3D7GA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcmc, a urea-based inhibitor
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 265
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7gA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7gA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7gA02
3PBEA 3PRTA 4FBEA 3S9NA 1TKFA 3ICUA 4IK2A 2C1CA 2XEFA 1KWMA 3PFEA 1WVMA 4X3RA 3KI9A 1Z8LA 5LRJA 3D7GA 5LYFA 3WC5A 1Y0RA 4C84A 2PJ0A 3SJGA 4WWVA 4MHYA 1Q7LA 5K8OA 3FVLA 2PJ1A 3I6SA 2IMOA 2Q51A 1TF8A 2V77A 2Q43A 3PFOA 4C9RA 2GREA 2ANPA 4ZY2A 4AXVA 2QVPA 3HUVA 1CPXA 3MRUA 2ZOFA 3S9LA 3DLJA 3D7DA 4UIAA 4H2KA 3I1UA 1JQGA 3VARA 4P4JA 4NGPA 3IEHA 2ZOGA 1TKJA 3HLPA 3VATA 1QQ9A 4MCPA 2PJ5A 4R7MA 3RAMA 4C9UA 5J1QA 4OC0A 2PJ4A 4YU9A 3QNVA 3LMSA 1CX8A 4ZX8A 1Z5RA 2EK9A 2ZEMA 2GU2A 2AFXA 4NGQA 4OC5A 2C6CA 4JYWA 2PJ2A 2XEIA 4OKOA 2CTBA 3EIFA 1LANA 4WJBA 2AFWA 3PB4X 4CDKA 3NH8A 4PXCA 1AMPA 2AFOA 3B3VA 1GYTA 2O4HA 3SI2A 2JBJA 3D7HA 3KGQA 1ZG9A 3BI1A 3IJ3A 5LYDA 3BI0A 4UEEA 1VIXA 3B3CA 4DYOA 3FEDA 1H8LA 2EK8A 1TF9A 1R3NA 1ZG8A 4FUUA 3FH4A 3PB7X 5HXDA 1XBUA 2IJZA 8CPAA 5ELYA 3CT9A 5JH9A 1CPSA 4GM5A 3KASA 1FNOA 3RZAA 2C6GA 4P4IA 3FECA 4ZYQA 1F2PA 1M4LA 4EFDA 4EMEA 4MMOA 1ARMA 2PJ9A 2PRQA 2BCOA 4P10A 2F8HA 1HDUA 1LAPA 4BD9A 1YSJA 3B3TA 3KHZA 3KR4A 3VH9A 4ONWA 2ZENA 4CDJA 3NFZA 5IB9A 2NSMA 1Y0YA 1YW4A 2VL1A 2CF4A 4ZX9A 2AFUA 2ZEHA 1YMEA 3D7FA 1ZLIA 5D8NA 3SJFA 1Y7EA 1Y9ZA 2PJCA 4NGTA 3PB8X 1R43A 3KL9A 1HDQA 5K8PA 4PXDA 4ZY1A 4UEFA 1DTDA 5THWA 5HVGA 3FF3A 1TKHA 1EE3P 1XJOA 3KR5A 1UWYA 4KSIA 1LCPA 4NJRA 3PB9X 4DJLA 4PQAA 4P4BA 3ISXA 4R6TA 4OIDA 3MN8A 4MHNA 4UEZA 4OC3A 2V8VA 4F8ZA 4MCQA 1IGBA 2PJ8A 4A38A 4A37A 2PIYA 2ZELA 4UIBA 4IHMA 2BO9A 4C8PA 4NGNA 1LAMA 1TXRA 2PJAA 4IAVA 2RB7A 1XFOA 4UF4A 4C8TA 4MHZA 4Z65A 3PBBA 2PCUA 4ZI6A 5LYLA 4R8FA 4MCRA 1CBXA 3GUXA 5JGFA 1CP7A 1LOKA 4TJXA 3PB6X 3K2KA 4C8CA 3KZWA 3B7IA 3D68A 4OC4A 2BOAA 3IFEA 3GLJA 4C99A 3V7ZA 2F7VA 3TX8A 4F9UA 2OR4A 4C8UA 3N5FA 4MRIA 1VHEA 2I3CA 2V8HA 2QYVA 1OBRA 2O53A 3SI1A 2PE3A 3TC8A 2WZNA 4OMEA 3SJEA 3B2YA 3T8WA 4TJVA 4R76A 1XMBA 2PJ7A 1BAVA 3FMCA 4P6YA 4A94A 3WT4A 4NGMA 3WABA 2AFSA 1YLOA 2NYQA 1F57A 1NSAA 4A39A 3FJUA 3H8EA 4C9EA 2PVVA 5CBMA 1FT7A 3FEEA 4YN3A 3BXMA 1ARLA 5JM6A 4C9AA 4K3NA 4MCSA 3GB0A 2GLJA 4P45A 3H8FA 1ELLP 2CTCA 3IO1A 6CPAA 4B6ZA 4EWTA 3D67A 3KHXA 1QMUA 2ZEOA 3NA6A 3NH5A 5K8MA 4NGRA 3CDXA 4TWEA 1CG2A 4MHPA 3NH4A 5F09A 4W9YA 4C86A 1ELMP 2CIJA 3S9MA 2XEJA 3RBUA 3K9TA 2PIZA 3KQXA 3I74A 4C9VA 2G9DA 5D29A 2FVGA 2Q4ZA 2ZEDA 4P4DA 4C8AA 4P44A 2AFMA 3D4UA 5LRGA 2HB6A 5I4MA 4X8IA 3VTAA 4C8FA 4ZY0A 3LWUA 2PJ6A 1PYTB 7CPAA 4KNGE 4YWYA 2DEAA 5CPAA 4OIWA 2JEWA 1PCAA 3SI0A 2ZEPA 4C85A 4JZ0A 1HEEA 3V38A 1ZG7A 4OP4A 1DE4C 4X2TA 4G1PA 4Q7AA 3B35A 3FX6A 3WC7A 3CPXA 4MXUA 2AFZA 1XF1A 1YW6A 3BHXA 3IC1A 4NFRA 2POKA 2RFHA 2JBKA 4OC1A 2PJ3A 3L2NA 1XRYA 2IQ6A 1VHOA 1BPNA 2WYRA 2HC9A 3B3SA 2V8GA 2OOTA 2ZEEA 2C6PA 4PXEA 1V6CA 1ZLHA 3ISZA 4FWUA 1AYEA 2ABZA 4PXBA 2V8DA 1VGYA 3B3WA 4F9VA 5HVHA 3D66A 5LRKA 2QJ8A 1LFWA 5LYIA 2PVWA 3DGVA 1CP6A 1RTQA 2ZEFA 2ZEGA 3IIBA 3SJXA 5K8NA 1Z2LA 5DS0A 4DUKA 4LQGA 3CPAA 1BPMA 4NGSA 2EWBA 3PEIA 4FAIA 5HVFA 4OC2A 4CPAA 4RUHA 1IY7A 3KQZA 4O23A 4P4FA 1BLLE 2J9AA 3WC6A 4TNUA 2PJBA 2XEGA 4P4EA 4PPZA 3H8GA 4NJQA 3IWWA 1F2OA 3JRUA 2GLFA
chains in the Genus database with same CATH superfamily
3P2HA 3PBEA 5H86A 2Q4VA 3PRTA 4FBEA 2R1IA 3OAKA 3U88C 3S9NA 1P4NA 1TKFA 4KOXA 1R57A 3NE7A 4NSQA 1VKCA 3NE8A 3S6GA 3TO7A 4IK2A 4BBHA 4A2ZA 4CYPA 3GKRA 3IU1A 3LD2A 2C1CA 2XEFA 4HNWB 4L8AA 3EZAA 1KWMA 3PFEA 2DXQA 2HROA 2H5MA 2J8MA 1WVMA 4X3RA 2Z3PA 2GIVA 4PK3A 4R9MA 4CGNA 4CYNA 2G0BA 3KI9A 1Z8LA 5LRJA 3D7GA 4F0XA 5LYFA 4YGOA 3WC5A 1Y0RA 1IYKA 1NBWA 4C84A 2PJ0A 1XF8A 4L89A 4NCZA 3SJGA 4E0AA 4MI1A 5EMIA 1LRZA 4WWVA 4MHYA 1Q7LA 5K8OA 3FVLA 2PC1A 3DNSA 5K99A 3TO9A 2PJ1A 2YNCC 3I6SA 4AG9A 2IMOA 2Q51A 1Z8XA 1TF8A 2VI7A 2Z3KA 1IOFA 2V77A 2D0PA 2B58A 3W6XA 5ISVA 2Q43A 4BMHA 3PFOA 5FD8A 4C9RA 5BY0A 2REEA 2GREA 2K5TA 2ANPA 4ZY2A 1ZRSA 1YVHA 4BPUB 4AXVA 2QVPA 3HUVA 1XE4A 2OH1A 4MI4A 2P6FA 1K4JA 1KEEB 1CPXA 1M4IA 2VXKA 3MRUA 4PV6A 5CNPA 4CGMA 2ZOFA 5KTCA 3S9LA 3D7DA 3DLJA 4J3GA 4UIAA 4H2KA 3R9GA 3EZEA 2ZW5A 3I1UA 4R3LA 1JQGA 3B8GA 4UCMA 3VARA 2REFA 5HKWA 4P4JA 4ONUA 4NGPA 2PSWA 2ZOGA 3IEHA 2JLMA 1TKJA 3HLPA 3PGPA 4KUAA 4OLLA 3U1BA 3R1KA 1S5KA 3VATA 1QQ9A 3VRRA 3F0AA 4LQ6A 4MCPA 3EY5A 4AVBA 1B87A 2EVNA 3S6FA 1ZL0A 3T5MA 2VBQA 3IU2A 2PQ8A 3TTHA 3RNZA 5JYBA 3FYNA 4J0NA 2PJ5A 4R7MA 3P2FA 3RAMA 3QB8A 4KOWA 4C9UA 5J1QA 4CZ1A 4OC0A 2PJ4A 4YU9A 3BUOB 3QNVA 3LMSA 1YQEA 3VRQA 1CX8A 4ZX8A 4GXHA 1Z5RA 2EK9A 3G8WA 4UBRA 5I0CA 4KZTA 4R57A 2ZEMA 3EXNA 4NEXA 4H6UA 2GU2A 2AFXA 4NGQA 4OC5A 2R8VA 2C6CA 4A4CA 4U9YA 4JYWA 3JVNA 2PJ2A 2XEIA 4MFKA 1A2ZA 4ZGYB 4OKOA 1YR0A 2CTBA 3TLGB 4CAVA 3EIFA 4JXQA 1LANA 5HKZA 3TCVA 2J8NA 2GFQA 4WJBA 2A4NA 2AUNA 2AFWA 2IL4A 2VZZA 5DWMA 3K4IA 2B5GA 3PB4X 4CDKA 3NH8A 4R3KA 4PXCA 3SXNA 1AMPA 2AFOA 3B3VA 3GIUA 4UWJA 1Z8WA 1YX0A 1GYTA 1L0CA 2O4HA 3SI2A 4KOVA 2GANA 3TLYA 2FS5A 4B5PA 1PU9A 3KRVA 4B12A 4JJXA 4UWIA 2JBJA 4LX9A 1CS0B 2X0SA 3D7HA 1ON0A 1I21A 2RC4A 3KGQA 4JD6A 1I1DA 4C7IA 2DPSA 1ZG9A 1QSRA 3BI1A 3ZJ0A 3T0TA 3IJ3A 4QUSA 3TLCA 4KUBA 2FE7A 5G1ZA 5LYDA 4HNYB 3BI0A 4UEEA 5F47A 1Z9EA 2AUMA 1VIXA 3B3CA 4DYOA 3FEDA 3HPGG 1H8LA 2EK8A 1TF9A 1R3NA 4E5SA 1ZG8A 3E0KA 4FUUA 3FH4A 1ZYMA 1KUVA 1Z9UA 2Z10A 2Q44A 3PB7X 5AG7A 5HXDA 1XBUA 1Y7RA 2PR8A 2IJZA 1JDEA 3TLZA 8CPAA 1EZBA 5ELYA 1AUGA 2R7HA 3CT9A 4B5OA 2EZCA 2Q7SA 1CPSA 2ODFA 1ZO0A 4NF1A 2EBJA 5JH9A 4GM5A 2D4PA 3KASA 5JQ4A 1FNOA 3RZAA 2C6GA 4B14A 4P4IA 4CS0B 1BXRB 3FECA 4CGOA 4ZYQA 1F2PA 4CAEA 1VHSA 1M4LA 4EFDA 2F5IA 4QB9A 1M44A 1NSLA 3F5BA 4EMEA 1QSTA 4OAEA 4UCNA 5J8CA 1BO4A 4MMOA 1ARMA 2Z3OA 1NXJA 4KLWA 2PJ9A 2PRQA 3R9EA 4E2AA 4M3SA 2BCOA 4P10A 4CO9A 2F8HA 1HDUA 1LAPA 5F49A 5IX3A 4AG7A 4BD9A 4EYSA 2PRBA 5JPHA 1NE9A 1YSJA 2FIWA 3B3TA 1Z8TA 5F13A 3KHZA 3KR4A 3IGRA 4B5PB 3TYXA 2Z0ZA 2QIRA 3VH9A 2BL1A 4ONWA 2CNMA 2ZENA 4CDJA 4AB7A 3NFZA 4COGA 5IB9A 2NSMA 4AVCA 2GE3A 4A32A 1Y0YA 1YW4A 2VL1A 2CF4A 3T90A 4ZX9A 2AFUA 2Q0YA 2ZEHA 3G23A 4IIXA 3D3SA 1YMEA 3TFYA 3VRNA 5IV0A 3D7FA 1ZLIA 3W6SA 5D8NA 1T36B 3SJFA 1Y7EA 3JUWA 1MJ9A 2HUZA 2YGWA 5IB0A 2PJCA 4NGTA 1KUXA 1Y9ZA 2R98A 3FBUA 3PB8X 1R43A 3KL9A 1HDQA 2ZW6A 5K8PA 4PXDA 3T9YA 4H1HA 2Y0MA 4XPLA 3ZZIA 4BTFA 4ZY1A 4UEFA 5G22A 1DTDA 5THWA 5HVGA 1OZPA 1B6BA 1S60A 3ZNIA 2CNTA 4EVYA 3PFVA 2DLAA 1FY7A 3CXQA 4XPDB 3FF3A 1C3OB 2UV8G 3IWGA 1MK4A 3LODA 2CY2A 3D2MA 3DR6A 2ARHA 1TKHA 4RI1A 1EE3P 2VQYA 1XJOA 3KR5A 2JEVA 5AG4A 1UWYA 4KSIA 4RN7A 5KTDA 1LCPA 5AG5A 2Z11A 4NJRA 1KC7A 3PB9X 4DJLA 4PQAA 1MJBA 1Y9WA 4P4BA 3ISXA 2Q04A 4R6TA 5GCNA 4OIDA 3MN8A 4MHNA 4UEZA 4KORA 4OC3A 5C88A 2Z3LA 2V8VA 4E8OA 3QAYA 3VGOA 2EUIA 4F8ZA 4MCQA 2Y1NA 1IGBA 2PJ8A 4PK2A 4M8DA 4A38A 1RO5A 4FD5A 2JDCA 2MP0A 4A37A 4CGPA 2PIYA 2D0OA 4BPXB 2ZELA 4UIBA 4IHMA 1KZFA 2HI6A 1U6MA 2BO9A 4C8PA 4F6AA 4KS9A 1QSOA 4NGNA 1LAMA 1XIXA 4B6ZA 5KTAA 2D4OA 3GY9A 3TLAA 1Z4EA 1TXRA 3SR3A 2PJAA 1Y9KA 4JWPA 1Q2DA 3F9KC 2Z3NA 1IB1E 4ORFA 3QAHA 4C2YA 4IAVA 2RB7A 1XFOA 4UF4A 1VBGA 4C8TA 2PR1A 1A9XB 5HH1A 2XPOA 4UFVA 4MHZA 1X10A 4Z65A 3PBBA 4MFZA 4KOTA 2PCUA 1YK3A 3BLNA 1FBVA 4CYOA 4PSWA 4ZI6A 4E94A 5LYLA 4MY3A 4R8FA 4MCRA 1CBXA 3GUXA 3TOBA 5JGFA 1J3LA 1DIKA 1R61A 1CP7A 2CXAA 1LOKA 4TJXA 5F9MA 3PP9A 2FT0A 3PB6X 3TLGA 2HWGA 1TIQA 5J3XA 2N3AB 4FD6A 1S7KA 1Q5XA 1KBLA 3TO6A 3K2KA 2EZAA 4C8CA 3KZWA 3B7IA 5BWAB 2BSWA 5F5XA 3D68A 4OC4A 3CZXA 4R87A 3VWEA 1IYLA 3H5ZA 2BOAA 3IFEA 4X5KA 3BUXB 3GLJA 4C99A 4H89A 3V7ZA 1BOBA 4B11A 4CRZB 4MFQA 2F7VA 3TX8A 4F9UA 2OR4A 4C8UA 3C8OA 4CAXA 4CRYB 3N5FA 1NMTA 2WSAA 3OWCA 1VHEA 4IUSA 4MRIA 3F8KA 4CAFA 2I3CA 2WPXA 2HV2A 2V8HA 3SXOA 1CJWA 4KSFA 1WK4A 2QYVA 3D2PA 1OBRA 2O53A 2Z3MA 4PSXA 3RYOA 2VEZA 3SI1A 2PE3A 4JVOA 3TT2A 1IU8A 3TC8A 2NMTA 1SQHA 1JDBC 2WZNA 1WWZA 4OMEA 4Y49B 3SJEA 3B2YA 1YGHA 2ATRA 4BINA 1XOVA 3T8WA 2OZHA 4KVXA 4TJVA 1V0CA 4KOYA 2AJ6A 5F48A 4XPKA 1GGOA 4RS2A 4MFLA 1P0HA 2B5GB 4UFXA 2ZXVA 3I3GA 3TE4A 4R76A 2PDOA 5DWNA 1XMBA 4A30A 5A28A 4XPDC 2R82A 1PUAA 1WJTA 3FIXA 2PJ7A 2B0AA 4C7HA 1VI4A 1BAVA 3IWEA 2EZBA 3FMCA 4IF5A 4P6YA 3H4QA 4LUAA 4B13A 2DIKA 4A94A 3WT4A 3R96A 4IIYA 3EO4A 5F46A 4NGMA 3OB1B 5E96A 1EZAA 3WABA 2JDDA 3D8PA 2I79A 2FXFA 2AFSA 1YLOA 2C27A 2NYQA 1F57A 1NSAA 1VBHA 3VRPA 4A39A 3FJUA 4Q38A 3SHPA 4MHDA 5G20A 2VKZG 3H8EA 1M6VB 4C9EA 3DR8A 2PVVA 2OLSA 3R9FA 4GS4A 4GPLB 4C2ZA 3RO0A 4QVTA 3BUMB 1IOIA 1FT7A 2WPWA 2X7BA 3FEEA 4NXYA 3S6HA 5CBMA 4YN3A 3BXMA 4Q36A 5G21A 1ARLA 5JM6A 3FXTA 5F1YA 4C9AA 3DSBA 4MCSA 4K3NA 4FD4A 4MY0A 4AVAA 5C82A 3GB0A 4C68A 3O8ZA 2PCNA 4KVME 2GLJA 2HQYA 1IIDA 4P45A 3H8FA 1ELLP 2CTCA 3IO1A 6CPAA 3GJZA 4M85A 1M4GA 2YNCA 2ZW7A 2CNSA 3D67A 3EC4A 3KHXA 1UFHA 4OADA 2B3UA 3S6KA 4A33A 1QMUA 2ZEOA 3NA6A 3NH5A 3PZJA 4NGRA 5K8MA 3CDXA 2YJVA 4F0YA 4TWEA 1CG2A 3BJ7A 1I12A 3LACA 4MHPA 3NH4A 5J8FA 5H84A 5F09A 4W9YA 4MJXA 4C86A 4A31A 4MJ8A 1ELMP 4M6IA 4XNHB 2CIJA 2B4BA 3W91A 1GHEA 3FNCA 1YREA 3S9MA 3OP0A 4A4BA 2XEJA 2BUEA 2OB0A 4DNCA 3PLFB 3RBUA 3K9TA 4H6ZA 3UY5A 3WR7A 5JVLA 3JTKA 1QSMA 2PIZA 3KQXA 2E28A 3I74A 2C5QA 4C9VA 2G9DA 4KOUA 5D29A 2ZPAA 2FVGA 4U5YA 4RR2B 1JWQA 2Q4ZA 2ZEDA 4COBA 4P4DA 1C30B 4C8AA 5A27A 4P44A 2AFMA 2FM4A 3D4UA 3KKWA 3OB2B 5LRGA 2G3AA 2HB6A 4QC6A 5I4MA 5EC4A 2B3VA 4CYQA 4X8IA 3VTAA 4C8FA 4ZY0A 1M1DA 3LWUA 1YVKA 1CE8B 2PJ6A 3TLBA 1PYTB 2CBLA 1N71A 7CPAA 4KNGE 2QMLA 4YWYA 2DEAA 5CPAA 3R95A 4OIWA 2JEWA 2FL4A 1PCAA 2OU2A 2ZEPA 3SI0A 4C85A 1KUYA 4JZ0A 5AGEA 1HEEA 2I00A 1S3ZA 2ZW4A 3G3SA 5FVJA 3V38A 1ZG7A 1S7NA 1DE4C 1B47A 3MGDA 2B4JC 4HNXB 4OP4A 4X2TA 3N7ZA 4G1PA 3V8IA 3NFQA 2BEIA 2P0WA 4MFJA 2DPTA 4Q7AA 3B35A 3FX6A 5EBVA 2Q4YA 3CPXA 4MXUA 3PT1A 2AFZA 4Y49C 3WC7A 4CAWA 1XF1A 1M4DA 1YW6A 3BJ8A 3BHXA 1QSNA 3IC1A 2EO8A 4JLYA 2XPLA 4NFRA 3CXPA 2POKA 4M6GA 4UA3A 3VWDA 2RFHA 4YFJA 2B4DA 2JBKA 4OC1A 2J8RA 2PJ3A 4ZBGA 3L2NA 2FSRA 2G3TA 1XRYA 3DDDA 3TOAA 2YJTA 2IQ6A 1VHOA 1EO0A 3NOJA 1BPNA 1J4JA 2HC9A 2WYRA 4I49A 3VROA 2FIAA 2V8GA 3B3SA 4KOSA 2OOTA 4BPWB 2ZEEA 4FD7A 4A95A 3I9SA 2Y1MA 2C6PA 2QECA 4PXEA 1V6CA 4INJA 1ZLHA 3ISZA 1S7LA 5AXIA 1AYEA 2ABZA 2AE6A 3FRMA 4FWUA 4PXBA 4K30A 4U9ZA 2V8DA 5HMNA 1VGYA 3T07A 1XMTA 3A9LA 3B3WA 4F9VA 2KCWA 4UCPA 3TLEA 3EFAA 2VZYA 3D66A 4KLVA 5HVHA 4HPSA 3HPHE 5LRKA 2QJ8A 2YNEA 3ICUA 1LFWA 5LYIA 4QBJA 4MFPA 4EWTA 1X12A 2PVWA 4II9A 2YNDA 3DGVA 1CP6A 1RTQA 2ZEFA 2ZEGA 3IIBA 1Q2CA 2OZGA 4M6HA 2GP4A 3T05A 3SJXA 5K8NA 1Z2LA 5DS0A 4DUKA 4LQGA 2WUUA 3CPAA 1CM0A 2P6EA 5IR2A 1BPMA 4NGSA 2OZUA 4YRHA 2P6GA 2EWBA 1YLEA 3BUWB 3PEIA 3BUNB 1Q2YA 4FAIA 1XEBA 1IICA 4UFWA 4OC2A 2XPPA 5HVFA 4CPAA 3K9UA 4RUHA 1Z4RA 1IY7A 2O28A 3KQZA 5AG6A 4KVOE 4O23A 2XPNA 2B4DB 4CGLA 3HMJG 1RXTA 3EZBA 2Q7BA 1MJAA 4P4FA 3CXSA 1BLLE 1YVOA 2J9AA 3C26A 4MBUA 4C2XA 3WC6A 1S7FA 3GYAA 4HKFA 4TNUA 2PJBA 2XEGA 4B10A 4P4EA 4KSAA 4PPZA 3H8GA 4NJQA 4XNHC 3IWWA 1F2OA 2FCKA 3JRUA 4JXRA 5HKYA 2DF5A 3FB3A 2GLFA
chains in the Genus database with same CATH topology
3PBEA 3PRTA 4FBEA 3S9NA 1TKFA 3ICUA 4IK2A 2C1CA 2XEFA 1KWMA 3PFEA 1WVMA 4X3RA 3KI9A 1Z8LA 5LRJA 3D7GA 5LYFA 3WC5A 1Y0RA 4C84A 2PJ0A 3SJGA 4WWVA 4MHYA 1Q7LA 5K8OA 3FVLA 2PJ1A 3I6SA 2IMOA 2Q51A 1TF8A 2V77A 2Q43A 3PFOA 4C9RA 2GREA 2ANPA 4ZY2A 4AXVA 2QVPA 3HUVA 1CPXA 3MRUA 2ZOFA 3S9LA 3DLJA 3D7DA 4UIAA 4H2KA 3I1UA 1JQGA 3VARA 4P4JA 4NGPA 3IEHA 2ZOGA 1TKJA 3HLPA 3VATA 1QQ9A 4MCPA 2PJ5A 4R7MA 3RAMA 4C9UA 5J1QA 4OC0A 2PJ4A 4YU9A 3QNVA 3LMSA 1CX8A 4ZX8A 1Z5RA 2EK9A 2ZEMA 2GU2A 2AFXA 4NGQA 4OC5A 2C6CA 4JYWA 2PJ2A 2XEIA 4OKOA 2CTBA 3EIFA 1LANA 4WJBA 2AFWA 3PB4X 4CDKA 3NH8A 4PXCA 1AMPA 2AFOA 3B3VA 1GYTA 2O4HA 3SI2A 2JBJA 3D7HA 3KGQA 1ZG9A 3BI1A 3IJ3A 5LYDA 3BI0A 4UEEA 1VIXA 3B3CA 4DYOA 3FEDA 1H8LA 2EK8A 1TF9A 1R3NA 1ZG8A 4FUUA 3FH4A 3PB7X 5HXDA 1XBUA 2IJZA 8CPAA 5ELYA 3CT9A 5JH9A 1CPSA 4GM5A 3KASA 1FNOA 3RZAA 2C6GA 4P4IA 3FECA 4ZYQA 1F2PA 1M4LA 4EFDA 4EMEA 4MMOA 1ARMA 2PJ9A 2PRQA 2BCOA 4P10A 2F8HA 1HDUA 1LAPA 4BD9A 1YSJA 3B3TA 3KHZA 3KR4A 3VH9A 4ONWA 2ZENA 4CDJA 3NFZA 5IB9A 2NSMA 1Y0YA 1YW4A 2VL1A 2CF4A 4ZX9A 2AFUA 2ZEHA 1YMEA 3D7FA 1ZLIA 5D8NA 3SJFA 1Y7EA 1Y9ZA 2PJCA 4NGTA 3PB8X 1R43A 3KL9A 1HDQA 5K8PA 4PXDA 4ZY1A 4UEFA 1DTDA 5THWA 5HVGA 3FF3A 1TKHA 1EE3P 1XJOA 3KR5A 1UWYA 4KSIA 1LCPA 4NJRA 3PB9X 4DJLA 4PQAA 4P4BA 3ISXA 4R6TA 4OIDA 3MN8A 4MHNA 4UEZA 4OC3A 2V8VA 4F8ZA 4MCQA 1IGBA 2PJ8A 4A38A 4A37A 2PIYA 2ZELA 4UIBA 4IHMA 2BO9A 4C8PA 4NGNA 1LAMA 1TXRA 2PJAA 4IAVA 2RB7A 1XFOA 4UF4A 4C8TA 4MHZA 4Z65A 3PBBA 2PCUA 4ZI6A 5LYLA 4R8FA 4MCRA 1CBXA 3GUXA 5JGFA 1CP7A 1LOKA 4TJXA 3PB6X 3K2KA 4C8CA 3KZWA 3B7IA 3D68A 4OC4A 2BOAA 3IFEA 3GLJA 4C99A 3V7ZA 2F7VA 3TX8A 4F9UA 2OR4A 4C8UA 3N5FA 4MRIA 1VHEA 2I3CA 2V8HA 2QYVA 1OBRA 2O53A 3SI1A 2PE3A 3TC8A 2WZNA 4OMEA 3SJEA 3B2YA 3T8WA 4TJVA 4R76A 1XMBA 2PJ7A 1BAVA 3FMCA 4P6YA 4A94A 3WT4A 4NGMA 3WABA 2AFSA 1YLOA 2NYQA 1F57A 1NSAA 4A39A 3FJUA 3H8EA 4C9EA 2PVVA 5CBMA 1FT7A 3FEEA 4YN3A 3BXMA 1ARLA 5JM6A 4C9AA 4K3NA 4MCSA 3GB0A 2GLJA 4P45A 3H8FA 1ELLP 2CTCA 3IO1A 6CPAA 4B6ZA 4EWTA 3D67A 3KHXA 1QMUA 2ZEOA 3NA6A 3NH5A 5K8MA 4NGRA 3CDXA 4TWEA 1CG2A 4MHPA 3NH4A 5F09A 4W9YA 4C86A 1ELMP 2CIJA 3S9MA 2XEJA 3RBUA 3K9TA 2PIZA 3KQXA 3I74A 2C5QA 4C9VA 2G9DA 5D29A 2FVGA 2Q4ZA 2ZEDA 4P4DA 4C8AA 4P44A 2AFMA 3D4UA 5LRGA 2HB6A 5I4MA 4X8IA 3VTAA 4C8FA 4ZY0A 3LWUA 2PJ6A 1PYTB 7CPAA 4KNGE 4YWYA 2DEAA 5CPAA 4OIWA 2JEWA 1PCAA 3SI0A 2ZEPA 4C85A 4JZ0A 1HEEA 3V38A 1ZG7A 4OP4A 1DE4C 4X2TA 4G1PA 4Q7AA 3B35A 3FX6A 3WC7A 3CPXA 4MXUA 2AFZA 1XF1A 1YW6A 3BHXA 3IC1A 4NFRA 2POKA 2RFHA 2JBKA 4OC1A 2PJ3A 3L2NA 1XRYA 2IQ6A 1VHOA 1BPNA 2WYRA 2HC9A 3B3SA 2V8GA 2OOTA 2ZEEA 2C6PA 4PXEA 1V6CA 1ZLHA 3ISZA 4FWUA 1AYEA 2ABZA 4PXBA 2V8DA 1VGYA 3B3WA 4F9VA 5HVHA 3D66A 5LRKA 2QJ8A 1LFWA 5LYIA 2PVWA 3DGVA 1CP6A 1RTQA 2ZEFA 2ZEGA 3IIBA 2GP4A 3SJXA 5K8NA 1Z2LA 5DS0A 4DUKA 4LQGA 3CPAA 5IR2A 1BPMA 4NGSA 2EWBA 3PEIA 4FAIA 5HVFA 4OC2A 4CPAA 4RUHA 1IY7A 3KQZA 4O23A 4P4FA 1BLLE 2J9AA 3WC6A 4TNUA 2PJBA 2XEGA 4P4EA 4PPZA 3H8GA 4NJQA 3IWWA 1F2OA 3JRUA 2GLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBE A;  3PRT A;  4FBE A;  3S9N A;  1TKF A;  3ICU A;  4IK2 A;  2C1C A;  2XEF A;  1KWM A;  3PFE A;  1WVM A;  4X3R A;  3KI9 A;  1Z8L A;  5LRJ A;  3D7G A;  5LYF A;  3WC5 A;  1Y0R A;  4C84 A;  2PJ0 A;  3SJG A;  4WWV A;  4MHY A;  1Q7L A;  5K8O A;  3FVL A;  2PJ1 A;  3I6S A;  2IMO A;  2Q51 A;  1TF8 A;  2V77 A;  2Q43 A;  3PFO A;  4C9R A;  2GRE A;  2ANP A;  4ZY2 A;  4AXV A;  2QVP A;  3HUV A;  1CPX A;  3MRU A;  2ZOF A;  3S9L A;  3DLJ A;  3D7D A;  4UIA A;  4H2K A;  3I1U A;  1JQG A;  3VAR A;  4P4J A;  4NGP A;  3IEH A;  2ZOG A;  1TKJ A;  3HLP A;  3VAT A;  1QQ9 A;  4MCP A;  2PJ5 A;  4R7M A;  3RAM A;  4C9U A;  5J1Q A;  4OC0 A;  2PJ4 A;  4YU9 A;  3QNV A;  3LMS A;  1CX8 A;  4ZX8 A;  1Z5R A;  2EK9 A;  2ZEM A;  2GU2 A;  2AFX A;  4NGQ A;  4OC5 A;  2C6C A;  4JYW A;  2PJ2 A;  2XEI A;  4OKO A;  2CTB A;  3EIF A;  1LAN A;  4WJB A;  2AFW A;  3PB4 X;  4CDK A;  3NH8 A;  4PXC A;  1AMP A;  2AFO A;  3B3V A;  1GYT A;  2O4H A;  3SI2 A;  2JBJ A;  3D7H A;  3KGQ A;  1ZG9 A;  3BI1 A;  3IJ3 A;  5LYD A;  3BI0 A;  4UEE A;  1VIX A;  3B3C A;  4DYO A;  3FED A;  1H8L A;  2EK8 A;  1TF9 A;  1R3N A;  1ZG8 A;  4FUU A;  3FH4 A;  3PB7 X;  5HXD A;  1XBU A;  2IJZ A;  8CPA A;  5ELY A;  3CT9 A;  5JH9 A;  1CPS A;  4GM5 A;  3KAS A;  1FNO A;  3RZA A;  2C6G A;  4P4I A;  3FEC A;  4ZYQ A;  1F2P A;  1M4L A;  4EFD A;  4EME A;  4MMO A;  1ARM A;  2PJ9 A;  2PRQ A;  2BCO A;  4P10 A;  2F8H A;  1HDU A;  1LAP A;  4BD9 A;  1YSJ A;  3B3T A;  3KHZ A;  3KR4 A;  3VH9 A;  4ONW A;  2ZEN A;  4CDJ A;  3NFZ A;  5IB9 A;  2NSM A;  1Y0Y A;  1YW4 A;  2VL1 A;  2CF4 A;  4ZX9 A;  2AFU A;  2ZEH A;  1YME A;  3D7F A;  1ZLI A;  5D8N A;  3SJF A;  1Y7E A;  1Y9Z A;  2PJC A;  4NGT A;  3PB8 X;  1R43 A;  3KL9 A;  1HDQ A;  5K8P A;  4PXD A;  4ZY1 A;  4UEF A;  1DTD A;  5THW A;  5HVG A;  3FF3 A;  1TKH A;  1EE3 P;  1XJO A;  3KR5 A;  1UWY A;  4KSI A;  1LCP A;  4NJR A;  3PB9 X;  4DJL A;  4PQA A;  4P4B A;  3ISX A;  4R6T A;  4OID A;  3MN8 A;  4MHN A;  4UEZ A;  4OC3 A;  2V8V A;  4F8Z A;  4MCQ A;  1IGB A;  2PJ8 A;  4A38 A;  4A37 A;  2PIY A;  2ZEL A;  4UIB A;  4IHM A;  2BO9 A;  4C8P A;  4NGN A;  1LAM A;  1TXR A;  2PJA A;  4IAV A;  2RB7 A;  1XFO A;  4UF4 A;  4C8T A;  4MHZ A;  4Z65 A;  3PBB A;  2PCU A;  4ZI6 A;  5LYL A;  4R8F A;  4MCR A;  1CBX A;  3GUX A;  5JGF A;  1CP7 A;  1LOK A;  4TJX A;  3PB6 X;  3K2K A;  4C8C A;  3KZW A;  3B7I A;  3D68 A;  4OC4 A;  2BOA A;  3IFE A;  3GLJ A;  4C99 A;  3V7Z A;  2F7V A;  3TX8 A;  4F9U A;  2OR4 A;  4C8U A;  3N5F A;  4MRI A;  1VHE A;  2I3C A;  2V8H A;  2QYV A;  1OBR A;  2O53 A;  3SI1 A;  2PE3 A;  3TC8 A;  2WZN A;  4OME A;  3SJE A;  3B2Y A;  3T8W A;  4TJV A;  4R76 A;  1XMB A;  2PJ7 A;  1BAV A;  3FMC A;  4P6Y A;  4A94 A;  3WT4 A;  4NGM A;  3WAB A;  2AFS A;  1YLO A;  2NYQ A;  1F57 A;  1NSA A;  4A39 A;  3FJU A;  3H8E A;  4C9E A;  2PVV A;  5CBM A;  1FT7 A;  3FEE A;  4YN3 A;  3BXM A;  1ARL A;  5JM6 A;  4C9A A;  4K3N A;  4MCS A;  3GB0 A;  2GLJ A;  4P45 A;  3H8F A;  1ELL P;  2CTC A;  3IO1 A;  6CPA A;  4B6Z A;  4EWT A;  3D67 A;  3KHX A;  1QMU A;  2ZEO A;  3NA6 A;  3NH5 A;  5K8M A;  4NGR A;  3CDX A;  4TWE A;  1CG2 A;  4MHP A;  3NH4 A;  5F09 A;  4W9Y A;  4C86 A;  1ELM P;  2CIJ A;  3S9M A;  2XEJ A;  3RBU A;  3K9T A;  2PIZ A;  3KQX A;  3I74 A;  4C9V A;  2G9D A;  5D29 A;  2FVG A;  2Q4Z A;  2ZED A;  4P4D A;  4C8A A;  4P44 A;  2AFM A;  3D4U A;  5LRG A;  2HB6 A;  5I4M A;  4X8I A;  3VTA A;  4C8F A;  4ZY0 A;  3LWU A;  2PJ6 A;  1PYT B;  7CPA A;  4KNG E;  4YWY A;  2DEA A;  5CPA A;  4OIW A;  2JEW A;  1PCA A;  3SI0 A;  2ZEP A;  4C85 A;  4JZ0 A;  1HEE A;  3V38 A;  1ZG7 A;  4OP4 A;  1DE4 C;  4X2T A;  4G1P A;  4Q7A A;  3B35 A;  3FX6 A;  3WC7 A;  3CPX A;  4MXU A;  2AFZ A;  1XF1 A;  1YW6 A;  3BHX A;  3IC1 A;  4NFR A;  2POK A;  2RFH A;  2JBK A;  4OC1 A;  2PJ3 A;  3L2N A;  1XRY A;  2IQ6 A;  1VHO A;  1BPN A;  2WYR A;  2HC9 A;  3B3S A;  2V8G A;  2OOT A;  2ZEE A;  2C6P A;  4PXE A;  1V6C A;  1ZLH A;  3ISZ A;  4FWU A;  1AYE A;  2ABZ A;  4PXB A;  2V8D A;  1VGY A;  3B3W A;  4F9V A;  5HVH A;  3D66 A;  5LRK A;  2QJ8 A;  1LFW A;  5LYI A;  2PVW A;  3DGV A;  1CP6 A;  1RTQ A;  2ZEF A;  2ZEG A;  3IIB A;  3SJX A;  5K8N A;  1Z2L A;  5DS0 A;  4DUK A;  4LQG A;  3CPA A;  1BPM A;  4NGS A;  2EWB A;  3PEI A;  4FAI A;  5HVF A;  4OC2 A;  4CPA A;  4RUH A;  1IY7 A;  3KQZ A;  4O23 A;  4P4F A;  1BLL E;  2J9A A;  3WC6 A;  4TNU A;  2PJB A;  2XEG A;  4P4E A;  4PPZ A;  3H8G A;  4NJQ A;  3IWW A;  1F2O A;  3JRU A;  2GLF A; 
#chains in the Genus database with same CATH topology
 3P2H A;  3PBE A;  5H86 A;  2Q4V A;  3PRT A;  4FBE A;  2R1I A;  3OAK A;  3U88 C;  3S9N A;  1P4N A;  1TKF A;  4KOX A;  1R57 A;  3NE7 A;  4NSQ A;  1VKC A;  3NE8 A;  3S6G A;  3TO7 A;  4IK2 A;  4BBH A;  4A2Z A;  4CYP A;  3GKR A;  3IU1 A;  3LD2 A;  2C1C A;  2XEF A;  4HNW B;  4L8A A;  3EZA A;  1KWM A;  3PFE A;  2DXQ A;  2HRO A;  2H5M A;  2J8M A;  1WVM A;  4X3R A;  2Z3P A;  2GIV A;  4PK3 A;  4R9M A;  4CGN A;  4CYN A;  2G0B A;  3KI9 A;  1Z8L A;  5LRJ A;  3D7G A;  4F0X A;  5LYF A;  4YGO A;  3WC5 A;  1Y0R A;  1IYK A;  1NBW A;  4C84 A;  2PJ0 A;  1XF8 A;  4L89 A;  4NCZ A;  3SJG A;  4E0A A;  4MI1 A;  5EMI A;  1LRZ A;  4WWV A;  4MHY A;  1Q7L A;  5K8O A;  3FVL A;  2PC1 A;  3DNS A;  5K99 A;  3TO9 A;  2PJ1 A;  2YNC C;  3I6S A;  4AG9 A;  2IMO A;  2Q51 A;  1Z8X A;  1TF8 A;  2VI7 A;  2Z3K A;  1IOF A;  2V77 A;  2D0P A;  2B58 A;  3W6X A;  5ISV A;  2Q43 A;  4BMH A;  3PFO A;  5FD8 A;  4C9R A;  5BY0 A;  2REE A;  2GRE A;  2K5T A;  2ANP A;  4ZY2 A;  1ZRS A;  1YVH A;  4BPU B;  4AXV A;  2QVP A;  3HUV A;  1XE4 A;  2OH1 A;  4MI4 A;  2P6F A;  1K4J A;  1KEE B;  1CPX A;  1M4I A;  2VXK A;  3MRU A;  4PV6 A;  5CNP A;  4CGM A;  2ZOF A;  5KTC A;  3S9L A;  3D7D A;  3DLJ A;  4J3G A;  4UIA A;  4H2K A;  3R9G A;  3EZE A;  2ZW5 A;  3I1U A;  4R3L A;  1JQG A;  3B8G A;  4UCM A;  3VAR A;  2REF A;  5HKW A;  4P4J A;  4ONU A;  4NGP A;  2PSW A;  2ZOG A;  3IEH A;  2JLM A;  1TKJ A;  3HLP A;  3PGP A;  4KUA A;  4OLL A;  3U1B A;  3R1K A;  1S5K A;  3VAT A;  1QQ9 A;  3VRR A;  3F0A A;  4LQ6 A;  4MCP A;  3EY5 A;  4AVB A;  1B87 A;  2EVN A;  3S6F A;  1ZL0 A;  3T5M A;  2VBQ A;  3IU2 A;  2PQ8 A;  3TTH A;  3RNZ A;  5JYB A;  3FYN A;  4J0N A;  2PJ5 A;  4R7M A;  3P2F A;  3RAM A;  3QB8 A;  4KOW A;  4C9U A;  5J1Q A;  4CZ1 A;  4OC0 A;  2PJ4 A;  4YU9 A;  3BUO B;  3QNV A;  3LMS A;  1YQE A;  3VRQ A;  1CX8 A;  4ZX8 A;  4GXH A;  1Z5R A;  2EK9 A;  3G8W A;  4UBR A;  5I0C A;  4KZT A;  4R57 A;  2ZEM A;  3EXN A;  4NEX A;  4H6U A;  2GU2 A;  2AFX A;  4NGQ A;  4OC5 A;  2R8V A;  2C6C A;  4A4C A;  4U9Y A;  4JYW A;  3JVN A;  2PJ2 A;  2XEI A;  4MFK A;  1A2Z A;  4ZGY B;  4OKO A;  1YR0 A;  2CTB A;  3TLG B;  4CAV A;  3EIF A;  4JXQ A;  1LAN A;  5HKZ A;  3TCV A;  2J8N A;  2GFQ A;  4WJB A;  2A4N A;  2AUN A;  2AFW A;  2IL4 A;  2VZZ A;  5DWM A;  3K4I A;  2B5G A;  3PB4 X;  4CDK A;  3NH8 A;  4R3K A;  4PXC A;  3SXN A;  1AMP A;  2AFO A;  3B3V A;  3GIU A;  4UWJ A;  1Z8W A;  1YX0 A;  1GYT A;  1L0C A;  2O4H A;  3SI2 A;  4KOV A;  2GAN A;  3TLY A;  2FS5 A;  4B5P A;  1PU9 A;  3KRV A;  4B12 A;  4JJX A;  4UWI A;  2JBJ A;  4LX9 A;  1CS0 B;  2X0S A;  3D7H A;  1ON0 A;  1I21 A;  2RC4 A;  3KGQ A;  4JD6 A;  1I1D A;  4C7I A;  2DPS A;  1ZG9 A;  1QSR A;  3BI1 A;  3ZJ0 A;  3T0T A;  3IJ3 A;  4QUS A;  3TLC A;  4KUB A;  2FE7 A;  5G1Z A;  5LYD A;  4HNY B;  3BI0 A;  4UEE A;  5F47 A;  1Z9E A;  2AUM A;  1VIX A;  3B3C A;  4DYO A;  3FED A;  3HPG G;  1H8L A;  2EK8 A;  1TF9 A;  1R3N A;  4E5S A;  1ZG8 A;  3E0K A;  4FUU A;  3FH4 A;  1ZYM A;  1KUV A;  1Z9U A;  2Z10 A;  2Q44 A;  3PB7 X;  5AG7 A;  5HXD A;  1XBU A;  1Y7R A;  2PR8 A;  2IJZ A;  1JDE A;  3TLZ A;  8CPA A;  1EZB A;  5ELY A;  1AUG A;  2R7H A;  3CT9 A;  4B5O A;  2EZC A;  2Q7S A;  1CPS A;  2ODF A;  1ZO0 A;  4NF1 A;  2EBJ A;  5JH9 A;  4GM5 A;  2D4P A;  3KAS A;  5JQ4 A;  1FNO A;  3RZA A;  2C6G A;  4B14 A;  4P4I A;  4CS0 B;  1BXR B;  3FEC A;  4CGO A;  4ZYQ A;  1F2P A;  4CAE A;  1VHS A;  1M4L A;  4EFD A;  2F5I A;  4QB9 A;  1M44 A;  1NSL A;  3F5B A;  4EME A;  1QST A;  4OAE A;  4UCN A;  5J8C A;  1BO4 A;  4MMO A;  1ARM A;  2Z3O A;  1NXJ A;  4KLW A;  2PJ9 A;  2PRQ A;  3R9E A;  4E2A A;  4M3S A;  2BCO A;  4P10 A;  4CO9 A;  2F8H A;  1HDU A;  1LAP A;  5F49 A;  5IX3 A;  4AG7 A;  4BD9 A;  4EYS A;  2PRB A;  5JPH A;  1NE9 A;  1YSJ A;  2FIW A;  3B3T A;  1Z8T A;  5F13 A;  3KHZ A;  3KR4 A;  3IGR A;  4B5P B;  3TYX A;  2Z0Z A;  2QIR A;  3VH9 A;  2BL1 A;  4ONW A;  2CNM A;  2ZEN A;  4CDJ A;  4AB7 A;  3NFZ A;  4COG A;  5IB9 A;  2NSM A;  4AVC A;  2GE3 A;  4A32 A;  1Y0Y A;  1YW4 A;  2VL1 A;  2CF4 A;  3T90 A;  4ZX9 A;  2AFU A;  2Q0Y A;  2ZEH A;  3G23 A;  4IIX A;  3D3S A;  1YME A;  3TFY A;  3VRN A;  5IV0 A;  3D7F A;  1ZLI A;  3W6S A;  5D8N A;  1T36 B;  3SJF A;  1Y7E A;  3JUW A;  1MJ9 A;  2HUZ A;  2YGW A;  5IB0 A;  2PJC A;  4NGT A;  1KUX A;  1Y9Z A;  2R98 A;  3FBU A;  3PB8 X;  1R43 A;  3KL9 A;  1HDQ A;  2ZW6 A;  5K8P A;  4PXD A;  3T9Y A;  4H1H A;  2Y0M A;  4XPL A;  3ZZI A;  4BTF A;  4ZY1 A;  4UEF A;  5G22 A;  1DTD A;  5THW A;  5HVG A;  1OZP A;  1B6B A;  1S60 A;  3ZNI A;  2CNT A;  4EVY A;  3PFV A;  2DLA A;  1FY7 A;  3CXQ A;  4XPD B;  3FF3 A;  1C3O B;  2UV8 G;  3IWG A;  1MK4 A;  3LOD A;  2CY2 A;  3D2M A;  3DR6 A;  2ARH A;  1TKH A;  4RI1 A;  1EE3 P;  2VQY A;  1XJO A;  3KR5 A;  2JEV A;  5AG4 A;  1UWY A;  4KSI A;  4RN7 A;  5KTD A;  1LCP A;  5AG5 A;  2Z11 A;  4NJR A;  1KC7 A;  3PB9 X;  4DJL A;  4PQA A;  1MJB A;  1Y9W A;  4P4B A;  3ISX A;  2Q04 A;  4R6T A;  5GCN A;  4OID A;  3MN8 A;  4MHN A;  4UEZ A;  4KOR A;  4OC3 A;  5C88 A;  2Z3L A;  2V8V A;  4E8O A;  3QAY A;  3VGO A;  2EUI A;  4F8Z A;  4MCQ A;  2Y1N A;  1IGB A;  2PJ8 A;  4PK2 A;  4M8D A;  4A38 A;  1RO5 A;  4FD5 A;  2JDC A;  2MP0 A;  4A37 A;  4CGP A;  2PIY A;  2D0O A;  4BPX B;  2ZEL A;  4UIB A;  4IHM A;  1KZF A;  2HI6 A;  1U6M A;  2BO9 A;  4C8P A;  4F6A A;  4KS9 A;  1QSO A;  4NGN A;  1LAM A;  1XIX A;  4B6Z A;  5KTA A;  2D4O A;  3GY9 A;  3TLA A;  1Z4E A;  1TXR A;  3SR3 A;  2PJA A;  1Y9K A;  4JWP A;  1Q2D A;  3F9K C;  2Z3N A;  1IB1 E;  4ORF A;  3QAH A;  4C2Y A;  4IAV A;  2RB7 A;  1XFO A;  4UF4 A;  1VBG A;  4C8T A;  2PR1 A;  1A9X B;  5HH1 A;  2XPO A;  4UFV A;  4MHZ A;  1X10 A;  4Z65 A;  3PBB A;  4MFZ A;  4KOT A;  2PCU A;  1YK3 A;  3BLN A;  1FBV A;  4CYO A;  4PSW A;  4ZI6 A;  4E94 A;  5LYL A;  4MY3 A;  4R8F A;  4MCR A;  1CBX A;  3GUX A;  3TOB A;  5JGF A;  1J3L A;  1DIK A;  1R61 A;  1CP7 A;  2CXA A;  1LOK A;  4TJX A;  5F9M A;  3PP9 A;  2FT0 A;  3PB6 X;  3TLG A;  2HWG A;  1TIQ A;  5J3X A;  2N3A B;  4FD6 A;  1S7K A;  1Q5X A;  1KBL A;  3TO6 A;  3K2K A;  2EZA A;  4C8C A;  3KZW A;  3B7I A;  5BWA B;  2BSW A;  5F5X A;  3D68 A;  4OC4 A;  3CZX A;  4R87 A;  3VWE A;  1IYL A;  3H5Z A;  2BOA A;  3IFE A;  4X5K A;  3BUX B;  3GLJ A;  4C99 A;  4H89 A;  3V7Z A;  1BOB A;  4B11 A;  4CRZ B;  4MFQ A;  2F7V A;  3TX8 A;  4F9U A;  2OR4 A;  4C8U A;  3C8O A;  4CAX A;  4CRY B;  3N5F A;  1NMT A;  2WSA A;  3OWC A;  1VHE A;  4IUS A;  4MRI A;  3F8K A;  4CAF A;  2I3C A;  2WPX A;  2HV2 A;  2V8H A;  3SXO A;  1CJW A;  4KSF A;  1WK4 A;  2QYV A;  3D2P A;  1OBR A;  2O53 A;  2Z3M A;  4PSX A;  3RYO A;  2VEZ A;  3SI1 A;  2PE3 A;  4JVO A;  3TT2 A;  1IU8 A;  3TC8 A;  2NMT A;  1SQH A;  1JDB C;  2WZN A;  1WWZ A;  4OME A;  4Y49 B;  3SJE A;  3B2Y A;  1YGH A;  2ATR A;  4BIN A;  1XOV A;  3T8W A;  2OZH A;  4KVX A;  4TJV A;  1V0C A;  4KOY A;  2AJ6 A;  5F48 A;  4XPK A;  1GGO A;  4RS2 A;  4MFL A;  1P0H A;  2B5G B;  4UFX A;  2ZXV A;  3I3G A;  3TE4 A;  4R76 A;  2PDO A;  5DWN A;  1XMB A;  4A30 A;  5A28 A;  4XPD C;  2R82 A;  1PUA A;  1WJT A;  3FIX A;  2PJ7 A;  2B0A A;  4C7H A;  1VI4 A;  1BAV A;  3IWE A;  2EZB A;  3FMC A;  4IF5 A;  4P6Y A;  3H4Q A;  4LUA A;  4B13 A;  2DIK A;  4A94 A;  3WT4 A;  3R96 A;  4IIY A;  3EO4 A;  5F46 A;  4NGM A;  3OB1 B;  5E96 A;  1EZA A;  3WAB A;  2JDD A;  3D8P A;  2I79 A;  2FXF A;  2AFS A;  1YLO A;  2C27 A;  2NYQ A;  1F57 A;  1NSA A;  1VBH A;  3VRP A;  4A39 A;  3FJU A;  4Q38 A;  3SHP A;  4MHD A;  5G20 A;  2VKZ G;  3H8E A;  1M6V B;  4C9E A;  3DR8 A;  2PVV A;  2OLS A;  3R9F A;  4GS4 A;  4GPL B;  4C2Z A;  3RO0 A;  4QVT A;  3BUM B;  1IOI A;  1FT7 A;  2WPW A;  2X7B A;  3FEE A;  4NXY A;  3S6H A;  5CBM A;  4YN3 A;  3BXM A;  4Q36 A;  5G21 A;  1ARL A;  5JM6 A;  3FXT A;  5F1Y A;  4C9A A;  3DSB A;  4MCS A;  4K3N A;  4FD4 A;  4MY0 A;  4AVA A;  5C82 A;  3GB0 A;  4C68 A;  3O8Z A;  2PCN A;  4KVM E;  2GLJ A;  2HQY A;  1IID A;  4P45 A;  3H8F A;  1ELL P;  2CTC A;  3IO1 A;  6CPA A;  3GJZ A;  4M85 A;  1M4G A;  2YNC A;  2ZW7 A;  2CNS A;  3D67 A;  3EC4 A;  3KHX A;  1UFH A;  4OAD A;  2B3U A;  3S6K A;  4A33 A;  1QMU A;  2ZEO A;  3NA6 A;  3NH5 A;  3PZJ A;  4NGR A;  5K8M A;  3CDX A;  2YJV A;  4F0Y A;  4TWE A;  1CG2 A;  3BJ7 A;  1I12 A;  3LAC A;  4MHP A;  3NH4 A;  5J8F A;  5H84 A;  5F09 A;  4W9Y A;  4MJX A;  4C86 A;  4A31 A;  4MJ8 A;  1ELM P;  4M6I A;  4XNH B;  2CIJ A;  2B4B A;  3W91 A;  1GHE A;  3FNC A;  1YRE A;  3S9M A;  3OP0 A;  4A4B A;  2XEJ A;  2BUE A;  2OB0 A;  4DNC A;  3PLF B;  3RBU A;  3K9T A;  4H6Z A;  3UY5 A;  3WR7 A;  5JVL A;  3JTK A;  1QSM A;  2PIZ A;  3KQX A;  2E28 A;  3I74 A;  2C5Q A;  4C9V A;  2G9D A;  4KOU A;  5D29 A;  2ZPA A;  2FVG A;  4U5Y A;  4RR2 B;  1JWQ A;  2Q4Z A;  2ZED A;  4COB A;  4P4D A;  1C30 B;  4C8A A;  5A27 A;  4P44 A;  2AFM A;  2FM4 A;  3D4U A;  3KKW A;  3OB2 B;  5LRG A;  2G3A A;  2HB6 A;  4QC6 A;  5I4M A;  5EC4 A;  2B3V A;  4CYQ A;  4X8I A;  3VTA A;  4C8F A;  4ZY0 A;  1M1D A;  3LWU A;  1YVK A;  1CE8 B;  2PJ6 A;  3TLB A;  1PYT B;  2CBL A;  1N71 A;  7CPA A;  4KNG E;  2QML A;  4YWY A;  2DEA A;  5CPA A;  3R95 A;  4OIW A;  2JEW A;  2FL4 A;  1PCA A;  2OU2 A;  2ZEP A;  3SI0 A;  4C85 A;  1KUY A;  4JZ0 A;  5AGE A;  1HEE A;  2I00 A;  1S3Z A;  2ZW4 A;  3G3S A;  5FVJ A;  3V38 A;  1ZG7 A;  1S7N A;  1DE4 C;  1B47 A;  3MGD A;  2B4J C;  4HNX B;  4OP4 A;  4X2T A;  3N7Z A;  4G1P A;  3V8I A;  3NFQ A;  2BEI A;  2P0W A;  4MFJ A;  2DPT A;  4Q7A A;  3B35 A;  3FX6 A;  5EBV A;  2Q4Y A;  3CPX A;  4MXU A;  3PT1 A;  2AFZ A;  4Y49 C;  3WC7 A;  4CAW A;  1XF1 A;  1M4D A;  1YW6 A;  3BJ8 A;  3BHX A;  1QSN A;  3IC1 A;  2EO8 A;  4JLY A;  2XPL A;  4NFR A;  3CXP A;  2POK A;  4M6G A;  4UA3 A;  3VWD A;  2RFH A;  4YFJ A;  2B4D A;  2JBK A;  4OC1 A;  2J8R A;  2PJ3 A;  4ZBG A;  3L2N A;  2FSR A;  2G3T A;  1XRY A;  3DDD A;  3TOA A;  2YJT A;  2IQ6 A;  1VHO A;  1EO0 A;  3NOJ A;  1BPN A;  1J4J A;  2HC9 A;  2WYR A;  4I49 A;  3VRO A;  2FIA A;  2V8G A;  3B3S A;  4KOS A;  2OOT A;  4BPW B;  2ZEE A;  4FD7 A;  4A95 A;  3I9S A;  2Y1M A;  2C6P A;  2QEC A;  4PXE A;  1V6C A;  4INJ A;  1ZLH A;  3ISZ A;  1S7L A;  5AXI A;  1AYE A;  2ABZ A;  2AE6 A;  3FRM A;  4FWU A;  4PXB A;  4K30 A;  4U9Z A;  2V8D A;  5HMN A;  1VGY A;  3T07 A;  1XMT A;  3A9L A;  3B3W A;  4F9V A;  2KCW A;  4UCP A;  3TLE A;  3EFA A;  2VZY A;  3D66 A;  4KLV A;  5HVH A;  4HPS A;  3HPH E;  5LRK A;  2QJ8 A;  2YNE A;  3ICU A;  1LFW A;  5LYI A;  4QBJ A;  4MFP A;  4EWT A;  1X12 A;  2PVW A;  4II9 A;  2YND A;  3DGV A;  1CP6 A;  1RTQ A;  2ZEF A;  2ZEG A;  3IIB A;  1Q2C A;  2OZG A;  4M6H A;  2GP4 A;  3T05 A;  3SJX A;  5K8N A;  1Z2L A;  5DS0 A;  4DUK A;  4LQG A;  2WUU A;  3CPA A;  1CM0 A;  2P6E A;  5IR2 A;  1BPM A;  4NGS A;  2OZU A;  4YRH A;  2P6G A;  2EWB A;  1YLE A;  3BUW B;  3PEI A;  3BUN B;  1Q2Y A;  4FAI A;  1XEB A;  1IIC A;  4UFW A;  4OC2 A;  2XPP A;  5HVF A;  4CPA A;  3K9U A;  4RUH A;  1Z4R A;  1IY7 A;  2O28 A;  3KQZ A;  5AG6 A;  4KVO E;  4O23 A;  2XPN A;  2B4D B;  4CGL A;  3HMJ G;  1RXT A;  3EZB A;  2Q7B A;  1MJA A;  4P4F A;  3CXS A;  1BLL E;  1YVO A;  2J9A A;  3C26 A;  4MBU A;  4C2X A;  3WC6 A;  1S7F A;  3GYA A;  4HKF A;  4TNU A;  2PJB A;  2XEG A;  4B10 A;  4P4E A;  4KSA A;  4PPZ A;  3H8G A;  4NJQ A;  4XNH C;  3IWW A;  1F2O A;  2FCK A;  3JRU A;  4JXR A;  5HKY A;  2DF5 A;  3FB3 A;  2GLF A; 
#chains in the Genus database with same CATH homology
 3PBE A;  3PRT A;  4FBE A;  3S9N A;  1TKF A;  3ICU A;  4IK2 A;  2C1C A;  2XEF A;  1KWM A;  3PFE A;  1WVM A;  4X3R A;  3KI9 A;  1Z8L A;  5LRJ A;  3D7G A;  5LYF A;  3WC5 A;  1Y0R A;  4C84 A;  2PJ0 A;  3SJG A;  4WWV A;  4MHY A;  1Q7L A;  5K8O A;  3FVL A;  2PJ1 A;  3I6S A;  2IMO A;  2Q51 A;  1TF8 A;  2V77 A;  2Q43 A;  3PFO A;  4C9R A;  2GRE A;  2ANP A;  4ZY2 A;  4AXV A;  2QVP A;  3HUV A;  1CPX A;  3MRU A;  2ZOF A;  3S9L A;  3DLJ A;  3D7D A;  4UIA A;  4H2K A;  3I1U A;  1JQG A;  3VAR A;  4P4J A;  4NGP A;  3IEH A;  2ZOG A;  1TKJ A;  3HLP A;  3VAT A;  1QQ9 A;  4MCP A;  2PJ5 A;  4R7M A;  3RAM A;  4C9U A;  5J1Q A;  4OC0 A;  2PJ4 A;  4YU9 A;  3QNV A;  3LMS A;  1CX8 A;  4ZX8 A;  1Z5R A;  2EK9 A;  2ZEM A;  2GU2 A;  2AFX A;  4NGQ A;  4OC5 A;  2C6C A;  4JYW A;  2PJ2 A;  2XEI A;  4OKO A;  2CTB A;  3EIF A;  1LAN A;  4WJB A;  2AFW A;  3PB4 X;  4CDK A;  3NH8 A;  4PXC A;  1AMP A;  2AFO A;  3B3V A;  1GYT A;  2O4H A;  3SI2 A;  2JBJ A;  3D7H A;  3KGQ A;  1ZG9 A;  3BI1 A;  3IJ3 A;  5LYD A;  3BI0 A;  4UEE A;  1VIX A;  3B3C A;  4DYO A;  3FED A;  1H8L A;  2EK8 A;  1TF9 A;  1R3N A;  1ZG8 A;  4FUU A;  3FH4 A;  3PB7 X;  5HXD A;  1XBU A;  2IJZ A;  8CPA A;  5ELY A;  3CT9 A;  5JH9 A;  1CPS A;  4GM5 A;  3KAS A;  1FNO A;  3RZA A;  2C6G A;  4P4I A;  3FEC A;  4ZYQ A;  1F2P A;  1M4L A;  4EFD A;  4EME A;  4MMO A;  1ARM A;  2PJ9 A;  2PRQ A;  2BCO A;  4P10 A;  2F8H A;  1HDU A;  1LAP A;  4BD9 A;  1YSJ A;  3B3T A;  3KHZ A;  3KR4 A;  3VH9 A;  4ONW A;  2ZEN A;  4CDJ A;  3NFZ A;  5IB9 A;  2NSM A;  1Y0Y A;  1YW4 A;  2VL1 A;  2CF4 A;  4ZX9 A;  2AFU A;  2ZEH A;  1YME A;  3D7F A;  1ZLI A;  5D8N A;  3SJF A;  1Y7E A;  1Y9Z A;  2PJC A;  4NGT A;  3PB8 X;  1R43 A;  3KL9 A;  1HDQ A;  5K8P A;  4PXD A;  4ZY1 A;  4UEF A;  1DTD A;  5THW A;  5HVG A;  3FF3 A;  1TKH A;  1EE3 P;  1XJO A;  3KR5 A;  1UWY A;  4KSI A;  1LCP A;  4NJR A;  3PB9 X;  4DJL A;  4PQA A;  4P4B A;  3ISX A;  4R6T A;  4OID A;  3MN8 A;  4MHN A;  4UEZ A;  4OC3 A;  2V8V A;  4F8Z A;  4MCQ A;  1IGB A;  2PJ8 A;  4A38 A;  4A37 A;  2PIY A;  2ZEL A;  4UIB A;  4IHM A;  2BO9 A;  4C8P A;  4NGN A;  1LAM A;  1TXR A;  2PJA A;  4IAV A;  2RB7 A;  1XFO A;  4UF4 A;  4C8T A;  4MHZ A;  4Z65 A;  3PBB A;  2PCU A;  4ZI6 A;  5LYL A;  4R8F A;  4MCR A;  1CBX A;  3GUX A;  5JGF A;  1CP7 A;  1LOK A;  4TJX A;  3PB6 X;  3K2K A;  4C8C A;  3KZW A;  3B7I A;  3D68 A;  4OC4 A;  2BOA A;  3IFE A;  3GLJ A;  4C99 A;  3V7Z A;  2F7V A;  3TX8 A;  4F9U A;  2OR4 A;  4C8U A;  3N5F A;  4MRI A;  1VHE A;  2I3C A;  2V8H A;  2QYV A;  1OBR A;  2O53 A;  3SI1 A;  2PE3 A;  3TC8 A;  2WZN A;  4OME A;  3SJE A;  3B2Y A;  3T8W A;  4TJV A;  4R76 A;  1XMB A;  2PJ7 A;  1BAV A;  3FMC A;  4P6Y A;  4A94 A;  3WT4 A;  4NGM A;  3WAB A;  2AFS A;  1YLO A;  2NYQ A;  1F57 A;  1NSA A;  4A39 A;  3FJU A;  3H8E A;  4C9E A;  2PVV A;  5CBM A;  1FT7 A;  3FEE A;  4YN3 A;  3BXM A;  1ARL A;  5JM6 A;  4C9A A;  4K3N A;  4MCS A;  3GB0 A;  2GLJ A;  4P45 A;  3H8F A;  1ELL P;  2CTC A;  3IO1 A;  6CPA A;  4B6Z A;  4EWT A;  3D67 A;  3KHX A;  1QMU A;  2ZEO A;  3NA6 A;  3NH5 A;  5K8M A;  4NGR A;  3CDX A;  4TWE A;  1CG2 A;  4MHP A;  3NH4 A;  5F09 A;  4W9Y A;  4C86 A;  1ELM P;  2CIJ A;  3S9M A;  2XEJ A;  3RBU A;  3K9T A;  2PIZ A;  3KQX A;  3I74 A;  2C5Q A;  4C9V A;  2G9D A;  5D29 A;  2FVG A;  2Q4Z A;  2ZED A;  4P4D A;  4C8A A;  4P44 A;  2AFM A;  3D4U A;  5LRG A;  2HB6 A;  5I4M A;  4X8I A;  3VTA A;  4C8F A;  4ZY0 A;  3LWU A;  2PJ6 A;  1PYT B;  7CPA A;  4KNG E;  4YWY A;  2DEA A;  5CPA A;  4OIW A;  2JEW A;  1PCA A;  3SI0 A;  2ZEP A;  4C85 A;  4JZ0 A;  1HEE A;  3V38 A;  1ZG7 A;  4OP4 A;  1DE4 C;  4X2T A;  4G1P A;  4Q7A A;  3B35 A;  3FX6 A;  3WC7 A;  3CPX A;  4MXU A;  2AFZ A;  1XF1 A;  1YW6 A;  3BHX A;  3IC1 A;  4NFR A;  2POK A;  2RFH A;  2JBK A;  4OC1 A;  2PJ3 A;  3L2N A;  1XRY A;  2IQ6 A;  1VHO A;  1BPN A;  2WYR A;  2HC9 A;  3B3S A;  2V8G A;  2OOT A;  2ZEE A;  2C6P A;  4PXE A;  1V6C A;  1ZLH A;  3ISZ A;  4FWU A;  1AYE A;  2ABZ A;  4PXB A;  2V8D A;  1VGY A;  3B3W A;  4F9V A;  5HVH A;  3D66 A;  5LRK A;  2QJ8 A;  1LFW A;  5LYI A;  2PVW A;  3DGV A;  1CP6 A;  1RTQ A;  2ZEF A;  2ZEG A;  3IIB A;  2GP4 A;  3SJX A;  5K8N A;  1Z2L A;  5DS0 A;  4DUK A;  4LQG A;  3CPA A;  5IR2 A;  1BPM A;  4NGS A;  2EWB A;  3PEI A;  4FAI A;  5HVF A;  4OC2 A;  4CPA A;  4RUH A;  1IY7 A;  3KQZ A;  4O23 A;  4P4F A;  1BLL E;  2J9A A;  3WC6 A;  4TNU A;  2PJB A;  2XEG A;  4P4E A;  4PPZ A;  3H8G A;  4NJQ A;  3IWW A;  1F2O A;  3JRU A;  2GLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...