4JYWA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with ctt1057
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title A high affinity 18F-labeled phosphoramidate peptidomimetic inhibitor as a PSMA-targeted PET imaging agent for prostate cancer
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 261
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4jywA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4jywA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4jywA02
2QVPA 3MRUA 4ZY2A 4NGNA 4C85A 3WABA 2I3CA 3WT4A 3NH4A 4C9EA 4A38A 1YSJA 3KASA 3SJEA 4P4JA 4ZY0A 5JH9A 1PCAA 2ZENA 1AMPA 3CPAA 3IO1A 2V8DA 2AFSA 4F9VA 2IMOA 2PJ7A 2PJCA 4Q7AA 4PXEA 4R8FA 3SI0A 1CX8A 2C6CA 2WZNA 3K9TA 3PFOA 4P10A 4MRIA 1CBXA 5K8NA 4ZI6A 2PJ0A 3GUXA 3NH5A 4TNUA 6CPAA 4A39A 2J9AA 5HXDA 1TF8A 4OMEA 3ICUA 1BPMA 3T8WA 1WVMA 5ELYA 3FF3A 3B35A 2PVWA 1LCPA 1Y0YA 4C8UA 3PFEA 5DS0A 3B2YA 5IB9A 2GLFA 4C8TA 1JQGA 2PJ3A 1XRYA 2GREA 1DE4C 2F8HA 4NGPA 4KSIA 2VL1A 2PIYA 2RB7A 4ZYQA 7CPAA 2QYVA 1KWMA 4MCSA 1ELLP 1Y0RA 4EWTA 2ZEGA 2XEIA 1AYEA 1V6CA 4KNGE 4C99A 5K8OA 2Q51A 3IJ3A 3H8FA 1Y9ZA 4C84A 3IFEA 1UWYA 1XMBA 2CIJA 4CDJA 2DEAA 1R3NA 1ZLIA 3QNVA 1ZG9A 2PRQA 3VH9A 3KHZA 3VTAA 5HVHA 3KHXA 4JZ0A 2G9DA 4NGTA 3BXMA 4ZX8A 2AFMA 2PE3A 2C6PA 5J1QA 5F09A 4P6YA 1IGBA 2ZEEA 1YMEA 1Q7LA 1IY7A 3FEDA 3S9LA 1BLLE 4MHZA 4YU9A 3S9MA 2C1CA 4ONWA 3D66A 3GLJA 4C9RA 1PYTB 4OP4A 4UEZA 4Z65A 5JGFA 4AXVA 2Q4ZA 4A94A 4OC0A 1Z8LA 4CDKA 3B7IA 4RUHA 1VGYA 3H8EA 4MCPA 1Y7EA 1BAVA 3D67A 4UEFA 4P45A 2AFOA 2FVGA 4MHNA 1YW6A 3D7HA 2GU2A 1OBRA 1GYTA 2ZEFA 3FJUA 3PEIA 2PJ6A 2AFUA 3RZAA 1NSAA 1CG2A 4FUUA 1ZG7A 4TJVA 2PJBA 2C6GA 4X8IA 4NGQA 3D7FA 2NSMA 3KQXA 3WC6A 2JBKA 2ANPA 2V8GA 4C8AA 3D68A 4ZY1A 2OOTA 5I4MA 1DTDA 4OKOA 5LYLA 2PJ9A 2NYQA 4IAVA 4UF4A 5LYFA 3VARA 4C9VA 3FECA 3I6SA 2ZOFA 4P4IA 4B6ZA 2JBJA 3CDXA 3FH4A 4MMOA 5K8MA 3B3CA 4DJLA 2PCUA 5LYIA 1LAMA 3PB8X 4C86A 3NA6A 4C8FA 3I1UA 1ZG8A 3VATA 3CPXA 4IK2A 1FT7A 3HLPA 2EWBA 4BD9A 1TKHA 2HC9A 3ISXA 4PXCA 3FMCA 1M4LA 4CPAA 4R6TA 5JM6A 2PJ1A 1XJOA 4NGRA 3B3WA 4P4BA 3H8GA 2EK9A 1VHOA 2ZEPA 2ZOGA 1CP6A 4TWEA 4WJBA 3D4UA 4LQGA 5LRKA 2ZEHA 2ABZA 5CPAA 3TX8A 4P44A 4OC2A 4OC4A 4NFRA 2PJ2A 3DGVA 4X2TA 1TF9A 2ZELA 3KGQA 3V7ZA 3RAMA 3S9NA 4C8PA 4MHPA 2Q43A 1R43A 1QQ9A 3I74A 3JRUA 1CP7A 4MXUA 4C9UA 4EMEA 2AFXA 2XEJA 2POKA 2BOAA 2V77A 1VHEA 2BCOA 1BPNA 3KQZA 3PB6X 4WWVA 3KR5A 4P4FA 2AFZA 5K8PA 3V38A 2ZEOA 2ZEDA 4PXBA 3KL9A 1ZLHA 3KR4A 1LAPA 2AFWA 4FAIA 5D29A 3FEEA 2O53A 4NJRA 3PB4X 3B3VA 5D8NA 3IC1A 4DYOA 1F2PA 5THWA 3KZWA 4O23A 1VIXA 1F57A 2CTCA 1EE3P 4YN3A 3D7DA 3DLJA 4EFDA 1F2OA 2V8VA 4G1PA 2HB6A 4YWYA 2PVVA 2ZEMA 4UIBA 3WC7A 2PIZA 3KI9A 1ARMA 1TKFA 4OIWA 4NGSA 2F7VA 2PJAA 5LRJA 4OC3A 4C9AA 4IHMA 4UEEA 2CTBA 3SJGA 3B3SA 1Z2LA 3ISZA 3GB0A 2PJ4A 1H8LA 1HDUA 4UIAA 1ARLA 4P4DA 2BO9A 2IJZA 4MCQA 4ZX9A 1TXRA 4H2KA 1TKJA 1Z5RA 4PPZA 2XEFA 4W9YA 1YW4A 2QJ8A 4P4EA 4TJXA 2JEWA 3CT9A 4A37A 5HVFA 3FVLA 3PBEA 2WYRA 1XBUA 2XEGA 5CBMA 4PQAA 3IIBA 1CPSA 4MHYA 3D7GA 3PBBA 3SI1A 1HDQA 4OC1A 3MN8A 1ELMP 3SJFA 4MCRA 3L2NA 4DUKA 4OC5A 3BI1A 3N5FA 1LOKA 2PJ5A 4OIDA 4X3RA 1XF1A 4FBEA 2EK8A 4GM5A 1QMUA 3B3TA 3IEHA 3PRTA 4K3NA 8CPAA 4NJQA 3LMSA 4R76A 3SI2A 2GLJA 3LWUA 3PB7X 4JYWA 4C8CA 4F8ZA 5HVGA 1CPXA 1RTQA 3HUVA 1YLOA 3K2KA 3IWWA 4FWUA 4F9UA 3BI0A 2PJ8A 2OR4A 3RBUA 2V8HA 3PB9X 3NFZA 1HEEA 2O4HA 3WC5A 2CF4A 1XFOA 3EIFA 1FNOA 4NGMA 2RFHA 3SJXA 4PXDA 3NH8A 1LFWA 5LRGA 4R7MA 3TC8A 3FX6A 2IQ6A 1LANA 5LYDA 3BHXA
chains in the Genus database with same CATH superfamily
3V8IA 2REFA 5F9MA 4UBRA 2QVPA 2GANA 3OB2B 2PDOA 3MRUA 4JWPA 3LODA 1EO0A 3IU1A 4NGNA 4KSAA 4ZY2A 1YX0A 3WABA 2I00A 1CE8B 2D0PA 4C85A 4CRYB 2I3CA 3WT4A 3NH4A 5G20A 2B3VA 4CGNA 4C9EA 4A38A 1YSJA 1X12A 3KASA 3SJEA 4P4JA 5FVJA 1Q2CA 4C2ZA 4ZY0A 4YFJA 5JH9A 2JDCA 1VHSA 3O8ZA 4L89A 4NSQA 2OH1A 5F13A 1Z9UA 3GY9A 3G8WA 1YVHA 1PCAA 4ZGYB 2ZENA 2PR8A 1AMPA 2FSRA 3CPAA 1P4NA 3IO1A 4CGLA 2FIAA 2V8DA 3CXQA 4KOXA 4RS2A 2AFSA 4F9VA 4A31A 3BJ7A 5AG4A 1YLEA 4KOYA 1IB1E 2VXKA 3H5ZA 2ZW5A 5J8CA 2IMOA 2PJ7A 2PJCA 4Q7AA 4XNHB 4F0YA 4B5PB 3CXPA 4PXEA 4KOUA 4R8FA 5G21A 3SI0A 1CX8A 5IR2A 2C6CA 2WZNA 3K9TA 3PFOA 4IIYA 4P10A 4MRIA 4CYQA 3FIXA 5GCNA 1CBXA 3TLBA 4OAEA 5IX3A 3BJ8A 5K8NA 4KOWA 3VRRA 4ZI6A 2GE3A 2REEA 2PJ0A 2Z3NA 3GUXA 2PR1A 3NH5A 2WPWA 5JQ4A 4TNUA 6CPAA 3T07A 2I79A 4F0XA 1QSMA 2B5GA 3DDDA 1Q5XA 4A39A 2J9AA 5HXDA 5IB0A 1TF8A 4IIXA 4OMEA 3QAHA 3ICUA 1L0CA 1BPMA 3T8WA 1WVMA 3VGOA 2F5IA 3FF3A 5ELYA 3B35A 2P6FA 2PVWA 1CJWA 2DPTA 1LCPA 2Z3MA 4MI4A 1Y0YA 4MY3A 4R3KA 2YGWA 1X10A 4II9A 4C8UA 3PFEA 5C88A 5DS0A 4Q36A 3B2YA 5IB9A 4C2YA 2GLFA 2FM4A 3JVNA 3T5MA 4C8TA 2XPNA 1JQGA 4FD6A 2K5TA 2PJ3A 2PRBA 1A2ZA 1C30B 1VI4A 4C68A 1XRYA 3NOJA 2GREA 2Z11A 1DE4C 1WJTA 2CNTA 2F8HA 4NGPA 4KSIA 2VL1A 2OZHA 2PIYA 2RB7A 3D8PA 4ZYQA 7CPAA 2QYVA 3LD2A 1KWMA 4MCSA 1ELLP 2PC1A 3R1KA 2CNSA 2ARHA 5KTAA 2KCWA 4CAVA 3D2PA 1Y0RA 4EWTA 1QSRA 2ZEGA 2XEIA 1AYEA 1I12A 2EVNA 3R9GA 5DWNA 3TCVA 3IU2A 1V6CA 3T90A 2EUIA 2A4NA 3FB3A 5KTDA 4B10A 2XPOA 4FD7A 4KNGE 4C99A 2Q7SA 1XIXA 1Z8WA 2Q51A 5K8OA 3IJ3A 4CAWA 2JLMA 4FD4A 2WSAA 2D0OA 3H8FA 4ORFA 1Y9ZA 4C84A 3IFEA 4Y49B 1UWYA 4BMHA 2FIWA 1XMBA 2CIJA 4CDJA 3EZAA 2DEAA 3E0KA 1TIQA 2R8VA 2BSWA 3SXNA 1VKCA 5F48A 1R3NA 1ZLIA 3CZXA 3QNVA 5EMIA 4A30A 3KRVA 1ZG9A 4M85A 2PRQA 4RI1A 2ODFA 3VH9A 3KHZA 3VTAA 5HVHA 3KHXA 3PP9A 3EZEA 4YRHA 4MBUA 4CYOA 4H6UA 1S7LA 4JZ0A 4MJ8A 3PFVA 2G9DA 1EZAA 4NGTA 1QSTA 3BXMA 4ZX8A 3UY5A 5JPHA 1Z8TA 2AFMA 4NF1A 4AVCA 1LRZA 2PE3A 2C6PA 1N71A 5F09A 5J1QA 4P6YA 4Q38A 1FY7A 1IGBA 3BLNA 1QSOA 2ATRA 1YMEA 2DF5A 2ZEEA 4CRZB 1MK4A 1Q7LA 2Q44A 4UCNA 1IY7A 3FEDA 3S9LA 1BLLE 3F5BA 4HNWB 1M44A 4MHZA 1RXTA 3B8GA 4YU9A 3S9MA 2C1CA 3EIFA 4AVAA 1WWZA 5DWMA 4ONWA 1JWQA 4BPXB 2HWGA 2B4DB 5E96A 1J4JA 1B6BA 3D66A 3OWCA 2XPLA 3GLJA 3W6SA 3TFYA 4C9RA 1PYTB 3N7ZA 4A4BA 4OP4A 2Z3LA 3I9SA 4UEZA 4Z65A 5JGFA 4JD6A 3TLAA 4UFXA 4AXVA 4JJXA 3TO7A 2QMLA 3G3SA 3ZZIA 3MGDA 1IOFA 2Q4ZA 2B58A 4A94A 4OC0A 1Y7RA 4NCZA 2X7BA 5EBVA 1Z8LA 4CDKA 3DR6A 3B7IA 3H4QA 3R96A 4KSFA 3TO6A 4RUHA 4EYSA 1VGYA 1M4GA 3H8EA 2Q7BA 4XNHC 3IWEA 3DR8A 4B13A 1VBHA 1R61A 4MCPA 1Y7EA 1QSNA 4JXQA 2YNCC 2J8NA 5I0CA 1BAVA 3D67A 4UEFA 3QB8A 4P45A 2ZPAA 3OP0A 2AFOA 4H89A 2FVGA 2DIKA 3HPGG 1EZBA 1S7NA 4MHNA 1PUAA 3IWGA 3OB1B 3VRPA 1YW6A 2PSWA 2BEIA 3HPHE 2D4PA 2DPSA 3D7HA 3I3GA 2GU2A 4LX9A 1OBRA 1GYTA 3BUNB 4UCPA 1Q2DA 5HKYA 3ZNIA 2ZEFA 1OZPA 3TO9A 2UV8G 3FJUA 3PEIA 2PJ6A 2AUNA 2R98A 2AFUA 2JDDA 1KZFA 3DNSA 4R3LA 3RZAA 1NSAA 1CG2A 4FUUA 1ZG7A 2Q4YA 1GHEA 5BWAB 2VKZG 3K4IA 4TJVA 2PJBA 2C6GA 2ZW7A 4X8IA 4K30A 4NGQA 3D7FA 2NSMA 3T05A 3S6GA 3VRNA 3KQXA 3WC6A 2EZAA 5HMNA 2JBKA 2ANPA 3R9EA 1BXRB 2V8GA 4BPWB 4XPDB 4C8AA 2P0WA 1XE4A 3D68A 4ZY1A 2OOTA 5I4MA 1DTDA 1ZL0A 4OKOA 3BUMB 4C7IA 4HNXB 2MP0A 5LYLA 2PJ9A 4PK2A 2NYQA 3TT2A 4IAVA 4UF4A 5LYFA 3VARA 3D2MA 2PCNA 2Y1MA 1IU8A 1ZRSA 4C9VA 1KUXA 4AVBA 3GKRA 3TOBA 1R57A 3VRQA 3FECA 5EC4A 4R57A 4CYPA 4BPUB 1IOIA 2VI7A 4B5PA 5AG6A 3I6SA 2ZOFA 4IF5A 1IYLA 2OB0A 4P4IA 2YNCA 2JBJA 4B6ZA 1ON0A 2J8RA 4J3GA 5JYBA 5K99A 3CDXA 3FH4A 4MMOA 2Y0MA 5K8MA 4UWIA 3B3CA 4CZ1A 4JVOA 3C26A 2QIRA 1V0CA 4RN7A 3CXSA 2PCUA 4DJLA 4Y49C 2C5QA 5LYIA 3QAYA 3F8KA 4KVXA 1LAMA 3PB8X 4C86A 1KUYA 4GXHA 4CAEA 3NA6A 2FXFA 4R9MA 2R82A 4C8FA 3I1UA 1ZG8A 4MFJA 4MFPA 3VATA 3CPXA 4IK2A 1FT7A 3HLPA 2EWBA 4BD9A 1TKHA 1S60A 5A27A 1KC7A 2HC9A 3ISXA 4I49A 4MFLA 2OLSA 1S7KA 4PXCA 3FMCA 1M4LA 4CPAA 4R6TA 4CYNA 5JM6A 5C82A 2PJ1A 1XJOA 4NGRA 3VROA 2HROA 4BTFA 4PK3A 4BINA 3TTHA 5F46A 3T9YA 1K4JA 3B3WA 2HUZA 4P4BA 3H8GA 2EK9A 1VHOA 2ZEPA 4A33A 2ZOGA 1CP6A 4TWEA 2WPXA 5HKZA 4CGMA 4WJBA 4CGOA 3D4UA 4LQGA 1B47A 4INJA 1CS0B 4PSXA 5F1YA 1IIDA 1Z4RA 2G0BA 4KZTA 1JDEA 1U6MA 3VWDA 4MI1A 5LRKA 2HV2A 2ZEHA 3U88C 3EY5A 2ABZA 3BUWB 5CPAA 3TX8A 4KVOE 4P44A 1YK3A 3BUOB 5G1ZA 3TE4A 4OC2A 1MJBA 1UFHA 4OC4A 4NFRA 3DSBA 2PJ2A 1S7FA 1NMTA 3IGRA 2G3AA 1B87A 3DGVA 4X2TA 3PLFB 5A28A 1TF9A 1AUGA 2ZELA 2ZW4A 4J0NA 3NE8A 4KVME 3KGQA 3SXOA 3V7ZA 3TLGB 4KOTA 3RAMA 3S9NA 3G23A 4C8PA 4MHDA 4MHPA 2Q43A 2GIVA 3BUXB 1R43A 1QQ9A 3JTKA 1NSLA 4OADA 3I74A 3S6HA 4X5KA 1Y9WA 3JRUA 1CP7A 2RC4A 2OZGA 3LACA 4M6IA 3GYAA 4MXUA 4C9UA 2B4BA 4EMEA 2AFXA 3W91A 2FT0A 1YREA 2BUEA 2XEJA 2POKA 1XOVA 4KLWA 4KUBA 3S6KA 2BOAA 2V77A 3ZJ0A 4LQ6A 3R95A 4CAXA 1VHEA 3RO0A 2HI6A 2BCOA 1S3ZA 4A32A 2AJ6A 1BPNA 5F5XA 1MJ9A 3KQZA 3PB6X 4WWVA 1DIKA 4UFVA 3KR5A 1Y9KA 4P4FA 3HMJG 2Z3KA 2AFZA 5IV0A 1NE9A 3EC4A 3K9UA 5F49A 3V38A 2ZEOA 5K8PA 2EZBA 2GP4A 4JXRA 5FD8A 2ZEDA 4KOSA 3P2FA 4PXBA 1J3LA 5CNPA 3KL9A 4GS4A 4OLLA 4AB7A 1ZLHA 1BOBA 4E8OA 3KR4A 1LAPA 2AFWA 4XPKA 4FAIA 4CGPA 3D3SA 4B11A 5D29A 1IYKA 2B4DA 2FCKA 3W6XA 1M6VB 4E0AA 4COBA 1IICA 4L8AA 3FEEA 2O53A 4NJRA 3PB4X 3B3VA 5D8NA 3IC1A 4DYOA 1F2PA 2P6GA 5THWA 3KZWA 3JUWA 4O23A 1VIXA 4XPDC 1F57A 4PSWA 2AE6A 3VWEA 2CTCA 1WK4A 1EE3P 4YN3A 3D7DA 3DLJA 5HKWA 4EFDA 1F2OA 2B3UA 2H5MA 2V8VA 4B12A 2IL4A 4EVYA 4G1PA 4B14A 3S6FA 4CO9A 2HB6A 2FS5A 4YWYA 4AG9A 2Z3OA 3TLEA 3SR3A 2DXQA 2PVVA 2OZUA 2ZEMA 5BY0A 4UIBA 3WC7A 4AG7A 2PIZA 1SQHA 3KI9A 5JVLA 2B4JC 1ARMA 1TKFA 2O28A 3EFAA 4NGSA 4OIWA 2B5GB 1YQEA 2ZXVA 4MY0A 4BBHA 3F0AA 2F7VA 2PJAA 2R7HA 3GIUA 3EZBA 5LRJA 1M4IA 2CNMA 3TLYA 1A9XB 4OC3A 4C9AA 3NE7A 1S5KA 1MJAA 4M8DA 2B0AA 4NXYA 2OU2A 4PV6A 2N3AB 3A9LA 4IHMA 4UEEA 2CTBA 3SJGA 3B3SA 1Z2LA 4KOVA 4C7HA 1Q2YA 2C27A 2ZW6A 3ISZA 1M4DA 3F9KC 3GB0A 4KLVA 2PJ4A 4B5OA 4UFWA 1H8LA 4QUSA 1P0HA 1YVKA 1HDUA 4UIAA 1ARLA 4A2ZA 5ISVA 4H1HA 4P4DA 2BO9A 1NXJA 2IJZA 1I1DA 3GJZA 4MCQA 4KS9A 4YGOA 3SHPA 4ZX9A 2FL4A 1XMTA 4M3SA 1TXRA 1XEBA 4H2KA 3FRMA 4KUAA 1KUVA 1TKJA 2Q4VA 1RO5A 1YVOA 4A95A 4MJXA 2GFQA 4C2XA 2EO8A 4IUSA 3RNZA 1XF8A 1Z5RA 4PPZA 2XEFA 1Z8XA 4FD5A 2Z0ZA 2HQYA 4HKFA 4W9YA 1YW4A 2BL1A 2VZYA 2QJ8A 4P4EA 4U9ZA 2R1IA 4TJXA 3PT1A 2JEWA 3CT9A 4A37A 5HVFA 4E5SA 3FVLA 5F47A 3PBEA 5J3XA 4NEXA 2WYRA 1XBUA 1JDBC 3U1BA 2XEGA 5CBMA 4QC6A 3WR7A 4PQAA 1KEEB 3IIBA 1CPSA 1C3OB 3C8OA 4MHYA 4A4CA 3D7GA 5H86A 3OAKA 3PBBA 3SI1A 2VZZA 4UA3A 2Z10A 5AG7A 3TYXA 1YR0A 4COGA 1HDQA 4R87A 4OC1A 2YNEA 4MFKA 3MN8A 5KTCA 4RR2B 2YJVA 3TLCA 1ELMP 3SJFA 4MCRA 3L2NA 2WUUA 4DUKA 2Q0YA 1FBVA 4MFZA 4OC5A 2PQ8A 2EBJA 3BI1A 3N5FA 3EO4A 1LOKA 2PJ5A 1GGOA 2AUMA 2YJTA 4OIDA 4X3RA 1XF1A 4FBEA 4QB9A 2Z3PA 3R9FA 1CM0A 2EK8A 2J8MA 4GPLB 1QMUA 3B3TA 3IEHA 3PRTA 4GM5A 4K3NA 1BO4A 4H6ZA 4U9YA 4NJQA 1YGHA 8CPAA 3FYNA 3FBUA 3EXNA 3LMSA 4HPSA 5G22A 4R76A 3SI2A 2GLJA 3LWUA 1Z4EA 4HNYB 3PGPA 3RYOA 5H84A 3PB7X 2Y1NA 2QECA 2CBLA 4JYWA 4C8CA 4F8ZA 5HVGA 2D4OA 4U5YA 4F6AA 4CS0B 1I21A 2P6EA 4QBJA 1CPXA 1RTQA 1NBWA 4QVTA 2FE7A 1PU9A 3HUVA 2VBQA 4CAFA 1YLOA 3K2KA 3IWWA 3P2HA 4DNCA 2NMTA 2X0SA 4FWUA 2EZCA 4MFQA 2Q04A 4F9UA 3TLGA 3BI0A 2PJ8A 5AXIA 2XPPA 4UCMA 2OR4A 3RBUA 2V8HA 2CY2A 2VQYA 3NFZA 1HEEA 2O4HA 3PB9X 2CF4A 1XFOA 2VEZA 3TOAA 3WC5A 1FNOA 3FXTA 4NGMA 3TLZA 2RFHA 4M6HA 3SJXA 4PXDA 4KORA 4JLYA 4ONUA 4UWJA 5J8FA 3NH8A 2YNDA 5AGEA 1LFWA 5LRGA 3PZJA 1ZYMA 4R7MA 2JEVA 3TC8A 2DLAA 2CXAA 3FX6A 3NFQA 1T36B 2E28A 1Z9EA 3KKWA 2IQ6A 4E94A 5HH1A 1M1DA 2G3TA 4LUAA 4ZBGA 3T0TA 4E2AA 1LANA 5AG5A 1KBLA 4M6GA 5LYDA 4XPLA 3FNCA 1VBGA 1ZO0A 3BHXA
chains in the Genus database with same CATH topology
2QVPA 3MRUA 4ZY2A 4NGNA 4C85A 3WABA 2I3CA 3WT4A 3NH4A 4C9EA 4A38A 1YSJA 3KASA 3SJEA 4P4JA 4ZY0A 5JH9A 1PCAA 2ZENA 1AMPA 3CPAA 3IO1A 2V8DA 2AFSA 4F9VA 2IMOA 2PJ7A 2PJCA 4Q7AA 4PXEA 4R8FA 3SI0A 5IR2A 1CX8A 2C6CA 2WZNA 3K9TA 3PFOA 4P10A 4MRIA 1CBXA 5K8NA 4ZI6A 2PJ0A 3GUXA 3NH5A 4TNUA 6CPAA 4A39A 2J9AA 5HXDA 1TF8A 4OMEA 3ICUA 1BPMA 3T8WA 1WVMA 5ELYA 3FF3A 3B35A 2PVWA 1LCPA 1Y0YA 4C8UA 3PFEA 5DS0A 3B2YA 5IB9A 2GLFA 4C8TA 1JQGA 2PJ3A 1XRYA 2GREA 1DE4C 2F8HA 4NGPA 4KSIA 2VL1A 2PIYA 2RB7A 4ZYQA 7CPAA 2QYVA 1KWMA 4MCSA 1ELLP 1Y0RA 4EWTA 2ZEGA 2XEIA 1AYEA 1V6CA 4KNGE 4C99A 5K8OA 2Q51A 3IJ3A 3H8FA 1Y9ZA 4C84A 3IFEA 1UWYA 1XMBA 2CIJA 4CDJA 2DEAA 1R3NA 1ZLIA 3QNVA 1ZG9A 2PRQA 3VH9A 3KHZA 3VTAA 5HVHA 3KHXA 4JZ0A 2G9DA 4NGTA 3BXMA 4ZX8A 2AFMA 2PE3A 2C6PA 5J1QA 5F09A 4P6YA 1IGBA 2ZEEA 1YMEA 1Q7LA 1IY7A 3FEDA 3S9LA 1BLLE 4MHZA 4YU9A 3S9MA 2C1CA 4ONWA 3D66A 3GLJA 4C9RA 1PYTB 4OP4A 4UEZA 4Z65A 5JGFA 4AXVA 2Q4ZA 4A94A 4OC0A 1Z8LA 4CDKA 3B7IA 4RUHA 1VGYA 3H8EA 4MCPA 1Y7EA 1BAVA 3D67A 4UEFA 4P45A 2AFOA 2FVGA 4MHNA 1YW6A 3D7HA 2GU2A 1OBRA 1GYTA 2ZEFA 3FJUA 3PEIA 2PJ6A 2AFUA 3RZAA 1NSAA 1CG2A 4FUUA 1ZG7A 4TJVA 2PJBA 2C6GA 4X8IA 4NGQA 3D7FA 2NSMA 3KQXA 3WC6A 2JBKA 2ANPA 2V8GA 4C8AA 3D68A 4ZY1A 2OOTA 5I4MA 1DTDA 4OKOA 5LYLA 2PJ9A 2NYQA 4IAVA 4UF4A 5LYFA 3VARA 4C9VA 3FECA 3I6SA 2ZOFA 4P4IA 4B6ZA 2JBJA 3CDXA 3FH4A 4MMOA 5K8MA 3B3CA 4DJLA 2PCUA 2C5QA 5LYIA 1LAMA 3PB8X 4C86A 3NA6A 4C8FA 3I1UA 1ZG8A 3VATA 3CPXA 4IK2A 1FT7A 3HLPA 2EWBA 4BD9A 1TKHA 2HC9A 3ISXA 4PXCA 3FMCA 1M4LA 4CPAA 4R6TA 5JM6A 2PJ1A 1XJOA 4NGRA 3B3WA 4P4BA 3H8GA 2EK9A 1VHOA 2ZEPA 2ZOGA 1CP6A 4TWEA 4WJBA 3D4UA 4LQGA 5LRKA 2ZEHA 2ABZA 5CPAA 3TX8A 4P44A 4OC2A 4OC4A 4NFRA 2PJ2A 3DGVA 4X2TA 1TF9A 2ZELA 3KGQA 3V7ZA 3RAMA 3S9NA 4C8PA 4MHPA 2Q43A 1R43A 1QQ9A 3I74A 3JRUA 1CP7A 4MXUA 4C9UA 4EMEA 2AFXA 2XEJA 2POKA 2BOAA 2V77A 1VHEA 2BCOA 1BPNA 3KQZA 3PB6X 4WWVA 3KR5A 4P4FA 2AFZA 5K8PA 3V38A 2ZEOA 2GP4A 2ZEDA 4PXBA 3KL9A 1ZLHA 3KR4A 1LAPA 2AFWA 4FAIA 5D29A 3FEEA 2O53A 4NJRA 3PB4X 3B3VA 5D8NA 3IC1A 4DYOA 1F2PA 5THWA 3KZWA 4O23A 1VIXA 1F57A 2CTCA 1EE3P 4YN3A 3D7DA 3DLJA 4EFDA 1F2OA 2V8VA 4G1PA 2HB6A 4YWYA 2PVVA 2ZEMA 4UIBA 3WC7A 2PIZA 3KI9A 1ARMA 1TKFA 4OIWA 4NGSA 2F7VA 2PJAA 5LRJA 4OC3A 4C9AA 4IHMA 4UEEA 2CTBA 3SJGA 3B3SA 1Z2LA 3ISZA 3GB0A 2PJ4A 1H8LA 1HDUA 4UIAA 1ARLA 4P4DA 2BO9A 2IJZA 4MCQA 4ZX9A 1TXRA 4H2KA 1TKJA 1Z5RA 4PPZA 2XEFA 4W9YA 1YW4A 2QJ8A 4P4EA 4TJXA 2JEWA 3CT9A 4A37A 5HVFA 3FVLA 3PBEA 2WYRA 1XBUA 2XEGA 5CBMA 4PQAA 3IIBA 1CPSA 4MHYA 3D7GA 3PBBA 3SI1A 1HDQA 4OC1A 3MN8A 1ELMP 3SJFA 4MCRA 3L2NA 4DUKA 4OC5A 3BI1A 3N5FA 1LOKA 2PJ5A 4OIDA 4X3RA 1XF1A 4FBEA 2EK8A 4GM5A 1QMUA 3B3TA 3IEHA 3PRTA 4K3NA 8CPAA 4NJQA 3LMSA 4R76A 3SI2A 2GLJA 3LWUA 3PB7X 4JYWA 4C8CA 4F8ZA 5HVGA 1CPXA 1RTQA 3HUVA 1YLOA 3K2KA 3IWWA 4FWUA 4F9UA 3BI0A 2PJ8A 2OR4A 3RBUA 2V8HA 3PB9X 3NFZA 1HEEA 2O4HA 3WC5A 2CF4A 1XFOA 3EIFA 1FNOA 4NGMA 2RFHA 3SJXA 4PXDA 3NH8A 1LFWA 5LRGA 4R7MA 3TC8A 3FX6A 2IQ6A 1LANA 5LYDA 3BHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVP A;  3MRU A;  4ZY2 A;  4NGN A;  4C85 A;  3WAB A;  2I3C A;  3WT4 A;  3NH4 A;  4C9E A;  4A38 A;  1YSJ A;  3KAS A;  3SJE A;  4P4J A;  4ZY0 A;  5JH9 A;  1PCA A;  2ZEN A;  1AMP A;  3CPA A;  3IO1 A;  2V8D A;  2AFS A;  4F9V A;  2IMO A;  2PJ7 A;  2PJC A;  4Q7A A;  4PXE A;  4R8F A;  3SI0 A;  1CX8 A;  2C6C A;  2WZN A;  3K9T A;  3PFO A;  4P10 A;  4MRI A;  1CBX A;  5K8N A;  4ZI6 A;  2PJ0 A;  3GUX A;  3NH5 A;  4TNU A;  6CPA A;  4A39 A;  2J9A A;  5HXD A;  1TF8 A;  4OME A;  3ICU A;  1BPM A;  3T8W A;  1WVM A;  5ELY A;  3FF3 A;  3B35 A;  2PVW A;  1LCP A;  1Y0Y A;  4C8U A;  3PFE A;  5DS0 A;  3B2Y A;  5IB9 A;  2GLF A;  4C8T A;  1JQG A;  2PJ3 A;  1XRY A;  2GRE A;  1DE4 C;  2F8H A;  4NGP A;  4KSI A;  2VL1 A;  2PIY A;  2RB7 A;  4ZYQ A;  7CPA A;  2QYV A;  1KWM A;  4MCS A;  1ELL P;  1Y0R A;  4EWT A;  2ZEG A;  2XEI A;  1AYE A;  1V6C A;  4KNG E;  4C99 A;  5K8O A;  2Q51 A;  3IJ3 A;  3H8F A;  1Y9Z A;  4C84 A;  3IFE A;  1UWY A;  1XMB A;  2CIJ A;  4CDJ A;  2DEA A;  1R3N A;  1ZLI A;  3QNV A;  1ZG9 A;  2PRQ A;  3VH9 A;  3KHZ A;  3VTA A;  5HVH A;  3KHX A;  4JZ0 A;  2G9D A;  4NGT A;  3BXM A;  4ZX8 A;  2AFM A;  2PE3 A;  2C6P A;  5J1Q A;  5F09 A;  4P6Y A;  1IGB A;  2ZEE A;  1YME A;  1Q7L A;  1IY7 A;  3FED A;  3S9L A;  1BLL E;  4MHZ A;  4YU9 A;  3S9M A;  2C1C A;  4ONW A;  3D66 A;  3GLJ A;  4C9R A;  1PYT B;  4OP4 A;  4UEZ A;  4Z65 A;  5JGF A;  4AXV A;  2Q4Z A;  4A94 A;  4OC0 A;  1Z8L A;  4CDK A;  3B7I A;  4RUH A;  1VGY A;  3H8E A;  4MCP A;  1Y7E A;  1BAV A;  3D67 A;  4UEF A;  4P45 A;  2AFO A;  2FVG A;  4MHN A;  1YW6 A;  3D7H A;  2GU2 A;  1OBR A;  1GYT A;  2ZEF A;  3FJU A;  3PEI A;  2PJ6 A;  2AFU A;  3RZA A;  1NSA A;  1CG2 A;  4FUU A;  1ZG7 A;  4TJV A;  2PJB A;  2C6G A;  4X8I A;  4NGQ A;  3D7F A;  2NSM A;  3KQX A;  3WC6 A;  2JBK A;  2ANP A;  2V8G A;  4C8A A;  3D68 A;  4ZY1 A;  2OOT A;  5I4M A;  1DTD A;  4OKO A;  5LYL A;  2PJ9 A;  2NYQ A;  4IAV A;  4UF4 A;  5LYF A;  3VAR A;  4C9V A;  3FEC A;  3I6S A;  2ZOF A;  4P4I A;  4B6Z A;  2JBJ A;  3CDX A;  3FH4 A;  4MMO A;  5K8M A;  3B3C A;  4DJL A;  2PCU A;  5LYI A;  1LAM A;  3PB8 X;  4C86 A;  3NA6 A;  4C8F A;  3I1U A;  1ZG8 A;  3VAT A;  3CPX A;  4IK2 A;  1FT7 A;  3HLP A;  2EWB A;  4BD9 A;  1TKH A;  2HC9 A;  3ISX A;  4PXC A;  3FMC A;  1M4L A;  4CPA A;  4R6T A;  5JM6 A;  2PJ1 A;  1XJO A;  4NGR A;  3B3W A;  4P4B A;  3H8G A;  2EK9 A;  1VHO A;  2ZEP A;  2ZOG A;  1CP6 A;  4TWE A;  4WJB A;  3D4U A;  4LQG A;  5LRK A;  2ZEH A;  2ABZ A;  5CPA A;  3TX8 A;  4P44 A;  4OC2 A;  4OC4 A;  4NFR A;  2PJ2 A;  3DGV A;  4X2T A;  1TF9 A;  2ZEL A;  3KGQ A;  3V7Z A;  3RAM A;  3S9N A;  4C8P A;  4MHP A;  2Q43 A;  1R43 A;  1QQ9 A;  3I74 A;  3JRU A;  1CP7 A;  4MXU A;  4C9U A;  4EME A;  2AFX A;  2XEJ A;  2POK A;  2BOA A;  2V77 A;  1VHE A;  2BCO A;  1BPN A;  3KQZ A;  3PB6 X;  4WWV A;  3KR5 A;  4P4F A;  2AFZ A;  5K8P A;  3V38 A;  2ZEO A;  2ZED A;  4PXB A;  3KL9 A;  1ZLH A;  3KR4 A;  1LAP A;  2AFW A;  4FAI A;  5D29 A;  3FEE A;  2O53 A;  4NJR A;  3PB4 X;  3B3V A;  5D8N A;  3IC1 A;  4DYO A;  1F2P A;  5THW A;  3KZW A;  4O23 A;  1VIX A;  1F57 A;  2CTC A;  1EE3 P;  4YN3 A;  3D7D A;  3DLJ A;  4EFD A;  1F2O A;  2V8V A;  4G1P A;  2HB6 A;  4YWY A;  2PVV A;  2ZEM A;  4UIB A;  3WC7 A;  2PIZ A;  3KI9 A;  1ARM A;  1TKF A;  4OIW A;  4NGS A;  2F7V A;  2PJA A;  5LRJ A;  4OC3 A;  4C9A A;  4IHM A;  4UEE A;  2CTB A;  3SJG A;  3B3S A;  1Z2L A;  3ISZ A;  3GB0 A;  2PJ4 A;  1H8L A;  1HDU A;  4UIA A;  1ARL A;  4P4D A;  2BO9 A;  2IJZ A;  4MCQ A;  4ZX9 A;  1TXR A;  4H2K A;  1TKJ A;  1Z5R A;  4PPZ A;  2XEF A;  4W9Y A;  1YW4 A;  2QJ8 A;  4P4E A;  4TJX A;  2JEW A;  3CT9 A;  4A37 A;  5HVF A;  3FVL A;  3PBE A;  2WYR A;  1XBU A;  2XEG A;  5CBM A;  4PQA A;  3IIB A;  1CPS A;  4MHY A;  3D7G A;  3PBB A;  3SI1 A;  1HDQ A;  4OC1 A;  3MN8 A;  1ELM P;  3SJF A;  4MCR A;  3L2N A;  4DUK A;  4OC5 A;  3BI1 A;  3N5F A;  1LOK A;  2PJ5 A;  4OID A;  4X3R A;  1XF1 A;  4FBE A;  2EK8 A;  4GM5 A;  1QMU A;  3B3T A;  3IEH A;  3PRT A;  4K3N A;  8CPA A;  4NJQ A;  3LMS A;  4R76 A;  3SI2 A;  2GLJ A;  3LWU A;  3PB7 X;  4JYW A;  4C8C A;  4F8Z A;  5HVG A;  1CPX A;  1RTQ A;  3HUV A;  1YLO A;  3K2K A;  3IWW A;  4FWU A;  4F9U A;  3BI0 A;  2PJ8 A;  2OR4 A;  3RBU A;  2V8H A;  3PB9 X;  3NFZ A;  1HEE A;  2O4H A;  3WC5 A;  2CF4 A;  1XFO A;  3EIF A;  1FNO A;  4NGM A;  2RFH A;  3SJX A;  4PXD A;  3NH8 A;  1LFW A;  5LRG A;  4R7M A;  3TC8 A;  3FX6 A;  2IQ6 A;  1LAN A;  5LYD A;  3BHX A; 
#chains in the Genus database with same CATH topology
 3V8I A;  2REF A;  5F9M A;  4UBR A;  2QVP A;  2GAN A;  3OB2 B;  2PDO A;  3MRU A;  4JWP A;  3LOD A;  1EO0 A;  3IU1 A;  4NGN A;  4KSA A;  4ZY2 A;  1YX0 A;  3WAB A;  2I00 A;  1CE8 B;  2D0P A;  4C85 A;  4CRY B;  2I3C A;  3WT4 A;  3NH4 A;  5G20 A;  2B3V A;  4CGN A;  4C9E A;  4A38 A;  1YSJ A;  1X12 A;  3KAS A;  3SJE A;  4P4J A;  5FVJ A;  1Q2C A;  4C2Z A;  4ZY0 A;  4YFJ A;  5JH9 A;  2JDC A;  1VHS A;  3O8Z A;  4L89 A;  4NSQ A;  2OH1 A;  5F13 A;  1Z9U A;  3GY9 A;  3G8W A;  1YVH A;  1PCA A;  4ZGY B;  2ZEN A;  2PR8 A;  1AMP A;  2FSR A;  3CPA A;  1P4N A;  3IO1 A;  4CGL A;  2FIA A;  2V8D A;  3CXQ A;  4KOX A;  4RS2 A;  2AFS A;  4F9V A;  4A31 A;  3BJ7 A;  5AG4 A;  1YLE A;  4KOY A;  1IB1 E;  2VXK A;  3H5Z A;  2ZW5 A;  5J8C A;  2IMO A;  2PJ7 A;  2PJC A;  4Q7A A;  4XNH B;  4F0Y A;  4B5P B;  3CXP A;  4PXE A;  4KOU A;  4R8F A;  5G21 A;  3SI0 A;  1CX8 A;  5IR2 A;  2C6C A;  2WZN A;  3K9T A;  3PFO A;  4IIY A;  4P10 A;  4MRI A;  4CYQ A;  3FIX A;  5GCN A;  1CBX A;  3TLB A;  4OAE A;  5IX3 A;  3BJ8 A;  5K8N A;  4KOW A;  3VRR A;  4ZI6 A;  2GE3 A;  2REE A;  2PJ0 A;  2Z3N A;  3GUX A;  2PR1 A;  3NH5 A;  2WPW A;  5JQ4 A;  4TNU A;  6CPA A;  3T07 A;  2I79 A;  4F0X A;  1QSM A;  2B5G A;  3DDD A;  1Q5X A;  4A39 A;  2J9A A;  5HXD A;  5IB0 A;  1TF8 A;  4IIX A;  4OME A;  3QAH A;  3ICU A;  1L0C A;  1BPM A;  3T8W A;  1WVM A;  3VGO A;  2F5I A;  3FF3 A;  5ELY A;  3B35 A;  2P6F A;  2PVW A;  1CJW A;  2DPT A;  1LCP A;  2Z3M A;  4MI4 A;  1Y0Y A;  4MY3 A;  4R3K A;  2YGW A;  1X10 A;  4II9 A;  4C8U A;  3PFE A;  5C88 A;  5DS0 A;  4Q36 A;  3B2Y A;  5IB9 A;  4C2Y A;  2GLF A;  2FM4 A;  3JVN A;  3T5M A;  4C8T A;  2XPN A;  1JQG A;  4FD6 A;  2K5T A;  2PJ3 A;  2PRB A;  1A2Z A;  1C30 B;  1VI4 A;  4C68 A;  1XRY A;  3NOJ A;  2GRE A;  2Z11 A;  1DE4 C;  1WJT A;  2CNT A;  2F8H A;  4NGP A;  4KSI A;  2VL1 A;  2OZH A;  2PIY A;  2RB7 A;  3D8P A;  4ZYQ A;  7CPA A;  2QYV A;  3LD2 A;  1KWM A;  4MCS A;  1ELL P;  2PC1 A;  3R1K A;  2CNS A;  2ARH A;  5KTA A;  2KCW A;  4CAV A;  3D2P A;  1Y0R A;  4EWT A;  1QSR A;  2ZEG A;  2XEI A;  1AYE A;  1I12 A;  2EVN A;  3R9G A;  5DWN A;  3TCV A;  3IU2 A;  1V6C A;  3T90 A;  2EUI A;  2A4N A;  3FB3 A;  5KTD A;  4B10 A;  2XPO A;  4FD7 A;  4KNG E;  4C99 A;  2Q7S A;  1XIX A;  1Z8W A;  2Q51 A;  5K8O A;  3IJ3 A;  4CAW A;  2JLM A;  4FD4 A;  2WSA A;  2D0O A;  3H8F A;  4ORF A;  1Y9Z A;  4C84 A;  3IFE A;  4Y49 B;  1UWY A;  4BMH A;  2FIW A;  1XMB A;  2CIJ A;  4CDJ A;  3EZA A;  2DEA A;  3E0K A;  1TIQ A;  2R8V A;  2BSW A;  3SXN A;  1VKC A;  5F48 A;  1R3N A;  1ZLI A;  3CZX A;  3QNV A;  5EMI A;  4A30 A;  3KRV A;  1ZG9 A;  4M85 A;  2PRQ A;  4RI1 A;  2ODF A;  3VH9 A;  3KHZ A;  3VTA A;  5HVH A;  3KHX A;  3PP9 A;  3EZE A;  4YRH A;  4MBU A;  4CYO A;  4H6U A;  1S7L A;  4JZ0 A;  4MJ8 A;  3PFV A;  2G9D A;  1EZA A;  4NGT A;  1QST A;  3BXM A;  4ZX8 A;  3UY5 A;  5JPH A;  1Z8T A;  2AFM A;  4NF1 A;  4AVC A;  1LRZ A;  2PE3 A;  2C6P A;  1N71 A;  5F09 A;  5J1Q A;  4P6Y A;  4Q38 A;  1FY7 A;  1IGB A;  3BLN A;  1QSO A;  2ATR A;  1YME A;  2DF5 A;  2ZEE A;  4CRZ B;  1MK4 A;  1Q7L A;  2Q44 A;  4UCN A;  1IY7 A;  3FED A;  3S9L A;  1BLL E;  3F5B A;  4HNW B;  1M44 A;  4MHZ A;  1RXT A;  3B8G A;  4YU9 A;  3S9M A;  2C1C A;  3EIF A;  4AVA A;  1WWZ A;  5DWM A;  4ONW A;  1JWQ A;  4BPX B;  2HWG A;  2B4D B;  5E96 A;  1J4J A;  1B6B A;  3D66 A;  3OWC A;  2XPL A;  3GLJ A;  3W6S A;  3TFY A;  4C9R A;  1PYT B;  3N7Z A;  4A4B A;  4OP4 A;  2Z3L A;  3I9S A;  4UEZ A;  4Z65 A;  5JGF A;  4JD6 A;  3TLA A;  4UFX A;  4AXV A;  4JJX A;  3TO7 A;  2QML A;  3G3S A;  3ZZI A;  3MGD A;  1IOF A;  2Q4Z A;  2B58 A;  4A94 A;  4OC0 A;  1Y7R A;  4NCZ A;  2X7B A;  5EBV A;  1Z8L A;  4CDK A;  3DR6 A;  3B7I A;  3H4Q A;  3R96 A;  4KSF A;  3TO6 A;  4RUH A;  4EYS A;  1VGY A;  1M4G A;  3H8E A;  2Q7B A;  4XNH C;  3IWE A;  3DR8 A;  4B13 A;  1VBH A;  1R61 A;  4MCP A;  1Y7E A;  1QSN A;  4JXQ A;  2YNC C;  2J8N A;  5I0C A;  1BAV A;  3D67 A;  4UEF A;  3QB8 A;  4P45 A;  2ZPA A;  3OP0 A;  2AFO A;  4H89 A;  2FVG A;  2DIK A;  3HPG G;  1EZB A;  1S7N A;  4MHN A;  1PUA A;  3IWG A;  3OB1 B;  3VRP A;  1YW6 A;  2PSW A;  2BEI A;  3HPH E;  2D4P A;  2DPS A;  3D7H A;  3I3G A;  2GU2 A;  4LX9 A;  1OBR A;  1GYT A;  3BUN B;  4UCP A;  1Q2D A;  5HKY A;  3ZNI A;  2ZEF A;  1OZP A;  3TO9 A;  2UV8 G;  3FJU A;  3PEI A;  2PJ6 A;  2AUN A;  2R98 A;  2AFU A;  2JDD A;  1KZF A;  3DNS A;  4R3L A;  3RZA A;  1NSA A;  1CG2 A;  4FUU A;  1ZG7 A;  2Q4Y A;  1GHE A;  5BWA B;  2VKZ G;  3K4I A;  4TJV A;  2PJB A;  2C6G A;  2ZW7 A;  4X8I A;  4K30 A;  4NGQ A;  3D7F A;  2NSM A;  3T05 A;  3S6G A;  3VRN A;  3KQX A;  3WC6 A;  2EZA A;  5HMN A;  2JBK A;  2ANP A;  3R9E A;  1BXR B;  2V8G A;  4BPW B;  4XPD B;  4C8A A;  2P0W A;  1XE4 A;  3D68 A;  4ZY1 A;  2OOT A;  5I4M A;  1DTD A;  1ZL0 A;  4OKO A;  3BUM B;  4C7I A;  4HNX B;  2MP0 A;  5LYL A;  2PJ9 A;  4PK2 A;  2NYQ A;  3TT2 A;  4IAV A;  4UF4 A;  5LYF A;  3VAR A;  3D2M A;  2PCN A;  2Y1M A;  1IU8 A;  1ZRS A;  4C9V A;  1KUX A;  4AVB A;  3GKR A;  3TOB A;  1R57 A;  3VRQ A;  3FEC A;  5EC4 A;  4R57 A;  4CYP A;  4BPU B;  1IOI A;  2VI7 A;  4B5P A;  5AG6 A;  3I6S A;  2ZOF A;  4IF5 A;  1IYL A;  2OB0 A;  4P4I A;  2YNC A;  2JBJ A;  4B6Z A;  1ON0 A;  2J8R A;  4J3G A;  5JYB A;  5K99 A;  3CDX A;  3FH4 A;  4MMO A;  2Y0M A;  5K8M A;  4UWI A;  3B3C A;  4CZ1 A;  4JVO A;  3C26 A;  2QIR A;  1V0C A;  4RN7 A;  3CXS A;  2PCU A;  4DJL A;  4Y49 C;  2C5Q A;  5LYI A;  3QAY A;  3F8K A;  4KVX A;  1LAM A;  3PB8 X;  4C86 A;  1KUY A;  4GXH A;  4CAE A;  3NA6 A;  2FXF A;  4R9M A;  2R82 A;  4C8F A;  3I1U A;  1ZG8 A;  4MFJ A;  4MFP A;  3VAT A;  3CPX A;  4IK2 A;  1FT7 A;  3HLP A;  2EWB A;  4BD9 A;  1TKH A;  1S60 A;  5A27 A;  1KC7 A;  2HC9 A;  3ISX A;  4I49 A;  4MFL A;  2OLS A;  1S7K A;  4PXC A;  3FMC A;  1M4L A;  4CPA A;  4R6T A;  4CYN A;  5JM6 A;  5C82 A;  2PJ1 A;  1XJO A;  4NGR A;  3VRO A;  2HRO A;  4BTF A;  4PK3 A;  4BIN A;  3TTH A;  5F46 A;  3T9Y A;  1K4J A;  3B3W A;  2HUZ A;  4P4B A;  3H8G A;  2EK9 A;  1VHO A;  2ZEP A;  4A33 A;  2ZOG A;  1CP6 A;  4TWE A;  2WPX A;  5HKZ A;  4CGM A;  4WJB A;  4CGO A;  3D4U A;  4LQG A;  1B47 A;  4INJ A;  1CS0 B;  4PSX A;  5F1Y A;  1IID A;  1Z4R A;  2G0B A;  4KZT A;  1JDE A;  1U6M A;  3VWD A;  4MI1 A;  5LRK A;  2HV2 A;  2ZEH A;  3U88 C;  3EY5 A;  2ABZ A;  3BUW B;  5CPA A;  3TX8 A;  4KVO E;  4P44 A;  1YK3 A;  3BUO B;  5G1Z A;  3TE4 A;  4OC2 A;  1MJB A;  1UFH A;  4OC4 A;  4NFR A;  3DSB A;  2PJ2 A;  1S7F A;  1NMT A;  3IGR A;  2G3A A;  1B87 A;  3DGV A;  4X2T A;  3PLF B;  5A28 A;  1TF9 A;  1AUG A;  2ZEL A;  2ZW4 A;  4J0N A;  3NE8 A;  4KVM E;  3KGQ A;  3SXO A;  3V7Z A;  3TLG B;  4KOT A;  3RAM A;  3S9N A;  3G23 A;  4C8P A;  4MHD A;  4MHP A;  2Q43 A;  2GIV A;  3BUX B;  1R43 A;  1QQ9 A;  3JTK A;  1NSL A;  4OAD A;  3I74 A;  3S6H A;  4X5K A;  1Y9W A;  3JRU A;  1CP7 A;  2RC4 A;  2OZG A;  3LAC A;  4M6I A;  3GYA A;  4MXU A;  4C9U A;  2B4B A;  4EME A;  2AFX A;  3W91 A;  2FT0 A;  1YRE A;  2BUE A;  2XEJ A;  2POK A;  1XOV A;  4KLW A;  4KUB A;  3S6K A;  2BOA A;  2V77 A;  3ZJ0 A;  4LQ6 A;  3R95 A;  4CAX A;  1VHE A;  3RO0 A;  2HI6 A;  2BCO A;  1S3Z A;  4A32 A;  2AJ6 A;  1BPN A;  5F5X A;  1MJ9 A;  3KQZ A;  3PB6 X;  4WWV A;  1DIK A;  4UFV A;  3KR5 A;  1Y9K A;  4P4F A;  3HMJ G;  2Z3K A;  2AFZ A;  5IV0 A;  1NE9 A;  3EC4 A;  3K9U A;  5F49 A;  3V38 A;  2ZEO A;  5K8P A;  2EZB A;  2GP4 A;  4JXR A;  5FD8 A;  2ZED A;  4KOS A;  3P2F A;  4PXB A;  1J3L A;  5CNP A;  3KL9 A;  4GS4 A;  4OLL A;  4AB7 A;  1ZLH A;  1BOB A;  4E8O A;  3KR4 A;  1LAP A;  2AFW A;  4XPK A;  4FAI A;  4CGP A;  3D3S A;  4B11 A;  5D29 A;  1IYK A;  2B4D A;  2FCK A;  3W6X A;  1M6V B;  4E0A A;  4COB A;  1IIC A;  4L8A A;  3FEE A;  2O53 A;  4NJR A;  3PB4 X;  3B3V A;  5D8N A;  3IC1 A;  4DYO A;  1F2P A;  2P6G A;  5THW A;  3KZW A;  3JUW A;  4O23 A;  1VIX A;  4XPD C;  1F57 A;  4PSW A;  2AE6 A;  3VWE A;  2CTC A;  1WK4 A;  1EE3 P;  4YN3 A;  3D7D A;  3DLJ A;  5HKW A;  4EFD A;  1F2O A;  2B3U A;  2H5M A;  2V8V A;  4B12 A;  2IL4 A;  4EVY A;  4G1P A;  4B14 A;  3S6F A;  4CO9 A;  2HB6 A;  2FS5 A;  4YWY A;  4AG9 A;  2Z3O A;  3TLE A;  3SR3 A;  2DXQ A;  2PVV A;  2OZU A;  2ZEM A;  5BY0 A;  4UIB A;  3WC7 A;  4AG7 A;  2PIZ A;  1SQH A;  3KI9 A;  5JVL A;  2B4J C;  1ARM A;  1TKF A;  2O28 A;  3EFA A;  4NGS A;  4OIW A;  2B5G B;  1YQE A;  2ZXV A;  4MY0 A;  4BBH A;  3F0A A;  2F7V A;  2PJA A;  2R7H A;  3GIU A;  3EZB A;  5LRJ A;  1M4I A;  2CNM A;  3TLY A;  1A9X B;  4OC3 A;  4C9A A;  3NE7 A;  1S5K A;  1MJA A;  4M8D A;  2B0A A;  4NXY A;  2OU2 A;  4PV6 A;  2N3A B;  3A9L A;  4IHM A;  4UEE A;  2CTB A;  3SJG A;  3B3S A;  1Z2L A;  4KOV A;  4C7H A;  1Q2Y A;  2C27 A;  2ZW6 A;  3ISZ A;  1M4D A;  3F9K C;  3GB0 A;  4KLV A;  2PJ4 A;  4B5O A;  4UFW A;  1H8L A;  4QUS A;  1P0H A;  1YVK A;  1HDU A;  4UIA A;  1ARL A;  4A2Z A;  5ISV A;  4H1H A;  4P4D A;  2BO9 A;  1NXJ A;  2IJZ A;  1I1D A;  3GJZ A;  4MCQ A;  4KS9 A;  4YGO A;  3SHP A;  4ZX9 A;  2FL4 A;  1XMT A;  4M3S A;  1TXR A;  1XEB A;  4H2K A;  3FRM A;  4KUA A;  1KUV A;  1TKJ A;  2Q4V A;  1RO5 A;  1YVO A;  4A95 A;  4MJX A;  2GFQ A;  4C2X A;  2EO8 A;  4IUS A;  3RNZ A;  1XF8 A;  1Z5R A;  4PPZ A;  2XEF A;  1Z8X A;  4FD5 A;  2Z0Z A;  2HQY A;  4HKF A;  4W9Y A;  1YW4 A;  2BL1 A;  2VZY A;  2QJ8 A;  4P4E A;  4U9Z A;  2R1I A;  4TJX A;  3PT1 A;  2JEW A;  3CT9 A;  4A37 A;  5HVF A;  4E5S A;  3FVL A;  5F47 A;  3PBE A;  5J3X A;  4NEX A;  2WYR A;  1XBU A;  1JDB C;  3U1B A;  2XEG A;  5CBM A;  4QC6 A;  3WR7 A;  4PQA A;  1KEE B;  3IIB A;  1CPS A;  1C3O B;  3C8O A;  4MHY A;  4A4C A;  3D7G A;  5H86 A;  3OAK A;  3PBB A;  3SI1 A;  2VZZ A;  4UA3 A;  2Z10 A;  5AG7 A;  3TYX A;  1YR0 A;  4COG A;  1HDQ A;  4R87 A;  4OC1 A;  2YNE A;  4MFK A;  3MN8 A;  5KTC A;  4RR2 B;  2YJV A;  3TLC A;  1ELM P;  3SJF A;  4MCR A;  3L2N A;  2WUU A;  4DUK A;  2Q0Y A;  1FBV A;  4MFZ A;  4OC5 A;  2PQ8 A;  2EBJ A;  3BI1 A;  3N5F A;  3EO4 A;  1LOK A;  2PJ5 A;  1GGO A;  2AUM A;  2YJT A;  4OID A;  4X3R A;  1XF1 A;  4FBE A;  4QB9 A;  2Z3P A;  3R9F A;  1CM0 A;  2EK8 A;  2J8M A;  4GPL B;  1QMU A;  3B3T A;  3IEH A;  3PRT A;  4GM5 A;  4K3N A;  1BO4 A;  4H6Z A;  4U9Y A;  4NJQ A;  1YGH A;  8CPA A;  3FYN A;  3FBU A;  3EXN A;  3LMS A;  4HPS A;  5G22 A;  4R76 A;  3SI2 A;  2GLJ A;  3LWU A;  1Z4E A;  4HNY B;  3PGP A;  3RYO A;  5H84 A;  3PB7 X;  2Y1N A;  2QEC A;  2CBL A;  4JYW A;  4C8C A;  4F8Z A;  5HVG A;  2D4O A;  4U5Y A;  4F6A A;  4CS0 B;  1I21 A;  2P6E A;  4QBJ A;  1CPX A;  1RTQ A;  1NBW A;  4QVT A;  2FE7 A;  1PU9 A;  3HUV A;  2VBQ A;  4CAF A;  1YLO A;  3K2K A;  3IWW A;  3P2H A;  4DNC A;  2NMT A;  2X0S A;  4FWU A;  2EZC A;  4MFQ A;  2Q04 A;  4F9U A;  3TLG A;  3BI0 A;  2PJ8 A;  5AXI A;  2XPP A;  4UCM A;  2OR4 A;  3RBU A;  2V8H A;  2CY2 A;  2VQY A;  3NFZ A;  1HEE A;  2O4H A;  3PB9 X;  2CF4 A;  1XFO A;  2VEZ A;  3TOA A;  3WC5 A;  1FNO A;  3FXT A;  4NGM A;  3TLZ A;  2RFH A;  4M6H A;  3SJX A;  4PXD A;  4KOR A;  4JLY A;  4ONU A;  4UWJ A;  5J8F A;  3NH8 A;  2YND A;  5AGE A;  1LFW A;  5LRG A;  3PZJ A;  1ZYM A;  4R7M A;  2JEV A;  3TC8 A;  2DLA A;  2CXA A;  3FX6 A;  3NFQ A;  1T36 B;  2E28 A;  1Z9E A;  3KKW A;  2IQ6 A;  4E94 A;  5HH1 A;  1M1D A;  2G3T A;  4LUA A;  4ZBG A;  3T0T A;  4E2A A;  1LAN A;  5AG5 A;  1KBL A;  4M6G A;  5LYD A;  4XPL A;  3FNC A;  1VBG A;  1ZO0 A;  3BHX A; 
#chains in the Genus database with same CATH homology
 2QVP A;  3MRU A;  4ZY2 A;  4NGN A;  4C85 A;  3WAB A;  2I3C A;  3WT4 A;  3NH4 A;  4C9E A;  4A38 A;  1YSJ A;  3KAS A;  3SJE A;  4P4J A;  4ZY0 A;  5JH9 A;  1PCA A;  2ZEN A;  1AMP A;  3CPA A;  3IO1 A;  2V8D A;  2AFS A;  4F9V A;  2IMO A;  2PJ7 A;  2PJC A;  4Q7A A;  4PXE A;  4R8F A;  3SI0 A;  5IR2 A;  1CX8 A;  2C6C A;  2WZN A;  3K9T A;  3PFO A;  4P10 A;  4MRI A;  1CBX A;  5K8N A;  4ZI6 A;  2PJ0 A;  3GUX A;  3NH5 A;  4TNU A;  6CPA A;  4A39 A;  2J9A A;  5HXD A;  1TF8 A;  4OME A;  3ICU A;  1BPM A;  3T8W A;  1WVM A;  5ELY A;  3FF3 A;  3B35 A;  2PVW A;  1LCP A;  1Y0Y A;  4C8U A;  3PFE A;  5DS0 A;  3B2Y A;  5IB9 A;  2GLF A;  4C8T A;  1JQG A;  2PJ3 A;  1XRY A;  2GRE A;  1DE4 C;  2F8H A;  4NGP A;  4KSI A;  2VL1 A;  2PIY A;  2RB7 A;  4ZYQ A;  7CPA A;  2QYV A;  1KWM A;  4MCS A;  1ELL P;  1Y0R A;  4EWT A;  2ZEG A;  2XEI A;  1AYE A;  1V6C A;  4KNG E;  4C99 A;  5K8O A;  2Q51 A;  3IJ3 A;  3H8F A;  1Y9Z A;  4C84 A;  3IFE A;  1UWY A;  1XMB A;  2CIJ A;  4CDJ A;  2DEA A;  1R3N A;  1ZLI A;  3QNV A;  1ZG9 A;  2PRQ A;  3VH9 A;  3KHZ A;  3VTA A;  5HVH A;  3KHX A;  4JZ0 A;  2G9D A;  4NGT A;  3BXM A;  4ZX8 A;  2AFM A;  2PE3 A;  2C6P A;  5J1Q A;  5F09 A;  4P6Y A;  1IGB A;  2ZEE A;  1YME A;  1Q7L A;  1IY7 A;  3FED A;  3S9L A;  1BLL E;  4MHZ A;  4YU9 A;  3S9M A;  2C1C A;  4ONW A;  3D66 A;  3GLJ A;  4C9R A;  1PYT B;  4OP4 A;  4UEZ A;  4Z65 A;  5JGF A;  4AXV A;  2Q4Z A;  4A94 A;  4OC0 A;  1Z8L A;  4CDK A;  3B7I A;  4RUH A;  1VGY A;  3H8E A;  4MCP A;  1Y7E A;  1BAV A;  3D67 A;  4UEF A;  4P45 A;  2AFO A;  2FVG A;  4MHN A;  1YW6 A;  3D7H A;  2GU2 A;  1OBR A;  1GYT A;  2ZEF A;  3FJU A;  3PEI A;  2PJ6 A;  2AFU A;  3RZA A;  1NSA A;  1CG2 A;  4FUU A;  1ZG7 A;  4TJV A;  2PJB A;  2C6G A;  4X8I A;  4NGQ A;  3D7F A;  2NSM A;  3KQX A;  3WC6 A;  2JBK A;  2ANP A;  2V8G A;  4C8A A;  3D68 A;  4ZY1 A;  2OOT A;  5I4M A;  1DTD A;  4OKO A;  5LYL A;  2PJ9 A;  2NYQ A;  4IAV A;  4UF4 A;  5LYF A;  3VAR A;  4C9V A;  3FEC A;  3I6S A;  2ZOF A;  4P4I A;  4B6Z A;  2JBJ A;  3CDX A;  3FH4 A;  4MMO A;  5K8M A;  3B3C A;  4DJL A;  2PCU A;  2C5Q A;  5LYI A;  1LAM A;  3PB8 X;  4C86 A;  3NA6 A;  4C8F A;  3I1U A;  1ZG8 A;  3VAT A;  3CPX A;  4IK2 A;  1FT7 A;  3HLP A;  2EWB A;  4BD9 A;  1TKH A;  2HC9 A;  3ISX A;  4PXC A;  3FMC A;  1M4L A;  4CPA A;  4R6T A;  5JM6 A;  2PJ1 A;  1XJO A;  4NGR A;  3B3W A;  4P4B A;  3H8G A;  2EK9 A;  1VHO A;  2ZEP A;  2ZOG A;  1CP6 A;  4TWE A;  4WJB A;  3D4U A;  4LQG A;  5LRK A;  2ZEH A;  2ABZ A;  5CPA A;  3TX8 A;  4P44 A;  4OC2 A;  4OC4 A;  4NFR A;  2PJ2 A;  3DGV A;  4X2T A;  1TF9 A;  2ZEL A;  3KGQ A;  3V7Z A;  3RAM A;  3S9N A;  4C8P A;  4MHP A;  2Q43 A;  1R43 A;  1QQ9 A;  3I74 A;  3JRU A;  1CP7 A;  4MXU A;  4C9U A;  4EME A;  2AFX A;  2XEJ A;  2POK A;  2BOA A;  2V77 A;  1VHE A;  2BCO A;  1BPN A;  3KQZ A;  3PB6 X;  4WWV A;  3KR5 A;  4P4F A;  2AFZ A;  5K8P A;  3V38 A;  2ZEO A;  2GP4 A;  2ZED A;  4PXB A;  3KL9 A;  1ZLH A;  3KR4 A;  1LAP A;  2AFW A;  4FAI A;  5D29 A;  3FEE A;  2O53 A;  4NJR A;  3PB4 X;  3B3V A;  5D8N A;  3IC1 A;  4DYO A;  1F2P A;  5THW A;  3KZW A;  4O23 A;  1VIX A;  1F57 A;  2CTC A;  1EE3 P;  4YN3 A;  3D7D A;  3DLJ A;  4EFD A;  1F2O A;  2V8V A;  4G1P A;  2HB6 A;  4YWY A;  2PVV A;  2ZEM A;  4UIB A;  3WC7 A;  2PIZ A;  3KI9 A;  1ARM A;  1TKF A;  4OIW A;  4NGS A;  2F7V A;  2PJA A;  5LRJ A;  4OC3 A;  4C9A A;  4IHM A;  4UEE A;  2CTB A;  3SJG A;  3B3S A;  1Z2L A;  3ISZ A;  3GB0 A;  2PJ4 A;  1H8L A;  1HDU A;  4UIA A;  1ARL A;  4P4D A;  2BO9 A;  2IJZ A;  4MCQ A;  4ZX9 A;  1TXR A;  4H2K A;  1TKJ A;  1Z5R A;  4PPZ A;  2XEF A;  4W9Y A;  1YW4 A;  2QJ8 A;  4P4E A;  4TJX A;  2JEW A;  3CT9 A;  4A37 A;  5HVF A;  3FVL A;  3PBE A;  2WYR A;  1XBU A;  2XEG A;  5CBM A;  4PQA A;  3IIB A;  1CPS A;  4MHY A;  3D7G A;  3PBB A;  3SI1 A;  1HDQ A;  4OC1 A;  3MN8 A;  1ELM P;  3SJF A;  4MCR A;  3L2N A;  4DUK A;  4OC5 A;  3BI1 A;  3N5F A;  1LOK A;  2PJ5 A;  4OID A;  4X3R A;  1XF1 A;  4FBE A;  2EK8 A;  4GM5 A;  1QMU A;  3B3T A;  3IEH A;  3PRT A;  4K3N A;  8CPA A;  4NJQ A;  3LMS A;  4R76 A;  3SI2 A;  2GLJ A;  3LWU A;  3PB7 X;  4JYW A;  4C8C A;  4F8Z A;  5HVG A;  1CPX A;  1RTQ A;  3HUV A;  1YLO A;  3K2K A;  3IWW A;  4FWU A;  4F9U A;  3BI0 A;  2PJ8 A;  2OR4 A;  3RBU A;  2V8H A;  3PB9 X;  3NFZ A;  1HEE A;  2O4H A;  3WC5 A;  2CF4 A;  1XFO A;  3EIF A;  1FNO A;  4NGM A;  2RFH A;  3SJX A;  4PXD A;  3NH8 A;  1LFW A;  5LRG A;  4R7M A;  3TC8 A;  3FX6 A;  2IQ6 A;  1LAN A;  5LYD A;  3BHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...