4P44A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor jrb-4-81
Total Genus 258
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
258
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 258
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p44A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p44A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p44A02
4A38A 1JQGA 5K8PA 2PJ5A 1PYTB 3I74A 5D29A 3S9NA 4NGPA 4A37A 4DYOA 3PBBA 3SI1A 5CPAA 2GU2A 3IO1A 4NGNA 4OMEA 4CDJA 3KL9A 4G1PA 4MCSA 1CP7A 2V8HA 4NGTA 1UWYA 1HDQA 2VL1A 3NH4A 2G9DA 2XEGA 2PIYA 3B7IA 4YWYA 1CP6A 1R43A 4FAIA 3V38A 1TKHA 1ZLHA 2Q51A 4OC0A 3KQZA 1YLOA 3KZWA 1CPSA 2CTCA 1Y0YA 3S9LA 2PVWA 2BO9A 2V8DA 3VTAA 2ZEGA 4UF4A 1VGYA 3CPXA 5LRJA 4PXBA 3IC1A 1RTQA 4C9EA 4P45A 4C9AA 3PBEA 1XRYA 2AFOA 4MHYA 2PRQA 1CBXA 2NYQA 3DGVA 1Q7LA 4C8AA 4GM5A 3BHXA 4P4FA 3L2NA 1CX8A 3IIBA 2CF4A 4OIWA 3ISXA 2IMOA 3D68A 4IAVA 2RFHA 1H8LA 3IEHA 5HVHA 3PB4X 4ZYQA 1QMUA 2PVVA 2ANPA 2F7VA 5HXDA 4P4BA 4TJXA 2FVGA 4Q7AA 2IQ6A 3DLJA 5I4MA 5LRKA 1YW4A 2PCUA 2I3CA 3ISZA 2PE3A 3KI9A 1R3NA 3KR5A 1VHEA 4MCRA 3QNVA 1ZG9A 4MHPA 4OC2A 4R7MA 5LYFA 2PJ4A 2C6GA 2ZEMA 2XEIA 4X2TA 2PJAA 3K9TA 2PJ9A 4FBEA 4DUKA 1FNOA 5K8OA 4NJRA 2QVPA 4JYWA 4OKOA 3GB0A 1TF8A 2AFZA 2HB6A 3TX8A 2PJ0A 1CPXA 7CPAA 3PFEA 2ZEFA 3IFEA 4WWVA 4NGMA 1M4LA 2O53A 4P4IA 4IK2A 2ABZA 1DTDA 2JBKA 3PB8X 4C86A 1V6CA 4WJBA 4PXCA 1ZLIA 3D67A 4C8PA 3KHZA 2AFMA 4C85A 4F9UA 3FEEA 3B3TA 4P10A 3WC6A 1GYTA 4TWEA 4F9VA 4C8TA 4C9RA 3RZAA 4MXUA 3D7GA 4P4DA 3ICUA 2DEAA 1XMBA 4P4JA 3B3VA 1ZG8A 1ZG7A 3FEDA 3PB7X 1LFWA 2JEWA 1BPMA 4JZ0A 3KASA 1Z2LA 3K2KA 3PB6X 4KNGE 4PPZA 3SI0A 3PB9X 3KR4A 3GLJA 2GLFA 4ZX8A 3WABA 4EMEA 5CBMA 1PCAA 4RUHA 1XF1A 4FUUA 1YSJA 4ZY0A 4W9YA 2QJ8A 4CDKA 4EFDA 1WVMA 2AFXA 4F8ZA 5THWA 1Z5RA 4C8FA 3KQXA 3RBUA 4O23A 2CTBA 4NJQA 4MRIA 4CPAA 2PJ7A 3D66A 2ZEPA 2RB7A 1F57A 1XBUA 3VARA 1ELLP 3LWUA 3WT4A 2PJ6A 4Z65A 4EWTA 3SI2A 2XEJA 2ZEDA 4TJVA 4TNUA 3BI1A 2C6PA 2QYVA 1AMPA 5IB9A 1FT7A 2GREA 4C9VA 3T8WA 1IGBA 2EK8A 3H8GA 1KWMA 4K3NA 2AFWA 2ZELA 8CPAA 3BXMA 1Y0RA 3CPAA 5J1QA 2HC9A 3KGQA 3IWWA 5ELYA 1ELMP 2C1CA 1TF9A 2F8HA 2BOAA 3WC5A 4A94A 4NGRA 1DE4C 1VHOA 3SJFA 3MN8A 1XFOA 3I1UA 2AFSA 1QQ9A 3SJXA 4OC3A 5HVGA 1LCPA 2ZEHA 3RAMA 5JGFA 3S9MA 4X8IA 1XJOA 4ZX9A 3FECA 2OOTA 3I6SA 4UIAA 3HLPA 4DJLA 1Y7EA 3SJGA 3JRUA 2AFUA 2PJ2A 1F2OA 3CT9A 3FMCA 3H8EA 3HUVA 6CPAA 3VATA 4OC4A 4NGQA 3VH9A 3NH5A 1ARMA 3NA6A 2V8VA 2EK9A 2J9AA 2BCOA 1BPNA 3D7DA 1VIXA 1HEEA 4PQAA 3NH8A 1LOKA 4AXVA 4LQGA 4P4EA 4MMOA 4R6TA 3NFZA 2PJCA 4H2KA 3V7ZA 4UEFA 3FH4A 3D4UA 2Q43A 5JM6A 2EWBA 2OR4A 2NSMA 4R76A 5LYDA 4MCPA 4PXDA 1Y9ZA 1LAMA 4UEEA 4KSIA 2IJZA 1BAVA 4UEZA 4X3RA 2C6CA 2GLJA 3B3SA 3N5FA 1CG2A 1Z8LA 2CIJA 1BLLE 3B2YA 3H8FA 4MCQA 1LAPA 4NFRA 4FWUA 5LYLA 3FVLA 3GUXA 5K8MA 3BI0A 2WYRA 3WC7A 3EIFA 4ZY2A 4IHMA 3TC8A 2PJ1A 4P44A 4YN3A 4BD9A 4MHZA 2XEFA 5D8NA 1TKJA 1TKFA 2V77A 1EE3P 2PJBA 1ARLA 2JBJA 2ZOGA 4MHNA 2ZENA 3IJ3A 1LANA 4C84A 3PFOA 1OBRA 1TXRA 4ZI6A 4NGSA 2V8GA 2PJ3A 5F09A 1AYEA 3FF3A 4OP4A 2Q4ZA 3SJEA 1YMEA 4C8CA 3B35A 3B3WA 3FJUA 5DS0A 3LMSA 3PEIA 4UIBA 4C9UA 5LYIA 4OC5A 2PJ8A 5HVFA 2POKA 4ONWA 4B6ZA 5LRGA 4PXEA 3CDXA 2O4HA 5K8NA 3D7FA 4A39A 3KHXA 1HDUA 4OIDA 4ZY1A 3B3CA 2WZNA 4OC1A 3MRUA 1YW6A 4C99A 3FX6A 5JH9A 4C8UA 3PRTA 4P6YA 4YU9A 2ZOFA 2PIZA 1NSAA 3D7HA 2ZEEA 1F2PA 1IY7A 4R8FA 2ZEOA
chains in the Genus database with same CATH superfamily
4A38A 1JQGA 5K8PA 1N71A 2PJ5A 2DIKA 3KRVA 3BUWB 1PYTB 5G22A 3S6GA 4F0XA 2YJVA 2CBLA 3I74A 4A32A 1X10A 4C2YA 5D29A 3G3SA 3S9NA 4BINA 4MJXA 3HMJG 4NGPA 4FD7A 5AG7A 2PDOA 3VRPA 1IICA 4A37A 5JQ4A 4XPLA 4DYOA 3PBBA 3MGDA 1Z8XA 1PU9A 1RXTA 3PZJA 3SI1A 5CPAA 1VKCA 2GU2A 3IO1A 2B58A 3PGPA 2R1IA 4NGNA 2Z3KA 4GS4A 1Z8TA 1NE9A 4OMEA 4CDJA 3F5BA 3KL9A 4G1PA 4MCSA 4OLLA 1OZPA 1CP7A 2V8HA 4NGTA 4PK3A 4CRZB 1UWYA 2Q4VA 1HDQA 5JPHA 2GIVA 4YGOA 2VL1A 3U88C 3NH4A 2ZPAA 1JWQA 2Z10A 4CAWA 2G9DA 2XEGA 2PIYA 3B7IA 4YWYA 2CNTA 4OADA 1CP6A 3JTKA 1R43A 5KTCA 4FAIA 3V38A 4NEXA 3G23A 4AB7A 5F5XA 3T0TA 1TKHA 1ZLHA 3T07A 4IIYA 2Q51A 4OC0A 3RO0A 1KUVA 3KQZA 2DPTA 5J8CA 2GP4A 2P6EA 4UA3A 1YLOA 2HV2A 3KZWA 1CPSA 2CTCA 4NF1A 3SR3A 5JYBA 2CXAA 2E28A 1IOIA 1Y0YA 3S9LA 2PVWA 2BO9A 4CGOA 3TYXA 4CRYB 4C2XA 1NSLA 1Y7RA 1S60A 1KEEB 2V8DA 4HPSA 3TLZA 3VTAA 2ZEGA 3QAHA 4OAEA 4UF4A 1B47A 1VGYA 2BL1A 3EY5A 3CPXA 5LRJA 4PXBA 5EBVA 3IC1A 2B4JC 2ATRA 3ZNIA 5BY0A 3GJZA 5K99A 2J8MA 1RTQA 4MFKA 1S7NA 2AJ6A 4C9EA 4P45A 2OB0A 4CAXA 4C9AA 3PBEA 4B13A 4II9A 1XRYA 2AFOA 4MHYA 2PRQA 2PRBA 1CBXA 2AE6A 4U9YA 3IU1A 2NYQA 2JDCA 1ON0A 1XE4A 3DGVA 1Q7LA 4K30A 1QSTA 4C8AA 4GM5A 3BHXA 4P4FA 1S7FA 4HKFA 3L2NA 1CX8A 3TLAA 3IIBA 2CF4A 4OIWA 4XPDC 5HKYA 3ISXA 5CNPA 2IMOA 2VEZA 3D68A 4CGLA 1C30B 4IAVA 3TTHA 3VROA 4BPXB 1H8LA 2Q0YA 2RFHA 2NMTA 2Z3MA 2Q4YA 3IEHA 3PB4X 4CYOA 5HVHA 4ZYQA 1QMUA 2P6GA 3D2PA 3ZZIA 2PVVA 1VI4A 2ANPA 2F7VA 2FIWA 3JUWA 4P4BA 4MFPA 1S7KA 4KSAA 5AG5A 2FVGA 3TO9A 5HXDA 4Q7AA 4U5YA 4TJXA 1YVHA 1VHSA 2IQ6A 3DLJA 5I4MA 4E0AA 2RC4A 3DR6A 5LRKA 4EVYA 4C8CA 1Q2CA 1Y9KA 4ZGYB 1YW4A 1YR0A 5HMNA 5F46A 2PCUA 4BBHA 2I3CA 2VKZG 5C82A 1Q5XA 2I79A 2YGWA 4UFWA 3ISZA 2PE3A 4B12A 3VRQA 3KI9A 1R3NA 2I00A 3PLFB 3KR5A 5F48A 4YFJA 1VHEA 5H86A 4MCRA 3QNVA 1ZG9A 3BUXB 3BJ7A 4RR2B 2AUNA 1KUXA 2B5GB 4UFVA 3EO4A 4Y49B 4CYNA 4MHPA 4OC2A 1Y9WA 4R7MA 4C68A 5LYFA 2PJ4A 2C6GA 2CY2A 2QMLA 4IIXA 2KCWA 5F9MA 2ZEMA 3G8WA 1M1DA 4UBRA 2B0AA 4MI1A 2XEIA 2XPOA 4X2TA 3N7ZA 2PJAA 3K9TA 4M6IA 5E96A 2PJ9A 4F0YA 4KORA 4FBEA 4DUKA 3VRNA 1FNOA 5K8OA 4KUBA 4NJRA 2QVPA 4JYWA 4KOVA 3NE8A 4CO9A 4OKOA 1R57A 3CZXA 4MFQA 4AG9A 3GB0A 2XPLA 1TF8A 2AFZA 2HB6A 2R98A 4COGA 4UCNA 3TX8A 1RO5A 4CZ1A 4M3SA 2PJ0A 3E0KA 2DLAA 1CPXA 4F6AA 2Z3OA 7CPAA 3F0AA 3PFEA 5G1ZA 3GYAA 1IYKA 3D2MA 4IF5A 2B3UA 2GFQA 2Q7SA 3VWDA 3T5MA 2ZEFA 3IFEA 4WWVA 2VXKA 4NGMA 1M4LA 2O53A 4KLVA 1DIKA 2YNCC 4A95A 5IB0A 3F8KA 3FNCA 2EO8A 3TO6A 4P4IA 3FXTA 4IK2A 4M6GA 2ABZA 4NCZA 4Q38A 3TLGA 1DTDA 4HNWB 4UCMA 4KVME 2JBKA 5AGEA 3PB8X 4C86A 1V6CA 4WJBA 1Q2DA 4PXCA 1ZLIA 4PK2A 3D67A 4C8PA 1Z4RA 3KHZA 2AFMA 4C85A 1XIXA 4F9UA 3FEEA 2YNEA 5C88A 3B3TA 3EFAA 1GGOA 1YGHA 4BPUB 1Z9UA 2BSWA 3CXQA 4P10A 3WC6A 1GYTA 4A31A 4TWEA 4F9VA 4C8TA 2ZW5A 4C9RA 2Z3NA 3RZAA 4MXUA 1X12A 3D7GA 1I12A 4P4DA 1S7LA 3ICUA 4KOYA 4A33A 2DEAA 1XMBA 4P4JA 4E94A 2BUEA 2HUZA 3B3VA 1ZG8A 1ZG7A 4PSWA 1ZL0A 3FEDA 3R9GA 4UWIA 1J3LA 4R9MA 3UY5A 2XPNA 3PB7X 2OLSA 1Q2YA 3OWCA 1LFWA 3NOJA 2JEWA 4R87A 1BPMA 1FBVA 1Z2LA 3KASA 4JZ0A 1J4JA 3PFVA 3K2KA 3PB6X 2Z0ZA 4KUAA 4MY3A 4M6HA 4PPZA 4KNGE 2PCNA 3SI0A 1P4NA 3PB9X 4AVCA 3KR4A 1IOFA 3GLJA 1QSOA 2GLFA 4CAVA 5IV0A 4ZX8A 3WABA 4B14A 1CM0A 2JLMA 4B5OA 4EMEA 4MFLA 5KTAA 4C7HA 5CBMA 3SXNA 1PCAA 4GXHA 4JXRA 2EZCA 4RUHA 2BEIA 3OP0A 1V0CA 1XF1A 2N3AB 2OZUA 3LACA 4FUUA 1YSJA 4ZY0A 4W9YA 2QJ8A 1JDBC 3EZEA 4EFDA 4CDKA 5AG6A 1WWZA 1WVMA 1ZYMA 2AFXA 5GCNA 3GY9A 4F8ZA 4QB9A 5THWA 3RYOA 3FIXA 4KZTA 3V8IA 1Z5RA 1WK4A 4HNXB 4AVAA 2YJTA 4C8FA 3KQXA 3RBUA 1NBWA 4O23A 1B87A 2B4BA 4HNYB 2CTBA 2QIRA 3CXPA 3DR8A 2G0BA 3PP9A 4MRIA 2ZW4A 2PJ7A 4NJQA 4CPAA 3D66A 2ZEPA 2RB7A 1M44A 1F57A 1XBUA 2ODFA 3VARA 1CJWA 4CS0B 1ELLP 3QB8A 1Z4EA 5FD8A 5JVLA 2OH1A 2O28A 2D4PA 3LWUA 2PJ6A 3WT4A 3IWEA 2WUUA 4QUSA 4UCPA 4Z65A 4EWTA 3C26A 2FIAA 2AUMA 2H5MA 3QAYA 3SI2A 2FE7A 2XEJA 2FSRA 4KLWA 2ZEDA 4TJVA 4TNUA 1KUYA 4JVOA 1I1DA 3BI1A 3I3GA 3P2FA 4RS2A 2C6PA 3T9YA 2QYVA 1AMPA 4EYSA 5IB9A 1Z9EA 3IU2A 4XNHB 1FT7A 3T05A 4KVXA 2GREA 4A4BA 2OU2A 1GHEA 4C9VA 1ZO0A 3T8WA 1M4GA 3OB2B 2VZYA 3U1BA 4ORFA 4MFZA 1IGBA 1SQHA 2EK8A 1KWMA 3H8GA 3FB3A 1JDEA 4K3NA 2AFWA 1S3ZA 5J8FA 4Y49C 4AVBA 2ZELA 8CPAA 3BXMA 2DF5A 1Y0RA 1LRZA 3CPAA 3R9EA 5J1QA 4R57A 2HC9A 3KGQA 3IWWA 5ELYA 1ELMP 2K5TA 3DSBA 2C1CA 1TF9A 2F8HA 2REEA 3LODA 1TIQA 2VQYA 1IU8A 2G3AA 2PSWA 2BOAA 3WC5A 4KS9A 3SXOA 4A94A 5A28A 3TLCA 4R3LA 2YNDA 4NGRA 1DE4C 1VHOA 4DNCA 3SJFA 1XFOA 3MN8A 3I1UA 3HPHE 2AFSA 3GIUA 4COBA 4LQ6A 1QQ9A 5I0CA 3OAKA 4L89A 3SJXA 4OC3A 1VBHA 5IR2A 4Q36A 5HVGA 3S6KA 4INJA 5DWMA 4IUSA 1LCPA 2ZEHA 4NXYA 3R96A 3RAMA 2JEVA 2Y1MA 3BLNA 5JGFA 1MJ9A 3TLEA 3FBUA 4H1HA 3S9MA 4X8IA 1XJOA 5EMIA 4ZX9A 2XPPA 3FECA 2OOTA 4BPWB 5DWNA 2Y1NA 5EC4A 3I6SA 1YX0A 4UIAA 3HLPA 4DJLA 2P0WA 2VBQA 2FS5A 1Y7EA 4B10A 3SJGA 2Y0MA 3JRUA 4LUAA 4B5PA 2AFUA 2PQ8A 2PJ2A 2EUIA 2FT0A 3R1KA 1F2OA 3CT9A 2B4DA 4MI4A 3FMCA 4RI1A 3H8EA 2X0SA 1IB1E 3HUVA 3R9FA 3TLGB 6CPAA 3VATA 4OC4A 4NGQA 3H5ZA 2ZXVA 3VH9A 3NH5A 4L8AA 1EO0A 5FVJA 4CAFA 1QSRA 1ARMA 3NA6A 4LX9A 4X5KA 5ISVA 2PR1A 3W6SA 3DDDA 3KKWA 2F5IA 2V8VA 2EK9A 1KC7A 4FD5A 4PV6A 2J9AA 5F13A 4KSFA 2BCOA 3CXSA 1BPNA 3NFQA 1YVOA 3IWGA 3D7DA 1VIXA 3VRRA 2OZHA 1HEEA 4PQAA 4A4CA 3B8GA 2DXQA 3EZBA 3NH8A 2Z3LA 2R82A 1LOKA 3R95A 4U9ZA 2G3TA 4AXVA 1CE8B 1M6VB 3WR7A 1XOVA 4LQGA 5F47A 4YRHA 4P4EA 4MHDA 4MMOA 4R6TA 3TO7A 2WPWA 4A2ZA 3NFZA 2D0PA 2PJCA 3JVNA 4H2KA 4UWJA 1BXRB 4UFXA 1YVKA 3V7ZA 3LD2A 2YNCA 3FH4A 4UEFA 3D4UA 4A30A 2Q43A 5JM6A 2WSAA 3TOBA 2VZZA 3GKRA 3TCVA 5G21A 1EZBA 2EWBA 2OR4A 1FY7A 2NSMA 4R76A 4MY0A 2A4NA 5LYDA 4MCPA 3H4QA 3S6HA 4PXDA 2X7BA 1Y9ZA 1LAMA 4UEEA 3D8PA 4KSIA 2IJZA 3IGRA 1BAVA 1IIDA 3BUNB 5KTDA 4CYQA 4UEZA 4X3RA 2C6CA 2VI7A 2OZGA 5F49A 3EXNA 4GPLB 2GLJA 3TT2A 4E5SA 3B3SA 5HH1A 3N5FA 3BUOB 4JD6A 2WPXA 4MFJA 1XEBA 2MP0A 4C2ZA 2D4OA 1CG2A 2IL4A 1Z8LA 5AXIA 3OB1B 1A2ZA 2CIJA 2EVNA 2J8RA 2JDDA 5G20A 1BLLE 2EBJA 1YLEA 3B2YA 3H8FA 4KOSA 4KOWA 4MCQA 1LAPA 4NFRA 4FWUA 1QSMA 2PR8A 5LYLA 1ZRSA 3FVLA 3GUXA 1QSNA 4KVOE 4QC6A 5K8MA 3K4IA 3BI0A 2WYRA 4CGPA 4FD6A 3WC7A 1XMTA 3EIFA 4ZY2A 3TOAA 2EZAA 4IHMA 3TC8A 2PJ1A 2FM4A 4P44A 4YN3A 1VBGA 4BD9A 4MHZA 1PUAA 1L0CA 4BTFA 2GANA 1T36B 3HPGG 3EC4A 2XEFA 4AG7A 4B11A 1IYLA 4XNHC 4R3KA 5D8NA 1TKJA 4H6UA 3W6XA 1TKFA 4KOTA 3RNZA 2REFA 3K9UA 2V77A 1EE3P 3F9KC 2PJBA 1ARLA 4JJXA 3W91A 2JBJA 2ZOGA 4MHNA 4ONUA 4CYPA 4E2AA 2HI6A 4RN7A 2ZENA 3IJ3A 1LANA 2Z3PA 2D0OA 2FL4A 3TLBA 3ZJ0A 4C84A 2P6FA 1NXJA 1I21A 2HROA 4KOUA 3PFOA 5BWAB 2FCKA 3DNSA 1YQEA 4JXQA 3P2HA 5H84A 1OBRA 1TXRA 4ZI6A 3I9SA 3T90A 4NGSA 2V8GA 3A9LA 1A9XB 2R7HA 2PJ3A 5F09A 1NMTA 3NE7A 2Z11A 1EZAA 4E8OA 4XPDB 3C8OA 1MJAA 4J3GA 3TLYA 1AYEA 3FF3A 3PT1A 4M8DA 4NSQA 2Q7BA 5HKZA 2CNSA 3FYNA 4OP4A 2Q4ZA 1U6MA 4C7IA 3EZAA 1KBLA 3SJEA 1YMEA 2C27A 3B35A 4KOXA 4ZBGA 3B3WA 3FJUA 4H6ZA 4QBJA 2ZW7A 5DS0A 3LMSA 3PEIA 2ZW6A 4UIBA 4CGMA 3O8ZA 4C9UA 5LYIA 4OC5A 2FXFA 4QVTA 2ARHA 2PJ8A 1UFHA 5HVFA 5A27A 3D3SA 2POKA 1Z8WA 4ONWA 4B6ZA 5J3XA 5LRGA 2EZBA 2B3VA 1YREA 3CDXA 1YK3A 4PXEA 1BO4A 2O4HA 4I49A 3SHPA 3D7FA 5K8NA 4J0NA 4CGNA 1S5KA 4A39A 2GE3A 2Q44A 1M4DA 1BOBA 1MJBA 3KHXA 1R61A 4CAEA 3TE4A 1HDUA 3BUMB 1WJTA 4MJ8A 1B6BA 4OIDA 3B3CA 4ZY1A 1AUGA 4JWPA 3S6FA 2WZNA 4OC1A 2B5GA 2DPSA 3MRUA 1CS0B 1YW6A 4C99A 3FX6A 3VWEA 4B5PB 4MBUA 2UV8G 3FRMA 5JH9A 2B4DB 1K4JA 4C8UA 5IX3A 1XF8A 2HQYA 4BMHA 3PRTA 5HKWA 4P6YA 2Q04A 4YU9A 3TFYA 2PC1A 5F1YA 1C3OB 1P0HA 2QECA 4JLYA 2ZOFA 4FD4A 1MK4A 1NSAA 2PIZA 2R8VA 4PSXA 3BJ8A 3D7HA 4XPKA 1KZFA 3VGOA 4H89A 1M4IA 5AG4A 2C5QA 2ZEEA 4M85A 2HWGA 2J8NA 1F2PA 1IY7A 4R8FA 2ZEOA 2CNMA
chains in the Genus database with same CATH topology
4A38A 1JQGA 5K8PA 2PJ5A 1PYTB 3I74A 5D29A 3S9NA 4NGPA 4A37A 4DYOA 3PBBA 3SI1A 5CPAA 2GU2A 3IO1A 4NGNA 4OMEA 4CDJA 3KL9A 4G1PA 4MCSA 1CP7A 2V8HA 4NGTA 1UWYA 1HDQA 2VL1A 3NH4A 2G9DA 2XEGA 2PIYA 3B7IA 4YWYA 1CP6A 1R43A 4FAIA 3V38A 1TKHA 1ZLHA 2Q51A 4OC0A 3KQZA 2GP4A 1YLOA 3KZWA 1CPSA 2CTCA 1Y0YA 3S9LA 2PVWA 2BO9A 2V8DA 3VTAA 2ZEGA 4UF4A 1VGYA 3CPXA 5LRJA 4PXBA 3IC1A 1RTQA 4C9EA 4P45A 4C9AA 3PBEA 1XRYA 2AFOA 4MHYA 2PRQA 1CBXA 2NYQA 3DGVA 1Q7LA 4C8AA 4GM5A 3BHXA 4P4FA 3L2NA 1CX8A 3IIBA 2CF4A 4OIWA 3ISXA 2IMOA 3D68A 4IAVA 2RFHA 1H8LA 3IEHA 5HVHA 3PB4X 4ZYQA 1QMUA 2PVVA 2ANPA 2F7VA 5HXDA 4P4BA 4TJXA 2FVGA 4Q7AA 2IQ6A 3DLJA 5I4MA 5LRKA 1YW4A 2PCUA 2I3CA 3ISZA 2PE3A 3KI9A 1R3NA 3KR5A 1VHEA 4MCRA 3QNVA 1ZG9A 4MHPA 4OC2A 4R7MA 5LYFA 2PJ4A 2C6GA 2ZEMA 2XEIA 4X2TA 2PJAA 3K9TA 2PJ9A 4FBEA 4DUKA 1FNOA 5K8OA 4NJRA 2QVPA 4JYWA 4OKOA 3GB0A 1TF8A 2AFZA 2HB6A 3TX8A 2PJ0A 1CPXA 7CPAA 3PFEA 2ZEFA 3IFEA 4WWVA 4NGMA 1M4LA 2O53A 4P4IA 4IK2A 2ABZA 1DTDA 2JBKA 3PB8X 4C86A 1V6CA 4WJBA 4PXCA 1ZLIA 3D67A 4C8PA 3KHZA 2AFMA 4C85A 4F9UA 3FEEA 3B3TA 4P10A 3WC6A 1GYTA 4TWEA 4F9VA 4C8TA 4C9RA 3RZAA 4MXUA 3D7GA 4P4DA 3ICUA 2DEAA 1XMBA 4P4JA 3B3VA 1ZG8A 1ZG7A 3FEDA 3PB7X 1LFWA 2JEWA 1BPMA 4JZ0A 3KASA 1Z2LA 3K2KA 3PB6X 4KNGE 4PPZA 3SI0A 3PB9X 3KR4A 3GLJA 2GLFA 4ZX8A 3WABA 4EMEA 5CBMA 1PCAA 4RUHA 1XF1A 4FUUA 1YSJA 4ZY0A 4W9YA 2QJ8A 4CDKA 4EFDA 1WVMA 2AFXA 4F8ZA 5THWA 1Z5RA 4C8FA 3KQXA 3RBUA 4O23A 2CTBA 4NJQA 4MRIA 4CPAA 2PJ7A 3D66A 2ZEPA 2RB7A 1F57A 1XBUA 3VARA 1ELLP 3LWUA 3WT4A 2PJ6A 4Z65A 4EWTA 3SI2A 2XEJA 2ZEDA 4TJVA 4TNUA 3BI1A 2C6PA 2QYVA 1AMPA 5IB9A 1FT7A 2GREA 4C9VA 3T8WA 1IGBA 2EK8A 3H8GA 1KWMA 4K3NA 2AFWA 2ZELA 8CPAA 3BXMA 1Y0RA 3CPAA 5J1QA 2HC9A 3KGQA 3IWWA 5ELYA 1ELMP 2C1CA 1TF9A 2F8HA 2BOAA 3WC5A 4A94A 4NGRA 1DE4C 1VHOA 3SJFA 3MN8A 1XFOA 3I1UA 2AFSA 1QQ9A 3SJXA 4OC3A 5IR2A 5HVGA 1LCPA 2ZEHA 3RAMA 5JGFA 3S9MA 4X8IA 1XJOA 4ZX9A 3FECA 2OOTA 3I6SA 4UIAA 3HLPA 4DJLA 1Y7EA 3SJGA 3JRUA 2AFUA 2PJ2A 1F2OA 3CT9A 3FMCA 3H8EA 3HUVA 6CPAA 3VATA 4OC4A 4NGQA 3VH9A 3NH5A 1ARMA 3NA6A 2V8VA 2EK9A 2J9AA 2BCOA 1BPNA 3D7DA 1VIXA 1HEEA 4PQAA 3NH8A 1LOKA 4AXVA 4LQGA 4P4EA 4MMOA 4R6TA 3NFZA 2PJCA 4H2KA 3V7ZA 4UEFA 3FH4A 3D4UA 2Q43A 5JM6A 2EWBA 2OR4A 2NSMA 4R76A 5LYDA 4MCPA 4PXDA 1Y9ZA 1LAMA 4UEEA 4KSIA 2IJZA 1BAVA 4UEZA 4X3RA 2C6CA 2GLJA 3B3SA 3N5FA 1CG2A 1Z8LA 2CIJA 1BLLE 3B2YA 3H8FA 4MCQA 1LAPA 4NFRA 4FWUA 5LYLA 3FVLA 3GUXA 5K8MA 3BI0A 2WYRA 3WC7A 3EIFA 4ZY2A 4IHMA 3TC8A 2PJ1A 4P44A 4YN3A 4BD9A 4MHZA 2XEFA 5D8NA 1TKJA 1TKFA 2V77A 1EE3P 2PJBA 1ARLA 2JBJA 2ZOGA 4MHNA 2ZENA 3IJ3A 1LANA 4C84A 3PFOA 1OBRA 1TXRA 4ZI6A 4NGSA 2V8GA 2PJ3A 5F09A 1AYEA 3FF3A 4OP4A 2Q4ZA 3SJEA 1YMEA 4C8CA 3B35A 3B3WA 3FJUA 5DS0A 3LMSA 3PEIA 4UIBA 4C9UA 5LYIA 4OC5A 2PJ8A 5HVFA 2POKA 4ONWA 4B6ZA 5LRGA 4PXEA 3CDXA 2O4HA 5K8NA 3D7FA 4A39A 3KHXA 1HDUA 4OIDA 4ZY1A 3B3CA 2WZNA 4OC1A 3MRUA 1YW6A 4C99A 3FX6A 5JH9A 4C8UA 3PRTA 4P6YA 4YU9A 2ZOFA 2PIZA 1NSAA 3D7HA 2C5QA 2ZEEA 1F2PA 1IY7A 4R8FA 2ZEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A38 A;  1JQG A;  5K8P A;  2PJ5 A;  1PYT B;  3I74 A;  5D29 A;  3S9N A;  4NGP A;  4A37 A;  4DYO A;  3PBB A;  3SI1 A;  5CPA A;  2GU2 A;  3IO1 A;  4NGN A;  4OME A;  4CDJ A;  3KL9 A;  4G1P A;  4MCS A;  1CP7 A;  2V8H A;  4NGT A;  1UWY A;  1HDQ A;  2VL1 A;  3NH4 A;  2G9D A;  2XEG A;  2PIY A;  3B7I A;  4YWY A;  1CP6 A;  1R43 A;  4FAI A;  3V38 A;  1TKH A;  1ZLH A;  2Q51 A;  4OC0 A;  3KQZ A;  1YLO A;  3KZW A;  1CPS A;  2CTC A;  1Y0Y A;  3S9L A;  2PVW A;  2BO9 A;  2V8D A;  3VTA A;  2ZEG A;  4UF4 A;  1VGY A;  3CPX A;  5LRJ A;  4PXB A;  3IC1 A;  1RTQ A;  4C9E A;  4P45 A;  4C9A A;  3PBE A;  1XRY A;  2AFO A;  4MHY A;  2PRQ A;  1CBX A;  2NYQ A;  3DGV A;  1Q7L A;  4C8A A;  4GM5 A;  3BHX A;  4P4F A;  3L2N A;  1CX8 A;  3IIB A;  2CF4 A;  4OIW A;  3ISX A;  2IMO A;  3D68 A;  4IAV A;  2RFH A;  1H8L A;  3IEH A;  5HVH A;  3PB4 X;  4ZYQ A;  1QMU A;  2PVV A;  2ANP A;  2F7V A;  5HXD A;  4P4B A;  4TJX A;  2FVG A;  4Q7A A;  2IQ6 A;  3DLJ A;  5I4M A;  5LRK A;  1YW4 A;  2PCU A;  2I3C A;  3ISZ A;  2PE3 A;  3KI9 A;  1R3N A;  3KR5 A;  1VHE A;  4MCR A;  3QNV A;  1ZG9 A;  4MHP A;  4OC2 A;  4R7M A;  5LYF A;  2PJ4 A;  2C6G A;  2ZEM A;  2XEI A;  4X2T A;  2PJA A;  3K9T A;  2PJ9 A;  4FBE A;  4DUK A;  1FNO A;  5K8O A;  4NJR A;  2QVP A;  4JYW A;  4OKO A;  3GB0 A;  1TF8 A;  2AFZ A;  2HB6 A;  3TX8 A;  2PJ0 A;  1CPX A;  7CPA A;  3PFE A;  2ZEF A;  3IFE A;  4WWV A;  4NGM A;  1M4L A;  2O53 A;  4P4I A;  4IK2 A;  2ABZ A;  1DTD A;  2JBK A;  3PB8 X;  4C86 A;  1V6C A;  4WJB A;  4PXC A;  1ZLI A;  3D67 A;  4C8P A;  3KHZ A;  2AFM A;  4C85 A;  4F9U A;  3FEE A;  3B3T A;  4P10 A;  3WC6 A;  1GYT A;  4TWE A;  4F9V A;  4C8T A;  4C9R A;  3RZA A;  4MXU A;  3D7G A;  4P4D A;  3ICU A;  2DEA A;  1XMB A;  4P4J A;  3B3V A;  1ZG8 A;  1ZG7 A;  3FED A;  3PB7 X;  1LFW A;  2JEW A;  1BPM A;  4JZ0 A;  3KAS A;  1Z2L A;  3K2K A;  3PB6 X;  4KNG E;  4PPZ A;  3SI0 A;  3PB9 X;  3KR4 A;  3GLJ A;  2GLF A;  4ZX8 A;  3WAB A;  4EME A;  5CBM A;  1PCA A;  4RUH A;  1XF1 A;  4FUU A;  1YSJ A;  4ZY0 A;  4W9Y A;  2QJ8 A;  4CDK A;  4EFD A;  1WVM A;  2AFX A;  4F8Z A;  5THW A;  1Z5R A;  4C8F A;  3KQX A;  3RBU A;  4O23 A;  2CTB A;  4NJQ A;  4MRI A;  4CPA A;  2PJ7 A;  3D66 A;  2ZEP A;  2RB7 A;  1F57 A;  1XBU A;  3VAR A;  1ELL P;  3LWU A;  3WT4 A;  2PJ6 A;  4Z65 A;  4EWT A;  3SI2 A;  2XEJ A;  2ZED A;  4TJV A;  4TNU A;  3BI1 A;  2C6P A;  2QYV A;  1AMP A;  5IB9 A;  1FT7 A;  2GRE A;  4C9V A;  3T8W A;  1IGB A;  2EK8 A;  3H8G A;  1KWM A;  4K3N A;  2AFW A;  2ZEL A;  8CPA A;  3BXM A;  1Y0R A;  3CPA A;  5J1Q A;  2HC9 A;  3KGQ A;  3IWW A;  5ELY A;  1ELM P;  2C1C A;  1TF9 A;  2F8H A;  2BOA A;  3WC5 A;  4A94 A;  4NGR A;  1DE4 C;  1VHO A;  3SJF A;  3MN8 A;  1XFO A;  3I1U A;  2AFS A;  1QQ9 A;  3SJX A;  4OC3 A;  5HVG A;  1LCP A;  2ZEH A;  3RAM A;  5JGF A;  3S9M A;  4X8I A;  1XJO A;  4ZX9 A;  3FEC A;  2OOT A;  3I6S A;  4UIA A;  3HLP A;  4DJL A;  1Y7E A;  3SJG A;  3JRU A;  2AFU A;  2PJ2 A;  1F2O A;  3CT9 A;  3FMC A;  3H8E A;  3HUV A;  6CPA A;  3VAT A;  4OC4 A;  4NGQ A;  3VH9 A;  3NH5 A;  1ARM A;  3NA6 A;  2V8V A;  2EK9 A;  2J9A A;  2BCO A;  1BPN A;  3D7D A;  1VIX A;  1HEE A;  4PQA A;  3NH8 A;  1LOK A;  4AXV A;  4LQG A;  4P4E A;  4MMO A;  4R6T A;  3NFZ A;  2PJC A;  4H2K A;  3V7Z A;  4UEF A;  3FH4 A;  3D4U A;  2Q43 A;  5JM6 A;  2EWB A;  2OR4 A;  2NSM A;  4R76 A;  5LYD A;  4MCP A;  4PXD A;  1Y9Z A;  1LAM A;  4UEE A;  4KSI A;  2IJZ A;  1BAV A;  4UEZ A;  4X3R A;  2C6C A;  2GLJ A;  3B3S A;  3N5F A;  1CG2 A;  1Z8L A;  2CIJ A;  1BLL E;  3B2Y A;  3H8F A;  4MCQ A;  1LAP A;  4NFR A;  4FWU A;  5LYL A;  3FVL A;  3GUX A;  5K8M A;  3BI0 A;  2WYR A;  3WC7 A;  3EIF A;  4ZY2 A;  4IHM A;  3TC8 A;  2PJ1 A;  4P44 A;  4YN3 A;  4BD9 A;  4MHZ A;  2XEF A;  5D8N A;  1TKJ A;  1TKF A;  2V77 A;  1EE3 P;  2PJB A;  1ARL A;  2JBJ A;  2ZOG A;  4MHN A;  2ZEN A;  3IJ3 A;  1LAN A;  4C84 A;  3PFO A;  1OBR A;  1TXR A;  4ZI6 A;  4NGS A;  2V8G A;  2PJ3 A;  5F09 A;  1AYE A;  3FF3 A;  4OP4 A;  2Q4Z A;  3SJE A;  1YME A;  4C8C A;  3B35 A;  3B3W A;  3FJU A;  5DS0 A;  3LMS A;  3PEI A;  4UIB A;  4C9U A;  5LYI A;  4OC5 A;  2PJ8 A;  5HVF A;  2POK A;  4ONW A;  4B6Z A;  5LRG A;  4PXE A;  3CDX A;  2O4H A;  5K8N A;  3D7F A;  4A39 A;  3KHX A;  1HDU A;  4OID A;  4ZY1 A;  3B3C A;  2WZN A;  4OC1 A;  3MRU A;  1YW6 A;  4C99 A;  3FX6 A;  5JH9 A;  4C8U A;  3PRT A;  4P6Y A;  4YU9 A;  2ZOF A;  2PIZ A;  1NSA A;  3D7H A;  2ZEE A;  1F2P A;  1IY7 A;  4R8F A;  2ZEO A; 
#chains in the Genus database with same CATH topology
 4A38 A;  1JQG A;  5K8P A;  1N71 A;  2PJ5 A;  2DIK A;  3KRV A;  3BUW B;  1PYT B;  5G22 A;  3S6G A;  4F0X A;  2YJV A;  2CBL A;  3I74 A;  4A32 A;  1X10 A;  4C2Y A;  5D29 A;  3G3S A;  3S9N A;  4BIN A;  4MJX A;  3HMJ G;  4NGP A;  4FD7 A;  5AG7 A;  2PDO A;  3VRP A;  1IIC A;  4A37 A;  5JQ4 A;  4XPL A;  4DYO A;  3PBB A;  3MGD A;  1Z8X A;  1PU9 A;  1RXT A;  3PZJ A;  3SI1 A;  5CPA A;  1VKC A;  2GU2 A;  3IO1 A;  2B58 A;  3PGP A;  2R1I A;  4NGN A;  2Z3K A;  4GS4 A;  1Z8T A;  1NE9 A;  4OME A;  4CDJ A;  3F5B A;  3KL9 A;  4G1P A;  4MCS A;  4OLL A;  1OZP A;  1CP7 A;  2V8H A;  4NGT A;  4PK3 A;  4CRZ B;  1UWY A;  2Q4V A;  1HDQ A;  5JPH A;  2GIV A;  4YGO A;  2VL1 A;  3U88 C;  3NH4 A;  2ZPA A;  1JWQ A;  2Z10 A;  4CAW A;  2G9D A;  2XEG A;  2PIY A;  3B7I A;  4YWY A;  2CNT A;  4OAD A;  1CP6 A;  3JTK A;  1R43 A;  5KTC A;  4FAI A;  3V38 A;  4NEX A;  3G23 A;  4AB7 A;  5F5X A;  3T0T A;  1TKH A;  1ZLH A;  3T07 A;  4IIY A;  2Q51 A;  4OC0 A;  3RO0 A;  1KUV A;  3KQZ A;  2DPT A;  5J8C A;  2GP4 A;  2P6E A;  4UA3 A;  1YLO A;  2HV2 A;  3KZW A;  1CPS A;  2CTC A;  4NF1 A;  3SR3 A;  5JYB A;  2CXA A;  2E28 A;  1IOI A;  1Y0Y A;  3S9L A;  2PVW A;  2BO9 A;  4CGO A;  3TYX A;  4CRY B;  4C2X A;  1NSL A;  1Y7R A;  1S60 A;  1KEE B;  2V8D A;  4HPS A;  3TLZ A;  3VTA A;  2ZEG A;  3QAH A;  4OAE A;  4UF4 A;  1B47 A;  1VGY A;  2BL1 A;  3EY5 A;  3CPX A;  5LRJ A;  4PXB A;  5EBV A;  3IC1 A;  2B4J C;  2ATR A;  3ZNI A;  5BY0 A;  3GJZ A;  5K99 A;  2J8M A;  1RTQ A;  4MFK A;  1S7N A;  2AJ6 A;  4C9E A;  4P45 A;  2OB0 A;  4CAX A;  4C9A A;  3PBE A;  4B13 A;  4II9 A;  1XRY A;  2AFO A;  4MHY A;  2PRQ A;  2PRB A;  1CBX A;  2AE6 A;  4U9Y A;  3IU1 A;  2NYQ A;  2JDC A;  1ON0 A;  1XE4 A;  3DGV A;  1Q7L A;  4K30 A;  1QST A;  4C8A A;  4GM5 A;  3BHX A;  4P4F A;  1S7F A;  4HKF A;  3L2N A;  1CX8 A;  3TLA A;  3IIB A;  2CF4 A;  4OIW A;  4XPD C;  5HKY A;  3ISX A;  5CNP A;  2IMO A;  2VEZ A;  3D68 A;  4CGL A;  1C30 B;  4IAV A;  3TTH A;  3VRO A;  4BPX B;  1H8L A;  2Q0Y A;  2RFH A;  2NMT A;  2Z3M A;  2Q4Y A;  3IEH A;  3PB4 X;  4CYO A;  5HVH A;  4ZYQ A;  1QMU A;  2P6G A;  3D2P A;  3ZZI A;  2PVV A;  1VI4 A;  2ANP A;  2F7V A;  2FIW A;  3JUW A;  4P4B A;  4MFP A;  1S7K A;  4KSA A;  5AG5 A;  2FVG A;  3TO9 A;  5HXD A;  4Q7A A;  4U5Y A;  4TJX A;  1YVH A;  1VHS A;  2IQ6 A;  3DLJ A;  5I4M A;  4E0A A;  2RC4 A;  3DR6 A;  5LRK A;  4EVY A;  4C8C A;  1Q2C A;  1Y9K A;  4ZGY B;  1YW4 A;  1YR0 A;  5HMN A;  5F46 A;  2PCU A;  4BBH A;  2I3C A;  2VKZ G;  5C82 A;  1Q5X A;  2I79 A;  2YGW A;  4UFW A;  3ISZ A;  2PE3 A;  4B12 A;  3VRQ A;  3KI9 A;  1R3N A;  2I00 A;  3PLF B;  3KR5 A;  5F48 A;  4YFJ A;  1VHE A;  5H86 A;  4MCR A;  3QNV A;  1ZG9 A;  3BUX B;  3BJ7 A;  4RR2 B;  2AUN A;  1KUX A;  2B5G B;  4UFV A;  3EO4 A;  4Y49 B;  4CYN A;  4MHP A;  4OC2 A;  1Y9W A;  4R7M A;  4C68 A;  5LYF A;  2PJ4 A;  2C6G A;  2CY2 A;  2QML A;  4IIX A;  2KCW A;  5F9M A;  2ZEM A;  3G8W A;  1M1D A;  4UBR A;  2B0A A;  4MI1 A;  2XEI A;  2XPO A;  4X2T A;  3N7Z A;  2PJA A;  3K9T A;  4M6I A;  5E96 A;  2PJ9 A;  4F0Y A;  4KOR A;  4FBE A;  4DUK A;  3VRN A;  1FNO A;  5K8O A;  4KUB A;  4NJR A;  2QVP A;  4JYW A;  4KOV A;  3NE8 A;  4CO9 A;  4OKO A;  1R57 A;  3CZX A;  4MFQ A;  4AG9 A;  3GB0 A;  2XPL A;  1TF8 A;  2AFZ A;  2HB6 A;  2R98 A;  4COG A;  4UCN A;  3TX8 A;  1RO5 A;  4CZ1 A;  4M3S A;  2PJ0 A;  3E0K A;  2DLA A;  1CPX A;  4F6A A;  2Z3O A;  7CPA A;  3F0A A;  3PFE A;  5G1Z A;  3GYA A;  1IYK A;  3D2M A;  4IF5 A;  2B3U A;  2GFQ A;  2Q7S A;  3VWD A;  3T5M A;  2ZEF A;  3IFE A;  4WWV A;  2VXK A;  4NGM A;  1M4L A;  2O53 A;  4KLV A;  1DIK A;  2YNC C;  4A95 A;  5IB0 A;  3F8K A;  3FNC A;  2EO8 A;  3TO6 A;  4P4I A;  3FXT A;  4IK2 A;  4M6G A;  2ABZ A;  4NCZ A;  4Q38 A;  3TLG A;  1DTD A;  4HNW B;  4UCM A;  4KVM E;  2JBK A;  5AGE A;  3PB8 X;  4C86 A;  1V6C A;  4WJB A;  1Q2D A;  4PXC A;  1ZLI A;  4PK2 A;  3D67 A;  4C8P A;  1Z4R A;  3KHZ A;  2AFM A;  4C85 A;  1XIX A;  4F9U A;  3FEE A;  2YNE A;  5C88 A;  3B3T A;  3EFA A;  1GGO A;  1YGH A;  4BPU B;  1Z9U A;  2BSW A;  3CXQ A;  4P10 A;  3WC6 A;  1GYT A;  4A31 A;  4TWE A;  4F9V A;  4C8T A;  2ZW5 A;  4C9R A;  2Z3N A;  3RZA A;  4MXU A;  1X12 A;  3D7G A;  1I12 A;  4P4D A;  1S7L A;  3ICU A;  4KOY A;  4A33 A;  2DEA A;  1XMB A;  4P4J A;  4E94 A;  2BUE A;  2HUZ A;  3B3V A;  1ZG8 A;  1ZG7 A;  4PSW A;  1ZL0 A;  3FED A;  3R9G A;  4UWI A;  1J3L A;  4R9M A;  3UY5 A;  2XPN A;  3PB7 X;  2OLS A;  1Q2Y A;  3OWC A;  1LFW A;  3NOJ A;  2JEW A;  4R87 A;  1BPM A;  1FBV A;  1Z2L A;  3KAS A;  4JZ0 A;  1J4J A;  3PFV A;  3K2K A;  3PB6 X;  2Z0Z A;  4KUA A;  4MY3 A;  4M6H A;  4PPZ A;  4KNG E;  2PCN A;  3SI0 A;  1P4N A;  3PB9 X;  4AVC A;  3KR4 A;  1IOF A;  3GLJ A;  1QSO A;  2GLF A;  4CAV A;  5IV0 A;  4ZX8 A;  3WAB A;  4B14 A;  1CM0 A;  2JLM A;  4B5O A;  4EME A;  4MFL A;  5KTA A;  4C7H A;  5CBM A;  3SXN A;  1PCA A;  4GXH A;  4JXR A;  2EZC A;  4RUH A;  2BEI A;  3OP0 A;  1V0C A;  1XF1 A;  2N3A B;  2OZU A;  3LAC A;  4FUU A;  1YSJ A;  4ZY0 A;  4W9Y A;  2QJ8 A;  1JDB C;  3EZE A;  4EFD A;  4CDK A;  5AG6 A;  1WWZ A;  1WVM A;  1ZYM A;  2AFX A;  5GCN A;  3GY9 A;  4F8Z A;  4QB9 A;  5THW A;  3RYO A;  3FIX A;  4KZT A;  3V8I A;  1Z5R A;  1WK4 A;  4HNX B;  4AVA A;  2YJT A;  4C8F A;  3KQX A;  3RBU A;  1NBW A;  4O23 A;  1B87 A;  2B4B A;  4HNY B;  2CTB A;  2QIR A;  3CXP A;  3DR8 A;  2G0B A;  3PP9 A;  4MRI A;  2ZW4 A;  2PJ7 A;  4NJQ A;  4CPA A;  3D66 A;  2ZEP A;  2RB7 A;  1M44 A;  1F57 A;  1XBU A;  2ODF A;  3VAR A;  1CJW A;  4CS0 B;  1ELL P;  3QB8 A;  1Z4E A;  5FD8 A;  5JVL A;  2OH1 A;  2O28 A;  2D4P A;  3LWU A;  2PJ6 A;  3WT4 A;  3IWE A;  2WUU A;  4QUS A;  4UCP A;  4Z65 A;  4EWT A;  3C26 A;  2FIA A;  2AUM A;  2H5M A;  3QAY A;  3SI2 A;  2FE7 A;  2XEJ A;  2FSR A;  4KLW A;  2ZED A;  4TJV A;  4TNU A;  1KUY A;  4JVO A;  1I1D A;  3BI1 A;  3I3G A;  3P2F A;  4RS2 A;  2C6P A;  3T9Y A;  2QYV A;  1AMP A;  4EYS A;  5IB9 A;  1Z9E A;  3IU2 A;  4XNH B;  1FT7 A;  3T05 A;  4KVX A;  2GRE A;  4A4B A;  2OU2 A;  1GHE A;  4C9V A;  1ZO0 A;  3T8W A;  1M4G A;  3OB2 B;  2VZY A;  3U1B A;  4ORF A;  4MFZ A;  1IGB A;  1SQH A;  2EK8 A;  1KWM A;  3H8G A;  3FB3 A;  1JDE A;  4K3N A;  2AFW A;  1S3Z A;  5J8F A;  4Y49 C;  4AVB A;  2ZEL A;  8CPA A;  3BXM A;  2DF5 A;  1Y0R A;  1LRZ A;  3CPA A;  3R9E A;  5J1Q A;  4R57 A;  2HC9 A;  3KGQ A;  3IWW A;  5ELY A;  1ELM P;  2K5T A;  3DSB A;  2C1C A;  1TF9 A;  2F8H A;  2REE A;  3LOD A;  1TIQ A;  2VQY A;  1IU8 A;  2G3A A;  2PSW A;  2BOA A;  3WC5 A;  4KS9 A;  3SXO A;  4A94 A;  5A28 A;  3TLC A;  4R3L A;  2YND A;  4NGR A;  1DE4 C;  1VHO A;  4DNC A;  3SJF A;  1XFO A;  3MN8 A;  3I1U A;  3HPH E;  2AFS A;  3GIU A;  4COB A;  4LQ6 A;  1QQ9 A;  5I0C A;  3OAK A;  4L89 A;  3SJX A;  4OC3 A;  1VBH A;  5IR2 A;  4Q36 A;  5HVG A;  3S6K A;  4INJ A;  5DWM A;  4IUS A;  1LCP A;  2ZEH A;  4NXY A;  3R96 A;  3RAM A;  2JEV A;  2Y1M A;  3BLN A;  5JGF A;  1MJ9 A;  3TLE A;  3FBU A;  4H1H A;  3S9M A;  4X8I A;  1XJO A;  5EMI A;  4ZX9 A;  2XPP A;  3FEC A;  2OOT A;  4BPW B;  5DWN A;  2Y1N A;  5EC4 A;  3I6S A;  1YX0 A;  4UIA A;  3HLP A;  4DJL A;  2P0W A;  2VBQ A;  2FS5 A;  1Y7E A;  4B10 A;  3SJG A;  2Y0M A;  3JRU A;  4LUA A;  4B5P A;  2AFU A;  2PQ8 A;  2PJ2 A;  2EUI A;  2FT0 A;  3R1K A;  1F2O A;  3CT9 A;  2B4D A;  4MI4 A;  3FMC A;  4RI1 A;  3H8E A;  2X0S A;  1IB1 E;  3HUV A;  3R9F A;  3TLG B;  6CPA A;  3VAT A;  4OC4 A;  4NGQ A;  3H5Z A;  2ZXV A;  3VH9 A;  3NH5 A;  4L8A A;  1EO0 A;  5FVJ A;  4CAF A;  1QSR A;  1ARM A;  3NA6 A;  4LX9 A;  4X5K A;  5ISV A;  2PR1 A;  3W6S A;  3DDD A;  3KKW A;  2F5I A;  2V8V A;  2EK9 A;  1KC7 A;  4FD5 A;  4PV6 A;  2J9A A;  5F13 A;  4KSF A;  2BCO A;  3CXS A;  1BPN A;  3NFQ A;  1YVO A;  3IWG A;  3D7D A;  1VIX A;  3VRR A;  2OZH A;  1HEE A;  4PQA A;  4A4C A;  3B8G A;  2DXQ A;  3EZB A;  3NH8 A;  2Z3L A;  2R82 A;  1LOK A;  3R95 A;  4U9Z A;  2G3T A;  4AXV A;  1CE8 B;  1M6V B;  3WR7 A;  1XOV A;  4LQG A;  5F47 A;  4YRH A;  4P4E A;  4MHD A;  4MMO A;  4R6T A;  3TO7 A;  2WPW A;  4A2Z A;  3NFZ A;  2D0P A;  2PJC A;  3JVN A;  4H2K A;  4UWJ A;  1BXR B;  4UFX A;  1YVK A;  3V7Z A;  3LD2 A;  2YNC A;  3FH4 A;  4UEF A;  3D4U A;  4A30 A;  2Q43 A;  5JM6 A;  2WSA A;  3TOB A;  2VZZ A;  3GKR A;  3TCV A;  5G21 A;  1EZB A;  2EWB A;  2OR4 A;  1FY7 A;  2NSM A;  4R76 A;  4MY0 A;  2A4N A;  5LYD A;  4MCP A;  3H4Q A;  3S6H A;  4PXD A;  2X7B A;  1Y9Z A;  1LAM A;  4UEE A;  3D8P A;  4KSI A;  2IJZ A;  3IGR A;  1BAV A;  1IID A;  3BUN B;  5KTD A;  4CYQ A;  4UEZ A;  4X3R A;  2C6C A;  2VI7 A;  2OZG A;  5F49 A;  3EXN A;  4GPL B;  2GLJ A;  3TT2 A;  4E5S A;  3B3S A;  5HH1 A;  3N5F A;  3BUO B;  4JD6 A;  2WPX A;  4MFJ A;  1XEB A;  2MP0 A;  4C2Z A;  2D4O A;  1CG2 A;  2IL4 A;  1Z8L A;  5AXI A;  3OB1 B;  1A2Z A;  2CIJ A;  2EVN A;  2J8R A;  2JDD A;  5G20 A;  1BLL E;  2EBJ A;  1YLE A;  3B2Y A;  3H8F A;  4KOS A;  4KOW A;  4MCQ A;  1LAP A;  4NFR A;  4FWU A;  1QSM A;  2PR8 A;  5LYL A;  1ZRS A;  3FVL A;  3GUX A;  1QSN A;  4KVO E;  4QC6 A;  5K8M A;  3K4I A;  3BI0 A;  2WYR A;  4CGP A;  4FD6 A;  3WC7 A;  1XMT A;  3EIF A;  4ZY2 A;  3TOA A;  2EZA A;  4IHM A;  3TC8 A;  2PJ1 A;  2FM4 A;  4P44 A;  4YN3 A;  1VBG A;  4BD9 A;  4MHZ A;  1PUA A;  1L0C A;  4BTF A;  2GAN A;  1T36 B;  3HPG G;  3EC4 A;  2XEF A;  4AG7 A;  4B11 A;  1IYL A;  4XNH C;  4R3K A;  5D8N A;  1TKJ A;  4H6U A;  3W6X A;  1TKF A;  4KOT A;  3RNZ A;  2REF A;  3K9U A;  2V77 A;  1EE3 P;  3F9K C;  2PJB A;  1ARL A;  4JJX A;  3W91 A;  2JBJ A;  2ZOG A;  4MHN A;  4ONU A;  4CYP A;  4E2A A;  2HI6 A;  4RN7 A;  2ZEN A;  3IJ3 A;  1LAN A;  2Z3P A;  2D0O A;  2FL4 A;  3TLB A;  3ZJ0 A;  4C84 A;  2P6F A;  1NXJ A;  1I21 A;  2HRO A;  4KOU A;  3PFO A;  5BWA B;  2FCK A;  3DNS A;  1YQE A;  4JXQ A;  3P2H A;  5H84 A;  1OBR A;  1TXR A;  4ZI6 A;  3I9S A;  3T90 A;  4NGS A;  2V8G A;  3A9L A;  1A9X B;  2R7H A;  2PJ3 A;  5F09 A;  1NMT A;  3NE7 A;  2Z11 A;  1EZA A;  4E8O A;  4XPD B;  3C8O A;  1MJA A;  4J3G A;  3TLY A;  1AYE A;  3FF3 A;  3PT1 A;  4M8D A;  4NSQ A;  2Q7B A;  5HKZ A;  2CNS A;  3FYN A;  4OP4 A;  2Q4Z A;  1U6M A;  4C7I A;  3EZA A;  1KBL A;  3SJE A;  1YME A;  2C27 A;  3B35 A;  4KOX A;  4ZBG A;  3B3W A;  3FJU A;  4H6Z A;  4QBJ A;  2ZW7 A;  5DS0 A;  3LMS A;  3PEI A;  2ZW6 A;  4UIB A;  4CGM A;  3O8Z A;  4C9U A;  5LYI A;  4OC5 A;  2FXF A;  4QVT A;  2ARH A;  2PJ8 A;  1UFH A;  5HVF A;  5A27 A;  3D3S A;  2POK A;  1Z8W A;  4ONW A;  4B6Z A;  5J3X A;  5LRG A;  2EZB A;  2B3V A;  1YRE A;  3CDX A;  1YK3 A;  4PXE A;  1BO4 A;  2O4H A;  4I49 A;  3SHP A;  3D7F A;  5K8N A;  4J0N A;  4CGN A;  1S5K A;  4A39 A;  2GE3 A;  2Q44 A;  1M4D A;  1BOB A;  1MJB A;  3KHX A;  1R61 A;  4CAE A;  3TE4 A;  1HDU A;  3BUM B;  1WJT A;  4MJ8 A;  1B6B A;  4OID A;  3B3C A;  4ZY1 A;  1AUG A;  4JWP A;  3S6F A;  2WZN A;  4OC1 A;  2B5G A;  2DPS A;  3MRU A;  1CS0 B;  1YW6 A;  4C99 A;  3FX6 A;  3VWE A;  4B5P B;  4MBU A;  2UV8 G;  3FRM A;  5JH9 A;  2B4D B;  1K4J A;  4C8U A;  5IX3 A;  1XF8 A;  2HQY A;  4BMH A;  3PRT A;  5HKW A;  4P6Y A;  2Q04 A;  4YU9 A;  3TFY A;  2PC1 A;  5F1Y A;  1C3O B;  1P0H A;  2QEC A;  4JLY A;  2ZOF A;  4FD4 A;  1MK4 A;  1NSA A;  2PIZ A;  2R8V A;  4PSX A;  3BJ8 A;  3D7H A;  4XPK A;  1KZF A;  3VGO A;  4H89 A;  1M4I A;  5AG4 A;  2C5Q A;  2ZEE A;  4M85 A;  2HWG A;  2J8N A;  1F2P A;  1IY7 A;  4R8F A;  2ZEO A;  2CNM A; 
#chains in the Genus database with same CATH homology
 4A38 A;  1JQG A;  5K8P A;  2PJ5 A;  1PYT B;  3I74 A;  5D29 A;  3S9N A;  4NGP A;  4A37 A;  4DYO A;  3PBB A;  3SI1 A;  5CPA A;  2GU2 A;  3IO1 A;  4NGN A;  4OME A;  4CDJ A;  3KL9 A;  4G1P A;  4MCS A;  1CP7 A;  2V8H A;  4NGT A;  1UWY A;  1HDQ A;  2VL1 A;  3NH4 A;  2G9D A;  2XEG A;  2PIY A;  3B7I A;  4YWY A;  1CP6 A;  1R43 A;  4FAI A;  3V38 A;  1TKH A;  1ZLH A;  2Q51 A;  4OC0 A;  3KQZ A;  2GP4 A;  1YLO A;  3KZW A;  1CPS A;  2CTC A;  1Y0Y A;  3S9L A;  2PVW A;  2BO9 A;  2V8D A;  3VTA A;  2ZEG A;  4UF4 A;  1VGY A;  3CPX A;  5LRJ A;  4PXB A;  3IC1 A;  1RTQ A;  4C9E A;  4P45 A;  4C9A A;  3PBE A;  1XRY A;  2AFO A;  4MHY A;  2PRQ A;  1CBX A;  2NYQ A;  3DGV A;  1Q7L A;  4C8A A;  4GM5 A;  3BHX A;  4P4F A;  3L2N A;  1CX8 A;  3IIB A;  2CF4 A;  4OIW A;  3ISX A;  2IMO A;  3D68 A;  4IAV A;  2RFH A;  1H8L A;  3IEH A;  5HVH A;  3PB4 X;  4ZYQ A;  1QMU A;  2PVV A;  2ANP A;  2F7V A;  5HXD A;  4P4B A;  4TJX A;  2FVG A;  4Q7A A;  2IQ6 A;  3DLJ A;  5I4M A;  5LRK A;  1YW4 A;  2PCU A;  2I3C A;  3ISZ A;  2PE3 A;  3KI9 A;  1R3N A;  3KR5 A;  1VHE A;  4MCR A;  3QNV A;  1ZG9 A;  4MHP A;  4OC2 A;  4R7M A;  5LYF A;  2PJ4 A;  2C6G A;  2ZEM A;  2XEI A;  4X2T A;  2PJA A;  3K9T A;  2PJ9 A;  4FBE A;  4DUK A;  1FNO A;  5K8O A;  4NJR A;  2QVP A;  4JYW A;  4OKO A;  3GB0 A;  1TF8 A;  2AFZ A;  2HB6 A;  3TX8 A;  2PJ0 A;  1CPX A;  7CPA A;  3PFE A;  2ZEF A;  3IFE A;  4WWV A;  4NGM A;  1M4L A;  2O53 A;  4P4I A;  4IK2 A;  2ABZ A;  1DTD A;  2JBK A;  3PB8 X;  4C86 A;  1V6C A;  4WJB A;  4PXC A;  1ZLI A;  3D67 A;  4C8P A;  3KHZ A;  2AFM A;  4C85 A;  4F9U A;  3FEE A;  3B3T A;  4P10 A;  3WC6 A;  1GYT A;  4TWE A;  4F9V A;  4C8T A;  4C9R A;  3RZA A;  4MXU A;  3D7G A;  4P4D A;  3ICU A;  2DEA A;  1XMB A;  4P4J A;  3B3V A;  1ZG8 A;  1ZG7 A;  3FED A;  3PB7 X;  1LFW A;  2JEW A;  1BPM A;  4JZ0 A;  3KAS A;  1Z2L A;  3K2K A;  3PB6 X;  4KNG E;  4PPZ A;  3SI0 A;  3PB9 X;  3KR4 A;  3GLJ A;  2GLF A;  4ZX8 A;  3WAB A;  4EME A;  5CBM A;  1PCA A;  4RUH A;  1XF1 A;  4FUU A;  1YSJ A;  4ZY0 A;  4W9Y A;  2QJ8 A;  4CDK A;  4EFD A;  1WVM A;  2AFX A;  4F8Z A;  5THW A;  1Z5R A;  4C8F A;  3KQX A;  3RBU A;  4O23 A;  2CTB A;  4NJQ A;  4MRI A;  4CPA A;  2PJ7 A;  3D66 A;  2ZEP A;  2RB7 A;  1F57 A;  1XBU A;  3VAR A;  1ELL P;  3LWU A;  3WT4 A;  2PJ6 A;  4Z65 A;  4EWT A;  3SI2 A;  2XEJ A;  2ZED A;  4TJV A;  4TNU A;  3BI1 A;  2C6P A;  2QYV A;  1AMP A;  5IB9 A;  1FT7 A;  2GRE A;  4C9V A;  3T8W A;  1IGB A;  2EK8 A;  3H8G A;  1KWM A;  4K3N A;  2AFW A;  2ZEL A;  8CPA A;  3BXM A;  1Y0R A;  3CPA A;  5J1Q A;  2HC9 A;  3KGQ A;  3IWW A;  5ELY A;  1ELM P;  2C1C A;  1TF9 A;  2F8H A;  2BOA A;  3WC5 A;  4A94 A;  4NGR A;  1DE4 C;  1VHO A;  3SJF A;  3MN8 A;  1XFO A;  3I1U A;  2AFS A;  1QQ9 A;  3SJX A;  4OC3 A;  5IR2 A;  5HVG A;  1LCP A;  2ZEH A;  3RAM A;  5JGF A;  3S9M A;  4X8I A;  1XJO A;  4ZX9 A;  3FEC A;  2OOT A;  3I6S A;  4UIA A;  3HLP A;  4DJL A;  1Y7E A;  3SJG A;  3JRU A;  2AFU A;  2PJ2 A;  1F2O A;  3CT9 A;  3FMC A;  3H8E A;  3HUV A;  6CPA A;  3VAT A;  4OC4 A;  4NGQ A;  3VH9 A;  3NH5 A;  1ARM A;  3NA6 A;  2V8V A;  2EK9 A;  2J9A A;  2BCO A;  1BPN A;  3D7D A;  1VIX A;  1HEE A;  4PQA A;  3NH8 A;  1LOK A;  4AXV A;  4LQG A;  4P4E A;  4MMO A;  4R6T A;  3NFZ A;  2PJC A;  4H2K A;  3V7Z A;  4UEF A;  3FH4 A;  3D4U A;  2Q43 A;  5JM6 A;  2EWB A;  2OR4 A;  2NSM A;  4R76 A;  5LYD A;  4MCP A;  4PXD A;  1Y9Z A;  1LAM A;  4UEE A;  4KSI A;  2IJZ A;  1BAV A;  4UEZ A;  4X3R A;  2C6C A;  2GLJ A;  3B3S A;  3N5F A;  1CG2 A;  1Z8L A;  2CIJ A;  1BLL E;  3B2Y A;  3H8F A;  4MCQ A;  1LAP A;  4NFR A;  4FWU A;  5LYL A;  3FVL A;  3GUX A;  5K8M A;  3BI0 A;  2WYR A;  3WC7 A;  3EIF A;  4ZY2 A;  4IHM A;  3TC8 A;  2PJ1 A;  4P44 A;  4YN3 A;  4BD9 A;  4MHZ A;  2XEF A;  5D8N A;  1TKJ A;  1TKF A;  2V77 A;  1EE3 P;  2PJB A;  1ARL A;  2JBJ A;  2ZOG A;  4MHN A;  2ZEN A;  3IJ3 A;  1LAN A;  4C84 A;  3PFO A;  1OBR A;  1TXR A;  4ZI6 A;  4NGS A;  2V8G A;  2PJ3 A;  5F09 A;  1AYE A;  3FF3 A;  4OP4 A;  2Q4Z A;  3SJE A;  1YME A;  4C8C A;  3B35 A;  3B3W A;  3FJU A;  5DS0 A;  3LMS A;  3PEI A;  4UIB A;  4C9U A;  5LYI A;  4OC5 A;  2PJ8 A;  5HVF A;  2POK A;  4ONW A;  4B6Z A;  5LRG A;  4PXE A;  3CDX A;  2O4H A;  5K8N A;  3D7F A;  4A39 A;  3KHX A;  1HDU A;  4OID A;  4ZY1 A;  3B3C A;  2WZN A;  4OC1 A;  3MRU A;  1YW6 A;  4C99 A;  3FX6 A;  5JH9 A;  4C8U A;  3PRT A;  4P6Y A;  4YU9 A;  2ZOF A;  2PIZ A;  1NSA A;  3D7H A;  2C5Q A;  2ZEE A;  1F2P A;  1IY7 A;  4R8F A;  2ZEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...