3D7GA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcmc, a urea-based inhibitor
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 265
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7gA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7gA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7gA02
2PJ8A 3H8EA 4MHZA 4NJQA 4ZY0A 4OC3A 3EIFA 5F09A 3S9LA 1LAMA 2PJ3A 3KR5A 1VGYA 4C85A 1AYEA 5JGFA 1TF9A 2PJ4A 2AFUA 4G1PA 2PJ5A 3HLPA 1PCAA 1ZLHA 1GYTA 4MHYA 1ELLP 1WVMA 2C1CA 3KZWA 2CTBA 4F9UA 5HVFA 2GLJA 5CPAA 3KHZA 4P4BA 3KQZA 4UIBA 4GM5A 3NFZA 2F7VA 1XFOA 4H2KA 1Y9ZA 2ZOGA 4IK2A 4P4DA 2PJ0A 2POKA 3KQXA 2HC9A 2EWBA 2ZEEA 2PVWA 2NYQA 4O23A 1YW6A 1F2PA 3VARA 4MRIA 4JYWA 3WT4A 3DLJA 2BCOA 3FEEA 2I3CA 5IB9A 4NGPA 2ANPA 1CX8A 4Q7AA 3BI1A 5LYDA 2BOAA 3IIBA 2PIYA 1V6CA 3NH4A 5JM6A 2PJ7A 3SI1A 3B3VA 5LRJA 3PB4X 1IGBA 4R8FA 2PVVA 3RBUA 2AFMA 1DE4C 3KI9A 3D4UA 4NJRA 3B3CA 3IWWA 3B35A 3IFEA 1ZLIA 3IO1A 4FBEA 2JEWA 3ISXA 3L2NA 2IMOA 1QQ9A 2EK9A 2WZNA 4C8PA 3GB0A 1YMEA 4OIDA 2V8VA 1Z5RA 1LCPA 3FX6A 4F9VA 2OR4A 1BAVA 1VIXA 3SJGA 4WWVA 4C86A 1YLOA 4EWTA 2C6PA 3S9NA 1TKHA 2PJBA 4P10A 1AMPA 4PXBA 4FAIA 3PFEA 4C8CA 3PB6X 5THWA 2Q43A 2V8GA 3B3WA 4R76A 3CDXA 4OC1A 4PPZA 2ZEPA 5K8OA 1TXRA 2IQ6A 2DEAA 3WC5A 2O53A 1NSAA 4NGTA 3D7GA 4JZ0A 3B7IA 4TJXA 1JQGA 3GLJA 2OOTA 2PE3A 2V8DA 4UEEA 1ARLA 2ZEGA 4MCSA 2V8HA 4F8ZA 1UWYA 5HXDA 1CG2A 3D7HA 3CPAA 8CPAA 3D7FA 3PRTA 4NGSA 4C84A 5DS0A 4IHMA 3MRUA 2AFZA 3IEHA 4BD9A 4MMOA 4PXCA 4TWEA 3H8GA 3IC1A 1ARMA 2RFHA 4UIAA 2WYRA 5D29A 2PJ2A 3D66A 2FVGA 3D67A 4UEFA 1YSJA 5D8NA 3RAMA 3VTAA 3PB9X 3KASA 2ZEDA 1Z8LA 4YN3A 3I1UA 5K8PA 2F8HA 1CP7A 3FEDA 3D68A 4P4EA 3S9MA 1F57A 5I4MA 4C9RA 3FH4A 4FWUA 4ZYQA 1F2OA 4MHNA 4ZI6A 1HEEA 1IY7A 2NSMA 3GUXA 4X3RA 2ZOFA 1VHEA 3LMSA 2Q4ZA 1TF8A 3KL9A 2XEFA 2XEJA 5LYIA 4C9UA 4ONWA 1QMUA 1XF1A 4OC5A 3SI2A 4LQGA 4B6ZA 2PIZA 4C8TA 3TC8A 1CPXA 5ELYA 4MCPA 1PYTB 4ZY2A 3WABA 1CP6A 1ELMP 2GREA 3BI0A 4ZY1A 4KSIA 3N5FA 3ISZA 1TKFA 6CPAA 4TJVA 5JH9A 4TNUA 7CPAA 3TX8A 4A39A 2AFWA 1LANA 3HUVA 2HB6A 2G9DA 5HVGA 4C8AA 2CF4A 3V38A 1VHOA 1R3NA 2C6CA 2XEIA 1LOKA 1Z2LA 1DTDA 2QJ8A 2ABZA 4C9VA 4MHPA 3WC7A 3FECA 1FT7A 3PB8X 4OC0A 4X8IA 1ZG9A 4ZX8A 3PB7X 4UF4A 4OC2A 1HDQA 1M4LA 2GLFA 3SJEA 1YW4A 3IJ3A 3PEIA 3K9TA 3VATA 4P4IA 4A94A 2RB7A 4C8UA 3CPXA 1H8LA 2C6GA 4EMEA 1LFWA 4R6TA 2AFOA 5K8MA 1XRYA 3FMCA 3B3TA 4P45A 3H8FA 3WC6A 2AFSA 3KHXA 4PXDA 4DYOA 3JRUA 4OP4A 5LRKA 1BLLE 3DGVA 4IAVA 5LYFA 4WJBA 1EE3P 4P4FA 4W9YA 2PJ9A 1ZG7A 4FUUA 3V7ZA 5K8NA 4AXVA 1KWMA 3FVLA 1Q7LA 4CPAA 1Y0YA 2VL1A 4DUKA 2ZEFA 3I74A 1XMBA 3LWUA 5LRGA 2BO9A 5LYLA 4C9AA 4OC4A 1RTQA 1CBXA 4DJLA 3SI0A 2J9AA 2O4HA 4A37A 4YU9A 3D7DA 1CPSA 4KNGE 1Y0RA 3B2YA 4C9EA 2CTCA 4MXUA 4P4JA 3RZAA 2IJZA 2PJCA 2ZELA 1XJOA 4ZX9A 4P6YA 2ZEMA 2PJAA 3CT9A 3VH9A 3T8WA 3QNVA 4R7MA 1LAPA 3NH5A 4RUHA 2ZEHA 3KGQA 4MCRA 2XEGA 1TKJA 4OMEA 2ZENA 3PBBA 3FF3A 1XBUA 3B3SA 4CDKA 3K2KA 5HVHA 3NH8A 2ZEOA 3PBEA 4YWYA 2PRQA 4K3NA 2PJ1A 4OKOA 1BPMA 4CDJA 3FJUA 2QYVA 2CIJA 4C8FA 3SJXA 1HDUA 1R43A 1OBRA 3NA6A 3ICUA 4PXEA 4NGRA 2QVPA 4PQAA 2AFXA 3BHXA 4P44A 2Q51A 3I6SA 3SJFA 1FNOA 2PJ6A 3MN8A 4MCQA 5J1QA 2PCUA 2JBKA 1ZG8A 3BXMA 4NGNA 4C99A 4NFRA 4NGMA 3PFOA 5CBMA 1BPNA 4X2TA 2V77A 4OIWA 4A38A 3KR4A 4Z65A 4EFDA 4NGQA 1Y7EA 2GU2A 2EK8A 4UEZA 2JBJA
chains in the Genus database with same CATH superfamily
2ZXVA 1L0CA 2PJ8A 3H8EA 4MHZA 1MJ9A 4NJQA 4ZY0A 4OC3A 5J8FA 1IICA 2EVNA 5AGEA 1T36B 3EIFA 2E28A 5F09A 3S9LA 1LAMA 2PJ3A 3PZJA 1XF8A 3KR5A 1VGYA 4C85A 1AYEA 5JGFA 1TF9A 4A4BA 2PJ4A 3EZBA 2AFUA 2B58A 3BJ8A 4KVOE 4UA3A 4G1PA 2PJ5A 4JJXA 5AG7A 3HLPA 1PCAA 3U88C 1ZLHA 1FBVA 2EBJA 1GYTA 1XEBA 1ELLP 2JDDA 2P6EA 2C1CA 2QECA 3GY9A 3KZWA 3PP9A 4MHYA 1WVMA 2CTBA 4F9UA 3TLEA 3E0KA 3GKRA 2G0BA 4GXHA 5HVFA 3R96A 2GLJA 1JDEA 2HROA 1S5KA 4U9YA 4FD4A 5CPAA 3TYXA 3KHZA 2VZZA 2B3UA 1S7LA 4P4BA 3KQZA 5G22A 4C2YA 4UIBA 1FY7A 3G3SA 3QAHA 3W6XA 4B5PB 1J3LA 3G8WA 3JVNA 4GM5A 3NFZA 3RNZA 2F7VA 1XOVA 1Z8TA 1XFOA 2K5TA 4H2KA 4XNHB 2ZOGA 1Y9ZA 4IK2A 2H5MA 5AG4A 3FYNA 5F5XA 5JQ4A 2JLMA 1M1DA 4P4DA 2PJ0A 2YNCA 2POKA 4CGMA 3KQXA 2HC9A 4A2ZA 2EWBA 4MFLA 4KUAA 3TT2A 2FT0A 1MK4A 3KRVA 2ZEEA 2PVWA 1M4IA 1RXTA 2GANA 1I12A 1VBHA 4COGA 2NYQA 4LX9A 2DPTA 4O23A 2ZW6A 1YW6A 2ZW4A 1F2PA 2P6FA 2ZPAA 3P2HA 5F49A 4MFPA 3VARA 4CYQA 4E2AA 4MRIA 2JEVA 3TLYA 2B4DB 4UBRA 4JYWA 3PLFB 4KOUA 4UCPA 3WT4A 4RS2A 3BUMB 2Z3LA 3TFYA 3TCVA 3DLJA 5F9MA 3VWEA 3D8PA 2BCOA 3DSBA 1Z4EA 2D0PA 3FEEA 2DLAA 1QSRA 1Z9UA 2I3CA 2GE3A 4M6GA 4XPLA 5IB9A 4NGPA 1U6MA 2ANPA 4RN7A 4Y49C 1CX8A 4Q7AA 5J8CA 4MJ8A 2AE6A 3BI1A 5LYDA 2BOAA 3DR8A 3IIBA 5IX3A 2G3AA 2VQYA 4E8OA 1SQHA 2Z3OA 2PIYA 1V6CA 3NH4A 4NSQA 4M8DA 5JM6A 4KUBA 2J8MA 2PJ7A 4OAEA 2Z10A 3DNSA 2QIRA 3T05A 3T07A 3SI1A 3B3VA 3EZEA 5LRJA 3PB4X 1IGBA 1S7FA 4R8FA 2PVVA 3RBUA 2FXFA 4PK3A 3SHPA 2AFMA 1DE4C 3KI9A 3D4UA 4NJRA 3GIUA 4B10A 4OLLA 4ONUA 1M4GA 3BJ7A 2XPOA 3B3CA 3G23A 3IWWA 3B35A 1XE4A 4GPLB 3IFEA 3S6KA 1ZLIA 4XPDB 3IO1A 4L89A 4FBEA 2HV2A 4CAEA 4IIXA 2A4NA 4A95A 2JEWA 1M44A 4YGOA 3ISXA 3L2NA 3NFQA 2FE7A 1NBWA 1X10A 2IMOA 1KBLA 4B14A 1B6BA 1QQ9A 2EK9A 2WZNA 3FNCA 4C8PA 4H89A 1YMEA 3GB0A 2B0AA 3QB8A 3F8KA 1J4JA 4NF1A 4OIDA 5AXIA 3NE7A 5EBVA 2V8VA 2OZHA 1TIQA 4ORFA 3R9GA 3D3SA 3R1KA 4UCMA 4UFWA 2AUNA 2HI6A 1Z5RA 2VEZA 3TLGA 1IOIA 1LCPA 3FX6A 4CYOA 4F9VA 2OR4A 1BAVA 1VIXA 3D2MA 1CS0B 2X0SA 3SJGA 4WWVA 4C86A 1YLOA 5H86A 5BY0A 1NMTA 4EWTA 4KOSA 3F0AA 2C6PA 3S9NA 1TKHA 2PJBA 3CXQA 5C82A 3TLBA 1N71A 4BPWB 3A9LA 4QUSA 4CRZB 4P10A 2XPNA 1AMPA 4PXBA 3EFAA 4C2ZA 1LRZA 4FAIA 1PU9A 3PFEA 3TOBA 3PB6X 4C8CA 4BTFA 1YREA 2Q43A 2CXAA 4FD7A 2V8GA 5THWA 3U1BA 3B3WA 1P0HA 1X12A 2GFQA 3CDXA 4JWPA 4R76A 4OC1A 1IYLA 1KUYA 2ZEPA 4PPZA 4MY0A 3T90A 5K8OA 2Q04A 1TXRA 4CO9A 2VKZG 2IQ6A 2DEAA 2Z11A 4H6ZA 3WC5A 4NCZA 4NXYA 2X7BA 2O28A 2R8VA 2O53A 4OADA 3MGDA 4J3GA 3TE4A 2OH1A 1NSAA 4NGTA 3OAKA 1KC7A 4NEXA 3IU1A 3D7GA 4JZ0A 3B7IA 1NXJA 4TJXA 3T0TA 3HPGG 4R3KA 1JQGA 1JWQA 2AJ6A 2JDCA 3GLJA 4CAWA 4XNHC 5AG5A 2OOTA 2PE3A 2V8DA 4UEEA 1ARLA 5IV0A 3WR7A 2CY2A 3LD2A 3QAYA 2ZEGA 2Q7SA 4MCSA 2V8HA 4F8ZA 4JLYA 3W91A 4AVBA 3EC4A 5G20A 1UWYA 5HXDA 2P6GA 3VRPA 3R9FA 1CG2A 3D7HA 2Y1NA 2I79A 1EZBA 3CPAA 8CPAA 4KORA 3D7FA 3R9EA 5HKYA 2B4BA 4C2XA 4BPXB 3LACA 4CGOA 3EY5A 3S6GA 3UY5A 2NMTA 2D0OA 2PCNA 3PRTA 2CBLA 3TO7A 4NGSA 2ATRA 4C7IA 3S6HA 4C84A 5DS0A 4IHMA 3MRUA 2AFZA 2PR1A 3IEHA 4BD9A 3FRMA 1V0CA 3BUOB 2CNTA 4MMOA 4PXCA 4TWEA 5G21A 4CZ1A 3TO6A 4JD6A 3H8GA 4PSXA 3IC1A 1ARMA 1WWZA 2RFHA 4KLVA 1YQEA 1EZAA 4UFVA 2Z3KA 4XPKA 4UIAA 3CXPA 2WYRA 5D29A 3TTHA 2PJ2A 3D66A 2FVGA 1Q5XA 3D67A 4UEFA 1YSJA 1YLEA 5D8NA 2WPXA 3RAMA 1CM0A 2B4JC 3PB9X 3VTAA 4FD6A 4DNCA 2PDOA 3IWGA 3KASA 2ZEDA 1Z8LA 4YN3A 3I1UA 5K8PA 2BUEA 2B5GA 2F8HA 1Z8XA 1Q2YA 2REEA 2FCKA 5G1ZA 1CP7A 1KEEB 2QMLA 3FEDA 3D68A 4LQ6A 1QSMA 4AG7A 4P4EA 3S9MA 1F57A 4UWJA 5I4MA 3FXTA 3ZZIA 3P2FA 4CGNA 3R95A 1GHEA 3FH4A 5E96A 4FWUA 2RC4A 4C9RA 4ZYQA 1F2OA 4BPUB 1UFHA 2VBQA 3VRRA 3C26A 1Q2CA 4MHNA 4ZI6A 4KLWA 5F1YA 1I21A 1WK4A 5GCNA 4BINA 1HEEA 1IY7A 2NSMA 4XPDC 4IF5A 3GUXA 4B13A 5BWAB 1CE8B 4H6UA 4X3RA 2ZOFA 1VHEA 2WUUA 2C5QA 4BMHA 4IIYA 3HMJG 3GJZA 3SR3A 3LMSA 4CAVA 2Q4ZA 5AG6A 1TF8A 3KL9A 4K30A 2REFA 2I00A 2XEFA 2HWGA 4MI4A 3BUXB 2ZW5A 2XEJA 1YR0A 4KOXA 4RI1A 4C7HA 2OZGA 1P4NA 5LYIA 1R57A 2G3TA 2EZAA 3DR6A 5HKWA 4E94A 4C9UA 4ONWA 3TLGB 1QMUA 3KKWA 1AUGA 1XF1A 4OC5A 3LODA 3SI2A 4LQGA 2VZYA 4B11A 5J3XA 1Y9KA 4B6ZA 2PIZA 4QB9A 3T9YA 2CNMA 4C8TA 4L8AA 4R3LA 4CYPA 3TC8A 2UV8G 1CPXA 4II9A 1I1DA 1YVOA 5ELYA 5KTCA 2Y0MA 5JVLA 3OP0A 4KOWA 3V8IA 3VWDA 2ODFA 2R82A 1QSTA 3CZXA 4MCPA 1PYTB 1C30B 1M4DA 3FBUA 4ZY2A 3JTKA 3WABA 1CP6A 1ELMP 2GREA 3BI0A 4Y49B 4R9MA 4YRHA 4A31A 4M6HA 4M3SA 5ISVA 4ZY1A 3TO9A 4KSIA 3OWCA 3K9UA 3N5FA 5HKZA 3F5BA 3IWEA 3ISZA 4HNXB 3PT1A 3VRNA 3OB1B 3F9KC 1TKFA 6CPAA 4TJVA 5CNPA 4EVYA 1S60A 2EO8A 3VRQA 4IUSA 4TNUA 7CPAA 5JH9A 1C3OB 3TLCA 3TX8A 1GGOA 1ZL0A 4A39A 3NOJA 2AFWA 1Z9EA 2XPPA 1YK3A 1LANA 3HUVA 4A4CA 2HB6A 3I3GA 4AB7A 2G9DA 4H1HA 2YNCC 5HVGA 4ZGYB 4C8AA 2CF4A 1MJAA 3V38A 3NE8A 1VHOA 5I0CA 2Q0YA 4HNWB 1R3NA 2C6CA 2XEIA 2R98A 2BEIA 3B8GA 5A28A 2Q44A 3O8ZA 4MBUA 5FD8A 2IL4A 2Q4YA 5EMIA 2WPWA 1LOKA 4YFJA 1IU8A 2B3VA 1B47A 3OB2B 1VHSA 1Z2LA 2R1IA 3EXNA 4U5YA 4B5OA 4KOVA 4CGPA 4ZBGA 1Z8WA 2PSWA 1YX0A 1MJBA 1DTDA 3FB3A 3IGRA 4CAXA 5KTAA 2D4PA 2QJ8A 2ABZA 3SXOA 4C9VA 4MI1A 4UCNA 2FIWA 1Q2DA 1K4JA 1IB1E 4MHPA 3FECA 1FT7A 3JUWA 3WC7A 4MY3A 3PB8X 4OC0A 3PGPA 1ZG9A 4FD5A 4HKFA 4X8IA 4ZX8A 3PB7X 4UF4A 4OC2A 1HDQA 1M4LA 2GLFA 3SJEA 1YW4A 3IJ3A 3PEIA 3K9TA 5C88A 2YJTA 4F6AA 3VATA 5F47A 4P4IA 4A94A 1QSNA 1A2ZA 5KTDA 2RB7A 4C8UA 2PR8A 3CPXA 2PC1A 1H8LA 4COBA 1NE9A 4BBHA 3C8OA 2C6GA 3DDDA 5HH1A 4EMEA 1IIDA 1LFWA 4KS9A 2PQ8A 2AFOA 4R6TA 4MFKA 5K8MA 1XRYA 3BUWB 2MP0A 3FMCA 5A27A 4E5SA 3B3TA 2C27A 3BLNA 2ZW7A 4P45A 2B5GB 1YVHA 3H8FA 2OZUA 4A33A 2GIVA 4HPSA 3WC6A 2HUZA 5IR2A 2AFSA 2Q7BA 3KHXA 4F0XA 4PXDA 2OU2A 4DYOA 3JRUA 1BO4A 4C68A 4KOYA 4OP4A 1YVKA 5LRKA 3H4QA 1BLLE 3DGVA 4IAVA 3D2PA 4QBJA 5LYFA 4WJBA 1EE3P 4P4FA 4W9YA 2PJ9A 1WJTA 4CAFA 1ZG7A 2R7HA 4KZTA 4FUUA 3V7ZA 5K8NA 4AXVA 1KWMA 2YJVA 1OZPA 4PSWA 3FVLA 1Q7LA 3I9SA 4CPAA 1Y0YA 3K4IA 2VL1A 4DUKA 1YGHA 2ZEFA 3I74A 4KSFA 2FIAA 1XMTA 1XMBA 3FIXA 3LWUA 4HNYB 1EO0A 5DWNA 5LRGA 3TLZA 3VROA 3N7ZA 3PFVA 2BO9A 5FVJA 5LYLA 2J8RA 4C9AA 4OC4A 2Z3NA 5F48A 1RTQA 4A30A 1CBXA 2Z3MA 1ON0A 4DJLA 3SI0A 5HMNA 2J9AA 4QC6A 2O4HA 4U9ZA 4A37A 4YU9A 2DIKA 1PUAA 3D7DA 1CPSA 1Z4RA 2J8NA 4KNGE 1Y0RA 3TLAA 4Q38A 1NSLA 3B2YA 1DIKA 4C9EA 3ZJ0A 2CTCA 4B5PA 1BXRB 1A9XB 1XIXA 4P4JA 4MXUA 4LUAA 2P0WA 3RZAA 1VKCA 4B12A 1RO5A 4R57A 2GP4A 4MJXA 2IJZA 2PJCA 3HPHE 2ZELA 1XJOA 4KVME 4R87A 4ZX9A 4AVCA 4A32A 4P6YA 2ZEMA 2PJAA 2Z0ZA 3CT9A 3VH9A 3T8WA 3QNVA 4R7MA 1LAPA 3NH5A 4MFQA 4RUHA 5JYBA 2D4OA 2ZEHA 3KGQA 1S3ZA 2EUIA 4KOTA 4EYSA 4MCRA 2XEGA 4RR2B 1CJWA 4UFXA 1TKJA 2YNEA 4OMEA 2VI7A 3ZNIA 1R61A 2ZENA 2B4DA 3FF3A 1XBUA 3BUNB 3PBBA 4M6IA 2AUMA 3B3SA 4CDKA 3RYOA 3K2KA 5HVHA 1IYKA 3NH8A 4JXQA 4MFJA 2BL1A 2ZEOA 1KUXA 2PRBA 3PBEA 3W6SA 4YWYA 4AVAA 1S7KA 3TOAA 2Z3PA 2PRQA 4K3NA 2PJ1A 4OKOA 3S6FA 4I49A 4AG9A 1BPMA 4UWIA 4J0NA 4M85A 4CDJA 3FJUA 2QYVA 4KVXA 2CIJA 1B87A 4PV6A 5H84A 4C8FA 2HQYA 3SJXA 2ARHA 2YNDA 1HDUA 2N3AB 1R43A 1OBRA 3IU2A 3NA6A 1VBGA 3ICUA 4PXEA 4E0AA 2YGWA 4NGRA 2Y1MA 1KZFA 2QVPA 2VXKA 5F13A 3CXSA 1BOBA 2AFXA 3H5ZA 4PQAA 2F5IA 4PK2A 4QVTA 5IB0A 2FS5A 3BHXA 1QSOA 4P44A 2Q51A 2WSAA 3I6SA 3SJFA 4CS0B 1FNOA 3T5MA 2CNSA 5JPHA 2PJ6A 3MN8A 4CRYB 4MCQA 1ZYMA 4Q36A 2FSRA 2KCWA 4JXRA 5J1QA 2BSWA 2PCUA 2JBKA 1ZG8A 3BXMA 4NGNA 4C99A 2EZBA 1S7NA 2OLSA 2DF5A 4NFRA 4F0YA 3EO4A 4INJA 4NGMA 2DPSA 4CYNA 3PFOA 2EZCA 5CBMA 1ZO0A 1BPNA 5DWMA 4JVOA 3GYAA 2V77A 4OIWA 4X2TA 4A38A 4MHDA 1ZRSA 4KSAA 3KR4A 3RO0A 2Q4VA 4Z65A 2OB0A 2DXQA 4EFDA 4NGQA 5EC4A 1Y7EA 2GU2A 1Y9WA 5K99A 1VI4A 1M6VB 4CGLA 2XPLA 4X5KA 1JDBC 2FL4A 1IOFA 3EZAA 2FM4A 3VGOA 2EK8A 4UEZA 4MFZA 1KUVA 2JBJA 3SXNA 4GS4A 5F46A 1Y7RA
chains in the Genus database with same CATH topology
2PJ8A 3H8EA 4MHZA 4NJQA 4ZY0A 4OC3A 3EIFA 5F09A 3S9LA 1LAMA 2PJ3A 3KR5A 1VGYA 4C85A 1AYEA 5JGFA 1TF9A 2PJ4A 2AFUA 4G1PA 2PJ5A 3HLPA 1PCAA 1ZLHA 1GYTA 4MHYA 1ELLP 1WVMA 2C1CA 3KZWA 2CTBA 4F9UA 5HVFA 2GLJA 5CPAA 3KHZA 4P4BA 3KQZA 4UIBA 4GM5A 3NFZA 2F7VA 1XFOA 4H2KA 1Y9ZA 2ZOGA 4IK2A 4P4DA 2PJ0A 2POKA 3KQXA 2HC9A 2EWBA 2ZEEA 2PVWA 2NYQA 4O23A 1YW6A 1F2PA 3VARA 4MRIA 4JYWA 3WT4A 3DLJA 2BCOA 3FEEA 2I3CA 5IB9A 4NGPA 2ANPA 1CX8A 4Q7AA 3BI1A 5LYDA 2BOAA 3IIBA 2PIYA 1V6CA 3NH4A 5JM6A 2PJ7A 3SI1A 3B3VA 5LRJA 3PB4X 1IGBA 4R8FA 2PVVA 3RBUA 2AFMA 1DE4C 3KI9A 3D4UA 4NJRA 3B3CA 3IWWA 3B35A 3IFEA 1ZLIA 3IO1A 4FBEA 2JEWA 3ISXA 3L2NA 2IMOA 1QQ9A 2EK9A 2WZNA 4C8PA 3GB0A 1YMEA 4OIDA 2V8VA 1Z5RA 1LCPA 3FX6A 4F9VA 2OR4A 1BAVA 1VIXA 3SJGA 4WWVA 4C86A 1YLOA 4EWTA 2C6PA 3S9NA 1TKHA 2PJBA 4P10A 1AMPA 4PXBA 4FAIA 3PFEA 4C8CA 3PB6X 5THWA 2Q43A 2V8GA 3B3WA 4R76A 3CDXA 4OC1A 4PPZA 2ZEPA 5K8OA 1TXRA 2IQ6A 2DEAA 3WC5A 2O53A 1NSAA 4NGTA 3D7GA 4JZ0A 3B7IA 4TJXA 1JQGA 3GLJA 2OOTA 2PE3A 2V8DA 4UEEA 1ARLA 2ZEGA 4MCSA 2V8HA 4F8ZA 1UWYA 5HXDA 1CG2A 3D7HA 3CPAA 8CPAA 3D7FA 3PRTA 4NGSA 4C84A 5DS0A 4IHMA 3MRUA 2AFZA 3IEHA 4BD9A 4MMOA 4PXCA 4TWEA 3H8GA 3IC1A 1ARMA 2RFHA 4UIAA 2WYRA 5D29A 2PJ2A 3D66A 2FVGA 3D67A 4UEFA 1YSJA 5D8NA 3RAMA 3VTAA 3PB9X 3KASA 2ZEDA 1Z8LA 4YN3A 3I1UA 5K8PA 2F8HA 1CP7A 3FEDA 3D68A 4P4EA 3S9MA 1F57A 5I4MA 4C9RA 3FH4A 4FWUA 4ZYQA 1F2OA 4MHNA 4ZI6A 1HEEA 1IY7A 2NSMA 3GUXA 4X3RA 2ZOFA 1VHEA 2C5QA 3LMSA 2Q4ZA 1TF8A 3KL9A 2XEFA 2XEJA 5LYIA 4C9UA 4ONWA 1QMUA 1XF1A 4OC5A 3SI2A 4LQGA 4B6ZA 2PIZA 4C8TA 3TC8A 1CPXA 5ELYA 4MCPA 1PYTB 4ZY2A 3WABA 1CP6A 1ELMP 2GREA 3BI0A 4ZY1A 4KSIA 3N5FA 3ISZA 1TKFA 6CPAA 4TJVA 5JH9A 4TNUA 7CPAA 3TX8A 4A39A 2AFWA 1LANA 3HUVA 2HB6A 2G9DA 5HVGA 4C8AA 2CF4A 3V38A 1VHOA 1R3NA 2C6CA 2XEIA 1LOKA 1Z2LA 1DTDA 2QJ8A 2ABZA 4C9VA 4MHPA 3WC7A 3FECA 1FT7A 3PB8X 4OC0A 4X8IA 1ZG9A 4ZX8A 3PB7X 4UF4A 4OC2A 1HDQA 1M4LA 2GLFA 3SJEA 1YW4A 3IJ3A 3PEIA 3K9TA 3VATA 4P4IA 4A94A 2RB7A 4C8UA 3CPXA 1H8LA 2C6GA 4EMEA 1LFWA 4R6TA 2AFOA 5K8MA 1XRYA 3FMCA 3B3TA 4P45A 3H8FA 3WC6A 5IR2A 2AFSA 3KHXA 4PXDA 4DYOA 3JRUA 4OP4A 5LRKA 1BLLE 3DGVA 4IAVA 5LYFA 4WJBA 1EE3P 4P4FA 4W9YA 2PJ9A 1ZG7A 4FUUA 3V7ZA 5K8NA 4AXVA 1KWMA 3FVLA 1Q7LA 4CPAA 1Y0YA 2VL1A 4DUKA 2ZEFA 3I74A 1XMBA 3LWUA 5LRGA 2BO9A 5LYLA 4C9AA 4OC4A 1RTQA 1CBXA 4DJLA 3SI0A 2J9AA 2O4HA 4A37A 4YU9A 3D7DA 1CPSA 4KNGE 1Y0RA 3B2YA 4C9EA 2CTCA 4MXUA 4P4JA 3RZAA 2GP4A 2IJZA 2PJCA 2ZELA 1XJOA 4ZX9A 4P6YA 2ZEMA 2PJAA 3CT9A 3VH9A 3T8WA 3QNVA 4R7MA 1LAPA 3NH5A 4RUHA 2ZEHA 3KGQA 4MCRA 2XEGA 1TKJA 4OMEA 2ZENA 3PBBA 3FF3A 1XBUA 3B3SA 4CDKA 3K2KA 5HVHA 3NH8A 2ZEOA 3PBEA 4YWYA 2PRQA 4K3NA 2PJ1A 4OKOA 1BPMA 4CDJA 3FJUA 2QYVA 2CIJA 4C8FA 3SJXA 1HDUA 1R43A 1OBRA 3NA6A 3ICUA 4PXEA 4NGRA 2QVPA 4PQAA 2AFXA 3BHXA 4P44A 2Q51A 3I6SA 3SJFA 1FNOA 2PJ6A 3MN8A 4MCQA 5J1QA 2PCUA 2JBKA 1ZG8A 3BXMA 4NGNA 4C99A 4NFRA 4NGMA 3PFOA 5CBMA 1BPNA 4X2TA 2V77A 4OIWA 4A38A 3KR4A 4Z65A 4EFDA 4NGQA 1Y7EA 2GU2A 2EK8A 4UEZA 2JBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ8 A;  3H8E A;  4MHZ A;  4NJQ A;  4ZY0 A;  4OC3 A;  3EIF A;  5F09 A;  3S9L A;  1LAM A;  2PJ3 A;  3KR5 A;  1VGY A;  4C85 A;  1AYE A;  5JGF A;  1TF9 A;  2PJ4 A;  2AFU A;  4G1P A;  2PJ5 A;  3HLP A;  1PCA A;  1ZLH A;  1GYT A;  4MHY A;  1ELL P;  1WVM A;  2C1C A;  3KZW A;  2CTB A;  4F9U A;  5HVF A;  2GLJ A;  5CPA A;  3KHZ A;  4P4B A;  3KQZ A;  4UIB A;  4GM5 A;  3NFZ A;  2F7V A;  1XFO A;  4H2K A;  1Y9Z A;  2ZOG A;  4IK2 A;  4P4D A;  2PJ0 A;  2POK A;  3KQX A;  2HC9 A;  2EWB A;  2ZEE A;  2PVW A;  2NYQ A;  4O23 A;  1YW6 A;  1F2P A;  3VAR A;  4MRI A;  4JYW A;  3WT4 A;  3DLJ A;  2BCO A;  3FEE A;  2I3C A;  5IB9 A;  4NGP A;  2ANP A;  1CX8 A;  4Q7A A;  3BI1 A;  5LYD A;  2BOA A;  3IIB A;  2PIY A;  1V6C A;  3NH4 A;  5JM6 A;  2PJ7 A;  3SI1 A;  3B3V A;  5LRJ A;  3PB4 X;  1IGB A;  4R8F A;  2PVV A;  3RBU A;  2AFM A;  1DE4 C;  3KI9 A;  3D4U A;  4NJR A;  3B3C A;  3IWW A;  3B35 A;  3IFE A;  1ZLI A;  3IO1 A;  4FBE A;  2JEW A;  3ISX A;  3L2N A;  2IMO A;  1QQ9 A;  2EK9 A;  2WZN A;  4C8P A;  3GB0 A;  1YME A;  4OID A;  2V8V A;  1Z5R A;  1LCP A;  3FX6 A;  4F9V A;  2OR4 A;  1BAV A;  1VIX A;  3SJG A;  4WWV A;  4C86 A;  1YLO A;  4EWT A;  2C6P A;  3S9N A;  1TKH A;  2PJB A;  4P10 A;  1AMP A;  4PXB A;  4FAI A;  3PFE A;  4C8C A;  3PB6 X;  5THW A;  2Q43 A;  2V8G A;  3B3W A;  4R76 A;  3CDX A;  4OC1 A;  4PPZ A;  2ZEP A;  5K8O A;  1TXR A;  2IQ6 A;  2DEA A;  3WC5 A;  2O53 A;  1NSA A;  4NGT A;  3D7G A;  4JZ0 A;  3B7I A;  4TJX A;  1JQG A;  3GLJ A;  2OOT A;  2PE3 A;  2V8D A;  4UEE A;  1ARL A;  2ZEG A;  4MCS A;  2V8H A;  4F8Z A;  1UWY A;  5HXD A;  1CG2 A;  3D7H A;  3CPA A;  8CPA A;  3D7F A;  3PRT A;  4NGS A;  4C84 A;  5DS0 A;  4IHM A;  3MRU A;  2AFZ A;  3IEH A;  4BD9 A;  4MMO A;  4PXC A;  4TWE A;  3H8G A;  3IC1 A;  1ARM A;  2RFH A;  4UIA A;  2WYR A;  5D29 A;  2PJ2 A;  3D66 A;  2FVG A;  3D67 A;  4UEF A;  1YSJ A;  5D8N A;  3RAM A;  3VTA A;  3PB9 X;  3KAS A;  2ZED A;  1Z8L A;  4YN3 A;  3I1U A;  5K8P A;  2F8H A;  1CP7 A;  3FED A;  3D68 A;  4P4E A;  3S9M A;  1F57 A;  5I4M A;  4C9R A;  3FH4 A;  4FWU A;  4ZYQ A;  1F2O A;  4MHN A;  4ZI6 A;  1HEE A;  1IY7 A;  2NSM A;  3GUX A;  4X3R A;  2ZOF A;  1VHE A;  3LMS A;  2Q4Z A;  1TF8 A;  3KL9 A;  2XEF A;  2XEJ A;  5LYI A;  4C9U A;  4ONW A;  1QMU A;  1XF1 A;  4OC5 A;  3SI2 A;  4LQG A;  4B6Z A;  2PIZ A;  4C8T A;  3TC8 A;  1CPX A;  5ELY A;  4MCP A;  1PYT B;  4ZY2 A;  3WAB A;  1CP6 A;  1ELM P;  2GRE A;  3BI0 A;  4ZY1 A;  4KSI A;  3N5F A;  3ISZ A;  1TKF A;  6CPA A;  4TJV A;  5JH9 A;  4TNU A;  7CPA A;  3TX8 A;  4A39 A;  2AFW A;  1LAN A;  3HUV A;  2HB6 A;  2G9D A;  5HVG A;  4C8A A;  2CF4 A;  3V38 A;  1VHO A;  1R3N A;  2C6C A;  2XEI A;  1LOK A;  1Z2L A;  1DTD A;  2QJ8 A;  2ABZ A;  4C9V A;  4MHP A;  3WC7 A;  3FEC A;  1FT7 A;  3PB8 X;  4OC0 A;  4X8I A;  1ZG9 A;  4ZX8 A;  3PB7 X;  4UF4 A;  4OC2 A;  1HDQ A;  1M4L A;  2GLF A;  3SJE A;  1YW4 A;  3IJ3 A;  3PEI A;  3K9T A;  3VAT A;  4P4I A;  4A94 A;  2RB7 A;  4C8U A;  3CPX A;  1H8L A;  2C6G A;  4EME A;  1LFW A;  4R6T A;  2AFO A;  5K8M A;  1XRY A;  3FMC A;  3B3T A;  4P45 A;  3H8F A;  3WC6 A;  2AFS A;  3KHX A;  4PXD A;  4DYO A;  3JRU A;  4OP4 A;  5LRK A;  1BLL E;  3DGV A;  4IAV A;  5LYF A;  4WJB A;  1EE3 P;  4P4F A;  4W9Y A;  2PJ9 A;  1ZG7 A;  4FUU A;  3V7Z A;  5K8N A;  4AXV A;  1KWM A;  3FVL A;  1Q7L A;  4CPA A;  1Y0Y A;  2VL1 A;  4DUK A;  2ZEF A;  3I74 A;  1XMB A;  3LWU A;  5LRG A;  2BO9 A;  5LYL A;  4C9A A;  4OC4 A;  1RTQ A;  1CBX A;  4DJL A;  3SI0 A;  2J9A A;  2O4H A;  4A37 A;  4YU9 A;  3D7D A;  1CPS A;  4KNG E;  1Y0R A;  3B2Y A;  4C9E A;  2CTC A;  4MXU A;  4P4J A;  3RZA A;  2IJZ A;  2PJC A;  2ZEL A;  1XJO A;  4ZX9 A;  4P6Y A;  2ZEM A;  2PJA A;  3CT9 A;  3VH9 A;  3T8W A;  3QNV A;  4R7M A;  1LAP A;  3NH5 A;  4RUH A;  2ZEH A;  3KGQ A;  4MCR A;  2XEG A;  1TKJ A;  4OME A;  2ZEN A;  3PBB A;  3FF3 A;  1XBU A;  3B3S A;  4CDK A;  3K2K A;  5HVH A;  3NH8 A;  2ZEO A;  3PBE A;  4YWY A;  2PRQ A;  4K3N A;  2PJ1 A;  4OKO A;  1BPM A;  4CDJ A;  3FJU A;  2QYV A;  2CIJ A;  4C8F A;  3SJX A;  1HDU A;  1R43 A;  1OBR A;  3NA6 A;  3ICU A;  4PXE A;  4NGR A;  2QVP A;  4PQA A;  2AFX A;  3BHX A;  4P44 A;  2Q51 A;  3I6S A;  3SJF A;  1FNO A;  2PJ6 A;  3MN8 A;  4MCQ A;  5J1Q A;  2PCU A;  2JBK A;  1ZG8 A;  3BXM A;  4NGN A;  4C99 A;  4NFR A;  4NGM A;  3PFO A;  5CBM A;  1BPN A;  4X2T A;  2V77 A;  4OIW A;  4A38 A;  3KR4 A;  4Z65 A;  4EFD A;  4NGQ A;  1Y7E A;  2GU2 A;  2EK8 A;  4UEZ A;  2JBJ A; 
#chains in the Genus database with same CATH topology
 2ZXV A;  1L0C A;  2PJ8 A;  3H8E A;  4MHZ A;  1MJ9 A;  4NJQ A;  4ZY0 A;  4OC3 A;  5J8F A;  1IIC A;  2EVN A;  5AGE A;  1T36 B;  3EIF A;  2E28 A;  5F09 A;  3S9L A;  1LAM A;  2PJ3 A;  3PZJ A;  1XF8 A;  3KR5 A;  1VGY A;  4C85 A;  1AYE A;  5JGF A;  1TF9 A;  4A4B A;  2PJ4 A;  3EZB A;  2AFU A;  2B58 A;  3BJ8 A;  4KVO E;  4UA3 A;  4G1P A;  2PJ5 A;  4JJX A;  5AG7 A;  3HLP A;  1PCA A;  3U88 C;  1ZLH A;  1FBV A;  2EBJ A;  1GYT A;  1XEB A;  1ELL P;  2JDD A;  2P6E A;  2C1C A;  2QEC A;  3GY9 A;  3KZW A;  3PP9 A;  4MHY A;  1WVM A;  2CTB A;  4F9U A;  3TLE A;  3E0K A;  3GKR A;  2G0B A;  4GXH A;  5HVF A;  3R96 A;  2GLJ A;  1JDE A;  2HRO A;  1S5K A;  4U9Y A;  4FD4 A;  5CPA A;  3TYX A;  3KHZ A;  2VZZ A;  2B3U A;  1S7L A;  4P4B A;  3KQZ A;  5G22 A;  4C2Y A;  4UIB A;  1FY7 A;  3G3S A;  3QAH A;  3W6X A;  4B5P B;  1J3L A;  3G8W A;  3JVN A;  4GM5 A;  3NFZ A;  3RNZ A;  2F7V A;  1XOV A;  1Z8T A;  1XFO A;  2K5T A;  4H2K A;  4XNH B;  2ZOG A;  1Y9Z A;  4IK2 A;  2H5M A;  5AG4 A;  3FYN A;  5F5X A;  5JQ4 A;  2JLM A;  1M1D A;  4P4D A;  2PJ0 A;  2YNC A;  2POK A;  4CGM A;  3KQX A;  2HC9 A;  4A2Z A;  2EWB A;  4MFL A;  4KUA A;  3TT2 A;  2FT0 A;  1MK4 A;  3KRV A;  2ZEE A;  2PVW A;  1M4I A;  1RXT A;  2GAN A;  1I12 A;  1VBH A;  4COG A;  2NYQ A;  4LX9 A;  2DPT A;  4O23 A;  2ZW6 A;  1YW6 A;  2ZW4 A;  1F2P A;  2P6F A;  2ZPA A;  3P2H A;  5F49 A;  4MFP A;  3VAR A;  4CYQ A;  4E2A A;  4MRI A;  2JEV A;  3TLY A;  2B4D B;  4UBR A;  4JYW A;  3PLF B;  4KOU A;  4UCP A;  3WT4 A;  4RS2 A;  3BUM B;  2Z3L A;  3TFY A;  3TCV A;  3DLJ A;  5F9M A;  3VWE A;  3D8P A;  2BCO A;  3DSB A;  1Z4E A;  2D0P A;  3FEE A;  2DLA A;  1QSR A;  1Z9U A;  2I3C A;  2GE3 A;  4M6G A;  4XPL A;  5IB9 A;  4NGP A;  1U6M A;  2ANP A;  4RN7 A;  4Y49 C;  1CX8 A;  4Q7A A;  5J8C A;  4MJ8 A;  2AE6 A;  3BI1 A;  5LYD A;  2BOA A;  3DR8 A;  3IIB A;  5IX3 A;  2G3A A;  2VQY A;  4E8O A;  1SQH A;  2Z3O A;  2PIY A;  1V6C A;  3NH4 A;  4NSQ A;  4M8D A;  5JM6 A;  4KUB A;  2J8M A;  2PJ7 A;  4OAE A;  2Z10 A;  3DNS A;  2QIR A;  3T05 A;  3T07 A;  3SI1 A;  3B3V A;  3EZE A;  5LRJ A;  3PB4 X;  1IGB A;  1S7F A;  4R8F A;  2PVV A;  3RBU A;  2FXF A;  4PK3 A;  3SHP A;  2AFM A;  1DE4 C;  3KI9 A;  3D4U A;  4NJR A;  3GIU A;  4B10 A;  4OLL A;  4ONU A;  1M4G A;  3BJ7 A;  2XPO A;  3B3C A;  3G23 A;  3IWW A;  3B35 A;  1XE4 A;  4GPL B;  3IFE A;  3S6K A;  1ZLI A;  4XPD B;  3IO1 A;  4L89 A;  4FBE A;  2HV2 A;  4CAE A;  4IIX A;  2A4N A;  4A95 A;  2JEW A;  1M44 A;  4YGO A;  3ISX A;  3L2N A;  3NFQ A;  2FE7 A;  1NBW A;  1X10 A;  2IMO A;  1KBL A;  4B14 A;  1B6B A;  1QQ9 A;  2EK9 A;  2WZN A;  3FNC A;  4C8P A;  4H89 A;  1YME A;  3GB0 A;  2B0A A;  3QB8 A;  3F8K A;  1J4J A;  4NF1 A;  4OID A;  5AXI A;  3NE7 A;  5EBV A;  2V8V A;  2OZH A;  1TIQ A;  4ORF A;  3R9G A;  3D3S A;  3R1K A;  4UCM A;  4UFW A;  2AUN A;  2HI6 A;  1Z5R A;  2VEZ A;  3TLG A;  1IOI A;  1LCP A;  3FX6 A;  4CYO A;  4F9V A;  2OR4 A;  1BAV A;  1VIX A;  3D2M A;  1CS0 B;  2X0S A;  3SJG A;  4WWV A;  4C86 A;  1YLO A;  5H86 A;  5BY0 A;  1NMT A;  4EWT A;  4KOS A;  3F0A A;  2C6P A;  3S9N A;  1TKH A;  2PJB A;  3CXQ A;  5C82 A;  3TLB A;  1N71 A;  4BPW B;  3A9L A;  4QUS A;  4CRZ B;  4P10 A;  2XPN A;  1AMP A;  4PXB A;  3EFA A;  4C2Z A;  1LRZ A;  4FAI A;  1PU9 A;  3PFE A;  3TOB A;  3PB6 X;  4C8C A;  4BTF A;  1YRE A;  2Q43 A;  2CXA A;  4FD7 A;  2V8G A;  5THW A;  3U1B A;  3B3W A;  1P0H A;  1X12 A;  2GFQ A;  3CDX A;  4JWP A;  4R76 A;  4OC1 A;  1IYL A;  1KUY A;  2ZEP A;  4PPZ A;  4MY0 A;  3T90 A;  5K8O A;  2Q04 A;  1TXR A;  4CO9 A;  2VKZ G;  2IQ6 A;  2DEA A;  2Z11 A;  4H6Z A;  3WC5 A;  4NCZ A;  4NXY A;  2X7B A;  2O28 A;  2R8V A;  2O53 A;  4OAD A;  3MGD A;  4J3G A;  3TE4 A;  2OH1 A;  1NSA A;  4NGT A;  3OAK A;  1KC7 A;  4NEX A;  3IU1 A;  3D7G A;  4JZ0 A;  3B7I A;  1NXJ A;  4TJX A;  3T0T A;  3HPG G;  4R3K A;  1JQG A;  1JWQ A;  2AJ6 A;  2JDC A;  3GLJ A;  4CAW A;  4XNH C;  5AG5 A;  2OOT A;  2PE3 A;  2V8D A;  4UEE A;  1ARL A;  5IV0 A;  3WR7 A;  2CY2 A;  3LD2 A;  3QAY A;  2ZEG A;  2Q7S A;  4MCS A;  2V8H A;  4F8Z A;  4JLY A;  3W91 A;  4AVB A;  3EC4 A;  5G20 A;  1UWY A;  5HXD A;  2P6G A;  3VRP A;  3R9F A;  1CG2 A;  3D7H A;  2Y1N A;  2I79 A;  1EZB A;  3CPA A;  8CPA A;  4KOR A;  3D7F A;  3R9E A;  5HKY A;  2B4B A;  4C2X A;  4BPX B;  3LAC A;  4CGO A;  3EY5 A;  3S6G A;  3UY5 A;  2NMT A;  2D0O A;  2PCN A;  3PRT A;  2CBL A;  3TO7 A;  4NGS A;  2ATR A;  4C7I A;  3S6H A;  4C84 A;  5DS0 A;  4IHM A;  3MRU A;  2AFZ A;  2PR1 A;  3IEH A;  4BD9 A;  3FRM A;  1V0C A;  3BUO B;  2CNT A;  4MMO A;  4PXC A;  4TWE A;  5G21 A;  4CZ1 A;  3TO6 A;  4JD6 A;  3H8G A;  4PSX A;  3IC1 A;  1ARM A;  1WWZ A;  2RFH A;  4KLV A;  1YQE A;  1EZA A;  4UFV A;  2Z3K A;  4XPK A;  4UIA A;  3CXP A;  2WYR A;  5D29 A;  3TTH A;  2PJ2 A;  3D66 A;  2FVG A;  1Q5X A;  3D67 A;  4UEF A;  1YSJ A;  1YLE A;  5D8N A;  2WPX A;  3RAM A;  1CM0 A;  2B4J C;  3PB9 X;  3VTA A;  4FD6 A;  4DNC A;  2PDO A;  3IWG A;  3KAS A;  2ZED A;  1Z8L A;  4YN3 A;  3I1U A;  5K8P A;  2BUE A;  2B5G A;  2F8H A;  1Z8X A;  1Q2Y A;  2REE A;  2FCK A;  5G1Z A;  1CP7 A;  1KEE B;  2QML A;  3FED A;  3D68 A;  4LQ6 A;  1QSM A;  4AG7 A;  4P4E A;  3S9M A;  1F57 A;  4UWJ A;  5I4M A;  3FXT A;  3ZZI A;  3P2F A;  4CGN A;  3R95 A;  1GHE A;  3FH4 A;  5E96 A;  4FWU A;  2RC4 A;  4C9R A;  4ZYQ A;  1F2O A;  4BPU B;  1UFH A;  2VBQ A;  3VRR A;  3C26 A;  1Q2C A;  4MHN A;  4ZI6 A;  4KLW A;  5F1Y A;  1I21 A;  1WK4 A;  5GCN A;  4BIN A;  1HEE A;  1IY7 A;  2NSM A;  4XPD C;  4IF5 A;  3GUX A;  4B13 A;  5BWA B;  1CE8 B;  4H6U A;  4X3R A;  2ZOF A;  1VHE A;  2WUU A;  2C5Q A;  4BMH A;  4IIY A;  3HMJ G;  3GJZ A;  3SR3 A;  3LMS A;  4CAV A;  2Q4Z A;  5AG6 A;  1TF8 A;  3KL9 A;  4K30 A;  2REF A;  2I00 A;  2XEF A;  2HWG A;  4MI4 A;  3BUX B;  2ZW5 A;  2XEJ A;  1YR0 A;  4KOX A;  4RI1 A;  4C7H A;  2OZG A;  1P4N A;  5LYI A;  1R57 A;  2G3T A;  2EZA A;  3DR6 A;  5HKW A;  4E94 A;  4C9U A;  4ONW A;  3TLG B;  1QMU A;  3KKW A;  1AUG A;  1XF1 A;  4OC5 A;  3LOD A;  3SI2 A;  4LQG A;  2VZY A;  4B11 A;  5J3X A;  1Y9K A;  4B6Z A;  2PIZ A;  4QB9 A;  3T9Y A;  2CNM A;  4C8T A;  4L8A A;  4R3L A;  4CYP A;  3TC8 A;  2UV8 G;  1CPX A;  4II9 A;  1I1D A;  1YVO A;  5ELY A;  5KTC A;  2Y0M A;  5JVL A;  3OP0 A;  4KOW A;  3V8I A;  3VWD A;  2ODF A;  2R82 A;  1QST A;  3CZX A;  4MCP A;  1PYT B;  1C30 B;  1M4D A;  3FBU A;  4ZY2 A;  3JTK A;  3WAB A;  1CP6 A;  1ELM P;  2GRE A;  3BI0 A;  4Y49 B;  4R9M A;  4YRH A;  4A31 A;  4M6H A;  4M3S A;  5ISV A;  4ZY1 A;  3TO9 A;  4KSI A;  3OWC A;  3K9U A;  3N5F A;  5HKZ A;  3F5B A;  3IWE A;  3ISZ A;  4HNX B;  3PT1 A;  3VRN A;  3OB1 B;  3F9K C;  1TKF A;  6CPA A;  4TJV A;  5CNP A;  4EVY A;  1S60 A;  2EO8 A;  3VRQ A;  4IUS A;  4TNU A;  7CPA A;  5JH9 A;  1C3O B;  3TLC A;  3TX8 A;  1GGO A;  1ZL0 A;  4A39 A;  3NOJ A;  2AFW A;  1Z9E A;  2XPP A;  1YK3 A;  1LAN A;  3HUV A;  4A4C A;  2HB6 A;  3I3G A;  4AB7 A;  2G9D A;  4H1H A;  2YNC C;  5HVG A;  4ZGY B;  4C8A A;  2CF4 A;  1MJA A;  3V38 A;  3NE8 A;  1VHO A;  5I0C A;  2Q0Y A;  4HNW B;  1R3N A;  2C6C A;  2XEI A;  2R98 A;  2BEI A;  3B8G A;  5A28 A;  2Q44 A;  3O8Z A;  4MBU A;  5FD8 A;  2IL4 A;  2Q4Y A;  5EMI A;  2WPW A;  1LOK A;  4YFJ A;  1IU8 A;  2B3V A;  1B47 A;  3OB2 B;  1VHS A;  1Z2L A;  2R1I A;  3EXN A;  4U5Y A;  4B5O A;  4KOV A;  4CGP A;  4ZBG A;  1Z8W A;  2PSW A;  1YX0 A;  1MJB A;  1DTD A;  3FB3 A;  3IGR A;  4CAX A;  5KTA A;  2D4P A;  2QJ8 A;  2ABZ A;  3SXO A;  4C9V A;  4MI1 A;  4UCN A;  2FIW A;  1Q2D A;  1K4J A;  1IB1 E;  4MHP A;  3FEC A;  1FT7 A;  3JUW A;  3WC7 A;  4MY3 A;  3PB8 X;  4OC0 A;  3PGP A;  1ZG9 A;  4FD5 A;  4HKF A;  4X8I A;  4ZX8 A;  3PB7 X;  4UF4 A;  4OC2 A;  1HDQ A;  1M4L A;  2GLF A;  3SJE A;  1YW4 A;  3IJ3 A;  3PEI A;  3K9T A;  5C88 A;  2YJT A;  4F6A A;  3VAT A;  5F47 A;  4P4I A;  4A94 A;  1QSN A;  1A2Z A;  5KTD A;  2RB7 A;  4C8U A;  2PR8 A;  3CPX A;  2PC1 A;  1H8L A;  4COB A;  1NE9 A;  4BBH A;  3C8O A;  2C6G A;  3DDD A;  5HH1 A;  4EME A;  1IID A;  1LFW A;  4KS9 A;  2PQ8 A;  2AFO A;  4R6T A;  4MFK A;  5K8M A;  1XRY A;  3BUW B;  2MP0 A;  3FMC A;  5A27 A;  4E5S A;  3B3T A;  2C27 A;  3BLN A;  2ZW7 A;  4P45 A;  2B5G B;  1YVH A;  3H8F A;  2OZU A;  4A33 A;  2GIV A;  4HPS A;  3WC6 A;  2HUZ A;  5IR2 A;  2AFS A;  2Q7B A;  3KHX A;  4F0X A;  4PXD A;  2OU2 A;  4DYO A;  3JRU A;  1BO4 A;  4C68 A;  4KOY A;  4OP4 A;  1YVK A;  5LRK A;  3H4Q A;  1BLL E;  3DGV A;  4IAV A;  3D2P A;  4QBJ A;  5LYF A;  4WJB A;  1EE3 P;  4P4F A;  4W9Y A;  2PJ9 A;  1WJT A;  4CAF A;  1ZG7 A;  2R7H A;  4KZT A;  4FUU A;  3V7Z A;  5K8N A;  4AXV A;  1KWM A;  2YJV A;  1OZP A;  4PSW A;  3FVL A;  1Q7L A;  3I9S A;  4CPA A;  1Y0Y A;  3K4I A;  2VL1 A;  4DUK A;  1YGH A;  2ZEF A;  3I74 A;  4KSF A;  2FIA A;  1XMT A;  1XMB A;  3FIX A;  3LWU A;  4HNY B;  1EO0 A;  5DWN A;  5LRG A;  3TLZ A;  3VRO A;  3N7Z A;  3PFV A;  2BO9 A;  5FVJ A;  5LYL A;  2J8R A;  4C9A A;  4OC4 A;  2Z3N A;  5F48 A;  1RTQ A;  4A30 A;  1CBX A;  2Z3M A;  1ON0 A;  4DJL A;  3SI0 A;  5HMN A;  2J9A A;  4QC6 A;  2O4H A;  4U9Z A;  4A37 A;  4YU9 A;  2DIK A;  1PUA A;  3D7D A;  1CPS A;  1Z4R A;  2J8N A;  4KNG E;  1Y0R A;  3TLA A;  4Q38 A;  1NSL A;  3B2Y A;  1DIK A;  4C9E A;  3ZJ0 A;  2CTC A;  4B5P A;  1BXR B;  1A9X B;  1XIX A;  4P4J A;  4MXU A;  4LUA A;  2P0W A;  3RZA A;  1VKC A;  4B12 A;  1RO5 A;  4R57 A;  2GP4 A;  4MJX A;  2IJZ A;  2PJC A;  3HPH E;  2ZEL A;  1XJO A;  4KVM E;  4R87 A;  4ZX9 A;  4AVC A;  4A32 A;  4P6Y A;  2ZEM A;  2PJA A;  2Z0Z A;  3CT9 A;  3VH9 A;  3T8W A;  3QNV A;  4R7M A;  1LAP A;  3NH5 A;  4MFQ A;  4RUH A;  5JYB A;  2D4O A;  2ZEH A;  3KGQ A;  1S3Z A;  2EUI A;  4KOT A;  4EYS A;  4MCR A;  2XEG A;  4RR2 B;  1CJW A;  4UFX A;  1TKJ A;  2YNE A;  4OME A;  2VI7 A;  3ZNI A;  1R61 A;  2ZEN A;  2B4D A;  3FF3 A;  1XBU A;  3BUN B;  3PBB A;  4M6I A;  2AUM A;  3B3S A;  4CDK A;  3RYO A;  3K2K A;  5HVH A;  1IYK A;  3NH8 A;  4JXQ A;  4MFJ A;  2BL1 A;  2ZEO A;  1KUX A;  2PRB A;  3PBE A;  3W6S A;  4YWY A;  4AVA A;  1S7K A;  3TOA A;  2Z3P A;  2PRQ A;  4K3N A;  2PJ1 A;  4OKO A;  3S6F A;  4I49 A;  4AG9 A;  1BPM A;  4UWI A;  4J0N A;  4M85 A;  4CDJ A;  3FJU A;  2QYV A;  4KVX A;  2CIJ A;  1B87 A;  4PV6 A;  5H84 A;  4C8F A;  2HQY A;  3SJX A;  2ARH A;  2YND A;  1HDU A;  2N3A B;  1R43 A;  1OBR A;  3IU2 A;  3NA6 A;  1VBG A;  3ICU A;  4PXE A;  4E0A A;  2YGW A;  4NGR A;  2Y1M A;  1KZF A;  2QVP A;  2VXK A;  5F13 A;  3CXS A;  1BOB A;  2AFX A;  3H5Z A;  4PQA A;  2F5I A;  4PK2 A;  4QVT A;  5IB0 A;  2FS5 A;  3BHX A;  1QSO A;  4P44 A;  2Q51 A;  2WSA A;  3I6S A;  3SJF A;  4CS0 B;  1FNO A;  3T5M A;  2CNS A;  5JPH A;  2PJ6 A;  3MN8 A;  4CRY B;  4MCQ A;  1ZYM A;  4Q36 A;  2FSR A;  2KCW A;  4JXR A;  5J1Q A;  2BSW A;  2PCU A;  2JBK A;  1ZG8 A;  3BXM A;  4NGN A;  4C99 A;  2EZB A;  1S7N A;  2OLS A;  2DF5 A;  4NFR A;  4F0Y A;  3EO4 A;  4INJ A;  4NGM A;  2DPS A;  4CYN A;  3PFO A;  2EZC A;  5CBM A;  1ZO0 A;  1BPN A;  5DWM A;  4JVO A;  3GYA A;  2V77 A;  4OIW A;  4X2T A;  4A38 A;  4MHD A;  1ZRS A;  4KSA A;  3KR4 A;  3RO0 A;  2Q4V A;  4Z65 A;  2OB0 A;  2DXQ A;  4EFD A;  4NGQ A;  5EC4 A;  1Y7E A;  2GU2 A;  1Y9W A;  5K99 A;  1VI4 A;  1M6V B;  4CGL A;  2XPL A;  4X5K A;  1JDB C;  2FL4 A;  1IOF A;  3EZA A;  2FM4 A;  3VGO A;  2EK8 A;  4UEZ A;  4MFZ A;  1KUV A;  2JBJ A;  3SXN A;  4GS4 A;  5F46 A;  1Y7R A; 
#chains in the Genus database with same CATH homology
 2PJ8 A;  3H8E A;  4MHZ A;  4NJQ A;  4ZY0 A;  4OC3 A;  3EIF A;  5F09 A;  3S9L A;  1LAM A;  2PJ3 A;  3KR5 A;  1VGY A;  4C85 A;  1AYE A;  5JGF A;  1TF9 A;  2PJ4 A;  2AFU A;  4G1P A;  2PJ5 A;  3HLP A;  1PCA A;  1ZLH A;  1GYT A;  4MHY A;  1ELL P;  1WVM A;  2C1C A;  3KZW A;  2CTB A;  4F9U A;  5HVF A;  2GLJ A;  5CPA A;  3KHZ A;  4P4B A;  3KQZ A;  4UIB A;  4GM5 A;  3NFZ A;  2F7V A;  1XFO A;  4H2K A;  1Y9Z A;  2ZOG A;  4IK2 A;  4P4D A;  2PJ0 A;  2POK A;  3KQX A;  2HC9 A;  2EWB A;  2ZEE A;  2PVW A;  2NYQ A;  4O23 A;  1YW6 A;  1F2P A;  3VAR A;  4MRI A;  4JYW A;  3WT4 A;  3DLJ A;  2BCO A;  3FEE A;  2I3C A;  5IB9 A;  4NGP A;  2ANP A;  1CX8 A;  4Q7A A;  3BI1 A;  5LYD A;  2BOA A;  3IIB A;  2PIY A;  1V6C A;  3NH4 A;  5JM6 A;  2PJ7 A;  3SI1 A;  3B3V A;  5LRJ A;  3PB4 X;  1IGB A;  4R8F A;  2PVV A;  3RBU A;  2AFM A;  1DE4 C;  3KI9 A;  3D4U A;  4NJR A;  3B3C A;  3IWW A;  3B35 A;  3IFE A;  1ZLI A;  3IO1 A;  4FBE A;  2JEW A;  3ISX A;  3L2N A;  2IMO A;  1QQ9 A;  2EK9 A;  2WZN A;  4C8P A;  3GB0 A;  1YME A;  4OID A;  2V8V A;  1Z5R A;  1LCP A;  3FX6 A;  4F9V A;  2OR4 A;  1BAV A;  1VIX A;  3SJG A;  4WWV A;  4C86 A;  1YLO A;  4EWT A;  2C6P A;  3S9N A;  1TKH A;  2PJB A;  4P10 A;  1AMP A;  4PXB A;  4FAI A;  3PFE A;  4C8C A;  3PB6 X;  5THW A;  2Q43 A;  2V8G A;  3B3W A;  4R76 A;  3CDX A;  4OC1 A;  4PPZ A;  2ZEP A;  5K8O A;  1TXR A;  2IQ6 A;  2DEA A;  3WC5 A;  2O53 A;  1NSA A;  4NGT A;  3D7G A;  4JZ0 A;  3B7I A;  4TJX A;  1JQG A;  3GLJ A;  2OOT A;  2PE3 A;  2V8D A;  4UEE A;  1ARL A;  2ZEG A;  4MCS A;  2V8H A;  4F8Z A;  1UWY A;  5HXD A;  1CG2 A;  3D7H A;  3CPA A;  8CPA A;  3D7F A;  3PRT A;  4NGS A;  4C84 A;  5DS0 A;  4IHM A;  3MRU A;  2AFZ A;  3IEH A;  4BD9 A;  4MMO A;  4PXC A;  4TWE A;  3H8G A;  3IC1 A;  1ARM A;  2RFH A;  4UIA A;  2WYR A;  5D29 A;  2PJ2 A;  3D66 A;  2FVG A;  3D67 A;  4UEF A;  1YSJ A;  5D8N A;  3RAM A;  3VTA A;  3PB9 X;  3KAS A;  2ZED A;  1Z8L A;  4YN3 A;  3I1U A;  5K8P A;  2F8H A;  1CP7 A;  3FED A;  3D68 A;  4P4E A;  3S9M A;  1F57 A;  5I4M A;  4C9R A;  3FH4 A;  4FWU A;  4ZYQ A;  1F2O A;  4MHN A;  4ZI6 A;  1HEE A;  1IY7 A;  2NSM A;  3GUX A;  4X3R A;  2ZOF A;  1VHE A;  2C5Q A;  3LMS A;  2Q4Z A;  1TF8 A;  3KL9 A;  2XEF A;  2XEJ A;  5LYI A;  4C9U A;  4ONW A;  1QMU A;  1XF1 A;  4OC5 A;  3SI2 A;  4LQG A;  4B6Z A;  2PIZ A;  4C8T A;  3TC8 A;  1CPX A;  5ELY A;  4MCP A;  1PYT B;  4ZY2 A;  3WAB A;  1CP6 A;  1ELM P;  2GRE A;  3BI0 A;  4ZY1 A;  4KSI A;  3N5F A;  3ISZ A;  1TKF A;  6CPA A;  4TJV A;  5JH9 A;  4TNU A;  7CPA A;  3TX8 A;  4A39 A;  2AFW A;  1LAN A;  3HUV A;  2HB6 A;  2G9D A;  5HVG A;  4C8A A;  2CF4 A;  3V38 A;  1VHO A;  1R3N A;  2C6C A;  2XEI A;  1LOK A;  1Z2L A;  1DTD A;  2QJ8 A;  2ABZ A;  4C9V A;  4MHP A;  3WC7 A;  3FEC A;  1FT7 A;  3PB8 X;  4OC0 A;  4X8I A;  1ZG9 A;  4ZX8 A;  3PB7 X;  4UF4 A;  4OC2 A;  1HDQ A;  1M4L A;  2GLF A;  3SJE A;  1YW4 A;  3IJ3 A;  3PEI A;  3K9T A;  3VAT A;  4P4I A;  4A94 A;  2RB7 A;  4C8U A;  3CPX A;  1H8L A;  2C6G A;  4EME A;  1LFW A;  4R6T A;  2AFO A;  5K8M A;  1XRY A;  3FMC A;  3B3T A;  4P45 A;  3H8F A;  3WC6 A;  5IR2 A;  2AFS A;  3KHX A;  4PXD A;  4DYO A;  3JRU A;  4OP4 A;  5LRK A;  1BLL E;  3DGV A;  4IAV A;  5LYF A;  4WJB A;  1EE3 P;  4P4F A;  4W9Y A;  2PJ9 A;  1ZG7 A;  4FUU A;  3V7Z A;  5K8N A;  4AXV A;  1KWM A;  3FVL A;  1Q7L A;  4CPA A;  1Y0Y A;  2VL1 A;  4DUK A;  2ZEF A;  3I74 A;  1XMB A;  3LWU A;  5LRG A;  2BO9 A;  5LYL A;  4C9A A;  4OC4 A;  1RTQ A;  1CBX A;  4DJL A;  3SI0 A;  2J9A A;  2O4H A;  4A37 A;  4YU9 A;  3D7D A;  1CPS A;  4KNG E;  1Y0R A;  3B2Y A;  4C9E A;  2CTC A;  4MXU A;  4P4J A;  3RZA A;  2GP4 A;  2IJZ A;  2PJC A;  2ZEL A;  1XJO A;  4ZX9 A;  4P6Y A;  2ZEM A;  2PJA A;  3CT9 A;  3VH9 A;  3T8W A;  3QNV A;  4R7M A;  1LAP A;  3NH5 A;  4RUH A;  2ZEH A;  3KGQ A;  4MCR A;  2XEG A;  1TKJ A;  4OME A;  2ZEN A;  3PBB A;  3FF3 A;  1XBU A;  3B3S A;  4CDK A;  3K2K A;  5HVH A;  3NH8 A;  2ZEO A;  3PBE A;  4YWY A;  2PRQ A;  4K3N A;  2PJ1 A;  4OKO A;  1BPM A;  4CDJ A;  3FJU A;  2QYV A;  2CIJ A;  4C8F A;  3SJX A;  1HDU A;  1R43 A;  1OBR A;  3NA6 A;  3ICU A;  4PXE A;  4NGR A;  2QVP A;  4PQA A;  2AFX A;  3BHX A;  4P44 A;  2Q51 A;  3I6S A;  3SJF A;  1FNO A;  2PJ6 A;  3MN8 A;  4MCQ A;  5J1Q A;  2PCU A;  2JBK A;  1ZG8 A;  3BXM A;  4NGN A;  4C99 A;  4NFR A;  4NGM A;  3PFO A;  5CBM A;  1BPN A;  4X2T A;  2V77 A;  4OIW A;  4A38 A;  3KR4 A;  4Z65 A;  4EFD A;  4NGQ A;  1Y7E A;  2GU2 A;  2EK8 A;  4UEZ A;  2JBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...