  2PCU A;  2Q43 A;  3NFZ A;  4P10 A;  4IHM A;  2NSM A;  4P4E A;  2C6C A;  3BI1 A;  1KWM A;  3FX6 A;  1TKH A;  1QQ9 A;  3TC8 A;  3RBU A;  4ZY0 A;  4OC1 A;  3SJE A;  1AYE A;  4WWV A;  4OC5 A;  5F09 A;  4ZY1 A;  1BPN A;  4P45 A;  5K8O A;  3B2Y A;  1Z2L A;  5JH9 A;  1DTD A;  2EK8 A;  1GYT A;  1TF8 A;  1CBX A;  4R76 A;  1BAV A;  3D7D A;  4Q7A A;  1OBR A;  2GLF A;  2PJ4 A;  3KI9 A;  5I4M A;  8CPA A;  4P44 A;  4NGP A;  1LAM A;  4BD9 A;  3B35 A;  4YN3 A;  4F9V A;  3PEI A;  4MCS A;  3LWU A;  3H8E A;  4WJB A;  3WT4 A;  2PJ6 A;  4A94 A;  4ZI6 A;  3B3S A;  2FVG A;  4NJQ A;  3D4U A;  5LRK A;  3MN8 A;  3K2K A;  1YSJ A;  7CPA A;  2OR4 A;  5ELY A;  1PCA A;  1YLO A;  3LMS A;  4ZX8 A;  4C9U A;  1LAN A;  4Z65 A;  2C1C A;  1VIX A;  5D8N A;  4IK2 A;  2NYQ A;  2ANP A;  2PVW A;  2GU2 A;  3IO1 A;  1CX8 A;  2V8G A;  3PB9 X;  4KSI A;  2IMO A;  1AMP A;  2ZEO A;  2ZED A;  1ZLI A;  4TJX A;  3PFO A;  2EK9 A;  3QNV A;  3WAB A;  3MRU A;  2RB7 A;  4F8Z A;  4DUK A;  1VHO A;  1XFO A;  4R8F A;  5LYF A;  3IFE A;  3WC6 A;  3VTA A;  1TF9 A;  2IQ6 A;  1XBU A;  3B7I A;  4DYO A;  3D66 A;  4GM5 A;  4JZ0 A;  4F9U A;  3RZA A;  1YME A;  3CPA A;  1Z8L A;  3FF3 A;  4C9A A;  2I3C A;  3SJG A;  6CPA A;  4PXC A;  3FEC A;  3KQX A;  1Q7L A;  3VAT A;  2PRQ A;  1PYT B;  4AXV A;  1F57 A;  2HC9 A;  4UIA A;  3DGV A;  1FT7 A;  5IB9 A;  2VL1 A;  4H2K A;  2C6P A;  2XEI A;  3IWW A;  4C99 A;  3PB6 X;  5LRG A;  4MHP A;  4NGS A;  3FH4 A;  3S9L A;  2PJ8 A;  4OP4 A;  3GUX A;  4C86 A;  3I74 A;  3TX8 A;  3PBE A;  2CTB A;  1EE3 P;  2OOT A;  3NA6 A;  3IEH A;  5D29 A;  1XMB A;  4PPZ A;  4OC0 A;  1M4L A;  3NH4 A;  1FNO A;  4EFD A;  2PJ3 A;  4UIB A;  3T8W A;  4C8U A;  3B3T A;  2V77 A;  2V8H A;  4CDJ A;  4NJR A;  4W9Y A;  3PFE A;  4ONW A;  1ELM P;  4A37 A;  4PQA A;  3KR4 A;  1CP6 A; 
#chains in the Genus database with same CATH topology
 2AFX A;  2A4N A;  3GLJ A;  4QC6 A;  3S6G A;  3QAH A;  2O28 A;  3KHZ A;  2YNC C;  3D7H A;  3PLF B;  4NGR A;  2DF5 A;  4M85 A;  2GLJ A;  3B3C A;  4MHN A;  3JRU A;  4MHZ A;  1FY7 A;  2B4D A;  3KL9 A;  3BI0 A;  4E2A A;  4FAI A;  2ZEN A;  1MJ9 A;  2QVP A;  4K30 A;  4MFP A;  1CE8 B;  2MP0 A;  3T05 A;  3VRN A;  3SJF A;  3ISX A;  3PB7 X;  2ABZ A;  4F6A A;  2ZEE A;  2B4B A;  4P4I A;  5JGF A;  4M3S A;  3HPG G;  3FJU A;  4B6Z A;  1V6C A;  2HWG A;  2J8M A;  1VKC A;  1HDU A;  1CG2 A;  4UEF A;  1TIQ A;  1R43 A;  1ZG9 A;  3EIF A;  2FE7 A;  4FBE A;  5F5X A;  4CGO A;  1BPM A;  4C8A A;  2EZC A;  5KTD A;  2ZEF A;  2Y0M A;  3V8I A;  1VHS A;  3DLJ A;  5AG6 A;  1QSM A;  4KOS A;  2ZPA A;  4PK2 A;  5IB0 A;  4PSX A;  4P4D A;  1XJO A;  3BHX A;  4A30 A;  1SQH A;  4H1H A;  2YND A;  4A39 A;  3B8G A;  4KVO E;  4MJX A;  3I1U A;  4ZY2 A;  2CF4 A;  2Z3P A;  1LFW A;  4A4B A;  4ORF A;  1CPX A;  3IU2 A;  2D4P A;  2ZEM A;  1RTQ A;  4K3N A;  4U9Z A;  3GY9 A;  4RN7 A;  1CM0 A;  4RS2 A;  2D0O A;  3G23 A;  4C85 A;  1N71 A;  4KOT A;  4P4J A;  5HKY A;  1MK4 A;  1Y7R A;  2AFS A;  4OIW A;  2OLS A;  3DR6 A;  2V8D A;  1ZG8 A;  4MCQ A;  4UCN A;  2AFU A;  4IF5 A;  1ARM A;  4NF1 A;  1UWY A;  2XPN A;  3KAS A;  5THW A;  4CPA A;  3BUO B;  1QMU A;  4KVM E;  2REE A;  4YFJ A;  1M1D A;  3HLP A;  3SI2 A;  3RO0 A;  3V7Z A;  4BIN A;  4CGN A;  4X8I A;  1BXR B;  4KSA A;  2PVV A;  3SHP A;  5BY0 A;  3NFQ A;  2J9A A;  2Q7B A;  2PJ5 A;  3W6S A;  4ZYQ A;  2R8V A;  3G8W A;  4B13 A;  4UF4 A;  2QYV A;  1VBH A;  2DIK A;  4COB A;  2G3T A;  4NGQ A;  4XPK A;  2CNS A;  3QAY A;  2DLA A;  3FMC A;  3OWC A;  2EWB A;  1GHE A;  3OB2 B;  3IU1 A;  3KQZ A;  2HB6 A;  1ELL P;  4BPX B;  4NFR A;  3BUW B;  3VGO A;  3N5F A;  2ZOF A;  2Q7S A;  4OAE A;  4ZBG A;  1TKJ A;  2FIA A;  2R7H A;  4KNG E;  1LOK A;  2I79 A;  3BXM A;  2PJ9 A;  4YU9 A;  3I6S A;  4MMO A;  3O8Z A;  1BLL E;  3W6X A;  3VH9 A;  3IIB A;  5EBV A;  5HVG A;  1KEE B;  4DJL A;  4C7H A;  5BWA B;  2CY2 A;  2OB0 A;  4B10 A;  3TTH A;  3MGD A;  5IX3 A;  2R98 A;  4B12 A;  2EUI A;  3GIU A;  4I49 A;  4OC2 A;  1H8L A;  2Z3L A;  2JBJ A;  4MY3 A;  2BL1 A;  3NE8 A;  4UEE A;  5AGE A;  1IIC A;  1Y9W A;  2Q4Y A;  4KOW A;  4OAD A;  3T90 A;  3ZZI A;  5LRJ A;  2JEW A;  3TYX A;  2XEF A;  3ISZ A;  2CBL A;  4UWJ A;  5HVF A;  4KVX A;  4EYS A;  1IYL A;  1JQG A;  2POK A;  3PB8 X;  3FIX A;  1CJW A;  4OC3 A;  2VZY A;  3IJ3 A;  5CPA A;  4CAV A;  4C8F A;  4UCP A;  3VTA A;  3PB4 X;  4XNH B;  2O4H A;  3RAM A;  4YRH A;  2EZA A;  3PFV A;  1LRZ A;  1VHE A;  4RUH A;  3T07 A;  2XEG A;  4H6U A;  2ZEL A;  1PUA A;  3HUV A;  5E96 A;  2OH1 A;  4QB9 A;  1KC7 A;  4R57 A;  5DS0 A;  3SI1 A;  2H5M A;  4PXE A;  3T9Y A;  2B3U A;  4C9R A;  4F0X A;  2OZU A;  4R87 A;  4IAV A;  4YWY A;  2WZN A;  4FD7 A;  4UFV A;  3OB1 B;  1IYK A;  1KUX A;  1XEB A;  2CTC A;  2QEC A;  5FVJ A;  1S5K A;  4CRZ B;  1Q2C A;  2P6G A;  3TLE A;  2C6G A;  1VGY A;  4PXD A;  2IL4 A;  3KRV A;  2B5G A;  1CPS A;  5HXD A;  5KTC A;  4LUA A;  3VRO A;  3S9N A;  1BO4 A;  5J1Q A;  2VZZ A;  4BTF A;  1Q2Y A;  4C8C A;  4ZGY B;  5HMN A;  2UV8 G;  1F2P A;  4MY0 A;  2X7B A;  4JYW A;  3S6F A;  2B4J C;  3RNZ A;  5AG7 A;  3F8K A;  5HKW A;  2BUE A;  2BO9 A;  3EO4 A;  4X5K A;  2XEJ A;  2C27 A;  3FB3 A;  1LAP A;  1XMT A;  1WVM A;  5A28 A;  2JDD A;  4GXH A;  4AG7 A;  3QB8 A;  1QST A;  1Z4E A;  3NH5 A;  3S6K A;  1ZLH A;  4COG A;  2PIY A;  2ZEG A;  2Z3N A;  3CDX A;  3VWD A;  3B3V A;  1P0H A;  1NSA A;  4M6I A;  2B58 A;  1Y9Z A;  2I00 A;  4A38 A;  2PJA A;  3D68 A;  2ARH A;  2DEA A;  2HUZ A;  3BLN A;  3D2M A;  2EO8 A;  4LQG A;  3SXO A;  1J4J A;  4C9E A;  4HPS A;  5EMI A;  2PJ2 A;  4R9M A;  2B0A A;  2FT0 A;  1IID A;  4E5S A;  1Y0R A;  4DNC A;  1TKF A;  1YVK A;  3K9T A;  5K8P A;  1CS0 B;  4C9V A;  4NGT A;  2REF A;  3H8G A;  3KGQ A;  5IR2 A;  1XF1 A;  4GPL B;  4PK3 A;  4IIY A;  1Y7E A;  4JD6 A;  2DPT A;  3JUW A;  3IWE A;  4JXQ A;  2IJZ A;  5KTA A;  3VWE A;  2Y1M A;  3GJZ A;  5CBM A;  5LYD A;  4C8T A;  4AG9 A;  5JM6 A;  3FED A;  2OU2 A;  1HDQ A;  1X10 A;  2Q44 A;  3D3S A;  4G1P A;  5G1Z A;  4CYN A;  3TE4 A;  2XPP A;  3D7F A;  4HKF A;  4C84 A;  1YX0 A;  4MFJ A;  2EVN A;  3D7G A;  2RFH A;  4FWU A;  4P6Y A;  3S9M A;  3CXS A;  4CGP A;  4A33 A;  1F2O A;  3SR3 A;  2ZEH A;  1KBL A;  4MCR A;  1ARL A;  2AFM A;  3R9E A;  2KCW A;  3V38 A;  1T36 B;  4AVA A;  4MI1 A;  2PE3 A;  1IY7 A;  2N3A B;  3CZX A;  2BEI A;  2Q51 A;  3DR8 A;  3PRT A;  4KS9 A;  3R9F A;  3SI0 A;  1Q5X A;  4CDK A;  3K9U A;  3FVL A;  3TLG B;  5HVH A;  4MFQ A;  2F8H A;  2AFW A;  2R82 A;  3TLY A;  1YRE A;  3CPX A;  1MJB A;  2K5T A;  3B3W A;  4J3G A;  3F0A A;  2PIZ A;  1ZO0 A;  2Q4Z A;  4M8D A;  3TCV A;  4R7M A;  1DE4 C;  1L0C A;  4MRI A;  4OID A;  1YK3 A;  4MFL A;  4XPD B;  1Y0Y A;  2B4D B;  1R61 A;  2Z3M A;  5F1Y A;  4TWE A;  5CNP A;  1ON0 A;  4NGM A;  3CT9 A;  1NSL A;  1S7F A;  2QJ8 A;  2Z0Z A;  4OME A;  3PBB A;  4MJ8 A;  4MBU A;  4JVO A;  4X2T A;  2VQY A;  3U1B A;  2CIJ A;  2WYR A;  4OC4 A;  2BCO A;  4EME A;  1IGB A;  1A9X B;  1HEE A;  4X3R A;  4BPU B;  1YW6 A;  5A27 A;  2PJ1 A;  2V8V A;  5HKZ A;  4MHY A;  2YGW A;  2J8N A;  2PJB A;  4ONU A;  1KZF A;  5J3X A;  3VAR A;  1R3N A;  4KZT A;  2D4O A;  4L8A A;  3KZW A;  3KR5 A;  3FEE A;  4UFX A;  4ZX9 A;  3NH8 A;  1LCP A;  2Z3O A;  3WC7 A;  1I12 A;  4TNU A;  4A31 A;  4EVY A;  3EFA A;  2PSW A;  2JBK A;  2G3A A;  4MXU A;  3TO7 A;  3GYA A;  4O23 A;  5C88 A;  2AFZ A;  2O53 A;  3ICU A;  2GE3 A;  2P0W A;  2ZW5 A;  3L2N A;  1KUY A;  3F9K C;  1QSN A;  4JWP A;  4R6T A;  4XPL A;  2Q0Y A;  3KHX A;  5G21 A;  5K99 A;  5DWN A;  1Z9U A;  5K8M A;  3WC5 A;  4CO9 A;  1Z8X A;  2PJ7 A;  4NEX A;  4P4B A;  4B5P A;  5JQ4 A;  1XOV A;  2PJC A;  4B5O A;  1B87 A;  2VEZ A;  2ZEP A;  3BUN B;  4OKO A;  4EWT A;  1VI4 A;  1XIX A;  4NCZ A;  2BOA A;  2PJ0 A;  3TT2 A;  4C8P A;  4TJV A;  1TXR A;  4NGN A;  2ZOG A;  3DSB A;  2GRE A;  4PXB A;  3T0T A;  3IGR A;  1Z5R A;  3PP9 A;  2G9D A;  2ODF A;  4UA3 A;  1XE4 A;  5G22 A;  1ZG7 A;  2P6F A;  5H86 A;  2FIW A;  3IC1 A;  2EZB A;  3H8F A;  3FBU A;  4R3K A;  5I0C A;  4IUS A;  1YR0 A;  4UEZ A;  5LYL A;  2HRO A;  1CP7 A;  1A2Z A;  3GB0 A;  4LQ6 A;  4XNH C;  2F7V A;  4CYO A;  5K8N A;  4FUU A;  4P4F A;  2VKZ G;  4JJX A;  1XRY A;  1YW4 A;  3R96 A;  4F0Y A;  5F49 A;  3K4I A;  2X0S A;  2DPS A;  3SJX A;  4MCP A;  1IOI A;  3CXQ A;  4JXR A;  3D67 A;  4NXY A;  2VXK A;  3D2P A;  3EC4 A;  1EZB A;  3G3S A;  3OP0 A;  1C30 B;  3A9L A;  2AFO A;  2PCU A;  4MFK A;  2Q43 A;  4BMH A;  4CGM A;  2Y1N A;  3VRQ A;  3HPH E;  3NFZ A;  4P10 A;  3R1K A;  1NXJ A;  2E28 A;  4IHM A;  1JDE A;  1YGH A;  2NSM A;  2PR8 A;  4BPW B;  3BJ8 A;  4P4E A;  3I3G A;  4Y49 B;  4RR2 B;  4CAF A;  2C6C A;  4CS0 B;  4J0N A;  3BI1 A;  1KWM A;  1B47 A;  1TKH A;  3FX6 A;  3TFY A;  1QQ9 A;  3TC8 A;  1S7K A;  2QML A;  3RBU A;  1S7N A;  5FD8 A;  3H5Z A;  4ZY0 A;  4OC1 A;  3PGP A;  3SJE A;  3TLB A;  2CNT A;  2Z3K A;  4E8O A;  3HMJ G;  5AG5 A;  1AYE A;  4WWV A;  3C8O A;  4OC5 A;  4LX9 A;  4KUB A;  4C2Z A;  2JDC A;  4KLW A;  5H84 A;  4A32 A;  5AG4 A;  3JVN A;  2YNC A;  5F09 A;  1Y9K A;  4ZY1 A;  1BPN A;  2G0B A;  4P45 A;  5K8O A;  3D8P A;  3B2Y A;  1Z2L A;  1AUG A;  2EBJ A;  5LYF A;  1PU9 A;  4BBH A;  3EY5 A;  5JH9 A;  1DTD A;  2HI6 A;  2EK8 A;  3ZJ0 A;  2Q04 A;  4H89 A;  1GYT A;  4KSF A;  1DIK A;  1U6M A;  3GKR A;  1TF8 A;  1CBX A;  4R76 A;  1BAV A;  3D7D A;  4Q7A A;  1JDB C;  4IIX A;  1JWQ A;  1OBR A;  2GFQ A;  2GLF A;  2PJ4 A;  2WPX A;  3KI9 A;  2PC1 A;  3U88 C;  5I4M A;  8CPA A;  4P44 A;  5G20 A;  3W91 A;  2ATR A;  4KOY A;  4NGP A;  1LAM A;  4BD9 A;  2PR1 A;  3SXN A;  3B35 A;  1EZA A;  4YN3 A;  4CYP A;  3BJ7 A;  1M4G A;  4C7I A;  4F9V A;  3PEI A;  4MCS A;  3LWU A;  3H8E A;  5JPH A;  1I1D A;  4WJB A;  3UY5 A;  2PJ6 A;  3WT4 A;  4FD4 A;  4HNY B;  4A94 A;  3B3S A;  4ZI6 A;  2FVG A;  3LOD A;  4KOU A;  4NJQ A;  1Z4R A;  3TO9 A;  3KKW A;  2FCK A;  4M6G A;  3D4U A;  5LRK A;  1OZP A;  1BOB A;  2Z11 A;  4AVB A;  3CXP A;  3MN8 A;  3FXT A;  3K2K A;  1EO0 A;  3EZA A;  5AXI A;  1YSJ A;  5GCN A;  1S3Z A;  5LYI A;  4XPD C;  3TLA A;  3ZNI A;  7CPA A;  5F47 A;  5F46 A;  1IOF A;  3LD2 A;  2OR4 A;  5ELY A;  5F13 A;  1PCA A;  1YLO A;  2NMT A;  3JTK A;  3LMS A;  1LAN A;  4ZX8 A;  2AUM A;  4Z65 A;  4C9U A;  2CNM A;  4UBR A;  2C1C A;  1VIX A;  5D8N A;  2D0P A;  4IK2 A;  2Q4V A;  2NYQ A;  1WWZ A;  5J8F A;  1C3O B;  2ANP A;  3C26 A;  2PVW A;  2GU2 A;  1CX8 A;  3IO1 A;  4B11 A;  2V8G A;  3PB9 X;  2WUU A;  4KSI A;  2ZW6 A;  3OAK A;  2JLM A;  2VI7 A;  2IMO A;  4FD6 A;  1AMP A;  4Q36 A;  5DWM A;  5EC4 A;  3RYO A;  4A95 A;  2AE6 A;  4II9 A;  4AB7 A;  2ZEO A;  1V0C A;  2ZED A;  3P2H A;  1ZLI A;  4M6H A;  4Q38 A;  1ZYM A;  4TJX A;  5JYB A;  1QSO A;  3PFO A;  4R3L A;  3R95 A;  2EK9 A;  3QNV A;  4HNW B;  3WAB A;  3H4Q A;  4L89 A;  3MRU A;  3WR7 A;  1NBW A;  2GIV A;  1M44 A;  2RB7 A;  4F8Z A;  2FSR A;  4DUK A;  3EZB A;  1M4I A;  1VHO A;  1XFO A;  4R8F A;  4H6Z A;  3IFE A;  5HH1 A;  2F5I A;  3S6H A;  3WC6 A;  1M6V B;  4JLY A;  1UFH A;  2WPW A;  3VRR A;  4A4C A;  2BSW A;  2J8R A;  2PQ8 A;  1KUV A;  1TF9 A;  2IQ6 A;  2ZXV A;  1XBU A;  4QBJ A;  2WSA A;  4AVC A;  2C5Q A;  3B7I A;  3TO6 A;  1Z9E A;  4DYO A;  2ZW4 A;  1NE9 A;  3FYN A;  1NMT A;  4CGL A;  3D66 A;  4GM5 A;  2B3V A;  4NSQ A;  4JZ0 A;  4F9U A;  3RZA A;  1WJT A;  1RXT A;  1Z8W A;  4E0A A;  1YME A;  1GGO A;  3CPA A;  2FM4 A;  1Z8L A;  4OLL A;  3FF3 A;  4C9A A;  1YVH A;  1S7L A;  1B6B A;  2I3C A;  2GAN A;  4QVT A;  1R57 A;  2R1I A;  3SJG A;  2PRB A;  6CPA A;  1S60 A;  5F9M A;  4CYQ A;  4U5Y A;  5ISV A;  4PXC A;  3FEC A;  3KQX A;  1Q7L A;  3VAT A;  3BUM B;  1M4D A;  2XPL A;  3R9G A;  2PRQ A;  4CAW A;  4MFZ A;  4C2Y A;  2FS5 A;  3FNC A;  1PYT B;  4C68 A;  3E0K A;  4AXV A;  4CAE A;  4CZ1 A;  3P2F A;  1F57 A;  1ZRS A;  2HC9 A;  4UIA A;  4CAX A;  1MJA A;  1Z8T A;  3DGV A;  2P6E A;  3EXN A;  4PV6 A;  1FT7 A;  3N7Z A;  4C2X A;  5IB9 A;  1J3L A;  4KUA A;  2GP4 A;  3NE7 A;  2VL1 A;  4HNX B;  4H2K A;  2C6P A;  2YNE A;  1P4N A;  1YVO A;  2FL4 A;  2YJV A;  3TLC A;  3DNS A;  4CRY B;  2XEI A;  4B5P B;  4MI4 A;  4KOR A;  3IWW A;  2RC4 A;  4C99 A;  1XF8 A;  3F5B A;  3PB6 X;  4UWI A;  4Y49 C;  2OZG A;  5LRG A;  1ZL0 A;  4MHP A;  4NGS A;  2VBQ A;  3FH4 A;  3S9L A;  5IV0 A;  3PT1 A;  1YLE A;  2PJ8 A;  1IB1 E;  4RI1 A;  4OP4 A;  3GUX A;  1QSR A;  1IU8 A;  5J8C A;  5JVL A;  3IWG A;  4C86 A;  1Q2D A;  4E94 A;  3I74 A;  3TX8 A;  4YGO A;  3PBE A;  4INJ A;  3LAC A;  1I21 A;  2CTB A;  2HV2 A;  3BUX B;  2HQY A;  4U9Y A;  3TLZ A;  1EE3 P;  2OOT A;  3NA6 A;  2FXF A;  2PCN A;  1YQE A;  5D29 A;  3IEH A;  3T5M A;  1WK4 A;  4KOX A;  1XMB A;  4PPZ A;  3DDD A;  2JEV A;  1K4J A;  4QUS A;  2AJ6 A;  3I9S A;  4FD5 A;  3PZJ A;  4OC0 A;  5C82 A;  5F48 A;  2YJT A;  4UCM A;  2OZH A;  4GS4 A;  1M4L A;  3NH4 A;  1FNO A;  4EFD A;  2PJ3 A;  4UIB A;  3T8W A;  4C8U A;  3B3T A;  2B5G B;  2CXA A;  2V77 A;  2V8H A;  4KLV A;  1FBV A;  2AUN A;  3TOB A;  4UFW A;  3TOA A;  4KOV A;  3VRP A;  2DXQ A;  4CDJ A;  4NJR A;  4PSW A;  3FRM A;  1X12 A;  4W9Y A;  3EZE A;  3PFE A;  3NOJ A;  4ONW A;  2QIR A;  2ZW7 A;  1RO5 A;  4A2Z A;  4B14 A;  1VBG A;  1ELM P;  2PDO A;  4MHD A;  4A37 A;  4PQA A;  2XPO A;  3TLG A;  2Z10 A;  3KR4 A;  1CP6 A; 
#chains in the Genus database with same CATH homology
 2AFX A;  3GLJ A;  3KHZ A;  3D7H A;  4NGR A;  4MHN A;  2GLJ A;  3B3C A;  4MHZ A;  3JRU A;  4FAI A;  3KL9 A;  3BI0 A;  2ZEN A;  2QVP A;  3PB7 X;  3SJF A;  3ISX A;  2ABZ A;  2ZEE A;  4P4I A;  5JGF A;  1V6C A;  4B6Z A;  3FJU A;  4UEF A;  1HDU A;  1CG2 A;  1R43 A;  1ZG9 A;  3EIF A;  4FBE A;  1BPM A;  4C8A A;  2ZEF A;  3DLJ A;  4P4D A;  1XJO A;  3BHX A;  4A39 A;  3I1U A;  4ZY2 A;  2CF4 A;  1LFW A;  1CPX A;  4C84 A;  2ZEM A;  1RTQ A;  4K3N A;  4C85 A;  4P4J A;  2AFS A;  4OIW A;  2V8D A;  1ZG8 A;  4MCQ A;  2AFU A;  1ARM A;  1UWY A;  3KAS A;  5THW A;  4CPA A;  1QMU A;  3HLP A;  3SI2 A;  3V7Z A;  4X8I A;  1WVM A;  2PVV A;  2J9A A;  4ZYQ A;  2PJ5 A;  4UF4 A;  2QYV A;  4NGQ A;  3FMC A;  2EWB A;  3KQZ A;  2HB6 A;  1ELL P;  4NFR A;  2C5Q A;  3N5F A;  2ZOF A;  1TKJ A;  4KNG E;  1LOK A;  2PJ9 A;  3BXM A;  4YU9 A;  3I6S A;  4MMO A;  1BLL E;  3VH9 A;  3IIB A;  5HVG A;  4DJL A;  4UEE A;  4OC2 A;  1H8L A;  2JBJ A;  5LRJ A;  2JEW A;  2XEF A;  3ISZ A;  5HVF A;  1JQG A;  2POK A;  3PB8 X;  4OC3 A;  3IJ3 A;  5CPA A;  4C8F A;  3PB4 X;  2O4H A;  3RAM A;  1VHE A;  4RUH A;  2XEG A;  2ZEL A;  3HUV A;  5DS0 A;  3SI1 A;  4PXE A;  4C9R A;  4IAV A;  4YWY A;  2WZN A;  2CTC A;  2C6G A;  1VGY A;  4PXD A;  1CPS A;  5HXD A;  3S9N A;  5J1Q A;  4C8C A;  1F2P A;  4JYW A;  5JM6 A;  2BO9 A;  2XEJ A;  1LAP A;  3NH5 A;  1ZLH A;  2PIY A;  2ZEG A;  3CDX A;  3B3V A;  1NSA A;  1Y9Z A;  4A38 A;  2PJA A;  3D68 A;  2DEA A;  4LQG A;  4C9E A;  2PJ2 A;  1Y0R A;  1TKF A;  3K9T A;  5K8P A;  4C9V A;  4NGT A;  3H8G A;  3KGQ A;  5IR2 A;  1XF1 A;  1Y7E A;  2IJZ A;  5CBM A;  5LYD A;  4C8T A;  3FED A;  1HDQ A;  4G1P A;  3D7F A;  4FWU A;  3D7G A;  2RFH A;  4P6Y A;  3S9M A;  1F2O A;  2ZEH A;  4MCR A;  1ARL A;  2AFM A;  3V38 A;  2PE3 A;  1IY7 A;  2Q51 A;  4CDK A;  3PRT A;  3SI0 A;  3FVL A;  5HVH A;  2F8H A;  2AFW A;  3CPX A;  3B3W A;  2PIZ A;  2Q4Z A;  4R7M A;  1DE4 C;  4MRI A;  4OID A;  1Y0Y A;  4TWE A;  4NGM A;  3CT9 A;  2QJ8 A;  4OME A;  3PBB A;  4X2T A;  2CIJ A;  2WYR A;  4OC4 A;  2BCO A;  4EME A;  1IGB A;  1HEE A;  4X3R A;  1YW6 A;  2PJ1 A;  2V8V A;  4MHY A;  2PJB A;  3VAR A;  1R3N A;  3KZW A;  3KR5 A;  3FEE A;  4ZX9 A;  3NH8 A;  1LCP A;  3WC7 A;  4TNU A;  2JBK A;  4MXU A;  4O23 A;  2AFZ A;  2O53 A;  3ICU A;  5LYI A;  3L2N A;  4R6T A;  3KHX A;  5K8M A;  3WC5 A;  2PJ7 A;  4P4B A;  2PJC A;  4OKO A;  4EWT A;  2ZEP A;  2BOA A;  2PJ0 A;  4C8P A;  4TJV A;  1TXR A;  4NGN A;  2ZOG A;  4PXB A;  2GRE A;  1Z5R A;  2G9D A;  1ZG7 A;  3IC1 A;  3H8F A;  4UEZ A;  5LYL A;  1CP7 A;  3GB0 A;  5K8N A;  2F7V A;  4FUU A;  4P4F A;  1XRY A;  1YW4 A;  3SJX A;  4MCP A;  3D67 A;  2AFO A;  2PCU A;  2Q43 A;  3NFZ A;  4P10 A;  4IHM A;  2NSM A;  4P4E A;  2C6C A;  3BI1 A;  1KWM A;  3FX6 A;  1TKH A;  1QQ9 A;  3TC8 A;  3RBU A;  4ZY0 A;  4OC1 A;  3SJE A;  1AYE A;  4WWV A;  4OC5 A;  5F09 A;  4ZY1 A;  1BPN A;  4P45 A;  5K8O A;  3B2Y A;  1Z2L A;  5JH9 A;  1DTD A;  2EK8 A;  1GYT A;  1TF8 A;  1CBX A;  4R76 A;  1BAV A;  3D7D A;  4Q7A A;  1OBR A;  2GLF A;  2PJ4 A;  3KI9 A;  5I4M A;  8CPA A;  4P44 A;  4NGP A;  1LAM A;  4BD9 A;  3B35 A;  4YN3 A;  4F9V A;  3PEI A;  4MCS A;  3LWU A;  3H8E A;  4WJB A;  3WT4 A;  2PJ6 A;  4A94 A;  4ZI6 A;  3B3S A;  2FVG A;  4NJQ A;  3D4U A;  5LRK A;  3MN8 A;  3K2K A;  1YSJ A;  7CPA A;  2OR4 A;  5ELY A;  1PCA A;  1YLO A;  3LMS A;  4ZX8 A;  4C9U A;  1LAN A;  4Z65 A;  2C1C A;  1VIX A;  5D8N A;  4IK2 A;  2NYQ A;  2ANP A;  2PVW A;  2GU2 A;  3IO1 A;  1CX8 A;  2V8G A;  3PB9 X;  4KSI A;  2IMO A;  1AMP A;  2ZEO A;  2ZED A;  1ZLI A;  4TJX A;  3PFO A;  2EK9 A;  3QNV A;  3WAB A;  3MRU A;  2RB7 A;  4F8Z A;  4DUK A;  1VHO A;  1XFO A;  4R8F A;  5LYF A;  3IFE A;  3WC6 A;  3VTA A;  1TF9 A;  2IQ6 A;  1XBU A;  3B7I A;  4DYO A;  3D66 A;  4GM5 A;  4JZ0 A;  4F9U A;  3RZA A;  1YME A;  3CPA A;  1Z8L A;  3FF3 A;  4C9A A;  2I3C A;  3SJG A;  6CPA A;  4PXC A;  3FEC A;  3KQX A;  1Q7L A;  3VAT A;  2PRQ A;  1PYT B;  4AXV A;  1F57 A;  2HC9 A;  4UIA A;  3DGV A;  1FT7 A;  5IB9 A;  2GP4 A;  2VL1 A;  4H2K A;  2C6P A;  2XEI A;  3IWW A;  4C99 A;  3PB6 X;  5LRG A;  4MHP A;  4NGS A;  3FH4 A;  3S9L A;  2PJ8 A;  4OP4 A;  3GUX A;  4C86 A;  3I74 A;  3TX8 A;  3PBE A;  2CTB A;  1EE3 P;  2OOT A;  3NA6 A;  3IEH A;  5D29 A;  1XMB A;  4PPZ A;  4OC0 A;  1M4L A;  3NH4 A;  1FNO A;  4EFD A;  2PJ3 A;  4UIB A;  3T8W A;  4C8U A;  3B3T A;  2V77 A;  2V8H A;  4CDJ A;  4NJR A;  4W9Y A;  3PFE A;  4ONW A;  1ELM P;  4A37 A;  4PQA A;  3KR4 A;  1CP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...