4JYWA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with ctt1057
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title A high affinity 18F-labeled phosphoramidate peptidomimetic inhibitor as a PSMA-targeted PET imaging agent for prostate cancer
rcsb
source organism Homo sapiens
total genus 261
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4jywA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4jywA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4jywA02
1RTQA 2CTCA 3KR5A 1H8LA 2XEGA 2PIZA 3B3CA 1ARMA 3BXMA 4P4EA 2ZEPA 1NSAA 2XEFA 2GU2A 1F2OA 3D66A 3SI1A 1XBUA 2CTBA 4C8AA 3V38A 5IB9A 4B6ZA 5LYFA 2C6PA 4YN3A 3PB7X 1ELMP 4DJLA 4MCSA 4OC4A 4TNUA 4ZX9A 4MRIA 3D68A 2BO9A 3IWWA 3KL9A 4F8ZA 2HC9A 3FVLA 4P4JA 4A38A 5HXDA 1JQGA 4ZX8A 1YLOA 5LYDA 4F9UA 3S9NA 2PJ0A 4WWVA 3I6SA 5F09A 4PXDA 1BAVA 1F2PA 4IHMA 4CDJA 2ZEGA 4OC0A 3L2NA 3D7GA 5LRKA 2F7VA 8CPAA 4R8FA 2EK9A 3WC6A 1ZG8A 4C8PA 3V7ZA 2RB7A 2ZEDA 5DS0A 1CPSA 3K9TA 3BHXA 2IQ6A 4JYWA 3MRUA 4Q7AA 3ISXA 1LFWA 4OP4A 2PJBA 3KHZA 4NGPA 2BOAA 3HUVA 2ZEFA 2DEAA 1HDUA 4K3NA 4PXCA 2GLJA 2ABZA 2OOTA 4CDKA 4PXEA 5HVFA 4OC1A 4MXUA 2ZENA 4CPAA 1ZLIA 2ZEOA 3FJUA 2PVWA 3B3VA 1M4LA 4MHZA 2RFHA 3RBUA 3IO1A 5CBMA 3PBEA 4NGSA 4UEZA 3ICUA 5THWA 1F57A 3D7HA 1IGBA 2FVGA 4NJRA 4P4DA 2WZNA 3LWUA 1TXRA 3KI9A 4X8IA 2ZEEA 1TKHA 1BLLE 4FWUA 1WVMA 2JBJA 3B3TA 2POKA 1PYTB 2PJAA 3QNVA 1YW6A 2ZEMA 3T8WA 1CPXA 3H8EA 4TWEA 3CT9A 3RAMA 1EE3P 3D4UA 4EWTA 2EWBA 1VIXA 3D67A 4OC2A 2Q51A 5ELYA 4R7MA 1DTDA 5JM6A 3VARA 4MCRA 4FUUA 3KASA 4JZ0A 4P45A 3IC1A 4C84A 4P44A 4P4BA 2G9DA 3B7IA 4ZYQA 3B35A 3PFOA 1R43A 4EFDA 5K8NA 4MHYA 3WT4A 3PEIA 3KZWA 3TC8A 3NH5A 1LOKA 4MCPA 5K8MA 5K8OA 3KQZA 4H2KA 3SJGA 1QQ9A 1DE4C 3IIBA 2V8DA 3S9MA 4NGRA 3S9LA 2PIYA 1ARLA 2PJ4A 3WC5A 4MHPA 2J9AA 4OIDA 2C6CA 2O53A 3FX6A 2PJ8A 1LCPA 2NYQA 3D7FA 1Y9ZA 3H8GA 3RZAA 3K2KA 4P4IA 1Y7EA 1XFOA 2PJ9A 3NH4A 2NSMA 4ZI6A 2IJZA 1KWMA 1XF1A 3HLPA 4ZY0A 1CG2A 4G1PA 1ZLHA 3CDXA 3VTAA 4C8FA 4R76A 2PJ2A 3PB8X 2PJCA 1HDQA 4C9VA 2AFXA 4DUKA 1XRYA 1FNOA 4PQAA 3DGVA 2BCOA 4UIBA 3FEEA 5LRJA 4WJBA 1YSJA 4C9EA 2QJ8A 3PB6X 1Z5RA 2OR4A 1IY7A 3BI0A 3N5FA 5D29A 3MN8A 4OIWA 3VH9A 1UWYA 3ISZA 4LQGA 3BI1A 2EK8A 2AFUA 3I1UA 4R6TA 1Q7LA 1TKFA 4MHNA 1YMEA 2ZEHA 4YU9A 5HVGA 4UEEA 4Z65A 1PCAA 4C8TA 4C99A 3H8FA 2AFMA 4C86A 4FAIA 3NFZA 1XMBA 4UEFA 3IEHA 2QVPA 4RUHA 1ZG7A 4O23A 2JBKA 4ZY2A 2PJ5A 4P6YA 4X3RA 2XEJA 3FH4A 4KNGE 4IK2A 5I4MA 4C9UA 5LYIA 2VL1A 3WABA 1R3NA 4GM5A 4MCQA 4C9AA 4UIAA 3PRTA 4EMEA 3WC7A 2CIJA 1ELLP 2I3CA 4W9YA 2PJ7A 5LYLA 4FBEA 5CPAA 2PCUA 2GLFA 4OC3A 3KHXA 1VHEA 1AYEA 1TF8A 1ZG9A 6CPAA 3SI2A 5HVHA 4UF4A 2PRQA 2F8HA 1GYTA 3NH8A 2PVVA 2AFWA 3PB9X 1VHOA 2ZOGA 4TJXA 3KQXA 4NGQA 3EIFA 4TJVA 3B3WA 3FMCA 5LRGA 3PFEA 1BPNA 3D7DA 3LMSA 2Q43A 1HEEA 1LAPA 3KR4A 2ANPA 2Q4ZA 3IJ3A 4NGNA 2JEWA 2PJ1A 1Z2LA 4F9VA 4YWYA 5JGFA 4P4FA 4PPZA 1LANA 3NA6A 2HB6A 7CPAA 3B2YA 4C8CA 5J1QA 3CPAA 3I74A 1BPMA 3JRUA 3PB4X 1Y0RA 1OBRA 4X2TA 1V6CA 4C85A 3SI0A 4IAVA 4KSIA 4BD9A 4NFRA 4OKOA 1AMPA 3FEDA 1CP7A 2AFOA 4ZY1A 3SJFA 2O4HA 3GLJA 3GUXA 2QYVA 4OC5A 4NGTA 2IMOA 2V77A 4A39A 2AFSA 1YW4A 3CPXA 3FECA 4DYOA 1VGYA 3SJXA 1XJOA 2GREA 4ONWA 5D8NA 1CX8A 2PJ3A 1FT7A 4A37A 2ZOFA 3GB0A 2CF4A 2WYRA 4AXVA 3SJEA 4C8UA 4PXBA 2V8VA 4OMEA 3KGQA 2PE3A 1QMUA 4P10A 5K8PA 4NJQA 2V8HA 1CBXA 4C9RA 4NGMA 4A94A 1Y0YA 4MMOA 2V8GA 3TX8A 3DLJA 3IFEA 2AFZA 2C1CA 5JH9A 3VATA 3FF3A 2PJ6A 1LAMA 2ZELA 2XEIA 2C6GA 1TKJA 3B3SA 1Z8LA 3PBBA 1CP6A 1TF9A
chains in the Genus database with same CATH superfamily
1RTQA 2IL4A 3TO9A 2CTCA 3KR5A 2DPTA 3T9YA 3VWDA 4JD6A 4CGLA 5C82A 2FCKA 3W6XA 4QVTA 1H8LA 2XEGA 2FIWA 4OLLA 4BPXB 2PIZA 3B3CA 1ARMA 3BXMA 4P4EA 4MI4A 4MFZA 2ZEPA 1C30B 2Z11A 1NSAA 4F8ZA 4CYQA 4BTFA 2XEFA 2GU2A 1EZAA 4MBUA 1F2OA 3D66A 3U88C 3EC4A 3K9UA 4KOSA 4NCZA 3S6KA 1XBUA 3SI1A 2C5QA 2B5GB 5JQ4A 4Y49B 1P4NA 2CTBA 2R8VA 3R95A 3DSBA 4C8AA 3V38A 5IB9A 2VXKA 4B6ZA 2D4PA 2OU2A 5LYFA 4E94A 4H6UA 3VRPA 2C6PA 4C68A 4ZBGA 3PB7X 1N71A 1VI4A 4YN3A 1ELMP 4JVOA 3TLCA 2Z3MA 4DJLA 4MCSA 4OC4A 1JWQA 2VKZG 1YR0A 4TNUA 2F5IA 2EZAA 3JUWA 3N7ZA 5H86A 2Q7BA 4ZX9A 5AG6A 4MRIA 5F13A 5JPHA 4FD5A 1S60A 1AUGA 3D68A 2BO9A 3GYAA 3T90A 1LRZA 1X10A 3H4QA 4CZ1A 3IWWA 2DF5A 1BOBA 2REEA 3FIXA 3KL9A 4M6IA 4NEXA 5AG5A 2QECA 4BINA 2HC9A 2CNTA 2REFA 1P0HA 2G3TA 1I21A 4H6ZA 2AUNA 4B10A 3FVLA 4P4JA 1M4DA 4KOYA 4A38A 5HXDA 1JQGA 2HI6A 3QAYA 4OADA 4L89A 1YLOA 4ZX8A 3SXOA 2E28A 5LYDA 3ZNIA 5AG7A 2B3VA 2VI7A 4F9UA 3S9NA 2X0SA 3BUNB 2QMLA 2OZHA 2PJ0A 3KKWA 4MFPA 3OB1B 4WWVA 2EO8A 5HMNA 3I6SA 4U9ZA 5F09A 4IIXA 2R98A 4PXDA 1BAVA 1F2PA 1X12A 4IHMA 4UWIA 3GKRA 4Q38A 4I49A 1IIDA 4CDJA 3PP9A 4KOTA 2ZEGA 4HPSA 4OC0A 1QSMA 5DWMA 3L2NA 3D7GA 5LRKA 2F7VA 8CPAA 4R8FA 1Q2DA 3C8OA 4MI1A 4CAFA 2EK9A 3WC6A 1ZG8A 2H5MA 3V7ZA 2RB7A 4C8PA 2ZEDA 5DS0A 1CPSA 3FRMA 3K9TA 3BHXA 3T07A 2IQ6A 4JYWA 2ODFA 4PSWA 2I00A 4A4BA 3MRUA 2B4DB 1ZO0A 2Z3NA 3DR8A 2Z10A 4Q7AA 3ISXA 5JVLA 1LFWA 4OP4A 2PJBA 3KHZA 2OB0A 1QSOA 3ZZIA 3OP0A 3D8PA 2OZUA 2PDOA 2CNSA 3OAKA 2Z3OA 3JVNA 3GIUA 4NGPA 2BOAA 3HUVA 4KUAA 2ZEFA 2DEAA 4DUKA 2DPSA 3EXNA 4JJXA 1HDUA 1UFHA 3LACA 5FD8A 4K3NA 4PXCA 4CAWA 1A9XB 2GLJA 2PSWA 3SHPA 2ABZA 4PSXA 4UWJA 4B14A 2OOTA 2K5TA 1I1DA 1GGOA 4COGA 4CDKA 3CXQA 5ISVA 4PXEA 2O28A 4U9YA 4OC1A 4XPDB 5HVFA 4MXUA 4PK2A 2ZENA 4CPAA 1Y9ZA 2PCNA 1ZLIA 2ZEOA 2MP0A 2CBLA 3FJUA 2PVWA 4JXQA 2BSWA 3B3VA 4J3GA 5HVGA 1FBVA 1M4LA 4MHZA 1C3OB 5HKZA 2JEVA 2RFHA 2Z3KA 4KVME 3RBUA 2J8NA 3IO1A 5CBMA 2B4DA 3PBEA 4B13A 2Q7SA 5IX3A 4NGSA 4UEZA 4RR2B 3ICUA 1K4JA 2X7BA 5THWA 4B12A 4XNHC 1QSRA 3TTHA 1F57A 3HMJG 3D7HA 1IGBA 2BUEA 2FVGA 4NJRA 4A33A 1QSNA 4P4DA 1XE4A 4CGPA 4UCMA 1B47A 2WZNA 1TXRA 3KI9A 1YQEA 3LWUA 2AE6A 4X8IA 1S3ZA 2ZEEA 2ZW4A 1TKHA 4KLVA 5EMIA 5FVJA 1BLLE 4FWUA 1WVMA 2JBJA 1IB1E 3B3TA 2POKA 3FB3A 1OZPA 4YRHA 4B5OA 1PYTB 2YJVA 2XPPA 1RXTA 2PJAA 4CGOA 3QNVA 1VHSA 1YW6A 2ZEMA 4M6GA 2ARHA 3T8WA 2P6GA 1CPXA 4ZGYB 3H8EA 1KUVA 3TLEA 4GS4A 4TWEA 3CT9A 3RAMA 3C26A 1EE3P 3D4UA 3UY5A 4EWTA 2EWBA 5KTAA 5F1YA 3TLGB 1VIXA 3D67A 3EZAA 4R3LA 4NXYA 4OC2A 2Q51A 2HWGA 5ELYA 3I3GA 4R7MA 2XPNA 2FS5A 2J8RA 3R9FA 1YREA 1DTDA 4R57A 4A2ZA 1MJAA 5JM6A 1Z8WA 3VARA 2HV2A 1BXRB 4CAVA 4R9MA 4MCRA 4FUUA 1J3LA 4INJA 4H89A 1Z8TA 3KASA 1S7NA 1ON0A 2PRBA 2FE7A 1MK4A 4JZ0A 4P45A 3IC1A 1VBHA 4BPWB 4C84A 5CNPA 4P44A 4P4BA 1T36B 2G9DA 3B7IA 3PFVA 4BMHA 4ZYQA 1PU9A 4M8DA 3B35A 3PFOA 1R43A 3DDDA 3QAHA 4EFDA 5K8NA 1BO4A 5BY0A 3HPHE 1S7KA 2OZGA 3PZJA 4MHYA 3PEIA 4KORA 3WT4A 1CJWA 2R7HA 3KZWA 4CRYB 2OLSA 1DIKA 1M6VB 3TC8A 4JLYA 3NH5A 5G20A 1XEBA 3TLGA 3IWEA 1LOKA 4Q36A 4MCPA 2WUUA 4KS9A 1WWZA 2RC4A 2G3AA 3LODA 4UBRA 5K8MA 4KOXA 5K8OA 4C2XA 3KQZA 4H2KA 3SJGA 1QQ9A 2YGWA 2JLMA 4RS2A 4Y49C 4CAXA 1DE4C 2DXQA 2NMTA 3IIBA 3W6SA 2V8DA 1IU8A 2B5GA 3G23A 3S9MA 4NGRA 3S9LA 2PIYA 1ARLA 5F9MA 2PJ4A 3WC5A 4MHPA 2J9AA 3IU2A 4OIDA 4XPKA 3WR7A 2FM4A 4YGOA 2C6CA 4A32A 5BWAB 5G22A 2O53A 3FX6A 4FD6A 1ZYMA 1QSTA 2PJ8A 4BBHA 1LCPA 5J8CA 2P0WA 3T05A 2I79A 2NYQA 3D7FA 2Z3PA 1XMTA 3H8GA 4GXHA 4KOWA 4PK3A 1Y7RA 3F5BA 4P4IA 1Y7EA 3K2KA 3RZAA 3TE4A 3OB2B 1XFOA 2PJ9A 3NH4A 2NSMA 4ZI6A 2EBJA 1A2ZA 2FSRA 1R57A 4AVCA 1J4JA 1KUXA 1EZBA 2IJZA 3LD2A 4XPLA 1NBWA 1KWMA 5G21A 1XF1A 3HLPA 5KTDA 4ZY0A 1CG2A 4G1PA 1ZLHA 3CDXA 4CYOA 3TOAA 3VTAA 4C8FA 5AGEA 3PLFB 4RI1A 2BEIA 4R76A 3S6HA 2PC1A 1KBLA 2PJ2A 2Q0YA 2PR8A 3TLZA 3PB8X 2PJCA 1JDEA 2OH1A 1HDQA 4QB9A 2Q04A 3BUXB 4HKFA 4E8OA 4C9VA 4UCNA 2AFXA 4M6HA 3PT1A 1XRYA 1FNOA 3GY9A 1M4IA 4L8AA 4PQAA 2GANA 3D2PA 3DGVA 2BCOA 3TO6A 4UIBA 2CXAA 3FEEA 1Z8XA 1Q2CA 5LRJA 4WJBA 3BLNA 4MHDA 1YSJA 4F0XA 4C9EA 2QJ8A 4FD7A 3PB6X 2DIKA 1XF8A 4MJXA 1Z5RA 2OR4A 1TIQA 1IY7A 1YX0A 5C88A 1CS0B 4HNYB 4GPLB 3BI0A 2J8MA 3N5FA 5AXIA 3DNSA 5K99A 5F48A 3JTKA 5D29A 3IU1A 3MN8A 4OIWA 1B87A 1NXJA 3VH9A 2FT0A 2KCWA 4C7IA 5KTCA 2FL4A 4KUBA 1UWYA 3ISZA 3F9KC 1EO0A 4LQGA 4H1HA 4AVBA 2HQYA 3BI1A 2EK8A 4AG9A 2AFUA 1I12A 3I1UA 3FXTA 4M3SA 3H5ZA 3F8KA 4E0AA 1Z4EA 3IWGA 1V0CA 3V8IA 4R6TA 1ZL0A 2N3AB 1Q7LA 2FXFA 4LUAA 1TKFA 4MHNA 3VRRA 2B4JC 3BJ8A 2A4NA 4MFQA 1YMEA 2ZEHA 2C27A 3D3SA 4YU9A 1MJBA 4UEEA 3R96A 4Z65A 1PCAA 4MY0A 4OAEA 3S6GA 2AUMA 4C8TA 4C99A 1Z9UA 2AFMA 3H8FA 4FAIA 4C86A 3NFZA 4QC6A 4CGNA 3EZEA 4AG7A 1XMBA 4UEFA 2B3UA 1M44A 3IEHA 2QVPA 1B6BA 4CS0B 4F6AA 3EFAA 4RUHA 1S5KA 5IB0A 4E2AA 1ZG7A 3FBUA 1Q2YA 4O23A 2EZBA 4KSFA 4R3KA 2JBKA 4ZY2A 2PJ5A 4UFWA 4P6YA 4X3RA 2XEJA 3FH4A 3G8WA 4XPDC 2Y1MA 3RNZA 4CO9A 4X5KA 4KNGE 4IK2A 4QUSA 4QBJA 5J3XA 5I4MA 4U5YA 1ZRSA 5HH1A 4C9UA 4C2YA 5LYIA 4KSAA 5GCNA 3OWCA 4AVAA 2VL1A 3WABA 4CYPA 1R3NA 4GM5A 4KOUA 4MCQA 4C9AA 3G3SA 4UIAA 1KUYA 2XPLA 3PRTA 4COBA 4MJ8A 1IOIA 4EMEA 2B58A 3NE7A 2GE3A 3WC7A 1Z4RA 2CIJA 3VRNA 3R9GA 3K4IA 1IYKA 1ELLP 5IV0A 5IR2A 4NSQA 2I3CA 4ORFA 2YNCC 2ZW5A 3BUOB 2FIAA 4W9YA 2PJ7A 5LYLA 2CY2A 4FBEA 2Q44A 2YNCA 1YVKA 5HKWA 5CPAA 3S6FA 2PCUA 4A31A 4RN7A 4C8CA 2GLFA 1CE8B 4OC3A 3KHXA 4MY3A 1VHEA 4CYNA 1AYEA 1TF8A 1ZG9A 4PV6A 6CPAA 3KRVA 4M85A 3SI2A 2WPXA 4EVYA 4CAEA 5HVHA 4UF4A 1XOVA 2WSAA 2PRQA 2Y0MA 2GFQA 1YGHA 2F8HA 3I9SA 1Y9KA 4KLWA 2Q4VA 4UFXA 5F49A 3CXSA 1GYTA 5H84A 4B5PB 4CGMA 4B11A 3NH8A 2B0AA 1R61A 1SQHA 2PVVA 2AFWA 4IIYA 5A27A 4CRZB 3U1BA 2ATRA 2ZW6A 3IGRA 3PB9X 1VHOA 1XIXA 3TFYA 2B4BA 2ZOGA 2GIVA 4KOVA 3SXNA 3W91A 2D0OA 1MJ9A 4TJXA 5G1ZA 2AJ6A 4NGQA 3KQXA 3NE8A 3E0KA 4R87A 5JYBA 2YNDA 3EIFA 4MFLA 4FD4A 3B8GA 4TJVA 3TYXA 2QIRA 5F46A 4JXRA 3B3WA 3FMCA 5LRGA 3R9EA 1RO5A 3PFEA 4AB7A 1Q5XA 2JDDA 4J0NA 1BPNA 3EO4A 1IOFA 3D7DA 1M4GA 3LMSA 2Q43A 3T5MA 4F0YA 1HEEA 1LAPA 3GJZA 1WK4A 3KR4A 5DWNA 2D4OA 3CXPA 3TCVA 2UV8G 1Y9WA 4UA3A 2ANPA 2Q4ZA 4B5PA 5HKYA 2G0BA 1NSLA 1KC7A 3TT2A 4BPUB 3P2HA 4ONUA 3VGOA 2ZXVA 3IJ3A 1S7LA 4NGNA 2JEWA 4UFVA 1CM0A 2PJ1A 1Z2LA 2EVNA 4F9VA 4YWYA 4YFJA 5JGFA 4P4FA 4PPZA 1LANA 3EZBA 4K30A 4LQ6A 3TO7A 1WJTA 1NMTA 1YLEA 3VRQA 2HB6A 2P6EA 3B2YA 3DR6A 3NA6A 1PUAA 2JDCA 3CPAA 4JWPA 4C7HA 1BPMA 5J1QA 4II9A 3RYOA 3JRUA 3I74A 4E5SA 1M1DA 2ZW7A 2Z0ZA 3PB4X 1CP6A 3TLAA 1Y0RA 1OBRA 4X2TA 1V6CA 2BL1A 3A9LA 3BUMB 1GHEA 2Q4YA 3FYNA 3SI0A 4IAVA 4C85A 4KSIA 1Z9EA 4BD9A 3HPGG 4NFRA 2P6FA 1IICA 2VEZA 2Z3LA 4OKOA 1AMPA 3FEDA 1CP7A 3NFQA 2AFOA 4ZY1A 3P2FA 2ZPAA 3SJFA 2O4HA 2VBQA 3GLJA 2HROA 3NOJA 4KVXA 3GUXA 2QYVA 1IYLA 4OC5A 4NGTA 2IMOA 2V77A 4A39A 2AFSA 2VZZA 2R82A 4IF5A 2D0PA 4HNXB 1YW4A 2EUIA 2GP4A 1FY7A 2VQYA 3CPXA 3FECA 5E96A 1KEEB 4XNHB 3F0AA 4DYOA 5J8FA 1VGYA 3SJXA 1XJOA 2YJTA 2GREA 4ONWA 4KZTA 5D8NA 3O8ZA 2YNEA 1CX8A 2R1IA 3MGDA 2PJ3A 4KVOE 1FT7A 5EBVA 5F47A 5EC4A 4A37A 2ZOFA 3QB8A 4MFJA 2Y1NA 3GB0A 2CF4A 3TOBA 2WYRA 1VKCA 4A30A 4AXVA 4IUSA 5F5XA 3SJEA 3CZXA 2EZCA 4C8UA 4PXBA 2XPOA 3SR3A 1U6MA 4NF1A 1YVHA 5AG4A 2V8VA 4OMEA 3KGQA 4DNCA 3VWEA 5I0CA 3R1KA 7CPAA 1L0CA 3ZJ0A 2PE3A 1QMUA 1YVOA 4P10A 5K8PA 4NJQA 2V8HA 3FNCA 5A28A 4EYSA 4A95A 1CBXA 4C9RA 4NGMA 1YK3A 4A4CA 4A94A 1VBGA 3TLBA 1S7FA 3D2MA 1KZFA 1Y0YA 2WPWA 4MMOA 2DLAA 1JDBC 2V8GA 4HNWB 4UCPA 2CNMA 3TX8A 2VZYA 3EY5A 3DLJA 3IFEA 4C2ZA 2AFZA 2C1CA 3T0TA 3TLYA 4MFKA 4LX9A 3BUWB 5JH9A 3VATA 3FF3A 2PJ6A 3BJ7A 1LAMA 2ZELA 2XEIA 3PGPA 1NE9A 2C6GA 1TKJA 3B3SA 3RO0A 2HUZA 1Z8LA 2PQ8A 2PR1A 3PBBA 3VROA 1TF9A
chains in the Genus database with same CATH topology
1RTQA 2CTCA 3KR5A 1H8LA 2XEGA 2PIZA 3B3CA 1ARMA 3BXMA 4P4EA 2ZEPA 1NSAA 2XEFA 2GU2A 1F2OA 3D66A 2C5QA 3SI1A 1XBUA 2CTBA 4C8AA 3V38A 5IB9A 4B6ZA 5LYFA 2C6PA 4YN3A 3PB7X 1ELMP 4DJLA 4MCSA 4OC4A 4TNUA 4ZX9A 4MRIA 3D68A 2BO9A 3IWWA 3KL9A 4F8ZA 2HC9A 3FVLA 4P4JA 4A38A 5HXDA 1JQGA 4ZX8A 1YLOA 5LYDA 4F9UA 3S9NA 2PJ0A 4WWVA 3I6SA 5F09A 4PXDA 1BAVA 1F2PA 4IHMA 4CDJA 2ZEGA 4OC0A 3L2NA 3D7GA 5LRKA 2F7VA 8CPAA 4R8FA 2EK9A 3WC6A 1ZG8A 4C8PA 3V7ZA 2RB7A 2ZEDA 5DS0A 1CPSA 3K9TA 3BHXA 2IQ6A 4JYWA 3MRUA 4Q7AA 3ISXA 1LFWA 4OP4A 2PJBA 3KHZA 4NGPA 2BOAA 3HUVA 2ZEFA 2DEAA 1HDUA 4K3NA 4PXCA 2GLJA 2ABZA 2OOTA 4CDKA 4PXEA 5HVFA 4OC1A 4MXUA 2ZENA 4CPAA 1ZLIA 2ZEOA 3FJUA 2PVWA 3B3VA 1M4LA 4MHZA 2RFHA 3RBUA 3IO1A 5CBMA 3PBEA 4NGSA 4UEZA 3ICUA 5THWA 1F57A 3D7HA 1IGBA 2FVGA 4NJRA 4P4DA 2WZNA 3LWUA 1TXRA 3KI9A 4X8IA 2ZEEA 1TKHA 1BLLE 4FWUA 1WVMA 2JBJA 3B3TA 2POKA 1PYTB 2PJAA 3QNVA 1YW6A 2ZEMA 3T8WA 1CPXA 3H8EA 4TWEA 3CT9A 3RAMA 1EE3P 3D4UA 4EWTA 2EWBA 1VIXA 3D67A 4OC2A 2Q51A 5ELYA 4R7MA 1DTDA 5JM6A 3VARA 4MCRA 4FUUA 3KASA 4JZ0A 4P45A 3IC1A 4C84A 4P44A 4P4BA 2G9DA 3B7IA 4ZYQA 3B35A 3PFOA 1R43A 4EFDA 5K8NA 4MHYA 3WT4A 3PEIA 3KZWA 3TC8A 3NH5A 1LOKA 4MCPA 5K8MA 5K8OA 3KQZA 4H2KA 3SJGA 1QQ9A 1DE4C 3IIBA 2V8DA 3S9MA 4NGRA 3S9LA 2PIYA 1ARLA 2PJ4A 3WC5A 4MHPA 2J9AA 4OIDA 2C6CA 2O53A 3FX6A 2PJ8A 1LCPA 2NYQA 3D7FA 1Y9ZA 3H8GA 3RZAA 3K2KA 4P4IA 1Y7EA 1XFOA 2PJ9A 3NH4A 2NSMA 4ZI6A 2IJZA 1KWMA 1XF1A 3HLPA 4ZY0A 1CG2A 4G1PA 1ZLHA 3CDXA 3VTAA 4C8FA 4R76A 2PJ2A 3PB8X 2PJCA 1HDQA 4C9VA 2AFXA 4DUKA 1XRYA 1FNOA 4PQAA 3DGVA 2BCOA 4UIBA 3FEEA 5LRJA 4WJBA 1YSJA 4C9EA 2QJ8A 3PB6X 1Z5RA 2OR4A 1IY7A 3BI0A 3N5FA 5D29A 3MN8A 4OIWA 3VH9A 1UWYA 3ISZA 4LQGA 3BI1A 2EK8A 2AFUA 3I1UA 4R6TA 1Q7LA 1TKFA 4MHNA 1YMEA 2ZEHA 4YU9A 5HVGA 4UEEA 4Z65A 1PCAA 4C8TA 4C99A 3H8FA 2AFMA 4C86A 4FAIA 3NFZA 1XMBA 4UEFA 3IEHA 2QVPA 4RUHA 1ZG7A 4O23A 2JBKA 4ZY2A 2PJ5A 4P6YA 4X3RA 2XEJA 3FH4A 4KNGE 4IK2A 5I4MA 4C9UA 5LYIA 2VL1A 3WABA 1R3NA 4GM5A 4MCQA 4C9AA 4UIAA 3PRTA 4EMEA 3WC7A 2CIJA 1ELLP 5IR2A 2I3CA 4W9YA 2PJ7A 5LYLA 4FBEA 5CPAA 2PCUA 2GLFA 4OC3A 3KHXA 1VHEA 1AYEA 1TF8A 1ZG9A 6CPAA 3SI2A 5HVHA 4UF4A 2PRQA 2F8HA 1GYTA 3NH8A 2PVVA 2AFWA 3PB9X 1VHOA 2ZOGA 4TJXA 3KQXA 4NGQA 3EIFA 4TJVA 3B3WA 3FMCA 5LRGA 3PFEA 1BPNA 3D7DA 3LMSA 2Q43A 1HEEA 1LAPA 3KR4A 2ANPA 2Q4ZA 3IJ3A 4NGNA 2JEWA 2PJ1A 1Z2LA 4F9VA 4YWYA 5JGFA 4P4FA 4PPZA 1LANA 3NA6A 2HB6A 7CPAA 3B2YA 4C8CA 5J1QA 3CPAA 3I74A 1BPMA 3JRUA 3PB4X 1Y0RA 1OBRA 4X2TA 1V6CA 4C85A 3SI0A 4IAVA 4KSIA 4BD9A 4NFRA 4OKOA 1AMPA 3FEDA 1CP7A 2AFOA 4ZY1A 3SJFA 2O4HA 3GLJA 3GUXA 2QYVA 4OC5A 4NGTA 2IMOA 2V77A 4A39A 2AFSA 1YW4A 2GP4A 3CPXA 3FECA 4DYOA 1VGYA 3SJXA 1XJOA 2GREA 4ONWA 5D8NA 1CX8A 2PJ3A 1FT7A 4A37A 2ZOFA 3GB0A 2CF4A 2WYRA 4AXVA 3SJEA 4C8UA 4PXBA 2V8VA 4OMEA 3KGQA 2PE3A 1QMUA 4P10A 5K8PA 4NJQA 2V8HA 1CBXA 4C9RA 4NGMA 4A94A 1Y0YA 4MMOA 2V8GA 3TX8A 3DLJA 3IFEA 2AFZA 2C1CA 5JH9A 3VATA 3FF3A 2PJ6A 1LAMA 2ZELA 2XEIA 2C6GA 1TKJA 3B3SA 1Z8LA 3PBBA 1CP6A 1TF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTQ A;  2CTC A;  3KR5 A;  1H8L A;  2XEG A;  2PIZ A;  3B3C A;  1ARM A;  3BXM A;  4P4E A;  2ZEP A;  1NSA A;  2XEF A;  2GU2 A;  1F2O A;  3D66 A;  3SI1 A;  1XBU A;  2CTB A;  4C8A A;  3V38 A;  5IB9 A;  4B6Z A;  5LYF A;  2C6P A;  4YN3 A;  3PB7 X;  1ELM P;  4DJL A;  4MCS A;  4OC4 A;  4TNU A;  4ZX9 A;  4MRI A;  3D68 A;  2BO9 A;  3IWW A;  3KL9 A;  4F8Z A;  2HC9 A;  3FVL A;  4P4J A;  4A38 A;  5HXD A;  1JQG A;  4ZX8 A;  1YLO A;  5LYD A;  4F9U A;  3S9N A;  2PJ0 A;  4WWV A;  3I6S A;  5F09 A;  4PXD A;  1BAV A;  1F2P A;  4IHM A;  4CDJ A;  2ZEG A;  4OC0 A;  3L2N A;  3D7G A;  5LRK A;  2F7V A;  8CPA A;  4R8F A;  2EK9 A;  3WC6 A;  1ZG8 A;  4C8P A;  3V7Z A;  2RB7 A;  2ZED A;  5DS0 A;  1CPS A;  3K9T A;  3BHX A;  2IQ6 A;  4JYW A;  3MRU A;  4Q7A A;  3ISX A;  1LFW A;  4OP4 A;  2PJB A;  3KHZ A;  4NGP A;  2BOA A;  3HUV A;  2ZEF A;  2DEA A;  1HDU A;  4K3N A;  4PXC A;  2GLJ A;  2ABZ A;  2OOT A;  4CDK A;  4PXE A;  5HVF A;  4OC1 A;  4MXU A;  2ZEN A;  4CPA A;  1ZLI A;  2ZEO A;  3FJU A;  2PVW A;  3B3V A;  1M4L A;  4MHZ A;  2RFH A;  3RBU A;  3IO1 A;  5CBM A;  3PBE A;  4NGS A;  4UEZ A;  3ICU A;  5THW A;  1F57 A;  3D7H A;  1IGB A;  2FVG A;  4NJR A;  4P4D A;  2WZN A;  3LWU A;  1TXR A;  3KI9 A;  4X8I A;  2ZEE A;  1TKH A;  1BLL E;  4FWU A;  1WVM A;  2JBJ A;  3B3T A;  2POK A;  1PYT B;  2PJA A;  3QNV A;  1YW6 A;  2ZEM A;  3T8W A;  1CPX A;  3H8E A;  4TWE A;  3CT9 A;  3RAM A;  1EE3 P;  3D4U A;  4EWT A;  2EWB A;  1VIX A;  3D67 A;  4OC2 A;  2Q51 A;  5ELY A;  4R7M A;  1DTD A;  5JM6 A;  3VAR A;  4MCR A;  4FUU A;  3KAS A;  4JZ0 A;  4P45 A;  3IC1 A;  4C84 A;  4P44 A;  4P4B A;  2G9D A;  3B7I A;  4ZYQ A;  3B35 A;  3PFO A;  1R43 A;  4EFD A;  5K8N A;  4MHY A;  3WT4 A;  3PEI A;  3KZW A;  3TC8 A;  3NH5 A;  1LOK A;  4MCP A;  5K8M A;  5K8O A;  3KQZ A;  4H2K A;  3SJG A;  1QQ9 A;  1DE4 C;  3IIB A;  2V8D A;  3S9M A;  4NGR A;  3S9L A;  2PIY A;  1ARL A;  2PJ4 A;  3WC5 A;  4MHP A;  2J9A A;  4OID A;  2C6C A;  2O53 A;  3FX6 A;  2PJ8 A;  1LCP A;  2NYQ A;  3D7F A;  1Y9Z A;  3H8G A;  3RZA A;  3K2K A;  4P4I A;  1Y7E A;  1XFO A;  2PJ9 A;  3NH4 A;  2NSM A;  4ZI6 A;  2IJZ A;  1KWM A;  1XF1 A;  3HLP A;  4ZY0 A;  1CG2 A;  4G1P A;  1ZLH A;  3CDX A;  3VTA A;  4C8F A;  4R76 A;  2PJ2 A;  3PB8 X;  2PJC A;  1HDQ A;  4C9V A;  2AFX A;  4DUK A;  1XRY A;  1FNO A;  4PQA A;  3DGV A;  2BCO A;  4UIB A;  3FEE A;  5LRJ A;  4WJB A;  1YSJ A;  4C9E A;  2QJ8 A;  3PB6 X;  1Z5R A;  2OR4 A;  1IY7 A;  3BI0 A;  3N5F A;  5D29 A;  3MN8 A;  4OIW A;  3VH9 A;  1UWY A;  3ISZ A;  4LQG A;  3BI1 A;  2EK8 A;  2AFU A;  3I1U A;  4R6T A;  1Q7L A;  1TKF A;  4MHN A;  1YME A;  2ZEH A;  4YU9 A;  5HVG A;  4UEE A;  4Z65 A;  1PCA A;  4C8T A;  4C99 A;  3H8F A;  2AFM A;  4C86 A;  4FAI A;  3NFZ A;  1XMB A;  4UEF A;  3IEH A;  2QVP A;  4RUH A;  1ZG7 A;  4O23 A;  2JBK A;  4ZY2 A;  2PJ5 A;  4P6Y A;  4X3R A;  2XEJ A;  3FH4 A;  4KNG E;  4IK2 A;  5I4M A;  4C9U A;  5LYI A;  2VL1 A;  3WAB A;  1R3N A;  4GM5 A;  4MCQ A;  4C9A A;  4UIA A;  3PRT A;  4EME A;  3WC7 A;  2CIJ A;  1ELL P;  2I3C A;  4W9Y A;  2PJ7 A;  5LYL A;  4FBE A;  5CPA A;  2PCU A;  2GLF A;  4OC3 A;  3KHX A;  1VHE A;  1AYE A;  1TF8 A;  1ZG9 A;  6CPA A;  3SI2 A;  5HVH A;  4UF4 A;  2PRQ A;  2F8H A;  1GYT A;  3NH8 A;  2PVV A;  2AFW A;  3PB9 X;  1VHO A;  2ZOG A;  4TJX A;  3KQX A;  4NGQ A;  3EIF A;  4TJV A;  3B3W A;  3FMC A;  5LRG A;  3PFE A;  1BPN A;  3D7D A;  3LMS A;  2Q43 A;  1HEE A;  1LAP A;  3KR4 A;  2ANP A;  2Q4Z A;  3IJ3 A;  4NGN A;  2JEW A;  2PJ1 A;  1Z2L A;  4F9V A;  4YWY A;  5JGF A;  4P4F A;  4PPZ A;  1LAN A;  3NA6 A;  2HB6 A;  7CPA A;  3B2Y A;  4C8C A;  5J1Q A;  3CPA A;  3I74 A;  1BPM A;  3JRU A;  3PB4 X;  1Y0R A;  1OBR A;  4X2T A;  1V6C A;  4C85 A;  3SI0 A;  4IAV A;  4KSI A;  4BD9 A;  4NFR A;  4OKO A;  1AMP A;  3FED A;  1CP7 A;  2AFO A;  4ZY1 A;  3SJF A;  2O4H A;  3GLJ A;  3GUX A;  2QYV A;  4OC5 A;  4NGT A;  2IMO A;  2V77 A;  4A39 A;  2AFS A;  1YW4 A;  3CPX A;  3FEC A;  4DYO A;  1VGY A;  3SJX A;  1XJO A;  2GRE A;  4ONW A;  5D8N A;  1CX8 A;  2PJ3 A;  1FT7 A;  4A37 A;  2ZOF A;  3GB0 A;  2CF4 A;  2WYR A;  4AXV A;  3SJE A;  4C8U A;  4PXB A;  2V8V A;  4OME A;  3KGQ A;  2PE3 A;  1QMU A;  4P10 A;  5K8P A;  4NJQ A;  2V8H A;  1CBX A;  4C9R A;  4NGM A;  4A94 A;  1Y0Y A;  4MMO A;  2V8G A;  3TX8 A;  3DLJ A;  3IFE A;  2AFZ A;  2C1C A;  5JH9 A;  3VAT A;  3FF3 A;  2PJ6 A;  1LAM A;  2ZEL A;  2XEI A;  2C6G A;  1TKJ A;  3B3S A;  1Z8L A;  3PBB A;  1CP6 A;  1TF9 A; 
#chains in the Genus database with same CATH topology
 1RTQ A;  2IL4 A;  3TO9 A;  2CTC A;  3KR5 A;  2DPT A;  3T9Y A;  3VWD A;  4JD6 A;  4CGL A;  5C82 A;  2FCK A;  3W6X A;  4QVT A;  1H8L A;  2XEG A;  2FIW A;  4OLL A;  4BPX B;  2PIZ A;  3B3C A;  1ARM A;  3BXM A;  4P4E A;  4MI4 A;  4MFZ A;  2ZEP A;  1C30 B;  2Z11 A;  1NSA A;  4F8Z A;  4CYQ A;  4BTF A;  2XEF A;  2GU2 A;  1EZA A;  4MBU A;  1F2O A;  3D66 A;  3U88 C;  3EC4 A;  3K9U A;  4KOS A;  4NCZ A;  3S6K A;  1XBU A;  3SI1 A;  2C5Q A;  2B5G B;  5JQ4 A;  4Y49 B;  1P4N A;  2CTB A;  2R8V A;  3R95 A;  3DSB A;  4C8A A;  3V38 A;  5IB9 A;  2VXK A;  4B6Z A;  2D4P A;  2OU2 A;  5LYF A;  4E94 A;  4H6U A;  3VRP A;  2C6P A;  4C68 A;  4ZBG A;  3PB7 X;  1N71 A;  1VI4 A;  4YN3 A;  1ELM P;  4JVO A;  3TLC A;  2Z3M A;  4DJL A;  4MCS A;  4OC4 A;  1JWQ A;  2VKZ G;  1YR0 A;  4TNU A;  2F5I A;  2EZA A;  3JUW A;  3N7Z A;  5H86 A;  2Q7B A;  4ZX9 A;  5AG6 A;  4MRI A;  5F13 A;  5JPH A;  4FD5 A;  1S60 A;  1AUG A;  3D68 A;  2BO9 A;  3GYA A;  3T90 A;  1LRZ A;  1X10 A;  3H4Q A;  4CZ1 A;  3IWW A;  2DF5 A;  1BOB A;  2REE A;  3FIX A;  3KL9 A;  4M6I A;  4NEX A;  5AG5 A;  2QEC A;  4BIN A;  2HC9 A;  2CNT A;  2REF A;  1P0H A;  2G3T A;  1I21 A;  4H6Z A;  2AUN A;  4B10 A;  3FVL A;  4P4J A;  1M4D A;  4KOY A;  4A38 A;  5HXD A;  1JQG A;  2HI6 A;  3QAY A;  4OAD A;  4L89 A;  1YLO A;  4ZX8 A;  3SXO A;  2E28 A;  5LYD A;  3ZNI A;  5AG7 A;  2B3V A;  2VI7 A;  4F9U A;  3S9N A;  2X0S A;  3BUN B;  2QML A;  2OZH A;  2PJ0 A;  3KKW A;  4MFP A;  3OB1 B;  4WWV A;  2EO8 A;  5HMN A;  3I6S A;  4U9Z A;  5F09 A;  4IIX A;  2R98 A;  4PXD A;  1BAV A;  1F2P A;  1X12 A;  4IHM A;  4UWI A;  3GKR A;  4Q38 A;  4I49 A;  1IID A;  4CDJ A;  3PP9 A;  4KOT A;  2ZEG A;  4HPS A;  4OC0 A;  1QSM A;  5DWM A;  3L2N A;  3D7G A;  5LRK A;  2F7V A;  8CPA A;  4R8F A;  1Q2D A;  3C8O A;  4MI1 A;  4CAF A;  2EK9 A;  3WC6 A;  1ZG8 A;  2H5M A;  3V7Z A;  2RB7 A;  4C8P A;  2ZED A;  5DS0 A;  1CPS A;  3FRM A;  3K9T A;  3BHX A;  3T07 A;  2IQ6 A;  4JYW A;  2ODF A;  4PSW A;  2I00 A;  4A4B A;  3MRU A;  2B4D B;  1ZO0 A;  2Z3N A;  3DR8 A;  2Z10 A;  4Q7A A;  3ISX A;  5JVL A;  1LFW A;  4OP4 A;  2PJB A;  3KHZ A;  2OB0 A;  1QSO A;  3ZZI A;  3OP0 A;  3D8P A;  2OZU A;  2PDO A;  2CNS A;  3OAK A;  2Z3O A;  3JVN A;  3GIU A;  4NGP A;  2BOA A;  3HUV A;  4KUA A;  2ZEF A;  2DEA A;  4DUK A;  2DPS A;  3EXN A;  4JJX A;  1HDU A;  1UFH A;  3LAC A;  5FD8 A;  4K3N A;  4PXC A;  4CAW A;  1A9X B;  2GLJ A;  2PSW A;  3SHP A;  2ABZ A;  4PSX A;  4UWJ A;  4B14 A;  2OOT A;  2K5T A;  1I1D A;  1GGO A;  4COG A;  4CDK A;  3CXQ A;  5ISV A;  4PXE A;  2O28 A;  4U9Y A;  4OC1 A;  4XPD B;  5HVF A;  4MXU A;  4PK2 A;  2ZEN A;  4CPA A;  1Y9Z A;  2PCN A;  1ZLI A;  2ZEO A;  2MP0 A;  2CBL A;  3FJU A;  2PVW A;  4JXQ A;  2BSW A;  3B3V A;  4J3G A;  5HVG A;  1FBV A;  1M4L A;  4MHZ A;  1C3O B;  5HKZ A;  2JEV A;  2RFH A;  2Z3K A;  4KVM E;  3RBU A;  2J8N A;  3IO1 A;  5CBM A;  2B4D A;  3PBE A;  4B13 A;  2Q7S A;  5IX3 A;  4NGS A;  4UEZ A;  4RR2 B;  3ICU A;  1K4J A;  2X7B A;  5THW A;  4B12 A;  4XNH C;  1QSR A;  3TTH A;  1F57 A;  3HMJ G;  3D7H A;  1IGB A;  2BUE A;  2FVG A;  4NJR A;  4A33 A;  1QSN A;  4P4D A;  1XE4 A;  4CGP A;  4UCM A;  1B47 A;  2WZN A;  1TXR A;  3KI9 A;  1YQE A;  3LWU A;  2AE6 A;  4X8I A;  1S3Z A;  2ZEE A;  2ZW4 A;  1TKH A;  4KLV A;  5EMI A;  5FVJ A;  1BLL E;  4FWU A;  1WVM A;  2JBJ A;  1IB1 E;  3B3T A;  2POK A;  3FB3 A;  1OZP A;  4YRH A;  4B5O A;  1PYT B;  2YJV A;  2XPP A;  1RXT A;  2PJA A;  4CGO A;  3QNV A;  1VHS A;  1YW6 A;  2ZEM A;  4M6G A;  2ARH A;  3T8W A;  2P6G A;  1CPX A;  4ZGY B;  3H8E A;  1KUV A;  3TLE A;  4GS4 A;  4TWE A;  3CT9 A;  3RAM A;  3C26 A;  1EE3 P;  3D4U A;  3UY5 A;  4EWT A;  2EWB A;  5KTA A;  5F1Y A;  3TLG B;  1VIX A;  3D67 A;  3EZA A;  4R3L A;  4NXY A;  4OC2 A;  2Q51 A;  2HWG A;  5ELY A;  3I3G A;  4R7M A;  2XPN A;  2FS5 A;  2J8R A;  3R9F A;  1YRE A;  1DTD A;  4R57 A;  4A2Z A;  1MJA A;  5JM6 A;  1Z8W A;  3VAR A;  2HV2 A;  1BXR B;  4CAV A;  4R9M A;  4MCR A;  4FUU A;  1J3L A;  4INJ A;  4H89 A;  1Z8T A;  3KAS A;  1S7N A;  1ON0 A;  2PRB A;  2FE7 A;  1MK4 A;  4JZ0 A;  4P45 A;  3IC1 A;  1VBH A;  4BPW B;  4C84 A;  5CNP A;  4P44 A;  4P4B A;  1T36 B;  2G9D A;  3B7I A;  3PFV A;  4BMH A;  4ZYQ A;  1PU9 A;  4M8D A;  3B35 A;  3PFO A;  1R43 A;  3DDD A;  3QAH A;  4EFD A;  5K8N A;  1BO4 A;  5BY0 A;  3HPH E;  1S7K A;  2OZG A;  3PZJ A;  4MHY A;  3PEI A;  4KOR A;  3WT4 A;  1CJW A;  2R7H A;  3KZW A;  4CRY B;  2OLS A;  1DIK A;  1M6V B;  3TC8 A;  4JLY A;  3NH5 A;  5G20 A;  1XEB A;  3TLG A;  3IWE A;  1LOK A;  4Q36 A;  4MCP A;  2WUU A;  4KS9 A;  1WWZ A;  2RC4 A;  2G3A A;  3LOD A;  4UBR A;  5K8M A;  4KOX A;  5K8O A;  4C2X A;  3KQZ A;  4H2K A;  3SJG A;  1QQ9 A;  2YGW A;  2JLM A;  4RS2 A;  4Y49 C;  4CAX A;  1DE4 C;  2DXQ A;  2NMT A;  3IIB A;  3W6S A;  2V8D A;  1IU8 A;  2B5G A;  3G23 A;  3S9M A;  4NGR A;  3S9L A;  2PIY A;  1ARL A;  5F9M A;  2PJ4 A;  3WC5 A;  4MHP A;  2J9A A;  3IU2 A;  4OID A;  4XPK A;  3WR7 A;  2FM4 A;  4YGO A;  2C6C A;  4A32 A;  5BWA B;  5G22 A;  2O53 A;  3FX6 A;  4FD6 A;  1ZYM A;  1QST A;  2PJ8 A;  4BBH A;  1LCP A;  5J8C A;  2P0W A;  3T05 A;  2I79 A;  2NYQ A;  3D7F A;  2Z3P A;  1XMT A;  3H8G A;  4GXH A;  4KOW A;  4PK3 A;  1Y7R A;  3F5B A;  4P4I A;  1Y7E A;  3K2K A;  3RZA A;  3TE4 A;  3OB2 B;  1XFO A;  2PJ9 A;  3NH4 A;  2NSM A;  4ZI6 A;  2EBJ A;  1A2Z A;  2FSR A;  1R57 A;  4AVC A;  1J4J A;  1KUX A;  1EZB A;  2IJZ A;  3LD2 A;  4XPL A;  1NBW A;  1KWM A;  5G21 A;  1XF1 A;  3HLP A;  5KTD A;  4ZY0 A;  1CG2 A;  4G1P A;  1ZLH A;  3CDX A;  4CYO A;  3TOA A;  3VTA A;  4C8F A;  5AGE A;  3PLF B;  4RI1 A;  2BEI A;  4R76 A;  3S6H A;  2PC1 A;  1KBL A;  2PJ2 A;  2Q0Y A;  2PR8 A;  3TLZ A;  3PB8 X;  2PJC A;  1JDE A;  2OH1 A;  1HDQ A;  4QB9 A;  2Q04 A;  3BUX B;  4HKF A;  4E8O A;  4C9V A;  4UCN A;  2AFX A;  4M6H A;  3PT1 A;  1XRY A;  1FNO A;  3GY9 A;  1M4I A;  4L8A A;  4PQA A;  2GAN A;  3D2P A;  3DGV A;  2BCO A;  3TO6 A;  4UIB A;  2CXA A;  3FEE A;  1Z8X A;  1Q2C A;  5LRJ A;  4WJB A;  3BLN A;  4MHD A;  1YSJ A;  4F0X A;  4C9E A;  2QJ8 A;  4FD7 A;  3PB6 X;  2DIK A;  1XF8 A;  4MJX A;  1Z5R A;  2OR4 A;  1TIQ A;  1IY7 A;  1YX0 A;  5C88 A;  1CS0 B;  4HNY B;  4GPL B;  3BI0 A;  2J8M A;  3N5F A;  5AXI A;  3DNS A;  5K99 A;  5F48 A;  3JTK A;  5D29 A;  3IU1 A;  3MN8 A;  4OIW A;  1B87 A;  1NXJ A;  3VH9 A;  2FT0 A;  2KCW A;  4C7I A;  5KTC A;  2FL4 A;  4KUB A;  1UWY A;  3ISZ A;  3F9K C;  1EO0 A;  4LQG A;  4H1H A;  4AVB A;  2HQY A;  3BI1 A;  2EK8 A;  4AG9 A;  2AFU A;  1I12 A;  3I1U A;  3FXT A;  4M3S A;  3H5Z A;  3F8K A;  4E0A A;  1Z4E A;  3IWG A;  1V0C A;  3V8I A;  4R6T A;  1ZL0 A;  2N3A B;  1Q7L A;  2FXF A;  4LUA A;  1TKF A;  4MHN A;  3VRR A;  2B4J C;  3BJ8 A;  2A4N A;  4MFQ A;  1YME A;  2ZEH A;  2C27 A;  3D3S A;  4YU9 A;  1MJB A;  4UEE A;  3R96 A;  4Z65 A;  1PCA A;  4MY0 A;  4OAE A;  3S6G A;  2AUM A;  4C8T A;  4C99 A;  1Z9U A;  2AFM A;  3H8F A;  4FAI A;  4C86 A;  3NFZ A;  4QC6 A;  4CGN A;  3EZE A;  4AG7 A;  1XMB A;  4UEF A;  2B3U A;  1M44 A;  3IEH A;  2QVP A;  1B6B A;  4CS0 B;  4F6A A;  3EFA A;  4RUH A;  1S5K A;  5IB0 A;  4E2A A;  1ZG7 A;  3FBU A;  1Q2Y A;  4O23 A;  2EZB A;  4KSF A;  4R3K A;  2JBK A;  4ZY2 A;  2PJ5 A;  4UFW A;  4P6Y A;  4X3R A;  2XEJ A;  3FH4 A;  3G8W A;  4XPD C;  2Y1M A;  3RNZ A;  4CO9 A;  4X5K A;  4KNG E;  4IK2 A;  4QUS A;  4QBJ A;  5J3X A;  5I4M A;  4U5Y A;  1ZRS A;  5HH1 A;  4C9U A;  4C2Y A;  5LYI A;  4KSA A;  5GCN A;  3OWC A;  4AVA A;  2VL1 A;  3WAB A;  4CYP A;  1R3N A;  4GM5 A;  4KOU A;  4MCQ A;  4C9A A;  3G3S A;  4UIA A;  1KUY A;  2XPL A;  3PRT A;  4COB A;  4MJ8 A;  1IOI A;  4EME A;  2B58 A;  3NE7 A;  2GE3 A;  3WC7 A;  1Z4R A;  2CIJ A;  3VRN A;  3R9G A;  3K4I A;  1IYK A;  1ELL P;  5IV0 A;  5IR2 A;  4NSQ A;  2I3C A;  4ORF A;  2YNC C;  2ZW5 A;  3BUO B;  2FIA A;  4W9Y A;  2PJ7 A;  5LYL A;  2CY2 A;  4FBE A;  2Q44 A;  2YNC A;  1YVK A;  5HKW A;  5CPA A;  3S6F A;  2PCU A;  4A31 A;  4RN7 A;  4C8C A;  2GLF A;  1CE8 B;  4OC3 A;  3KHX A;  4MY3 A;  1VHE A;  4CYN A;  1AYE A;  1TF8 A;  1ZG9 A;  4PV6 A;  6CPA A;  3KRV A;  4M85 A;  3SI2 A;  2WPX A;  4EVY A;  4CAE A;  5HVH A;  4UF4 A;  1XOV A;  2WSA A;  2PRQ A;  2Y0M A;  2GFQ A;  1YGH A;  2F8H A;  3I9S A;  1Y9K A;  4KLW A;  2Q4V A;  4UFX A;  5F49 A;  3CXS A;  1GYT A;  5H84 A;  4B5P B;  4CGM A;  4B11 A;  3NH8 A;  2B0A A;  1R61 A;  1SQH A;  2PVV A;  2AFW A;  4IIY A;  5A27 A;  4CRZ B;  3U1B A;  2ATR A;  2ZW6 A;  3IGR A;  3PB9 X;  1VHO A;  1XIX A;  3TFY A;  2B4B A;  2ZOG A;  2GIV A;  4KOV A;  3SXN A;  3W91 A;  2D0O A;  1MJ9 A;  4TJX A;  5G1Z A;  2AJ6 A;  4NGQ A;  3KQX A;  3NE8 A;  3E0K A;  4R87 A;  5JYB A;  2YND A;  3EIF A;  4MFL A;  4FD4 A;  3B8G A;  4TJV A;  3TYX A;  2QIR A;  5F46 A;  4JXR A;  3B3W A;  3FMC A;  5LRG A;  3R9E A;  1RO5 A;  3PFE A;  4AB7 A;  1Q5X A;  2JDD A;  4J0N A;  1BPN A;  3EO4 A;  1IOF A;  3D7D A;  1M4G A;  3LMS A;  2Q43 A;  3T5M A;  4F0Y A;  1HEE A;  1LAP A;  3GJZ A;  1WK4 A;  3KR4 A;  5DWN A;  2D4O A;  3CXP A;  3TCV A;  2UV8 G;  1Y9W A;  4UA3 A;  2ANP A;  2Q4Z A;  4B5P A;  5HKY A;  2G0B A;  1NSL A;  1KC7 A;  3TT2 A;  4BPU B;  3P2H A;  4ONU A;  3VGO A;  2ZXV A;  3IJ3 A;  1S7L A;  4NGN A;  2JEW A;  4UFV A;  1CM0 A;  2PJ1 A;  1Z2L A;  2EVN A;  4F9V A;  4YWY A;  4YFJ A;  5JGF A;  4P4F A;  4PPZ A;  1LAN A;  3EZB A;  4K30 A;  4LQ6 A;  3TO7 A;  1WJT A;  1NMT A;  1YLE A;  3VRQ A;  2HB6 A;  2P6E A;  3B2Y A;  3DR6 A;  3NA6 A;  1PUA A;  2JDC A;  3CPA A;  4JWP A;  4C7H A;  1BPM A;  5J1Q A;  4II9 A;  3RYO A;  3JRU A;  3I74 A;  4E5S A;  1M1D A;  2ZW7 A;  2Z0Z A;  3PB4 X;  1CP6 A;  3TLA A;  1Y0R A;  1OBR A;  4X2T A;  1V6C A;  2BL1 A;  3A9L A;  3BUM B;  1GHE A;  2Q4Y A;  3FYN A;  3SI0 A;  4IAV A;  4C85 A;  4KSI A;  1Z9E A;  4BD9 A;  3HPG G;  4NFR A;  2P6F A;  1IIC A;  2VEZ A;  2Z3L A;  4OKO A;  1AMP A;  3FED A;  1CP7 A;  3NFQ A;  2AFO A;  4ZY1 A;  3P2F A;  2ZPA A;  3SJF A;  2O4H A;  2VBQ A;  3GLJ A;  2HRO A;  3NOJ A;  4KVX A;  3GUX A;  2QYV A;  1IYL A;  4OC5 A;  4NGT A;  2IMO A;  2V77 A;  4A39 A;  2AFS A;  2VZZ A;  2R82 A;  4IF5 A;  2D0P A;  4HNX B;  1YW4 A;  2EUI A;  2GP4 A;  1FY7 A;  2VQY A;  3CPX A;  3FEC A;  5E96 A;  1KEE B;  4XNH B;  3F0A A;  4DYO A;  5J8F A;  1VGY A;  3SJX A;  1XJO A;  2YJT A;  2GRE A;  4ONW A;  4KZT A;  5D8N A;  3O8Z A;  2YNE A;  1CX8 A;  2R1I A;  3MGD A;  2PJ3 A;  4KVO E;  1FT7 A;  5EBV A;  5F47 A;  5EC4 A;  4A37 A;  2ZOF A;  3QB8 A;  4MFJ A;  2Y1N A;  3GB0 A;  2CF4 A;  3TOB A;  2WYR A;  1VKC A;  4A30 A;  4AXV A;  4IUS A;  5F5X A;  3SJE A;  3CZX A;  2EZC A;  4C8U A;  4PXB A;  2XPO A;  3SR3 A;  1U6M A;  4NF1 A;  1YVH A;  5AG4 A;  2V8V A;  4OME A;  3KGQ A;  4DNC A;  3VWE A;  5I0C A;  3R1K A;  7CPA A;  1L0C A;  3ZJ0 A;  2PE3 A;  1QMU A;  1YVO A;  4P10 A;  5K8P A;  4NJQ A;  2V8H A;  3FNC A;  5A28 A;  4EYS A;  4A95 A;  1CBX A;  4C9R A;  4NGM A;  1YK3 A;  4A4C A;  4A94 A;  1VBG A;  3TLB A;  1S7F A;  3D2M A;  1KZF A;  1Y0Y A;  2WPW A;  4MMO A;  2DLA A;  1JDB C;  2V8G A;  4HNW B;  4UCP A;  2CNM A;  3TX8 A;  2VZY A;  3EY5 A;  3DLJ A;  3IFE A;  4C2Z A;  2AFZ A;  2C1C A;  3T0T A;  3TLY A;  4MFK A;  4LX9 A;  3BUW B;  5JH9 A;  3VAT A;  3FF3 A;  2PJ6 A;  3BJ7 A;  1LAM A;  2ZEL A;  2XEI A;  3PGP A;  1NE9 A;  2C6G A;  1TKJ A;  3B3S A;  3RO0 A;  2HUZ A;  1Z8L A;  2PQ8 A;  2PR1 A;  3PBB A;  3VRO A;  1TF9 A; 
#chains in the Genus database with same CATH homology
 1RTQ A;  2CTC A;  3KR5 A;  1H8L A;  2XEG A;  2PIZ A;  3B3C A;  1ARM A;  3BXM A;  4P4E A;  2ZEP A;  1NSA A;  2XEF A;  2GU2 A;  1F2O A;  3D66 A;  2C5Q A;  3SI1 A;  1XBU A;  2CTB A;  4C8A A;  3V38 A;  5IB9 A;  4B6Z A;  5LYF A;  2C6P A;  4YN3 A;  3PB7 X;  1ELM P;  4DJL A;  4MCS A;  4OC4 A;  4TNU A;  4ZX9 A;  4MRI A;  3D68 A;  2BO9 A;  3IWW A;  3KL9 A;  4F8Z A;  2HC9 A;  3FVL A;  4P4J A;  4A38 A;  5HXD A;  1JQG A;  4ZX8 A;  1YLO A;  5LYD A;  4F9U A;  3S9N A;  2PJ0 A;  4WWV A;  3I6S A;  5F09 A;  4PXD A;  1BAV A;  1F2P A;  4IHM A;  4CDJ A;  2ZEG A;  4OC0 A;  3L2N A;  3D7G A;  5LRK A;  2F7V A;  8CPA A;  4R8F A;  2EK9 A;  3WC6 A;  1ZG8 A;  4C8P A;  3V7Z A;  2RB7 A;  2ZED A;  5DS0 A;  1CPS A;  3K9T A;  3BHX A;  2IQ6 A;  4JYW A;  3MRU A;  4Q7A A;  3ISX A;  1LFW A;  4OP4 A;  2PJB A;  3KHZ A;  4NGP A;  2BOA A;  3HUV A;  2ZEF A;  2DEA A;  1HDU A;  4K3N A;  4PXC A;  2GLJ A;  2ABZ A;  2OOT A;  4CDK A;  4PXE A;  5HVF A;  4OC1 A;  4MXU A;  2ZEN A;  4CPA A;  1ZLI A;  2ZEO A;  3FJU A;  2PVW A;  3B3V A;  1M4L A;  4MHZ A;  2RFH A;  3RBU A;  3IO1 A;  5CBM A;  3PBE A;  4NGS A;  4UEZ A;  3ICU A;  5THW A;  1F57 A;  3D7H A;  1IGB A;  2FVG A;  4NJR A;  4P4D A;  2WZN A;  3LWU A;  1TXR A;  3KI9 A;  4X8I A;  2ZEE A;  1TKH A;  1BLL E;  4FWU A;  1WVM A;  2JBJ A;  3B3T A;  2POK A;  1PYT B;  2PJA A;  3QNV A;  1YW6 A;  2ZEM A;  3T8W A;  1CPX A;  3H8E A;  4TWE A;  3CT9 A;  3RAM A;  1EE3 P;  3D4U A;  4EWT A;  2EWB A;  1VIX A;  3D67 A;  4OC2 A;  2Q51 A;  5ELY A;  4R7M A;  1DTD A;  5JM6 A;  3VAR A;  4MCR A;  4FUU A;  3KAS A;  4JZ0 A;  4P45 A;  3IC1 A;  4C84 A;  4P44 A;  4P4B A;  2G9D A;  3B7I A;  4ZYQ A;  3B35 A;  3PFO A;  1R43 A;  4EFD A;  5K8N A;  4MHY A;  3WT4 A;  3PEI A;  3KZW A;  3TC8 A;  3NH5 A;  1LOK A;  4MCP A;  5K8M A;  5K8O A;  3KQZ A;  4H2K A;  3SJG A;  1QQ9 A;  1DE4 C;  3IIB A;  2V8D A;  3S9M A;  4NGR A;  3S9L A;  2PIY A;  1ARL A;  2PJ4 A;  3WC5 A;  4MHP A;  2J9A A;  4OID A;  2C6C A;  2O53 A;  3FX6 A;  2PJ8 A;  1LCP A;  2NYQ A;  3D7F A;  1Y9Z A;  3H8G A;  3RZA A;  3K2K A;  4P4I A;  1Y7E A;  1XFO A;  2PJ9 A;  3NH4 A;  2NSM A;  4ZI6 A;  2IJZ A;  1KWM A;  1XF1 A;  3HLP A;  4ZY0 A;  1CG2 A;  4G1P A;  1ZLH A;  3CDX A;  3VTA A;  4C8F A;  4R76 A;  2PJ2 A;  3PB8 X;  2PJC A;  1HDQ A;  4C9V A;  2AFX A;  4DUK A;  1XRY A;  1FNO A;  4PQA A;  3DGV A;  2BCO A;  4UIB A;  3FEE A;  5LRJ A;  4WJB A;  1YSJ A;  4C9E A;  2QJ8 A;  3PB6 X;  1Z5R A;  2OR4 A;  1IY7 A;  3BI0 A;  3N5F A;  5D29 A;  3MN8 A;  4OIW A;  3VH9 A;  1UWY A;  3ISZ A;  4LQG A;  3BI1 A;  2EK8 A;  2AFU A;  3I1U A;  4R6T A;  1Q7L A;  1TKF A;  4MHN A;  1YME A;  2ZEH A;  4YU9 A;  5HVG A;  4UEE A;  4Z65 A;  1PCA A;  4C8T A;  4C99 A;  3H8F A;  2AFM A;  4C86 A;  4FAI A;  3NFZ A;  1XMB A;  4UEF A;  3IEH A;  2QVP A;  4RUH A;  1ZG7 A;  4O23 A;  2JBK A;  4ZY2 A;  2PJ5 A;  4P6Y A;  4X3R A;  2XEJ A;  3FH4 A;  4KNG E;  4IK2 A;  5I4M A;  4C9U A;  5LYI A;  2VL1 A;  3WAB A;  1R3N A;  4GM5 A;  4MCQ A;  4C9A A;  4UIA A;  3PRT A;  4EME A;  3WC7 A;  2CIJ A;  1ELL P;  5IR2 A;  2I3C A;  4W9Y A;  2PJ7 A;  5LYL A;  4FBE A;  5CPA A;  2PCU A;  2GLF A;  4OC3 A;  3KHX A;  1VHE A;  1AYE A;  1TF8 A;  1ZG9 A;  6CPA A;  3SI2 A;  5HVH A;  4UF4 A;  2PRQ A;  2F8H A;  1GYT A;  3NH8 A;  2PVV A;  2AFW A;  3PB9 X;  1VHO A;  2ZOG A;  4TJX A;  3KQX A;  4NGQ A;  3EIF A;  4TJV A;  3B3W A;  3FMC A;  5LRG A;  3PFE A;  1BPN A;  3D7D A;  3LMS A;  2Q43 A;  1HEE A;  1LAP A;  3KR4 A;  2ANP A;  2Q4Z A;  3IJ3 A;  4NGN A;  2JEW A;  2PJ1 A;  1Z2L A;  4F9V A;  4YWY A;  5JGF A;  4P4F A;  4PPZ A;  1LAN A;  3NA6 A;  2HB6 A;  7CPA A;  3B2Y A;  4C8C A;  5J1Q A;  3CPA A;  3I74 A;  1BPM A;  3JRU A;  3PB4 X;  1Y0R A;  1OBR A;  4X2T A;  1V6C A;  4C85 A;  3SI0 A;  4IAV A;  4KSI A;  4BD9 A;  4NFR A;  4OKO A;  1AMP A;  3FED A;  1CP7 A;  2AFO A;  4ZY1 A;  3SJF A;  2O4H A;  3GLJ A;  3GUX A;  2QYV A;  4OC5 A;  4NGT A;  2IMO A;  2V77 A;  4A39 A;  2AFS A;  1YW4 A;  2GP4 A;  3CPX A;  3FEC A;  4DYO A;  1VGY A;  3SJX A;  1XJO A;  2GRE A;  4ONW A;  5D8N A;  1CX8 A;  2PJ3 A;  1FT7 A;  4A37 A;  2ZOF A;  3GB0 A;  2CF4 A;  2WYR A;  4AXV A;  3SJE A;  4C8U A;  4PXB A;  2V8V A;  4OME A;  3KGQ A;  2PE3 A;  1QMU A;  4P10 A;  5K8P A;  4NJQ A;  2V8H A;  1CBX A;  4C9R A;  4NGM A;  4A94 A;  1Y0Y A;  4MMO A;  2V8G A;  3TX8 A;  3DLJ A;  3IFE A;  2AFZ A;  2C1C A;  5JH9 A;  3VAT A;  3FF3 A;  2PJ6 A;  1LAM A;  2ZEL A;  2XEI A;  2C6G A;  1TKJ A;  3B3S A;  1Z8L A;  3PBB A;  1CP6 A;  1TF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...