4NGRA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
689
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
total genus 261
structure length 689
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngrA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngrA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngrA02
4C8AA 2ZEOA 3LWUA 4PXDA 3FVLA 4PQAA 4MCSA 4R7MA 2PJ6A 1XBUA 3ICUA 3HUVA 1NSAA 2XEFA 1XRYA 2C6PA 4YN3A 4W9YA 4Q7AA 2EWBA 2O4HA 2ZOGA 2JBKA 4B6ZA 2F7VA 4IK2A 3PBBA 4C85A 4C9RA 2AFMA 2PVWA 4NGTA 3BHXA 5ELYA 2GREA 1Y0YA 3K2KA 4UF4A 2WYRA 2BOAA 2CIJA 3TC8A 3VH9A 4MCPA 3FH4A 4P4IA 3GB0A 1LOKA 5THWA 4P4BA 1UWYA 3I6SA 2ABZA 4OC2A 2ZEGA 3NFZA 3PB4X 4UEEA 1Z5RA 1PYTB 3T8WA 2V8GA 3I74A 1R3NA 3D7HA 2PJ7A 5JGFA 4NGSA 4P44A 5F09A 4ZYQA 4A94A 1YMEA 3IO1A 1ELLP 4P4EA 3KR4A 2PIYA 2BO9A 4JYWA 3L2NA 3IIBA 5LYIA 4F9VA 5DS0A 3HLPA 3B35A 1YW4A 3N5FA 3FEEA 4MRIA 4OMEA 2PCUA 2ZELA 3WC6A 3DGVA 2AFOA 1TKHA 2GLFA 2OR4A 2ANPA 3D7FA 1GYTA 3D7GA 3H8GA 1FNOA 4X2TA 4LQGA 4PXBA 2EK8A 2FVGA 2PIZA 5CPAA 2AFXA 4P45A 1JQGA 4NGMA 4YU9A 4A39A 1Y7EA 2PJ1A 2PJ4A 1XMBA 3SI2A 2O53A 3FX6A 5D29A 3H8EA 1VGYA 3IFEA 2PJ8A 5LYDA 1F2PA 1IY7A 2BCOA 4BD9A 1BLLE 3S9LA 2V77A 4R6TA 1BAVA 4NJQA 2Q43A 4NJRA 5LRJA 4OKOA 4UEFA 4PPZA 4OIDA 5LRGA 4C84A 1Q7LA 5K8MA 2J9AA 3WC7A 3SJFA 4F9UA 1YSJA 1CG2A 2PRQA 4P4DA 3QNVA 2ZEDA 4P10A 1R43A 2AFZA 3D66A 1OBRA 2Q51A 3B3SA 3PFEA 3KASA 5HVHA 1Z8LA 3B2YA 3CDXA 3VTAA 1RTQA 2EK9A 4ZY2A 5LYFA 4C8UA 2CTCA 4ONWA 3KR5A 4MHYA 2G9DA 3V38A 4NGNA 1ZG7A 4P4FA 2PVVA 4IHMA 5JH9A 4MCQA 1LCPA 4UEZA 5CBMA 4FWUA 4C8PA 3VARA 3KZWA 3MN8A 4EMEA 1AYEA 3FF3A 2JEWA 2C1CA 1M4LA 4ZY1A 4C86A 3TX8A 2RFHA 2V8VA 1TXRA 3BI1A 1TF8A 2WZNA 3WC5A 3FJUA 1H8LA 1TKFA 1Z2LA 3V7ZA 3B3CA 3SI0A 1LAMA 1PCAA 4DJLA 1VIXA 3S9MA 4A38A 3D67A 3KQXA 3FEDA 2IJZA 2V8DA 1QQ9A 3WT4A 2PJ3A 1ELMP 2Q4ZA 3IEHA 2PJ5A 3B3VA 3DLJA 3ISXA 4KSIA 3KL9A 1F57A 5I4MA 3B7IA 1DTDA 2IQ6A 1ZG8A 3NH5A 1YW6A 3VATA 2OOTA 4FBEA 4C8TA 3GUXA 4TWEA 3KHXA 3IJ3A 1CPXA 2GU2A 3S9NA 3PFOA 3KQZA 1VHEA 4X8IA 3BI0A 3RZAA 2PE3A 3D68A 1WVMA 2V8HA 4FUUA 1QMUA 1TF9A 1AMPA 1BPMA 4NGRA 4AXVA 4WWVA 5K8PA 1FT7A 1CP7A 2XEJA 1CP6A 1HDUA 1KWMA 2ZEEA 4P6YA 1XFOA 3SJEA 2ZENA 7CPAA 5HVGA 1ARLA 3PBEA 4KNGE 2AFWA 1BPNA 2PJ0A 3D4UA 3ISZA 1ZLHA 3I1UA 4NGPA 1HDQA 8CPAA 4OC4A 1CPSA 4MHNA 2POKA 2I3CA 4C9EA 1XF1A 3BXMA 3KHZA 4DYOA 4MMOA 1EE3P 4X3RA 2DEAA 5JM6A 4GM5A 2ZOFA 4C9AA 4C99A 2ZEMA 1DE4C 4TJVA 1ZG9A 3PB8X 2HB6A 2JBJA 2ZEFA 3PEIA 4EWTA 4UIAA 2CF4A 1TKJA 2C6GA 4JZ0A 3FECA 1LFWA 5LYLA 2XEGA 4ZX8A 4CDKA 1V6CA 4UIBA 4MHPA 2IMOA 4G1PA 1IGBA 1Y0RA 3PB6X 1F2OA 4NFRA 4RUHA 4DUKA 2QVPA 4MCRA 1YLOA 1ZLIA 4Z65A 3CPXA 1XJOA 5HVFA 3H8FA 2CTBA 2NSMA 3IWWA 3WABA 3JRUA 4NGQA 4CPAA 3EIFA 4YWYA 3SJGA 3NH4A 2PJ9A 4MHZA 3SJXA 3KGQA 4OC3A 3IC1A 4MXUA 2RB7A 1ARMA 4CDJA 3CPAA 2AFSA 1CBXA 3PRTA 1VHOA 3RAMA 2AFUA 5D8NA 4PXEA 4FAIA 4A37A 3GLJA 4P4JA 4TJXA 1LANA 3KI9A 2PJ2A 5HXDA 4OC0A 3SI1A 4OP4A 4OIWA 3NH8A 5K8NA 2QJ8A 4O23A 2HC9A 2PJCA 4TNUA 4ZY0A 2NYQA 4OC1A 3RBUA 3K9TA 1HEEA 2GLJA 3NA6A 3CT9A 1Y9ZA 4H2KA 2PJBA 3MRUA 6CPAA 4ZI6A 5J1QA 4OC5A 2C6CA 3B3WA 4R76A 1CX8A 2XEIA 2QYVA 3PB9X 4R8FA 3LMSA 2ZEHA 2ZEPA 4C8CA 4WJBA 2PJAA 4IAVA 4K3NA 1LAPA 3D7DA 5LRKA 5K8OA 4C9VA 3PB7X 4EFDA 3B3TA 4C9UA 4C8FA 2F8HA 2VL1A 4F8ZA 4PXCA 5IB9A 3FMCA 4ZX9A
chains in the Genus database with same CATH superfamily
4C8AA 4ZGYB 1JDEA 4JVOA 2ZEOA 3OP0A 4HKFA 3LWUA 4PXDA 3FVLA 4PQAA 4MCSA 1GHEA 3PZJA 1QSMA 4R7MA 3F5BA 5HH1A 3G23A 1RXTA 4C9VA 1YVHA 4CRYB 2PJ6A 1XBUA 3TT2A 3ICUA 3HUVA 3TO9A 1NSAA 2XEFA 1XRYA 2C6PA 3T5MA 3EXNA 2XPLA 3CZXA 4YN3A 2Z3NA 4W9YA 3A9LA 2EWBA 2O4HA 4Q7AA 2ZOGA 2JBKA 4B6ZA 2F7VA 4IK2A 3PBBA 3EZEA 4CYQA 4C85A 4C9RA 2AFMA 2FE7A 1MJ9A 4E0AA 2PVWA 4EVYA 4NGTA 4F0YA 4JJXA 3BHXA 2Q0YA 3VRQA 2FS5A 4FD7A 1BO4A 4KUBA 2EZAA 4BPXB 1S7NA 2DPSA 1WJTA 4Q36A 4A33A 1ZRSA 4AVCA 4LQ6A 2Z3MA 1Y7RA 5ELYA 4EYSA 2GREA 1Y0YA 3K2KA 4JXRA 4M6HA 3RYOA 3CXQA 3TO6A 4AG7A 4CRZB 4KSAA 2WYRA 4KORA 2BOAA 1IICA 4UF4A 2AJ6A 4AG9A 2CIJA 4C7IA 5F5XA 2GE3A 2B4DB 3TC8A 2FM4A 4KVOE 2HV2A 3VH9A 4MCPA 4B14A 3FH4A 2EBJA 3W91A 5JYBA 4P4IA 3GB0A 1LOKA 2HWGA 5THWA 4P4BA 1RO5A 1YR0A 5A27A 1UWYA 1XIXA 2Q04A 3BUXB 2ABZA 2GANA 3I6SA 4OC2A 2ZEGA 3NFZA 4Y49B 3VRNA 4MI1A 2RC4A 2HUZA 2PQ8A 3PB4X 4UEEA 3IU1A 1Z5RA 2CBLA 1PYTB 2VZYA 3S6GA 3T8WA 4C7HA 2V8GA 3FXTA 2HQYA 1R3NA 3D7HA 2G3AA 2B3VA 2PJ7A 5JGFA 3I74A 4NGSA 4P44A 3QB8A 4E8OA 2BL1A 3TLAA 5F09A 1XMTA 2Q7BA 4ZYQA 4A94A 1YMEA 1YGHA 1Z4EA 3JTKA 3FIXA 3IO1A 1ELLP 3UY5A 4BMHA 4P4EA 1MK4A 3KR4A 2PIYA 2PSWA 2BO9A 4JYWA 4UCPA 4CGPA 3L2NA 2GIVA 4UA3A 4XPKA 3IIBA 1VHSA 3EZBA 4CS0B 5LYIA 2B5GB 1NMTA 4F9VA 1I12A 5EBVA 4AVAA 3R95A 5DS0A 3NFQA 3TE4A 3HLPA 3IWEA 1TIQA 4JD6A 4RI1A 1BOBA 5G22A 4MFPA 4B12A 2VZZA 4M85A 4II9A 4ORFA 3ZJ0A 3B35A 4PSWA 3TO7A 4KUAA 3VRPA 4I49A 1YW4A 5BY0A 3N5FA 3F8KA 3T07A 3BUNB 4CGMA 4FD5A 3FEEA 1Z9EA 4MRIA 4OMEA 2PCUA 2ZELA 1IYKA 3WC6A 4A31A 4JXQA 5F47A 2I79A 4PK3A 3DGVA 2AFOA 3LODA 1TKHA 2EO8A 3H5ZA 3T0TA 2GLFA 5AGEA 1M4IA 3C8OA 4L89A 2OR4A 2ANPA 3D7FA 1GYTA 1M4DA 3D7GA 3H8GA 4MFQA 2YNDA 2HI6A 1IOFA 1FNOA 4J0NA 3P2HA 3D2PA 4GPLB 4X2TA 1CE8B 5BWAB 4LQGA 4PXBA 2EK8A 2FVGA 3VGOA 4FD6A 2PIZA 2GFQA 3EO4A 4QBJA 4KOUA 5K99A 4MI4A 1KUXA 5CPAA 4KOVA 4B5PA 4CO9A 2AFXA 4P45A 2DPTA 1QSNA 4MFZA 4M6GA 4IUSA 1VBGA 1JQGA 4NGMA 2CXAA 4YU9A 4A39A 5F9MA 1Y7EA 2PJ1A 2D4OA 1S5KA 3CXPA 5JQ4A 5F49A 2PJ4A 1XMBA 3SI2A 1I21A 2O53A 3FX6A 1ON0A 2DLAA 4M6IA 2FL4A 5D29A 3GKRA 3NE7A 2AE6A 3H8EA 3TTHA 1VGYA 3IFEA 2UV8G 1M44A 1MJAA 2PJ8A 5ISVA 4H6ZA 2JDCA 2YJTA 3SXNA 2AUNA 3RNZA 5GCNA 1XF8A 5LYDA 2Z3LA 4HNYB 3S6FA 1F2PA 2Y1NA 1Z9UA 2JDDA 5C82A 1IY7A 1S60A 2BCOA 5HKWA 2X7BA 4B11A 3F9KC 2J8NA 4BD9A 1BLLE 5DWNA 3S9LA 2V77A 2ZW7A 1VI4A 4R6TA 1BAVA 4NJQA 4BBHA 2J8RA 3FNCA 2Q43A 3G8WA 4NJRA 4KS9A 3OAKA 2ATRA 3CXSA 4UFWA 5LRJA 4OKOA 4UEFA 4NF1A 4PPZA 2AUMA 4A2ZA 4OIDA 3K9UA 5LRGA 4C84A 1Q7LA 5K8MA 3B8GA 3PT1A 2J9AA 4HNWB 2O28A 5CNPA 4KOXA 1IB1E 2Q4YA 1M1DA 2WSAA 3SJFA 3WC7A 1S7KA 4XNHB 4F9UA 1YSJA 1CG2A 4NCZA 2BSWA 3R1KA 4E2AA 2PRQA 4P4DA 2ODFA 1YK3A 3QNVA 2ZEDA 1J3LA 3ZNIA 1Y9KA 1R43A 3H4QA 4P10A 4UCNA 4KVXA 1YVKA 2AFZA 2OH1A 3D66A 4RN7A 2G3TA 4R87A 3SR3A 1OBRA 2Q7SA 4KOYA 1SQHA 3HMJG 1IYLA 2ZXVA 3BJ7A 4F0XA 2VI7A 3T05A 2Q51A 3B3SA 3PFEA 4XNHC 3PGPA 3EC4A 5F46A 2YJVA 3KASA 5HVHA 1Q2DA 1Z8LA 3B2YA 4RS2A 3CDXA 4UWJA 3R9GA 5JVLA 3VTAA 1RTQA 2EK9A 3VROA 4ZY2A 5LYFA 4C8UA 1VKCA 4CGNA 2FXFA 2CNMA 2CTCA 2PR8A 2Y0MA 4ONWA 2EUIA 5C88A 3KR5A 4MHYA 2G9DA 3DDDA 2Q4VA 2Z3OA 3QAYA 3V38A 4NGNA 1ZG7A 3BUMB 2I00A 4P4FA 2PVVA 3TLEA 1YQEA 2YGWA 4PK2A 1KC7A 4IHMA 5JH9A 3OB1B 4MCQA 3U88C 1LCPA 1NXJA 3EY5A 4UEZA 3K4IA 5CBMA 1EO0A 4QVTA 4FWUA 4C8PA 2OZUA 1CS0B 2BUEA 4RR2B 3VARA 3KZWA 3MN8A 4K30A 4UFVA 2ZW4A 4EMEA 1AYEA 4A30A 3W6SA 2K5TA 3FF3A 2JEWA 3SHPA 3DSBA 3NE8A 4JLYA 4KLWA 1U6MA 2C1CA 4R3LA 4Y49C 4CAWA 5JPHA 5IB0A 3TFYA 4NXYA 2EZBA 3TLGA 1M4LA 3O8ZA 3TLBA 1JDBC 1DIKA 5F1YA 4ZY1A 4XPDB 3GYAA 4UCMA 3MGDA 2CY2A 4BINA 3TX8A 4C86A 1WWZA 1KBLA 2RFHA 2V8VA 2NMTA 2EZCA 1TXRA 3DNSA 3BI1A 1TF8A 2ARHA 3C26A 3E0KA 3LACA 1T36B 2WZNA 3WC5A 4UBRA 3FJUA 3TLZA 1H8LA 1TKFA 4B5PB 1Z2LA 1P4NA 3V7ZA 3B3CA 3SI0A 2D0PA 4MFJA 1LAMA 2DF5A 1PCAA 5KTCA 4DJLA 1VIXA 3S9MA 4QB9A 4A38A 3OWCA 5AXIA 2FIWA 3D67A 4B13A 3FB3A 2Q44A 1Z8XA 3KQXA 3FEDA 5F13A 1N71A 2IJZA 2V8DA 4MJXA 5J8FA 4H89A 1PUAA 1QQ9A 1UFHA 3WT4A 2PJ3A 4JWPA 1ELMP 2Q4ZA 3IEHA 4CAEA 2PJ5A 3B3VA 3DLJA 1QSTA 3ISXA 3T9YA 3TCVA 4KSIA 4A32A 3KL9A 5IV0A 1ZL0A 2X0SA 4A95A 2Z3PA 2FT0A 4GXHA 3NOJA 2MP0A 1IOIA 3PFVA 4HPSA 4CYOA 4CYPA 3IGRA 1F57A 5I4MA 1A9XB 2YNCA 4ZBGA 1XE4A 3B7IA 1DTDA 2OLSA 2IQ6A 2IL4A 1ZG8A 1KUVA 4L8AA 3NH5A 1YW6A 3VATA 4KZTA 3GY9A 2Z3KA 2OOTA 4FBEA 1EZAA 1QSOA 4C8TA 1K4JA 3GUXA 4TWEA 4M8DA 2B5GA 2PRBA 3TLYA 3KHXA 4YGOA 4NSQA 3IJ3A 4KOWA 1CPXA 2GU2A 1FY7A 2BEIA 4MHDA 3S9NA 4XPLA 4F6AA 3PFOA 3KQZA 1VHEA 1Q2YA 5DWMA 4C2YA 5EMIA 2Z11A 1Z8TA 4E94A 4X8IA 3BI0A 3RZAA 1YLEA 5G20A 2PE3A 3D68A 1WVMA 2V8HA 2FSRA 5IX3A 5AG5A 4FUUA 5EC4A 1QMUA 4C2ZA 2E28A 1TF9A 1AMPA 4ONUA 3VWEA 3FYNA 1BPMA 3LD2A 4YRHA 3WR7A 2PR1A 4C2XA 4NGRA 4AXVA 4CGOA 4WWVA 4U9YA 2Y1MA 3V8IA 5K8PA 1FT7A 1QSRA 1ZO0A 1CP7A 2XEJA 1CP6A 1HDUA 1KWMA 2ZEEA 4P6YA 3KRVA 1XFOA 4Q38A 1OZPA 3R9FA 1S3ZA 3SJEA 4J3GA 3IU2A 2VKZG 1KZFA 2ZENA 7CPAA 5HVGA 1ARLA 3FRMA 3HPGG 3BLNA 3PBEA 4C68A 4KNGE 2AFWA 1C3OB 1BPNA 3HPHE 2PJ0A 3D4UA 3ISZA 4OAEA 1ZLHA 3I1UA 4NGPA 2YNEA 3TLCA 1HDQA 3F0AA 4R9MA 8CPAA 2PDOA 1IIDA 4OC4A 1Q2CA 2C27A 1CPSA 4MHNA 2POKA 4AVBA 1YREA 2R98A 2I3CA 4C9EA 4GS4A 4AB7A 1EZBA 2Z0ZA 2Z10A 4U5YA 1Z4RA 3IWGA 1XF1A 3BXMA 2B58A 3BUWB 3KHZA 1CJWA 4KOTA 3QAHA 4DYOA 4MMOA 1EE3P 4IIXA 4X3RA 5KTAA 2DEAA 5E96A 1R57A 3R9EA 5JM6A 4UFXA 4GM5A 2G0BA 1I1DA 2ZOFA 4C9AA 4C99A 2ZEMA 1DE4C 2QMLA 3D3SA 2REFA 4TJVA 1ZG9A 1V0CA 1NE9A 2XPPA 2OZHA 3TLGB 5I0CA 1L0CA 1YX0A 4R3KA 3PB8X 2KCWA 2HB6A 2JBJA 4BPUB 2ZEFA 3D8PA 2ZW6A 3PEIA 4U9ZA 4UIAA 4EWTA 1VBHA 2CF4A 1TKJA 2C6GA 2N3AB 4JZ0A 2FIAA 1MJBA 3RO0A 5FD8A 3FECA 1LFWA 5LYLA 2XEGA 1Y9WA 3BJ8A 4QUSA 4ZX8A 3TOBA 4CDKA 1Q5XA 1AUGA 1V6CA 2WUUA 4UIBA 3OB2B 4MHPA 2H5MA 4H6UA 1R61A 2IMOA 2R1IA 4G1PA 2QIRA 2C5QA 4LX9A 2F5IA 5AG6A 1IGBA 4COBA 4OLLA 4CZ1A 1M4GA 1Y0RA 3PB6X 2WPXA 1F2OA 4NFRA 4CGLA 4RUHA 2DIKA 4DUKA 5HKZA 1BXRB 1A2ZA 3G3SA 3GIUA 5G21A 2JEVA 2QVPA 3P2FA 4MCRA 1YLOA 1ZLIA 2B4JC 3CPXA 1XJOA 5AG7A 5H84A 5HVFA 3H8FA 4Z65A 2XPNA 2CTBA 2NSMA 4MFLA 1LRZA 4UWIA 3IWWA 2VEZA 3I9SA 3WABA 1FBVA 4NGQA 3JRUA 4HNXB 5HMNA 3DR8A 4KOSA 4CPAA 4OADA 2REEA 2B4DA 1XOVA 4CAFA 2EVNA 3DR6A 4YWYA 3EIFA 1C30B 1M6VB 1IU8A 3SJGA 1P0HA 4XPDC 3D2MA 3NH4A 5H86A 2PJ9A 3KKWA 2P6EA 4MHZA 1CM0A 2ZPAA 5A28A 3SJXA 2A4NA 3KGQA 4OC3A 3I3GA 3IC1A 4MXUA 2P0WA 1XEBA 2RB7A 1ARMA 4CDJA 4E5SA 3CPAA 2AFSA 1CBXA 5J8CA 3PRTA 4KVME 1VHOA 4M3SA 2AFUA 3RAMA 4KLVA 5D8NA 4NEXA 4PXEA 3JUWA 4FAIA 2YNCC 3JVNA 1S7LA 1KEEB 5F48A 3ZZIA 4A37A 3GLJA 1B6BA 4R57A 3U1BA 2FCKA 4P4JA 3R96A 2CNSA 4TJXA 1LANA 2J8MA 1S7FA 3KI9A 1NBWA 2PJ2A 5HXDA 4OC0A 4BPWB 4OP4A 3SI1A 4OIWA 4MY0A 3NH8A 5K8NA 1X10A 2QJ8A 5KTDA 1B87A 5AG4A 3PLFB 2D4PA 4MFKA 2GP4A 2ZW5A 2HROA 4O23A 4CAVA 2HC9A 2PJCA 4TNUA 4ZY0A 1JWQA 2OB0A 2NYQA 4OC1A 2VQYA 1PU9A 3RBUA 2B4BA 4QC6A 3K9TA 1HEEA 2GLJA 3NA6A 3CT9A 1Y9ZA 4H2KA 2R82A 2PJBA 2QECA 3MRUA 6CPAA 3GJZA 1Z8WA 4ZI6A 4KSFA 4B5OA 5J1QA 1WK4A 4OC5A 4MBUA 2JLMA 2C6CA 4PV6A 3SXOA 3B3WA 3N7ZA 3S6HA 4B10A 4R76A 3VWDA 2R8VA 4YFJA 1CX8A 3S6KA 3VRRA 3T90A 2PC1A 2XEIA 2QYVA 3EZAA 4H1HA 2CNTA 3PB9X 4PSXA 3LMSA 4R8FA 4CAXA 2ZEHA 2ZEPA 5J3XA 2WPWA 1NSLA 3FBUA 3PP9A 4WJBA 4C8CA 2PJAA 1J4JA 1X12A 4IAVA 4MY3A 5G1ZA 4MJ8A 4BTFA 2VBQA 4A4CA 4COGA 4K3NA 5IR2A 1LAPA 4A4BA 1KUYA 3EFAA 3D7DA 1GGOA 4FD4A 3TYXA 4IF5A 5LRKA 2PCNA 1YVOA 4INJA 3W6XA 5K8OA 4IIYA 1B47A 2P6FA 2VXKA 2XPOA 2DXQA 3PB7X 5FVJA 3BUOB 4LUAA 3TOAA 3B3TA 4EFDA 4C9UA 4C8FA 2OU2A 2F8HA 2P6GA 2VL1A 4PXCA 4DNCA 4F8ZA 1ZYMA 4X5KA 5HKYA 2B0AA 2B3UA 5IB9A 2R7HA 2D0OA 2OZGA 3FMCA 4CYNA 4ZX9A
chains in the Genus database with same CATH topology
4C8AA 2ZEOA 3LWUA 4PXDA 3FVLA 4PQAA 4MCSA 4R7MA 2PJ6A 1XBUA 3ICUA 3HUVA 1NSAA 2XEFA 1XRYA 2C6PA 4YN3A 4W9YA 4Q7AA 2EWBA 2O4HA 2ZOGA 2JBKA 4B6ZA 2F7VA 4IK2A 3PBBA 4C85A 4C9RA 2AFMA 2PVWA 4NGTA 3BHXA 5ELYA 2GREA 1Y0YA 3K2KA 4UF4A 2WYRA 2BOAA 2CIJA 3TC8A 3VH9A 4MCPA 3FH4A 4P4IA 3GB0A 1LOKA 5THWA 4P4BA 1UWYA 3I6SA 2ABZA 4OC2A 2ZEGA 3NFZA 3PB4X 4UEEA 1Z5RA 1PYTB 3T8WA 2V8GA 3I74A 1R3NA 3D7HA 2PJ7A 5JGFA 4NGSA 4P44A 5F09A 4ZYQA 4A94A 1YMEA 3IO1A 1ELLP 4P4EA 3KR4A 2PIYA 2BO9A 4JYWA 3L2NA 3IIBA 5LYIA 4F9VA 5DS0A 3HLPA 3B35A 1YW4A 3N5FA 3FEEA 4MRIA 4OMEA 2PCUA 2ZELA 3WC6A 3DGVA 2AFOA 1TKHA 2GLFA 2OR4A 2ANPA 3D7FA 1GYTA 3D7GA 3H8GA 1FNOA 4X2TA 4LQGA 4PXBA 2EK8A 2FVGA 2PIZA 5CPAA 2AFXA 4P45A 1JQGA 4NGMA 4YU9A 4A39A 1Y7EA 2PJ1A 2PJ4A 1XMBA 3SI2A 2O53A 3FX6A 5D29A 3H8EA 1VGYA 3IFEA 2PJ8A 5LYDA 1F2PA 1IY7A 2BCOA 4BD9A 1BLLE 3S9LA 2V77A 4R6TA 1BAVA 4NJQA 2Q43A 4NJRA 5LRJA 4OKOA 4UEFA 4PPZA 4OIDA 5LRGA 4C84A 1Q7LA 5K8MA 2J9AA 3WC7A 3SJFA 4F9UA 1YSJA 1CG2A 2PRQA 4P4DA 3QNVA 2ZEDA 4P10A 1R43A 2AFZA 3D66A 1OBRA 2Q51A 3B3SA 3PFEA 3KASA 5HVHA 1Z8LA 3B2YA 3CDXA 3VTAA 1RTQA 2EK9A 4ZY2A 5LYFA 4C8UA 2CTCA 4ONWA 3KR5A 4MHYA 2G9DA 3V38A 4NGNA 1ZG7A 4P4FA 2PVVA 4IHMA 5JH9A 4MCQA 1LCPA 4UEZA 5CBMA 4FWUA 4C8PA 3VARA 3KZWA 3MN8A 4EMEA 1AYEA 3FF3A 2JEWA 2C1CA 1M4LA 4ZY1A 4C86A 3TX8A 2RFHA 2V8VA 1TXRA 3BI1A 1TF8A 2WZNA 3WC5A 3FJUA 1H8LA 1TKFA 1Z2LA 3V7ZA 3B3CA 3SI0A 1LAMA 1PCAA 4DJLA 1VIXA 3S9MA 4A38A 3D67A 3KQXA 3FEDA 2IJZA 2V8DA 1QQ9A 3WT4A 2PJ3A 1ELMP 2Q4ZA 3IEHA 2PJ5A 3B3VA 3DLJA 3ISXA 4KSIA 3KL9A 1F57A 5I4MA 3B7IA 1DTDA 2IQ6A 1ZG8A 3NH5A 1YW6A 3VATA 2OOTA 4FBEA 4C8TA 3GUXA 4TWEA 3KHXA 3IJ3A 1CPXA 2GU2A 3S9NA 3PFOA 3KQZA 1VHEA 4X8IA 3BI0A 3RZAA 2PE3A 3D68A 1WVMA 2V8HA 4FUUA 1QMUA 1TF9A 1AMPA 1BPMA 4NGRA 4AXVA 4WWVA 5K8PA 1FT7A 1CP7A 2XEJA 1CP6A 1HDUA 1KWMA 2ZEEA 4P6YA 1XFOA 3SJEA 2ZENA 7CPAA 5HVGA 1ARLA 3PBEA 4KNGE 2AFWA 1BPNA 2PJ0A 3D4UA 3ISZA 1ZLHA 3I1UA 4NGPA 1HDQA 8CPAA 4OC4A 1CPSA 4MHNA 2POKA 2I3CA 4C9EA 1XF1A 3BXMA 3KHZA 4DYOA 4MMOA 1EE3P 4X3RA 2DEAA 5JM6A 4GM5A 2ZOFA 4C9AA 4C99A 2ZEMA 1DE4C 4TJVA 1ZG9A 3PB8X 2HB6A 2JBJA 2ZEFA 3PEIA 4EWTA 4UIAA 2CF4A 1TKJA 2C6GA 4JZ0A 3FECA 1LFWA 5LYLA 2XEGA 4ZX8A 4CDKA 1V6CA 4UIBA 4MHPA 2IMOA 4G1PA 2C5QA 1IGBA 1Y0RA 3PB6X 1F2OA 4NFRA 4RUHA 4DUKA 2QVPA 4MCRA 1YLOA 1ZLIA 4Z65A 3CPXA 1XJOA 5HVFA 3H8FA 2CTBA 2NSMA 3IWWA 3WABA 3JRUA 4NGQA 4CPAA 3EIFA 4YWYA 3SJGA 3NH4A 2PJ9A 4MHZA 3SJXA 3KGQA 4OC3A 3IC1A 4MXUA 2RB7A 1ARMA 4CDJA 3CPAA 2AFSA 1CBXA 3PRTA 1VHOA 3RAMA 2AFUA 5D8NA 4PXEA 4FAIA 4A37A 3GLJA 4P4JA 4TJXA 1LANA 3KI9A 2PJ2A 5HXDA 4OC0A 3SI1A 4OP4A 4OIWA 3NH8A 5K8NA 2QJ8A 2GP4A 4O23A 2HC9A 2PJCA 4TNUA 4ZY0A 2NYQA 4OC1A 3RBUA 3K9TA 1HEEA 2GLJA 3NA6A 3CT9A 1Y9ZA 4H2KA 2PJBA 3MRUA 6CPAA 4ZI6A 5J1QA 4OC5A 2C6CA 3B3WA 4R76A 1CX8A 2XEIA 2QYVA 3PB9X 4R8FA 3LMSA 2ZEHA 2ZEPA 4C8CA 4WJBA 2PJAA 4IAVA 4K3NA 5IR2A 1LAPA 3D7DA 5LRKA 5K8OA 4C9VA 3PB7X 4EFDA 3B3TA 4C9UA 4C8FA 2F8HA 2VL1A 4F8ZA 4PXCA 5IB9A 3FMCA 4ZX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8A A;  2ZEO A;  3LWU A;  4PXD A;  3FVL A;  4PQA A;  4MCS A;  4R7M A;  2PJ6 A;  1XBU A;  3ICU A;  3HUV A;  1NSA A;  2XEF A;  1XRY A;  2C6P A;  4YN3 A;  4W9Y A;  4Q7A A;  2EWB A;  2O4H A;  2ZOG A;  2JBK A;  4B6Z A;  2F7V A;  4IK2 A;  3PBB A;  4C85 A;  4C9R A;  2AFM A;  2PVW A;  4NGT A;  3BHX A;  5ELY A;  2GRE A;  1Y0Y A;  3K2K A;  4UF4 A;  2WYR A;  2BOA A;  2CIJ A;  3TC8 A;  3VH9 A;  4MCP A;  3FH4 A;  4P4I A;  3GB0 A;  1LOK A;  5THW A;  4P4B A;  1UWY A;  3I6S A;  2ABZ A;  4OC2 A;  2ZEG A;  3NFZ A;  3PB4 X;  4UEE A;  1Z5R A;  1PYT B;  3T8W A;  2V8G A;  3I74 A;  1R3N A;  3D7H A;  2PJ7 A;  5JGF A;  4NGS A;  4P44 A;  5F09 A;  4ZYQ A;  4A94 A;  1YME A;  3IO1 A;  1ELL P;  4P4E A;  3KR4 A;  2PIY A;  2BO9 A;  4JYW A;  3L2N A;  3IIB A;  5LYI A;  4F9V A;  5DS0 A;  3HLP A;  3B35 A;  1YW4 A;  3N5F A;  3FEE A;  4MRI A;  4OME A;  2PCU A;  2ZEL A;  3WC6 A;  3DGV A;  2AFO A;  1TKH A;  2GLF A;  2OR4 A;  2ANP A;  3D7F A;  1GYT A;  3D7G A;  3H8G A;  1FNO A;  4X2T A;  4LQG A;  4PXB A;  2EK8 A;  2FVG A;  2PIZ A;  5CPA A;  2AFX A;  4P45 A;  1JQG A;  4NGM A;  4YU9 A;  4A39 A;  1Y7E A;  2PJ1 A;  2PJ4 A;  1XMB A;  3SI2 A;  2O53 A;  3FX6 A;  5D29 A;  3H8E A;  1VGY A;  3IFE A;  2PJ8 A;  5LYD A;  1F2P A;  1IY7 A;  2BCO A;  4BD9 A;  1BLL E;  3S9L A;  2V77 A;  4R6T A;  1BAV A;  4NJQ A;  2Q43 A;  4NJR A;  5LRJ A;  4OKO A;  4UEF A;  4PPZ A;  4OID A;  5LRG A;  4C84 A;  1Q7L A;  5K8M A;  2J9A A;  3WC7 A;  3SJF A;  4F9U A;  1YSJ A;  1CG2 A;  2PRQ A;  4P4D A;  3QNV A;  2ZED A;  4P10 A;  1R43 A;  2AFZ A;  3D66 A;  1OBR A;  2Q51 A;  3B3S A;  3PFE A;  3KAS A;  5HVH A;  1Z8L A;  3B2Y A;  3CDX A;  3VTA A;  1RTQ A;  2EK9 A;  4ZY2 A;  5LYF A;  4C8U A;  2CTC A;  4ONW A;  3KR5 A;  4MHY A;  2G9D A;  3V38 A;  4NGN A;  1ZG7 A;  4P4F A;  2PVV A;  4IHM A;  5JH9 A;  4MCQ A;  1LCP A;  4UEZ A;  5CBM A;  4FWU A;  4C8P A;  3VAR A;  3KZW A;  3MN8 A;  4EME A;  1AYE A;  3FF3 A;  2JEW A;  2C1C A;  1M4L A;  4ZY1 A;  4C86 A;  3TX8 A;  2RFH A;  2V8V A;  1TXR A;  3BI1 A;  1TF8 A;  2WZN A;  3WC5 A;  3FJU A;  1H8L A;  1TKF A;  1Z2L A;  3V7Z A;  3B3C A;  3SI0 A;  1LAM A;  1PCA A;  4DJL A;  1VIX A;  3S9M A;  4A38 A;  3D67 A;  3KQX A;  3FED A;  2IJZ A;  2V8D A;  1QQ9 A;  3WT4 A;  2PJ3 A;  1ELM P;  2Q4Z A;  3IEH A;  2PJ5 A;  3B3V A;  3DLJ A;  3ISX A;  4KSI A;  3KL9 A;  1F57 A;  5I4M A;  3B7I A;  1DTD A;  2IQ6 A;  1ZG8 A;  3NH5 A;  1YW6 A;  3VAT A;  2OOT A;  4FBE A;  4C8T A;  3GUX A;  4TWE A;  3KHX A;  3IJ3 A;  1CPX A;  2GU2 A;  3S9N A;  3PFO A;  3KQZ A;  1VHE A;  4X8I A;  3BI0 A;  3RZA A;  2PE3 A;  3D68 A;  1WVM A;  2V8H A;  4FUU A;  1QMU A;  1TF9 A;  1AMP A;  1BPM A;  4NGR A;  4AXV A;  4WWV A;  5K8P A;  1FT7 A;  1CP7 A;  2XEJ A;  1CP6 A;  1HDU A;  1KWM A;  2ZEE A;  4P6Y A;  1XFO A;  3SJE A;  2ZEN A;  7CPA A;  5HVG A;  1ARL A;  3PBE A;  4KNG E;  2AFW A;  1BPN A;  2PJ0 A;  3D4U A;  3ISZ A;  1ZLH A;  3I1U A;  4NGP A;  1HDQ A;  8CPA A;  4OC4 A;  1CPS A;  4MHN A;  2POK A;  2I3C A;  4C9E A;  1XF1 A;  3BXM A;  3KHZ A;  4DYO A;  4MMO A;  1EE3 P;  4X3R A;  2DEA A;  5JM6 A;  4GM5 A;  2ZOF A;  4C9A A;  4C99 A;  2ZEM A;  1DE4 C;  4TJV A;  1ZG9 A;  3PB8 X;  2HB6 A;  2JBJ A;  2ZEF A;  3PEI A;  4EWT A;  4UIA A;  2CF4 A;  1TKJ A;  2C6G A;  4JZ0 A;  3FEC A;  1LFW A;  5LYL A;  2XEG A;  4ZX8 A;  4CDK A;  1V6C A;  4UIB A;  4MHP A;  2IMO A;  4G1P A;  1IGB A;  1Y0R A;  3PB6 X;  1F2O A;  4NFR A;  4RUH A;  4DUK A;  2QVP A;  4MCR A;  1YLO A;  1ZLI A;  4Z65 A;  3CPX A;  1XJO A;  5HVF A;  3H8F A;  2CTB A;  2NSM A;  3IWW A;  3WAB A;  3JRU A;  4NGQ A;  4CPA A;  3EIF A;  4YWY A;  3SJG A;  3NH4 A;  2PJ9 A;  4MHZ A;  3SJX A;  3KGQ A;  4OC3 A;  3IC1 A;  4MXU A;  2RB7 A;  1ARM A;  4CDJ A;  3CPA A;  2AFS A;  1CBX A;  3PRT A;  1VHO A;  3RAM A;  2AFU A;  5D8N A;  4PXE A;  4FAI A;  4A37 A;  3GLJ A;  4P4J A;  4TJX A;  1LAN A;  3KI9 A;  2PJ2 A;  5HXD A;  4OC0 A;  3SI1 A;  4OP4 A;  4OIW A;  3NH8 A;  5K8N A;  2QJ8 A;  4O23 A;  2HC9 A;  2PJC A;  4TNU A;  4ZY0 A;  2NYQ A;  4OC1 A;  3RBU A;  3K9T A;  1HEE A;  2GLJ A;  3NA6 A;  3CT9 A;  1Y9Z A;  4H2K A;  2PJB A;  3MRU A;  6CPA A;  4ZI6 A;  5J1Q A;  4OC5 A;  2C6C A;  3B3W A;  4R76 A;  1CX8 A;  2XEI A;  2QYV A;  3PB9 X;  4R8F A;  3LMS A;  2ZEH A;  2ZEP A;  4C8C A;  4WJB A;  2PJA A;  4IAV A;  4K3N A;  1LAP A;  3D7D A;  5LRK A;  5K8O A;  4C9V A;  3PB7 X;  4EFD A;  3B3T A;  4C9U A;  4C8F A;  2F8H A;  2VL1 A;  4F8Z A;  4PXC A;  5IB9 A;  3FMC A;  4ZX9 A; 
#chains in the Genus database with same CATH topology
 4C8A A;  4ZGY B;  1JDE A;  4JVO A;  2ZEO A;  3OP0 A;  4HKF A;  3LWU A;  4PXD A;  3FVL A;  4PQA A;  4MCS A;  1GHE A;  3PZJ A;  1QSM A;  4R7M A;  3F5B A;  5HH1 A;  3G23 A;  1RXT A;  4C9V A;  1YVH A;  4CRY B;  2PJ6 A;  1XBU A;  3TT2 A;  3ICU A;  3HUV A;  3TO9 A;  1NSA A;  2XEF A;  1XRY A;  2C6P A;  3T5M A;  3EXN A;  2XPL A;  3CZX A;  4YN3 A;  2Z3N A;  4W9Y A;  3A9L A;  2EWB A;  2O4H A;  4Q7A A;  2ZOG A;  2JBK A;  4B6Z A;  2F7V A;  4IK2 A;  3PBB A;  3EZE A;  4CYQ A;  4C85 A;  4C9R A;  2AFM A;  2FE7 A;  1MJ9 A;  4E0A A;  2PVW A;  4EVY A;  4NGT A;  4F0Y A;  4JJX A;  3BHX A;  2Q0Y A;  3VRQ A;  2FS5 A;  4FD7 A;  1BO4 A;  4KUB A;  2EZA A;  4BPX B;  1S7N A;  2DPS A;  1WJT A;  4Q36 A;  4A33 A;  1ZRS A;  4AVC A;  4LQ6 A;  2Z3M A;  1Y7R A;  5ELY A;  4EYS A;  2GRE A;  1Y0Y A;  3K2K A;  4JXR A;  4M6H A;  3RYO A;  3CXQ A;  3TO6 A;  4AG7 A;  4CRZ B;  4KSA A;  2WYR A;  4KOR A;  2BOA A;  1IIC A;  4UF4 A;  2AJ6 A;  4AG9 A;  2CIJ A;  4C7I A;  5F5X A;  2GE3 A;  2B4D B;  3TC8 A;  2FM4 A;  4KVO E;  2HV2 A;  3VH9 A;  4MCP A;  4B14 A;  3FH4 A;  2EBJ A;  3W91 A;  5JYB A;  4P4I A;  3GB0 A;  1LOK A;  2HWG A;  5THW A;  4P4B A;  1RO5 A;  1YR0 A;  5A27 A;  1UWY A;  1XIX A;  2Q04 A;  3BUX B;  2ABZ A;  2GAN A;  3I6S A;  4OC2 A;  2ZEG A;  3NFZ A;  4Y49 B;  3VRN A;  4MI1 A;  2RC4 A;  2HUZ A;  2PQ8 A;  3PB4 X;  4UEE A;  3IU1 A;  1Z5R A;  2CBL A;  1PYT B;  2VZY A;  3S6G A;  3T8W A;  4C7H A;  2V8G A;  3FXT A;  2HQY A;  1R3N A;  3D7H A;  2G3A A;  2B3V A;  2PJ7 A;  5JGF A;  3I74 A;  4NGS A;  4P44 A;  3QB8 A;  4E8O A;  2BL1 A;  3TLA A;  5F09 A;  1XMT A;  2Q7B A;  4ZYQ A;  4A94 A;  1YME A;  1YGH A;  1Z4E A;  3JTK A;  3FIX A;  3IO1 A;  1ELL P;  3UY5 A;  4BMH A;  4P4E A;  1MK4 A;  3KR4 A;  2PIY A;  2PSW A;  2BO9 A;  4JYW A;  4UCP A;  4CGP A;  3L2N A;  2GIV A;  4UA3 A;  4XPK A;  3IIB A;  1VHS A;  3EZB A;  4CS0 B;  5LYI A;  2B5G B;  1NMT A;  4F9V A;  1I12 A;  5EBV A;  4AVA A;  3R95 A;  5DS0 A;  3NFQ A;  3TE4 A;  3HLP A;  3IWE A;  1TIQ A;  4JD6 A;  4RI1 A;  1BOB A;  5G22 A;  4MFP A;  4B12 A;  2VZZ A;  4M85 A;  4II9 A;  4ORF A;  3ZJ0 A;  3B35 A;  4PSW A;  3TO7 A;  4KUA A;  3VRP A;  4I49 A;  1YW4 A;  5BY0 A;  3N5F A;  3F8K A;  3T07 A;  3BUN B;  4CGM A;  4FD5 A;  3FEE A;  1Z9E A;  4MRI A;  4OME A;  2PCU A;  2ZEL A;  1IYK A;  3WC6 A;  4A31 A;  4JXQ A;  5F47 A;  2I79 A;  4PK3 A;  3DGV A;  2AFO A;  3LOD A;  1TKH A;  2EO8 A;  3H5Z A;  3T0T A;  2GLF A;  5AGE A;  1M4I A;  3C8O A;  4L89 A;  2OR4 A;  2ANP A;  3D7F A;  1GYT A;  1M4D A;  3D7G A;  3H8G A;  4MFQ A;  2YND A;  2HI6 A;  1IOF A;  1FNO A;  4J0N A;  3P2H A;  3D2P A;  4GPL B;  4X2T A;  1CE8 B;  5BWA B;  4LQG A;  4PXB A;  2EK8 A;  2FVG A;  3VGO A;  4FD6 A;  2PIZ A;  2GFQ A;  3EO4 A;  4QBJ A;  4KOU A;  5K99 A;  4MI4 A;  1KUX A;  5CPA A;  4KOV A;  4B5P A;  4CO9 A;  2AFX A;  4P45 A;  2DPT A;  1QSN A;  4MFZ A;  4M6G A;  4IUS A;  1VBG A;  1JQG A;  4NGM A;  2CXA A;  4YU9 A;  4A39 A;  5F9M A;  1Y7E A;  2PJ1 A;  2D4O A;  1S5K A;  3CXP A;  5JQ4 A;  5F49 A;  2PJ4 A;  1XMB A;  3SI2 A;  1I21 A;  2O53 A;  3FX6 A;  1ON0 A;  2DLA A;  4M6I A;  2FL4 A;  5D29 A;  3GKR A;  3NE7 A;  2AE6 A;  3H8E A;  3TTH A;  1VGY A;  3IFE A;  2UV8 G;  1M44 A;  1MJA A;  2PJ8 A;  5ISV A;  4H6Z A;  2JDC A;  2YJT A;  3SXN A;  2AUN A;  3RNZ A;  5GCN A;  1XF8 A;  5LYD A;  2Z3L A;  4HNY B;  3S6F A;  1F2P A;  2Y1N A;  1Z9U A;  2JDD A;  5C82 A;  1IY7 A;  1S60 A;  2BCO A;  5HKW A;  2X7B A;  4B11 A;  3F9K C;  2J8N A;  4BD9 A;  1BLL E;  5DWN A;  3S9L A;  2V77 A;  2ZW7 A;  1VI4 A;  4R6T A;  1BAV A;  4NJQ A;  4BBH A;  2J8R A;  3FNC A;  2Q43 A;  3G8W A;  4NJR A;  4KS9 A;  3OAK A;  2ATR A;  3CXS A;  4UFW A;  5LRJ A;  4OKO A;  4UEF A;  4NF1 A;  4PPZ A;  2AUM A;  4A2Z A;  4OID A;  3K9U A;  5LRG A;  4C84 A;  1Q7L A;  5K8M A;  3B8G A;  3PT1 A;  2J9A A;  4HNW B;  2O28 A;  5CNP A;  4KOX A;  1IB1 E;  2Q4Y A;  1M1D A;  2WSA A;  3SJF A;  3WC7 A;  1S7K A;  4XNH B;  4F9U A;  1YSJ A;  1CG2 A;  4NCZ A;  2BSW A;  3R1K A;  4E2A A;  2PRQ A;  4P4D A;  2ODF A;  1YK3 A;  3QNV A;  2ZED A;  1J3L A;  3ZNI A;  1Y9K A;  1R43 A;  3H4Q A;  4P10 A;  4UCN A;  4KVX A;  1YVK A;  2AFZ A;  2OH1 A;  3D66 A;  4RN7 A;  2G3T A;  4R87 A;  3SR3 A;  1OBR A;  2Q7S A;  4KOY A;  1SQH A;  3HMJ G;  1IYL A;  2ZXV A;  3BJ7 A;  4F0X A;  2VI7 A;  3T05 A;  2Q51 A;  3B3S A;  3PFE A;  4XNH C;  3PGP A;  3EC4 A;  5F46 A;  2YJV A;  3KAS A;  5HVH A;  1Q2D A;  1Z8L A;  3B2Y A;  4RS2 A;  3CDX A;  4UWJ A;  3R9G A;  5JVL A;  3VTA A;  1RTQ A;  2EK9 A;  3VRO A;  4ZY2 A;  5LYF A;  4C8U A;  1VKC A;  4CGN A;  2FXF A;  2CNM A;  2CTC A;  2PR8 A;  2Y0M A;  4ONW A;  2EUI A;  5C88 A;  3KR5 A;  4MHY A;  2G9D A;  3DDD A;  2Q4V A;  2Z3O A;  3QAY A;  3V38 A;  4NGN A;  1ZG7 A;  3BUM B;  2I00 A;  4P4F A;  2PVV A;  3TLE A;  1YQE A;  2YGW A;  4PK2 A;  1KC7 A;  4IHM A;  5JH9 A;  3OB1 B;  4MCQ A;  3U88 C;  1LCP A;  1NXJ A;  3EY5 A;  4UEZ A;  3K4I A;  5CBM A;  1EO0 A;  4QVT A;  4FWU A;  4C8P A;  2OZU A;  1CS0 B;  2BUE A;  4RR2 B;  3VAR A;  3KZW A;  3MN8 A;  4K30 A;  4UFV A;  2ZW4 A;  4EME A;  1AYE A;  4A30 A;  3W6S A;  2K5T A;  3FF3 A;  2JEW A;  3SHP A;  3DSB A;  3NE8 A;  4JLY A;  4KLW A;  1U6M A;  2C1C A;  4R3L A;  4Y49 C;  4CAW A;  5JPH A;  5IB0 A;  3TFY A;  4NXY A;  2EZB A;  3TLG A;  1M4L A;  3O8Z A;  3TLB A;  1JDB C;  1DIK A;  5F1Y A;  4ZY1 A;  4XPD B;  3GYA A;  4UCM A;  3MGD A;  2CY2 A;  4BIN A;  3TX8 A;  4C86 A;  1WWZ A;  1KBL A;  2RFH A;  2V8V A;  2NMT A;  2EZC A;  1TXR A;  3DNS A;  3BI1 A;  1TF8 A;  2ARH A;  3C26 A;  3E0K A;  3LAC A;  1T36 B;  2WZN A;  3WC5 A;  4UBR A;  3FJU A;  3TLZ A;  1H8L A;  1TKF A;  4B5P B;  1Z2L A;  1P4N A;  3V7Z A;  3B3C A;  3SI0 A;  2D0P A;  4MFJ A;  1LAM A;  2DF5 A;  1PCA A;  5KTC A;  4DJL A;  1VIX A;  3S9M A;  4QB9 A;  4A38 A;  3OWC A;  5AXI A;  2FIW A;  3D67 A;  4B13 A;  3FB3 A;  2Q44 A;  1Z8X A;  3KQX A;  3FED A;  5F13 A;  1N71 A;  2IJZ A;  2V8D A;  4MJX A;  5J8F A;  4H89 A;  1PUA A;  1QQ9 A;  1UFH A;  3WT4 A;  2PJ3 A;  4JWP A;  1ELM P;  2Q4Z A;  3IEH A;  4CAE A;  2PJ5 A;  3B3V A;  3DLJ A;  1QST A;  3ISX A;  3T9Y A;  3TCV A;  4KSI A;  4A32 A;  3KL9 A;  5IV0 A;  1ZL0 A;  2X0S A;  4A95 A;  2Z3P A;  2FT0 A;  4GXH A;  3NOJ A;  2MP0 A;  1IOI A;  3PFV A;  4HPS A;  4CYO A;  4CYP A;  3IGR A;  1F57 A;  5I4M A;  1A9X B;  2YNC A;  4ZBG A;  1XE4 A;  3B7I A;  1DTD A;  2OLS A;  2IQ6 A;  2IL4 A;  1ZG8 A;  1KUV A;  4L8A A;  3NH5 A;  1YW6 A;  3VAT A;  4KZT A;  3GY9 A;  2Z3K A;  2OOT A;  4FBE A;  1EZA A;  1QSO A;  4C8T A;  1K4J A;  3GUX A;  4TWE A;  4M8D A;  2B5G A;  2PRB A;  3TLY A;  3KHX A;  4YGO A;  4NSQ A;  3IJ3 A;  4KOW A;  1CPX A;  2GU2 A;  1FY7 A;  2BEI A;  4MHD A;  3S9N A;  4XPL A;  4F6A A;  3PFO A;  3KQZ A;  1VHE A;  1Q2Y A;  5DWM A;  4C2Y A;  5EMI A;  2Z11 A;  1Z8T A;  4E94 A;  4X8I A;  3BI0 A;  3RZA A;  1YLE A;  5G20 A;  2PE3 A;  3D68 A;  1WVM A;  2V8H A;  2FSR A;  5IX3 A;  5AG5 A;  4FUU A;  5EC4 A;  1QMU A;  4C2Z A;  2E28 A;  1TF9 A;  1AMP A;  4ONU A;  3VWE A;  3FYN A;  1BPM A;  3LD2 A;  4YRH A;  3WR7 A;  2PR1 A;  4C2X A;  4NGR A;  4AXV A;  4CGO A;  4WWV A;  4U9Y A;  2Y1M A;  3V8I A;  5K8P A;  1FT7 A;  1QSR A;  1ZO0 A;  1CP7 A;  2XEJ A;  1CP6 A;  1HDU A;  1KWM A;  2ZEE A;  4P6Y A;  3KRV A;  1XFO A;  4Q38 A;  1OZP A;  3R9F A;  1S3Z A;  3SJE A;  4J3G A;  3IU2 A;  2VKZ G;  1KZF A;  2ZEN A;  7CPA A;  5HVG A;  1ARL A;  3FRM A;  3HPG G;  3BLN A;  3PBE A;  4C68 A;  4KNG E;  2AFW A;  1C3O B;  1BPN A;  3HPH E;  2PJ0 A;  3D4U A;  3ISZ A;  4OAE A;  1ZLH A;  3I1U A;  4NGP A;  2YNE A;  3TLC A;  1HDQ A;  3F0A A;  4R9M A;  8CPA A;  2PDO A;  1IID A;  4OC4 A;  1Q2C A;  2C27 A;  1CPS A;  4MHN A;  2POK A;  4AVB A;  1YRE A;  2R98 A;  2I3C A;  4C9E A;  4GS4 A;  4AB7 A;  1EZB A;  2Z0Z A;  2Z10 A;  4U5Y A;  1Z4R A;  3IWG A;  1XF1 A;  3BXM A;  2B58 A;  3BUW B;  3KHZ A;  1CJW A;  4KOT A;  3QAH A;  4DYO A;  4MMO A;  1EE3 P;  4IIX A;  4X3R A;  5KTA A;  2DEA A;  5E96 A;  1R57 A;  3R9E A;  5JM6 A;  4UFX A;  4GM5 A;  2G0B A;  1I1D A;  2ZOF A;  4C9A A;  4C99 A;  2ZEM A;  1DE4 C;  2QML A;  3D3S A;  2REF A;  4TJV A;  1ZG9 A;  1V0C A;  1NE9 A;  2XPP A;  2OZH A;  3TLG B;  5I0C A;  1L0C A;  1YX0 A;  4R3K A;  3PB8 X;  2KCW A;  2HB6 A;  2JBJ A;  4BPU B;  2ZEF A;  3D8P A;  2ZW6 A;  3PEI A;  4U9Z A;  4UIA A;  4EWT A;  1VBH A;  2CF4 A;  1TKJ A;  2C6G A;  2N3A B;  4JZ0 A;  2FIA A;  1MJB A;  3RO0 A;  5FD8 A;  3FEC A;  1LFW A;  5LYL A;  2XEG A;  1Y9W A;  3BJ8 A;  4QUS A;  4ZX8 A;  3TOB A;  4CDK A;  1Q5X A;  1AUG A;  1V6C A;  2WUU A;  4UIB A;  3OB2 B;  4MHP A;  2H5M A;  4H6U A;  1R61 A;  2IMO A;  2R1I A;  4G1P A;  2QIR A;  2C5Q A;  4LX9 A;  2F5I A;  5AG6 A;  1IGB A;  4COB A;  4OLL A;  4CZ1 A;  1M4G A;  1Y0R A;  3PB6 X;  2WPX A;  1F2O A;  4NFR A;  4CGL A;  4RUH A;  2DIK A;  4DUK A;  5HKZ A;  1BXR B;  1A2Z A;  3G3S A;  3GIU A;  5G21 A;  2JEV A;  2QVP A;  3P2F A;  4MCR A;  1YLO A;  1ZLI A;  2B4J C;  3CPX A;  1XJO A;  5AG7 A;  5H84 A;  5HVF A;  3H8F A;  4Z65 A;  2XPN A;  2CTB A;  2NSM A;  4MFL A;  1LRZ A;  4UWI A;  3IWW A;  2VEZ A;  3I9S A;  3WAB A;  1FBV A;  4NGQ A;  3JRU A;  4HNX B;  5HMN A;  3DR8 A;  4KOS A;  4CPA A;  4OAD A;  2REE A;  2B4D A;  1XOV A;  4CAF A;  2EVN A;  3DR6 A;  4YWY A;  3EIF A;  1C30 B;  1M6V B;  1IU8 A;  3SJG A;  1P0H A;  4XPD C;  3D2M A;  3NH4 A;  5H86 A;  2PJ9 A;  3KKW A;  2P6E A;  4MHZ A;  1CM0 A;  2ZPA A;  5A28 A;  3SJX A;  2A4N A;  3KGQ A;  4OC3 A;  3I3G A;  3IC1 A;  4MXU A;  2P0W A;  1XEB A;  2RB7 A;  1ARM A;  4CDJ A;  4E5S A;  3CPA A;  2AFS A;  1CBX A;  5J8C A;  3PRT A;  4KVM E;  1VHO A;  4M3S A;  2AFU A;  3RAM A;  4KLV A;  5D8N A;  4NEX A;  4PXE A;  3JUW A;  4FAI A;  2YNC C;  3JVN A;  1S7L A;  1KEE B;  5F48 A;  3ZZI A;  4A37 A;  3GLJ A;  1B6B A;  4R57 A;  3U1B A;  2FCK A;  4P4J A;  3R96 A;  2CNS A;  4TJX A;  1LAN A;  2J8M A;  1S7F A;  3KI9 A;  1NBW A;  2PJ2 A;  5HXD A;  4OC0 A;  4BPW B;  4OP4 A;  3SI1 A;  4OIW A;  4MY0 A;  3NH8 A;  5K8N A;  1X10 A;  2QJ8 A;  5KTD A;  1B87 A;  5AG4 A;  3PLF B;  2D4P A;  4MFK A;  2GP4 A;  2ZW5 A;  2HRO A;  4O23 A;  4CAV A;  2HC9 A;  2PJC A;  4TNU A;  4ZY0 A;  1JWQ A;  2OB0 A;  2NYQ A;  4OC1 A;  2VQY A;  1PU9 A;  3RBU A;  2B4B A;  4QC6 A;  3K9T A;  1HEE A;  2GLJ A;  3NA6 A;  3CT9 A;  1Y9Z A;  4H2K A;  2R82 A;  2PJB A;  2QEC A;  3MRU A;  6CPA A;  3GJZ A;  1Z8W A;  4ZI6 A;  4KSF A;  4B5O A;  5J1Q A;  1WK4 A;  4OC5 A;  4MBU A;  2JLM A;  2C6C A;  4PV6 A;  3SXO A;  3B3W A;  3N7Z A;  3S6H A;  4B10 A;  4R76 A;  3VWD A;  2R8V A;  4YFJ A;  1CX8 A;  3S6K A;  3VRR A;  3T90 A;  2PC1 A;  2XEI A;  2QYV A;  3EZA A;  4H1H A;  2CNT A;  3PB9 X;  4PSX A;  3LMS A;  4R8F A;  4CAX A;  2ZEH A;  2ZEP A;  5J3X A;  2WPW A;  1NSL A;  3FBU A;  3PP9 A;  4WJB A;  4C8C A;  2PJA A;  1J4J A;  1X12 A;  4IAV A;  4MY3 A;  5G1Z A;  4MJ8 A;  4BTF A;  2VBQ A;  4A4C A;  4COG A;  4K3N A;  5IR2 A;  1LAP A;  4A4B A;  1KUY A;  3EFA A;  3D7D A;  1GGO A;  4FD4 A;  3TYX A;  4IF5 A;  5LRK A;  2PCN A;  1YVO A;  4INJ A;  3W6X A;  5K8O A;  4IIY A;  1B47 A;  2P6F A;  2VXK A;  2XPO A;  2DXQ A;  3PB7 X;  5FVJ A;  3BUO B;  4LUA A;  3TOA A;  3B3T A;  4EFD A;  4C9U A;  4C8F A;  2OU2 A;  2F8H A;  2P6G A;  2VL1 A;  4PXC A;  4DNC A;  4F8Z A;  1ZYM A;  4X5K A;  5HKY A;  2B0A A;  2B3U A;  5IB9 A;  2R7H A;  2D0O A;  2OZG A;  3FMC A;  4CYN A;  4ZX9 A; 
#chains in the Genus database with same CATH homology
 4C8A A;  2ZEO A;  3LWU A;  4PXD A;  3FVL A;  4PQA A;  4MCS A;  4R7M A;  2PJ6 A;  1XBU A;  3ICU A;  3HUV A;  1NSA A;  2XEF A;  1XRY A;  2C6P A;  4YN3 A;  4W9Y A;  4Q7A A;  2EWB A;  2O4H A;  2ZOG A;  2JBK A;  4B6Z A;  2F7V A;  4IK2 A;  3PBB A;  4C85 A;  4C9R A;  2AFM A;  2PVW A;  4NGT A;  3BHX A;  5ELY A;  2GRE A;  1Y0Y A;  3K2K A;  4UF4 A;  2WYR A;  2BOA A;  2CIJ A;  3TC8 A;  3VH9 A;  4MCP A;  3FH4 A;  4P4I A;  3GB0 A;  1LOK A;  5THW A;  4P4B A;  1UWY A;  3I6S A;  2ABZ A;  4OC2 A;  2ZEG A;  3NFZ A;  3PB4 X;  4UEE A;  1Z5R A;  1PYT B;  3T8W A;  2V8G A;  3I74 A;  1R3N A;  3D7H A;  2PJ7 A;  5JGF A;  4NGS A;  4P44 A;  5F09 A;  4ZYQ A;  4A94 A;  1YME A;  3IO1 A;  1ELL P;  4P4E A;  3KR4 A;  2PIY A;  2BO9 A;  4JYW A;  3L2N A;  3IIB A;  5LYI A;  4F9V A;  5DS0 A;  3HLP A;  3B35 A;  1YW4 A;  3N5F A;  3FEE A;  4MRI A;  4OME A;  2PCU A;  2ZEL A;  3WC6 A;  3DGV A;  2AFO A;  1TKH A;  2GLF A;  2OR4 A;  2ANP A;  3D7F A;  1GYT A;  3D7G A;  3H8G A;  1FNO A;  4X2T A;  4LQG A;  4PXB A;  2EK8 A;  2FVG A;  2PIZ A;  5CPA A;  2AFX A;  4P45 A;  1JQG A;  4NGM A;  4YU9 A;  4A39 A;  1Y7E A;  2PJ1 A;  2PJ4 A;  1XMB A;  3SI2 A;  2O53 A;  3FX6 A;  5D29 A;  3H8E A;  1VGY A;  3IFE A;  2PJ8 A;  5LYD A;  1F2P A;  1IY7 A;  2BCO A;  4BD9 A;  1BLL E;  3S9L A;  2V77 A;  4R6T A;  1BAV A;  4NJQ A;  2Q43 A;  4NJR A;  5LRJ A;  4OKO A;  4UEF A;  4PPZ A;  4OID A;  5LRG A;  4C84 A;  1Q7L A;  5K8M A;  2J9A A;  3WC7 A;  3SJF A;  4F9U A;  1YSJ A;  1CG2 A;  2PRQ A;  4P4D A;  3QNV A;  2ZED A;  4P10 A;  1R43 A;  2AFZ A;  3D66 A;  1OBR A;  2Q51 A;  3B3S A;  3PFE A;  3KAS A;  5HVH A;  1Z8L A;  3B2Y A;  3CDX A;  3VTA A;  1RTQ A;  2EK9 A;  4ZY2 A;  5LYF A;  4C8U A;  2CTC A;  4ONW A;  3KR5 A;  4MHY A;  2G9D A;  3V38 A;  4NGN A;  1ZG7 A;  4P4F A;  2PVV A;  4IHM A;  5JH9 A;  4MCQ A;  1LCP A;  4UEZ A;  5CBM A;  4FWU A;  4C8P A;  3VAR A;  3KZW A;  3MN8 A;  4EME A;  1AYE A;  3FF3 A;  2JEW A;  2C1C A;  1M4L A;  4ZY1 A;  4C86 A;  3TX8 A;  2RFH A;  2V8V A;  1TXR A;  3BI1 A;  1TF8 A;  2WZN A;  3WC5 A;  3FJU A;  1H8L A;  1TKF A;  1Z2L A;  3V7Z A;  3B3C A;  3SI0 A;  1LAM A;  1PCA A;  4DJL A;  1VIX A;  3S9M A;  4A38 A;  3D67 A;  3KQX A;  3FED A;  2IJZ A;  2V8D A;  1QQ9 A;  3WT4 A;  2PJ3 A;  1ELM P;  2Q4Z A;  3IEH A;  2PJ5 A;  3B3V A;  3DLJ A;  3ISX A;  4KSI A;  3KL9 A;  1F57 A;  5I4M A;  3B7I A;  1DTD A;  2IQ6 A;  1ZG8 A;  3NH5 A;  1YW6 A;  3VAT A;  2OOT A;  4FBE A;  4C8T A;  3GUX A;  4TWE A;  3KHX A;  3IJ3 A;  1CPX A;  2GU2 A;  3S9N A;  3PFO A;  3KQZ A;  1VHE A;  4X8I A;  3BI0 A;  3RZA A;  2PE3 A;  3D68 A;  1WVM A;  2V8H A;  4FUU A;  1QMU A;  1TF9 A;  1AMP A;  1BPM A;  4NGR A;  4AXV A;  4WWV A;  5K8P A;  1FT7 A;  1CP7 A;  2XEJ A;  1CP6 A;  1HDU A;  1KWM A;  2ZEE A;  4P6Y A;  1XFO A;  3SJE A;  2ZEN A;  7CPA A;  5HVG A;  1ARL A;  3PBE A;  4KNG E;  2AFW A;  1BPN A;  2PJ0 A;  3D4U A;  3ISZ A;  1ZLH A;  3I1U A;  4NGP A;  1HDQ A;  8CPA A;  4OC4 A;  1CPS A;  4MHN A;  2POK A;  2I3C A;  4C9E A;  1XF1 A;  3BXM A;  3KHZ A;  4DYO A;  4MMO A;  1EE3 P;  4X3R A;  2DEA A;  5JM6 A;  4GM5 A;  2ZOF A;  4C9A A;  4C99 A;  2ZEM A;  1DE4 C;  4TJV A;  1ZG9 A;  3PB8 X;  2HB6 A;  2JBJ A;  2ZEF A;  3PEI A;  4EWT A;  4UIA A;  2CF4 A;  1TKJ A;  2C6G A;  4JZ0 A;  3FEC A;  1LFW A;  5LYL A;  2XEG A;  4ZX8 A;  4CDK A;  1V6C A;  4UIB A;  4MHP A;  2IMO A;  4G1P A;  2C5Q A;  1IGB A;  1Y0R A;  3PB6 X;  1F2O A;  4NFR A;  4RUH A;  4DUK A;  2QVP A;  4MCR A;  1YLO A;  1ZLI A;  4Z65 A;  3CPX A;  1XJO A;  5HVF A;  3H8F A;  2CTB A;  2NSM A;  3IWW A;  3WAB A;  3JRU A;  4NGQ A;  4CPA A;  3EIF A;  4YWY A;  3SJG A;  3NH4 A;  2PJ9 A;  4MHZ A;  3SJX A;  3KGQ A;  4OC3 A;  3IC1 A;  4MXU A;  2RB7 A;  1ARM A;  4CDJ A;  3CPA A;  2AFS A;  1CBX A;  3PRT A;  1VHO A;  3RAM A;  2AFU A;  5D8N A;  4PXE A;  4FAI A;  4A37 A;  3GLJ A;  4P4J A;  4TJX A;  1LAN A;  3KI9 A;  2PJ2 A;  5HXD A;  4OC0 A;  3SI1 A;  4OP4 A;  4OIW A;  3NH8 A;  5K8N A;  2QJ8 A;  2GP4 A;  4O23 A;  2HC9 A;  2PJC A;  4TNU A;  4ZY0 A;  2NYQ A;  4OC1 A;  3RBU A;  3K9T A;  1HEE A;  2GLJ A;  3NA6 A;  3CT9 A;  1Y9Z A;  4H2K A;  2PJB A;  3MRU A;  6CPA A;  4ZI6 A;  5J1Q A;  4OC5 A;  2C6C A;  3B3W A;  4R76 A;  1CX8 A;  2XEI A;  2QYV A;  3PB9 X;  4R8F A;  3LMS A;  2ZEH A;  2ZEP A;  4C8C A;  4WJB A;  2PJA A;  4IAV A;  4K3N A;  5IR2 A;  1LAP A;  3D7D A;  5LRK A;  5K8O A;  4C9V A;  3PB7 X;  4EFD A;  3B3T A;  4C9U A;  4C8F A;  2F8H A;  2VL1 A;  4F8Z A;  4PXC A;  5IB9 A;  3FMC A;  4ZX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...