4NGNA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 258
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
258
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 258
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngnA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngnA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngnA02
2AFZA 3S9LA 1Y0YA 3D7FA 4KSIA 4C8TA 2CF4A 3HLPA 2PJ9A 2ZEFA 4NGTA 2V8GA 4JZ0A 3D4UA 4X2TA 2AFMA 4P4EA 2PJ1A 1LOKA 2ZELA 4LQGA 2NSMA 3K2KA 4NGNA 3SJXA 5HVHA 4C8FA 3I1UA 3N5FA 4C9VA 2IMOA 1VIXA 4AXVA 3PEIA 4C8PA 2ZEDA 4NGQA 4OKOA 2PIYA 3CPXA 4FUUA 2GREA 4MXUA 4MHNA 4NFRA 4TJVA 1TXRA 1CP6A 4RUHA 3PFEA 4OC3A 1QMUA 3BI0A 4GM5A 3KR4A 2QVPA 1DE4C 4ZX8A 3WT4A 2GLFA 1IY7A 3NH8A 4OP4A 1YW6A 5CPAA 2IQ6A 4UIBA 3K9TA 4C9AA 3B35A 3D66A 4FAIA 5LYLA 4A94A 4BD9A 4DJLA 3GUXA 2ZEGA 1LAPA 3B3WA 4ONWA 4W9YA 1CP7A 2QJ8A 7CPAA 4F8ZA 1GYTA 2Q4ZA 3FX6A 3SJGA 5LYIA 3PB7X 3TC8A 2ANPA 3D7HA 4FBEA 1Z8LA 4P6YA 3B7IA 3B3VA 4F9UA 3D68A 2EK8A 3WABA 4P10A 4MMOA 3FJUA 4ZY0A 2CTBA 3LWUA 2PJBA 3TX8A 4IK2A 3IC1A 2OOTA 2AFSA 2Q51A 1XJOA 3FF3A 2GU2A 3KI9A 2ZEPA 4NGSA 2HC9A 3IFEA 3LMSA 5ELYA 4R6TA 1Y0RA 3NA6A 1XF1A 1TF9A 4MHYA 1LCPA 5CBMA 3L2NA 2IJZA 3GLJA 3PBEA 1VHOA 3VTAA 2OR4A 4C99A 3WC6A 3CPAA 2V8VA 3B3SA 4OC1A 3CDXA 2CIJA 4DUKA 5K8OA 1Q7LA 2PJ6A 3IIBA 3ISZA 1XRYA 5K8MA 4OC4A 1BPNA 3PRTA 5HVGA 4A37A 3NH4A 4C85A 3WC5A 2EWBA 1LFWA 1TKJA 2BO9A 1BLLE 3B3CA 8CPAA 4ZI6A 2PCUA 1NSAA 4UEEA 1YW4A 2WYRA 2RFHA 2AFWA 5K8PA 3QNVA 1Z2LA 4P4JA 3BXMA 3FEEA 4Z65A 4P4BA 5LYDA 4MCQA 4DYOA 2C6GA 1ZG7A 3KASA 4P4DA 1KWMA 3BHXA 2CTCA 3IJ3A 5LYFA 4NJQA 4P4IA 4CPAA 2DEAA 4C84A 2AFUA 3S9MA 3IEHA 3B2YA 4WJBA 3KGQA 5J1QA 2XEFA 4P45A 1WVMA 1LANA 1R3NA 4R7MA 2GLJA 5K8NA 2ZEHA 1V6CA 2PJ5A 3D7DA 1Y7EA 5THWA 2RB7A 2JBJA 4X3RA 3KQZA 4UEZA 4F9VA 4UIAA 5D29A 2HB6A 3PB6X 3SI2A 2NYQA 3KR5A 4UF4A 4H2KA 5HXDA 5JH9A 3FECA 2JEWA 2FVGA 3S9NA 4JYWA 4UEFA 4ZY2A 3IWWA 4NGMA 1YMEA 4A39A 1YSJA 3KHXA 4C8AA 3H8GA 3VATA 2PE3A 4K3NA 6CPAA 4O23A 3EIFA 4C9UA 2VL1A 2ABZA 4C8CA 1XFOA 1EE3P 1F57A 2ZEOA 2PJ8A 4ZX9A 1LAMA 4PPZA 4TNUA 3CT9A 1FNOA 1DTDA 2V8HA 1ZLHA 2F8HA 4C86A 3V38A 3NFZA 5JM6A 4IAVA 4PXBA 1ARMA 1XBUA 4Q7AA 5LRKA 4MRIA 1ZG9A 4ZYQA 1RTQA 5LRJA 2XEJA 4OC2A 1AMPA 4X8IA 3SJFA 2C6PA 2F7VA 4ZY1A 3I74A 3H8EA 3ISXA 5F09A 4PQAA 4C8UA 4P4FA 1AYEA 2AFOA 2C6CA 2PJ2A 4OC0A 1CBXA 2PJCA 4OC5A 3VH9A 1JQGA 2WZNA 3GB0A 3D67A 2QYVA 5I4MA 3PB4X 1BAVA 4CDJA 1CPSA 1F2PA 1Y9ZA 3RBUA 3MRUA 4CDKA 2AFXA 3DLJA 4WWVA 1YLOA 3RZAA 4TJXA 4OMEA 2O53A 1HDQA 2PJAA 3WC7A 3SI0A 4PXEA 4IHMA 4TWEA 3I6SA 2PJ3A 2ZOFA 3KZWA 3V7ZA 3KQXA 1CG2A 2BCOA 3PB9X 5JGFA 1QQ9A 4PXDA 5DS0A 3NH5A 4NGPA 2J9AA 3VARA 1XMBA 1PYTB 2PVWA 1HEEA 4MHPA 3ICUA 2XEIA 3T8WA 4EFDA 2JBKA 3DGVA 1FT7A 3PB8X 3RAMA 1TKHA 1R43A 3PBBA 4R76A 1TF8A 4OIWA 4MCRA 1OBRA 1VHEA 1ELMP 1PCAA 3FVLA 1M4LA 4G1PA 4YWYA 5HVFA 3SJEA 2PIZA 2Q43A 5D8NA 2PJ0A 2V8DA 4A38A 4P44A 3FMCA 1ARLA 4KNGE 2POKA 1F2OA 2ZEMA 3B3TA 2V77A 4B6ZA 1H8LA 3H8FA 2C1CA 3D7GA 4NGRA 1IGBA 3JRUA 4EMEA 2EK9A 1CX8A 4MHZA 4OIDA 2PRQA 1Z5RA 2O4HA 2PJ4A 4C9RA 3FH4A 2ZENA 4YN3A 4R8FA 2PJ7A 3FEDA 3SI1A 1HDUA 4NJRA 3KL9A 5IB9A 1ZG8A 1UWYA 2I3CA 3IO1A 4FWUA 5LRGA 3HUVA 2BOAA 1TKFA 4EWTA 2XEGA 2G9DA 2ZOGA 4MCPA 1ELLP 1CPXA 2ZEEA 2PVVA 3KHZA 4MCSA 1VGYA 1ZLIA 3MN8A 4YU9A 1BPMA 4C9EA 3BI1A 3PFOA 4PXCA
chains in the Genus database with same CATH superfamily
4LUAA 3B8GA 2AFZA 3S9LA 1Y0YA 2AJ6A 2KCWA 3D7FA 5IR2A 1YQEA 4KSIA 4C8TA 4CGPA 1M1DA 3A9LA 2CF4A 3HLPA 2PJ9A 2ZEFA 4NGTA 2V8GA 1IIDA 4EVYA 1X10A 3TLGA 4JZ0A 1UFHA 3D4UA 4X2TA 3VRNA 2AFMA 2CY2A 2HI6A 4HNYB 2B5GA 5KTAA 4P4EA 2PJ1A 1LOKA 2ZELA 4H89A 3FRMA 3GY9A 4LQGA 4KOWA 3R96A 3BJ8A 1B6BA 2BEIA 2ZPAA 2PCNA 5HKYA 1S3ZA 2NSMA 4H6ZA 4B11A 3QB8A 4Q38A 3EFAA 1T36B 3K2KA 2EUIA 5F48A 4F6AA 3R9EA 4NGNA 4HKFA 4GXHA 4XPDC 4U9ZA 3SXOA 4E2AA 3SJXA 1YVOA 1Z9EA 3D3SA 2CNSA 4A32A 5HVHA 4C8FA 2VEZA 3I1UA 4CAWA 4NCZA 3N5FA 4AG7A 4C9VA 2IMOA 1VIXA 4AXVA 2FIWA 3PEIA 3P2FA 4NF1A 3S6HA 1VBGA 4C8PA 4RI1A 2ZEDA 4NGQA 1IU8A 4OKOA 3FBUA 5AG7A 2PIYA 3CPXA 1YLEA 2AE6A 4FUUA 2GREA 3LD2A 4MXUA 4JXQA 4MHNA 3N7ZA 4NFRA 4INJA 4TJVA 1TXRA 4E94A 1CP6A 1Y9KA 1IOFA 2B4DA 3OAKA 4KUBA 3PFEA 5AG5A 4RUHA 4C7HA 4OC3A 2C5QA 1QMUA 4C2YA 2HROA 3UY5A 4BMHA 2EZAA 3BI0A 5GCNA 2D4PA 4GM5A 1VI4A 1NMTA 2B4JC 1LRZA 2WPWA 2QVPA 3KR4A 1XE4A 5AG6A 1B87A 1DE4C 2P6FA 4R3KA 4ZX8A 3TLBA 2B3UA 3R9FA 4AB7A 3WT4A 4ZGYB 2GLFA 1IY7A 2JDDA 3NH8A 1CJWA 3KRVA 3SHPA 5C88A 4A2ZA 4OP4A 1AUGA 1YW6A 5CPAA 2IQ6A 4QVTA 3T07A 4MFPA 4UIBA 2H5MA 3K9TA 2BL1A 5F1YA 4C9AA 3B35A 3D66A 4FAIA 5LYLA 3DR6A 4A94A 4BD9A 4DJLA 3GUXA 2GIVA 2ATRA 3BUXB 2ODFA 4BINA 2ZEGA 1LAPA 2B0AA 3B3WA 4ONWA 3OP0A 4W9YA 1CP7A 2G0BA 2QJ8A 4CGMA 7CPAA 3P2HA 1GYTA 4F8ZA 4CAVA 2Q4ZA 1NXJA 1YVHA 3FX6A 3SJGA 1GHEA 2Z3LA 4KVXA 2Q04A 4B5PB 2YGWA 5LYIA 3VRRA 2J8NA 4JD6A 1J3LA 4A4BA 3PB7X 4K30A 4BPUB 4UBRA 3TC8A 2ANPA 3D7HA 2D4OA 1Z8LA 4YRHA 4MBUA 4JXRA 2Z11A 5EMIA 4FBEA 3DDDA 1IYKA 4KOVA 4P6YA 4LQ6A 4XPKA 4AVCA 4CGOA 2XPLA 2D0OA 4M3SA 3B7IA 3TLEA 1Q2YA 3B3VA 4UFVA 3D68A 2EK8A 4F9UA 3WABA 4P10A 5H84A 4EYSA 3D2PA 4KLVA 3FJUA 3G3SA 4MMOA 4HNXB 2FM4A 2Z0ZA 4KORA 2Z10A 4ZY0A 2CTBA 3LWUA 2PJBA 3S6GA 2Q7BA 3TX8A 3BLNA 1C3OB 2YJVA 3W6SA 4IK2A 4YGOA 3HMJG 4B13A 4H6UA 3IC1A 2OOTA 2AFSA 2Q51A 3TO7A 5J8CA 5F5XA 1XJOA 3FF3A 2GU2A 3KI9A 2DPSA 2ZEPA 2WSAA 4FD4A 4KS9A 4KVOE 4NGSA 4JJXA 1MJ9A 5HKZA 2HC9A 2VBQA 2PR1A 2EVNA 2B4BA 3IFEA 3LMSA 5ELYA 2ZXVA 3PZJA 4R6TA 3CXQA 5G21A 4GS4A 1Y0RA 3NA6A 1QSNA 4DNCA 1XF1A 1TF9A 1KUXA 4MHYA 2ARHA 4KOYA 1LCPA 2X7BA 5CBMA 2OU2A 3L2NA 4B10A 4UCNA 4KOSA 2IJZA 3OB2B 3GLJA 3PBEA 1VHOA 3VTAA 2OR4A 4BPXB 4MY3A 3IWGA 4C99A 3WC6A 3CPAA 2V8VA 1YGHA 3B3SA 5DWNA 4OC1A 1BOBA 1M4GA 3CDXA 2CIJA 4A30A 4DUKA 5K8OA 1Q7LA 2PJ6A 3JUWA 4LX9A 2GE3A 3IIBA 4HNWB 4R3LA 2DIKA 3ISZA 1XRYA 4R9MA 5K8MA 4OC4A 1BPNA 3PRTA 5HVGA 4KSFA 3S6KA 3NH4A 4A37A 4CGNA 4UFWA 4ONUA 4C85A 2ZW7A 2REFA 3TTHA 3WC5A 2EWBA 2F5IA 1LFWA 1TKJA 2JLMA 2N3AB 4F0XA 3TYXA 2QIRA 2Q0YA 5KTDA 2YNEA 2BO9A 2VXKA 1BLLE 3B3CA 4R87A 8CPAA 1M6VB 3H4QA 4ZI6A 2PCUA 4M6HA 2UV8G 1NSAA 3DNSA 1YR0A 1YVKA 4UEEA 4ZBGA 4UA3A 3T9YA 2EZCA 4UWJA 1YW4A 2WYRA 1BXRB 2RFHA 2AFWA 1L0CA 2I00A 3C26A 5K8PA 3QNVA 3BUNB 1Z2LA 4MFZA 4UCMA 4P4JA 3BXMA 4CAFA 3FEEA 1FY7A 1KZFA 4P4BA 1WK4A 4KLWA 4PSXA 5HKWA 3FNCA 5LYDA 4Z65A 1Q2CA 2GP4A 1SQHA 5ISVA 4MCQA 3VWDA 4Q36A 4MFLA 4DYOA 2C6GA 1ZG7A 2JEVA 3GIUA 3KASA 4BPWB 4P4DA 1KWMA 3FIXA 4KVME 3BHXA 3OB1B 2CTCA 4JLYA 4E8OA 4A4CA 3TE4A 3EZBA 3K4IA 3IJ3A 4KOTA 2HUZA 4CYPA 5LYFA 4NJQA 4P4IA 1XIXA 4CPAA 4RS2A 2DEAA 4MY0A 3TOAA 2JDCA 3IGRA 1VHSA 2AFUA 4PSWA 1BO4A 3GJZA 4IIYA 1I12A 1VBHA 4MI1A 3S9MA 1IB1E 3IEHA 3IWEA 4MJ8A 3B2YA 4WJBA 4BBHA 3KGQA 2PC1A 3ZZIA 4E0AA 1Z9UA 3VWEA 5J1QA 2XEFA 2Z3NA 4P45A 4PK2A 1WVMA 1LANA 1R3NA 4R7MA 4CAEA 2DLAA 2GLJA 5K8NA 2ZEHA 1XMTA 5HH1A 3SXNA 3WR7A 1ZRSA 4J3GA 1V6CA 2PJ5A 2AUMA 2P0WA 5F9MA 2R82A 1N71A 2FE7A 3D7DA 2FXFA 1Y7EA 4PK3A 5THWA 2RB7A 1S5KA 2JBJA 3TO6A 3HPGG 1R61A 4X3RA 3KQZA 1QSTA 4UEZA 1C30B 1M4IA 3W91A 4F9VA 4UIAA 4GPLB 4ORFA 3IU1A 1K4JA 2WUUA 1M4DA 5D29A 2HB6A 3PB6X 3SI2A 2NYQA 3KR5A 4UF4A 4NEXA 4A31A 4H2KA 1I21A 1A9XB 4COGA 1YREA 5HXDA 3FECA 2Q7SA 5JH9A 2JEWA 2FVGA 2WPXA 3S9NA 3EXNA 3K9UA 3F8KA 4C68A 4H1HA 5BWAB 4JYWA 3VRQA 2VQYA 4QBJA 5K99A 5C82A 4UEFA 2HQYA 1P4NA 5F46A 2FIAA 1CE8B 1S7NA 4ZY2A 3IU2A 3IWWA 4NGMA 2Y0MA 3HPHE 3RNZA 5JVLA 1EO0A 2HWGA 1P0HA 2R7HA 1YMEA 2Q44A 3D2MA 3RYOA 4B5OA 1GGOA 4CZ1A 4A39A 1YSJA 2FL4A 3KHXA 4C8AA 5F47A 3TOBA 2FT0A 3H8GA 3VATA 1ON0A 2BSWA 1WWZA 2PE3A 2Z3OA 4K3NA 2DXQA 4O23A 4CRYB 4CYNA 6CPAA 2VL1A 2ABZA 1IOIA 3D8PA 3EIFA 4C8CA 4CS0B 1XFOA 3T90A 1EE3P 4R57A 4M85A 5G1ZA 1F57A 4OLLA 3PT1A 4MJXA 5F13A 2VZZA 2ZEOA 1U6MA 3DSBA 2G3AA 2PJ8A 4ZX9A 4XNHB 3PLFB 2QECA 3H5ZA 1ZL0A 2MP0A 3JTKA 1LAMA 4Y49B 4PPZA 4TNUA 3CT9A 1ZYMA 1FNOA 1DTDA 2B5GB 2V8HA 2VI7A 4CGLA 1ZLHA 5FVJA 2F8HA 4NSQA 3T05A 3R1KA 4C86A 1NBWA 3V38A 3NFZA 4M6GA 1M44A 1TIQA 2FCKA 5JM6A 4IAVA 4AVBA 4PXBA 1ARMA 2XPNA 1A2ZA 1XBUA 4HPSA 4Q7AA 3EC4A 5LRKA 4MRIA 2ZW5A 5JPHA 1ZG9A 4ZYQA 2OB0A 1RTQA 1XEBA 1QSMA 2PR8A 1S60A 4IIXA 4KZTA 4FD5A 1XF8A 2XEJA 5LRJA 2DF5A 4CYOA 1CS0B 4B5PA 4OC2A 4IF5A 1AMPA 4X8IA 5A28A 2PRBA 2HV2A 4C2XA 3SJFA 2C6PA 2PDOA 4L8AA 4CRZB 2E28A 4C84A 2F7VA 1XOVA 3LACA 4ZY1A 3I74A 1B47A 1S7LA 3EY5A 4FD7A 2D0PA 3TLCA 2RC4A 3H8EA 3ISXA 3OWCA 2O28A 5F09A 4PQAA 1X12A 4C8UA 4RR2B 1YK3A 1KC7A 4P4FA 3CZXA 2CBLA 5J3XA 2C6CA 1AYEA 4OC0A 2AFOA 2B4DB 2PJ2A 3PGPA 4MFKA 1CBXA 2PJCA 4OC5A 4MFQA 5E96A 1RXTA 3VH9A 2J8MA 3R95A 3S6FA 1JQGA 3TLYA 4KOXA 2OZGA 2WZNA 3GB0A 3F5BA 3KKWA 5IX3A 3T5MA 3GKRA 4AG9A 3D67A 3BUWB 2QYVA 5I4MA 4X5KA 3GYAA 2BUEA 3PB4X 4M6IA 1BAVA 3CXPA 1CPSA 2YJTA 4CDJA 1I1DA 3TFYA 1Q2DA 3TLZA 1F2PA 5CNPA 3O8ZA 1Y9ZA 1S7FA 3RBUA 5J8FA 1V0CA 3MRUA 1YX0A 3FYNA 4CDKA 4PV6A 2AFXA 3DLJA 4WWVA 1YLOA 3E0KA 3RZAA 2C27A 4CO9A 2K5TA 4QC6A 5JQ4A 2PQ8A 5AXIA 3VROA 3ZNIA 4TJXA 5G20A 1KEEB 4B12A 5FD8A 4OMEA 4MHDA 2O53A 3VGOA 1HDQA 2PJAA 5IV0A 1Y7RA 1RO5A 2OZUA 5DWMA 3WC7A 3SI0A 2EBJA 4PXEA 4IHMA 1IICA 4M8DA 3BJ7A 3FB3A 4XNHC 2NMTA 2YNCA 5AG4A 4MI4A 4A95A 4Y49C 4TWEA 3I6SA 1R57A 3NFQA 4BTFA 3JVNA 4B14A 2I79A 2PJ3A 2P6GA 2ZOFA 2FSRA 3ZJ0A 2XPOA 3KZWA 1Z4EA 3TLAA 3V7ZA 3KQXA 2CNTA 1CG2A 2BCOA 3PB9X 5JGFA 2OZHA 4I49A 1QQ9A 5A27A 3QAYA 2OLSA 4PXDA 5DS0A 3NH5A 2YNCC 4NGPA 2J8RA 2XPPA 1QSOA 2J9AA 2R98A 3VARA 3EZEA 1XMBA 4F0YA 2OH1A 2EZBA 4A33A 1NSLA 4JVOA 3BUOB 1PYTB 2PVWA 1HEEA 4MHPA 3ICUA 2XEIA 5G22A 1FBVA 3T8WA 1Q5XA 4EFDA 2VZYA 4II9A 5EBVA 2JBKA 3F0AA 1MK4A 3DGVA 1Y9WA 1FT7A 3PB8X 3RAMA 4C2ZA 2X0SA 5KTCA 2P6EA 4NXYA 1TKHA 3FXTA 4COBA 1Z8WA 2G3TA 4OAEA 5I0CA 1R43A 3PBBA 4L89A 3SR3A 4R76A 1TF8A 1IYLA 4OIWA 1Z8XA 3U88C 2AUNA 4MCRA 1OBRA 1VHEA 4KUAA 2GANA 1ELMP 1PCAA 3FVLA 1M4LA 4G1PA 1ZO0A 4JWPA 4YWYA 5HVFA 3SJEA 1OZPA 2PIZA 1KUVA 2Q43A 2R1IA 3NE7A 2YNDA 2Z3MA 2ZW6A 5HMNA 5D8NA 2PJ0A 2V8DA 3G8WA 4RN7A 5JYBA 4A38A 2Z3PA 4P44A 3TT2A 2Q4YA 1EZAA 3VRPA 3FMCA 5F49A 5IB0A 5EC4A 1ARLA 1Z8TA 3NE8A 4KNGE 4UFXA 2POKA 1VKCA 2DPTA 2Q4VA 2R8VA 1DIKA 4C9UA 1F2OA 2ZEMA 3B3TA 3TLGB 2V77A 4UWIA 4XPDB 3V8IA 4B6ZA 1H8LA 3PP9A 3H8FA 2ZW4A 2C1CA 1MJAA 4KOUA 2Y1MA 3D7GA 4QB9A 4QUSA 2CNMA 3W6XA 4NGRA 3LODA 1IGBA 1PU9A 2PSWA 3JRUA 3QAHA 2FS5A 2EK9A 2Z3KA 3EO4A 3I3GA 3R9GA 4EMEA 1CX8A 4KSAA 4MHZA 4OADA 4OIDA 1KUYA 2PRQA 3TO9A 4YFJA 1KBLA 3F9KC 3BUMB 1CM0A 1Z5RA 2O4HA 2PJ4A 3I9SA 4IUSA 3CXSA 3TCVA 4C9RA 1EZBA 3FH4A 3MGDA 2ZENA 4YN3A 4R8FA 3T0TA 2GFQA 3DR8A 1QSRA 2PJ7A 3FEDA 4U5YA 4XPLA 3SI1A 3EZAA 4E5SA 1WJTA 1HDUA 1PUAA 4U9YA 3NOJA 2CXAA 4NJRA 1MJBA 3KL9A 5IB9A 1ZG8A 1UWYA 1S7KA 2I3CA 1NE9A 3IO1A 3RO0A 1JDEA 4FWUA 5LRGA 3HUVA 1Z4RA 1TKFA 2BOAA 2Y1NA 4EWTA 4FD6A 2XEGA 5BY0A 4C7IA 2G9DA 2ZOGA 2EO8A 4MCPA 5AGEA 1ELLP 1CPXA 2ZEEA 4AVAA 2PVVA 3PFVA 4CAXA 4J0NA 3KHZA 3G23A 1J4JA 4MFJA 4MCSA 1VGYA 1ZLIA 2IL4A 2QMLA 5H86A 2A4NA 2B3VA 2REEA 2VKZG 1JWQA 3MN8A 1BPMA 4YU9A 4CYQA 1JDBC 4C9EA 4UCPA 3U1BA 3BI1A 3PFOA 2B58A 4PXCA 3C8OA
chains in the Genus database with same CATH topology
2AFZA 3S9LA 1Y0YA 3D7FA 5IR2A 4KSIA 4C8TA 2CF4A 3HLPA 2PJ9A 2ZEFA 4NGTA 2V8GA 4JZ0A 3D4UA 4X2TA 2AFMA 4P4EA 2PJ1A 1LOKA 2ZELA 4LQGA 2NSMA 3K2KA 4NGNA 3SJXA 5HVHA 4C8FA 3I1UA 3N5FA 4C9VA 2IMOA 1VIXA 4AXVA 3PEIA 4C8PA 2ZEDA 4NGQA 4OKOA 2PIYA 3CPXA 4FUUA 2GREA 4MXUA 4MHNA 4NFRA 4TJVA 1TXRA 1CP6A 4RUHA 3PFEA 4OC3A 2C5QA 1QMUA 3BI0A 4GM5A 3KR4A 2QVPA 1DE4C 4ZX8A 3WT4A 2GLFA 1IY7A 3NH8A 4OP4A 1YW6A 5CPAA 2IQ6A 4UIBA 3K9TA 4C9AA 3B35A 3D66A 4FAIA 5LYLA 4A94A 4BD9A 4DJLA 3GUXA 2ZEGA 1LAPA 3B3WA 4ONWA 4W9YA 1CP7A 2QJ8A 7CPAA 4F8ZA 1GYTA 2Q4ZA 3FX6A 3SJGA 5LYIA 3PB7X 3TC8A 2ANPA 3D7HA 4FBEA 1Z8LA 4P6YA 3B7IA 3B3VA 4F9UA 3D68A 2EK8A 3WABA 4P10A 4MMOA 3FJUA 4ZY0A 2CTBA 3LWUA 2PJBA 3TX8A 4IK2A 3IC1A 2OOTA 2AFSA 2Q51A 1XJOA 3FF3A 2GU2A 3KI9A 2ZEPA 4NGSA 2HC9A 3IFEA 3LMSA 5ELYA 4R6TA 1Y0RA 3NA6A 1XF1A 1TF9A 4MHYA 1LCPA 5CBMA 3L2NA 2IJZA 3GLJA 3PBEA 1VHOA 3VTAA 2OR4A 4C99A 3WC6A 3CPAA 2V8VA 3B3SA 4OC1A 3CDXA 2CIJA 4DUKA 5K8OA 1Q7LA 2PJ6A 3IIBA 3ISZA 1XRYA 5K8MA 4OC4A 1BPNA 3PRTA 5HVGA 4A37A 3NH4A 4C85A 3WC5A 2EWBA 1LFWA 1TKJA 2BO9A 1BLLE 3B3CA 8CPAA 4ZI6A 2PCUA 1NSAA 4UEEA 1YW4A 2WYRA 2RFHA 2AFWA 5K8PA 3QNVA 1Z2LA 4P4JA 3BXMA 3FEEA 4Z65A 4P4BA 5LYDA 2GP4A 4MCQA 4DYOA 2C6GA 1ZG7A 3KASA 4P4DA 1KWMA 3BHXA 2CTCA 3IJ3A 5LYFA 4NJQA 4P4IA 4CPAA 2DEAA 4C84A 2AFUA 3S9MA 3IEHA 3B2YA 4WJBA 3KGQA 5J1QA 2XEFA 4P45A 1WVMA 1LANA 1R3NA 4R7MA 2GLJA 5K8NA 2ZEHA 1V6CA 2PJ5A 3D7DA 1Y7EA 5THWA 2RB7A 2JBJA 4X3RA 3KQZA 4UEZA 4F9VA 4UIAA 5D29A 2HB6A 3PB6X 3SI2A 2NYQA 3KR5A 4UF4A 4H2KA 5HXDA 5JH9A 3FECA 2JEWA 2FVGA 3S9NA 4JYWA 4UEFA 4ZY2A 3IWWA 4NGMA 1YMEA 4A39A 1YSJA 3KHXA 4C8AA 3H8GA 3VATA 2PE3A 4K3NA 6CPAA 4O23A 3EIFA 4C9UA 2VL1A 2ABZA 4C8CA 1XFOA 1EE3P 1F57A 2ZEOA 2PJ8A 4ZX9A 1LAMA 4PPZA 4TNUA 3CT9A 1FNOA 1DTDA 2V8HA 1ZLHA 2F8HA 4C86A 3V38A 3NFZA 5JM6A 4IAVA 4PXBA 1ARMA 1XBUA 4Q7AA 5LRKA 4MRIA 1ZG9A 4ZYQA 1RTQA 5LRJA 2XEJA 4OC2A 1AMPA 4X8IA 3SJFA 2C6PA 2F7VA 4ZY1A 3I74A 3H8EA 3ISXA 5F09A 4PQAA 4C8UA 4P4FA 1AYEA 2AFOA 2C6CA 2PJ2A 4OC0A 1CBXA 2PJCA 4OC5A 3VH9A 1JQGA 2WZNA 3GB0A 3D67A 2QYVA 5I4MA 3PB4X 1BAVA 4CDJA 1CPSA 1F2PA 1Y9ZA 3RBUA 3MRUA 4CDKA 2AFXA 3DLJA 4WWVA 1YLOA 3RZAA 4TJXA 4OMEA 2O53A 1HDQA 2PJAA 3WC7A 3SI0A 4PXEA 4IHMA 4TWEA 3I6SA 2PJ3A 2ZOFA 3KZWA 3V7ZA 3KQXA 1CG2A 2BCOA 3PB9X 5JGFA 1QQ9A 4PXDA 5DS0A 3NH5A 4NGPA 2J9AA 3VARA 1XMBA 1PYTB 2PVWA 1HEEA 4MHPA 3ICUA 2XEIA 3T8WA 4EFDA 2JBKA 3DGVA 1FT7A 3PB8X 3RAMA 1TKHA 1R43A 3PBBA 4R76A 1TF8A 4OIWA 4MCRA 1OBRA 1VHEA 1ELMP 1PCAA 3FVLA 1M4LA 4G1PA 4YWYA 5HVFA 3SJEA 2PIZA 2Q43A 5D8NA 2PJ0A 2V8DA 4A38A 4P44A 3FMCA 1ARLA 4KNGE 2POKA 1F2OA 2ZEMA 3B3TA 2V77A 4B6ZA 1H8LA 3H8FA 2C1CA 3D7GA 4NGRA 1IGBA 3JRUA 4EMEA 2EK9A 1CX8A 4MHZA 4OIDA 2PRQA 1Z5RA 2O4HA 2PJ4A 4C9RA 3FH4A 2ZENA 4YN3A 4R8FA 2PJ7A 3FEDA 3SI1A 1HDUA 4NJRA 3KL9A 5IB9A 1ZG8A 1UWYA 2I3CA 3IO1A 4FWUA 5LRGA 3HUVA 2BOAA 1TKFA 4EWTA 2XEGA 2G9DA 2ZOGA 4MCPA 1ELLP 1CPXA 2ZEEA 2PVVA 3KHZA 4MCSA 1VGYA 1ZLIA 3MN8A 4YU9A 1BPMA 4C9EA 3BI1A 3PFOA 4PXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFZ A;  3S9L A;  1Y0Y A;  3D7F A;  4KSI A;  4C8T A;  2CF4 A;  3HLP A;  2PJ9 A;  2ZEF A;  4NGT A;  2V8G A;  4JZ0 A;  3D4U A;  4X2T A;  2AFM A;  4P4E A;  2PJ1 A;  1LOK A;  2ZEL A;  4LQG A;  2NSM A;  3K2K A;  4NGN A;  3SJX A;  5HVH A;  4C8F A;  3I1U A;  3N5F A;  4C9V A;  2IMO A;  1VIX A;  4AXV A;  3PEI A;  4C8P A;  2ZED A;  4NGQ A;  4OKO A;  2PIY A;  3CPX A;  4FUU A;  2GRE A;  4MXU A;  4MHN A;  4NFR A;  4TJV A;  1TXR A;  1CP6 A;  4RUH A;  3PFE A;  4OC3 A;  1QMU A;  3BI0 A;  4GM5 A;  3KR4 A;  2QVP A;  1DE4 C;  4ZX8 A;  3WT4 A;  2GLF A;  1IY7 A;  3NH8 A;  4OP4 A;  1YW6 A;  5CPA A;  2IQ6 A;  4UIB A;  3K9T A;  4C9A A;  3B35 A;  3D66 A;  4FAI A;  5LYL A;  4A94 A;  4BD9 A;  4DJL A;  3GUX A;  2ZEG A;  1LAP A;  3B3W A;  4ONW A;  4W9Y A;  1CP7 A;  2QJ8 A;  7CPA A;  4F8Z A;  1GYT A;  2Q4Z A;  3FX6 A;  3SJG A;  5LYI A;  3PB7 X;  3TC8 A;  2ANP A;  3D7H A;  4FBE A;  1Z8L A;  4P6Y A;  3B7I A;  3B3V A;  4F9U A;  3D68 A;  2EK8 A;  3WAB A;  4P10 A;  4MMO A;  3FJU A;  4ZY0 A;  2CTB A;  3LWU A;  2PJB A;  3TX8 A;  4IK2 A;  3IC1 A;  2OOT A;  2AFS A;  2Q51 A;  1XJO A;  3FF3 A;  2GU2 A;  3KI9 A;  2ZEP A;  4NGS A;  2HC9 A;  3IFE A;  3LMS A;  5ELY A;  4R6T A;  1Y0R A;  3NA6 A;  1XF1 A;  1TF9 A;  4MHY A;  1LCP A;  5CBM A;  3L2N A;  2IJZ A;  3GLJ A;  3PBE A;  1VHO A;  3VTA A;  2OR4 A;  4C99 A;  3WC6 A;  3CPA A;  2V8V A;  3B3S A;  4OC1 A;  3CDX A;  2CIJ A;  4DUK A;  5K8O A;  1Q7L A;  2PJ6 A;  3IIB A;  3ISZ A;  1XRY A;  5K8M A;  4OC4 A;  1BPN A;  3PRT A;  5HVG A;  4A37 A;  3NH4 A;  4C85 A;  3WC5 A;  2EWB A;  1LFW A;  1TKJ A;  2BO9 A;  1BLL E;  3B3C A;  8CPA A;  4ZI6 A;  2PCU A;  1NSA A;  4UEE A;  1YW4 A;  2WYR A;  2RFH A;  2AFW A;  5K8P A;  3QNV A;  1Z2L A;  4P4J A;  3BXM A;  3FEE A;  4Z65 A;  4P4B A;  5LYD A;  4MCQ A;  4DYO A;  2C6G A;  1ZG7 A;  3KAS A;  4P4D A;  1KWM A;  3BHX A;  2CTC A;  3IJ3 A;  5LYF A;  4NJQ A;  4P4I A;  4CPA A;  2DEA A;  4C84 A;  2AFU A;  3S9M A;  3IEH A;  3B2Y A;  4WJB A;  3KGQ A;  5J1Q A;  2XEF A;  4P45 A;  1WVM A;  1LAN A;  1R3N A;  4R7M A;  2GLJ A;  5K8N A;  2ZEH A;  1V6C A;  2PJ5 A;  3D7D A;  1Y7E A;  5THW A;  2RB7 A;  2JBJ A;  4X3R A;  3KQZ A;  4UEZ A;  4F9V A;  4UIA A;  5D29 A;  2HB6 A;  3PB6 X;  3SI2 A;  2NYQ A;  3KR5 A;  4UF4 A;  4H2K A;  5HXD A;  5JH9 A;  3FEC A;  2JEW A;  2FVG A;  3S9N A;  4JYW A;  4UEF A;  4ZY2 A;  3IWW A;  4NGM A;  1YME A;  4A39 A;  1YSJ A;  3KHX A;  4C8A A;  3H8G A;  3VAT A;  2PE3 A;  4K3N A;  6CPA A;  4O23 A;  3EIF A;  4C9U A;  2VL1 A;  2ABZ A;  4C8C A;  1XFO A;  1EE3 P;  1F57 A;  2ZEO A;  2PJ8 A;  4ZX9 A;  1LAM A;  4PPZ A;  4TNU A;  3CT9 A;  1FNO A;  1DTD A;  2V8H A;  1ZLH A;  2F8H A;  4C86 A;  3V38 A;  3NFZ A;  5JM6 A;  4IAV A;  4PXB A;  1ARM A;  1XBU A;  4Q7A A;  5LRK A;  4MRI A;  1ZG9 A;  4ZYQ A;  1RTQ A;  5LRJ A;  2XEJ A;  4OC2 A;  1AMP A;  4X8I A;  3SJF A;  2C6P A;  2F7V A;  4ZY1 A;  3I74 A;  3H8E A;  3ISX A;  5F09 A;  4PQA A;  4C8U A;  4P4F A;  1AYE A;  2AFO A;  2C6C A;  2PJ2 A;  4OC0 A;  1CBX A;  2PJC A;  4OC5 A;  3VH9 A;  1JQG A;  2WZN A;  3GB0 A;  3D67 A;  2QYV A;  5I4M A;  3PB4 X;  1BAV A;  4CDJ A;  1CPS A;  1F2P A;  1Y9Z A;  3RBU A;  3MRU A;  4CDK A;  2AFX A;  3DLJ A;  4WWV A;  1YLO A;  3RZA A;  4TJX A;  4OME A;  2O53 A;  1HDQ A;  2PJA A;  3WC7 A;  3SI0 A;  4PXE A;  4IHM A;  4TWE A;  3I6S A;  2PJ3 A;  2ZOF A;  3KZW A;  3V7Z A;  3KQX A;  1CG2 A;  2BCO A;  3PB9 X;  5JGF A;  1QQ9 A;  4PXD A;  5DS0 A;  3NH5 A;  4NGP A;  2J9A A;  3VAR A;  1XMB A;  1PYT B;  2PVW A;  1HEE A;  4MHP A;  3ICU A;  2XEI A;  3T8W A;  4EFD A;  2JBK A;  3DGV A;  1FT7 A;  3PB8 X;  3RAM A;  1TKH A;  1R43 A;  3PBB A;  4R76 A;  1TF8 A;  4OIW A;  4MCR A;  1OBR A;  1VHE A;  1ELM P;  1PCA A;  3FVL A;  1M4L A;  4G1P A;  4YWY A;  5HVF A;  3SJE A;  2PIZ A;  2Q43 A;  5D8N A;  2PJ0 A;  2V8D A;  4A38 A;  4P44 A;  3FMC A;  1ARL A;  4KNG E;  2POK A;  1F2O A;  2ZEM A;  3B3T A;  2V77 A;  4B6Z A;  1H8L A;  3H8F A;  2C1C A;  3D7G A;  4NGR A;  1IGB A;  3JRU A;  4EME A;  2EK9 A;  1CX8 A;  4MHZ A;  4OID A;  2PRQ A;  1Z5R A;  2O4H A;  2PJ4 A;  4C9R A;  3FH4 A;  2ZEN A;  4YN3 A;  4R8F A;  2PJ7 A;  3FED A;  3SI1 A;  1HDU A;  4NJR A;  3KL9 A;  5IB9 A;  1ZG8 A;  1UWY A;  2I3C A;  3IO1 A;  4FWU A;  5LRG A;  3HUV A;  2BOA A;  1TKF A;  4EWT A;  2XEG A;  2G9D A;  2ZOG A;  4MCP A;  1ELL P;  1CPX A;  2ZEE A;  2PVV A;  3KHZ A;  4MCS A;  1VGY A;  1ZLI A;  3MN8 A;  4YU9 A;  1BPM A;  4C9E A;  3BI1 A;  3PFO A;  4PXC A; 
#chains in the Genus database with same CATH topology
 4LUA A;  3B8G A;  2AFZ A;  3S9L A;  1Y0Y A;  2AJ6 A;  2KCW A;  3D7F A;  5IR2 A;  1YQE A;  4KSI A;  4C8T A;  4CGP A;  1M1D A;  3A9L A;  2CF4 A;  3HLP A;  2PJ9 A;  2ZEF A;  4NGT A;  2V8G A;  1IID A;  4EVY A;  1X10 A;  3TLG A;  4JZ0 A;  1UFH A;  3D4U A;  4X2T A;  3VRN A;  2AFM A;  2CY2 A;  2HI6 A;  4HNY B;  2B5G A;  5KTA A;  4P4E A;  2PJ1 A;  1LOK A;  2ZEL A;  4H89 A;  3FRM A;  3GY9 A;  4LQG A;  4KOW A;  3R96 A;  3BJ8 A;  1B6B A;  2BEI A;  2ZPA A;  2PCN A;  5HKY A;  1S3Z A;  2NSM A;  4H6Z A;  4B11 A;  3QB8 A;  4Q38 A;  3EFA A;  1T36 B;  3K2K A;  2EUI A;  5F48 A;  4F6A A;  3R9E A;  4NGN A;  4HKF A;  4GXH A;  4XPD C;  4U9Z A;  3SXO A;  4E2A A;  3SJX A;  1YVO A;  1Z9E A;  3D3S A;  2CNS A;  4A32 A;  5HVH A;  4C8F A;  2VEZ A;  3I1U A;  4CAW A;  4NCZ A;  3N5F A;  4AG7 A;  4C9V A;  2IMO A;  1VIX A;  4AXV A;  2FIW A;  3PEI A;  3P2F A;  4NF1 A;  3S6H A;  1VBG A;  4C8P A;  4RI1 A;  2ZED A;  4NGQ A;  1IU8 A;  4OKO A;  3FBU A;  5AG7 A;  2PIY A;  3CPX A;  1YLE A;  2AE6 A;  4FUU A;  2GRE A;  3LD2 A;  4MXU A;  4JXQ A;  4MHN A;  3N7Z A;  4NFR A;  4INJ A;  4TJV A;  1TXR A;  4E94 A;  1CP6 A;  1Y9K A;  1IOF A;  2B4D A;  3OAK A;  4KUB A;  3PFE A;  5AG5 A;  4RUH A;  4C7H A;  4OC3 A;  2C5Q A;  1QMU A;  4C2Y A;  2HRO A;  3UY5 A;  4BMH A;  2EZA A;  3BI0 A;  5GCN A;  2D4P A;  4GM5 A;  1VI4 A;  1NMT A;  2B4J C;  1LRZ A;  2WPW A;  2QVP A;  3KR4 A;  1XE4 A;  5AG6 A;  1B87 A;  1DE4 C;  2P6F A;  4R3K A;  4ZX8 A;  3TLB A;  2B3U A;  3R9F A;  4AB7 A;  3WT4 A;  4ZGY B;  2GLF A;  1IY7 A;  2JDD A;  3NH8 A;  1CJW A;  3KRV A;  3SHP A;  5C88 A;  4A2Z A;  4OP4 A;  1AUG A;  1YW6 A;  5CPA A;  2IQ6 A;  4QVT A;  3T07 A;  4MFP A;  4UIB A;  2H5M A;  3K9T A;  2BL1 A;  5F1Y A;  4C9A A;  3B35 A;  3D66 A;  4FAI A;  5LYL A;  3DR6 A;  4A94 A;  4BD9 A;  4DJL A;  3GUX A;  2GIV A;  2ATR A;  3BUX B;  2ODF A;  4BIN A;  2ZEG A;  1LAP A;  2B0A A;  3B3W A;  4ONW A;  3OP0 A;  4W9Y A;  1CP7 A;  2G0B A;  2QJ8 A;  4CGM A;  7CPA A;  3P2H A;  1GYT A;  4F8Z A;  4CAV A;  2Q4Z A;  1NXJ A;  1YVH A;  3FX6 A;  3SJG A;  1GHE A;  2Z3L A;  4KVX A;  2Q04 A;  4B5P B;  2YGW A;  5LYI A;  3VRR A;  2J8N A;  4JD6 A;  1J3L A;  4A4B A;  3PB7 X;  4K30 A;  4BPU B;  4UBR A;  3TC8 A;  2ANP A;  3D7H A;  2D4O A;  1Z8L A;  4YRH A;  4MBU A;  4JXR A;  2Z11 A;  5EMI A;  4FBE A;  3DDD A;  1IYK A;  4KOV A;  4P6Y A;  4LQ6 A;  4XPK A;  4AVC A;  4CGO A;  2XPL A;  2D0O A;  4M3S A;  3B7I A;  3TLE A;  1Q2Y A;  3B3V A;  4UFV A;  3D68 A;  2EK8 A;  4F9U A;  3WAB A;  4P10 A;  5H84 A;  4EYS A;  3D2P A;  4KLV A;  3FJU A;  3G3S A;  4MMO A;  4HNX B;  2FM4 A;  2Z0Z A;  4KOR A;  2Z10 A;  4ZY0 A;  2CTB A;  3LWU A;  2PJB A;  3S6G A;  2Q7B A;  3TX8 A;  3BLN A;  1C3O B;  2YJV A;  3W6S A;  4IK2 A;  4YGO A;  3HMJ G;  4B13 A;  4H6U A;  3IC1 A;  2OOT A;  2AFS A;  2Q51 A;  3TO7 A;  5J8C A;  5F5X A;  1XJO A;  3FF3 A;  2GU2 A;  3KI9 A;  2DPS A;  2ZEP A;  2WSA A;  4FD4 A;  4KS9 A;  4KVO E;  4NGS A;  4JJX A;  1MJ9 A;  5HKZ A;  2HC9 A;  2VBQ A;  2PR1 A;  2EVN A;  2B4B A;  3IFE A;  3LMS A;  5ELY A;  2ZXV A;  3PZJ A;  4R6T A;  3CXQ A;  5G21 A;  4GS4 A;  1Y0R A;  3NA6 A;  1QSN A;  4DNC A;  1XF1 A;  1TF9 A;  1KUX A;  4MHY A;  2ARH A;  4KOY A;  1LCP A;  2X7B A;  5CBM A;  2OU2 A;  3L2N A;  4B10 A;  4UCN A;  4KOS A;  2IJZ A;  3OB2 B;  3GLJ A;  3PBE A;  1VHO A;  3VTA A;  2OR4 A;  4BPX B;  4MY3 A;  3IWG A;  4C99 A;  3WC6 A;  3CPA A;  2V8V A;  1YGH A;  3B3S A;  5DWN A;  4OC1 A;  1BOB A;  1M4G A;  3CDX A;  2CIJ A;  4A30 A;  4DUK A;  5K8O A;  1Q7L A;  2PJ6 A;  3JUW A;  4LX9 A;  2GE3 A;  3IIB A;  4HNW B;  4R3L A;  2DIK A;  3ISZ A;  1XRY A;  4R9M A;  5K8M A;  4OC4 A;  1BPN A;  3PRT A;  5HVG A;  4KSF A;  3S6K A;  3NH4 A;  4A37 A;  4CGN A;  4UFW A;  4ONU A;  4C85 A;  2ZW7 A;  2REF A;  3TTH A;  3WC5 A;  2EWB A;  2F5I A;  1LFW A;  1TKJ A;  2JLM A;  2N3A B;  4F0X A;  3TYX A;  2QIR A;  2Q0Y A;  5KTD A;  2YNE A;  2BO9 A;  2VXK A;  1BLL E;  3B3C A;  4R87 A;  8CPA A;  1M6V B;  3H4Q A;  4ZI6 A;  2PCU A;  4M6H A;  2UV8 G;  1NSA A;  3DNS A;  1YR0 A;  1YVK A;  4UEE A;  4ZBG A;  4UA3 A;  3T9Y A;  2EZC A;  4UWJ A;  1YW4 A;  2WYR A;  1BXR B;  2RFH A;  2AFW A;  1L0C A;  2I00 A;  3C26 A;  5K8P A;  3QNV A;  3BUN B;  1Z2L A;  4MFZ A;  4UCM A;  4P4J A;  3BXM A;  4CAF A;  3FEE A;  1FY7 A;  1KZF A;  4P4B A;  1WK4 A;  4KLW A;  4PSX A;  5HKW A;  3FNC A;  5LYD A;  4Z65 A;  1Q2C A;  2GP4 A;  1SQH A;  5ISV A;  4MCQ A;  3VWD A;  4Q36 A;  4MFL A;  4DYO A;  2C6G A;  1ZG7 A;  2JEV A;  3GIU A;  3KAS A;  4BPW B;  4P4D A;  1KWM A;  3FIX A;  4KVM E;  3BHX A;  3OB1 B;  2CTC A;  4JLY A;  4E8O A;  4A4C A;  3TE4 A;  3EZB A;  3K4I A;  3IJ3 A;  4KOT A;  2HUZ A;  4CYP A;  5LYF A;  4NJQ A;  4P4I A;  1XIX A;  4CPA A;  4RS2 A;  2DEA A;  4MY0 A;  3TOA A;  2JDC A;  3IGR A;  1VHS A;  2AFU A;  4PSW A;  1BO4 A;  3GJZ A;  4IIY A;  1I12 A;  1VBH A;  4MI1 A;  3S9M A;  1IB1 E;  3IEH A;  3IWE A;  4MJ8 A;  3B2Y A;  4WJB A;  4BBH A;  3KGQ A;  2PC1 A;  3ZZI A;  4E0A A;  1Z9U A;  3VWE A;  5J1Q A;  2XEF A;  2Z3N A;  4P45 A;  4PK2 A;  1WVM A;  1LAN A;  1R3N A;  4R7M A;  4CAE A;  2DLA A;  2GLJ A;  5K8N A;  2ZEH A;  1XMT A;  5HH1 A;  3SXN A;  3WR7 A;  1ZRS A;  4J3G A;  1V6C A;  2PJ5 A;  2AUM A;  2P0W A;  5F9M A;  2R82 A;  1N71 A;  2FE7 A;  3D7D A;  2FXF A;  1Y7E A;  4PK3 A;  5THW A;  2RB7 A;  1S5K A;  2JBJ A;  3TO6 A;  3HPG G;  1R61 A;  4X3R A;  3KQZ A;  1QST A;  4UEZ A;  1C30 B;  1M4I A;  3W91 A;  4F9V A;  4UIA A;  4GPL B;  4ORF A;  3IU1 A;  1K4J A;  2WUU A;  1M4D A;  5D29 A;  2HB6 A;  3PB6 X;  3SI2 A;  2NYQ A;  3KR5 A;  4UF4 A;  4NEX A;  4A31 A;  4H2K A;  1I21 A;  1A9X B;  4COG A;  1YRE A;  5HXD A;  3FEC A;  2Q7S A;  5JH9 A;  2JEW A;  2FVG A;  2WPX A;  3S9N A;  3EXN A;  3K9U A;  3F8K A;  4C68 A;  4H1H A;  5BWA B;  4JYW A;  3VRQ A;  2VQY A;  4QBJ A;  5K99 A;  5C82 A;  4UEF A;  2HQY A;  1P4N A;  5F46 A;  2FIA A;  1CE8 B;  1S7N A;  4ZY2 A;  3IU2 A;  3IWW A;  4NGM A;  2Y0M A;  3HPH E;  3RNZ A;  5JVL A;  1EO0 A;  2HWG A;  1P0H A;  2R7H A;  1YME A;  2Q44 A;  3D2M A;  3RYO A;  4B5O A;  1GGO A;  4CZ1 A;  4A39 A;  1YSJ A;  2FL4 A;  3KHX A;  4C8A A;  5F47 A;  3TOB A;  2FT0 A;  3H8G A;  3VAT A;  1ON0 A;  2BSW A;  1WWZ A;  2PE3 A;  2Z3O A;  4K3N A;  2DXQ A;  4O23 A;  4CRY B;  4CYN A;  6CPA A;  2VL1 A;  2ABZ A;  1IOI A;  3D8P A;  3EIF A;  4C8C A;  4CS0 B;  1XFO A;  3T90 A;  1EE3 P;  4R57 A;  4M85 A;  5G1Z A;  1F57 A;  4OLL A;  3PT1 A;  4MJX A;  5F13 A;  2VZZ A;  2ZEO A;  1U6M A;  3DSB A;  2G3A A;  2PJ8 A;  4ZX9 A;  4XNH B;  3PLF B;  2QEC A;  3H5Z A;  1ZL0 A;  2MP0 A;  3JTK A;  1LAM A;  4Y49 B;  4PPZ A;  4TNU A;  3CT9 A;  1ZYM A;  1FNO A;  1DTD A;  2B5G B;  2V8H A;  2VI7 A;  4CGL A;  1ZLH A;  5FVJ A;  2F8H A;  4NSQ A;  3T05 A;  3R1K A;  4C86 A;  1NBW A;  3V38 A;  3NFZ A;  4M6G A;  1M44 A;  1TIQ A;  2FCK A;  5JM6 A;  4IAV A;  4AVB A;  4PXB A;  1ARM A;  2XPN A;  1A2Z A;  1XBU A;  4HPS A;  4Q7A A;  3EC4 A;  5LRK A;  4MRI A;  2ZW5 A;  5JPH A;  1ZG9 A;  4ZYQ A;  2OB0 A;  1RTQ A;  1XEB A;  1QSM A;  2PR8 A;  1S60 A;  4IIX A;  4KZT A;  4FD5 A;  1XF8 A;  2XEJ A;  5LRJ A;  2DF5 A;  4CYO A;  1CS0 B;  4B5P A;  4OC2 A;  4IF5 A;  1AMP A;  4X8I A;  5A28 A;  2PRB A;  2HV2 A;  4C2X A;  3SJF A;  2C6P A;  2PDO A;  4L8A A;  4CRZ B;  2E28 A;  4C84 A;  2F7V A;  1XOV A;  3LAC A;  4ZY1 A;  3I74 A;  1B47 A;  1S7L A;  3EY5 A;  4FD7 A;  2D0P A;  3TLC A;  2RC4 A;  3H8E A;  3ISX A;  3OWC A;  2O28 A;  5F09 A;  4PQA A;  1X12 A;  4C8U A;  4RR2 B;  1YK3 A;  1KC7 A;  4P4F A;  3CZX A;  2CBL A;  5J3X A;  2C6C A;  1AYE A;  4OC0 A;  2AFO A;  2B4D B;  2PJ2 A;  3PGP A;  4MFK A;  1CBX A;  2PJC A;  4OC5 A;  4MFQ A;  5E96 A;  1RXT A;  3VH9 A;  2J8M A;  3R95 A;  3S6F A;  1JQG A;  3TLY A;  4KOX A;  2OZG A;  2WZN A;  3GB0 A;  3F5B A;  3KKW A;  5IX3 A;  3T5M A;  3GKR A;  4AG9 A;  3D67 A;  3BUW B;  2QYV A;  5I4M A;  4X5K A;  3GYA A;  2BUE A;  3PB4 X;  4M6I A;  1BAV A;  3CXP A;  1CPS A;  2YJT A;  4CDJ A;  1I1D A;  3TFY A;  1Q2D A;  3TLZ A;  1F2P A;  5CNP A;  3O8Z A;  1Y9Z A;  1S7F A;  3RBU A;  5J8F A;  1V0C A;  3MRU A;  1YX0 A;  3FYN A;  4CDK A;  4PV6 A;  2AFX A;  3DLJ A;  4WWV A;  1YLO A;  3E0K A;  3RZA A;  2C27 A;  4CO9 A;  2K5T A;  4QC6 A;  5JQ4 A;  2PQ8 A;  5AXI A;  3VRO A;  3ZNI A;  4TJX A;  5G20 A;  1KEE B;  4B12 A;  5FD8 A;  4OME A;  4MHD A;  2O53 A;  3VGO A;  1HDQ A;  2PJA A;  5IV0 A;  1Y7R A;  1RO5 A;  2OZU A;  5DWM A;  3WC7 A;  3SI0 A;  2EBJ A;  4PXE A;  4IHM A;  1IIC A;  4M8D A;  3BJ7 A;  3FB3 A;  4XNH C;  2NMT A;  2YNC A;  5AG4 A;  4MI4 A;  4A95 A;  4Y49 C;  4TWE A;  3I6S A;  1R57 A;  3NFQ A;  4BTF A;  3JVN A;  4B14 A;  2I79 A;  2PJ3 A;  2P6G A;  2ZOF A;  2FSR A;  3ZJ0 A;  2XPO A;  3KZW A;  1Z4E A;  3TLA A;  3V7Z A;  3KQX A;  2CNT A;  1CG2 A;  2BCO A;  3PB9 X;  5JGF A;  2OZH A;  4I49 A;  1QQ9 A;  5A27 A;  3QAY A;  2OLS A;  4PXD A;  5DS0 A;  3NH5 A;  2YNC C;  4NGP A;  2J8R A;  2XPP A;  1QSO A;  2J9A A;  2R98 A;  3VAR A;  3EZE A;  1XMB A;  4F0Y A;  2OH1 A;  2EZB A;  4A33 A;  1NSL A;  4JVO A;  3BUO B;  1PYT B;  2PVW A;  1HEE A;  4MHP A;  3ICU A;  2XEI A;  5G22 A;  1FBV A;  3T8W A;  1Q5X A;  4EFD A;  2VZY A;  4II9 A;  5EBV A;  2JBK A;  3F0A A;  1MK4 A;  3DGV A;  1Y9W A;  1FT7 A;  3PB8 X;  3RAM A;  4C2Z A;  2X0S A;  5KTC A;  2P6E A;  4NXY A;  1TKH A;  3FXT A;  4COB A;  1Z8W A;  2G3T A;  4OAE A;  5I0C A;  1R43 A;  3PBB A;  4L89 A;  3SR3 A;  4R76 A;  1TF8 A;  1IYL A;  4OIW A;  1Z8X A;  3U88 C;  2AUN A;  4MCR A;  1OBR A;  1VHE A;  4KUA A;  2GAN A;  1ELM P;  1PCA A;  3FVL A;  1M4L A;  4G1P A;  1ZO0 A;  4JWP A;  4YWY A;  5HVF A;  3SJE A;  1OZP A;  2PIZ A;  1KUV A;  2Q43 A;  2R1I A;  3NE7 A;  2YND A;  2Z3M A;  2ZW6 A;  5HMN A;  5D8N A;  2PJ0 A;  2V8D A;  3G8W A;  4RN7 A;  5JYB A;  4A38 A;  2Z3P A;  4P44 A;  3TT2 A;  2Q4Y A;  1EZA A;  3VRP A;  3FMC A;  5F49 A;  5IB0 A;  5EC4 A;  1ARL A;  1Z8T A;  3NE8 A;  4KNG E;  4UFX A;  2POK A;  1VKC A;  2DPT A;  2Q4V A;  2R8V A;  1DIK A;  4C9U A;  1F2O A;  2ZEM A;  3B3T A;  3TLG B;  2V77 A;  4UWI A;  4XPD B;  3V8I A;  4B6Z A;  1H8L A;  3PP9 A;  3H8F A;  2ZW4 A;  2C1C A;  1MJA A;  4KOU A;  2Y1M A;  3D7G A;  4QB9 A;  4QUS A;  2CNM A;  3W6X A;  4NGR A;  3LOD A;  1IGB A;  1PU9 A;  2PSW A;  3JRU A;  3QAH A;  2FS5 A;  2EK9 A;  2Z3K A;  3EO4 A;  3I3G A;  3R9G A;  4EME A;  1CX8 A;  4KSA A;  4MHZ A;  4OAD A;  4OID A;  1KUY A;  2PRQ A;  3TO9 A;  4YFJ A;  1KBL A;  3F9K C;  3BUM B;  1CM0 A;  1Z5R A;  2O4H A;  2PJ4 A;  3I9S A;  4IUS A;  3CXS A;  3TCV A;  4C9R A;  1EZB A;  3FH4 A;  3MGD A;  2ZEN A;  4YN3 A;  4R8F A;  3T0T A;  2GFQ A;  3DR8 A;  1QSR A;  2PJ7 A;  3FED A;  4U5Y A;  4XPL A;  3SI1 A;  3EZA A;  4E5S A;  1WJT A;  1HDU A;  1PUA A;  4U9Y A;  3NOJ A;  2CXA A;  4NJR A;  1MJB A;  3KL9 A;  5IB9 A;  1ZG8 A;  1UWY A;  1S7K A;  2I3C A;  1NE9 A;  3IO1 A;  3RO0 A;  1JDE A;  4FWU A;  5LRG A;  3HUV A;  1Z4R A;  1TKF A;  2BOA A;  2Y1N A;  4EWT A;  4FD6 A;  2XEG A;  5BY0 A;  4C7I A;  2G9D A;  2ZOG A;  2EO8 A;  4MCP A;  5AGE A;  1ELL P;  1CPX A;  2ZEE A;  4AVA A;  2PVV A;  3PFV A;  4CAX A;  4J0N A;  3KHZ A;  3G23 A;  1J4J A;  4MFJ A;  4MCS A;  1VGY A;  1ZLI A;  2IL4 A;  2QML A;  5H86 A;  2A4N A;  2B3V A;  2REE A;  2VKZ G;  1JWQ A;  3MN8 A;  1BPM A;  4YU9 A;  4CYQ A;  1JDB C;  4C9E A;  4UCP A;  3U1B A;  3BI1 A;  3PFO A;  2B58 A;  4PXC A;  3C8O A; 
#chains in the Genus database with same CATH homology
 2AFZ A;  3S9L A;  1Y0Y A;  3D7F A;  5IR2 A;  4KSI A;  4C8T A;  2CF4 A;  3HLP A;  2PJ9 A;  2ZEF A;  4NGT A;  2V8G A;  4JZ0 A;  3D4U A;  4X2T A;  2AFM A;  4P4E A;  2PJ1 A;  1LOK A;  2ZEL A;  4LQG A;  2NSM A;  3K2K A;  4NGN A;  3SJX A;  5HVH A;  4C8F A;  3I1U A;  3N5F A;  4C9V A;  2IMO A;  1VIX A;  4AXV A;  3PEI A;  4C8P A;  2ZED A;  4NGQ A;  4OKO A;  2PIY A;  3CPX A;  4FUU A;  2GRE A;  4MXU A;  4MHN A;  4NFR A;  4TJV A;  1TXR A;  1CP6 A;  4RUH A;  3PFE A;  4OC3 A;  2C5Q A;  1QMU A;  3BI0 A;  4GM5 A;  3KR4 A;  2QVP A;  1DE4 C;  4ZX8 A;  3WT4 A;  2GLF A;  1IY7 A;  3NH8 A;  4OP4 A;  1YW6 A;  5CPA A;  2IQ6 A;  4UIB A;  3K9T A;  4C9A A;  3B35 A;  3D66 A;  4FAI A;  5LYL A;  4A94 A;  4BD9 A;  4DJL A;  3GUX A;  2ZEG A;  1LAP A;  3B3W A;  4ONW A;  4W9Y A;  1CP7 A;  2QJ8 A;  7CPA A;  4F8Z A;  1GYT A;  2Q4Z A;  3FX6 A;  3SJG A;  5LYI A;  3PB7 X;  3TC8 A;  2ANP A;  3D7H A;  4FBE A;  1Z8L A;  4P6Y A;  3B7I A;  3B3V A;  4F9U A;  3D68 A;  2EK8 A;  3WAB A;  4P10 A;  4MMO A;  3FJU A;  4ZY0 A;  2CTB A;  3LWU A;  2PJB A;  3TX8 A;  4IK2 A;  3IC1 A;  2OOT A;  2AFS A;  2Q51 A;  1XJO A;  3FF3 A;  2GU2 A;  3KI9 A;  2ZEP A;  4NGS A;  2HC9 A;  3IFE A;  3LMS A;  5ELY A;  4R6T A;  1Y0R A;  3NA6 A;  1XF1 A;  1TF9 A;  4MHY A;  1LCP A;  5CBM A;  3L2N A;  2IJZ A;  3GLJ A;  3PBE A;  1VHO A;  3VTA A;  2OR4 A;  4C99 A;  3WC6 A;  3CPA A;  2V8V A;  3B3S A;  4OC1 A;  3CDX A;  2CIJ A;  4DUK A;  5K8O A;  1Q7L A;  2PJ6 A;  3IIB A;  3ISZ A;  1XRY A;  5K8M A;  4OC4 A;  1BPN A;  3PRT A;  5HVG A;  4A37 A;  3NH4 A;  4C85 A;  3WC5 A;  2EWB A;  1LFW A;  1TKJ A;  2BO9 A;  1BLL E;  3B3C A;  8CPA A;  4ZI6 A;  2PCU A;  1NSA A;  4UEE A;  1YW4 A;  2WYR A;  2RFH A;  2AFW A;  5K8P A;  3QNV A;  1Z2L A;  4P4J A;  3BXM A;  3FEE A;  4Z65 A;  4P4B A;  5LYD A;  2GP4 A;  4MCQ A;  4DYO A;  2C6G A;  1ZG7 A;  3KAS A;  4P4D A;  1KWM A;  3BHX A;  2CTC A;  3IJ3 A;  5LYF A;  4NJQ A;  4P4I A;  4CPA A;  2DEA A;  4C84 A;  2AFU A;  3S9M A;  3IEH A;  3B2Y A;  4WJB A;  3KGQ A;  5J1Q A;  2XEF A;  4P45 A;  1WVM A;  1LAN A;  1R3N A;  4R7M A;  2GLJ A;  5K8N A;  2ZEH A;  1V6C A;  2PJ5 A;  3D7D A;  1Y7E A;  5THW A;  2RB7 A;  2JBJ A;  4X3R A;  3KQZ A;  4UEZ A;  4F9V A;  4UIA A;  5D29 A;  2HB6 A;  3PB6 X;  3SI2 A;  2NYQ A;  3KR5 A;  4UF4 A;  4H2K A;  5HXD A;  5JH9 A;  3FEC A;  2JEW A;  2FVG A;  3S9N A;  4JYW A;  4UEF A;  4ZY2 A;  3IWW A;  4NGM A;  1YME A;  4A39 A;  1YSJ A;  3KHX A;  4C8A A;  3H8G A;  3VAT A;  2PE3 A;  4K3N A;  6CPA A;  4O23 A;  3EIF A;  4C9U A;  2VL1 A;  2ABZ A;  4C8C A;  1XFO A;  1EE3 P;  1F57 A;  2ZEO A;  2PJ8 A;  4ZX9 A;  1LAM A;  4PPZ A;  4TNU A;  3CT9 A;  1FNO A;  1DTD A;  2V8H A;  1ZLH A;  2F8H A;  4C86 A;  3V38 A;  3NFZ A;  5JM6 A;  4IAV A;  4PXB A;  1ARM A;  1XBU A;  4Q7A A;  5LRK A;  4MRI A;  1ZG9 A;  4ZYQ A;  1RTQ A;  5LRJ A;  2XEJ A;  4OC2 A;  1AMP A;  4X8I A;  3SJF A;  2C6P A;  2F7V A;  4ZY1 A;  3I74 A;  3H8E A;  3ISX A;  5F09 A;  4PQA A;  4C8U A;  4P4F A;  1AYE A;  2AFO A;  2C6C A;  2PJ2 A;  4OC0 A;  1CBX A;  2PJC A;  4OC5 A;  3VH9 A;  1JQG A;  2WZN A;  3GB0 A;  3D67 A;  2QYV A;  5I4M A;  3PB4 X;  1BAV A;  4CDJ A;  1CPS A;  1F2P A;  1Y9Z A;  3RBU A;  3MRU A;  4CDK A;  2AFX A;  3DLJ A;  4WWV A;  1YLO A;  3RZA A;  4TJX A;  4OME A;  2O53 A;  1HDQ A;  2PJA A;  3WC7 A;  3SI0 A;  4PXE A;  4IHM A;  4TWE A;  3I6S A;  2PJ3 A;  2ZOF A;  3KZW A;  3V7Z A;  3KQX A;  1CG2 A;  2BCO A;  3PB9 X;  5JGF A;  1QQ9 A;  4PXD A;  5DS0 A;  3NH5 A;  4NGP A;  2J9A A;  3VAR A;  1XMB A;  1PYT B;  2PVW A;  1HEE A;  4MHP A;  3ICU A;  2XEI A;  3T8W A;  4EFD A;  2JBK A;  3DGV A;  1FT7 A;  3PB8 X;  3RAM A;  1TKH A;  1R43 A;  3PBB A;  4R76 A;  1TF8 A;  4OIW A;  4MCR A;  1OBR A;  1VHE A;  1ELM P;  1PCA A;  3FVL A;  1M4L A;  4G1P A;  4YWY A;  5HVF A;  3SJE A;  2PIZ A;  2Q43 A;  5D8N A;  2PJ0 A;  2V8D A;  4A38 A;  4P44 A;  3FMC A;  1ARL A;  4KNG E;  2POK A;  1F2O A;  2ZEM A;  3B3T A;  2V77 A;  4B6Z A;  1H8L A;  3H8F A;  2C1C A;  3D7G A;  4NGR A;  1IGB A;  3JRU A;  4EME A;  2EK9 A;  1CX8 A;  4MHZ A;  4OID A;  2PRQ A;  1Z5R A;  2O4H A;  2PJ4 A;  4C9R A;  3FH4 A;  2ZEN A;  4YN3 A;  4R8F A;  2PJ7 A;  3FED A;  3SI1 A;  1HDU A;  4NJR A;  3KL9 A;  5IB9 A;  1ZG8 A;  1UWY A;  2I3C A;  3IO1 A;  4FWU A;  5LRG A;  3HUV A;  2BOA A;  1TKF A;  4EWT A;  2XEG A;  2G9D A;  2ZOG A;  4MCP A;  1ELL P;  1CPX A;  2ZEE A;  2PVV A;  3KHZ A;  4MCS A;  1VGY A;  1ZLI A;  3MN8 A;  4YU9 A;  1BPM A;  4C9E A;  3BI1 A;  3PFO A;  4PXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...