4P44A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor jrb-4-81
Total Genus 258
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
258
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
total genus 258
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p44A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p44A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p44A02
2G9DA 4KSIA 2NYQA 3FF3A 2V8HA 5LRKA 5F09A 1BPNA 1UWYA 1OBRA 4A37A 2ZEPA 1CBXA 2PRQA 4P4DA 4ZY1A 2ZENA 3NFZA 4EMEA 3HLPA 4OC1A 2GU2A 2CIJA 4R76A 1Y7EA 4NGTA 4CPAA 4MHYA 1R43A 3D4UA 4EWTA 1DE4C 3S9LA 2AFUA 3NH5A 2PJ1A 4FUUA 3KZWA 2VL1A 2ZOGA 1Z8LA 3CDXA 4UIAA 3SJFA 3IWWA 3H8GA 3PB7X 1YLOA 4A38A 4LQGA 4TJVA 2ABZA 1KWMA 1YW4A 2PIZA 4IK2A 1JQGA 5K8OA 1ZG8A 1FT7A 3PB4X 2BO9A 4UEFA 3B35A 4A39A 1BLLE 4MHPA 4OP4A 1PYTB 3D68A 2PVWA 5D29A 3GUXA 2XEGA 3V38A 1Y0RA 4YU9A 4C8CA 1ZG9A 5LYLA 4OKOA 3V7ZA 1WVMA 4MRIA 2DEAA 3GB0A 3FVLA 2OOTA 1AYEA 4UIBA 1VGYA 1BPMA 2V77A 3CT9A 4A94A 5K8MA 4CDKA 1TF8A 4OMEA 4TWEA 5HVFA 5LYIA 2WZNA 3SI2A 4ZY0A 2Q51A 5DS0A 2PJ6A 4FWUA 4ZX9A 2PCUA 2OR4A 5JM6A 2HB6A 1CP6A 2JBJA 2PIYA 3S9MA 4P10A 2WYRA 1PCAA 4R6TA 4OC3A 2IQ6A 1IY7A 5JGFA 4FAIA 1YW6A 1ELLP 4PXCA 4OC0A 3PRTA 4ZX8A 3D7FA 3B7IA 3ISXA 3L2NA 2QVPA 4ZI6A 3LWUA 2V8VA 4NFRA 1TKFA 4F9VA 4C8UA 2RB7A 2PJ0A 3FEEA 3D67A 3PB8X 4MHZA 4NGPA 2HC9A 2Q4ZA 1XBUA 4MCSA 1VIXA 2QJ8A 3PB6X 3RZAA 3I6SA 3FX6A 3PBBA 2BCOA 3MRUA 4C9RA 2F8HA 3N5FA 4C9EA 3DLJA 4PPZA 2PJ9A 4C9UA 4NGMA 4R8FA 1F57A 3SI0A 4WWVA 2NSMA 3ICUA 4X2TA 3IFEA 1Z5RA 3BI0A 3HUVA 5JH9A 3SI1A 3SJXA 2F7VA 2PJ2A 1ARLA 2CF4A 3PBEA 1ZLIA 4K3NA 5K8PA 1Q7LA 4P44A 4F8ZA 4P4EA 3KASA 1LAMA 3IO1A 4C85A 2XEIA 2PJ7A 1V6CA 3IJ3A 4DJLA 2PJBA 1ZLHA 4NGNA 3CPXA 3D7GA 3I1UA 4ZYQA 2FVGA 4UEZA 3FJUA 2ZEOA 4R7MA 4FBEA 1LAPA 2ZEHA 1YSJA 1XF1A 1H8LA 2EK9A 5THWA 3LMSA 5HVGA 1F2OA 5J1QA 5CBMA 4NJRA 3JRUA 3KQXA 3GLJA 1NSAA 5HXDA 3TC8A 1QQ9A 3D7DA 4P4FA 5IB9A 1ARMA 4DYOA 1M4LA 7CPAA 3NH4A 2C1CA 1XMBA 3MN8A 2AFOA 4C9AA 4C8FA 5LRJA 2CTBA 1Y9ZA 2PVVA 3KR5A 5LRGA 4Z65A 3EIFA 1LCPA 2XEJA 4P4JA 4NGQA 3VATA 4MCRA 1BAVA 2ZEFA 3BXMA 1YMEA 2GREA 3ISZA 4DUKA 3CPAA 3VH9A 1VHOA 2PJ5A 4RUHA 2ZEGA 1LANA 4NGSA 1LFWA 1CG2A 3WC7A 2ZEMA 1ZG7A 4OC5A 4OIWA 2Q43A 1EE3P 3VARA 3VTAA 4H2KA 3KGQA 4C99A 4P45A 5HVHA 4P4BA 3BHXA 3IEHA 2QYVA 1TXRA 2IMOA 3B3WA 4IAVA 3KHXA 5K8NA 3S9NA 4OIDA 1Y0YA 3KR4A 1DTDA 1FNOA 4JYWA 4PXDA 1QMUA 3TX8A 2ANPA 3SJGA 2GLJA 3B3VA 3B2YA 2AFWA 3D66A 2ZEDA 4YWYA 4UF4A 2V8GA 3WC5A 2ZOFA 4MHNA 2XEFA 1VHEA 1XJOA 5LYDA 2PJ8A 2ZEEA 3NH8A 4MMOA 4PXEA 4P6YA 2ZELA 3D7HA 2CTCA 5D8NA 1CPXA 4MCPA 2PJCA 3B3CA 2EK8A 3KQZA 2C6CA 4MCQA 3NA6A 4CDJA 5ELYA 1TKJA 2AFMA 2PJAA 1RTQA 5I4MA 4C8AA 1R3NA 4JZ0A 4PXBA 3B3TA 4NJQA 3FECA 1HEEA 4X8IA 4TJXA 4OC4A 2O53A 1XRYA 1LOKA 1CPSA 2PE3A 6CPAA 3IC1A 4MXUA 4UEEA 4G1PA 3FMCA 4ZY2A 5LYFA 1GYTA 3WT4A 4C8PA 3PFOA 3RBUA 4NGRA 4AXVA 2RFHA 4B6ZA 3KHZA 3SJEA 4KNGE 2PJ3A 3IIBA 4GM5A 3KL9A 1ELMP 2AFSA 3BI1A 3B3SA 4F9UA 2AFZA 4IHMA 4ONWA 3PB9X 8CPAA 4PQAA 4C86A 1Z2LA 3H8FA 3I74A 3K2KA 1IGBA 2O4HA 4X3RA 3KI9A 3FH4A 4EFDA 2JBKA 3RAMA 4OC2A 4WJBA 2EWBA 3PEIA 5CPAA 3FEDA 3PFEA 2POKA 2V8DA 2I3CA 1XFOA 2JEWA 1CX8A 3K9TA 2GLFA 4P4IA 3WABA 2AFXA 1HDUA 4W9YA 1TF9A 2J9AA 1F2PA 3QNVA 4O23A 1AMPA 2BOAA 4TNUA 1TKHA 2C6GA 4C8TA 3WC6A 1HDQA 2IJZA 3T8WA 4YN3A 4C84A 2C6PA 3DGVA 4Q7AA 1CP7A 4C9VA 3H8EA 2PJ4A 4BD9A
chains in the Genus database with same CATH superfamily
3OAKA 4JD6A 2G9DA 4FD5A 4KSIA 4B5PA 4H6ZA 2NYQA 3FF3A 2V8HA 3GY9A 5LRKA 4C84A 2CBLA 2Q4YA 3VWDA 4PV6A 5F09A 1BPNA 1UWYA 4C68A 1VI4A 4KOUA 1OBRA 2EUIA 4A37A 1JDEA 2HI6A 3VROA 4AVBA 2ZEPA 4IIYA 1CBXA 1K4JA 2PRQA 4P4DA 4ZY1A 1J3LA 2ZENA 3T07A 3NFZA 1WJTA 4EMEA 1B6BA 3MGDA 3R1KA 2C5QA 4EYSA 1KC7A 4NF1A 5J3XA 2EO8A 3HLPA 4KS9A 4OC1A 2GU2A 4E2AA 2CIJA 4R76A 1Y7EA 4NGTA 4CPAA 4MHYA 1R43A 4NCZA 3T05A 3D4UA 4Q38A 5I0CA 3R95A 5K99A 4BPXB 3LD2A 4M6IA 4EWTA 4MFZA 3S6FA 3LACA 1KZFA 5KTDA 2R82A 5FVJA 2PSWA 2EZCA 1DE4C 2NMTA 3EO4A 3RNZA 3S9LA 4RI1A 3PGPA 2AFUA 1FBVA 2PQ8A 3I3GA 2PJ1A 3NH5A 3KZWA 4FUUA 1Y9WA 4JXQA 5AG6A 2XPNA 4K30A 1VBGA 1YVOA 3TE4A 2VL1A 1ON0A 2ZOGA 4A30A 1Z8LA 5F13A 3CDXA 3QAHA 2WPWA 4HPSA 4UIAA 3TLAA 3TLCA 3SJFA 4C7HA 1Z8TA 1M6VB 3IWWA 1TIQA 3GIUA 3H8GA 5FD8A 3PB7X 4MFQA 1YLOA 2PC1A 4A38A 3BJ7A 2GFQA 4LQGA 4II9A 3BUMB 4TJVA 2ABZA 1KWMA 1YW4A 2PIZA 4IK2A 5KTAA 2DXQA 1JQGA 4KVME 5K8OA 1IB1E 1ZG8A 1FT7A 2BEIA 3PB4X 3C8OA 1BOBA 2BO9A 4CDJA 4MI1A 3FB3A 4M8DA 2R7HA 4UEFA 4IIXA 3K4IA 3B35A 4MY0A 4A39A 5F46A 2Q4VA 4MFLA 1BLLE 4KVXA 4MHPA 4OP4A 1GGOA 1PYTB 3D68A 2B4DB 3OB2B 5AXIA 2PVWA 2B3VA 5D29A 3GUXA 1Z4RA 4UCMA 4FD6A 2YGWA 1CE8B 2VZZA 2XEGA 2BSWA 2QMLA 2Z3OA 3V38A 4YFJA 5A28A 4R3LA 2YJVA 2OH1A 1Z4EA 3DSBA 1Y0RA 4UCPA 3TFYA 4YU9A 4C8CA 5JVLA 1ZG9A 5LYLA 4OKOA 1RO5A 4A95A 1CJWA 3V7ZA 1WVMA 3SHPA 3S6KA 1B47A 3R96A 4OAEA 4X5KA 2G3AA 4MRIA 2DEAA 2FL4A 3GB0A 1GHEA 1A2ZA 3FVLA 2OOTA 3KKWA 4RR2B 1PUAA 1AYEA 4UIBA 4UWJA 3T90A 1VGYA 1BPMA 2F5IA 2JEVA 2V77A 3CT9A 4A94A 1L0CA 4E8OA 5K8MA 4CDKA 3T0TA 1TF8A 4OMEA 3D2PA 4TWEA 5HVFA 5LYIA 2WZNA 5AG7A 3SI2A 4KOXA 2B4DA 5G21A 2Q51A 4ZY0A 2HROA 5DS0A 4KOYA 5IX3A 1U6MA 1ZO0A 4UCNA 2PJ6A 4FWUA 4ZX9A 3TT2A 3D8PA 1M4DA 2PCUA 3FIXA 2OR4A 1IU8A 5JM6A 2HB6A 1CP6A 2ZW4A 2JBJA 2PIYA 3DDDA 3S9MA 4P10A 2XPOA 4YRHA 2WYRA 1CM0A 3D3SA 4UFWA 2WUUA 4XNHB 1PCAA 4R6TA 2OB0A 3N7ZA 4OC3A 3BLNA 4A31A 4KZTA 2IQ6A 4UFXA 1IY7A 5JGFA 4FAIA 2WPXA 1YW6A 5G1ZA 4HNWB 4CAXA 5JPHA 3BUXB 2AUMA 1ELLP 4PXCA 4OC0A 3PRTA 4ZX8A 2PDOA 4M6GA 3D7FA 3B7IA 4IUSA 4GPLB 4CYNA 2VXKA 1AUGA 1Z8XA 1Q2CA 4AG7A 3ISXA 3L2NA 2I00A 2QVPA 4ZI6A 3LWUA 2V8VA 4NFRA 1TKFA 2CXAA 2PR1A 2FXFA 4R57A 4F9VA 5H86A 1QSNA 1QSRA 2GE3A 2Z0ZA 4C8UA 4INJA 5F5XA 2ZW6A 3O8ZA 2PRBA 2RB7A 1KBLA 2PJ0A 4KSAA 3W91A 5A27A 2C27A 3CXQA 4Y49C 5F9MA 1M1DA 4B12A 4KUBA 5DWNA 4MFPA 1YQEA 2Z10A 4BBHA 3W6SA 3FEEA 5J8FA 3D67A 4CGPA 3PB8X 4MHZA 4NGPA 1EZAA 2HC9A 2Q4ZA 2N3AB 1XBUA 4MCSA 4J0NA 1VIXA 5JYBA 5G20A 2QJ8A 1T36B 4R87A 4A4CA 3PB6X 3RZAA 2OZHA 2J8MA 3FX6A 3K9UA 2QIRA 3I6SA 3OB1B 2DPTA 3JTKA 3PBBA 2BCOA 4UWIA 3MRUA 3F0AA 4C2YA 4C9RA 1XIXA 2F8HA 1Z8WA 3N5FA 4MBUA 4C9EA 3DLJA 4PPZA 2PJ9A 4C9UA 1A9XB 4NGMA 2Z11A 3NE7A 2OU2A 3A9LA 1F57A 4R8FA 4A32A 3SI0A 5C82A 3U1BA 1FY7A 3TCVA 4WWVA 3PT1A 3KRVA 1S7KA 2NSMA 3GKRA 3H4QA 3ICUA 4X2TA 3IFEA 1B87A 2YNCA 3CXSA 1Z5RA 5F47A 4AG9A 3BI0A 3HUVA 4GS4A 2DIKA 1NE9A 2OZGA 5JH9A 4YN3A 2Y1NA 3SI1A 4UBRA 2J8RA 2PR8A 4H89A 3SJXA 4MFJA 2F7VA 4JXRA 4CGNA 4C2XA 2H5MA 2PJ2A 2ATRA 1MJ9A 1ARLA 2CF4A 3CZXA 3TLYA 2ZW5A 3PBEA 1R61A 5E96A 1M4GA 1ZLIA 1NMTA 4U9YA 2WSAA 4K3NA 1Q7LA 5BWAB 5K8PA 3GJZA 1KUVA 3PLFB 4ZBGA 1WWZA 2OZUA 4AB7A 3VRPA 2P6FA 2Z3PA 4CO9A 4P44A 2FT0A 1VKCA 4P4EA 4OLLA 4F8ZA 4JWPA 3KASA 3TO7A 5KTCA 3BJ8A 1NXJA 3T9YA 1NBWA 2B3UA 1LAMA 3IO1A 4C85A 2XEIA 3NOJA 2PJ7A 2AUNA 5HKZA 4LX9A 4H6UA 1V6CA 3IJ3A 3EXNA 2A4NA 4DJLA 2PJBA 1ZLHA 2GIVA 4NGNA 3G3SA 4XPDC 2Q7BA 4CGLA 5IB0A 3CPXA 3D7GA 1KUXA 2Z3MA 3I1UA 2XPLA 4ZYQA 2FVGA 2IL4A 4UEZA 5G22A 3FJUA 4LUAA 2ZEOA 4R7MA 5BY0A 3EY5A 5DWMA 4FBEA 2P0WA 1YVHA 1YVKA 1LAPA 4DNCA 2ZEHA 1YR0A 2DF5A 4E94A 1EO0A 1Y7RA 1N71A 1YSJA 2FCKA 2O28A 2YNCC 3FBUA 3BUOB 2P6GA 4KOVA 4PK2A 4AVAA 5IV0A 1H8LA 2EK9A 2ZPAA 5THWA 3LMSA 5HVGA 1F2OA 2B5GB 1YLEA 1VBHA 2JDDA 4MJXA 3F5BA 5J1QA 4M85A 4NSQA 4UA3A 2P6EA 4CAVA 1I12A 4NJRA 3JRUA 2Q0YA 3D2MA 5CBMA 2EZBA 3KQXA 1XMTA 4COBA 2CNSA 3GLJA 1NSAA 5EBVA 2G3TA 5HXDA 1Y9KA 3TC8A 1QQ9A 3D7DA 4P4FA 4GXHA 4BTFA 5IB9A 4C2ZA 2HWGA 1ARMA 3TLGB 4JLYA 4DYOA 3BUNB 1M4LA 3R9EA 7CPAA 3NH4A 5AG5A 2C1CA 2AE6A 4QVTA 4EVYA 1XMBA 2YJTA 3MN8A 1VHSA 2AFOA 4C7IA 1BXRB 4C9AA 5F49A 5LRJA 4NXYA 4C8FA 3TLEA 2CTBA 1Y9ZA 2PVVA 4A4BA 3KR5A 1XOVA 4F0XA 2B5GA 4KORA 5LRGA 3IU1A 3P2HA 3V8IA 1LCPA 2EBJA 4Z65A 3EIFA 2XEJA 4P4JA 2J8NA 4NGQA 2EZAA 4QUSA 3VATA 4MCRA 3QAYA 3TO6A 5JQ4A 1BAVA 2ZEFA 1Q2DA 5CNPA 3BXMA 1M4IA 2XPPA 4CYQA 4F0YA 2FM4A 1YMEA 5F48A 1QSMA 3FNCA 2RC4A 3TLGA 1C3OB 2GREA 3ISZA 2Q44A 4OADA 3NFQA 1S3ZA 3CPAA 4DUKA 1Q2YA 3VH9A 1S5KA 4CAEA 1VHOA 2D4OA 2PJ5A 2Z3LA 1IYKA 1LANA 2ZEGA 4RUHA 4NGSA 3ZZIA 1LFWA 2R8VA 2BL1A 2KCWA 1XEBA 3TOAA 1CG2A 3WC7A 2OLSA 2ZEMA 3T5MA 3VRRA 1R57A 1ZG7A 4R9MA 4JVOA 3HMJG 3SR3A 4J3GA 4OC5A 4CRYB 1LRZA 4OIWA 2Z3NA 4BPWB 1YX0A 2UV8G 2Q43A 1KEEB 4KOTA 1XF1A 3F8KA 1EE3P 2I79A 1IIDA 3VARA 4CS0B 3VTAA 3H5ZA 2BUEA 2JLMA 2Q7SA 3LODA 3KGQA 4H2KA 3QB8A 3PP9A 3G23A 4C99A 1SQHA 2CY2A 4P45A 1S7FA 4IF5A 1I1DA 5HVHA 4P4BA 4XPKA 3S6HA 2GP4A 2B58A 1ZRSA 3TO9A 3BHXA 2CNTA 2YNEA 3IEHA 2QYVA 1TXRA 3JUWA 3VGOA 3VWEA 1WK4A 2IMOA 3B3WA 4IAVA 4CGMA 3KHXA 1ZYMA 4KLVA 5K8NA 4CAWA 3S9NA 4OIDA 1Y0YA 4A33A 4CYOA 5ISVA 4CGOA 4E5SA 5GCNA 4BMHA 3KR4A 1MJAA 3I9SA 1DTDA 1FNOA 4XPLA 2DLAA 4JYWA 4PXDA 3SXNA 4E0AA 1ZL0A 1QMUA 4QBJA 1PU9A 1OZPA 3TX8A 2AJ6A 2R98A 4F6AA 2ANPA 1JDBC 3SJGA 2GLJA 2QECA 3B3VA 3IGRA 2VEZA 1YGHA 1Z9UA 3B2YA 2GANA 5HKYA 4BPUB 2AFWA 4HNXB 3D66A 3R9FA 4B10A 2ZEDA 4YWYA 4UF4A 2V8GA 2VI7A 1QSOA 4B11A 3WC5A 2ZOFA 4MHNA 4Q36A 2XEFA 1VHEA 1XJOA 5LYDA 2PJ8A 2ZEEA 1EZBA 1C30B 2FIAA 3NH8A 4XNHC 3W6XA 4MMOA 4PXEA 3FRMA 2ZELA 4KLWA 3D7HA 3HPGG 4P6YA 1QSTA 2CTCA 3R9GA 1CS0B 4CAFA 3CXPA 5D8NA 3EZAA 4KOWA 1CPXA 4MCPA 2PJCA 2Y0MA 3B3CA 5F1YA 2ARHA 3TTHA 2Y1MA 2VKZG 1IOIA 3C26A 4R3KA 2EK8A 3KQZA 2C6CA 4MCQA 3NA6A 4HNYB 4KVOE 4QB9A 2FSRA 5ELYA 3ZNIA 1TKJA 2AFMA 2PJAA 4KUAA 4PSWA 4B13A 1RTQA 5AG4A 4JJXA 1S60A 4BINA 2MP0A 5I4MA 4C8AA 3EZEA 3EFAA 1Q5XA 2VQYA 3BUWB 1R3NA 1M44A 4MI4A 4CRZB 1MK4A 2HV2A 4JZ0A 4PXBA 3B3TA 3FXTA 4NJQA 3FECA 3IWGA 1HEEA 4X8IA 5AGEA 4B5OA 1XE4A 4TJXA 5HH1A 4OC4A 2EVNA 2O53A 4COGA 2REEA 1XRYA 3UY5A 1LOKA 3GYAA 1CPSA 2PE3A 6CPAA 4H1HA 3IC1A 1P4NA 4MXUA 4UEEA 2B4JC 4G1PA 3FMCA 4ZY2A 1NSLA 3WR7A 5LYFA 1GYTA 3WT4A 3P2FA 4Y49B 3DR6A 4U5YA 1YK3A 3ZJ0A 3WC6A 4I49A 4C8PA 3PFOA 4M3SA 3RBUA 1IYLA 2B4BA 2JDCA 4NGRA 4PK3A 4AXVA 2PCNA 2HQYA 4LQ6A 2RFHA 4B6ZA 2Q04A 3KHZA 2D0PA 3SJEA 4KNGE 3IWEA 3RO0A 3TLBA 2PJ3A 3IIBA 3OWCA 4GM5A 4RN7A 4L89A 3G8WA 3RYOA 4MJ8A 4ONUA 2DPSA 3KL9A 1ELMP 5EC4A 2AFSA 4L8AA 4CZ1A 1S7NA 3BI1A 5H84A 4FD4A 3B3SA 4F9UA 2E28A 1X10A 2AFZA 4IHMA 4ONWA 2YNDA 4M6HA 3PB9X 8CPAA 2D0OA 4PQAA 1J4JA 4C86A 1Z2LA 3H8FA 1V0CA 4QC6A 3JVNA 3I74A 3K2KA 1IGBA 2O4HA 4MFKA 4X3RA 2K5TA 3FH4A 3KI9A 4FD7A 4EFDA 2X7BA 2JBKA 4UFVA 1IOFA 4YGOA 4OC2A 3RAMA 4WJBA 5HKWA 2EWBA 2ODFA 1P0HA 4ORFA 4B14A 3PEIA 3OP0A 5CPAA 3FEDA 5J8CA 1DIKA 3PFEA 2POKA 2V8DA 2I3CA 3DNSA 3TLZA 1KUYA 3VRQA 1XFOA 2X0SA 2D4PA 3NE8A 4ZGYB 5C88A 2JEWA 1IICA 2G0BA 4HKFA 3TYXA 2VZYA 1CX8A 3K9TA 2GLFA 4P4IA 3DR8A 3U88C 3WABA 1JWQA 3PZJA 4A2ZA 3HPHE 2AFXA 2REFA 3S6GA 1HDUA 4AVCA 4MHDA 4W9YA 2HUZA 3EC4A 1TF9A 2FE7A 2CNMA 2J9AA 4KOSA 4B5PB 2R1IA 1F2PA 2FS5A 3IU2A 3QNVA 4O23A 3PFVA 1AMPA 2VBQA 4KSFA 2BOAA 4CYPA 4TNUA 1TKHA 3E0KA 1S7LA 5IR2A 2FIWA 2C6GA 2ZXVA 2Z3KA 1MJBA 3TOBA 4NEXA 5EMIA 1HDQA 1XF8A 2IJZA 3B8GA 3T8WA 4RS2A 2C6PA 3DGVA 4Q7AA 1RXTA 1Z9EA 4MY3A 5HMNA 4C8TA 1CP7A 1YREA 4PSXA 4XPDB 3VRNA 1I21A 3EZBA 2B0AA 4C9VA 3FYNA 3H8EA 3F9KC 2PJ4A 4U9ZA 4BD9A 2ZW7A 1UFHA 3SXOA 1X12A 1BO4A
chains in the Genus database with same CATH topology
2G9DA 4KSIA 2NYQA 3FF3A 2V8HA 5LRKA 5F09A 1BPNA 1UWYA 1OBRA 4A37A 2ZEPA 1CBXA 2PRQA 4P4DA 4ZY1A 2ZENA 3NFZA 4EMEA 2C5QA 3HLPA 4OC1A 2GU2A 2CIJA 4R76A 1Y7EA 4NGTA 4CPAA 4MHYA 1R43A 3D4UA 4EWTA 1DE4C 3S9LA 2AFUA 3NH5A 2PJ1A 4FUUA 3KZWA 2VL1A 2ZOGA 1Z8LA 3CDXA 4UIAA 3SJFA 3IWWA 3H8GA 3PB7X 1YLOA 4A38A 4LQGA 4TJVA 2ABZA 1KWMA 1YW4A 2PIZA 4IK2A 1JQGA 5K8OA 1ZG8A 1FT7A 3PB4X 2BO9A 4UEFA 3B35A 4A39A 1BLLE 4MHPA 4OP4A 1PYTB 3D68A 2PVWA 5D29A 3GUXA 2XEGA 3V38A 1Y0RA 4YU9A 4C8CA 1ZG9A 5LYLA 4OKOA 3V7ZA 1WVMA 4MRIA 2DEAA 3GB0A 3FVLA 2OOTA 1AYEA 4UIBA 1VGYA 1BPMA 2V77A 3CT9A 4A94A 5K8MA 4CDKA 1TF8A 4OMEA 4TWEA 5HVFA 5LYIA 2WZNA 3SI2A 4ZY0A 2Q51A 5DS0A 2PJ6A 4FWUA 4ZX9A 2PCUA 2OR4A 5JM6A 2HB6A 1CP6A 2JBJA 2PIYA 3S9MA 4P10A 2WYRA 1PCAA 4R6TA 4OC3A 2IQ6A 1IY7A 5JGFA 4FAIA 1YW6A 1ELLP 4PXCA 4OC0A 3PRTA 4ZX8A 3D7FA 3B7IA 3ISXA 3L2NA 2QVPA 4ZI6A 3LWUA 2V8VA 4NFRA 1TKFA 4F9VA 4C8UA 2RB7A 2PJ0A 3FEEA 3D67A 3PB8X 4MHZA 4NGPA 2HC9A 2Q4ZA 1XBUA 4MCSA 1VIXA 2QJ8A 3PB6X 3RZAA 3I6SA 3FX6A 3PBBA 2BCOA 3MRUA 4C9RA 2F8HA 3N5FA 4C9EA 3DLJA 4PPZA 2PJ9A 4C9UA 4NGMA 4R8FA 1F57A 3SI0A 4WWVA 2NSMA 3ICUA 4X2TA 3IFEA 1Z5RA 3BI0A 3HUVA 5JH9A 3SI1A 3SJXA 2F7VA 2PJ2A 1ARLA 2CF4A 3PBEA 1ZLIA 4K3NA 5K8PA 1Q7LA 4P44A 4F8ZA 4P4EA 3KASA 1LAMA 3IO1A 4C85A 2XEIA 2PJ7A 1V6CA 3IJ3A 4DJLA 2PJBA 1ZLHA 4NGNA 3CPXA 3D7GA 3I1UA 4ZYQA 2FVGA 4UEZA 3FJUA 2ZEOA 4R7MA 4FBEA 1LAPA 2ZEHA 1YSJA 1XF1A 1H8LA 2EK9A 5THWA 3LMSA 5HVGA 1F2OA 5J1QA 5CBMA 4NJRA 3JRUA 3KQXA 3GLJA 1NSAA 5HXDA 3TC8A 1QQ9A 3D7DA 4P4FA 5IB9A 1ARMA 4DYOA 1M4LA 7CPAA 3NH4A 2C1CA 1XMBA 3MN8A 2AFOA 4C9AA 4C8FA 5LRJA 2CTBA 1Y9ZA 2PVVA 3KR5A 5LRGA 4Z65A 3EIFA 1LCPA 2XEJA 4P4JA 4NGQA 3VATA 4MCRA 1BAVA 2ZEFA 3BXMA 1YMEA 2GREA 3ISZA 4DUKA 3CPAA 3VH9A 1VHOA 2PJ5A 4RUHA 2ZEGA 1LANA 4NGSA 1LFWA 1CG2A 3WC7A 2ZEMA 1ZG7A 4OC5A 4OIWA 2Q43A 1EE3P 3VARA 3VTAA 4H2KA 3KGQA 4C99A 4P45A 5HVHA 4P4BA 2GP4A 3BHXA 3IEHA 2QYVA 1TXRA 2IMOA 3B3WA 4IAVA 3KHXA 5K8NA 3S9NA 4OIDA 1Y0YA 3KR4A 1DTDA 1FNOA 4JYWA 4PXDA 1QMUA 3TX8A 2ANPA 3SJGA 2GLJA 3B3VA 3B2YA 2AFWA 3D66A 2ZEDA 4YWYA 4UF4A 2V8GA 3WC5A 2ZOFA 4MHNA 2XEFA 1VHEA 1XJOA 5LYDA 2PJ8A 2ZEEA 3NH8A 4MMOA 4PXEA 4P6YA 2ZELA 3D7HA 2CTCA 5D8NA 1CPXA 4MCPA 2PJCA 3B3CA 2EK8A 3KQZA 2C6CA 4MCQA 3NA6A 4CDJA 5ELYA 1TKJA 2AFMA 2PJAA 1RTQA 5I4MA 4C8AA 1R3NA 4JZ0A 4PXBA 3B3TA 4NJQA 3FECA 1HEEA 4X8IA 4TJXA 4OC4A 2O53A 1XRYA 1LOKA 1CPSA 2PE3A 6CPAA 3IC1A 4MXUA 4UEEA 4G1PA 3FMCA 4ZY2A 5LYFA 1GYTA 3WT4A 4C8PA 3PFOA 3RBUA 4NGRA 4AXVA 2RFHA 4B6ZA 3KHZA 3SJEA 4KNGE 2PJ3A 3IIBA 4GM5A 3KL9A 1ELMP 2AFSA 3BI1A 3B3SA 4F9UA 2AFZA 4IHMA 4ONWA 3PB9X 8CPAA 4PQAA 4C86A 1Z2LA 3H8FA 3I74A 3K2KA 1IGBA 2O4HA 4X3RA 3KI9A 3FH4A 4EFDA 2JBKA 3RAMA 4OC2A 4WJBA 2EWBA 3PEIA 5CPAA 3FEDA 3PFEA 2POKA 2V8DA 2I3CA 1XFOA 2JEWA 1CX8A 3K9TA 2GLFA 4P4IA 3WABA 2AFXA 1HDUA 4W9YA 1TF9A 2J9AA 1F2PA 3QNVA 4O23A 1AMPA 2BOAA 4TNUA 1TKHA 5IR2A 2C6GA 4C8TA 3WC6A 1HDQA 2IJZA 3T8WA 4YN3A 4C84A 2C6PA 3DGVA 4Q7AA 1CP7A 4C9VA 3H8EA 2PJ4A 4BD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G9D A;  4KSI A;  2NYQ A;  3FF3 A;  2V8H A;  5LRK A;  5F09 A;  1BPN A;  1UWY A;  1OBR A;  4A37 A;  2ZEP A;  1CBX A;  2PRQ A;  4P4D A;  4ZY1 A;  2ZEN A;  3NFZ A;  4EME A;  3HLP A;  4OC1 A;  2GU2 A;  2CIJ A;  4R76 A;  1Y7E A;  4NGT A;  4CPA A;  4MHY A;  1R43 A;  3D4U A;  4EWT A;  1DE4 C;  3S9L A;  2AFU A;  3NH5 A;  2PJ1 A;  4FUU A;  3KZW A;  2VL1 A;  2ZOG A;  1Z8L A;  3CDX A;  4UIA A;  3SJF A;  3IWW A;  3H8G A;  3PB7 X;  1YLO A;  4A38 A;  4LQG A;  4TJV A;  2ABZ A;  1KWM A;  1YW4 A;  2PIZ A;  4IK2 A;  1JQG A;  5K8O A;  1ZG8 A;  1FT7 A;  3PB4 X;  2BO9 A;  4UEF A;  3B35 A;  4A39 A;  1BLL E;  4MHP A;  4OP4 A;  1PYT B;  3D68 A;  2PVW A;  5D29 A;  3GUX A;  2XEG A;  3V38 A;  1Y0R A;  4YU9 A;  4C8C A;  1ZG9 A;  5LYL A;  4OKO A;  3V7Z A;  1WVM A;  4MRI A;  2DEA A;  3GB0 A;  3FVL A;  2OOT A;  1AYE A;  4UIB A;  1VGY A;  1BPM A;  2V77 A;  3CT9 A;  4A94 A;  5K8M A;  4CDK A;  1TF8 A;  4OME A;  4TWE A;  5HVF A;  5LYI A;  2WZN A;  3SI2 A;  4ZY0 A;  2Q51 A;  5DS0 A;  2PJ6 A;  4FWU A;  4ZX9 A;  2PCU A;  2OR4 A;  5JM6 A;  2HB6 A;  1CP6 A;  2JBJ A;  2PIY A;  3S9M A;  4P10 A;  2WYR A;  1PCA A;  4R6T A;  4OC3 A;  2IQ6 A;  1IY7 A;  5JGF A;  4FAI A;  1YW6 A;  1ELL P;  4PXC A;  4OC0 A;  3PRT A;  4ZX8 A;  3D7F A;  3B7I A;  3ISX A;  3L2N A;  2QVP A;  4ZI6 A;  3LWU A;  2V8V A;  4NFR A;  1TKF A;  4F9V A;  4C8U A;  2RB7 A;  2PJ0 A;  3FEE A;  3D67 A;  3PB8 X;  4MHZ A;  4NGP A;  2HC9 A;  2Q4Z A;  1XBU A;  4MCS A;  1VIX A;  2QJ8 A;  3PB6 X;  3RZA A;  3I6S A;  3FX6 A;  3PBB A;  2BCO A;  3MRU A;  4C9R A;  2F8H A;  3N5F A;  4C9E A;  3DLJ A;  4PPZ A;  2PJ9 A;  4C9U A;  4NGM A;  4R8F A;  1F57 A;  3SI0 A;  4WWV A;  2NSM A;  3ICU A;  4X2T A;  3IFE A;  1Z5R A;  3BI0 A;  3HUV A;  5JH9 A;  3SI1 A;  3SJX A;  2F7V A;  2PJ2 A;  1ARL A;  2CF4 A;  3PBE A;  1ZLI A;  4K3N A;  5K8P A;  1Q7L A;  4P44 A;  4F8Z A;  4P4E A;  3KAS A;  1LAM A;  3IO1 A;  4C85 A;  2XEI A;  2PJ7 A;  1V6C A;  3IJ3 A;  4DJL A;  2PJB A;  1ZLH A;  4NGN A;  3CPX A;  3D7G A;  3I1U A;  4ZYQ A;  2FVG A;  4UEZ A;  3FJU A;  2ZEO A;  4R7M A;  4FBE A;  1LAP A;  2ZEH A;  1YSJ A;  1XF1 A;  1H8L A;  2EK9 A;  5THW A;  3LMS A;  5HVG A;  1F2O A;  5J1Q A;  5CBM A;  4NJR A;  3JRU A;  3KQX A;  3GLJ A;  1NSA A;  5HXD A;  3TC8 A;  1QQ9 A;  3D7D A;  4P4F A;  5IB9 A;  1ARM A;  4DYO A;  1M4L A;  7CPA A;  3NH4 A;  2C1C A;  1XMB A;  3MN8 A;  2AFO A;  4C9A A;  4C8F A;  5LRJ A;  2CTB A;  1Y9Z A;  2PVV A;  3KR5 A;  5LRG A;  4Z65 A;  3EIF A;  1LCP A;  2XEJ A;  4P4J A;  4NGQ A;  3VAT A;  4MCR A;  1BAV A;  2ZEF A;  3BXM A;  1YME A;  2GRE A;  3ISZ A;  4DUK A;  3CPA A;  3VH9 A;  1VHO A;  2PJ5 A;  4RUH A;  2ZEG A;  1LAN A;  4NGS A;  1LFW A;  1CG2 A;  3WC7 A;  2ZEM A;  1ZG7 A;  4OC5 A;  4OIW A;  2Q43 A;  1EE3 P;  3VAR A;  3VTA A;  4H2K A;  3KGQ A;  4C99 A;  4P45 A;  5HVH A;  4P4B A;  3BHX A;  3IEH A;  2QYV A;  1TXR A;  2IMO A;  3B3W A;  4IAV A;  3KHX A;  5K8N A;  3S9N A;  4OID A;  1Y0Y A;  3KR4 A;  1DTD A;  1FNO A;  4JYW A;  4PXD A;  1QMU A;  3TX8 A;  2ANP A;  3SJG A;  2GLJ A;  3B3V A;  3B2Y A;  2AFW A;  3D66 A;  2ZED A;  4YWY A;  4UF4 A;  2V8G A;  3WC5 A;  2ZOF A;  4MHN A;  2XEF A;  1VHE A;  1XJO A;  5LYD A;  2PJ8 A;  2ZEE A;  3NH8 A;  4MMO A;  4PXE A;  4P6Y A;  2ZEL A;  3D7H A;  2CTC A;  5D8N A;  1CPX A;  4MCP A;  2PJC A;  3B3C A;  2EK8 A;  3KQZ A;  2C6C A;  4MCQ A;  3NA6 A;  4CDJ A;  5ELY A;  1TKJ A;  2AFM A;  2PJA A;  1RTQ A;  5I4M A;  4C8A A;  1R3N A;  4JZ0 A;  4PXB A;  3B3T A;  4NJQ A;  3FEC A;  1HEE A;  4X8I A;  4TJX A;  4OC4 A;  2O53 A;  1XRY A;  1LOK A;  1CPS A;  2PE3 A;  6CPA A;  3IC1 A;  4MXU A;  4UEE A;  4G1P A;  3FMC A;  4ZY2 A;  5LYF A;  1GYT A;  3WT4 A;  4C8P A;  3PFO A;  3RBU A;  4NGR A;  4AXV A;  2RFH A;  4B6Z A;  3KHZ A;  3SJE A;  4KNG E;  2PJ3 A;  3IIB A;  4GM5 A;  3KL9 A;  1ELM P;  2AFS A;  3BI1 A;  3B3S A;  4F9U A;  2AFZ A;  4IHM A;  4ONW A;  3PB9 X;  8CPA A;  4PQA A;  4C86 A;  1Z2L A;  3H8F A;  3I74 A;  3K2K A;  1IGB A;  2O4H A;  4X3R A;  3KI9 A;  3FH4 A;  4EFD A;  2JBK A;  3RAM A;  4OC2 A;  4WJB A;  2EWB A;  3PEI A;  5CPA A;  3FED A;  3PFE A;  2POK A;  2V8D A;  2I3C A;  1XFO A;  2JEW A;  1CX8 A;  3K9T A;  2GLF A;  4P4I A;  3WAB A;  2AFX A;  1HDU A;  4W9Y A;  1TF9 A;  2J9A A;  1F2P A;  3QNV A;  4O23 A;  1AMP A;  2BOA A;  4TNU A;  1TKH A;  2C6G A;  4C8T A;  3WC6 A;  1HDQ A;  2IJZ A;  3T8W A;  4YN3 A;  4C84 A;  2C6P A;  3DGV A;  4Q7A A;  1CP7 A;  4C9V A;  3H8E A;  2PJ4 A;  4BD9 A; 
#chains in the Genus database with same CATH topology
 3OAK A;  4JD6 A;  2G9D A;  4FD5 A;  4KSI A;  4B5P A;  4H6Z A;  2NYQ A;  3FF3 A;  2V8H A;  3GY9 A;  5LRK A;  4C84 A;  2CBL A;  2Q4Y A;  3VWD A;  4PV6 A;  5F09 A;  1BPN A;  1UWY A;  4C68 A;  1VI4 A;  4KOU A;  1OBR A;  2EUI A;  4A37 A;  1JDE A;  2HI6 A;  3VRO A;  4AVB A;  2ZEP A;  4IIY A;  1CBX A;  1K4J A;  2PRQ A;  4P4D A;  4ZY1 A;  1J3L A;  2ZEN A;  3T07 A;  3NFZ A;  1WJT A;  4EME A;  1B6B A;  3MGD A;  3R1K A;  2C5Q A;  4EYS A;  1KC7 A;  4NF1 A;  5J3X A;  2EO8 A;  3HLP A;  4KS9 A;  4OC1 A;  2GU2 A;  4E2A A;  2CIJ A;  4R76 A;  1Y7E A;  4NGT A;  4CPA A;  4MHY A;  1R43 A;  4NCZ A;  3T05 A;  3D4U A;  4Q38 A;  5I0C A;  3R95 A;  5K99 A;  4BPX B;  3LD2 A;  4M6I A;  4EWT A;  4MFZ A;  3S6F A;  3LAC A;  1KZF A;  5KTD A;  2R82 A;  5FVJ A;  2PSW A;  2EZC A;  1DE4 C;  2NMT A;  3EO4 A;  3RNZ A;  3S9L A;  4RI1 A;  3PGP A;  2AFU A;  1FBV A;  2PQ8 A;  3I3G A;  2PJ1 A;  3NH5 A;  3KZW A;  4FUU A;  1Y9W A;  4JXQ A;  5AG6 A;  2XPN A;  4K30 A;  1VBG A;  1YVO A;  3TE4 A;  2VL1 A;  1ON0 A;  2ZOG A;  4A30 A;  1Z8L A;  5F13 A;  3CDX A;  3QAH A;  2WPW A;  4HPS A;  4UIA A;  3TLA A;  3TLC A;  3SJF A;  4C7H A;  1Z8T A;  1M6V B;  3IWW A;  1TIQ A;  3GIU A;  3H8G A;  5FD8 A;  3PB7 X;  4MFQ A;  1YLO A;  2PC1 A;  4A38 A;  3BJ7 A;  2GFQ A;  4LQG A;  4II9 A;  3BUM B;  4TJV A;  2ABZ A;  1KWM A;  1YW4 A;  2PIZ A;  4IK2 A;  5KTA A;  2DXQ A;  1JQG A;  4KVM E;  5K8O A;  1IB1 E;  1ZG8 A;  1FT7 A;  2BEI A;  3PB4 X;  3C8O A;  1BOB A;  2BO9 A;  4CDJ A;  4MI1 A;  3FB3 A;  4M8D A;  2R7H A;  4UEF A;  4IIX A;  3K4I A;  3B35 A;  4MY0 A;  4A39 A;  5F46 A;  2Q4V A;  4MFL A;  1BLL E;  4KVX A;  4MHP A;  4OP4 A;  1GGO A;  1PYT B;  3D68 A;  2B4D B;  3OB2 B;  5AXI A;  2PVW A;  2B3V A;  5D29 A;  3GUX A;  1Z4R A;  4UCM A;  4FD6 A;  2YGW A;  1CE8 B;  2VZZ A;  2XEG A;  2BSW A;  2QML A;  2Z3O A;  3V38 A;  4YFJ A;  5A28 A;  4R3L A;  2YJV A;  2OH1 A;  1Z4E A;  3DSB A;  1Y0R A;  4UCP A;  3TFY A;  4YU9 A;  4C8C A;  5JVL A;  1ZG9 A;  5LYL A;  4OKO A;  1RO5 A;  4A95 A;  1CJW A;  3V7Z A;  1WVM A;  3SHP A;  3S6K A;  1B47 A;  3R96 A;  4OAE A;  4X5K A;  2G3A A;  4MRI A;  2DEA A;  2FL4 A;  3GB0 A;  1GHE A;  1A2Z A;  3FVL A;  2OOT A;  3KKW A;  4RR2 B;  1PUA A;  1AYE A;  4UIB A;  4UWJ A;  3T90 A;  1VGY A;  1BPM A;  2F5I A;  2JEV A;  2V77 A;  3CT9 A;  4A94 A;  1L0C A;  4E8O A;  5K8M A;  4CDK A;  3T0T A;  1TF8 A;  4OME A;  3D2P A;  4TWE A;  5HVF A;  5LYI A;  2WZN A;  5AG7 A;  3SI2 A;  4KOX A;  2B4D A;  5G21 A;  2Q51 A;  4ZY0 A;  2HRO A;  5DS0 A;  4KOY A;  5IX3 A;  1U6M A;  1ZO0 A;  4UCN A;  2PJ6 A;  4FWU A;  4ZX9 A;  3TT2 A;  3D8P A;  1M4D A;  2PCU A;  3FIX A;  2OR4 A;  1IU8 A;  5JM6 A;  2HB6 A;  1CP6 A;  2ZW4 A;  2JBJ A;  2PIY A;  3DDD A;  3S9M A;  4P10 A;  2XPO A;  4YRH A;  2WYR A;  1CM0 A;  3D3S A;  4UFW A;  2WUU A;  4XNH B;  1PCA A;  4R6T A;  2OB0 A;  3N7Z A;  4OC3 A;  3BLN A;  4A31 A;  4KZT A;  2IQ6 A;  4UFX A;  1IY7 A;  5JGF A;  4FAI A;  2WPX A;  1YW6 A;  5G1Z A;  4HNW B;  4CAX A;  5JPH A;  3BUX B;  2AUM A;  1ELL P;  4PXC A;  4OC0 A;  3PRT A;  4ZX8 A;  2PDO A;  4M6G A;  3D7F A;  3B7I A;  4IUS A;  4GPL B;  4CYN A;  2VXK A;  1AUG A;  1Z8X A;  1Q2C A;  4AG7 A;  3ISX A;  3L2N A;  2I00 A;  2QVP A;  4ZI6 A;  3LWU A;  2V8V A;  4NFR A;  1TKF A;  2CXA A;  2PR1 A;  2FXF A;  4R57 A;  4F9V A;  5H86 A;  1QSN A;  1QSR A;  2GE3 A;  2Z0Z A;  4C8U A;  4INJ A;  5F5X A;  2ZW6 A;  3O8Z A;  2PRB A;  2RB7 A;  1KBL A;  2PJ0 A;  4KSA A;  3W91 A;  5A27 A;  2C27 A;  3CXQ A;  4Y49 C;  5F9M A;  1M1D A;  4B12 A;  4KUB A;  5DWN A;  4MFP A;  1YQE A;  2Z10 A;  4BBH A;  3W6S A;  3FEE A;  5J8F A;  3D67 A;  4CGP A;  3PB8 X;  4MHZ A;  4NGP A;  1EZA A;  2HC9 A;  2Q4Z A;  2N3A B;  1XBU A;  4MCS A;  4J0N A;  1VIX A;  5JYB A;  5G20 A;  2QJ8 A;  1T36 B;  4R87 A;  4A4C A;  3PB6 X;  3RZA A;  2OZH A;  2J8M A;  3FX6 A;  3K9U A;  2QIR A;  3I6S A;  3OB1 B;  2DPT A;  3JTK A;  3PBB A;  2BCO A;  4UWI A;  3MRU A;  3F0A A;  4C2Y A;  4C9R A;  1XIX A;  2F8H A;  1Z8W A;  3N5F A;  4MBU A;  4C9E A;  3DLJ A;  4PPZ A;  2PJ9 A;  4C9U A;  1A9X B;  4NGM A;  2Z11 A;  3NE7 A;  2OU2 A;  3A9L A;  1F57 A;  4R8F A;  4A32 A;  3SI0 A;  5C82 A;  3U1B A;  1FY7 A;  3TCV A;  4WWV A;  3PT1 A;  3KRV A;  1S7K A;  2NSM A;  3GKR A;  3H4Q A;  3ICU A;  4X2T A;  3IFE A;  1B87 A;  2YNC A;  3CXS A;  1Z5R A;  5F47 A;  4AG9 A;  3BI0 A;  3HUV A;  4GS4 A;  2DIK A;  1NE9 A;  2OZG A;  5JH9 A;  4YN3 A;  2Y1N A;  3SI1 A;  4UBR A;  2J8R A;  2PR8 A;  4H89 A;  3SJX A;  4MFJ A;  2F7V A;  4JXR A;  4CGN A;  4C2X A;  2H5M A;  2PJ2 A;  2ATR A;  1MJ9 A;  1ARL A;  2CF4 A;  3CZX A;  3TLY A;  2ZW5 A;  3PBE A;  1R61 A;  5E96 A;  1M4G A;  1ZLI A;  1NMT A;  4U9Y A;  2WSA A;  4K3N A;  1Q7L A;  5BWA B;  5K8P A;  3GJZ A;  1KUV A;  3PLF B;  4ZBG A;  1WWZ A;  2OZU A;  4AB7 A;  3VRP A;  2P6F A;  2Z3P A;  4CO9 A;  4P44 A;  2FT0 A;  1VKC A;  4P4E A;  4OLL A;  4F8Z A;  4JWP A;  3KAS A;  3TO7 A;  5KTC A;  3BJ8 A;  1NXJ A;  3T9Y A;  1NBW A;  2B3U A;  1LAM A;  3IO1 A;  4C85 A;  2XEI A;  3NOJ A;  2PJ7 A;  2AUN A;  5HKZ A;  4LX9 A;  4H6U A;  1V6C A;  3IJ3 A;  3EXN A;  2A4N A;  4DJL A;  2PJB A;  1ZLH A;  2GIV A;  4NGN A;  3G3S A;  4XPD C;  2Q7B A;  4CGL A;  5IB0 A;  3CPX A;  3D7G A;  1KUX A;  2Z3M A;  3I1U A;  2XPL A;  4ZYQ A;  2FVG A;  2IL4 A;  4UEZ A;  5G22 A;  3FJU A;  4LUA A;  2ZEO A;  4R7M A;  5BY0 A;  3EY5 A;  5DWM A;  4FBE A;  2P0W A;  1YVH A;  1YVK A;  1LAP A;  4DNC A;  2ZEH A;  1YR0 A;  2DF5 A;  4E94 A;  1EO0 A;  1Y7R A;  1N71 A;  1YSJ A;  2FCK A;  2O28 A;  2YNC C;  3FBU A;  3BUO B;  2P6G A;  4KOV A;  4PK2 A;  4AVA A;  5IV0 A;  1H8L A;  2EK9 A;  2ZPA A;  5THW A;  3LMS A;  5HVG A;  1F2O A;  2B5G B;  1YLE A;  1VBH A;  2JDD A;  4MJX A;  3F5B A;  5J1Q A;  4M85 A;  4NSQ A;  4UA3 A;  2P6E A;  4CAV A;  1I12 A;  4NJR A;  3JRU A;  2Q0Y A;  3D2M A;  5CBM A;  2EZB A;  3KQX A;  1XMT A;  4COB A;  2CNS A;  3GLJ A;  1NSA A;  5EBV A;  2G3T A;  5HXD A;  1Y9K A;  3TC8 A;  1QQ9 A;  3D7D A;  4P4F A;  4GXH A;  4BTF A;  5IB9 A;  4C2Z A;  2HWG A;  1ARM A;  3TLG B;  4JLY A;  4DYO A;  3BUN B;  1M4L A;  3R9E A;  7CPA A;  3NH4 A;  5AG5 A;  2C1C A;  2AE6 A;  4QVT A;  4EVY A;  1XMB A;  2YJT A;  3MN8 A;  1VHS A;  2AFO A;  4C7I A;  1BXR B;  4C9A A;  5F49 A;  5LRJ A;  4NXY A;  4C8F A;  3TLE A;  2CTB A;  1Y9Z A;  2PVV A;  4A4B A;  3KR5 A;  1XOV A;  4F0X A;  2B5G A;  4KOR A;  5LRG A;  3IU1 A;  3P2H A;  3V8I A;  1LCP A;  2EBJ A;  4Z65 A;  3EIF A;  2XEJ A;  4P4J A;  2J8N A;  4NGQ A;  2EZA A;  4QUS A;  3VAT A;  4MCR A;  3QAY A;  3TO6 A;  5JQ4 A;  1BAV A;  2ZEF A;  1Q2D A;  5CNP A;  3BXM A;  1M4I A;  2XPP A;  4CYQ A;  4F0Y A;  2FM4 A;  1YME A;  5F48 A;  1QSM A;  3FNC A;  2RC4 A;  3TLG A;  1C3O B;  2GRE A;  3ISZ A;  2Q44 A;  4OAD A;  3NFQ A;  1S3Z A;  3CPA A;  4DUK A;  1Q2Y A;  3VH9 A;  1S5K A;  4CAE A;  1VHO A;  2D4O A;  2PJ5 A;  2Z3L A;  1IYK A;  1LAN A;  2ZEG A;  4RUH A;  4NGS A;  3ZZI A;  1LFW A;  2R8V A;  2BL1 A;  2KCW A;  1XEB A;  3TOA A;  1CG2 A;  3WC7 A;  2OLS A;  2ZEM A;  3T5M A;  3VRR A;  1R57 A;  1ZG7 A;  4R9M A;  4JVO A;  3HMJ G;  3SR3 A;  4J3G A;  4OC5 A;  4CRY B;  1LRZ A;  4OIW A;  2Z3N A;  4BPW B;  1YX0 A;  2UV8 G;  2Q43 A;  1KEE B;  4KOT A;  1XF1 A;  3F8K A;  1EE3 P;  2I79 A;  1IID A;  3VAR A;  4CS0 B;  3VTA A;  3H5Z A;  2BUE A;  2JLM A;  2Q7S A;  3LOD A;  3KGQ A;  4H2K A;  3QB8 A;  3PP9 A;  3G23 A;  4C99 A;  1SQH A;  2CY2 A;  4P45 A;  1S7F A;  4IF5 A;  1I1D A;  5HVH A;  4P4B A;  4XPK A;  3S6H A;  2GP4 A;  2B58 A;  1ZRS A;  3TO9 A;  3BHX A;  2CNT A;  2YNE A;  3IEH A;  2QYV A;  1TXR A;  3JUW A;  3VGO A;  3VWE A;  1WK4 A;  2IMO A;  3B3W A;  4IAV A;  4CGM A;  3KHX A;  1ZYM A;  4KLV A;  5K8N A;  4CAW A;  3S9N A;  4OID A;  1Y0Y A;  4A33 A;  4CYO A;  5ISV A;  4CGO A;  4E5S A;  5GCN A;  4BMH A;  3KR4 A;  1MJA A;  3I9S A;  1DTD A;  1FNO A;  4XPL A;  2DLA A;  4JYW A;  4PXD A;  3SXN A;  4E0A A;  1ZL0 A;  1QMU A;  4QBJ A;  1PU9 A;  1OZP A;  3TX8 A;  2AJ6 A;  2R98 A;  4F6A A;  2ANP A;  1JDB C;  3SJG A;  2GLJ A;  2QEC A;  3B3V A;  3IGR A;  2VEZ A;  1YGH A;  1Z9U A;  3B2Y A;  2GAN A;  5HKY A;  4BPU B;  2AFW A;  4HNX B;  3D66 A;  3R9F A;  4B10 A;  2ZED A;  4YWY A;  4UF4 A;  2V8G A;  2VI7 A;  1QSO A;  4B11 A;  3WC5 A;  2ZOF A;  4MHN A;  4Q36 A;  2XEF A;  1VHE A;  1XJO A;  5LYD A;  2PJ8 A;  2ZEE A;  1EZB A;  1C30 B;  2FIA A;  3NH8 A;  4XNH C;  3W6X A;  4MMO A;  4PXE A;  3FRM A;  2ZEL A;  4KLW A;  3D7H A;  3HPG G;  4P6Y A;  1QST A;  2CTC A;  3R9G A;  1CS0 B;  4CAF A;  3CXP A;  5D8N A;  3EZA A;  4KOW A;  1CPX A;  4MCP A;  2PJC A;  2Y0M A;  3B3C A;  5F1Y A;  2ARH A;  3TTH A;  2Y1M A;  2VKZ G;  1IOI A;  3C26 A;  4R3K A;  2EK8 A;  3KQZ A;  2C6C A;  4MCQ A;  3NA6 A;  4HNY B;  4KVO E;  4QB9 A;  2FSR A;  5ELY A;  3ZNI A;  1TKJ A;  2AFM A;  2PJA A;  4KUA A;  4PSW A;  4B13 A;  1RTQ A;  5AG4 A;  4JJX A;  1S60 A;  4BIN A;  2MP0 A;  5I4M A;  4C8A A;  3EZE A;  3EFA A;  1Q5X A;  2VQY A;  3BUW B;  1R3N A;  1M44 A;  4MI4 A;  4CRZ B;  1MK4 A;  2HV2 A;  4JZ0 A;  4PXB A;  3B3T A;  3FXT A;  4NJQ A;  3FEC A;  3IWG A;  1HEE A;  4X8I A;  5AGE A;  4B5O A;  1XE4 A;  4TJX A;  5HH1 A;  4OC4 A;  2EVN A;  2O53 A;  4COG A;  2REE A;  1XRY A;  3UY5 A;  1LOK A;  3GYA A;  1CPS A;  2PE3 A;  6CPA A;  4H1H A;  3IC1 A;  1P4N A;  4MXU A;  4UEE A;  2B4J C;  4G1P A;  3FMC A;  4ZY2 A;  1NSL A;  3WR7 A;  5LYF A;  1GYT A;  3WT4 A;  3P2F A;  4Y49 B;  3DR6 A;  4U5Y A;  1YK3 A;  3ZJ0 A;  3WC6 A;  4I49 A;  4C8P A;  3PFO A;  4M3S A;  3RBU A;  1IYL A;  2B4B A;  2JDC A;  4NGR A;  4PK3 A;  4AXV A;  2PCN A;  2HQY A;  4LQ6 A;  2RFH A;  4B6Z A;  2Q04 A;  3KHZ A;  2D0P A;  3SJE A;  4KNG E;  3IWE A;  3RO0 A;  3TLB A;  2PJ3 A;  3IIB A;  3OWC A;  4GM5 A;  4RN7 A;  4L89 A;  3G8W A;  3RYO A;  4MJ8 A;  4ONU A;  2DPS A;  3KL9 A;  1ELM P;  5EC4 A;  2AFS A;  4L8A A;  4CZ1 A;  1S7N A;  3BI1 A;  5H84 A;  4FD4 A;  3B3S A;  4F9U A;  2E28 A;  1X10 A;  2AFZ A;  4IHM A;  4ONW A;  2YND A;  4M6H A;  3PB9 X;  8CPA A;  2D0O A;  4PQA A;  1J4J A;  4C86 A;  1Z2L A;  3H8F A;  1V0C A;  4QC6 A;  3JVN A;  3I74 A;  3K2K A;  1IGB A;  2O4H A;  4MFK A;  4X3R A;  2K5T A;  3FH4 A;  3KI9 A;  4FD7 A;  4EFD A;  2X7B A;  2JBK A;  4UFV A;  1IOF A;  4YGO A;  4OC2 A;  3RAM A;  4WJB A;  5HKW A;  2EWB A;  2ODF A;  1P0H A;  4ORF A;  4B14 A;  3PEI A;  3OP0 A;  5CPA A;  3FED A;  5J8C A;  1DIK A;  3PFE A;  2POK A;  2V8D A;  2I3C A;  3DNS A;  3TLZ A;  1KUY A;  3VRQ A;  1XFO A;  2X0S A;  2D4P A;  3NE8 A;  4ZGY B;  5C88 A;  2JEW A;  1IIC A;  2G0B A;  4HKF A;  3TYX A;  2VZY A;  1CX8 A;  3K9T A;  2GLF A;  4P4I A;  3DR8 A;  3U88 C;  3WAB A;  1JWQ A;  3PZJ A;  4A2Z A;  3HPH E;  2AFX A;  2REF A;  3S6G A;  1HDU A;  4AVC A;  4MHD A;  4W9Y A;  2HUZ A;  3EC4 A;  1TF9 A;  2FE7 A;  2CNM A;  2J9A A;  4KOS A;  4B5P B;  2R1I A;  1F2P A;  2FS5 A;  3IU2 A;  3QNV A;  4O23 A;  3PFV A;  1AMP A;  2VBQ A;  4KSF A;  2BOA A;  4CYP A;  4TNU A;  1TKH A;  3E0K A;  1S7L A;  5IR2 A;  2FIW A;  2C6G A;  2ZXV A;  2Z3K A;  1MJB A;  3TOB A;  4NEX A;  5EMI A;  1HDQ A;  1XF8 A;  2IJZ A;  3B8G A;  3T8W A;  4RS2 A;  2C6P A;  3DGV A;  4Q7A A;  1RXT A;  1Z9E A;  4MY3 A;  5HMN A;  4C8T A;  1CP7 A;  1YRE A;  4PSX A;  4XPD B;  3VRN A;  1I21 A;  3EZB A;  2B0A A;  4C9V A;  3FYN A;  3H8E A;  3F9K C;  2PJ4 A;  4U9Z A;  4BD9 A;  2ZW7 A;  1UFH A;  3SXO A;  1X12 A;  1BO4 A; 
#chains in the Genus database with same CATH homology
 2G9D A;  4KSI A;  2NYQ A;  3FF3 A;  2V8H A;  5LRK A;  5F09 A;  1BPN A;  1UWY A;  1OBR A;  4A37 A;  2ZEP A;  1CBX A;  2PRQ A;  4P4D A;  4ZY1 A;  2ZEN A;  3NFZ A;  4EME A;  2C5Q A;  3HLP A;  4OC1 A;  2GU2 A;  2CIJ A;  4R76 A;  1Y7E A;  4NGT A;  4CPA A;  4MHY A;  1R43 A;  3D4U A;  4EWT A;  1DE4 C;  3S9L A;  2AFU A;  3NH5 A;  2PJ1 A;  4FUU A;  3KZW A;  2VL1 A;  2ZOG A;  1Z8L A;  3CDX A;  4UIA A;  3SJF A;  3IWW A;  3H8G A;  3PB7 X;  1YLO A;  4A38 A;  4LQG A;  4TJV A;  2ABZ A;  1KWM A;  1YW4 A;  2PIZ A;  4IK2 A;  1JQG A;  5K8O A;  1ZG8 A;  1FT7 A;  3PB4 X;  2BO9 A;  4UEF A;  3B35 A;  4A39 A;  1BLL E;  4MHP A;  4OP4 A;  1PYT B;  3D68 A;  2PVW A;  5D29 A;  3GUX A;  2XEG A;  3V38 A;  1Y0R A;  4YU9 A;  4C8C A;  1ZG9 A;  5LYL A;  4OKO A;  3V7Z A;  1WVM A;  4MRI A;  2DEA A;  3GB0 A;  3FVL A;  2OOT A;  1AYE A;  4UIB A;  1VGY A;  1BPM A;  2V77 A;  3CT9 A;  4A94 A;  5K8M A;  4CDK A;  1TF8 A;  4OME A;  4TWE A;  5HVF A;  5LYI A;  2WZN A;  3SI2 A;  4ZY0 A;  2Q51 A;  5DS0 A;  2PJ6 A;  4FWU A;  4ZX9 A;  2PCU A;  2OR4 A;  5JM6 A;  2HB6 A;  1CP6 A;  2JBJ A;  2PIY A;  3S9M A;  4P10 A;  2WYR A;  1PCA A;  4R6T A;  4OC3 A;  2IQ6 A;  1IY7 A;  5JGF A;  4FAI A;  1YW6 A;  1ELL P;  4PXC A;  4OC0 A;  3PRT A;  4ZX8 A;  3D7F A;  3B7I A;  3ISX A;  3L2N A;  2QVP A;  4ZI6 A;  3LWU A;  2V8V A;  4NFR A;  1TKF A;  4F9V A;  4C8U A;  2RB7 A;  2PJ0 A;  3FEE A;  3D67 A;  3PB8 X;  4MHZ A;  4NGP A;  2HC9 A;  2Q4Z A;  1XBU A;  4MCS A;  1VIX A;  2QJ8 A;  3PB6 X;  3RZA A;  3I6S A;  3FX6 A;  3PBB A;  2BCO A;  3MRU A;  4C9R A;  2F8H A;  3N5F A;  4C9E A;  3DLJ A;  4PPZ A;  2PJ9 A;  4C9U A;  4NGM A;  4R8F A;  1F57 A;  3SI0 A;  4WWV A;  2NSM A;  3ICU A;  4X2T A;  3IFE A;  1Z5R A;  3BI0 A;  3HUV A;  5JH9 A;  3SI1 A;  3SJX A;  2F7V A;  2PJ2 A;  1ARL A;  2CF4 A;  3PBE A;  1ZLI A;  4K3N A;  5K8P A;  1Q7L A;  4P44 A;  4F8Z A;  4P4E A;  3KAS A;  1LAM A;  3IO1 A;  4C85 A;  2XEI A;  2PJ7 A;  1V6C A;  3IJ3 A;  4DJL A;  2PJB A;  1ZLH A;  4NGN A;  3CPX A;  3D7G A;  3I1U A;  4ZYQ A;  2FVG A;  4UEZ A;  3FJU A;  2ZEO A;  4R7M A;  4FBE A;  1LAP A;  2ZEH A;  1YSJ A;  1XF1 A;  1H8L A;  2EK9 A;  5THW A;  3LMS A;  5HVG A;  1F2O A;  5J1Q A;  5CBM A;  4NJR A;  3JRU A;  3KQX A;  3GLJ A;  1NSA A;  5HXD A;  3TC8 A;  1QQ9 A;  3D7D A;  4P4F A;  5IB9 A;  1ARM A;  4DYO A;  1M4L A;  7CPA A;  3NH4 A;  2C1C A;  1XMB A;  3MN8 A;  2AFO A;  4C9A A;  4C8F A;  5LRJ A;  2CTB A;  1Y9Z A;  2PVV A;  3KR5 A;  5LRG A;  4Z65 A;  3EIF A;  1LCP A;  2XEJ A;  4P4J A;  4NGQ A;  3VAT A;  4MCR A;  1BAV A;  2ZEF A;  3BXM A;  1YME A;  2GRE A;  3ISZ A;  4DUK A;  3CPA A;  3VH9 A;  1VHO A;  2PJ5 A;  4RUH A;  2ZEG A;  1LAN A;  4NGS A;  1LFW A;  1CG2 A;  3WC7 A;  2ZEM A;  1ZG7 A;  4OC5 A;  4OIW A;  2Q43 A;  1EE3 P;  3VAR A;  3VTA A;  4H2K A;  3KGQ A;  4C99 A;  4P45 A;  5HVH A;  4P4B A;  2GP4 A;  3BHX A;  3IEH A;  2QYV A;  1TXR A;  2IMO A;  3B3W A;  4IAV A;  3KHX A;  5K8N A;  3S9N A;  4OID A;  1Y0Y A;  3KR4 A;  1DTD A;  1FNO A;  4JYW A;  4PXD A;  1QMU A;  3TX8 A;  2ANP A;  3SJG A;  2GLJ A;  3B3V A;  3B2Y A;  2AFW A;  3D66 A;  2ZED A;  4YWY A;  4UF4 A;  2V8G A;  3WC5 A;  2ZOF A;  4MHN A;  2XEF A;  1VHE A;  1XJO A;  5LYD A;  2PJ8 A;  2ZEE A;  3NH8 A;  4MMO A;  4PXE A;  4P6Y A;  2ZEL A;  3D7H A;  2CTC A;  5D8N A;  1CPX A;  4MCP A;  2PJC A;  3B3C A;  2EK8 A;  3KQZ A;  2C6C A;  4MCQ A;  3NA6 A;  4CDJ A;  5ELY A;  1TKJ A;  2AFM A;  2PJA A;  1RTQ A;  5I4M A;  4C8A A;  1R3N A;  4JZ0 A;  4PXB A;  3B3T A;  4NJQ A;  3FEC A;  1HEE A;  4X8I A;  4TJX A;  4OC4 A;  2O53 A;  1XRY A;  1LOK A;  1CPS A;  2PE3 A;  6CPA A;  3IC1 A;  4MXU A;  4UEE A;  4G1P A;  3FMC A;  4ZY2 A;  5LYF A;  1GYT A;  3WT4 A;  4C8P A;  3PFO A;  3RBU A;  4NGR A;  4AXV A;  2RFH A;  4B6Z A;  3KHZ A;  3SJE A;  4KNG E;  2PJ3 A;  3IIB A;  4GM5 A;  3KL9 A;  1ELM P;  2AFS A;  3BI1 A;  3B3S A;  4F9U A;  2AFZ A;  4IHM A;  4ONW A;  3PB9 X;  8CPA A;  4PQA A;  4C86 A;  1Z2L A;  3H8F A;  3I74 A;  3K2K A;  1IGB A;  2O4H A;  4X3R A;  3KI9 A;  3FH4 A;  4EFD A;  2JBK A;  3RAM A;  4OC2 A;  4WJB A;  2EWB A;  3PEI A;  5CPA A;  3FED A;  3PFE A;  2POK A;  2V8D A;  2I3C A;  1XFO A;  2JEW A;  1CX8 A;  3K9T A;  2GLF A;  4P4I A;  3WAB A;  2AFX A;  1HDU A;  4W9Y A;  1TF9 A;  2J9A A;  1F2P A;  3QNV A;  4O23 A;  1AMP A;  2BOA A;  4TNU A;  1TKH A;  5IR2 A;  2C6G A;  4C8T A;  3WC6 A;  1HDQ A;  2IJZ A;  3T8W A;  4YN3 A;  4C84 A;  2C6P A;  3DGV A;  4Q7A A;  1CP7 A;  4C9V A;  3H8E A;  2PJ4 A;  4BD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...