3D7GA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcmc, a urea-based inhibitor
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
total genus 265
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7gA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7gA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7gA02
4IHMA 1LAPA 2PJCA 4WWVA 1JQGA 4P4FA 1OBRA 3BI0A 3B3CA 2ZEPA 1KWMA 1VIXA 2FVGA 4R6TA 4C99A 2XEJA 1PCAA 4EWTA 4NGPA 3IEHA 4P45A 2PVVA 4MRIA 2POKA 4NJQA 3FEDA 4PXEA 4R8FA 3PB7X 3V7ZA 2GREA 1IY7A 1LOKA 2PVWA 2XEFA 2O53A 3SI2A 5LYDA 4JZ0A 4B6ZA 4OC5A 1BLLE 3D66A 4C8AA 3NFZA 3KQZA 5JH9A 3S9NA 4UIBA 3H8EA 6CPAA 2WYRA 3JRUA 2V8VA 2AFWA 2GLJA 4UIAA 2PJ4A 3QNVA 4DJLA 3CPXA 2PE3A 4UEFA 3LMSA 4AXVA 4F9VA 1Z5RA 4YU9A 1DTDA 2EK8A 1H8LA 4P4BA 2JEWA 2JBKA 2NSMA 1BAVA 3RZAA 3PFEA 3PFOA 5THWA 1Z2LA 3S9MA 2AFOA 4NFRA 1V6CA 3NH8A 3IO1A 4GM5A 2PJAA 1QQ9A 3KHXA 1Z8LA 3RBUA 4P44A 4C9VA 3N5FA 1TKHA 1AYEA 2PRQA 4OC3A 4OC1A 5HVFA 5JM6A 1YW4A 3IIBA 1TF8A 4PQAA 2ZOFA 4K3NA 1XBUA 2CTCA 2RFHA 3K9TA 3TC8A 5I4MA 1R43A 3MRUA 4TWEA 4F9UA 3NH5A 5HXDA 3KHZA 3BXMA 1CBXA 4X3RA 3D7GA 3WT4A 2ZENA 5K8OA 4MHNA 2G9DA 3VATA 5D29A 3VH9A 3LWUA 1F2OA 2OOTA 3CPAA 3D4UA 2BCOA 1CPXA 4OIWA 2VL1A 3D7HA 3KI9A 4NGQA 4YWYA 3VTAA 1CPSA 5DS0A 2ZEHA 1TKFA 3MN8A 3BHXA 3FMCA 4RUHA 4NJRA 3HLPA 2XEGA 2ANPA 1GYTA 2AFUA 3WC5A 4PXDA 1YMEA 5JGFA 3PBEA 3HUVA 3PB4X 2AFZA 2PJ9A 1CP6A 1XFOA 3L2NA 4WJBA 4UEZA 4R7MA 3SJGA 4P4EA 2GU2A 4A37A 5K8PA 2PJ7A 3SI1A 2PIZA 4G1PA 1R3NA 4KNGE 1DE4C 1EE3P 1ARMA 2QJ8A 2V8HA 3D7FA 2PJBA 4FUUA 7CPAA 3FF3A 3KASA 4FWUA 4EFDA 2PJ6A 5LRGA 4MCPA 2V77A 3T8WA 2PJ8A 3PB9X 5J1QA 3FVLA 2PJ5A 3SJXA 1ZG7A 4BD9A 3D68A 5CBMA 3KL9A 3DLJA 1IGBA 1FT7A 3IWWA 2RB7A 2QYVA 2ZEDA 3PB8X 2F8HA 2PJ2A 1RTQA 3GB0A 2ZEMA 3PBBA 2AFSA 5D8NA 1LANA 2V8GA 4ZYQA 3TX8A 4NGSA 4NGRA 3I1UA 3GUXA 1QMUA 1YLOA 4MHYA 3KGQA 2IJZA 3B3TA 4KSIA 4PXCA 1CX8A 3PRTA 5LRJA 4ZX8A 3BI1A 1HDUA 5K8NA 1HDQA 3FX6A 2ZOGA 4H2KA 2JBJA 3WABA 1TXRA 3SJFA 2Q43A 2EWBA 2IQ6A 3B3VA 4EMEA 5LYLA 2I3CA 3WC7A 2C1CA 4P4JA 4UEEA 4ZI6A 1ZLIA 4C8FA 2CIJA 2OR4A 4MHPA 4C86A 1ZG9A 2WZNA 1YW6A 4UF4A 3FEEA 4X2TA 1Y7EA 4P4DA 1ZG8A 4DYOA 4R76A 2ZEOA 4C8UA 4LQGA 3D67A 4OC0A 4TJXA 2C6GA 4C8CA 1ZLHA 4C84A 4TNUA 3VARA 1Y0RA 3CT9A 4YN3A 2BOAA 1ELMP 4MCRA 2DEAA 2C6CA 1YSJA 1M4LA 4OMEA 4ZY2A 4C85A 2ZEFA 1LCPA 3IC1A 2CF4A 4IK2A 4F8ZA 5CPAA 3WC6A 3PEIA 1TF9A 1CG2A 4ZX9A 3B7IA 4O23A 4C9AA 4TJVA 2IMOA 1HEEA 4A38A 2PJ3A 3FECA 1VHOA 5LYIA 4IAVA 2Q51A 4FBEA 1Y9ZA 4MXUA 4C8PA 4PPZA 4ZY0A 1VGYA 3ISZA 5F09A 3RAMA 4P4IA 2V8DA 4OC2A 1BPMA 1F2PA 1TKJA 5HVHA 2ZEGA 2AFMA 2PJ0A 3NH4A 8CPAA 5LYFA 1Y0YA 4A39A 4MMOA 4CPAA 4OP4A 5ELYA 1XF1A 3K2KA 4W9YA 3S9LA 2ZEEA 3GLJA 4JYWA 1ELLP 3SJEA 3B3WA 5K8MA 2PCUA 2HC9A 3EIFA 3ISXA 1PYTB 1UWYA 4Q7AA 2XEIA 1BPNA 2NYQA 1VHEA 3I6SA 3SI0A 3FJUA 3IJ3A 4OIDA 1CP7A 1F57A 2Q4ZA 2PJ1A 3H8FA 2QVPA 1XRYA 4C8TA 4CDJA 2CTBA 1WVMA 4X8IA 2PIYA 4C9EA 4MCSA 4PXBA 4NGTA 3KR4A 4ONWA 5LRKA 2ABZA 1LFWA 3I74A 2GLFA 3B2YA 3D7DA 3KR5A 2ZELA 3DGVA 3B3SA 5IB9A 4FAIA 4Z65A 2BO9A 4NGMA 3B35A 3IFEA 4MHZA 3KQXA 1LAMA 4C9RA 1XJOA 1XMBA 5HVGA 2EK9A 2O4HA 4OKOA 1FNOA 2F7VA 1AMPA 1ARLA 3CDXA 3V38A 3NA6A 2J9AA 3KZWA 3FH4A 4DUKA 1NSAA 4P10A 4CDKA 3H8GA 4C9UA 4NGNA 2C6PA 2HB6A 4MCQA 3PB6X 4OC4A 1Q7LA 3ICUA 2AFXA 4A94A 4P6YA 4ZY1A
chains in the Genus database with same CATH superfamily
2FS5A 2OH1A 1LAPA 2GIVA 2PJCA 3JVNA 1CM0A 3F8KA 1JQGA 4IHMA 4R87A 4WWVA 4ZBGA 4P4FA 3TLEA 4MFZA 1X10A 4Q36A 1OBRA 4M85A 3BI0A 3B3CA 3RNZA 3PZJA 3ZZIA 3QAHA 4A33A 2ZEPA 1KWMA 2YNDA 3PP9A 4HNWB 1JDEA 3OB1B 1VIXA 1S7NA 2FVGA 4R6TA 4YFJA 2XEJA 4C99A 4EVYA 5DWMA 3PGPA 1PCAA 4R3KA 4EWTA 4NGPA 5G21A 3I9SA 3IEHA 4P45A 1Z4EA 2PVVA 2QMLA 3PT1A 4MRIA 4I49A 4UFWA 1Y9KA 4KUBA 3S6KA 2POKA 2Z10A 4NJQA 1YX0A 2YNCC 1Z8XA 2XPPA 3FEDA 1N71A 4PXEA 1NSLA 1WK4A 5JQ4A 4R8FA 4CRYB 2IL4A 4B14A 1EZBA 2XPOA 3W6XA 1R57A 3HPGG 3PB7X 5HKWA 3V7ZA 2A4NA 4UWJA 4U9YA 5ISVA 2GREA 1IY7A 1LOKA 2PR1A 2PVWA 2XEFA 2O53A 3SI2A 4KORA 5LYDA 3KRVA 4JZ0A 4XPDB 4B6ZA 2R98A 2AE6A 4OC5A 1BLLE 4C8PA 5F47A 1XMTA 2Q04A 3D66A 1OZPA 2VZZA 3QAYA 4C8AA 2Z3OA 3KQZA 3NFZA 5JH9A 5KTAA 1IOFA 5IX3A 2Z3MA 3S9NA 4UIBA 4C7IA 3H8EA 2J8RA 6CPAA 2WYRA 3I3GA 4IIXA 2JLMA 3JRUA 4M3SA 4MY3A 4YRHA 2V8VA 2AFWA 2N3AB 2GLJA 4A31A 1B87A 1IYLA 2DXQA 4L89A 4UIAA 3BUMB 1GGOA 2PJ4A 3QNVA 5CNPA 3TLBA 3S6GA 4DJLA 3CPXA 2PE3A 4UEFA 3LMSA 1Q2DA 4AXVA 3FNCA 3EZAA 4JVOA 4UA3A 4F9VA 2NMTA 3R95A 1Z5RA 3OWCA 4KOTA 4YU9A 1DTDA 2EK8A 5E96A 5J8FA 5JVLA 3DR6A 4J3GA 4QVTA 4U9ZA 1Q5XA 1Q2CA 1H8LA 1BXRB 3GJZA 4P4BA 2JEWA 3IGRA 4MFKA 2JBKA 4AB7A 1K4JA 1M4IA 2NSMA 2YNCA 4UBRA 5A28A 2JDDA 3MGDA 1BAVA 3RZAA 3PFEA 3PFOA 4KOUA 5THWA 1PU9A 1Z2LA 2BEIA 5H84A 4E8OA 1ON0A 4B13A 3S9MA 2AFOA 2MP0A 4NFRA 1V6CA 3NH8A 3IO1A 2C5QA 4GM5A 2PJAA 4KOXA 1QQ9A 3BLNA 3R9FA 2Y1MA 3GYAA 3KHXA 4XNHB 3IU2A 1MJBA 1Z8LA 3RBUA 2YJVA 3T05A 4P44A 4XPLA 2CNTA 4C9VA 3N5FA 4XPDC 1IOIA 1TKHA 1AYEA 2D4PA 2PRQA 3BJ8A 5IB0A 1QSOA 2J8NA 3D2MA 5G1ZA 4M6GA 4OC3A 4OC1A 4MJ8A 5HVFA 4A4CA 4NSQA 4BINA 1EZAA 2HROA 4BTFA 5JM6A 1YW4A 1JWQA 3IIBA 4MY0A 1JDBC 3EZBA 4LUAA 4BMHA 2Z3NA 4H89A 1TF8A 3IWGA 4PQAA 4CAXA 2ZOFA 4MFLA 2OU2A 4K3NA 4C2XA 3T9YA 1CE8B 2PCNA 2FCKA 3C8OA 1XBUA 2CTCA 2R8VA 2RFHA 3K9TA 4GS4A 3TC8A 5I4MA 1R43A 1VKCA 4B5OA 3MRUA 4TWEA 2E28A 2FSRA 1NE9A 3VGOA 1Y9WA 3R9EA 2Z3LA 3NH5A 4F9UA 5HXDA 5JPHA 3TLGA 3KHZA 1XF8A 1YREA 1YR0A 4MFPA 5F1YA 2R7HA 3BXMA 1CBXA 3HPHE 4X3RA 3D7GA 2KCWA 4NXYA 3WT4A 2ZENA 5K8OA 2WPXA 2VKZG 1VI4A 4MHNA 4CYPA 3JUWA 1YVOA 2G0BA 2G9DA 3LD2A 3VATA 2HQYA 5HMNA 1GHEA 5K99A 5D29A 3VH9A 2Z11A 2EZCA 3LWUA 1MK4A 1QSTA 1F2OA 2OOTA 3CPAA 3BUXB 3D4UA 4UFVA 2BCOA 1CPXA 2FXFA 4OIWA 4JJXA 1QSRA 2VL1A 2B4JC 3D7HA 4NGQA 3KI9A 4YWYA 3OB2B 2B0AA 4KSFA 3VTAA 1CPSA 5DS0A 2ZEHA 5AXIA 4RS2A 4RR2B 1TKFA 4XNHC 4CZ1A 3MN8A 4ONUA 1S5KA 4HKFA 3BHXA 3FYNA 3FMCA 1ZL0A 3LODA 2D4OA 1M44A 1MJ9A 2I00A 2Z3PA 3F0AA 3S6HA 1LRZA 2BSWA 4NJRA 4RUHA 3O8ZA 5BY0A 1NMTA 2K5TA 3HLPA 2XEGA 4CS0B 2ANPA 2OB0A 1GYTA 3PLFB 2AFUA 3D2PA 2PSWA 3WC5A 2YJTA 4E2AA 4PXDA 1YMEA 1XOVA 4FD6A 3PBEA 5JGFA 3HUVA 3K9UA 3PB4X 2AFZA 2PJ9A 2HUZA 4FD7A 1CP6A 3GKRA 1XFOA 3L2NA 4WJBA 4UEZA 3TOAA 4R7MA 3SJGA 3T0TA 4P4EA 2GU2A 4A37A 2C27A 3PFVA 3F5BA 5IV0A 4NF1A 5K8PA 2PJ7A 1S7FA 3SI1A 3WR7A 4J0NA 2PIZA 4G1PA 1R3NA 4KNGE 4CO9A 1DE4C 1EE3P 1ARMA 2QJ8A 2V8HA 1IICA 3D7FA 3OAKA 2X7BA 5AG5A 4U5YA 2PJBA 4FUUA 7CPAA 2CBLA 3FF3A 1ZO0A 2B5GB 2OZHA 4KS9A 3T5MA 5EC4A 3T07A 4FD4A 4RN7A 1FY7A 2AJ6A 3NOJA 3KASA 2GE3A 4FWUA 3NE7A 3VRQA 4EFDA 2PJ6A 5LRGA 3QB8A 4OLLA 2EBJA 4MCPA 2V77A 3A9LA 4QUSA 3T8WA 2PJ8A 4HPSA 3PB9X 5J1QA 4YGOA 2REFA 3ZJ0A 3FVLA 5G20A 4JXRA 2VQYA 2PJ5A 3SJXA 1ZG7A 2CNSA 2ZPAA 4LQ6A 4A2ZA 2J8MA 3D68A 3FXTA 4BD9A 5CBMA 2B4DA 4CYQA 3CZXA 2VZYA 3EFAA 3KL9A 2HI6A 3TFYA 3DLJA 4UCNA 1IGBA 5AGEA 1AUGA 4B5PB 4F0YA 1FT7A 3IWWA 3EY5A 2RB7A 3TLYA 2QYVA 2ZEDA 3PB8X 1I21A 1I12A 2FT0A 5C88A 2F8HA 2PJ2A 1RTQA 3GB0A 2ZEMA 3PBBA 4CAWA 1YQEA 2AFSA 5D8NA 1I1DA 2DF5A 1LANA 1KUXA 5J8CA 2V8GA 4PSWA 5FVJA 1L0CA 4ZYQA 3TX8A 2Q4VA 3SXNA 2B4BA 4NGSA 4NGRA 5HKYA 3GUXA 3I1UA 3SHPA 2HWGA 2F5IA 4IUSA 2VXKA 1U6MA 4CYNA 1QMUA 4CGOA 1WJTA 4C2YA 1YLOA 4HNXB 4ORFA 4A95A 3BUNB 4MHYA 5J3XA 3KGQA 4KLVA 5DWNA 5H86A 4A32A 4AVBA 5F48A 3TO7A 2UV8G 4GPLB 2IJZA 3B3TA 4KSIA 4PXCA 4B12A 1CX8A 2CNMA 3PRTA 5F46A 3TYXA 2OLSA 5LRJA 4CGNA 3TLZA 1Z8TA 4CAVA 1VBHA 4ZX8A 1P4NA 3BI1A 2BL1A 2XPLA 5JYBA 2XPNA 1HDUA 4IF5A 5K8NA 1HDQA 3FX6A 2ZOGA 2FL4A 2Y1NA 2VBQA 4H2KA 4CAFA 2JBJA 2EZBA 4E94A 3GY9A 5F49A 2ATRA 3WABA 4COBA 1SQHA 1J4JA 1TXRA 3TE4A 3SJFA 2Q43A 2R1IA 3VROA 2EWBA 1Q2YA 2G3TA 2IQ6A 3B3VA 3N7ZA 3VWEA 4RI1A 4EMEA 5LYLA 2FIWA 3DSBA 2I3CA 2ZXVA 4M6IA 3WC7A 4AVAA 1V0CA 3G3SA 1KUVA 2C1CA 4P4JA 4BPUB 4UEEA 4Y49B 2B3UA 4FD5A 5F13A 4K30A 4ZI6A 1ZLIA 2Q0YA 4C8FA 2CIJA 2OR4A 3K4IA 4MHPA 2Z3KA 1B47A 3VRPA 2ZW4A 5FD8A 4QC6A 5F9MA 1ZG9A 4C86A 2WZNA 1YW6A 3C26A 4UF4A 4X5KA 3G23A 3FEEA 3EXNA 4X2TA 4C7HA 2PRBA 1Y7EA 2PC1A 4P4DA 2REEA 1FBVA 1ZG8A 4OADA 3NE8A 2O28A 4R76A 4H6UA 2QECA 4R3LA 4KOVA 3T90A 4DYOA 4EYSA 2CY2A 4II9A 5IR2A 2ZEOA 4BPWB 4C8UA 4LQGA 2YNEA 5KTDA 2B5GA 2Q7BA 3D67A 1YVHA 4OC0A 1S7LA 4TJXA 3D3SA 2C6GA 1YLEA 5KTCA 4PV6A 4MI1A 4C8CA 1ZLHA 4C84A 4TNUA 4UCPA 1Y0RA 4L8AA 3VARA 4H1HA 3CT9A 1VBGA 4ZGYB 2BOAA 5F5XA 4YN3A 1ELMP 2DPTA 2JDCA 2G3AA 4AG9A 4MCRA 4PK2A 2DEAA 4MFQA 1S7KA 2C6CA 1YSJA 4KVOE 1M4LA 5C82A 4F6AA 4OMEA 1KZFA 4ZY2A 4B10A 3TTHA 1XIXA 4A30A 4C85A 2ZEFA 1LCPA 1YK3A 2DPSA 1Y7RA 2Z0ZA 3TOBA 3IC1A 2GP4A 2B3VA 2FM4A 3SR3A 2CF4A 4IK2A 4F8ZA 4Y49C 5CPAA 3WC6A 3FBUA 3IWEA 3PEIA 4E5SA 2DLAA 1TF9A 2D0PA 2Q4YA 1CG2A 2DIKA 4KOWA 4ZX9A 1S3ZA 2P0WA 3B7IA 3FB3A 4O23A 4C9AA 4TJVA 3R9GA 4PK3A 1KBLA 2IMOA 1HEEA 3U1BA 4A38A 2PJ3A 5HKZA 3FECA 3HMJG 1VHSA 1XE4A 2ODFA 3G8WA 4KOSA 4COGA 1VHOA 3TO9A 1A2ZA 2YGWA 4R9MA 2WUUA 4JWPA 2WPWA 2VI7A 4IAVA 5LYIA 3W91A 2Q51A 4DNCA 4FBEA 1Y9ZA 3BUWB 4MXUA 4CYOA 2GFQA 1C3OB 4PPZA 4ZY0A 3TLGB 1VGYA 4JD6A 1X12A 5F09A 3ISZA 3RAMA 2P6FA 3TLAA 4Q38A 4P4IA 2CXAA 2V8DA 4KOYA 2P6GA 4CGMA 2OZUA 2Y0MA 4OC2A 2X0SA 2EO8A 1BPMA 1F2PA 1TKJA 4INJA 5HVHA 2ZEGA 2AFMA 3TCVA 5A27A 1Z9UA 2PJ0A 3NH4A 4CAEA 3TLCA 1NBWA 3VRNA 5HH1A 1IYKA 2EUIA 2OZGA 4HNYB 8CPAA 2I79A 1Y0YA 3EC4A 4A39A 5LYFA 2VEZA 4MMOA 1NXJA 3LACA 1Z8WA 2GANA 4CPAA 1J3LA 4OP4A 5ELYA 1XF1A 3K2KA 3EZEA 4W9YA 2ARHA 2PR8A 3S9LA 2ZEEA 3GLJA 1TIQA 1PUAA 3JTKA 4JYWA 1ELLP 2BUEA 1M4DA 3DR8A 4MHDA 4OAEA 4AVCA 1CS0B 3SJEA 1M4GA 3B3WA 5AG6A 4KVME 5K8MA 2PCUA 1BOBA 2HC9A 3VWDA 1RO5A 1KUYA 4F0XA 3IU1A 3EIFA 3ISXA 2Q7SA 4M8DA 1PYTB 1UWYA 2HV2A 1DIKA 1ZRSA 4Q7AA 2XEIA 5G22A 1BPNA 4C2ZA 2R82A 5I0CA 2NYQA 1VHEA 4KSAA 5EBVA 1A9XB 2AUMA 3I6SA 2PDOA 3ZNIA 4M6HA 4H6ZA 3SI0A 4KZTA 4CRZB 3TO6A 4GXHA 2RC4A 3FJUA 4B11A 3IJ3A 3F9KC 3DNSA 4OIDA 1CP7A 3R96A 1F57A 3GIUA 2Q4ZA 1M1DA 2PJ1A 1B6BA 1IU8A 2QVPA 2ZW7A 3H8FA 1XEBA 3P2FA 1XRYA 1Z4RA 3H5ZA 4C8TA 1QSMA 3UY5A 4CDJA 1P0HA 3R1KA 4MI4A 2CTBA 1WVMA 4MBUA 3U88C 2EVNA 4X8IA 2P6EA 2QIRA 1S60A 4MJXA 4C68A 2PIYA 2Q44A 4C9EA 4KLWA 4QBJA 4JLYA 4MCSA 4PXBA 3FIXA 3SXOA 1Z9EA 4NGTA 1CJWA 2EZAA 3KR4A 3V8IA 4ONWA 2B4DB 5LRKA 2ABZA 1LFWA 1BO4A 3RYOA 2AUNA 5AG4A 3FRMA 2JEVA 2B58A 1YVKA 3I74A 4BPXB 2D0OA 2GLFA 4E0AA 2WSAA 3B2YA 4XPKA 3D7DA 3KR5A 2ZELA 1C30B 3DGVA 3B8GA 4R57A 3BUOB 4KVXA 1IIDA 3B3SA 3CXQA 4JXQA 3CXPA 5IB9A 1KC7A 3NFQA 3EO4A 4FAIA 3DDDA 5AG7A 4Z65A 2BO9A 4NGMA 3B35A 3IFEA 4MHZA 3KQXA 4BBHA 4CGLA 1KEEB 1IB1E 3BJ7A 4LX9A 1LAMA 3OP0A 4C9RA 4NCZA 1UFHA 1XMBA 1XJOA 5HVGA 1RXTA 2EK9A 2PQ8A 2O4HA 4OKOA 1FNOA 2F7VA 4UWIA 3TT2A 1AMPA 1R61A 3CXSA 5GCNA 1ARLA 3CDXA 3P2HA 4NEXA 2H5MA 3NA6A 3V38A 3H4QA 2J9AA 2ZW6A 1M6VB 1EO0A 3FH4A 3KZWA 3S6FA 4AG7A 5BWAB 2FE7A 5EMIA 4DUKA 4IIYA 1NSAA 4KUAA 4B5PA 4A4BA 4P10A 1WWZA 2FIAA 1ZYMA 1MJAA 4CDKA 3W6SA 1YGHA 2ZW5A 3H8GA 3KKWA 4UFXA 1T36B 4CGPA 4MFJA 3E0KA 4C9UA 1QSNA 4NGNA 2C6PA 4UCMA 2HB6A 4PSXA 4MCQA 3VRRA 3PB6X 4OC4A 1Q7LA 3ICUA 2AFXA 4A94A 4P6YA 3RO0A 3D8PA 4QB9A 4ZY1A
chains in the Genus database with same CATH topology
4IHMA 1LAPA 2PJCA 4WWVA 1JQGA 4P4FA 1OBRA 3BI0A 3B3CA 2ZEPA 1KWMA 1VIXA 2FVGA 4R6TA 4C99A 2XEJA 1PCAA 4EWTA 4NGPA 3IEHA 4P45A 2PVVA 4MRIA 2POKA 4NJQA 3FEDA 4PXEA 4R8FA 3PB7X 3V7ZA 2GREA 1IY7A 1LOKA 2PVWA 2XEFA 2O53A 3SI2A 5LYDA 4JZ0A 4B6ZA 4OC5A 1BLLE 3D66A 4C8AA 3NFZA 3KQZA 5JH9A 3S9NA 4UIBA 3H8EA 6CPAA 2WYRA 3JRUA 2V8VA 2AFWA 2GLJA 4UIAA 2PJ4A 3QNVA 4DJLA 3CPXA 2PE3A 4UEFA 3LMSA 4AXVA 4F9VA 1Z5RA 4YU9A 1DTDA 2EK8A 1H8LA 4P4BA 2JEWA 2JBKA 2NSMA 1BAVA 3RZAA 3PFEA 3PFOA 5THWA 1Z2LA 3S9MA 2AFOA 4NFRA 1V6CA 3NH8A 3IO1A 2C5QA 4GM5A 2PJAA 1QQ9A 3KHXA 1Z8LA 3RBUA 4P44A 4C9VA 3N5FA 1TKHA 1AYEA 2PRQA 4OC3A 4OC1A 5HVFA 5JM6A 1YW4A 3IIBA 1TF8A 4PQAA 2ZOFA 4K3NA 1XBUA 2CTCA 2RFHA 3K9TA 3TC8A 5I4MA 1R43A 3MRUA 4TWEA 4F9UA 3NH5A 5HXDA 3KHZA 3BXMA 1CBXA 4X3RA 3D7GA 3WT4A 2ZENA 5K8OA 4MHNA 2G9DA 3VATA 5D29A 3VH9A 3LWUA 1F2OA 2OOTA 3CPAA 3D4UA 2BCOA 1CPXA 4OIWA 2VL1A 3D7HA 3KI9A 4NGQA 4YWYA 3VTAA 1CPSA 5DS0A 2ZEHA 1TKFA 3MN8A 3BHXA 3FMCA 4RUHA 4NJRA 3HLPA 2XEGA 2ANPA 1GYTA 2AFUA 3WC5A 4PXDA 1YMEA 5JGFA 3PBEA 3HUVA 3PB4X 2AFZA 2PJ9A 1CP6A 1XFOA 3L2NA 4WJBA 4UEZA 4R7MA 3SJGA 4P4EA 2GU2A 4A37A 5K8PA 2PJ7A 3SI1A 2PIZA 4G1PA 1R3NA 4KNGE 1DE4C 1EE3P 1ARMA 2QJ8A 2V8HA 3D7FA 2PJBA 4FUUA 7CPAA 3FF3A 3KASA 4FWUA 4EFDA 2PJ6A 5LRGA 4MCPA 2V77A 3T8WA 2PJ8A 3PB9X 5J1QA 3FVLA 2PJ5A 3SJXA 1ZG7A 4BD9A 3D68A 5CBMA 3KL9A 3DLJA 1IGBA 1FT7A 3IWWA 2RB7A 2QYVA 2ZEDA 3PB8X 2F8HA 2PJ2A 1RTQA 3GB0A 2ZEMA 3PBBA 2AFSA 5D8NA 1LANA 2V8GA 4ZYQA 3TX8A 4NGSA 4NGRA 3I1UA 3GUXA 1QMUA 1YLOA 4MHYA 3KGQA 2IJZA 3B3TA 4KSIA 4PXCA 1CX8A 3PRTA 5LRJA 4ZX8A 3BI1A 1HDUA 5K8NA 1HDQA 3FX6A 2ZOGA 4H2KA 2JBJA 3WABA 1TXRA 3SJFA 2Q43A 2EWBA 2IQ6A 3B3VA 4EMEA 5LYLA 2I3CA 3WC7A 2C1CA 4P4JA 4UEEA 4ZI6A 1ZLIA 4C8FA 2CIJA 2OR4A 4MHPA 4C86A 1ZG9A 2WZNA 1YW6A 4UF4A 3FEEA 4X2TA 1Y7EA 4P4DA 1ZG8A 4DYOA 4R76A 5IR2A 2ZEOA 4C8UA 4LQGA 3D67A 4OC0A 4TJXA 2C6GA 4C8CA 1ZLHA 4C84A 4TNUA 3VARA 1Y0RA 3CT9A 4YN3A 2BOAA 1ELMP 4MCRA 2DEAA 2C6CA 1YSJA 1M4LA 4OMEA 4ZY2A 4C85A 2ZEFA 1LCPA 3IC1A 2GP4A 2CF4A 4IK2A 4F8ZA 5CPAA 3WC6A 3PEIA 1TF9A 1CG2A 4ZX9A 3B7IA 4O23A 4C9AA 4TJVA 2IMOA 1HEEA 4A38A 2PJ3A 3FECA 1VHOA 5LYIA 4IAVA 2Q51A 4FBEA 1Y9ZA 4MXUA 4C8PA 4PPZA 4ZY0A 1VGYA 3ISZA 5F09A 3RAMA 4P4IA 2V8DA 4OC2A 1BPMA 1F2PA 1TKJA 5HVHA 2ZEGA 2AFMA 2PJ0A 3NH4A 8CPAA 5LYFA 1Y0YA 4A39A 4MMOA 4CPAA 4OP4A 5ELYA 1XF1A 3K2KA 4W9YA 3S9LA 2ZEEA 3GLJA 4JYWA 1ELLP 3SJEA 3B3WA 5K8MA 2PCUA 2HC9A 3EIFA 3ISXA 1PYTB 1UWYA 4Q7AA 2XEIA 1BPNA 2NYQA 1VHEA 3I6SA 3SI0A 3FJUA 3IJ3A 4OIDA 1CP7A 1F57A 2Q4ZA 2PJ1A 3H8FA 2QVPA 1XRYA 4C8TA 4CDJA 2CTBA 1WVMA 4X8IA 2PIYA 4C9EA 4MCSA 4PXBA 4NGTA 3KR4A 4ONWA 5LRKA 2ABZA 1LFWA 3I74A 2GLFA 3B2YA 3D7DA 3KR5A 2ZELA 3DGVA 3B3SA 5IB9A 4FAIA 4Z65A 2BO9A 4NGMA 3B35A 3IFEA 4MHZA 3KQXA 1LAMA 4C9RA 1XJOA 1XMBA 5HVGA 2EK9A 2O4HA 4OKOA 1FNOA 2F7VA 1AMPA 1ARLA 3CDXA 3V38A 3NA6A 2J9AA 3KZWA 3FH4A 4DUKA 1NSAA 4P10A 4CDKA 3H8GA 4C9UA 4NGNA 2C6PA 2HB6A 4MCQA 3PB6X 4OC4A 1Q7LA 3ICUA 2AFXA 4A94A 4P6YA 4ZY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHM A;  1LAP A;  2PJC A;  4WWV A;  1JQG A;  4P4F A;  1OBR A;  3BI0 A;  3B3C A;  2ZEP A;  1KWM A;  1VIX A;  2FVG A;  4R6T A;  4C99 A;  2XEJ A;  1PCA A;  4EWT A;  4NGP A;  3IEH A;  4P45 A;  2PVV A;  4MRI A;  2POK A;  4NJQ A;  3FED A;  4PXE A;  4R8F A;  3PB7 X;  3V7Z A;  2GRE A;  1IY7 A;  1LOK A;  2PVW A;  2XEF A;  2O53 A;  3SI2 A;  5LYD A;  4JZ0 A;  4B6Z A;  4OC5 A;  1BLL E;  3D66 A;  4C8A A;  3NFZ A;  3KQZ A;  5JH9 A;  3S9N A;  4UIB A;  3H8E A;  6CPA A;  2WYR A;  3JRU A;  2V8V A;  2AFW A;  2GLJ A;  4UIA A;  2PJ4 A;  3QNV A;  4DJL A;  3CPX A;  2PE3 A;  4UEF A;  3LMS A;  4AXV A;  4F9V A;  1Z5R A;  4YU9 A;  1DTD A;  2EK8 A;  1H8L A;  4P4B A;  2JEW A;  2JBK A;  2NSM A;  1BAV A;  3RZA A;  3PFE A;  3PFO A;  5THW A;  1Z2L A;  3S9M A;  2AFO A;  4NFR A;  1V6C A;  3NH8 A;  3IO1 A;  4GM5 A;  2PJA A;  1QQ9 A;  3KHX A;  1Z8L A;  3RBU A;  4P44 A;  4C9V A;  3N5F A;  1TKH A;  1AYE A;  2PRQ A;  4OC3 A;  4OC1 A;  5HVF A;  5JM6 A;  1YW4 A;  3IIB A;  1TF8 A;  4PQA A;  2ZOF A;  4K3N A;  1XBU A;  2CTC A;  2RFH A;  3K9T A;  3TC8 A;  5I4M A;  1R43 A;  3MRU A;  4TWE A;  4F9U A;  3NH5 A;  5HXD A;  3KHZ A;  3BXM A;  1CBX A;  4X3R A;  3D7G A;  3WT4 A;  2ZEN A;  5K8O A;  4MHN A;  2G9D A;  3VAT A;  5D29 A;  3VH9 A;  3LWU A;  1F2O A;  2OOT A;  3CPA A;  3D4U A;  2BCO A;  1CPX A;  4OIW A;  2VL1 A;  3D7H A;  3KI9 A;  4NGQ A;  4YWY A;  3VTA A;  1CPS A;  5DS0 A;  2ZEH A;  1TKF A;  3MN8 A;  3BHX A;  3FMC A;  4RUH A;  4NJR A;  3HLP A;  2XEG A;  2ANP A;  1GYT A;  2AFU A;  3WC5 A;  4PXD A;  1YME A;  5JGF A;  3PBE A;  3HUV A;  3PB4 X;  2AFZ A;  2PJ9 A;  1CP6 A;  1XFO A;  3L2N A;  4WJB A;  4UEZ A;  4R7M A;  3SJG A;  4P4E A;  2GU2 A;  4A37 A;  5K8P A;  2PJ7 A;  3SI1 A;  2PIZ A;  4G1P A;  1R3N A;  4KNG E;  1DE4 C;  1EE3 P;  1ARM A;  2QJ8 A;  2V8H A;  3D7F A;  2PJB A;  4FUU A;  7CPA A;  3FF3 A;  3KAS A;  4FWU A;  4EFD A;  2PJ6 A;  5LRG A;  4MCP A;  2V77 A;  3T8W A;  2PJ8 A;  3PB9 X;  5J1Q A;  3FVL A;  2PJ5 A;  3SJX A;  1ZG7 A;  4BD9 A;  3D68 A;  5CBM A;  3KL9 A;  3DLJ A;  1IGB A;  1FT7 A;  3IWW A;  2RB7 A;  2QYV A;  2ZED A;  3PB8 X;  2F8H A;  2PJ2 A;  1RTQ A;  3GB0 A;  2ZEM A;  3PBB A;  2AFS A;  5D8N A;  1LAN A;  2V8G A;  4ZYQ A;  3TX8 A;  4NGS A;  4NGR A;  3I1U A;  3GUX A;  1QMU A;  1YLO A;  4MHY A;  3KGQ A;  2IJZ A;  3B3T A;  4KSI A;  4PXC A;  1CX8 A;  3PRT A;  5LRJ A;  4ZX8 A;  3BI1 A;  1HDU A;  5K8N A;  1HDQ A;  3FX6 A;  2ZOG A;  4H2K A;  2JBJ A;  3WAB A;  1TXR A;  3SJF A;  2Q43 A;  2EWB A;  2IQ6 A;  3B3V A;  4EME A;  5LYL A;  2I3C A;  3WC7 A;  2C1C A;  4P4J A;  4UEE A;  4ZI6 A;  1ZLI A;  4C8F A;  2CIJ A;  2OR4 A;  4MHP A;  4C86 A;  1ZG9 A;  2WZN A;  1YW6 A;  4UF4 A;  3FEE A;  4X2T A;  1Y7E A;  4P4D A;  1ZG8 A;  4DYO A;  4R76 A;  2ZEO A;  4C8U A;  4LQG A;  3D67 A;  4OC0 A;  4TJX A;  2C6G A;  4C8C A;  1ZLH A;  4C84 A;  4TNU A;  3VAR A;  1Y0R A;  3CT9 A;  4YN3 A;  2BOA A;  1ELM P;  4MCR A;  2DEA A;  2C6C A;  1YSJ A;  1M4L A;  4OME A;  4ZY2 A;  4C85 A;  2ZEF A;  1LCP A;  3IC1 A;  2CF4 A;  4IK2 A;  4F8Z A;  5CPA A;  3WC6 A;  3PEI A;  1TF9 A;  1CG2 A;  4ZX9 A;  3B7I A;  4O23 A;  4C9A A;  4TJV A;  2IMO A;  1HEE A;  4A38 A;  2PJ3 A;  3FEC A;  1VHO A;  5LYI A;  4IAV A;  2Q51 A;  4FBE A;  1Y9Z A;  4MXU A;  4C8P A;  4PPZ A;  4ZY0 A;  1VGY A;  3ISZ A;  5F09 A;  3RAM A;  4P4I A;  2V8D A;  4OC2 A;  1BPM A;  1F2P A;  1TKJ A;  5HVH A;  2ZEG A;  2AFM A;  2PJ0 A;  3NH4 A;  8CPA A;  5LYF A;  1Y0Y A;  4A39 A;  4MMO A;  4CPA A;  4OP4 A;  5ELY A;  1XF1 A;  3K2K A;  4W9Y A;  3S9L A;  2ZEE A;  3GLJ A;  4JYW A;  1ELL P;  3SJE A;  3B3W A;  5K8M A;  2PCU A;  2HC9 A;  3EIF A;  3ISX A;  1PYT B;  1UWY A;  4Q7A A;  2XEI A;  1BPN A;  2NYQ A;  1VHE A;  3I6S A;  3SI0 A;  3FJU A;  3IJ3 A;  4OID A;  1CP7 A;  1F57 A;  2Q4Z A;  2PJ1 A;  3H8F A;  2QVP A;  1XRY A;  4C8T A;  4CDJ A;  2CTB A;  1WVM A;  4X8I A;  2PIY A;  4C9E A;  4MCS A;  4PXB A;  4NGT A;  3KR4 A;  4ONW A;  5LRK A;  2ABZ A;  1LFW A;  3I74 A;  2GLF A;  3B2Y A;  3D7D A;  3KR5 A;  2ZEL A;  3DGV A;  3B3S A;  5IB9 A;  4FAI A;  4Z65 A;  2BO9 A;  4NGM A;  3B35 A;  3IFE A;  4MHZ A;  3KQX A;  1LAM A;  4C9R A;  1XJO A;  1XMB A;  5HVG A;  2EK9 A;  2O4H A;  4OKO A;  1FNO A;  2F7V A;  1AMP A;  1ARL A;  3CDX A;  3V38 A;  3NA6 A;  2J9A A;  3KZW A;  3FH4 A;  4DUK A;  1NSA A;  4P10 A;  4CDK A;  3H8G A;  4C9U A;  4NGN A;  2C6P A;  2HB6 A;  4MCQ A;  3PB6 X;  4OC4 A;  1Q7L A;  3ICU A;  2AFX A;  4A94 A;  4P6Y A;  4ZY1 A; 
#chains in the Genus database with same CATH topology
 2FS5 A;  2OH1 A;  1LAP A;  2GIV A;  2PJC A;  3JVN A;  1CM0 A;  3F8K A;  1JQG A;  4IHM A;  4R87 A;  4WWV A;  4ZBG A;  4P4F A;  3TLE A;  4MFZ A;  1X10 A;  4Q36 A;  1OBR A;  4M85 A;  3BI0 A;  3B3C A;  3RNZ A;  3PZJ A;  3ZZI A;  3QAH A;  4A33 A;  2ZEP A;  1KWM A;  2YND A;  3PP9 A;  4HNW B;  1JDE A;  3OB1 B;  1VIX A;  1S7N A;  2FVG A;  4R6T A;  4YFJ A;  2XEJ A;  4C99 A;  4EVY A;  5DWM A;  3PGP A;  1PCA A;  4R3K A;  4EWT A;  4NGP A;  5G21 A;  3I9S A;  3IEH A;  4P45 A;  1Z4E A;  2PVV A;  2QML A;  3PT1 A;  4MRI A;  4I49 A;  4UFW A;  1Y9K A;  4KUB A;  3S6K A;  2POK A;  2Z10 A;  4NJQ A;  1YX0 A;  2YNC C;  1Z8X A;  2XPP A;  3FED A;  1N71 A;  4PXE A;  1NSL A;  1WK4 A;  5JQ4 A;  4R8F A;  4CRY B;  2IL4 A;  4B14 A;  1EZB A;  2XPO A;  3W6X A;  1R57 A;  3HPG G;  3PB7 X;  5HKW A;  3V7Z A;  2A4N A;  4UWJ A;  4U9Y A;  5ISV A;  2GRE A;  1IY7 A;  1LOK A;  2PR1 A;  2PVW A;  2XEF A;  2O53 A;  3SI2 A;  4KOR A;  5LYD A;  3KRV A;  4JZ0 A;  4XPD B;  4B6Z A;  2R98 A;  2AE6 A;  4OC5 A;  1BLL E;  4C8P A;  5F47 A;  1XMT A;  2Q04 A;  3D66 A;  1OZP A;  2VZZ A;  3QAY A;  4C8A A;  2Z3O A;  3KQZ A;  3NFZ A;  5JH9 A;  5KTA A;  1IOF A;  5IX3 A;  2Z3M A;  3S9N A;  4UIB A;  4C7I A;  3H8E A;  2J8R A;  6CPA A;  2WYR A;  3I3G A;  4IIX A;  2JLM A;  3JRU A;  4M3S A;  4MY3 A;  4YRH A;  2V8V A;  2AFW A;  2N3A B;  2GLJ A;  4A31 A;  1B87 A;  1IYL A;  2DXQ A;  4L89 A;  4UIA A;  3BUM B;  1GGO A;  2PJ4 A;  3QNV A;  5CNP A;  3TLB A;  3S6G A;  4DJL A;  3CPX A;  2PE3 A;  4UEF A;  3LMS A;  1Q2D A;  4AXV A;  3FNC A;  3EZA A;  4JVO A;  4UA3 A;  4F9V A;  2NMT A;  3R95 A;  1Z5R A;  3OWC A;  4KOT A;  4YU9 A;  1DTD A;  2EK8 A;  5E96 A;  5J8F A;  5JVL A;  3DR6 A;  4J3G A;  4QVT A;  4U9Z A;  1Q5X A;  1Q2C A;  1H8L A;  1BXR B;  3GJZ A;  4P4B A;  2JEW A;  3IGR A;  4MFK A;  2JBK A;  4AB7 A;  1K4J A;  1M4I A;  2NSM A;  2YNC A;  4UBR A;  5A28 A;  2JDD A;  3MGD A;  1BAV A;  3RZA A;  3PFE A;  3PFO A;  4KOU A;  5THW A;  1PU9 A;  1Z2L A;  2BEI A;  5H84 A;  4E8O A;  1ON0 A;  4B13 A;  3S9M A;  2AFO A;  2MP0 A;  4NFR A;  1V6C A;  3NH8 A;  3IO1 A;  2C5Q A;  4GM5 A;  2PJA A;  4KOX A;  1QQ9 A;  3BLN A;  3R9F A;  2Y1M A;  3GYA A;  3KHX A;  4XNH B;  3IU2 A;  1MJB A;  1Z8L A;  3RBU A;  2YJV A;  3T05 A;  4P44 A;  4XPL A;  2CNT A;  4C9V A;  3N5F A;  4XPD C;  1IOI A;  1TKH A;  1AYE A;  2D4P A;  2PRQ A;  3BJ8 A;  5IB0 A;  1QSO A;  2J8N A;  3D2M A;  5G1Z A;  4M6G A;  4OC3 A;  4OC1 A;  4MJ8 A;  5HVF A;  4A4C A;  4NSQ A;  4BIN A;  1EZA A;  2HRO A;  4BTF A;  5JM6 A;  1YW4 A;  1JWQ A;  3IIB A;  4MY0 A;  1JDB C;  3EZB A;  4LUA A;  4BMH A;  2Z3N A;  4H89 A;  1TF8 A;  3IWG A;  4PQA A;  4CAX A;  2ZOF A;  4MFL A;  2OU2 A;  4K3N A;  4C2X A;  3T9Y A;  1CE8 B;  2PCN A;  2FCK A;  3C8O A;  1XBU A;  2CTC A;  2R8V A;  2RFH A;  3K9T A;  4GS4 A;  3TC8 A;  5I4M A;  1R43 A;  1VKC A;  4B5O A;  3MRU A;  4TWE A;  2E28 A;  2FSR A;  1NE9 A;  3VGO A;  1Y9W A;  3R9E A;  2Z3L A;  3NH5 A;  4F9U A;  5HXD A;  5JPH A;  3TLG A;  3KHZ A;  1XF8 A;  1YRE A;  1YR0 A;  4MFP A;  5F1Y A;  2R7H A;  3BXM A;  1CBX A;  3HPH E;  4X3R A;  3D7G A;  2KCW A;  4NXY A;  3WT4 A;  2ZEN A;  5K8O A;  2WPX A;  2VKZ G;  1VI4 A;  4MHN A;  4CYP A;  3JUW A;  1YVO A;  2G0B A;  2G9D A;  3LD2 A;  3VAT A;  2HQY A;  5HMN A;  1GHE A;  5K99 A;  5D29 A;  3VH9 A;  2Z11 A;  2EZC A;  3LWU A;  1MK4 A;  1QST A;  1F2O A;  2OOT A;  3CPA A;  3BUX B;  3D4U A;  4UFV A;  2BCO A;  1CPX A;  2FXF A;  4OIW A;  4JJX A;  1QSR A;  2VL1 A;  2B4J C;  3D7H A;  4NGQ A;  3KI9 A;  4YWY A;  3OB2 B;  2B0A A;  4KSF A;  3VTA A;  1CPS A;  5DS0 A;  2ZEH A;  5AXI A;  4RS2 A;  4RR2 B;  1TKF A;  4XNH C;  4CZ1 A;  3MN8 A;  4ONU A;  1S5K A;  4HKF A;  3BHX A;  3FYN A;  3FMC A;  1ZL0 A;  3LOD A;  2D4O A;  1M44 A;  1MJ9 A;  2I00 A;  2Z3P A;  3F0A A;  3S6H A;  1LRZ A;  2BSW A;  4NJR A;  4RUH A;  3O8Z A;  5BY0 A;  1NMT A;  2K5T A;  3HLP A;  2XEG A;  4CS0 B;  2ANP A;  2OB0 A;  1GYT A;  3PLF B;  2AFU A;  3D2P A;  2PSW A;  3WC5 A;  2YJT A;  4E2A A;  4PXD A;  1YME A;  1XOV A;  4FD6 A;  3PBE A;  5JGF A;  3HUV A;  3K9U A;  3PB4 X;  2AFZ A;  2PJ9 A;  2HUZ A;  4FD7 A;  1CP6 A;  3GKR A;  1XFO A;  3L2N A;  4WJB A;  4UEZ A;  3TOA A;  4R7M A;  3SJG A;  3T0T A;  4P4E A;  2GU2 A;  4A37 A;  2C27 A;  3PFV A;  3F5B A;  5IV0 A;  4NF1 A;  5K8P A;  2PJ7 A;  1S7F A;  3SI1 A;  3WR7 A;  4J0N A;  2PIZ A;  4G1P A;  1R3N A;  4KNG E;  4CO9 A;  1DE4 C;  1EE3 P;  1ARM A;  2QJ8 A;  2V8H A;  1IIC A;  3D7F A;  3OAK A;  2X7B A;  5AG5 A;  4U5Y A;  2PJB A;  4FUU A;  7CPA A;  2CBL A;  3FF3 A;  1ZO0 A;  2B5G B;  2OZH A;  4KS9 A;  3T5M A;  5EC4 A;  3T07 A;  4FD4 A;  4RN7 A;  1FY7 A;  2AJ6 A;  3NOJ A;  3KAS A;  2GE3 A;  4FWU A;  3NE7 A;  3VRQ A;  4EFD A;  2PJ6 A;  5LRG A;  3QB8 A;  4OLL A;  2EBJ A;  4MCP A;  2V77 A;  3A9L A;  4QUS A;  3T8W A;  2PJ8 A;  4HPS A;  3PB9 X;  5J1Q A;  4YGO A;  2REF A;  3ZJ0 A;  3FVL A;  5G20 A;  4JXR A;  2VQY A;  2PJ5 A;  3SJX A;  1ZG7 A;  2CNS A;  2ZPA A;  4LQ6 A;  4A2Z A;  2J8M A;  3D68 A;  3FXT A;  4BD9 A;  5CBM A;  2B4D A;  4CYQ A;  3CZX A;  2VZY A;  3EFA A;  3KL9 A;  2HI6 A;  3TFY A;  3DLJ A;  4UCN A;  1IGB A;  5AGE A;  1AUG A;  4B5P B;  4F0Y A;  1FT7 A;  3IWW A;  3EY5 A;  2RB7 A;  3TLY A;  2QYV A;  2ZED A;  3PB8 X;  1I21 A;  1I12 A;  2FT0 A;  5C88 A;  2F8H A;  2PJ2 A;  1RTQ A;  3GB0 A;  2ZEM A;  3PBB A;  4CAW A;  1YQE A;  2AFS A;  5D8N A;  1I1D A;  2DF5 A;  1LAN A;  1KUX A;  5J8C A;  2V8G A;  4PSW A;  5FVJ A;  1L0C A;  4ZYQ A;  3TX8 A;  2Q4V A;  3SXN A;  2B4B A;  4NGS A;  4NGR A;  5HKY A;  3GUX A;  3I1U A;  3SHP A;  2HWG A;  2F5I A;  4IUS A;  2VXK A;  1U6M A;  4CYN A;  1QMU A;  4CGO A;  1WJT A;  4C2Y A;  1YLO A;  4HNX B;  4ORF A;  4A95 A;  3BUN B;  4MHY A;  5J3X A;  3KGQ A;  4KLV A;  5DWN A;  5H86 A;  4A32 A;  4AVB A;  5F48 A;  3TO7 A;  2UV8 G;  4GPL B;  2IJZ A;  3B3T A;  4KSI A;  4PXC A;  4B12 A;  1CX8 A;  2CNM A;  3PRT A;  5F46 A;  3TYX A;  2OLS A;  5LRJ A;  4CGN A;  3TLZ A;  1Z8T A;  4CAV A;  1VBH A;  4ZX8 A;  1P4N A;  3BI1 A;  2BL1 A;  2XPL A;  5JYB A;  2XPN A;  1HDU A;  4IF5 A;  5K8N A;  1HDQ A;  3FX6 A;  2ZOG A;  2FL4 A;  2Y1N A;  2VBQ A;  4H2K A;  4CAF A;  2JBJ A;  2EZB A;  4E94 A;  3GY9 A;  5F49 A;  2ATR A;  3WAB A;  4COB A;  1SQH A;  1J4J A;  1TXR A;  3TE4 A;  3SJF A;  2Q43 A;  2R1I A;  3VRO A;  2EWB A;  1Q2Y A;  2G3T A;  2IQ6 A;  3B3V A;  3N7Z A;  3VWE A;  4RI1 A;  4EME A;  5LYL A;  2FIW A;  3DSB A;  2I3C A;  2ZXV A;  4M6I A;  3WC7 A;  4AVA A;  1V0C A;  3G3S A;  1KUV A;  2C1C A;  4P4J A;  4BPU B;  4UEE A;  4Y49 B;  2B3U A;  4FD5 A;  5F13 A;  4K30 A;  4ZI6 A;  1ZLI A;  2Q0Y A;  4C8F A;  2CIJ A;  2OR4 A;  3K4I A;  4MHP A;  2Z3K A;  1B47 A;  3VRP A;  2ZW4 A;  5FD8 A;  4QC6 A;  5F9M A;  1ZG9 A;  4C86 A;  2WZN A;  1YW6 A;  3C26 A;  4UF4 A;  4X5K A;  3G23 A;  3FEE A;  3EXN A;  4X2T A;  4C7H A;  2PRB A;  1Y7E A;  2PC1 A;  4P4D A;  2REE A;  1FBV A;  1ZG8 A;  4OAD A;  3NE8 A;  2O28 A;  4R76 A;  4H6U A;  2QEC A;  4R3L A;  4KOV A;  3T90 A;  4DYO A;  4EYS A;  2CY2 A;  4II9 A;  5IR2 A;  2ZEO A;  4BPW B;  4C8U A;  4LQG A;  2YNE A;  5KTD A;  2B5G A;  2Q7B A;  3D67 A;  1YVH A;  4OC0 A;  1S7L A;  4TJX A;  3D3S A;  2C6G A;  1YLE A;  5KTC A;  4PV6 A;  4MI1 A;  4C8C A;  1ZLH A;  4C84 A;  4TNU A;  4UCP A;  1Y0R A;  4L8A A;  3VAR A;  4H1H A;  3CT9 A;  1VBG A;  4ZGY B;  2BOA A;  5F5X A;  4YN3 A;  1ELM P;  2DPT A;  2JDC A;  2G3A A;  4AG9 A;  4MCR A;  4PK2 A;  2DEA A;  4MFQ A;  1S7K A;  2C6C A;  1YSJ A;  4KVO E;  1M4L A;  5C82 A;  4F6A A;  4OME A;  1KZF A;  4ZY2 A;  4B10 A;  3TTH A;  1XIX A;  4A30 A;  4C85 A;  2ZEF A;  1LCP A;  1YK3 A;  2DPS A;  1Y7R A;  2Z0Z A;  3TOB A;  3IC1 A;  2GP4 A;  2B3V A;  2FM4 A;  3SR3 A;  2CF4 A;  4IK2 A;  4F8Z A;  4Y49 C;  5CPA A;  3WC6 A;  3FBU A;  3IWE A;  3PEI A;  4E5S A;  2DLA A;  1TF9 A;  2D0P A;  2Q4Y A;  1CG2 A;  2DIK A;  4KOW A;  4ZX9 A;  1S3Z A;  2P0W A;  3B7I A;  3FB3 A;  4O23 A;  4C9A A;  4TJV A;  3R9G A;  4PK3 A;  1KBL A;  2IMO A;  1HEE A;  3U1B A;  4A38 A;  2PJ3 A;  5HKZ A;  3FEC A;  3HMJ G;  1VHS A;  1XE4 A;  2ODF A;  3G8W A;  4KOS A;  4COG A;  1VHO A;  3TO9 A;  1A2Z A;  2YGW A;  4R9M A;  2WUU A;  4JWP A;  2WPW A;  2VI7 A;  4IAV A;  5LYI A;  3W91 A;  2Q51 A;  4DNC A;  4FBE A;  1Y9Z A;  3BUW B;  4MXU A;  4CYO A;  2GFQ A;  1C3O B;  4PPZ A;  4ZY0 A;  3TLG B;  1VGY A;  4JD6 A;  1X12 A;  5F09 A;  3ISZ A;  3RAM A;  2P6F A;  3TLA A;  4Q38 A;  4P4I A;  2CXA A;  2V8D A;  4KOY A;  2P6G A;  4CGM A;  2OZU A;  2Y0M A;  4OC2 A;  2X0S A;  2EO8 A;  1BPM A;  1F2P A;  1TKJ A;  4INJ A;  5HVH A;  2ZEG A;  2AFM A;  3TCV A;  5A27 A;  1Z9U A;  2PJ0 A;  3NH4 A;  4CAE A;  3TLC A;  1NBW A;  3VRN A;  5HH1 A;  1IYK A;  2EUI A;  2OZG A;  4HNY B;  8CPA A;  2I79 A;  1Y0Y A;  3EC4 A;  4A39 A;  5LYF A;  2VEZ A;  4MMO A;  1NXJ A;  3LAC A;  1Z8W A;  2GAN A;  4CPA A;  1J3L A;  4OP4 A;  5ELY A;  1XF1 A;  3K2K A;  3EZE A;  4W9Y A;  2ARH A;  2PR8 A;  3S9L A;  2ZEE A;  3GLJ A;  1TIQ A;  1PUA A;  3JTK A;  4JYW A;  1ELL P;  2BUE A;  1M4D A;  3DR8 A;  4MHD A;  4OAE A;  4AVC A;  1CS0 B;  3SJE A;  1M4G A;  3B3W A;  5AG6 A;  4KVM E;  5K8M A;  2PCU A;  1BOB A;  2HC9 A;  3VWD A;  1RO5 A;  1KUY A;  4F0X A;  3IU1 A;  3EIF A;  3ISX A;  2Q7S A;  4M8D A;  1PYT B;  1UWY A;  2HV2 A;  1DIK A;  1ZRS A;  4Q7A A;  2XEI A;  5G22 A;  1BPN A;  4C2Z A;  2R82 A;  5I0C A;  2NYQ A;  1VHE A;  4KSA A;  5EBV A;  1A9X B;  2AUM A;  3I6S A;  2PDO A;  3ZNI A;  4M6H A;  4H6Z A;  3SI0 A;  4KZT A;  4CRZ B;  3TO6 A;  4GXH A;  2RC4 A;  3FJU A;  4B11 A;  3IJ3 A;  3F9K C;  3DNS A;  4OID A;  1CP7 A;  3R96 A;  1F57 A;  3GIU A;  2Q4Z A;  1M1D A;  2PJ1 A;  1B6B A;  1IU8 A;  2QVP A;  2ZW7 A;  3H8F A;  1XEB A;  3P2F A;  1XRY A;  1Z4R A;  3H5Z A;  4C8T A;  1QSM A;  3UY5 A;  4CDJ A;  1P0H A;  3R1K A;  4MI4 A;  2CTB A;  1WVM A;  4MBU A;  3U88 C;  2EVN A;  4X8I A;  2P6E A;  2QIR A;  1S60 A;  4MJX A;  4C68 A;  2PIY A;  2Q44 A;  4C9E A;  4KLW A;  4QBJ A;  4JLY A;  4MCS A;  4PXB A;  3FIX A;  3SXO A;  1Z9E A;  4NGT A;  1CJW A;  2EZA A;  3KR4 A;  3V8I A;  4ONW A;  2B4D B;  5LRK A;  2ABZ A;  1LFW A;  1BO4 A;  3RYO A;  2AUN A;  5AG4 A;  3FRM A;  2JEV A;  2B58 A;  1YVK A;  3I74 A;  4BPX B;  2D0O A;  2GLF A;  4E0A A;  2WSA A;  3B2Y A;  4XPK A;  3D7D A;  3KR5 A;  2ZEL A;  1C30 B;  3DGV A;  3B8G A;  4R57 A;  3BUO B;  4KVX A;  1IID A;  3B3S A;  3CXQ A;  4JXQ A;  3CXP A;  5IB9 A;  1KC7 A;  3NFQ A;  3EO4 A;  4FAI A;  3DDD A;  5AG7 A;  4Z65 A;  2BO9 A;  4NGM A;  3B35 A;  3IFE A;  4MHZ A;  3KQX A;  4BBH A;  4CGL A;  1KEE B;  1IB1 E;  3BJ7 A;  4LX9 A;  1LAM A;  3OP0 A;  4C9R A;  4NCZ A;  1UFH A;  1XMB A;  1XJO A;  5HVG A;  1RXT A;  2EK9 A;  2PQ8 A;  2O4H A;  4OKO A;  1FNO A;  2F7V A;  4UWI A;  3TT2 A;  1AMP A;  1R61 A;  3CXS A;  5GCN A;  1ARL A;  3CDX A;  3P2H A;  4NEX A;  2H5M A;  3NA6 A;  3V38 A;  3H4Q A;  2J9A A;  2ZW6 A;  1M6V B;  1EO0 A;  3FH4 A;  3KZW A;  3S6F A;  4AG7 A;  5BWA B;  2FE7 A;  5EMI A;  4DUK A;  4IIY A;  1NSA A;  4KUA A;  4B5P A;  4A4B A;  4P10 A;  1WWZ A;  2FIA A;  1ZYM A;  1MJA A;  4CDK A;  3W6S A;  1YGH A;  2ZW5 A;  3H8G A;  3KKW A;  4UFX A;  1T36 B;  4CGP A;  4MFJ A;  3E0K A;  4C9U A;  1QSN A;  4NGN A;  2C6P A;  4UCM A;  2HB6 A;  4PSX A;  4MCQ A;  3VRR A;  3PB6 X;  4OC4 A;  1Q7L A;  3ICU A;  2AFX A;  4A94 A;  4P6Y A;  3RO0 A;  3D8P A;  4QB9 A;  4ZY1 A; 
#chains in the Genus database with same CATH homology
 4IHM A;  1LAP A;  2PJC A;  4WWV A;  1JQG A;  4P4F A;  1OBR A;  3BI0 A;  3B3C A;  2ZEP A;  1KWM A;  1VIX A;  2FVG A;  4R6T A;  4C99 A;  2XEJ A;  1PCA A;  4EWT A;  4NGP A;  3IEH A;  4P45 A;  2PVV A;  4MRI A;  2POK A;  4NJQ A;  3FED A;  4PXE A;  4R8F A;  3PB7 X;  3V7Z A;  2GRE A;  1IY7 A;  1LOK A;  2PVW A;  2XEF A;  2O53 A;  3SI2 A;  5LYD A;  4JZ0 A;  4B6Z A;  4OC5 A;  1BLL E;  3D66 A;  4C8A A;  3NFZ A;  3KQZ A;  5JH9 A;  3S9N A;  4UIB A;  3H8E A;  6CPA A;  2WYR A;  3JRU A;  2V8V A;  2AFW A;  2GLJ A;  4UIA A;  2PJ4 A;  3QNV A;  4DJL A;  3CPX A;  2PE3 A;  4UEF A;  3LMS A;  4AXV A;  4F9V A;  1Z5R A;  4YU9 A;  1DTD A;  2EK8 A;  1H8L A;  4P4B A;  2JEW A;  2JBK A;  2NSM A;  1BAV A;  3RZA A;  3PFE A;  3PFO A;  5THW A;  1Z2L A;  3S9M A;  2AFO A;  4NFR A;  1V6C A;  3NH8 A;  3IO1 A;  2C5Q A;  4GM5 A;  2PJA A;  1QQ9 A;  3KHX A;  1Z8L A;  3RBU A;  4P44 A;  4C9V A;  3N5F A;  1TKH A;  1AYE A;  2PRQ A;  4OC3 A;  4OC1 A;  5HVF A;  5JM6 A;  1YW4 A;  3IIB A;  1TF8 A;  4PQA A;  2ZOF A;  4K3N A;  1XBU A;  2CTC A;  2RFH A;  3K9T A;  3TC8 A;  5I4M A;  1R43 A;  3MRU A;  4TWE A;  4F9U A;  3NH5 A;  5HXD A;  3KHZ A;  3BXM A;  1CBX A;  4X3R A;  3D7G A;  3WT4 A;  2ZEN A;  5K8O A;  4MHN A;  2G9D A;  3VAT A;  5D29 A;  3VH9 A;  3LWU A;  1F2O A;  2OOT A;  3CPA A;  3D4U A;  2BCO A;  1CPX A;  4OIW A;  2VL1 A;  3D7H A;  3KI9 A;  4NGQ A;  4YWY A;  3VTA A;  1CPS A;  5DS0 A;  2ZEH A;  1TKF A;  3MN8 A;  3BHX A;  3FMC A;  4RUH A;  4NJR A;  3HLP A;  2XEG A;  2ANP A;  1GYT A;  2AFU A;  3WC5 A;  4PXD A;  1YME A;  5JGF A;  3PBE A;  3HUV A;  3PB4 X;  2AFZ A;  2PJ9 A;  1CP6 A;  1XFO A;  3L2N A;  4WJB A;  4UEZ A;  4R7M A;  3SJG A;  4P4E A;  2GU2 A;  4A37 A;  5K8P A;  2PJ7 A;  3SI1 A;  2PIZ A;  4G1P A;  1R3N A;  4KNG E;  1DE4 C;  1EE3 P;  1ARM A;  2QJ8 A;  2V8H A;  3D7F A;  2PJB A;  4FUU A;  7CPA A;  3FF3 A;  3KAS A;  4FWU A;  4EFD A;  2PJ6 A;  5LRG A;  4MCP A;  2V77 A;  3T8W A;  2PJ8 A;  3PB9 X;  5J1Q A;  3FVL A;  2PJ5 A;  3SJX A;  1ZG7 A;  4BD9 A;  3D68 A;  5CBM A;  3KL9 A;  3DLJ A;  1IGB A;  1FT7 A;  3IWW A;  2RB7 A;  2QYV A;  2ZED A;  3PB8 X;  2F8H A;  2PJ2 A;  1RTQ A;  3GB0 A;  2ZEM A;  3PBB A;  2AFS A;  5D8N A;  1LAN A;  2V8G A;  4ZYQ A;  3TX8 A;  4NGS A;  4NGR A;  3I1U A;  3GUX A;  1QMU A;  1YLO A;  4MHY A;  3KGQ A;  2IJZ A;  3B3T A;  4KSI A;  4PXC A;  1CX8 A;  3PRT A;  5LRJ A;  4ZX8 A;  3BI1 A;  1HDU A;  5K8N A;  1HDQ A;  3FX6 A;  2ZOG A;  4H2K A;  2JBJ A;  3WAB A;  1TXR A;  3SJF A;  2Q43 A;  2EWB A;  2IQ6 A;  3B3V A;  4EME A;  5LYL A;  2I3C A;  3WC7 A;  2C1C A;  4P4J A;  4UEE A;  4ZI6 A;  1ZLI A;  4C8F A;  2CIJ A;  2OR4 A;  4MHP A;  4C86 A;  1ZG9 A;  2WZN A;  1YW6 A;  4UF4 A;  3FEE A;  4X2T A;  1Y7E A;  4P4D A;  1ZG8 A;  4DYO A;  4R76 A;  5IR2 A;  2ZEO A;  4C8U A;  4LQG A;  3D67 A;  4OC0 A;  4TJX A;  2C6G A;  4C8C A;  1ZLH A;  4C84 A;  4TNU A;  3VAR A;  1Y0R A;  3CT9 A;  4YN3 A;  2BOA A;  1ELM P;  4MCR A;  2DEA A;  2C6C A;  1YSJ A;  1M4L A;  4OME A;  4ZY2 A;  4C85 A;  2ZEF A;  1LCP A;  3IC1 A;  2GP4 A;  2CF4 A;  4IK2 A;  4F8Z A;  5CPA A;  3WC6 A;  3PEI A;  1TF9 A;  1CG2 A;  4ZX9 A;  3B7I A;  4O23 A;  4C9A A;  4TJV A;  2IMO A;  1HEE A;  4A38 A;  2PJ3 A;  3FEC A;  1VHO A;  5LYI A;  4IAV A;  2Q51 A;  4FBE A;  1Y9Z A;  4MXU A;  4C8P A;  4PPZ A;  4ZY0 A;  1VGY A;  3ISZ A;  5F09 A;  3RAM A;  4P4I A;  2V8D A;  4OC2 A;  1BPM A;  1F2P A;  1TKJ A;  5HVH A;  2ZEG A;  2AFM A;  2PJ0 A;  3NH4 A;  8CPA A;  5LYF A;  1Y0Y A;  4A39 A;  4MMO A;  4CPA A;  4OP4 A;  5ELY A;  1XF1 A;  3K2K A;  4W9Y A;  3S9L A;  2ZEE A;  3GLJ A;  4JYW A;  1ELL P;  3SJE A;  3B3W A;  5K8M A;  2PCU A;  2HC9 A;  3EIF A;  3ISX A;  1PYT B;  1UWY A;  4Q7A A;  2XEI A;  1BPN A;  2NYQ A;  1VHE A;  3I6S A;  3SI0 A;  3FJU A;  3IJ3 A;  4OID A;  1CP7 A;  1F57 A;  2Q4Z A;  2PJ1 A;  3H8F A;  2QVP A;  1XRY A;  4C8T A;  4CDJ A;  2CTB A;  1WVM A;  4X8I A;  2PIY A;  4C9E A;  4MCS A;  4PXB A;  4NGT A;  3KR4 A;  4ONW A;  5LRK A;  2ABZ A;  1LFW A;  3I74 A;  2GLF A;  3B2Y A;  3D7D A;  3KR5 A;  2ZEL A;  3DGV A;  3B3S A;  5IB9 A;  4FAI A;  4Z65 A;  2BO9 A;  4NGM A;  3B35 A;  3IFE A;  4MHZ A;  3KQX A;  1LAM A;  4C9R A;  1XJO A;  1XMB A;  5HVG A;  2EK9 A;  2O4H A;  4OKO A;  1FNO A;  2F7V A;  1AMP A;  1ARL A;  3CDX A;  3V38 A;  3NA6 A;  2J9A A;  3KZW A;  3FH4 A;  4DUK A;  1NSA A;  4P10 A;  4CDK A;  3H8G A;  4C9U A;  4NGN A;  2C6P A;  2HB6 A;  4MCQ A;  3PB6 X;  4OC4 A;  1Q7L A;  3ICU A;  2AFX A;  4A94 A;  4P6Y A;  4ZY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...