4NGNA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 258
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
258
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 258
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngnA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngnA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngnA02
1Y0YA 1VHOA 4NJRA 2VL1A 5JH9A 4PQAA 3RAMA 3I1UA 2ZOGA 4WJBA 4P44A 3B35A 2WZNA 2ZEOA 4ZY1A 3B3WA 4PPZA 4P4DA 4AXVA 1XMBA 4A94A 2I3CA 2V8VA 2Q43A 3PB4X 3PBEA 4X2TA 1TKJA 1HEEA 4MHYA 2CTCA 3T8WA 2CF4A 2JBKA 2PJ3A 1TXRA 4JZ0A 2AFSA 5ELYA 1KWMA 4C8CA 4EMEA 3IEHA 1CX8A 4C8PA 3CPXA 2IJZA 3KI9A 5JM6A 3B3CA 2PIYA 4FWUA 1Z2LA 2ZEMA 3B7IA 3CT9A 3I6SA 3WT4A 3D7HA 2HC9A 3D7DA 3PB8X 1M4LA 2XEIA 1LANA 1Y7EA 4Z65A 3N5FA 4MRIA 1BPMA 1TKFA 1VGYA 4OC1A 4PXEA 2FVGA 2Q4ZA 3IIBA 1BPNA 2ABZA 4NGNA 1YW4A 3S9LA 4FBEA 2C6GA 1LCPA 4YWYA 4OMEA 4IK2A 3WC7A 4X8IA 4MXUA 3HUVA 4A38A 2PJ2A 4UF4A 1Y9ZA 1Y0RA 2PVVA 2F8HA 3NH5A 4X3RA 2V77A 3KGQA 4TJVA 2BO9A 3H8GA 3PBBA 5HXDA 2ZEDA 3ICUA 1ELMP 2Q51A 1R43A 1FT7A 2PJ4A 5LRKA 3GB0A 2V8GA 1CP6A 3PFOA 1IY7A 3K2KA 4MHPA 2HB6A 4UEEA 3ISXA 3V7ZA 4TJXA 4RUHA 2EK9A 5K8PA 3RBUA 2CIJA 1AYEA 1EE3P 1F57A 1Q7LA 2XEJA 1YW6A 5F09A 4NJQA 5LYLA 2BOAA 2NSMA 1QMUA 2O4HA 4R76A 4P10A 3RZAA 5D8NA 4NGRA 4TNUA 1LFWA 4R6TA 2ZEPA 3BI1A 3D4UA 2PJ8A 1F2PA 4G1PA 4KSIA 2C6CA 3LWUA 3SJXA 3D67A 2ZEFA 4YU9A 3BHXA 4GM5A 4OC0A 4MMOA 1H8LA 4IAVA 2PCUA 1LAMA 4F9VA 4R8FA 1QQ9A 1XFOA 3KHZA 2JBJA 1XJOA 3PB7X 2PJ1A 4W9YA 2OR4A 5JGFA 5LRGA 3BXMA 1Z8LA 4O23A 4OC3A 4C9RA 5HVFA 4JYWA 1ARMA 2V8DA 4EWTA 2GU2A 2J9AA 5LYFA 2G9DA 3PB9X 3FX6A 3KQXA 1BLLE 1F2OA 5LYIA 3MN8A 3LMSA 4B6ZA 2BCOA 2DEAA 3FH4A 4FAIA 4Q7AA 4UEZA 2IMOA 3NH8A 4MCPA 1Z5RA 3QNVA 3NFZA 2O53A 4DYOA 1FNOA 2PJBA 5I4MA 7CPAA 1ZLIA 2AFXA 5HVHA 2C6PA 3IWWA 1LAPA 1DTDA 4UIBA 4DJLA 4MCRA 1ZLHA 3VTAA 1ZG7A 2PJCA 3VH9A 3FF3A 2PJ5A 4OIWA 2AFUA 1AMPA 1UWYA 3SJGA 4OP4A 2IQ6A 1CPXA 3IO1A 2OOTA 1VIXA 2F7VA 2CTBA 4H2KA 3WABA 4P4IA 4C8FA 3FEEA 5HVGA 2QYVA 4C8AA 2XEFA 2AFWA 4OC5A 3KZWA 4P4EA 3GLJA 4FUUA 4OKOA 5CPAA 4ZI6A 1OBRA 5K8NA 3S9NA 3ISZA 4NGSA 3KHXA 3FJUA 4MHZA 3I74A 3NA6A 4C8TA 1TF9A 1ZG9A 3EIFA 4WWVA 1YMEA 3B3VA 2QJ8A 2RB7A 2PE3A 2POKA 4MCSA 3GUXA 3PRTA 3SI2A 4MCQA 3KASA 4TWEA 4F8ZA 4P4FA 4C9EA 1ARLA 1BAVA 1IGBA 5D29A 2AFZA 4P6YA 2AFOA 1DE4C 3L2NA 3CPAA 3D7GA 4ZX9A 2ZEEA 3SI0A 1PYTB 4A37A 3B3TA 2GLJA 3PEIA 2ZEHA 4YN3A 2RFHA 1TKHA 3IJ3A 1YSJA 4NFRA 3HLPA 2V8HA 2PVWA 4NGPA 4C85A 3H8EA 1ELLP 3MRUA 4C9UA 5K8OA 1CPSA 2PRQA 3B3SA 4PXDA 1HDUA 3TC8A 1CBXA 2PJAA 3WC5A 2PIZA 4OC2A 4PXCA 2ANPA 4MHNA 1YLOA 3FECA 3H8FA 3CDXA 3IC1A 3JRUA 4CDKA 5LRJA 4C84A 1TF8A 1XBUA 1ZG8A 3IFEA 4C9AA 1JQGA 2PJ9A 3SI1A 2NYQA 4NGQA 1HDQA 4R7MA 3V38A 5THWA 5K8MA 3D66A 3KR4A 1CG2A 6CPAA 3FEDA 2ZEGA 4P4BA 3DGVA 1VHEA 2GREA 5LYDA 4ZY0A 3NH4A 4KNGE 2AFMA 4CPAA 4F9UA 5DS0A 2QVPA 3WC6A 4ZYQA 2ZOFA 4ZY2A 2PJ7A 4ZX8A 4CDJA 3KL9A 2GLFA 3BI0A 4ONWA 3SJEA 3KR5A 1PCAA 3K9TA 4DUKA 4OC4A 4C8UA 1V6CA 5CBMA 2EK8A 2ZELA 4IHMA 3PFEA 3VATA 3D7FA 2C1CA 1XF1A 4OIDA 3PB6X 3SJFA 3FVLA 4UIAA 4UEFA 1R3NA 1LOKA 4NGMA 2ZENA 4NGTA 1XRYA 4A39A 5IB9A 4C86A 2PJ6A 3DLJA 4P45A 1CP7A 3D68A 5J1QA 4K3NA 1RTQA 3VARA 2JEWA 4PXBA 4C9VA 3S9MA 1GYTA 3KQZA 4EFDA 3B2YA 2XEGA 4C99A 2WYRA 2EWBA 1NSAA 1WVMA 4LQGA 4P4JA 2PJ0A 8CPAA 3FMCA 4BD9A 3TX8A
chains in the Genus database with same CATH superfamily
1Y0YA 5BY0A 1VHOA 3IU2A 5AG4A 4NJRA 2VL1A 3PP9A 4C7IA 5JH9A 4PQAA 3G8WA 4KSFA 2PCNA 4L8AA 3RAMA 1KZFA 3I1UA 1XMTA 2FS5A 2ZOGA 4WJBA 4P44A 2VQYA 1Z9EA 2DPSA 3B35A 3D3SA 5I0CA 4UWIA 2WZNA 1YK3A 3CXQA 3IU1A 1L0CA 2ZEOA 4ZY1A 3BUOB 1S7FA 3B3WA 5KTAA 2D0PA 4PPZA 2FSRA 2QIRA 3R9FA 4P4DA 4AXVA 1XMBA 4A94A 4J0NA 2I3CA 2PRBA 4E2AA 2V8VA 3OAKA 4AG7A 4CAVA 5F46A 2Q43A 3PB4X 4IIXA 3PBEA 4ZBGA 4X2TA 4B14A 3CXSA 2PR8A 1TKJA 2AUMA 1HEEA 4MHYA 2CTCA 1NSLA 2CF4A 3T8WA 3TOBA 2JBKA 3PZJA 2PJ3A 1EZBA 1TXRA 4JZ0A 4R57A 2DF5A 2EVNA 2AFSA 5ELYA 3RNZA 1YVHA 1YVOA 1KWMA 2JEVA 4NCZA 3OP0A 4CS0B 3D2PA 2R1IA 4C8CA 4CGLA 5G21A 4EMEA 3IEHA 1CX8A 3TLBA 3HPGG 4C8PA 1MJ9A 1VHSA 3CPXA 4KLVA 3VRRA 3QB8A 4M6HA 2IJZA 4JLYA 3KI9A 4KZTA 4CGNA 5JM6A 3B3CA 2PIYA 4FWUA 4KUBA 1P0HA 1Z2LA 2ZEMA 3B7IA 4QBJA 3CT9A 3VRQA 3I6SA 3WT4A 4UA3A 1WJTA 3D7HA 2HC9A 4R3KA 3D7DA 4AVBA 1X12A 3PB8X 1IU8A 1M4LA 5AXIA 1EZAA 4H6UA 2XEIA 1LANA 4FD6A 4B5PA 2CY2A 2CNSA 3CZXA 4X5KA 3R95A 3C26A 1N71A 5JPHA 4CRZB 2GP4A 1Y7EA 4Z65A 4IIYA 3N5FA 4MRIA 1BPMA 1TKFA 4LQ6A 4KORA 4QVTA 4KOTA 1VGYA 4H1HA 4CAWA 1LRZA 2WPWA 4OC1A 4PXEA 2FVGA 3PGPA 2Q4ZA 4I49A 4PSXA 1YGHA 4MFZA 2REEA 4LUAA 3IIBA 1VBGA 4K30A 2FCKA 2QECA 3GIUA 1BPNA 2ABZA 1M1DA 4CRYB 4NGNA 5F1YA 4AB7A 1YW4A 2A4NA 3S9LA 3RYOA 4FBEA 2C6GA 1LCPA 3QAHA 4KOVA 5CNPA 4OMEA 4FD7A 3FIXA 3IWGA 4M85A 4YWYA 3U1BA 2DIKA 4IK2A 3WC7A 2ZXVA 4X8IA 2G0BA 4MXUA 1BXRB 3HUVA 2BSWA 4XNHB 2N3AB 2R82A 3U88C 2VZYA 4HPSA 4A38A 4Q36A 3TYXA 1QSOA 2PJ2A 2OH1A 3TLEA 1S7LA 4UF4A 1Y9ZA 1Y0RA 2Z3MA 4JVOA 4MHDA 3ZJ0A 2PVVA 3DNSA 3F0AA 4UWJA 2YJTA 2F8HA 3NH5A 5C82A 4X3RA 1R61A 2V77A 2YNCA 3KGQA 2BO9A 4TJVA 3C8OA 2I00A 5EC4A 1AUGA 3H8GA 3EZBA 3PBBA 5HXDA 2ZEDA 5DWMA 2REFA 1Z8TA 3ICUA 1ELMP 2Q51A 1ZYMA 3KRVA 3LACA 1IICA 4PV6A 1IOFA 1R43A 4OLLA 1FT7A 3EXNA 2PJ4A 1M4IA 4R9MA 3GB0A 5LRKA 2V8GA 1X10A 4A4BA 2IL4A 1V0CA 1Z4RA 2O28A 4M8DA 1CP6A 1C30B 4KOWA 3BUXB 3PFOA 1IY7A 4JWPA 3K2KA 3TLCA 4MHPA 2HB6A 4UEEA 3ISXA 2ZW6A 3V7ZA 1KEEB 4TJXA 2HUZA 3QAYA 4RUHA 4XPDB 5EMIA 3FB3A 2EK9A 1I1DA 4EYSA 5K8PA 4H89A 3RBUA 2CIJA 4H6ZA 1AYEA 1EE3P 1F57A 1Q7LA 2XEJA 4AG9A 1PUAA 5F09A 1YW6A 4NJQA 5LYLA 2BOAA 2NSMA 3BJ7A 1QMUA 2O4HA 2Z3PA 3O8ZA 4P10A 4R76A 3RZAA 3VGOA 2Z11A 5D8NA 4JXRA 2RC4A 4A95A 4NGRA 3DR6A 4HNWB 4TNUA 3PFVA 1LFWA 4NSQA 2EZAA 1CJWA 2WPXA 4MBUA 4R6TA 4B5OA 3K4IA 1KC7A 1OZPA 3BI1A 3VRPA 2ZEPA 1I21A 4CAEA 3D4UA 4CYOA 4XPLA 4PK2A 2PJ8A 1F2PA 4G1PA 4KSIA 5HKYA 1S5KA 2C6CA 2VI7A 3IGRA 3LWUA 1A9XB 3SJXA 4CZ1A 4L89A 4RN7A 3SXNA 5F48A 3T07A 3D67A 2ZEFA 4YU9A 3EC4A 4B10A 5F13A 3BHXA 4GM5A 4CGOA 4OC0A 4MMOA 4BPWB 1H8LA 4NEXA 4IAVA 2PCUA 3S6HA 3H4QA 1IB1E 3G23A 5F47A 1LAMA 4F9VA 4INJA 4ONUA 4R8FA 1XOVA 2P0WA 1QQ9A 2WUUA 2Q4YA 5H86A 1XFOA 2JLMA 2P6EA 3KKWA 5F49A 3KHZA 2JBJA 1XJOA 3BJ8A 3PB7X 4YRHA 4M3SA 4BMHA 1QSMA 2PJ1A 4W9YA 1ZO0A 2OR4A 5JGFA 3NOJA 5LRGA 3BXMA 2YGWA 1Z8LA 1U6MA 4O23A 1M44A 4OC3A 1PU9A 4CO9A 4JD6A 2Z3OA 5IR2A 1Y9WA 5HVFA 4C9RA 2FE7A 5G20A 4JYWA 1XF8A 5J8FA 1ARMA 2V8DA 1C3OB 1FY7A 1XIXA 4EWTA 4QC6A 1BO4A 2YNCC 2GU2A 1T36B 2J9AA 5G22A 5LYFA 3TLZA 3TTHA 4EVYA 2XPOA 2XPLA 2G9DA 3PB9X 3SXOA 1M6VB 3FX6A 3PT1A 2B4DB 3KQXA 4F6AA 2ZPAA 3JTKA 3OWCA 1BLLE 1F2OA 5LYIA 3MN8A 3LMSA 3P2FA 4B12A 3W91A 4HKFA 3R9GA 4YFJA 1YX0A 2P6FA 2BCOA 1GHEA 3TO9A 2DEAA 4B6ZA 5KTDA 2JDCA 1YREA 3FH4A 4FAIA 2HI6A 4Q7AA 1Q2CA 2D4PA 1JDBC 3GYAA 4UEZA 2IMOA 3NH8A 3TO6A 4MCPA 1A2ZA 1Z5RA 3QNVA 4FD4A 2B0AA 4CYNA 4CGPA 3NFZA 2O53A 4DYOA 2R7HA 2Q7BA 1FNOA 2VEZA 1JWQA 3T0TA 3F5BA 2PJBA 5I4MA 2PSWA 2HQYA 4KVOE 2DXQA 7CPAA 2EZBA 1ZLIA 2C27A 2AFXA 3SR3A 2FL4A 2C6PA 4MY3A 5HVHA 1GGOA 1IYLA 1WWZA 3IWWA 1LAPA 1DTDA 4UIBA 4DJLA 4A32A 4MCRA 3LODA 1ZLHA 3S6FA 4U5YA 1YR0A 3VTAA 4KOSA 2Q44A 3E0KA 3EO4A 1ZG7A 2B3VA 3K9UA 3WR7A 4U9ZA 1QSTA 2JDDA 2PJCA 1NE9A 1WK4A 3VH9A 2X7BA 4PK3A 4MFKA 3FF3A 3IWEA 4UFXA 3UY5A 3N7ZA 1Y7RA 2XPNA 2PJ5A 4FD5A 2AFUA 4OIWA 4ORFA 4R3LA 1AMPA 2G3TA 5J3XA 4XPDC 1UWYA 3SJGA 4OADA 4OP4A 2IQ6A 2CNMA 2ZW5A 4QUSA 4E8OA 1Q5XA 1CPXA 3IO1A 4MFPA 5HKWA 2OOTA 4AVCA 1VIXA 2F7VA 2ODFA 3F8KA 3BUWB 1KUXA 2CTBA 2FT0A 4H2KA 3WABA 4P4IA 4A31A 2FIWA 5ISVA 1ON0A 2Z0ZA 2R98A 4C8FA 4C2ZA 2VZZA 4MI4A 5JQ4A 2FM4A 4MY0A 2PR1A 3FEEA 5HVGA 2QYVA 5A27A 4CAXA 4AVAA 4C8AA 2XEFA 4BBHA 2AFWA 2PDOA 4OC5A 1IIDA 3KZWA 2B3UA 4B11A 4MJXA 3BUNB 4P4EA 3S6GA 4E94A 3W6SA 3GLJA 4KVXA 4A4CA 2OLSA 2MP0A 2UV8G 4FUUA 4OKOA 2EO8A 2YJVA 2Q7SA 2E28A 5CPAA 4ZI6A 4NF1A 1OBRA 4MJ8A 4LX9A 2Z3KA 3R1KA 5K8NA 1ZL0A 3S9NA 3ISZA 2P6GA 2Z10A 4IUSA 1VI4A 5HKZA 4NGSA 3JVNA 3TT2A 1RXTA 5JYBA 3KHXA 3FJUA 3TLAA 4MHZA 1QSNA 1S7KA 2B58A 1Q2DA 4C2YA 2OB0A 3NA6A 3I74A 1MJBA 3FNCA 2J8NA 5FVJA 1TF9A 4C8TA 1ZG9A 3EIFA 4WWVA 1YMEA 3B3VA 2QJ8A 2BUEA 2RB7A 2HV2A 2PE3A 5A28A 2POKA 2PC1A 2OZGA 4GXHA 4XPKA 4KOUA 1K4JA 4MCSA 3GUXA 1NXJA 3PRTA 2GFQA 3D2MA 3SI2A 4MCQA 5IX3A 1Z4EA 2AUNA 3KASA 3TLGB 4TWEA 4F8ZA 2B5GB 3GY9A 1UFHA 4U9YA 4P4FA 4C9EA 1ARLA 2NMTA 2YNEA 3G3SA 3RO0A 1BAVA 1IGBA 5D29A 3EY5A 3HMJG 3A9LA 4KUAA 2DPTA 5GCNA 4A30A 4M6IA 2R8VA 3HPHE 2AFZA 3T90A 4P6YA 2AFOA 4CYQA 1DE4C 2B4BA 2EUIA 4E5SA 3L2NA 3CPAA 3I9SA 4HNXB 3D7GA 4ZX9A 2ZEEA 4JXQA 1S60A 3SI0A 2VKZG 3B8GA 1PYTB 4A37A 3B3TA 2GLJA 4UFWA 3PEIA 2ZEHA 5F9MA 2D4OA 4YN3A 2HWGA 1Y9KA 2RFHA 1TKHA 2ZW4A 3IJ3A 3EZEA 1YSJA 4QB9A 1IYKA 1Q2YA 5HH1A 4NFRA 3FXTA 3HLPA 2V8HA 2PVWA 4NGPA 2B5GA 4C2XA 2CBLA 1KUYA 1QSRA 3DDDA 5H84A 3TO7A 4MFJA 4C85A 4Y49C 3H8EA 3SHPA 1ELLP 1M4DA 2AE6A 3MRUA 1NBWA 4C9UA 5K8OA 1CPSA 2PRQA 1B47A 3B3SA 2Q0YA 4PXDA 1YVKA 2DLAA 5EBVA 1HDUA 4RR2B 1B6BA 2VXKA 4HNYB 3TC8A 3P2HA 1CBXA 4F0XA 2H5MA 2PJAA 4KSAA 3WC5A 4J3GA 1I12A 4IF5A 2PIZA 4DNCA 2XPPA 4ZGYB 4OC2A 3FYNA 4PXCA 3NE8A 3S6KA 2ANPA 1YLOA 4MHNA 3FECA 4BPXB 3D8PA 3H8FA 5G1ZA 3OB1B 3CDXA 1XE4A 4COBA 5AG6A 3IC1A 2HROA 3JRUA 2ZW7A 4CDKA 5LRJA 2EZCA 1TF8A 4C84A 1XBUA 1ZG8A 3BLNA 3IFEA 4UBRA 4CGMA 3TLGA 4C9AA 1R57A 4KS9A 2Y1MA 1JQGA 3CXPA 3TLYA 5J8CA 2PJ9A 1EO0A 3SI1A 2NYQA 2FIAA 3F9KC 4NGQA 1HDQA 4R7MA 4UFVA 3T9YA 3V38A 4MFQA 5THWA 4UCNA 5K8MA 3D66A 3KR4A 1CG2A 6CPAA 3T5MA 1BOBA 3FEDA 1KBLA 3VROA 2ZEGA 4P4BA 3DGVA 1J4JA 1VHEA 2GREA 2K5TA 1RO5A 3MGDA 2G3AA 3NE7A 2J8MA 5LYDA 4F0YA 4ZY0A 4KVME 3NH4A 4II9A 5AG7A 2Z3LA 4RS2A 4KNGE 4NXYA 2AFMA 4CPAA 4F9UA 5DS0A 4A2ZA 2AJ6A 5KTCA 5F5XA 1Z8WA 1CS0B 3GKRA 2C5QA 2QVPA 3WC6A 4ZYQA 1Z9UA 2F5IA 2ZOFA 4ZY2A 2Q4VA 2PJ7A 3V8IA 2J8RA 5DWNA 4PSWA 4ZX8A 5BWAB 2GANA 4CDJA 3KL9A 2GLFA 2KCWA 3BI0A 1FBVA 4ONWA 4COGA 4Q38A 1VKCA 3SJEA 3KR5A 4KLWA 3LD2A 3BUMB 1PCAA 3K9TA 1SQHA 4DUKA 4M6GA 2B4DA 3VWDA 3TCVA 2WSAA 5C88A 1YLEA 3FBUA 5HMNA 3TE4A 1Z8XA 1YQEA 2FXFA 5JVLA 4OC4A 2Y1NA 4C68A 2I79A 5AG5A 4C7HA 4C8UA 1V6CA 5CBMA 3I3GA 2CXAA 1MK4A 2EK8A 2CNTA 2OZHA 2ZELA 4IHMA 3W6XA 2Z3NA 3PFEA 1IOIA 3VATA 4BINA 4B5PB 3D7FA 4BPUB 2C1CA 3DSBA 1XF1A 3DR8A 4OIDA 1P4NA 3SJFA 3PB6X 4A33A 5FD8A 4CAFA 4KOYA 4OAEA 3T05A 2Y0MA 3FRMA 3FVLA 4UEFA 4UIAA 4E0AA 4CYPA 2ATRA 2QMLA 1R3NA 3ZZIA 4YGOA 2EBJA 2OU2A 3R9EA 1LOKA 4NGMA 2B4JC 1NMTA 2ZENA 1MJAA 4NGTA 2GIVA 1XRYA 2PQ8A 1JDEA 4A39A 3JUWA 1ZRSA 1S3ZA 1TIQA 4GPLB 3H5ZA 4UCPA 5IB9A 1J3LA 4MFLA 1CE8B 3VRNA 4XNHC 1CM0A 4C86A 2PJ6A 3DLJA 5E96A 2VBQA 4P45A 1CP7A 3D68A 5J1QA 4K3NA 3PLFB 3OB2B 2Q04A 1RTQA 3EFAA 3NFQA 4JJXA 4R87A 4Y49B 3VARA 3TFYA 1XEBA 1VBHA 3TOAA 3EZAA 2JEWA 4PXBA 4RI1A 3S9MA 2BEIA 1DIKA 4C9VA 1GYTA 3KQZA 4MI1A 4KOXA 3ZNIA 4BTFA 1KUVA 1M4GA 4UCMA 5K99A 4EFDA 2BL1A 2YNDA 4B13A 2D0OA 3B2YA 2XEGA 4C99A 2WYRA 2OZUA 2EWBA 1S7NA 2ARHA 3VWEA 5IV0A 1NSAA 4GS4A 1WVMA 4LQGA 4P4JA 3GJZA 5IB0A 2PJ0A 8CPAA 1B87A 3FMCA 2GE3A 4BD9A 3R96A 3TX8A 2X0SA 5AGEA
chains in the Genus database with same CATH topology
1Y0YA 1VHOA 4NJRA 2VL1A 5JH9A 4PQAA 3RAMA 3I1UA 2ZOGA 4WJBA 4P44A 3B35A 2WZNA 2ZEOA 4ZY1A 3B3WA 4PPZA 4P4DA 4AXVA 1XMBA 4A94A 2I3CA 2V8VA 2Q43A 3PB4X 3PBEA 4X2TA 1TKJA 1HEEA 4MHYA 2CTCA 3T8WA 2CF4A 2JBKA 2PJ3A 1TXRA 4JZ0A 2AFSA 5ELYA 2GP4A 1KWMA 4C8CA 4EMEA 3IEHA 1CX8A 4C8PA 3CPXA 2IJZA 3KI9A 5JM6A 3B3CA 2PIYA 4FWUA 1Z2LA 2ZEMA 3B7IA 3CT9A 3I6SA 3WT4A 3D7HA 2HC9A 3D7DA 3PB8X 1M4LA 2XEIA 1LANA 1Y7EA 4Z65A 3N5FA 4MRIA 1BPMA 1TKFA 1VGYA 4OC1A 4PXEA 2FVGA 2Q4ZA 3IIBA 1BPNA 2ABZA 4NGNA 1YW4A 3S9LA 4FBEA 2C6GA 1LCPA 4YWYA 4OMEA 4IK2A 3WC7A 4X8IA 4MXUA 3HUVA 4A38A 2PJ2A 4UF4A 1Y9ZA 1Y0RA 2PVVA 2F8HA 3NH5A 4X3RA 2V77A 3KGQA 4TJVA 2BO9A 3H8GA 3PBBA 5HXDA 2ZEDA 3ICUA 1ELMP 2Q51A 1R43A 1FT7A 2PJ4A 5LRKA 3GB0A 2V8GA 1CP6A 3PFOA 1IY7A 3K2KA 4MHPA 2HB6A 4UEEA 3ISXA 3V7ZA 4TJXA 4RUHA 2EK9A 5K8PA 3RBUA 2CIJA 1AYEA 1EE3P 1F57A 1Q7LA 2XEJA 1YW6A 5F09A 4NJQA 5LYLA 2BOAA 2NSMA 1QMUA 2O4HA 4R76A 4P10A 3RZAA 5D8NA 4NGRA 4TNUA 1LFWA 4R6TA 2ZEPA 3BI1A 3D4UA 2PJ8A 1F2PA 4G1PA 4KSIA 2C6CA 3LWUA 3SJXA 3D67A 2ZEFA 4YU9A 3BHXA 4GM5A 4OC0A 4MMOA 1H8LA 4IAVA 2PCUA 1LAMA 4F9VA 4R8FA 1QQ9A 1XFOA 3KHZA 2JBJA 1XJOA 3PB7X 2PJ1A 4W9YA 2OR4A 5JGFA 5LRGA 3BXMA 1Z8LA 4O23A 4OC3A 5IR2A 4C9RA 5HVFA 4JYWA 1ARMA 2V8DA 4EWTA 2GU2A 2J9AA 5LYFA 2G9DA 3PB9X 3FX6A 3KQXA 1BLLE 1F2OA 5LYIA 3MN8A 3LMSA 4B6ZA 2BCOA 2DEAA 3FH4A 4FAIA 4Q7AA 4UEZA 2IMOA 3NH8A 4MCPA 1Z5RA 3QNVA 3NFZA 2O53A 4DYOA 1FNOA 2PJBA 5I4MA 7CPAA 1ZLIA 2AFXA 5HVHA 2C6PA 3IWWA 1LAPA 1DTDA 4UIBA 4DJLA 4MCRA 1ZLHA 3VTAA 1ZG7A 2PJCA 3VH9A 3FF3A 2PJ5A 4OIWA 2AFUA 1AMPA 1UWYA 3SJGA 4OP4A 2IQ6A 1CPXA 3IO1A 2OOTA 1VIXA 2F7VA 2CTBA 4H2KA 3WABA 4P4IA 4C8FA 3FEEA 5HVGA 2QYVA 4C8AA 2XEFA 2AFWA 4OC5A 3KZWA 4P4EA 3GLJA 4FUUA 4OKOA 5CPAA 4ZI6A 1OBRA 5K8NA 3S9NA 3ISZA 4NGSA 3KHXA 3FJUA 4MHZA 3I74A 3NA6A 4C8TA 1TF9A 1ZG9A 3EIFA 4WWVA 1YMEA 3B3VA 2QJ8A 2RB7A 2PE3A 2POKA 4MCSA 3GUXA 3PRTA 3SI2A 4MCQA 3KASA 4TWEA 4F8ZA 4P4FA 4C9EA 1ARLA 1BAVA 1IGBA 5D29A 2AFZA 4P6YA 2AFOA 1DE4C 3L2NA 3CPAA 3D7GA 4ZX9A 2ZEEA 3SI0A 1PYTB 4A37A 3B3TA 2GLJA 3PEIA 2ZEHA 4YN3A 2RFHA 1TKHA 3IJ3A 1YSJA 4NFRA 3HLPA 2V8HA 2PVWA 4NGPA 4C85A 3H8EA 1ELLP 3MRUA 4C9UA 5K8OA 1CPSA 2PRQA 3B3SA 4PXDA 1HDUA 3TC8A 1CBXA 2PJAA 3WC5A 2PIZA 4OC2A 4PXCA 2ANPA 4MHNA 1YLOA 3FECA 3H8FA 3CDXA 3IC1A 3JRUA 4CDKA 5LRJA 4C84A 1TF8A 1XBUA 1ZG8A 3IFEA 4C9AA 1JQGA 2PJ9A 3SI1A 2NYQA 4NGQA 1HDQA 4R7MA 3V38A 5THWA 5K8MA 3D66A 3KR4A 1CG2A 6CPAA 3FEDA 2ZEGA 4P4BA 3DGVA 1VHEA 2GREA 5LYDA 4ZY0A 3NH4A 4KNGE 2AFMA 4CPAA 4F9UA 5DS0A 2C5QA 2QVPA 3WC6A 4ZYQA 2ZOFA 4ZY2A 2PJ7A 4ZX8A 4CDJA 3KL9A 2GLFA 3BI0A 4ONWA 3SJEA 3KR5A 1PCAA 3K9TA 4DUKA 4OC4A 4C8UA 1V6CA 5CBMA 2EK8A 2ZELA 4IHMA 3PFEA 3VATA 3D7FA 2C1CA 1XF1A 4OIDA 3PB6X 3SJFA 3FVLA 4UIAA 4UEFA 1R3NA 1LOKA 4NGMA 2ZENA 4NGTA 1XRYA 4A39A 5IB9A 4C86A 2PJ6A 3DLJA 4P45A 1CP7A 3D68A 5J1QA 4K3NA 1RTQA 3VARA 2JEWA 4PXBA 4C9VA 3S9MA 1GYTA 3KQZA 4EFDA 3B2YA 2XEGA 4C99A 2WYRA 2EWBA 1NSAA 1WVMA 4LQGA 4P4JA 2PJ0A 8CPAA 3FMCA 4BD9A 3TX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0Y A;  1VHO A;  4NJR A;  2VL1 A;  5JH9 A;  4PQA A;  3RAM A;  3I1U A;  2ZOG A;  4WJB A;  4P44 A;  3B35 A;  2WZN A;  2ZEO A;  4ZY1 A;  3B3W A;  4PPZ A;  4P4D A;  4AXV A;  1XMB A;  4A94 A;  2I3C A;  2V8V A;  2Q43 A;  3PB4 X;  3PBE A;  4X2T A;  1TKJ A;  1HEE A;  4MHY A;  2CTC A;  3T8W A;  2CF4 A;  2JBK A;  2PJ3 A;  1TXR A;  4JZ0 A;  2AFS A;  5ELY A;  1KWM A;  4C8C A;  4EME A;  3IEH A;  1CX8 A;  4C8P A;  3CPX A;  2IJZ A;  3KI9 A;  5JM6 A;  3B3C A;  2PIY A;  4FWU A;  1Z2L A;  2ZEM A;  3B7I A;  3CT9 A;  3I6S A;  3WT4 A;  3D7H A;  2HC9 A;  3D7D A;  3PB8 X;  1M4L A;  2XEI A;  1LAN A;  1Y7E A;  4Z65 A;  3N5F A;  4MRI A;  1BPM A;  1TKF A;  1VGY A;  4OC1 A;  4PXE A;  2FVG A;  2Q4Z A;  3IIB A;  1BPN A;  2ABZ A;  4NGN A;  1YW4 A;  3S9L A;  4FBE A;  2C6G A;  1LCP A;  4YWY A;  4OME A;  4IK2 A;  3WC7 A;  4X8I A;  4MXU A;  3HUV A;  4A38 A;  2PJ2 A;  4UF4 A;  1Y9Z A;  1Y0R A;  2PVV A;  2F8H A;  3NH5 A;  4X3R A;  2V77 A;  3KGQ A;  4TJV A;  2BO9 A;  3H8G A;  3PBB A;  5HXD A;  2ZED A;  3ICU A;  1ELM P;  2Q51 A;  1R43 A;  1FT7 A;  2PJ4 A;  5LRK A;  3GB0 A;  2V8G A;  1CP6 A;  3PFO A;  1IY7 A;  3K2K A;  4MHP A;  2HB6 A;  4UEE A;  3ISX A;  3V7Z A;  4TJX A;  4RUH A;  2EK9 A;  5K8P A;  3RBU A;  2CIJ A;  1AYE A;  1EE3 P;  1F57 A;  1Q7L A;  2XEJ A;  1YW6 A;  5F09 A;  4NJQ A;  5LYL A;  2BOA A;  2NSM A;  1QMU A;  2O4H A;  4R76 A;  4P10 A;  3RZA A;  5D8N A;  4NGR A;  4TNU A;  1LFW A;  4R6T A;  2ZEP A;  3BI1 A;  3D4U A;  2PJ8 A;  1F2P A;  4G1P A;  4KSI A;  2C6C A;  3LWU A;  3SJX A;  3D67 A;  2ZEF A;  4YU9 A;  3BHX A;  4GM5 A;  4OC0 A;  4MMO A;  1H8L A;  4IAV A;  2PCU A;  1LAM A;  4F9V A;  4R8F A;  1QQ9 A;  1XFO A;  3KHZ A;  2JBJ A;  1XJO A;  3PB7 X;  2PJ1 A;  4W9Y A;  2OR4 A;  5JGF A;  5LRG A;  3BXM A;  1Z8L A;  4O23 A;  4OC3 A;  4C9R A;  5HVF A;  4JYW A;  1ARM A;  2V8D A;  4EWT A;  2GU2 A;  2J9A A;  5LYF A;  2G9D A;  3PB9 X;  3FX6 A;  3KQX A;  1BLL E;  1F2O A;  5LYI A;  3MN8 A;  3LMS A;  4B6Z A;  2BCO A;  2DEA A;  3FH4 A;  4FAI A;  4Q7A A;  4UEZ A;  2IMO A;  3NH8 A;  4MCP A;  1Z5R A;  3QNV A;  3NFZ A;  2O53 A;  4DYO A;  1FNO A;  2PJB A;  5I4M A;  7CPA A;  1ZLI A;  2AFX A;  5HVH A;  2C6P A;  3IWW A;  1LAP A;  1DTD A;  4UIB A;  4DJL A;  4MCR A;  1ZLH A;  3VTA A;  1ZG7 A;  2PJC A;  3VH9 A;  3FF3 A;  2PJ5 A;  4OIW A;  2AFU A;  1AMP A;  1UWY A;  3SJG A;  4OP4 A;  2IQ6 A;  1CPX A;  3IO1 A;  2OOT A;  1VIX A;  2F7V A;  2CTB A;  4H2K A;  3WAB A;  4P4I A;  4C8F A;  3FEE A;  5HVG A;  2QYV A;  4C8A A;  2XEF A;  2AFW A;  4OC5 A;  3KZW A;  4P4E A;  3GLJ A;  4FUU A;  4OKO A;  5CPA A;  4ZI6 A;  1OBR A;  5K8N A;  3S9N A;  3ISZ A;  4NGS A;  3KHX A;  3FJU A;  4MHZ A;  3I74 A;  3NA6 A;  4C8T A;  1TF9 A;  1ZG9 A;  3EIF A;  4WWV A;  1YME A;  3B3V A;  2QJ8 A;  2RB7 A;  2PE3 A;  2POK A;  4MCS A;  3GUX A;  3PRT A;  3SI2 A;  4MCQ A;  3KAS A;  4TWE A;  4F8Z A;  4P4F A;  4C9E A;  1ARL A;  1BAV A;  1IGB A;  5D29 A;  2AFZ A;  4P6Y A;  2AFO A;  1DE4 C;  3L2N A;  3CPA A;  3D7G A;  4ZX9 A;  2ZEE A;  3SI0 A;  1PYT B;  4A37 A;  3B3T A;  2GLJ A;  3PEI A;  2ZEH A;  4YN3 A;  2RFH A;  1TKH A;  3IJ3 A;  1YSJ A;  4NFR A;  3HLP A;  2V8H A;  2PVW A;  4NGP A;  4C85 A;  3H8E A;  1ELL P;  3MRU A;  4C9U A;  5K8O A;  1CPS A;  2PRQ A;  3B3S A;  4PXD A;  1HDU A;  3TC8 A;  1CBX A;  2PJA A;  3WC5 A;  2PIZ A;  4OC2 A;  4PXC A;  2ANP A;  4MHN A;  1YLO A;  3FEC A;  3H8F A;  3CDX A;  3IC1 A;  3JRU A;  4CDK A;  5LRJ A;  4C84 A;  1TF8 A;  1XBU A;  1ZG8 A;  3IFE A;  4C9A A;  1JQG A;  2PJ9 A;  3SI1 A;  2NYQ A;  4NGQ A;  1HDQ A;  4R7M A;  3V38 A;  5THW A;  5K8M A;  3D66 A;  3KR4 A;  1CG2 A;  6CPA A;  3FED A;  2ZEG A;  4P4B A;  3DGV A;  1VHE A;  2GRE A;  5LYD A;  4ZY0 A;  3NH4 A;  4KNG E;  2AFM A;  4CPA A;  4F9U A;  5DS0 A;  2QVP A;  3WC6 A;  4ZYQ A;  2ZOF A;  4ZY2 A;  2PJ7 A;  4ZX8 A;  4CDJ A;  3KL9 A;  2GLF A;  3BI0 A;  4ONW A;  3SJE A;  3KR5 A;  1PCA A;  3K9T A;  4DUK A;  4OC4 A;  4C8U A;  1V6C A;  5CBM A;  2EK8 A;  2ZEL A;  4IHM A;  3PFE A;  3VAT A;  3D7F A;  2C1C A;  1XF1 A;  4OID A;  3PB6 X;  3SJF A;  3FVL A;  4UIA A;  4UEF A;  1R3N A;  1LOK A;  4NGM A;  2ZEN A;  4NGT A;  1XRY A;  4A39 A;  5IB9 A;  4C86 A;  2PJ6 A;  3DLJ A;  4P45 A;  1CP7 A;  3D68 A;  5J1Q A;  4K3N A;  1RTQ A;  3VAR A;  2JEW A;  4PXB A;  4C9V A;  3S9M A;  1GYT A;  3KQZ A;  4EFD A;  3B2Y A;  2XEG A;  4C99 A;  2WYR A;  2EWB A;  1NSA A;  1WVM A;  4LQG A;  4P4J A;  2PJ0 A;  8CPA A;  3FMC A;  4BD9 A;  3TX8 A; 
#chains in the Genus database with same CATH topology
 1Y0Y A;  5BY0 A;  1VHO A;  3IU2 A;  5AG4 A;  4NJR A;  2VL1 A;  3PP9 A;  4C7I A;  5JH9 A;  4PQA A;  3G8W A;  4KSF A;  2PCN A;  4L8A A;  3RAM A;  1KZF A;  3I1U A;  1XMT A;  2FS5 A;  2ZOG A;  4WJB A;  4P44 A;  2VQY A;  1Z9E A;  2DPS A;  3B35 A;  3D3S A;  5I0C A;  4UWI A;  2WZN A;  1YK3 A;  3CXQ A;  3IU1 A;  1L0C A;  2ZEO A;  4ZY1 A;  3BUO B;  1S7F A;  3B3W A;  5KTA A;  2D0P A;  4PPZ A;  2FSR A;  2QIR A;  3R9F A;  4P4D A;  4AXV A;  1XMB A;  4A94 A;  4J0N A;  2I3C A;  2PRB A;  4E2A A;  2V8V A;  3OAK A;  4AG7 A;  4CAV A;  5F46 A;  2Q43 A;  3PB4 X;  4IIX A;  3PBE A;  4ZBG A;  4X2T A;  4B14 A;  3CXS A;  2PR8 A;  1TKJ A;  2AUM A;  1HEE A;  4MHY A;  2CTC A;  1NSL A;  2CF4 A;  3T8W A;  3TOB A;  2JBK A;  3PZJ A;  2PJ3 A;  1EZB A;  1TXR A;  4JZ0 A;  4R57 A;  2DF5 A;  2EVN A;  2AFS A;  5ELY A;  3RNZ A;  1YVH A;  1YVO A;  1KWM A;  2JEV A;  4NCZ A;  3OP0 A;  4CS0 B;  3D2P A;  2R1I A;  4C8C A;  4CGL A;  5G21 A;  4EME A;  3IEH A;  1CX8 A;  3TLB A;  3HPG G;  4C8P A;  1MJ9 A;  1VHS A;  3CPX A;  4KLV A;  3VRR A;  3QB8 A;  4M6H A;  2IJZ A;  4JLY A;  3KI9 A;  4KZT A;  4CGN A;  5JM6 A;  3B3C A;  2PIY A;  4FWU A;  4KUB A;  1P0H A;  1Z2L A;  2ZEM A;  3B7I A;  4QBJ A;  3CT9 A;  3VRQ A;  3I6S A;  3WT4 A;  4UA3 A;  1WJT A;  3D7H A;  2HC9 A;  4R3K A;  3D7D A;  4AVB A;  1X12 A;  3PB8 X;  1IU8 A;  1M4L A;  5AXI A;  1EZA A;  4H6U A;  2XEI A;  1LAN A;  4FD6 A;  4B5P A;  2CY2 A;  2CNS A;  3CZX A;  4X5K A;  3R95 A;  3C26 A;  1N71 A;  5JPH A;  4CRZ B;  2GP4 A;  1Y7E A;  4Z65 A;  4IIY A;  3N5F A;  4MRI A;  1BPM A;  1TKF A;  4LQ6 A;  4KOR A;  4QVT A;  4KOT A;  1VGY A;  4H1H A;  4CAW A;  1LRZ A;  2WPW A;  4OC1 A;  4PXE A;  2FVG A;  3PGP A;  2Q4Z A;  4I49 A;  4PSX A;  1YGH A;  4MFZ A;  2REE A;  4LUA A;  3IIB A;  1VBG A;  4K30 A;  2FCK A;  2QEC A;  3GIU A;  1BPN A;  2ABZ A;  1M1D A;  4CRY B;  4NGN A;  5F1Y A;  4AB7 A;  1YW4 A;  2A4N A;  3S9L A;  3RYO A;  4FBE A;  2C6G A;  1LCP A;  3QAH A;  4KOV A;  5CNP A;  4OME A;  4FD7 A;  3FIX A;  3IWG A;  4M85 A;  4YWY A;  3U1B A;  2DIK A;  4IK2 A;  3WC7 A;  2ZXV A;  4X8I A;  2G0B A;  4MXU A;  1BXR B;  3HUV A;  2BSW A;  4XNH B;  2N3A B;  2R82 A;  3U88 C;  2VZY A;  4HPS A;  4A38 A;  4Q36 A;  3TYX A;  1QSO A;  2PJ2 A;  2OH1 A;  3TLE A;  1S7L A;  4UF4 A;  1Y9Z A;  1Y0R A;  2Z3M A;  4JVO A;  4MHD A;  3ZJ0 A;  2PVV A;  3DNS A;  3F0A A;  4UWJ A;  2YJT A;  2F8H A;  3NH5 A;  5C82 A;  4X3R A;  1R61 A;  2V77 A;  2YNC A;  3KGQ A;  2BO9 A;  4TJV A;  3C8O A;  2I00 A;  5EC4 A;  1AUG A;  3H8G A;  3EZB A;  3PBB A;  5HXD A;  2ZED A;  5DWM A;  2REF A;  1Z8T A;  3ICU A;  1ELM P;  2Q51 A;  1ZYM A;  3KRV A;  3LAC A;  1IIC A;  4PV6 A;  1IOF A;  1R43 A;  4OLL A;  1FT7 A;  3EXN A;  2PJ4 A;  1M4I A;  4R9M A;  3GB0 A;  5LRK A;  2V8G A;  1X10 A;  4A4B A;  2IL4 A;  1V0C A;  1Z4R A;  2O28 A;  4M8D A;  1CP6 A;  1C30 B;  4KOW A;  3BUX B;  3PFO A;  1IY7 A;  4JWP A;  3K2K A;  3TLC A;  4MHP A;  2HB6 A;  4UEE A;  3ISX A;  2ZW6 A;  3V7Z A;  1KEE B;  4TJX A;  2HUZ A;  3QAY A;  4RUH A;  4XPD B;  5EMI A;  3FB3 A;  2EK9 A;  1I1D A;  4EYS A;  5K8P A;  4H89 A;  3RBU A;  2CIJ A;  4H6Z A;  1AYE A;  1EE3 P;  1F57 A;  1Q7L A;  2XEJ A;  4AG9 A;  1PUA A;  5F09 A;  1YW6 A;  4NJQ A;  5LYL A;  2BOA A;  2NSM A;  3BJ7 A;  1QMU A;  2O4H A;  2Z3P A;  3O8Z A;  4P10 A;  4R76 A;  3RZA A;  3VGO A;  2Z11 A;  5D8N A;  4JXR A;  2RC4 A;  4A95 A;  4NGR A;  3DR6 A;  4HNW B;  4TNU A;  3PFV A;  1LFW A;  4NSQ A;  2EZA A;  1CJW A;  2WPX A;  4MBU A;  4R6T A;  4B5O A;  3K4I A;  1KC7 A;  1OZP A;  3BI1 A;  3VRP A;  2ZEP A;  1I21 A;  4CAE A;  3D4U A;  4CYO A;  4XPL A;  4PK2 A;  2PJ8 A;  1F2P A;  4G1P A;  4KSI A;  5HKY A;  1S5K A;  2C6C A;  2VI7 A;  3IGR A;  3LWU A;  1A9X B;  3SJX A;  4CZ1 A;  4L89 A;  4RN7 A;  3SXN A;  5F48 A;  3T07 A;  3D67 A;  2ZEF A;  4YU9 A;  3EC4 A;  4B10 A;  5F13 A;  3BHX A;  4GM5 A;  4CGO A;  4OC0 A;  4MMO A;  4BPW B;  1H8L A;  4NEX A;  4IAV A;  2PCU A;  3S6H A;  3H4Q A;  1IB1 E;  3G23 A;  5F47 A;  1LAM A;  4F9V A;  4INJ A;  4ONU A;  4R8F A;  1XOV A;  2P0W A;  1QQ9 A;  2WUU A;  2Q4Y A;  5H86 A;  1XFO A;  2JLM A;  2P6E A;  3KKW A;  5F49 A;  3KHZ A;  2JBJ A;  1XJO A;  3BJ8 A;  3PB7 X;  4YRH A;  4M3S A;  4BMH A;  1QSM A;  2PJ1 A;  4W9Y A;  1ZO0 A;  2OR4 A;  5JGF A;  3NOJ A;  5LRG A;  3BXM A;  2YGW A;  1Z8L A;  1U6M A;  4O23 A;  1M44 A;  4OC3 A;  1PU9 A;  4CO9 A;  4JD6 A;  2Z3O A;  5IR2 A;  1Y9W A;  5HVF A;  4C9R A;  2FE7 A;  5G20 A;  4JYW A;  1XF8 A;  5J8F A;  1ARM A;  2V8D A;  1C3O B;  1FY7 A;  1XIX A;  4EWT A;  4QC6 A;  1BO4 A;  2YNC C;  2GU2 A;  1T36 B;  2J9A A;  5G22 A;  5LYF A;  3TLZ A;  3TTH A;  4EVY A;  2XPO A;  2XPL A;  2G9D A;  3PB9 X;  3SXO A;  1M6V B;  3FX6 A;  3PT1 A;  2B4D B;  3KQX A;  4F6A A;  2ZPA A;  3JTK A;  3OWC A;  1BLL E;  1F2O A;  5LYI A;  3MN8 A;  3LMS A;  3P2F A;  4B12 A;  3W91 A;  4HKF A;  3R9G A;  4YFJ A;  1YX0 A;  2P6F A;  2BCO A;  1GHE A;  3TO9 A;  2DEA A;  4B6Z A;  5KTD A;  2JDC A;  1YRE A;  3FH4 A;  4FAI A;  2HI6 A;  4Q7A A;  1Q2C A;  2D4P A;  1JDB C;  3GYA A;  4UEZ A;  2IMO A;  3NH8 A;  3TO6 A;  4MCP A;  1A2Z A;  1Z5R A;  3QNV A;  4FD4 A;  2B0A A;  4CYN A;  4CGP A;  3NFZ A;  2O53 A;  4DYO A;  2R7H A;  2Q7B A;  1FNO A;  2VEZ A;  1JWQ A;  3T0T A;  3F5B A;  2PJB A;  5I4M A;  2PSW A;  2HQY A;  4KVO E;  2DXQ A;  7CPA A;  2EZB A;  1ZLI A;  2C27 A;  2AFX A;  3SR3 A;  2FL4 A;  2C6P A;  4MY3 A;  5HVH A;  1GGO A;  1IYL A;  1WWZ A;  3IWW A;  1LAP A;  1DTD A;  4UIB A;  4DJL A;  4A32 A;  4MCR A;  3LOD A;  1ZLH A;  3S6F A;  4U5Y A;  1YR0 A;  3VTA A;  4KOS A;  2Q44 A;  3E0K A;  3EO4 A;  1ZG7 A;  2B3V A;  3K9U A;  3WR7 A;  4U9Z A;  1QST A;  2JDD A;  2PJC A;  1NE9 A;  1WK4 A;  3VH9 A;  2X7B A;  4PK3 A;  4MFK A;  3FF3 A;  3IWE A;  4UFX A;  3UY5 A;  3N7Z A;  1Y7R A;  2XPN A;  2PJ5 A;  4FD5 A;  2AFU A;  4OIW A;  4ORF A;  4R3L A;  1AMP A;  2G3T A;  5J3X A;  4XPD C;  1UWY A;  3SJG A;  4OAD A;  4OP4 A;  2IQ6 A;  2CNM A;  2ZW5 A;  4QUS A;  4E8O A;  1Q5X A;  1CPX A;  3IO1 A;  4MFP A;  5HKW A;  2OOT A;  4AVC A;  1VIX A;  2F7V A;  2ODF A;  3F8K A;  3BUW B;  1KUX A;  2CTB A;  2FT0 A;  4H2K A;  3WAB A;  4P4I A;  4A31 A;  2FIW A;  5ISV A;  1ON0 A;  2Z0Z A;  2R98 A;  4C8F A;  4C2Z A;  2VZZ A;  4MI4 A;  5JQ4 A;  2FM4 A;  4MY0 A;  2PR1 A;  3FEE A;  5HVG A;  2QYV A;  5A27 A;  4CAX A;  4AVA A;  4C8A A;  2XEF A;  4BBH A;  2AFW A;  2PDO A;  4OC5 A;  1IID A;  3KZW A;  2B3U A;  4B11 A;  4MJX A;  3BUN B;  4P4E A;  3S6G A;  4E94 A;  3W6S A;  3GLJ A;  4KVX A;  4A4C A;  2OLS A;  2MP0 A;  2UV8 G;  4FUU A;  4OKO A;  2EO8 A;  2YJV A;  2Q7S A;  2E28 A;  5CPA A;  4ZI6 A;  4NF1 A;  1OBR A;  4MJ8 A;  4LX9 A;  2Z3K A;  3R1K A;  5K8N A;  1ZL0 A;  3S9N A;  3ISZ A;  2P6G A;  2Z10 A;  4IUS A;  1VI4 A;  5HKZ A;  4NGS A;  3JVN A;  3TT2 A;  1RXT A;  5JYB A;  3KHX A;  3FJU A;  3TLA A;  4MHZ A;  1QSN A;  1S7K A;  2B58 A;  1Q2D A;  4C2Y A;  2OB0 A;  3NA6 A;  3I74 A;  1MJB A;  3FNC A;  2J8N A;  5FVJ A;  1TF9 A;  4C8T A;  1ZG9 A;  3EIF A;  4WWV A;  1YME A;  3B3V A;  2QJ8 A;  2BUE A;  2RB7 A;  2HV2 A;  2PE3 A;  5A28 A;  2POK A;  2PC1 A;  2OZG A;  4GXH A;  4XPK A;  4KOU A;  1K4J A;  4MCS A;  3GUX A;  1NXJ A;  3PRT A;  2GFQ A;  3D2M A;  3SI2 A;  4MCQ A;  5IX3 A;  1Z4E A;  2AUN A;  3KAS A;  3TLG B;  4TWE A;  4F8Z A;  2B5G B;  3GY9 A;  1UFH A;  4U9Y A;  4P4F A;  4C9E A;  1ARL A;  2NMT A;  2YNE A;  3G3S A;  3RO0 A;  1BAV A;  1IGB A;  5D29 A;  3EY5 A;  3HMJ G;  3A9L A;  4KUA A;  2DPT A;  5GCN A;  4A30 A;  4M6I A;  2R8V A;  3HPH E;  2AFZ A;  3T90 A;  4P6Y A;  2AFO A;  4CYQ A;  1DE4 C;  2B4B A;  2EUI A;  4E5S A;  3L2N A;  3CPA A;  3I9S A;  4HNX B;  3D7G A;  4ZX9 A;  2ZEE A;  4JXQ A;  1S60 A;  3SI0 A;  2VKZ G;  3B8G A;  1PYT B;  4A37 A;  3B3T A;  2GLJ A;  4UFW A;  3PEI A;  2ZEH A;  5F9M A;  2D4O A;  4YN3 A;  2HWG A;  1Y9K A;  2RFH A;  1TKH A;  2ZW4 A;  3IJ3 A;  3EZE A;  1YSJ A;  4QB9 A;  1IYK A;  1Q2Y A;  5HH1 A;  4NFR A;  3FXT A;  3HLP A;  2V8H A;  2PVW A;  4NGP A;  2B5G A;  4C2X A;  2CBL A;  1KUY A;  1QSR A;  3DDD A;  5H84 A;  3TO7 A;  4MFJ A;  4C85 A;  4Y49 C;  3H8E A;  3SHP A;  1ELL P;  1M4D A;  2AE6 A;  3MRU A;  1NBW A;  4C9U A;  5K8O A;  1CPS A;  2PRQ A;  1B47 A;  3B3S A;  2Q0Y A;  4PXD A;  1YVK A;  2DLA A;  5EBV A;  1HDU A;  4RR2 B;  1B6B A;  2VXK A;  4HNY B;  3TC8 A;  3P2H A;  1CBX A;  4F0X A;  2H5M A;  2PJA A;  4KSA A;  3WC5 A;  4J3G A;  1I12 A;  4IF5 A;  2PIZ A;  4DNC A;  2XPP A;  4ZGY B;  4OC2 A;  3FYN A;  4PXC A;  3NE8 A;  3S6K A;  2ANP A;  1YLO A;  4MHN A;  3FEC A;  4BPX B;  3D8P A;  3H8F A;  5G1Z A;  3OB1 B;  3CDX A;  1XE4 A;  4COB A;  5AG6 A;  3IC1 A;  2HRO A;  3JRU A;  2ZW7 A;  4CDK A;  5LRJ A;  2EZC A;  1TF8 A;  4C84 A;  1XBU A;  1ZG8 A;  3BLN A;  3IFE A;  4UBR A;  4CGM A;  3TLG A;  4C9A A;  1R57 A;  4KS9 A;  2Y1M A;  1JQG A;  3CXP A;  3TLY A;  5J8C A;  2PJ9 A;  1EO0 A;  3SI1 A;  2NYQ A;  2FIA A;  3F9K C;  4NGQ A;  1HDQ A;  4R7M A;  4UFV A;  3T9Y A;  3V38 A;  4MFQ A;  5THW A;  4UCN A;  5K8M A;  3D66 A;  3KR4 A;  1CG2 A;  6CPA A;  3T5M A;  1BOB A;  3FED A;  1KBL A;  3VRO A;  2ZEG A;  4P4B A;  3DGV A;  1J4J A;  1VHE A;  2GRE A;  2K5T A;  1RO5 A;  3MGD A;  2G3A A;  3NE7 A;  2J8M A;  5LYD A;  4F0Y A;  4ZY0 A;  4KVM E;  3NH4 A;  4II9 A;  5AG7 A;  2Z3L A;  4RS2 A;  4KNG E;  4NXY A;  2AFM A;  4CPA A;  4F9U A;  5DS0 A;  4A2Z A;  2AJ6 A;  5KTC A;  5F5X A;  1Z8W A;  1CS0 B;  3GKR A;  2C5Q A;  2QVP A;  3WC6 A;  4ZYQ A;  1Z9U A;  2F5I A;  2ZOF A;  4ZY2 A;  2Q4V A;  2PJ7 A;  3V8I A;  2J8R A;  5DWN A;  4PSW A;  4ZX8 A;  5BWA B;  2GAN A;  4CDJ A;  3KL9 A;  2GLF A;  2KCW A;  3BI0 A;  1FBV A;  4ONW A;  4COG A;  4Q38 A;  1VKC A;  3SJE A;  3KR5 A;  4KLW A;  3LD2 A;  3BUM B;  1PCA A;  3K9T A;  1SQH A;  4DUK A;  4M6G A;  2B4D A;  3VWD A;  3TCV A;  2WSA A;  5C88 A;  1YLE A;  3FBU A;  5HMN A;  3TE4 A;  1Z8X A;  1YQE A;  2FXF A;  5JVL A;  4OC4 A;  2Y1N A;  4C68 A;  2I79 A;  5AG5 A;  4C7H A;  4C8U A;  1V6C A;  5CBM A;  3I3G A;  2CXA A;  1MK4 A;  2EK8 A;  2CNT A;  2OZH A;  2ZEL A;  4IHM A;  3W6X A;  2Z3N A;  3PFE A;  1IOI A;  3VAT A;  4BIN A;  4B5P B;  3D7F A;  4BPU B;  2C1C A;  3DSB A;  1XF1 A;  3DR8 A;  4OID A;  1P4N A;  3SJF A;  3PB6 X;  4A33 A;  5FD8 A;  4CAF A;  4KOY A;  4OAE A;  3T05 A;  2Y0M A;  3FRM A;  3FVL A;  4UEF A;  4UIA A;  4E0A A;  4CYP A;  2ATR A;  2QML A;  1R3N A;  3ZZI A;  4YGO A;  2EBJ A;  2OU2 A;  3R9E A;  1LOK A;  4NGM A;  2B4J C;  1NMT A;  2ZEN A;  1MJA A;  4NGT A;  2GIV A;  1XRY A;  2PQ8 A;  1JDE A;  4A39 A;  3JUW A;  1ZRS A;  1S3Z A;  1TIQ A;  4GPL B;  3H5Z A;  4UCP A;  5IB9 A;  1J3L A;  4MFL A;  1CE8 B;  3VRN A;  4XNH C;  1CM0 A;  4C86 A;  2PJ6 A;  3DLJ A;  5E96 A;  2VBQ A;  4P45 A;  1CP7 A;  3D68 A;  5J1Q A;  4K3N A;  3PLF B;  3OB2 B;  2Q04 A;  1RTQ A;  3EFA A;  3NFQ A;  4JJX A;  4R87 A;  4Y49 B;  3VAR A;  3TFY A;  1XEB A;  1VBH A;  3TOA A;  3EZA A;  2JEW A;  4PXB A;  4RI1 A;  3S9M A;  2BEI A;  1DIK A;  4C9V A;  1GYT A;  3KQZ A;  4MI1 A;  4KOX A;  3ZNI A;  4BTF A;  1KUV A;  1M4G A;  4UCM A;  5K99 A;  4EFD A;  2BL1 A;  2YND A;  4B13 A;  2D0O A;  3B2Y A;  2XEG A;  4C99 A;  2WYR A;  2OZU A;  2EWB A;  1S7N A;  2ARH A;  3VWE A;  5IV0 A;  1NSA A;  4GS4 A;  1WVM A;  4LQG A;  4P4J A;  3GJZ A;  5IB0 A;  2PJ0 A;  8CPA A;  1B87 A;  3FMC A;  2GE3 A;  4BD9 A;  3R96 A;  3TX8 A;  2X0S A;  5AGE A; 
#chains in the Genus database with same CATH homology
 1Y0Y A;  1VHO A;  4NJR A;  2VL1 A;  5JH9 A;  4PQA A;  3RAM A;  3I1U A;  2ZOG A;  4WJB A;  4P44 A;  3B35 A;  2WZN A;  2ZEO A;  4ZY1 A;  3B3W A;  4PPZ A;  4P4D A;  4AXV A;  1XMB A;  4A94 A;  2I3C A;  2V8V A;  2Q43 A;  3PB4 X;  3PBE A;  4X2T A;  1TKJ A;  1HEE A;  4MHY A;  2CTC A;  3T8W A;  2CF4 A;  2JBK A;  2PJ3 A;  1TXR A;  4JZ0 A;  2AFS A;  5ELY A;  2GP4 A;  1KWM A;  4C8C A;  4EME A;  3IEH A;  1CX8 A;  4C8P A;  3CPX A;  2IJZ A;  3KI9 A;  5JM6 A;  3B3C A;  2PIY A;  4FWU A;  1Z2L A;  2ZEM A;  3B7I A;  3CT9 A;  3I6S A;  3WT4 A;  3D7H A;  2HC9 A;  3D7D A;  3PB8 X;  1M4L A;  2XEI A;  1LAN A;  1Y7E A;  4Z65 A;  3N5F A;  4MRI A;  1BPM A;  1TKF A;  1VGY A;  4OC1 A;  4PXE A;  2FVG A;  2Q4Z A;  3IIB A;  1BPN A;  2ABZ A;  4NGN A;  1YW4 A;  3S9L A;  4FBE A;  2C6G A;  1LCP A;  4YWY A;  4OME A;  4IK2 A;  3WC7 A;  4X8I A;  4MXU A;  3HUV A;  4A38 A;  2PJ2 A;  4UF4 A;  1Y9Z A;  1Y0R A;  2PVV A;  2F8H A;  3NH5 A;  4X3R A;  2V77 A;  3KGQ A;  4TJV A;  2BO9 A;  3H8G A;  3PBB A;  5HXD A;  2ZED A;  3ICU A;  1ELM P;  2Q51 A;  1R43 A;  1FT7 A;  2PJ4 A;  5LRK A;  3GB0 A;  2V8G A;  1CP6 A;  3PFO A;  1IY7 A;  3K2K A;  4MHP A;  2HB6 A;  4UEE A;  3ISX A;  3V7Z A;  4TJX A;  4RUH A;  2EK9 A;  5K8P A;  3RBU A;  2CIJ A;  1AYE A;  1EE3 P;  1F57 A;  1Q7L A;  2XEJ A;  1YW6 A;  5F09 A;  4NJQ A;  5LYL A;  2BOA A;  2NSM A;  1QMU A;  2O4H A;  4R76 A;  4P10 A;  3RZA A;  5D8N A;  4NGR A;  4TNU A;  1LFW A;  4R6T A;  2ZEP A;  3BI1 A;  3D4U A;  2PJ8 A;  1F2P A;  4G1P A;  4KSI A;  2C6C A;  3LWU A;  3SJX A;  3D67 A;  2ZEF A;  4YU9 A;  3BHX A;  4GM5 A;  4OC0 A;  4MMO A;  1H8L A;  4IAV A;  2PCU A;  1LAM A;  4F9V A;  4R8F A;  1QQ9 A;  1XFO A;  3KHZ A;  2JBJ A;  1XJO A;  3PB7 X;  2PJ1 A;  4W9Y A;  2OR4 A;  5JGF A;  5LRG A;  3BXM A;  1Z8L A;  4O23 A;  4OC3 A;  5IR2 A;  4C9R A;  5HVF A;  4JYW A;  1ARM A;  2V8D A;  4EWT A;  2GU2 A;  2J9A A;  5LYF A;  2G9D A;  3PB9 X;  3FX6 A;  3KQX A;  1BLL E;  1F2O A;  5LYI A;  3MN8 A;  3LMS A;  4B6Z A;  2BCO A;  2DEA A;  3FH4 A;  4FAI A;  4Q7A A;  4UEZ A;  2IMO A;  3NH8 A;  4MCP A;  1Z5R A;  3QNV A;  3NFZ A;  2O53 A;  4DYO A;  1FNO A;  2PJB A;  5I4M A;  7CPA A;  1ZLI A;  2AFX A;  5HVH A;  2C6P A;  3IWW A;  1LAP A;  1DTD A;  4UIB A;  4DJL A;  4MCR A;  1ZLH A;  3VTA A;  1ZG7 A;  2PJC A;  3VH9 A;  3FF3 A;  2PJ5 A;  4OIW A;  2AFU A;  1AMP A;  1UWY A;  3SJG A;  4OP4 A;  2IQ6 A;  1CPX A;  3IO1 A;  2OOT A;  1VIX A;  2F7V A;  2CTB A;  4H2K A;  3WAB A;  4P4I A;  4C8F A;  3FEE A;  5HVG A;  2QYV A;  4C8A A;  2XEF A;  2AFW A;  4OC5 A;  3KZW A;  4P4E A;  3GLJ A;  4FUU A;  4OKO A;  5CPA A;  4ZI6 A;  1OBR A;  5K8N A;  3S9N A;  3ISZ A;  4NGS A;  3KHX A;  3FJU A;  4MHZ A;  3I74 A;  3NA6 A;  4C8T A;  1TF9 A;  1ZG9 A;  3EIF A;  4WWV A;  1YME A;  3B3V A;  2QJ8 A;  2RB7 A;  2PE3 A;  2POK A;  4MCS A;  3GUX A;  3PRT A;  3SI2 A;  4MCQ A;  3KAS A;  4TWE A;  4F8Z A;  4P4F A;  4C9E A;  1ARL A;  1BAV A;  1IGB A;  5D29 A;  2AFZ A;  4P6Y A;  2AFO A;  1DE4 C;  3L2N A;  3CPA A;  3D7G A;  4ZX9 A;  2ZEE A;  3SI0 A;  1PYT B;  4A37 A;  3B3T A;  2GLJ A;  3PEI A;  2ZEH A;  4YN3 A;  2RFH A;  1TKH A;  3IJ3 A;  1YSJ A;  4NFR A;  3HLP A;  2V8H A;  2PVW A;  4NGP A;  4C85 A;  3H8E A;  1ELL P;  3MRU A;  4C9U A;  5K8O A;  1CPS A;  2PRQ A;  3B3S A;  4PXD A;  1HDU A;  3TC8 A;  1CBX A;  2PJA A;  3WC5 A;  2PIZ A;  4OC2 A;  4PXC A;  2ANP A;  4MHN A;  1YLO A;  3FEC A;  3H8F A;  3CDX A;  3IC1 A;  3JRU A;  4CDK A;  5LRJ A;  4C84 A;  1TF8 A;  1XBU A;  1ZG8 A;  3IFE A;  4C9A A;  1JQG A;  2PJ9 A;  3SI1 A;  2NYQ A;  4NGQ A;  1HDQ A;  4R7M A;  3V38 A;  5THW A;  5K8M A;  3D66 A;  3KR4 A;  1CG2 A;  6CPA A;  3FED A;  2ZEG A;  4P4B A;  3DGV A;  1VHE A;  2GRE A;  5LYD A;  4ZY0 A;  3NH4 A;  4KNG E;  2AFM A;  4CPA A;  4F9U A;  5DS0 A;  2C5Q A;  2QVP A;  3WC6 A;  4ZYQ A;  2ZOF A;  4ZY2 A;  2PJ7 A;  4ZX8 A;  4CDJ A;  3KL9 A;  2GLF A;  3BI0 A;  4ONW A;  3SJE A;  3KR5 A;  1PCA A;  3K9T A;  4DUK A;  4OC4 A;  4C8U A;  1V6C A;  5CBM A;  2EK8 A;  2ZEL A;  4IHM A;  3PFE A;  3VAT A;  3D7F A;  2C1C A;  1XF1 A;  4OID A;  3PB6 X;  3SJF A;  3FVL A;  4UIA A;  4UEF A;  1R3N A;  1LOK A;  4NGM A;  2ZEN A;  4NGT A;  1XRY A;  4A39 A;  5IB9 A;  4C86 A;  2PJ6 A;  3DLJ A;  4P45 A;  1CP7 A;  3D68 A;  5J1Q A;  4K3N A;  1RTQ A;  3VAR A;  2JEW A;  4PXB A;  4C9V A;  3S9M A;  1GYT A;  3KQZ A;  4EFD A;  3B2Y A;  2XEG A;  4C99 A;  2WYR A;  2EWB A;  1NSA A;  1WVM A;  4LQG A;  4P4J A;  2PJ0 A;  8CPA A;  3FMC A;  4BD9 A;  3TX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...