4JYWA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with ctt1057
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title A high affinity 18F-labeled phosphoramidate peptidomimetic inhibitor as a PSMA-targeted PET imaging agent for prostate cancer
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 261
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4jywA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4jywA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4jywA02
3H8EA 4F8ZA 4X2TA 3NH5A 4FBEA 5JH9A 3SJFA 2AFZA 2PJ4A 3KHZA 3N5FA 2ZELA 3PB4X 3IWWA 4KSIA 3SJGA 3FH4A 1VGYA 2PJ7A 3BI1A 1AMPA 2C6CA 2IMOA 2POKA 5K8PA 3LWUA 2PJ9A 1LAPA 4O23A 4OC4A 2CTCA 1LOKA 2GLJA 4A38A 4PPZA 3ISXA 2J9AA 1TF8A 4OP4A 2PRQA 2PJBA 4YN3A 1LFWA 2XEIA 2F8HA 3EIFA 1CBXA 4OKOA 2PJ1A 1WVMA 1HDUA 2IQ6A 5DS0A 4NGRA 1VIXA 4C8FA 4DYOA 2G9DA 4A37A 4OC0A 3KZWA 5ELYA 4C9RA 2RFHA 4WWVA 1RTQA 4IAVA 2F7VA 3MRUA 3FEEA 4PXEA 4PXDA 4PXBA 4OC3A 2ZEPA 2QYVA 4Q7AA 3FMCA 3K2KA 1CP6A 4P4JA 2GU2A 4CDKA 3V7ZA 1XRYA 2ZEMA 4UEFA 1QQ9A 3PRTA 4OIWA 4RUHA 4YU9A 2AFUA 3D68A 1CG2A 4MCPA 1BPNA 1ZLIA 4NJRA 3IO1A 1BAVA 1M4LA 5D29A 1ARMA 3RAMA 2Q43A 4PQAA 1AYEA 3MN8A 4FUUA 4TWEA 2AFXA 2JEWA 1XF1A 1Y0YA 1TKJA 4K3NA 1LANA 3PBEA 2V8DA 5HXDA 4TJXA 1EE3P 2EK9A 4P4IA 3PFEA 4Z65A 4C8CA 2PJ8A 1DE4C 3DGVA 2C6GA 1CPSA 3B3WA 4FWUA 4ONWA 3FJUA 4LQGA 2O4HA 3D66A 1Y0RA 2DEAA 4NGQA 4NFRA 3K9TA 4G1PA 1CX8A 3D7HA 4DUKA 5K8MA 4ZX8A 2PJ6A 2V77A 3RBUA 4X3RA 2AFSA 3B3SA 2OOTA 5LYIA 1VHOA 3JRUA 2PJAA 4OMEA 3S9MA 1XMBA 2PJ5A 3SI0A 4F9UA 4R6TA 4MCRA 3GB0A 4B6ZA 2ZEEA 2BOAA 1CP7A 4MCQA 2I3CA 5I4MA 3D4UA 3I1UA 6CPAA 2O53A 2C6PA 2C1CA 3I74A 5CBMA 3VARA 3PB8X 3PFOA 1BPMA 3KR4A 3D7DA 3FVLA 1LAMA 2PVWA 4EWTA 1TXRA 3KR5A 3KQXA 4NGNA 3B3TA 5THWA 1F57A 3TX8A 4R76A 5K8OA 1YLOA 1HEEA 4C99A 1F2PA 4P4DA 2WZNA 3WC6A 1F2OA 4YWYA 4C84A 2EK8A 1GYTA 3ISZA 5K8NA 3KL9A 3VATA 4C86A 3WT4A 3WABA 2FVGA 3FX6A 5HVGA 1PCAA 3B2YA 2ZEHA 1YW4A 2PJ2A 4OIDA 1Z5RA 2Q51A 3KHXA 1NSAA 4P4EA 2HB6A 5LRGA 3SI1A 1CPXA 3D7FA 3D67A 1R43A 3BHXA 4W9YA 3NA6A 1YW6A 2ZEFA 4C8PA 5D8NA 3HUVA 3ICUA 2CIJA 4NGMA 1H8LA 4MHNA 4JYWA 5LRKA 3H8FA 2WYRA 3IEHA 4C8TA 4IK2A 2ZEDA 5F09A 1TKFA 3SJEA 2NYQA 4X8IA 3WC7A 4MRIA 2GREA 4F9VA 1XFOA 5HVHA 4ZY2A 3H8GA 4FAIA 4NGPA 8CPAA 4ZX9A 3PBBA 1LCPA 3WC5A 4P4BA 3T8WA 3S9LA 4UEEA 1PYTB 3FEDA 1ZLHA 4JZ0A 4WJBA 4MXUA 3PB6X 2CF4A 1ZG8A 5JM6A 4MHYA 4TJVA 4UIBA 3KI9A 2BO9A 4EFDA 4C9UA 3IJ3A 1V6CA 4AXVA 4MMOA 5JGFA 3IC1A 3IIBA 2PCUA 5LYDA 4UEZA 4P45A 3V38A 1JQGA 4A94A 3S9NA 2ZEGA 4GM5A 5LYLA 5LRJA 1TKHA 1ARLA 3NH4A 1Y7EA 3NFZA 4UIAA 3GLJA 2ZOFA 3FECA 1Q7LA 5HVFA 2PIYA 3KGQA 1IY7A 1TF9A 2VL1A 2PJCA 2V8VA 4TNUA 1UWYA 4P44A 2GLFA 1ELLP 3LMSA 4P4FA 2ANPA 3TC8A 2ZEOA 1HDQA 2CTBA 3PB9X 2QVPA 4R8FA 5LYFA 4IHMA 4ZY0A 4C8UA 4ZYQA 3SI2A 2ZOGA 3B7IA 4KNGE 3CT9A 1YSJA 2AFOA 2JBKA 2AFWA 3HLPA 3NH8A 1YMEA 3SJXA 4P6YA 1BLLE 3PEIA 1DTDA 2NSMA 4R7MA 2PJ3A 4NJQA 2V8HA 3KASA 3L2NA 3PB7X 2QJ8A 4P10A 3IFEA 3RZAA 3B3CA 1Z8LA 2RB7A 5CPAA 1IGBA 1ZG9A 4NGSA 4C9EA 3B3VA 4H2KA 2AFMA 1Z2LA 4EMEA 2OR4A 2ZENA 3CDXA 4C9VA 1Y9ZA 1KWMA 2PIZA 4C85A 1R3NA 4PXCA 1QMUA 2EWBA 2PVVA 1ZG7A 4ZY1A 3CPAA 3GUXA 4C9AA 2PE3A 4ZI6A 1FNOA 2XEJA 3QNVA 3I6SA 2XEGA 1XBUA 4OC5A 2PJ0A 3DLJA 4BD9A 5J1QA 4OC1A 3KQZA 3VH9A 7CPAA 3VTAA 1XJOA 3FF3A 4UF4A 2ABZA 4MHPA 1FT7A 4A39A 2JBJA 3BI0A 1ELMP 3D7GA 4CDJA 3B35A 4NGTA 2Q4ZA 1VHEA 2IJZA 3BXMA 4C8AA 4MCSA 5IB9A 4DJLA 2XEFA 1OBRA 2BCOA 2V8GA 3CPXA 4CPAA 4OC2A 4MHZA 2HC9A
chains in the Genus database with same CATH superfamily
1UFHA 2FIAA 3H8EA 4F8ZA 1XEBA 4U5YA 4M3SA 1YVHA 2CNMA 4X2TA 3NH5A 3KRVA 1NMTA 2AJ6A 4FD4A 4UBRA 4FBEA 5JH9A 3SJFA 2AFZA 2BL1A 2PJ4A 2YNCA 3KHZA 5F5XA 3N5FA 2ZELA 2GFQA 4F0YA 2Z0ZA 3PB4X 4BINA 5F1YA 3IWWA 4KSIA 3SJGA 2R98A 1YQEA 3FH4A 4GXHA 1VGYA 5IB0A 2G0BA 2PJ7A 3BI1A 3FYNA 5E96A 4F0XA 2HROA 4COBA 3TLBA 2B4DA 1AMPA 2C6CA 2IMOA 3VRNA 2POKA 2QIRA 4K30A 5K8PA 1YX0A 2PJ9A 3LWUA 4A33A 5J8FA 4C2XA 4PK3A 1NXJA 1Z4RA 2R7HA 2VZYA 3HPGG 4BPUB 1EZAA 1LAPA 4O23A 3R1KA 4OC4A 1JDEA 1VBHA 2OZUA 5H86A 2Q4YA 2CTCA 1LOKA 1WWZA 1Q2YA 2GLJA 4A38A 4PPZA 3FBUA 3S6GA 3TCVA 4KUAA 2Z3NA 2WUUA 3ISXA 3R9EA 4PSWA 2J9AA 2WPXA 2YJTA 3CXPA 1TF8A 4OP4A 2PRQA 3TLGB 1R57A 1C3OB 3LACA 2PJBA 1ON0A 2I79A 5EC4A 1KBLA 1EZBA 5AGEA 1NBWA 4YN3A 4PV6A 1LFWA 2ZW5A 2XEIA 5F46A 1CS0B 4MY0A 3ZNIA 2F8HA 1CBXA 3EIFA 4OKOA 3RYOA 1YK3A 1XIXA 3NE8A 3OAKA 4QVTA 2PJ1A 2PCNA 2DPTA 2CXAA 1WVMA 2B5GB 1HDUA 4A31A 5KTCA 2IQ6A 5DS0A 4NGRA 1IICA 1VIXA 4C8FA 2MP0A 4KZTA 2G9DA 2XPOA 2P0WA 4DYOA 4EVYA 4A37A 4OC0A 4H1HA 5F49A 3TO6A 2FT0A 3DR6A 4R9MA 2D4PA 2REFA 4M8DA 4A4BA 1B6BA 4GPLB 3KZWA 4KS9A 3R9GA 5ELYA 4MJ8A 1S7NA 4C9RA 4AVCA 2AE6A 2RFHA 4WWVA 1RTQA 1M6VB 4IAVA 2F7VA 3MRUA 3FEEA 4PXEA 1S7LA 4PXDA 4HPSA 2DLAA 4PXBA 4OC3A 2PR1A 2ZEPA 2OU2A 2QYVA 2B58A 2YNDA 3FNCA 3FMCA 3IU1A 4Q7AA 3UY5A 4YRHA 2Y1NA 1CE8B 3BUOB 3K2KA 1CP6A 4P4JA 2GU2A 1Z8TA 2YGWA 3CXQA 3DNSA 4KSAA 4IUSA 3TLYA 2GP4A 3V7ZA 5FD8A 4CDKA 1S7FA 1XRYA 2ZEMA 3DSBA 1QQ9A 3I9SA 1I21A 3PRTA 4JLYA 4KUBA 4MBUA 4NEXA 4OIWA 4YU9A 2AFUA 4AVAA 2D0OA 4IIYA 2XPNA 1QSRA 4KOYA 1YVOA 4UFVA 5DWNA 1M4IA 3P2FA 4CO9A 3D68A 1IYLA 1CG2A 4MCPA 1BPNA 1QSNA 1S7KA 1ZLIA 2FE7A 3LODA 2O28A 4HNYB 3IO1A 1BAVA 4NJRA 4H6ZA 1J3LA 4Q36A 4MI1A 2X0SA 1M4LA 5D29A 1ARMA 3RAMA 2CNSA 2Q43A 3OB2B 1AYEA 3MN8A 4PQAA 4B11A 3I3GA 3QAHA 5C82A 4B13A 3HPHE 2ZW7A 4FUUA 4CGMA 1I1DA 4TWEA 4QB9A 1XF8A 3PLFB 3LD2A 4CYPA 3BUNB 2AFXA 2JEWA 3PGPA 4UEFA 2G3TA 1MJAA 3JTKA 4IF5A 4CGLA 1XF1A 3TLAA 1T36B 2HV2A 3EY5A 2J8MA 1Y0YA 3TLZA 2PSWA 2VKZG 3A9LA 3U88C 2FL4A 1TKJA 5JQ4A 1M4GA 3T0TA 1YVKA 4K3NA 4MHDA 1VKCA 4KLVA 1LANA 3G8WA 3EO4A 3GYAA 2V8DA 3PBEA 4X5KA 4RUHA 1DIKA 1MJBA 3BUWB 1YLEA 5HXDA 2HWGA 4C2ZA 1GGOA 1EE3P 3K4IA 1FBVA 2HQYA 4TJXA 5ISVA 2EK9A 4P4IA 3PFEA 4MFQA 4MFZA 4R3LA 4Z65A 2FM4A 5HH1A 4C8CA 2ZW4A 4Y49C 2PJ8A 1BOBA 4KVXA 1DE4C 4B5OA 3DGVA 4CRZB 4JWPA 4AB7A 3TLEA 2C6GA 4JXRA 1CPSA 3B3WA 1OZPA 4KVME 4FWUA 5AXIA 4ONWA 1JDBC 1B87A 1KUYA 4MY3A 2HI6A 1A2ZA 3SHPA 4UWIA 3FJUA 2WSAA 2Q44A 4XPDB 4LQGA 4C2YA 2O4HA 3D66A 1Y0RA 3VROA 5BWAB 5JYBA 2DEAA 4NGQA 4NFRA 1BXRB 4OLLA 3K9TA 3T05A 4G1PA 4Y49B 1CX8A 2F5IA 1JWQA 3D7HA 3CXSA 4DUKA 2EZAA 5K8MA 2N3AB 4ZX8A 3R9FA 2PJ6A 1R61A 2YNEA 2V77A 3RBUA 3SXOA 2AUNA 2OZHA 4X3RA 2AFSA 3B3SA 4UCNA 3TT2A 2OOTA 5LYIA 1VHOA 3JRUA 5K8NA 2PJAA 5A27A 4B5PA 4KOUA 5IX3A 5KTDA 2ARHA 4OMEA 3S9MA 4CGPA 1XMBA 2PJ5A 2B4JC 1RXTA 2J8RA 3C26A 4R6TA 3SI0A 4F9UA 4MCRA 4BTFA 4KSFA 3S6HA 3B8GA 3GB0A 1PU9A 2UV8G 3EC4A 2C5QA 1YREA 2DPSA 2R8VA 4KOSA 4NCZA 4B6ZA 2P6FA 2ZEEA 3K9UA 3PT1A 2BOAA 3FB3A 4F6AA 1CP7A 4MCQA 2I3CA 2ZPAA 3D4UA 5I4MA 1N71A 1Q2CA 3I1UA 6CPAA 3V8IA 4CGNA 2O53A 3O8ZA 1KUXA 2C6PA 4B10A 2Z3KA 2OLSA 2C1CA 4FD7A 3I74A 3PZJA 5CBMA 1S60A 3W91A 3VARA 2EVNA 3PB8X 5EBVA 1CM0A 4RN7A 2D0PA 3PFOA 1BPMA 3T5MA 2YNCC 3KR4A 2PQ8A 3W6XA 4I49A 2XPLA 3D7DA 3FVLA 4J0NA 1LAMA 4AG7A 2PVWA 1J4JA 3VGOA 4EWTA 3TLCA 1TXRA 3KR5A 2JLMA 1CJWA 3EFAA 3BUMB 3KQXA 4NGNA 2Z10A 3B3TA 5THWA 1F57A 3TX8A 3NOJA 4RR2B 4R76A 5K8OA 3BLNA 1YLOA 1HEEA 2BEIA 4A2ZA 4C99A 1F2PA 3EZEA 4OADA 2CBLA 4P4DA 2WZNA 3WC6A 1F2OA 5AG4A 4YWYA 4C84A 1FY7A 1GYTA 1VHSA 2EK8A 2ATRA 3G3SA 3ISZA 3KL9A 4R87A 2EBJA 2Q04A 3R96A 3VATA 2HUZA 1PUAA 2G3AA 1Z8WA 2ODFA 2Q4VA 3WT4A 4C86A 3WABA 2A4NA 4JXQA 3D2MA 4LUAA 2FVGA 3FX6A 3NE7A 2FXFA 5HVGA 4CAWA 1PCAA 3B2YA 2ZEHA 5I0CA 1YW4A 2PJ2A 4L8AA 1Z5RA 4KVOE 4OIDA 2X7BA 5G1ZA 4CRYB 2DF5A 4CAFA 2R1IA 5J8CA 4MJXA 2Q51A 1XMTA 2B4DB 3KHXA 4BPXB 1NSAA 2B4BA 4P4EA 5F13A 2HB6A 4KORA 5LRGA 1CPXA 3D7FA 2OH1A 3D67A 5F48A 3SI1A 3VWDA 3TOAA 1R43A 3BHXA 4W9YA 2GIVA 1LRZA 3NA6A 3PFVA 1YW6A 2ZEFA 5GCNA 3HMJG 3WR7A 4C8PA 4KOVA 1ZRSA 2QMLA 5D8NA 4C7HA 3G23A 1X12A 1Q2DA 3HUVA 5AG7A 3IU2A 3ICUA 2CIJA 4NGMA 5DWMA 5AG6A 1VI4A 1H8LA 4MHNA 4BPWB 1M44A 4BMHA 4JYWA 2GE3A 5LRKA 3H8FA 1KUVA 4MI4A 2NMTA 2WYRA 4QUSA 3IEHA 1Q5XA 2Z3PA 1IIDA 4M6IA 4IK2A 2ZEDA 4C8TA 4YGOA 5F09A 1TKFA 3W6SA 2B0AA 1I12A 4KOTA 3SJEA 3KKWA 4CS0B 1MJ9A 5HMNA 2QECA 1VBGA 1ZL0A 2NYQA 4H6UA 1YR0A 4X8IA 4JVOA 3WC7A 4MRIA 4PSXA 4UFWA 4B14A 5J3XA 2GREA 3FIXA 4F9VA 1XFOA 3OB1B 3TYXA 5HVHA 1V0CA 4ZY2A 3H8GA 4XPDC 5HKYA 4AVBA 4FAIA 4NGPA 5KTAA 1U6MA 2CNTA 4ONUA 4ZX9A 8CPAA 3PBBA 3N7ZA 4J3GA 4M6GA 2C27A 2H5MA 1LCPA 2PR8A 3WC5A 3D3SA 4P4BA 4Q38A 5J1QA 4U9ZA 3T8WA 3S9LA 1SQHA 1PYTB 4KOWA 1XE4A 2B3VA 2JDCA 3FEDA 4M85A 4UEEA 3EZAA 2Y1MA 4UFXA 1ZLHA 4E94A 3H4QA 4JZ0A 4WJBA 4MXUA 3PB6X 2CF4A 3S6FA 1ZG8A 5JM6A 4H89A 4MHYA 4KLWA 1Z4EA 2PDOA 3JUWA 4TJVA 4UIBA 5G22A 3QAYA 2Z11A 3KI9A 3PP9A 2BO9A 2XPPA 3D8PA 3U1BA 3TOBA 5JVLA 4CAXA 4EFDA 2I00A 3GJZA 4C9UA 3IJ3A 2P6GA 2Z3OA 1V6CA 4NF1A 4UA3A 2FIWA 2VXKA 4UWJA 2ZXVA 4AXVA 2RC4A 4CYNA 2PC1A 5AG5A 4MFLA 2FS5A 4MMOA 2VQYA 5JGFA 1ZO0A 3IC1A 1L0CA 2PCUA 3IIBA 4XPKA 3BUXB 2B5GA 2BUEA 5BY0A 5LYDA 5F47A 5G21A 3SXNA 1GHEA 1YGHA 4KOXA 1QSOA 3OP0A 4P45A 1JQGA 4UEZA 3V38A 3TE4A 2EZBA 4A94A 3C8OA 1B47A 3S9NA 2ZEGA 1IYKA 4XNHC 4CGOA 4IIXA 4CAEA 1A9XB 4GM5A 4HKFA 4LX9A 2VBQA 2EO8A 4RI1A 5LRJA 4CAVA 5LYLA 4UCPA 1TKHA 1ARLA 3MGDA 5FVJA 1QSMA 3NH4A 1Y7EA 1Y7RA 3R95A 2WPWA 4AG9A 2OZGA 3NFZA 4DNCA 3FRMA 4A95A 3JVNA 4UIAA 3GLJA 1Z9UA 5IR2A 2ZOFA 3FECA 4ZBGA 4A4CA 1Q7LA 3NFQA 2OB0A 4GS4A 1ZYMA 5HVFA 2YJVA 2AUMA 2PIYA 4HNWB 3KGQA 3S6KA 3EZBA 1IY7A 1TF9A 3GKRA 2VL1A 1XOVA 2PJCA 4XNHB 2V8VA 4CYOA 4TNUA 3IWEA 1UWYA 4P44A 2GLFA 1ELLP 3VRPA 3F5BA 4P4FA 2DXQA 2REEA 2ANPA 3LMSA 3TC8A 2ZEOA 4C68A 4JD6A 1HDQA 1M4DA 2CTBA 2JEVA 2K5TA 4NXYA 3ZJ0A 3PB9X 1K4JA 2QVPA 1KC7A 4R8FA 5LYFA 4IHMA 1RO5A 2VI7A 1Z8XA 4QC6A 3F8KA 5H84A 4ZY0A 4R57A 5A28A 3SR3A 2Z3LA 2J8NA 4A32A 2KCWA 4ZYQA 4C8UA 3QB8A 4HNXB 4LQ6A 3SI2A 3TTHA 1C30B 2BSWA 2ZOGA 1MK4A 3CZXA 3B7IA 4XPLA 3FXTA 1EO0A 4KNGE 1BO4A 4ZGYB 2Q0YA 1AUGA 2VEZA 3CT9A 1M1DA 1YSJA 2AFOA 2Z3MA 2R82A 4FD5A 2JBKA 4B5PB 3DR8A 3RO0A 3BJ7A 2AFWA 2D4OA 3HLPA 3NH8A 3GY9A 4QBJA 4COGA 3F9KC 1YMEA 1KZFA 3ZZIA 5C88A 2EZCA 3SJXA 3F0AA 4P6YA 1BLLE 3PEIA 1DTDA 2NSMA 3DDDA 2PJ3A 4R7MA 4NJQA 2V8HA 3KASA 3EXNA 3L2NA 3PB7X 2QJ8A 4P10A 5K99A 4E5SA 1P4NA 5CNPA 3D2PA 3IFEA 3RZAA 3B3CA 1Z8LA 2RB7A 5EMIA 5CPAA 4C7IA 4B12A 3RNZA 4BBHA 3IGRA 1IGBA 1ZG9A 4MFKA 4NGSA 4C9EA 3IWGA 3B3VA 4H2KA 4CZ1A 2AFMA 1Z2LA 1WK4A 2ZW6A 2OR4A 4MFJA 3TO9A 4EMEA 2ZENA 3CDXA 4C9VA 1Y9ZA 1KWMA 2PIZA 4C85A 2Q7BA 1R3NA 4PXCA 1QMUA 2Y0MA 2DIKA 1P0HA 3TO7A 2EWBA 4PK2A 2PVVA 1ZG7A 4FD6A 3CPAA 3GUXA 4ZY1A 4C9AA 1NE9A 2PE3A 4II9A 4EYSA 3GIUA 4ZI6A 1FNOA 4UCMA 4RS2A 4BD9A 2XEJA 3QNVA 3E0KA 3I6SA 4L89A 4INJA 5G20A 3P2HA 2B3UA 2XEGA 1X10A 4R3KA 1XBUA 1Z9EA 4OC5A 2CY2A 2PJ0A 3DLJA 4NSQA 4OC1A 2FSRA 3KQZA 3OWCA 3T90A 3VH9A 4E0AA 1Y9KA 1IOFA 7CPAA 3VTAA 4OAEA 1XJOA 5IV0A 3FF3A 3VRRA 4UF4A 1Y9WA 2ABZA 2VZZA 4MHPA 4CYQA 3T9YA 3T07A 1FT7A 4A39A 2JBJA 4M6HA 3BI0A 1IOIA 1ELMP 3D7GA 4A30A 3VRQA 5JPHA 3B35A 4CDJA 4NGTA 2EUIA 2Q4ZA 1VHEA 2IJZA 3BXMA 4E2AA 4U9YA 3TLGA 1S3ZA 4C8AA 4ORFA 3H5ZA 4MCSA 5HKZA 2GANA 5HKWA 5IB9A 4DJLA 1S5KA 4YFJA 3VWEA 2FCKA 2P6EA 1QSTA 2XEFA 1TIQA 2E28A 1IB1E 1KEEB 4JJXA 1IU8A 2IL4A 1OBRA 2BCOA 2V8GA 3BJ8A 3CPXA 3TFYA 1WJTA 2PRBA 4MFPA 2Q7SA 5F9MA 1NSLA 4CPAA 4OC2A 4MHZA 2HC9A 4E8OA 2JDDA
chains in the Genus database with same CATH topology
3H8EA 4F8ZA 4X2TA 3NH5A 4FBEA 5JH9A 3SJFA 2AFZA 2PJ4A 3KHZA 3N5FA 2ZELA 3PB4X 3IWWA 4KSIA 3SJGA 3FH4A 1VGYA 2PJ7A 3BI1A 1AMPA 2C6CA 2IMOA 2POKA 5K8PA 3LWUA 2PJ9A 1LAPA 4O23A 4OC4A 2CTCA 1LOKA 2GLJA 4A38A 4PPZA 3ISXA 2J9AA 1TF8A 4OP4A 2PRQA 2PJBA 4YN3A 1LFWA 2XEIA 2F8HA 3EIFA 1CBXA 4OKOA 2PJ1A 1WVMA 1HDUA 2IQ6A 5DS0A 4NGRA 1VIXA 4C8FA 4DYOA 2G9DA 4A37A 4OC0A 3KZWA 5ELYA 4C9RA 2RFHA 4WWVA 1RTQA 4IAVA 2F7VA 3MRUA 3FEEA 4PXEA 4PXDA 4PXBA 4OC3A 2ZEPA 2QYVA 4Q7AA 3FMCA 3K2KA 1CP6A 4P4JA 2GU2A 4CDKA 2GP4A 3V7ZA 1XRYA 2ZEMA 4UEFA 1QQ9A 3PRTA 4OIWA 4RUHA 4YU9A 2AFUA 3D68A 1CG2A 4MCPA 1BPNA 1ZLIA 4NJRA 3IO1A 1BAVA 1M4LA 5D29A 1ARMA 3RAMA 2Q43A 4PQAA 1AYEA 3MN8A 4FUUA 4TWEA 2AFXA 2JEWA 1XF1A 1Y0YA 1TKJA 4K3NA 1LANA 3PBEA 2V8DA 5HXDA 4TJXA 1EE3P 2EK9A 4P4IA 3PFEA 4Z65A 4C8CA 2PJ8A 1DE4C 3DGVA 2C6GA 1CPSA 3B3WA 4FWUA 4ONWA 3FJUA 4LQGA 2O4HA 3D66A 1Y0RA 2DEAA 4NGQA 4NFRA 3K9TA 4G1PA 1CX8A 3D7HA 4DUKA 5K8MA 4ZX8A 2PJ6A 2V77A 3RBUA 4X3RA 2AFSA 3B3SA 2OOTA 5LYIA 1VHOA 3JRUA 2PJAA 4OMEA 3S9MA 1XMBA 2PJ5A 3SI0A 4F9UA 4R6TA 4MCRA 3GB0A 2C5QA 4B6ZA 2ZEEA 2BOAA 1CP7A 4MCQA 2I3CA 5I4MA 3D4UA 3I1UA 6CPAA 2O53A 2C6PA 2C1CA 3I74A 5CBMA 3VARA 3PB8X 3PFOA 1BPMA 3KR4A 3D7DA 3FVLA 1LAMA 2PVWA 4EWTA 1TXRA 3KR5A 3KQXA 4NGNA 3B3TA 5THWA 1F57A 3TX8A 4R76A 5K8OA 1YLOA 1HEEA 4C99A 1F2PA 4P4DA 2WZNA 3WC6A 1F2OA 4YWYA 4C84A 2EK8A 1GYTA 3ISZA 5K8NA 3KL9A 3VATA 4C86A 3WT4A 3WABA 2FVGA 3FX6A 5HVGA 1PCAA 3B2YA 2ZEHA 1YW4A 2PJ2A 4OIDA 1Z5RA 2Q51A 3KHXA 1NSAA 4P4EA 2HB6A 5LRGA 3SI1A 1CPXA 3D7FA 3D67A 1R43A 3BHXA 4W9YA 3NA6A 1YW6A 2ZEFA 4C8PA 5D8NA 3HUVA 3ICUA 2CIJA 4NGMA 1H8LA 4MHNA 4JYWA 5LRKA 3H8FA 2WYRA 3IEHA 4C8TA 4IK2A 2ZEDA 5F09A 1TKFA 3SJEA 2NYQA 4X8IA 3WC7A 4MRIA 2GREA 4F9VA 1XFOA 5HVHA 4ZY2A 3H8GA 4FAIA 4NGPA 8CPAA 4ZX9A 3PBBA 1LCPA 3WC5A 4P4BA 3T8WA 3S9LA 4UEEA 1PYTB 3FEDA 1ZLHA 4JZ0A 4WJBA 4MXUA 3PB6X 2CF4A 1ZG8A 5JM6A 4MHYA 4TJVA 4UIBA 3KI9A 2BO9A 4EFDA 4C9UA 3IJ3A 1V6CA 4AXVA 4MMOA 5JGFA 3IC1A 3IIBA 2PCUA 5LYDA 4UEZA 4P45A 3V38A 1JQGA 4A94A 3S9NA 2ZEGA 4GM5A 5LYLA 5LRJA 1TKHA 1ARLA 3NH4A 1Y7EA 3NFZA 4UIAA 3GLJA 5IR2A 2ZOFA 3FECA 1Q7LA 5HVFA 2PIYA 3KGQA 1IY7A 1TF9A 2VL1A 2PJCA 2V8VA 4TNUA 1UWYA 4P44A 2GLFA 1ELLP 3LMSA 4P4FA 2ANPA 3TC8A 2ZEOA 1HDQA 2CTBA 3PB9X 2QVPA 4R8FA 5LYFA 4IHMA 4ZY0A 4C8UA 4ZYQA 3SI2A 2ZOGA 3B7IA 4KNGE 3CT9A 1YSJA 2AFOA 2JBKA 2AFWA 3HLPA 3NH8A 1YMEA 3SJXA 4P6YA 1BLLE 3PEIA 1DTDA 2NSMA 4R7MA 2PJ3A 4NJQA 2V8HA 3KASA 3L2NA 3PB7X 2QJ8A 4P10A 3IFEA 3RZAA 3B3CA 1Z8LA 2RB7A 5CPAA 1IGBA 1ZG9A 4NGSA 4C9EA 3B3VA 4H2KA 2AFMA 1Z2LA 4EMEA 2OR4A 2ZENA 3CDXA 4C9VA 1Y9ZA 1KWMA 2PIZA 4C85A 1R3NA 4PXCA 1QMUA 2EWBA 2PVVA 1ZG7A 4ZY1A 3CPAA 3GUXA 4C9AA 2PE3A 4ZI6A 1FNOA 2XEJA 3QNVA 3I6SA 2XEGA 1XBUA 4OC5A 2PJ0A 3DLJA 4BD9A 5J1QA 4OC1A 3KQZA 3VH9A 7CPAA 3VTAA 1XJOA 3FF3A 4UF4A 2ABZA 4MHPA 1FT7A 4A39A 2JBJA 3BI0A 1ELMP 3D7GA 4CDJA 3B35A 4NGTA 2Q4ZA 1VHEA 2IJZA 3BXMA 4C8AA 4MCSA 5IB9A 4DJLA 2XEFA 1OBRA 2BCOA 2V8GA 3CPXA 4CPAA 4OC2A 4MHZA 2HC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8E A;  4F8Z A;  4X2T A;  3NH5 A;  4FBE A;  5JH9 A;  3SJF A;  2AFZ A;  2PJ4 A;  3KHZ A;  3N5F A;  2ZEL A;  3PB4 X;  3IWW A;  4KSI A;  3SJG A;  3FH4 A;  1VGY A;  2PJ7 A;  3BI1 A;  1AMP A;  2C6C A;  2IMO A;  2POK A;  5K8P A;  3LWU A;  2PJ9 A;  1LAP A;  4O23 A;  4OC4 A;  2CTC A;  1LOK A;  2GLJ A;  4A38 A;  4PPZ A;  3ISX A;  2J9A A;  1TF8 A;  4OP4 A;  2PRQ A;  2PJB A;  4YN3 A;  1LFW A;  2XEI A;  2F8H A;  3EIF A;  1CBX A;  4OKO A;  2PJ1 A;  1WVM A;  1HDU A;  2IQ6 A;  5DS0 A;  4NGR A;  1VIX A;  4C8F A;  4DYO A;  2G9D A;  4A37 A;  4OC0 A;  3KZW A;  5ELY A;  4C9R A;  2RFH A;  4WWV A;  1RTQ A;  4IAV A;  2F7V A;  3MRU A;  3FEE A;  4PXE A;  4PXD A;  4PXB A;  4OC3 A;  2ZEP A;  2QYV A;  4Q7A A;  3FMC A;  3K2K A;  1CP6 A;  4P4J A;  2GU2 A;  4CDK A;  3V7Z A;  1XRY A;  2ZEM A;  4UEF A;  1QQ9 A;  3PRT A;  4OIW A;  4RUH A;  4YU9 A;  2AFU A;  3D68 A;  1CG2 A;  4MCP A;  1BPN A;  1ZLI A;  4NJR A;  3IO1 A;  1BAV A;  1M4L A;  5D29 A;  1ARM A;  3RAM A;  2Q43 A;  4PQA A;  1AYE A;  3MN8 A;  4FUU A;  4TWE A;  2AFX A;  2JEW A;  1XF1 A;  1Y0Y A;  1TKJ A;  4K3N A;  1LAN A;  3PBE A;  2V8D A;  5HXD A;  4TJX A;  1EE3 P;  2EK9 A;  4P4I A;  3PFE A;  4Z65 A;  4C8C A;  2PJ8 A;  1DE4 C;  3DGV A;  2C6G A;  1CPS A;  3B3W A;  4FWU A;  4ONW A;  3FJU A;  4LQG A;  2O4H A;  3D66 A;  1Y0R A;  2DEA A;  4NGQ A;  4NFR A;  3K9T A;  4G1P A;  1CX8 A;  3D7H A;  4DUK A;  5K8M A;  4ZX8 A;  2PJ6 A;  2V77 A;  3RBU A;  4X3R A;  2AFS A;  3B3S A;  2OOT A;  5LYI A;  1VHO A;  3JRU A;  2PJA A;  4OME A;  3S9M A;  1XMB A;  2PJ5 A;  3SI0 A;  4F9U A;  4R6T A;  4MCR A;  3GB0 A;  4B6Z A;  2ZEE A;  2BOA A;  1CP7 A;  4MCQ A;  2I3C A;  5I4M A;  3D4U A;  3I1U A;  6CPA A;  2O53 A;  2C6P A;  2C1C A;  3I74 A;  5CBM A;  3VAR A;  3PB8 X;  3PFO A;  1BPM A;  3KR4 A;  3D7D A;  3FVL A;  1LAM A;  2PVW A;  4EWT A;  1TXR A;  3KR5 A;  3KQX A;  4NGN A;  3B3T A;  5THW A;  1F57 A;  3TX8 A;  4R76 A;  5K8O A;  1YLO A;  1HEE A;  4C99 A;  1F2P A;  4P4D A;  2WZN A;  3WC6 A;  1F2O A;  4YWY A;  4C84 A;  2EK8 A;  1GYT A;  3ISZ A;  5K8N A;  3KL9 A;  3VAT A;  4C86 A;  3WT4 A;  3WAB A;  2FVG A;  3FX6 A;  5HVG A;  1PCA A;  3B2Y A;  2ZEH A;  1YW4 A;  2PJ2 A;  4OID A;  1Z5R A;  2Q51 A;  3KHX A;  1NSA A;  4P4E A;  2HB6 A;  5LRG A;  3SI1 A;  1CPX A;  3D7F A;  3D67 A;  1R43 A;  3BHX A;  4W9Y A;  3NA6 A;  1YW6 A;  2ZEF A;  4C8P A;  5D8N A;  3HUV A;  3ICU A;  2CIJ A;  4NGM A;  1H8L A;  4MHN A;  4JYW A;  5LRK A;  3H8F A;  2WYR A;  3IEH A;  4C8T A;  4IK2 A;  2ZED A;  5F09 A;  1TKF A;  3SJE A;  2NYQ A;  4X8I A;  3WC7 A;  4MRI A;  2GRE A;  4F9V A;  1XFO A;  5HVH A;  4ZY2 A;  3H8G A;  4FAI A;  4NGP A;  8CPA A;  4ZX9 A;  3PBB A;  1LCP A;  3WC5 A;  4P4B A;  3T8W A;  3S9L A;  4UEE A;  1PYT B;  3FED A;  1ZLH A;  4JZ0 A;  4WJB A;  4MXU A;  3PB6 X;  2CF4 A;  1ZG8 A;  5JM6 A;  4MHY A;  4TJV A;  4UIB A;  3KI9 A;  2BO9 A;  4EFD A;  4C9U A;  3IJ3 A;  1V6C A;  4AXV A;  4MMO A;  5JGF A;  3IC1 A;  3IIB A;  2PCU A;  5LYD A;  4UEZ A;  4P45 A;  3V38 A;  1JQG A;  4A94 A;  3S9N A;  2ZEG A;  4GM5 A;  5LYL A;  5LRJ A;  1TKH A;  1ARL A;  3NH4 A;  1Y7E A;  3NFZ A;  4UIA A;  3GLJ A;  2ZOF A;  3FEC A;  1Q7L A;  5HVF A;  2PIY A;  3KGQ A;  1IY7 A;  1TF9 A;  2VL1 A;  2PJC A;  2V8V A;  4TNU A;  1UWY A;  4P44 A;  2GLF A;  1ELL P;  3LMS A;  4P4F A;  2ANP A;  3TC8 A;  2ZEO A;  1HDQ A;  2CTB A;  3PB9 X;  2QVP A;  4R8F A;  5LYF A;  4IHM A;  4ZY0 A;  4C8U A;  4ZYQ A;  3SI2 A;  2ZOG A;  3B7I A;  4KNG E;  3CT9 A;  1YSJ A;  2AFO A;  2JBK A;  2AFW A;  3HLP A;  3NH8 A;  1YME A;  3SJX A;  4P6Y A;  1BLL E;  3PEI A;  1DTD A;  2NSM A;  4R7M A;  2PJ3 A;  4NJQ A;  2V8H A;  3KAS A;  3L2N A;  3PB7 X;  2QJ8 A;  4P10 A;  3IFE A;  3RZA A;  3B3C A;  1Z8L A;  2RB7 A;  5CPA A;  1IGB A;  1ZG9 A;  4NGS A;  4C9E A;  3B3V A;  4H2K A;  2AFM A;  1Z2L A;  4EME A;  2OR4 A;  2ZEN A;  3CDX A;  4C9V A;  1Y9Z A;  1KWM A;  2PIZ A;  4C85 A;  1R3N A;  4PXC A;  1QMU A;  2EWB A;  2PVV A;  1ZG7 A;  4ZY1 A;  3CPA A;  3GUX A;  4C9A A;  2PE3 A;  4ZI6 A;  1FNO A;  2XEJ A;  3QNV A;  3I6S A;  2XEG A;  1XBU A;  4OC5 A;  2PJ0 A;  3DLJ A;  4BD9 A;  5J1Q A;  4OC1 A;  3KQZ A;  3VH9 A;  7CPA A;  3VTA A;  1XJO A;  3FF3 A;  4UF4 A;  2ABZ A;  4MHP A;  1FT7 A;  4A39 A;  2JBJ A;  3BI0 A;  1ELM P;  3D7G A;  4CDJ A;  3B35 A;  4NGT A;  2Q4Z A;  1VHE A;  2IJZ A;  3BXM A;  4C8A A;  4MCS A;  5IB9 A;  4DJL A;  2XEF A;  1OBR A;  2BCO A;  2V8G A;  3CPX A;  4CPA A;  4OC2 A;  4MHZ A;  2HC9 A; 
#chains in the Genus database with same CATH topology
 1UFH A;  2FIA A;  3H8E A;  4F8Z A;  1XEB A;  4U5Y A;  4M3S A;  1YVH A;  2CNM A;  4X2T A;  3NH5 A;  3KRV A;  1NMT A;  2AJ6 A;  4FD4 A;  4UBR A;  4FBE A;  5JH9 A;  3SJF A;  2AFZ A;  2BL1 A;  2PJ4 A;  2YNC A;  3KHZ A;  5F5X A;  3N5F A;  2ZEL A;  2GFQ A;  4F0Y A;  2Z0Z A;  3PB4 X;  4BIN A;  5F1Y A;  3IWW A;  4KSI A;  3SJG A;  2R98 A;  1YQE A;  3FH4 A;  4GXH A;  1VGY A;  5IB0 A;  2G0B A;  2PJ7 A;  3BI1 A;  3FYN A;  5E96 A;  4F0X A;  2HRO A;  4COB A;  3TLB A;  2B4D A;  1AMP A;  2C6C A;  2IMO A;  3VRN A;  2POK A;  2QIR A;  4K30 A;  5K8P A;  1YX0 A;  2PJ9 A;  3LWU A;  4A33 A;  5J8F A;  4C2X A;  4PK3 A;  1NXJ A;  1Z4R A;  2R7H A;  2VZY A;  3HPG G;  4BPU B;  1EZA A;  1LAP A;  4O23 A;  3R1K A;  4OC4 A;  1JDE A;  1VBH A;  2OZU A;  5H86 A;  2Q4Y A;  2CTC A;  1LOK A;  1WWZ A;  1Q2Y A;  2GLJ A;  4A38 A;  4PPZ A;  3FBU A;  3S6G A;  3TCV A;  4KUA A;  2Z3N A;  2WUU A;  3ISX A;  3R9E A;  4PSW A;  2J9A A;  2WPX A;  2YJT A;  3CXP A;  1TF8 A;  4OP4 A;  2PRQ A;  3TLG B;  1R57 A;  1C3O B;  3LAC A;  2PJB A;  1ON0 A;  2I79 A;  5EC4 A;  1KBL A;  1EZB A;  5AGE A;  1NBW A;  4YN3 A;  4PV6 A;  1LFW A;  2ZW5 A;  2XEI A;  5F46 A;  1CS0 B;  4MY0 A;  3ZNI A;  2F8H A;  1CBX A;  3EIF A;  4OKO A;  3RYO A;  1YK3 A;  1XIX A;  3NE8 A;  3OAK A;  4QVT A;  2PJ1 A;  2PCN A;  2DPT A;  2CXA A;  1WVM A;  2B5G B;  1HDU A;  4A31 A;  5KTC A;  2IQ6 A;  5DS0 A;  4NGR A;  1IIC A;  1VIX A;  4C8F A;  2MP0 A;  4KZT A;  2G9D A;  2XPO A;  2P0W A;  4DYO A;  4EVY A;  4A37 A;  4OC0 A;  4H1H A;  5F49 A;  3TO6 A;  2FT0 A;  3DR6 A;  4R9M A;  2D4P A;  2REF A;  4M8D A;  4A4B A;  1B6B A;  4GPL B;  3KZW A;  4KS9 A;  3R9G A;  5ELY A;  4MJ8 A;  1S7N A;  4C9R A;  4AVC A;  2AE6 A;  2RFH A;  4WWV A;  1RTQ A;  1M6V B;  4IAV A;  2F7V A;  3MRU A;  3FEE A;  4PXE A;  1S7L A;  4PXD A;  4HPS A;  2DLA A;  4PXB A;  4OC3 A;  2PR1 A;  2ZEP A;  2OU2 A;  2QYV A;  2B58 A;  2YND A;  3FNC A;  3FMC A;  3IU1 A;  4Q7A A;  3UY5 A;  4YRH A;  2Y1N A;  1CE8 B;  3BUO B;  3K2K A;  1CP6 A;  4P4J A;  2GU2 A;  1Z8T A;  2YGW A;  3CXQ A;  3DNS A;  4KSA A;  4IUS A;  3TLY A;  2GP4 A;  3V7Z A;  5FD8 A;  4CDK A;  1S7F A;  1XRY A;  2ZEM A;  3DSB A;  1QQ9 A;  3I9S A;  1I21 A;  3PRT A;  4JLY A;  4KUB A;  4MBU A;  4NEX A;  4OIW A;  4YU9 A;  2AFU A;  4AVA A;  2D0O A;  4IIY A;  2XPN A;  1QSR A;  4KOY A;  1YVO A;  4UFV A;  5DWN A;  1M4I A;  3P2F A;  4CO9 A;  3D68 A;  1IYL A;  1CG2 A;  4MCP A;  1BPN A;  1QSN A;  1S7K A;  1ZLI A;  2FE7 A;  3LOD A;  2O28 A;  4HNY B;  3IO1 A;  1BAV A;  4NJR A;  4H6Z A;  1J3L A;  4Q36 A;  4MI1 A;  2X0S A;  1M4L A;  5D29 A;  1ARM A;  3RAM A;  2CNS A;  2Q43 A;  3OB2 B;  1AYE A;  3MN8 A;  4PQA A;  4B11 A;  3I3G A;  3QAH A;  5C82 A;  4B13 A;  3HPH E;  2ZW7 A;  4FUU A;  4CGM A;  1I1D A;  4TWE A;  4QB9 A;  1XF8 A;  3PLF B;  3LD2 A;  4CYP A;  3BUN B;  2AFX A;  2JEW A;  3PGP A;  4UEF A;  2G3T A;  1MJA A;  3JTK A;  4IF5 A;  4CGL A;  1XF1 A;  3TLA A;  1T36 B;  2HV2 A;  3EY5 A;  2J8M A;  1Y0Y A;  3TLZ A;  2PSW A;  2VKZ G;  3A9L A;  3U88 C;  2FL4 A;  1TKJ A;  5JQ4 A;  1M4G A;  3T0T A;  1YVK A;  4K3N A;  4MHD A;  1VKC A;  4KLV A;  1LAN A;  3G8W A;  3EO4 A;  3GYA A;  2V8D A;  3PBE A;  4X5K A;  4RUH A;  1DIK A;  1MJB A;  3BUW B;  1YLE A;  5HXD A;  2HWG A;  4C2Z A;  1GGO A;  1EE3 P;  3K4I A;  1FBV A;  2HQY A;  4TJX A;  5ISV A;  2EK9 A;  4P4I A;  3PFE A;  4MFQ A;  4MFZ A;  4R3L A;  4Z65 A;  2FM4 A;  5HH1 A;  4C8C A;  2ZW4 A;  4Y49 C;  2PJ8 A;  1BOB A;  4KVX A;  1DE4 C;  4B5O A;  3DGV A;  4CRZ B;  4JWP A;  4AB7 A;  3TLE A;  2C6G A;  4JXR A;  1CPS A;  3B3W A;  1OZP A;  4KVM E;  4FWU A;  5AXI A;  4ONW A;  1JDB C;  1B87 A;  1KUY A;  4MY3 A;  2HI6 A;  1A2Z A;  3SHP A;  4UWI A;  3FJU A;  2WSA A;  2Q44 A;  4XPD B;  4LQG A;  4C2Y A;  2O4H A;  3D66 A;  1Y0R A;  3VRO A;  5BWA B;  5JYB A;  2DEA A;  4NGQ A;  4NFR A;  1BXR B;  4OLL A;  3K9T A;  3T05 A;  4G1P A;  4Y49 B;  1CX8 A;  2F5I A;  1JWQ A;  3D7H A;  3CXS A;  4DUK A;  2EZA A;  5K8M A;  2N3A B;  4ZX8 A;  3R9F A;  2PJ6 A;  1R61 A;  2YNE A;  2V77 A;  3RBU A;  3SXO A;  2AUN A;  2OZH A;  4X3R A;  2AFS A;  3B3S A;  4UCN A;  3TT2 A;  2OOT A;  5LYI A;  1VHO A;  3JRU A;  5K8N A;  2PJA A;  5A27 A;  4B5P A;  4KOU A;  5IX3 A;  5KTD A;  2ARH A;  4OME A;  3S9M A;  4CGP A;  1XMB A;  2PJ5 A;  2B4J C;  1RXT A;  2J8R A;  3C26 A;  4R6T A;  3SI0 A;  4F9U A;  4MCR A;  4BTF A;  4KSF A;  3S6H A;  3B8G A;  3GB0 A;  1PU9 A;  2UV8 G;  3EC4 A;  2C5Q A;  1YRE A;  2DPS A;  2R8V A;  4KOS A;  4NCZ A;  4B6Z A;  2P6F A;  2ZEE A;  3K9U A;  3PT1 A;  2BOA A;  3FB3 A;  4F6A A;  1CP7 A;  4MCQ A;  2I3C A;  2ZPA A;  3D4U A;  5I4M A;  1N71 A;  1Q2C A;  3I1U A;  6CPA A;  3V8I A;  4CGN A;  2O53 A;  3O8Z A;  1KUX A;  2C6P A;  4B10 A;  2Z3K A;  2OLS A;  2C1C A;  4FD7 A;  3I74 A;  3PZJ A;  5CBM A;  1S60 A;  3W91 A;  3VAR A;  2EVN A;  3PB8 X;  5EBV A;  1CM0 A;  4RN7 A;  2D0P A;  3PFO A;  1BPM A;  3T5M A;  2YNC C;  3KR4 A;  2PQ8 A;  3W6X A;  4I49 A;  2XPL A;  3D7D A;  3FVL A;  4J0N A;  1LAM A;  4AG7 A;  2PVW A;  1J4J A;  3VGO A;  4EWT A;  3TLC A;  1TXR A;  3KR5 A;  2JLM A;  1CJW A;  3EFA A;  3BUM B;  3KQX A;  4NGN A;  2Z10 A;  3B3T A;  5THW A;  1F57 A;  3TX8 A;  3NOJ A;  4RR2 B;  4R76 A;  5K8O A;  3BLN A;  1YLO A;  1HEE A;  2BEI A;  4A2Z A;  4C99 A;  1F2P A;  3EZE A;  4OAD A;  2CBL A;  4P4D A;  2WZN A;  3WC6 A;  1F2O A;  5AG4 A;  4YWY A;  4C84 A;  1FY7 A;  1GYT A;  1VHS A;  2EK8 A;  2ATR A;  3G3S A;  3ISZ A;  3KL9 A;  4R87 A;  2EBJ A;  2Q04 A;  3R96 A;  3VAT A;  2HUZ A;  1PUA A;  2G3A A;  1Z8W A;  2ODF A;  2Q4V A;  3WT4 A;  4C86 A;  3WAB A;  2A4N A;  4JXQ A;  3D2M A;  4LUA A;  2FVG A;  3FX6 A;  3NE7 A;  2FXF A;  5HVG A;  4CAW A;  1PCA A;  3B2Y A;  2ZEH A;  5I0C A;  1YW4 A;  2PJ2 A;  4L8A A;  1Z5R A;  4KVO E;  4OID A;  2X7B A;  5G1Z A;  4CRY B;  2DF5 A;  4CAF A;  2R1I A;  5J8C A;  4MJX A;  2Q51 A;  1XMT A;  2B4D B;  3KHX A;  4BPX B;  1NSA A;  2B4B A;  4P4E A;  5F13 A;  2HB6 A;  4KOR A;  5LRG A;  1CPX A;  3D7F A;  2OH1 A;  3D67 A;  5F48 A;  3SI1 A;  3VWD A;  3TOA A;  1R43 A;  3BHX A;  4W9Y A;  2GIV A;  1LRZ A;  3NA6 A;  3PFV A;  1YW6 A;  2ZEF A;  5GCN A;  3HMJ G;  3WR7 A;  4C8P A;  4KOV A;  1ZRS A;  2QML A;  5D8N A;  4C7H A;  3G23 A;  1X12 A;  1Q2D A;  3HUV A;  5AG7 A;  3IU2 A;  3ICU A;  2CIJ A;  4NGM A;  5DWM A;  5AG6 A;  1VI4 A;  1H8L A;  4MHN A;  4BPW B;  1M44 A;  4BMH A;  4JYW A;  2GE3 A;  5LRK A;  3H8F A;  1KUV A;  4MI4 A;  2NMT A;  2WYR A;  4QUS A;  3IEH A;  1Q5X A;  2Z3P A;  1IID A;  4M6I A;  4IK2 A;  2ZED A;  4C8T A;  4YGO A;  5F09 A;  1TKF A;  3W6S A;  2B0A A;  1I12 A;  4KOT A;  3SJE A;  3KKW A;  4CS0 B;  1MJ9 A;  5HMN A;  2QEC A;  1VBG A;  1ZL0 A;  2NYQ A;  4H6U A;  1YR0 A;  4X8I A;  4JVO A;  3WC7 A;  4MRI A;  4PSX A;  4UFW A;  4B14 A;  5J3X A;  2GRE A;  3FIX A;  4F9V A;  1XFO A;  3OB1 B;  3TYX A;  5HVH A;  1V0C A;  4ZY2 A;  3H8G A;  4XPD C;  5HKY A;  4AVB A;  4FAI A;  4NGP A;  5KTA A;  1U6M A;  2CNT A;  4ONU A;  4ZX9 A;  8CPA A;  3PBB A;  3N7Z A;  4J3G A;  4M6G A;  2C27 A;  2H5M A;  1LCP A;  2PR8 A;  3WC5 A;  3D3S A;  4P4B A;  4Q38 A;  5J1Q A;  4U9Z A;  3T8W A;  3S9L A;  1SQH A;  1PYT B;  4KOW A;  1XE4 A;  2B3V A;  2JDC A;  3FED A;  4M85 A;  4UEE A;  3EZA A;  2Y1M A;  4UFX A;  1ZLH A;  4E94 A;  3H4Q A;  4JZ0 A;  4WJB A;  4MXU A;  3PB6 X;  2CF4 A;  3S6F A;  1ZG8 A;  5JM6 A;  4H89 A;  4MHY A;  4KLW A;  1Z4E A;  2PDO A;  3JUW A;  4TJV A;  4UIB A;  5G22 A;  3QAY A;  2Z11 A;  3KI9 A;  3PP9 A;  2BO9 A;  2XPP A;  3D8P A;  3U1B A;  3TOB A;  5JVL A;  4CAX A;  4EFD A;  2I00 A;  3GJZ A;  4C9U A;  3IJ3 A;  2P6G A;  2Z3O A;  1V6C A;  4NF1 A;  4UA3 A;  2FIW A;  2VXK A;  4UWJ A;  2ZXV A;  4AXV A;  2RC4 A;  4CYN A;  2PC1 A;  5AG5 A;  4MFL A;  2FS5 A;  4MMO A;  2VQY A;  5JGF A;  1ZO0 A;  3IC1 A;  1L0C A;  2PCU A;  3IIB A;  4XPK A;  3BUX B;  2B5G A;  2BUE A;  5BY0 A;  5LYD A;  5F47 A;  5G21 A;  3SXN A;  1GHE A;  1YGH A;  4KOX A;  1QSO A;  3OP0 A;  4P45 A;  1JQG A;  4UEZ A;  3V38 A;  3TE4 A;  2EZB A;  4A94 A;  3C8O A;  1B47 A;  3S9N A;  2ZEG A;  1IYK A;  4XNH C;  4CGO A;  4IIX A;  4CAE A;  1A9X B;  4GM5 A;  4HKF A;  4LX9 A;  2VBQ A;  2EO8 A;  4RI1 A;  5LRJ A;  4CAV A;  5LYL A;  4UCP A;  1TKH A;  1ARL A;  3MGD A;  5FVJ A;  1QSM A;  3NH4 A;  1Y7E A;  1Y7R A;  3R95 A;  2WPW A;  4AG9 A;  2OZG A;  3NFZ A;  4DNC A;  3FRM A;  4A95 A;  3JVN A;  4UIA A;  3GLJ A;  1Z9U A;  5IR2 A;  2ZOF A;  3FEC A;  4ZBG A;  4A4C A;  1Q7L A;  3NFQ A;  2OB0 A;  4GS4 A;  1ZYM A;  5HVF A;  2YJV A;  2AUM A;  2PIY A;  4HNW B;  3KGQ A;  3S6K A;  3EZB A;  1IY7 A;  1TF9 A;  3GKR A;  2VL1 A;  1XOV A;  2PJC A;  4XNH B;  2V8V A;  4CYO A;  4TNU A;  3IWE A;  1UWY A;  4P44 A;  2GLF A;  1ELL P;  3VRP A;  3F5B A;  4P4F A;  2DXQ A;  2REE A;  2ANP A;  3LMS A;  3TC8 A;  2ZEO A;  4C68 A;  4JD6 A;  1HDQ A;  1M4D A;  2CTB A;  2JEV A;  2K5T A;  4NXY A;  3ZJ0 A;  3PB9 X;  1K4J A;  2QVP A;  1KC7 A;  4R8F A;  5LYF A;  4IHM A;  1RO5 A;  2VI7 A;  1Z8X A;  4QC6 A;  3F8K A;  5H84 A;  4ZY0 A;  4R57 A;  5A28 A;  3SR3 A;  2Z3L A;  2J8N A;  4A32 A;  2KCW A;  4ZYQ A;  4C8U A;  3QB8 A;  4HNX B;  4LQ6 A;  3SI2 A;  3TTH A;  1C30 B;  2BSW A;  2ZOG A;  1MK4 A;  3CZX A;  3B7I A;  4XPL A;  3FXT A;  1EO0 A;  4KNG E;  1BO4 A;  4ZGY B;  2Q0Y A;  1AUG A;  2VEZ A;  3CT9 A;  1M1D A;  1YSJ A;  2AFO A;  2Z3M A;  2R82 A;  4FD5 A;  2JBK A;  4B5P B;  3DR8 A;  3RO0 A;  3BJ7 A;  2AFW A;  2D4O A;  3HLP A;  3NH8 A;  3GY9 A;  4QBJ A;  4COG A;  3F9K C;  1YME A;  1KZF A;  3ZZI A;  5C88 A;  2EZC A;  3SJX A;  3F0A A;  4P6Y A;  1BLL E;  3PEI A;  1DTD A;  2NSM A;  3DDD A;  2PJ3 A;  4R7M A;  4NJQ A;  2V8H A;  3KAS A;  3EXN A;  3L2N A;  3PB7 X;  2QJ8 A;  4P10 A;  5K99 A;  4E5S A;  1P4N A;  5CNP A;  3D2P A;  3IFE A;  3RZA A;  3B3C A;  1Z8L A;  2RB7 A;  5EMI A;  5CPA A;  4C7I A;  4B12 A;  3RNZ A;  4BBH A;  3IGR A;  1IGB A;  1ZG9 A;  4MFK A;  4NGS A;  4C9E A;  3IWG A;  3B3V A;  4H2K A;  4CZ1 A;  2AFM A;  1Z2L A;  1WK4 A;  2ZW6 A;  2OR4 A;  4MFJ A;  3TO9 A;  4EME A;  2ZEN A;  3CDX A;  4C9V A;  1Y9Z A;  1KWM A;  2PIZ A;  4C85 A;  2Q7B A;  1R3N A;  4PXC A;  1QMU A;  2Y0M A;  2DIK A;  1P0H A;  3TO7 A;  2EWB A;  4PK2 A;  2PVV A;  1ZG7 A;  4FD6 A;  3CPA A;  3GUX A;  4ZY1 A;  4C9A A;  1NE9 A;  2PE3 A;  4II9 A;  4EYS A;  3GIU A;  4ZI6 A;  1FNO A;  4UCM A;  4RS2 A;  4BD9 A;  2XEJ A;  3QNV A;  3E0K A;  3I6S A;  4L89 A;  4INJ A;  5G20 A;  3P2H A;  2B3U A;  2XEG A;  1X10 A;  4R3K A;  1XBU A;  1Z9E A;  4OC5 A;  2CY2 A;  2PJ0 A;  3DLJ A;  4NSQ A;  4OC1 A;  2FSR A;  3KQZ A;  3OWC A;  3T90 A;  3VH9 A;  4E0A A;  1Y9K A;  1IOF A;  7CPA A;  3VTA A;  4OAE A;  1XJO A;  5IV0 A;  3FF3 A;  3VRR A;  4UF4 A;  1Y9W A;  2ABZ A;  2VZZ A;  4MHP A;  4CYQ A;  3T9Y A;  3T07 A;  1FT7 A;  4A39 A;  2JBJ A;  4M6H A;  3BI0 A;  1IOI A;  1ELM P;  3D7G A;  4A30 A;  3VRQ A;  5JPH A;  3B35 A;  4CDJ A;  4NGT A;  2EUI A;  2Q4Z A;  1VHE A;  2IJZ A;  3BXM A;  4E2A A;  4U9Y A;  3TLG A;  1S3Z A;  4C8A A;  4ORF A;  3H5Z A;  4MCS A;  5HKZ A;  2GAN A;  5HKW A;  5IB9 A;  4DJL A;  1S5K A;  4YFJ A;  3VWE A;  2FCK A;  2P6E A;  1QST A;  2XEF A;  1TIQ A;  2E28 A;  1IB1 E;  1KEE B;  4JJX A;  1IU8 A;  2IL4 A;  1OBR A;  2BCO A;  2V8G A;  3BJ8 A;  3CPX A;  3TFY A;  1WJT A;  2PRB A;  4MFP A;  2Q7S A;  5F9M A;  1NSL A;  4CPA A;  4OC2 A;  4MHZ A;  2HC9 A;  4E8O A;  2JDD A; 
#chains in the Genus database with same CATH homology
 3H8E A;  4F8Z A;  4X2T A;  3NH5 A;  4FBE A;  5JH9 A;  3SJF A;  2AFZ A;  2PJ4 A;  3KHZ A;  3N5F A;  2ZEL A;  3PB4 X;  3IWW A;  4KSI A;  3SJG A;  3FH4 A;  1VGY A;  2PJ7 A;  3BI1 A;  1AMP A;  2C6C A;  2IMO A;  2POK A;  5K8P A;  3LWU A;  2PJ9 A;  1LAP A;  4O23 A;  4OC4 A;  2CTC A;  1LOK A;  2GLJ A;  4A38 A;  4PPZ A;  3ISX A;  2J9A A;  1TF8 A;  4OP4 A;  2PRQ A;  2PJB A;  4YN3 A;  1LFW A;  2XEI A;  2F8H A;  3EIF A;  1CBX A;  4OKO A;  2PJ1 A;  1WVM A;  1HDU A;  2IQ6 A;  5DS0 A;  4NGR A;  1VIX A;  4C8F A;  4DYO A;  2G9D A;  4A37 A;  4OC0 A;  3KZW A;  5ELY A;  4C9R A;  2RFH A;  4WWV A;  1RTQ A;  4IAV A;  2F7V A;  3MRU A;  3FEE A;  4PXE A;  4PXD A;  4PXB A;  4OC3 A;  2ZEP A;  2QYV A;  4Q7A A;  3FMC A;  3K2K A;  1CP6 A;  4P4J A;  2GU2 A;  4CDK A;  2GP4 A;  3V7Z A;  1XRY A;  2ZEM A;  4UEF A;  1QQ9 A;  3PRT A;  4OIW A;  4RUH A;  4YU9 A;  2AFU A;  3D68 A;  1CG2 A;  4MCP A;  1BPN A;  1ZLI A;  4NJR A;  3IO1 A;  1BAV A;  1M4L A;  5D29 A;  1ARM A;  3RAM A;  2Q43 A;  4PQA A;  1AYE A;  3MN8 A;  4FUU A;  4TWE A;  2AFX A;  2JEW A;  1XF1 A;  1Y0Y A;  1TKJ A;  4K3N A;  1LAN A;  3PBE A;  2V8D A;  5HXD A;  4TJX A;  1EE3 P;  2EK9 A;  4P4I A;  3PFE A;  4Z65 A;  4C8C A;  2PJ8 A;  1DE4 C;  3DGV A;  2C6G A;  1CPS A;  3B3W A;  4FWU A;  4ONW A;  3FJU A;  4LQG A;  2O4H A;  3D66 A;  1Y0R A;  2DEA A;  4NGQ A;  4NFR A;  3K9T A;  4G1P A;  1CX8 A;  3D7H A;  4DUK A;  5K8M A;  4ZX8 A;  2PJ6 A;  2V77 A;  3RBU A;  4X3R A;  2AFS A;  3B3S A;  2OOT A;  5LYI A;  1VHO A;  3JRU A;  2PJA A;  4OME A;  3S9M A;  1XMB A;  2PJ5 A;  3SI0 A;  4F9U A;  4R6T A;  4MCR A;  3GB0 A;  2C5Q A;  4B6Z A;  2ZEE A;  2BOA A;  1CP7 A;  4MCQ A;  2I3C A;  5I4M A;  3D4U A;  3I1U A;  6CPA A;  2O53 A;  2C6P A;  2C1C A;  3I74 A;  5CBM A;  3VAR A;  3PB8 X;  3PFO A;  1BPM A;  3KR4 A;  3D7D A;  3FVL A;  1LAM A;  2PVW A;  4EWT A;  1TXR A;  3KR5 A;  3KQX A;  4NGN A;  3B3T A;  5THW A;  1F57 A;  3TX8 A;  4R76 A;  5K8O A;  1YLO A;  1HEE A;  4C99 A;  1F2P A;  4P4D A;  2WZN A;  3WC6 A;  1F2O A;  4YWY A;  4C84 A;  2EK8 A;  1GYT A;  3ISZ A;  5K8N A;  3KL9 A;  3VAT A;  4C86 A;  3WT4 A;  3WAB A;  2FVG A;  3FX6 A;  5HVG A;  1PCA A;  3B2Y A;  2ZEH A;  1YW4 A;  2PJ2 A;  4OID A;  1Z5R A;  2Q51 A;  3KHX A;  1NSA A;  4P4E A;  2HB6 A;  5LRG A;  3SI1 A;  1CPX A;  3D7F A;  3D67 A;  1R43 A;  3BHX A;  4W9Y A;  3NA6 A;  1YW6 A;  2ZEF A;  4C8P A;  5D8N A;  3HUV A;  3ICU A;  2CIJ A;  4NGM A;  1H8L A;  4MHN A;  4JYW A;  5LRK A;  3H8F A;  2WYR A;  3IEH A;  4C8T A;  4IK2 A;  2ZED A;  5F09 A;  1TKF A;  3SJE A;  2NYQ A;  4X8I A;  3WC7 A;  4MRI A;  2GRE A;  4F9V A;  1XFO A;  5HVH A;  4ZY2 A;  3H8G A;  4FAI A;  4NGP A;  8CPA A;  4ZX9 A;  3PBB A;  1LCP A;  3WC5 A;  4P4B A;  3T8W A;  3S9L A;  4UEE A;  1PYT B;  3FED A;  1ZLH A;  4JZ0 A;  4WJB A;  4MXU A;  3PB6 X;  2CF4 A;  1ZG8 A;  5JM6 A;  4MHY A;  4TJV A;  4UIB A;  3KI9 A;  2BO9 A;  4EFD A;  4C9U A;  3IJ3 A;  1V6C A;  4AXV A;  4MMO A;  5JGF A;  3IC1 A;  3IIB A;  2PCU A;  5LYD A;  4UEZ A;  4P45 A;  3V38 A;  1JQG A;  4A94 A;  3S9N A;  2ZEG A;  4GM5 A;  5LYL A;  5LRJ A;  1TKH A;  1ARL A;  3NH4 A;  1Y7E A;  3NFZ A;  4UIA A;  3GLJ A;  5IR2 A;  2ZOF A;  3FEC A;  1Q7L A;  5HVF A;  2PIY A;  3KGQ A;  1IY7 A;  1TF9 A;  2VL1 A;  2PJC A;  2V8V A;  4TNU A;  1UWY A;  4P44 A;  2GLF A;  1ELL P;  3LMS A;  4P4F A;  2ANP A;  3TC8 A;  2ZEO A;  1HDQ A;  2CTB A;  3PB9 X;  2QVP A;  4R8F A;  5LYF A;  4IHM A;  4ZY0 A;  4C8U A;  4ZYQ A;  3SI2 A;  2ZOG A;  3B7I A;  4KNG E;  3CT9 A;  1YSJ A;  2AFO A;  2JBK A;  2AFW A;  3HLP A;  3NH8 A;  1YME A;  3SJX A;  4P6Y A;  1BLL E;  3PEI A;  1DTD A;  2NSM A;  4R7M A;  2PJ3 A;  4NJQ A;  2V8H A;  3KAS A;  3L2N A;  3PB7 X;  2QJ8 A;  4P10 A;  3IFE A;  3RZA A;  3B3C A;  1Z8L A;  2RB7 A;  5CPA A;  1IGB A;  1ZG9 A;  4NGS A;  4C9E A;  3B3V A;  4H2K A;  2AFM A;  1Z2L A;  4EME A;  2OR4 A;  2ZEN A;  3CDX A;  4C9V A;  1Y9Z A;  1KWM A;  2PIZ A;  4C85 A;  1R3N A;  4PXC A;  1QMU A;  2EWB A;  2PVV A;  1ZG7 A;  4ZY1 A;  3CPA A;  3GUX A;  4C9A A;  2PE3 A;  4ZI6 A;  1FNO A;  2XEJ A;  3QNV A;  3I6S A;  2XEG A;  1XBU A;  4OC5 A;  2PJ0 A;  3DLJ A;  4BD9 A;  5J1Q A;  4OC1 A;  3KQZ A;  3VH9 A;  7CPA A;  3VTA A;  1XJO A;  3FF3 A;  4UF4 A;  2ABZ A;  4MHP A;  1FT7 A;  4A39 A;  2JBJ A;  3BI0 A;  1ELM P;  3D7G A;  4CDJ A;  3B35 A;  4NGT A;  2Q4Z A;  1VHE A;  2IJZ A;  3BXM A;  4C8A A;  4MCS A;  5IB9 A;  4DJL A;  2XEF A;  1OBR A;  2BCO A;  2V8G A;  3CPX A;  4CPA A;  4OC2 A;  4MHZ A;  2HC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...