4NGNA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 258
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
258
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
total genus 258
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngnA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngnA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngnA02
3BXMA 4F8ZA 4C9RA 1ELLP 2QJ8A 4CPAA 4A39A 2ZELA 4C8TA 4DJLA 4NGRA 1Z2LA 5LRKA 1LOKA 1PCAA 1Q7LA 3SJXA 3K9TA 2C1CA 4PXEA 1RTQA 4MCQA 4JYWA 4FAIA 1XFOA 2AFWA 1LANA 2PJ3A 4R6TA 5LRJA 8CPAA 3BHXA 1VHOA 3CPXA 5HVFA 1CPSA 2PIZA 3DGVA 1FT7A 2POKA 2CIJA 4ZX9A 2PRQA 1CBXA 2AFMA 2QVPA 1M4LA 3QNVA 3BI0A 1IY7A 4NJQA 4ZY1A 3D66A 2BO9A 4MHNA 2XEFA 4C8CA 3L2NA 1TKJA 4P4DA 4P4IA 4K3NA 4YWYA 4NFRA 1ZLIA 1EE3P 2Q43A 5D8NA 1Y9ZA 5LRGA 4UF4A 5I4MA 2PJ9A 4EWTA 3FX6A 3GLJA 3ISXA 3EIFA 4PXDA 4GM5A 4DYOA 5HXDA 3KR4A 3SJFA 4IAVA 3BI1A 3FEEA 3FJUA 1XBUA 1BPMA 2PJBA 3PB9X 3CPAA 5JGFA 5J1QA 1HDQA 2WYRA 4MHYA 5JM6A 4NGTA 2PJ5A 1H8LA 4AXVA 2PJCA 3KR5A 4H2KA 2F7VA 4KSIA 2DEAA 2Q51A 1NSAA 3NH5A 3IWWA 1ZG8A 3WC6A 2PVVA 4R7MA 1CPXA 3KGQA 2JBJA 2OOTA 4X3RA 1PYTB 2RFHA 5HVHA 1JQGA 5ELYA 4MHZA 4WJBA 2AFSA 2WZNA 4OMEA 1CG2A 3B7IA 3PRTA 1GYTA 2HB6A 4MCRA 2AFZA 3H8GA 4MCPA 4NJRA 2PJ2A 2NYQA 1F2PA 4YN3A 3KHXA 2PJ1A 3D67A 2EK9A 1Y0YA 3RZAA 5LYIA 3T8WA 2PJAA 4FUUA 3CDXA 2ZEFA 4RUHA 1CX8A 5CBMA 5LYLA 3DLJA 3TX8A 2BOAA 2ZOGA 2J9AA 5K8NA 5DS0A 4FBEA 4OIWA 3FEDA 4X8IA 5IB9A 1BPNA 3B3SA 2G9DA 3HLPA 1XMBA 1ARLA 2PJ4A 2O53A 4ZYQA 1XRYA 7CPAA 3B3WA 3WABA 3SJEA 2VL1A 2V77A 4UIBA 2GU2A 1XF1A 4C8PA 3PB8X 3B3CA 4C8FA 2O4HA 3B3VA 2GLJA 2ZEDA 2ZENA 3NA6A 4P4JA 1DE4C 3GB0A 4ZX8A 2C6PA 2AFUA 3SI2A 3SI0A 4JZ0A 3KQZA 1KWMA 4OC4A 4KNGE 1Y0RA 3FVLA 5JH9A 4UIAA 3LMSA 4A38A 3MN8A 3LWUA 2I3CA 4OIDA 3SI1A 2EK8A 3NH8A 1ZLHA 1TKFA 1OBRA 4NGSA 3I6SA 4PXCA 4OC1A 3IO1A 1HEEA 4ONWA 1DTDA 4IHMA 1F2OA 4P45A 3NFZA 3IJ3A 3IEHA 3D7HA 4IK2A 4WWVA 2QYVA 1Z8LA 2ABZA 1ARMA 3FMCA 3PEIA 4G1PA 4P44A 4CDJA 4P6YA 1AYEA 5K8OA 2FVGA 2XEGA 4O23A 4R8FA 4C9AA 4C9UA 2ZEGA 3KQXA 3PBEA 3PFEA 4EFDA 3B35A 3S9NA 4C8AA 4W9YA 1LCPA 3VTAA 1LFWA 3KL9A 2ZEPA 2AFXA 3PB4X 3KASA 3ICUA 2PJ0A 3VARA 5F09A 4NGNA 4BD9A 2AFOA 4C9EA 1TKHA 1Z5RA 3N5FA 4P4BA 4NGQA 3GUXA 4TJXA 4NGMA 1R43A 1CP6A 3S9LA 2ANPA 3RAMA 1HDUA 4F9UA 3ISZA 4TWEA 3SJGA 4DUKA 2BCOA 1UWYA 4MCSA 3CT9A 1ZG7A 3D68A 1IGBA 2EWBA 4YU9A 4MMOA 4OKOA 3NH4A 1YW6A 2ZEHA 3WC5A 4ZI6A 5THWA 4C9VA 1VHEA 2GLFA 4B6ZA 2NSMA 4C86A 4A94A 3FF3A 2V8GA 2PJ7A 5K8MA 3IC1A 4OC2A 4A37A 5HVGA 2JEWA 4C99A 4P4FA 4LQGA 1ELMP 4UEZA 4X2TA 1F57A 4C8UA 2GREA 4ZY2A 3V38A 1BAVA 3B3TA 2PJ8A 4Q7AA 1CP7A 2PIYA 1YMEA 1TXRA 4C84A 1YLOA 4CDKA 2CF4A 2ZEOA 3PB6X 1LAPA 2ZEMA 3K2KA 5LYDA 3WC7A 1XJOA 1TF9A 2V8DA 3RBUA 4OC0A 1YW4A 3D7FA 3I74A 4EMEA 1QQ9A 2RB7A 4OP4A 3KHZA 1ZG9A 3IIBA 2ZEEA 3D7GA 2OR4A 1AMPA 3S9MA 2V8VA 2PVWA 2Q4ZA 4ZY0A 3D4UA 4MHPA 5CPAA 5K8PA 4P10A 2XEIA 2F8HA 3MRUA 1Y7EA 3PB7X 4PXBA 3WT4A 2CTBA 3FECA 1WVMA 2CTCA 1V6CA 3D7DA 1QMUA 2PCUA 3VH9A 3KI9A 2C6CA 4TJVA 1VIXA 2HC9A 3V7ZA 4TNUA 4C85A 2XEJA 3PFOA 4OC5A 2IQ6A 2PE3A 1FNOA 1VGYA 4FWUA 4UEFA 1BLLE 1TF8A 2PJ6A 3B2YA 2C6GA 2ZOFA 3I1UA 1YSJA 3JRUA 3H8FA 4MRIA 3PBBA 6CPAA 5LYFA 4OC3A 3KZWA 4F9VA 3H8EA 1R3NA 4NGPA 3HUVA 4PPZA 4PQAA 3TC8A 4MXUA 2V8HA 4R76A 3FH4A 4UEEA 5D29A 3IFEA 2IMOA 2JBKA 4Z65A 2IJZA 4P4EA 3VATA 1LAMA
chains in the Genus database with same CATH superfamily
3BXMA 4F8ZA 4C9RA 1ELLP 2F5IA 2QJ8A 2WUUA 3JVNA 4CYNA 4M6GA 4CPAA 3P2HA 4YGOA 3NE8A 5HKZA 4A39A 2Z3MA 2ZELA 3VRRA 4A30A 4B11A 4C8TA 3T90A 1ZO0A 4IIXA 3R95A 2J8MA 4DJLA 4NGRA 1Z2LA 1Z9UA 5LRKA 4B10A 2OZUA 1LOKA 1PCAA 3EO4A 3W6XA 4AXVA 2FL4A 1KEEB 5J3XA 1Q7LA 2O28A 3SJXA 2Y0MA 4NF1A 3K9TA 4B5PA 2R8VA 4MFLA 2C1CA 4PXEA 1RTQA 3VRPA 1CS0B 1DIKA 4H6UA 1KUVA 4UFXA 1ZRSA 5F1YA 2FT0A 4MCQA 2UV8G 4FD6A 4JYWA 4FAIA 1KC7A 2P0WA 1QSMA 5I0CA 1XFOA 2AFWA 1LANA 2PJ3A 3JTKA 3R1KA 4GXHA 4K30A 4JXQA 4R6TA 4UWIA 5LRJA 5J8FA 3BHXA 1VHOA 3CPXA 5HVFA 1CPSA 3F8KA 4E0AA 2OZHA 2PIZA 3DGVA 5AG6A 4UCMA 4YFJA 1FT7A 2POKA 2CIJA 1Q2DA 4ZX9A 2PRQA 1CBXA 2AFMA 3F9KC 4CGPA 2I79A 2YNDA 4BINA 4CYQA 2QVPA 3IU2A 5G21A 1M4LA 2J8NA 5DWMA 3A9LA 3QNVA 2HI6A 2JEVA 3BI0A 1IY7A 2OU2A 2R98A 2J8RA 4NJQA 4ZY1A 3D66A 1Y7RA 2BO9A 2Z3PA 4MHNA 4UFVA 3TE4A 2XEFA 2EZBA 4C8CA 5AG4A 3L2NA 4R3LA 5JPHA 1TKJA 4P4DA 4P4IA 5HKYA 4H89A 4K3NA 4YWYA 4NFRA 2JLMA 1ZLIA 4DNCA 1EE3P 4E2AA 3GJZA 2Q43A 5D8NA 1Y9ZA 5LRGA 3VWEA 4UF4A 3R96A 4CGNA 5I4MA 2OH1A 2PJ9A 4EWTA 5IX3A 4XPLA 2EO8A 2R82A 3K9UA 3FX6A 3GLJA 3ISXA 1ON0A 3TCVA 3EIFA 4PXDA 4GM5A 4DYOA 4JVOA 4MFKA 5HXDA 3KR4A 3SJFA 4IAVA 3JUWA 4HKFA 3BI1A 4KORA 3FEEA 3FJUA 4A2ZA 4UA3A 3KRVA 3BJ7A 2FIWA 3IWEA 2CBLA 1IB1E 1XBUA 3TO7A 5F5XA 1BPMA 2FE7A 2YGWA 4UWJA 2PJBA 3PB9X 5AG5A 3C8OA 4EYSA 3TLZA 3B8GA 3CPAA 1FBVA 4QBJA 4PSWA 3BUXB 3EC4A 5JGFA 3LODA 4XPDC 5J1QA 1WWZA 4KOWA 3SXNA 4CO9A 1HDQA 2WYRA 4MHYA 5JM6A 3QAYA 5AGEA 1GHEA 1YVKA 4NGTA 3K4IA 2G3TA 1XF8A 2CNMA 2PJ5A 1H8LA 3NFQA 2REFA 4KVME 4R57A 4UFWA 2PJCA 1OZPA 3KR5A 4H2KA 5F48A 2OZGA 3OAKA 2F7VA 4C7IA 1M6VB 3NOJA 2PR8A 2FIAA 3FNCA 2DF5A 2DEAA 3GYAA 4KSIA 5IB0A 2Q51A 2G3AA 4CAXA 3U1BA 4C2XA 1NSAA 1LRZA 3NH5A 3HPHE 3IWWA 4CRYB 1VKCA 3E0KA 4KS9A 4MJXA 4E8OA 1YVHA 2XPPA 4HNXB 2B5GA 1B87A 1R57A 4I49A 3TLGA 4PSXA 1ZG8A 3PZJA 3WC6A 3CZXA 2C5QA 1P0HA 1Z8WA 2QECA 2PVVA 1J4JA 1CPXA 4NCZA 4R7MA 3KGQA 4ZGYB 2JBJA 2OOTA 3D8PA 3FIXA 4BBHA 2BL1A 5H84A 4X3RA 4JJXA 4GS4A 1PYTB 4ORFA 2RFHA 5HVHA 1JQGA 4RS2A 2ZW7A 1CM0A 5ELYA 1QSTA 3F5BA 4MHZA 4AG7A 3NE7A 4M6IA 4WJBA 2AFSA 3H5ZA 2FM4A 1YQEA 2WZNA 1YGHA 4OMEA 1CG2A 3B7IA 3PRTA 3R9EA 1GYTA 4IF5A 4KOUA 1VBGA 4BTFA 2HB6A 4MCRA 3QB8A 4CAEA 2AFZA 2B4DB 2NMTA 4KVXA 3H8GA 4NXYA 4XPKA 5HMNA 4MCPA 4NJRA 4R9MA 3EZAA 2PJ2A 2NYQA 2B3VA 2H5MA 3BLNA 3EZEA 1F2PA 3SR3A 4YN3A 4C2YA 3KHXA 2PJ1A 3D67A 2EK9A 3IWGA 1IYLA 4LQ6A 5FD8A 1Y0YA 2K5TA 3RZAA 2VI7A 4Y49C 5LYIA 4BPXB 3T8WA 3ICUA 2KCWA 1VHSA 2ARHA 2PJAA 3DR6A 4FUUA 4MFQA 2OLSA 1I1DA 4IUSA 1JWQA 4U9ZA 3CDXA 5J8CA 1MJ9A 2ZEFA 8CPAA 4RUHA 1CX8A 5CBMA 5LYLA 4KUBA 3DLJA 3I9SA 4UCNA 3TX8A 2BOAA 1I12A 2ZOGA 2J9AA 4CS0B 5K8NA 1BO4A 4HPSA 3PP9A 4BPUB 1N71A 5DS0A 3HPGG 1M44A 4FBEA 4OIWA 3FEDA 4X8IA 3OP0A 4B14A 5IB9A 4XNHC 2AUMA 4AG9A 1BPNA 3B3SA 1NE9A 3VRQA 2G9DA 3HLPA 3ZZIA 1CJWA 1XMBA 2REEA 3DSBA 4B5OA 1NXJA 1ARLA 2PJ4A 2O53A 5G1ZA 1XRYA 3W6SA 3B3WA 3GY9A 4B5PB 4ZYQA 7CPAA 1C3OB 3RNZA 3SJEA 2VL1A 3BUOB 1KUYA 2V77A 4FD5A 3WABA 4RI1A 2GU2A 3LACA 1S7NA 4UIBA 1XF1A 4C8PA 3UY5A 3PB8X 2ZW4A 3B3CA 5A28A 5F13A 5AG7A 2O4HA 4C8FA 3B3VA 4UBRA 1YVOA 1IOFA 3OWCA 3G23A 2GLJA 3DDDA 2ZEDA 1A9XB 4HNWB 1Z8XA 2GANA 5FVJA 2YJVA 2ZENA 4MHDA 4KSFA 2DPSA 4U9YA 3F0AA 3NA6A 2I00A 1BXRB 4P4JA 1DE4C 3GB0A 3DR8A 4ZX8A 4II9A 1T36B 2C6PA 1Y9WA 2AFUA 3SI2A 3SI0A 4JZ0A 3KQZA 5IR2A 1KWMA 4OC4A 1XIXA 1Y0RA 3FVLA 3R9GA 4KNGE 5JH9A 1J3LA 3BUWB 2D0PA 4UIAA 2DPTA 2X7BA 3C26A 4YRHA 3HMJG 2GE3A 4QUSA 2HROA 3LMSA 5C82A 4A38A 2A4NA 5IV0A 3LD2A 3MN8A 1JDBC 4J3GA 4CGMA 2YNCC 3LWUA 2I3CA 1ZYMA 4CRZB 4MFPA 2G0BA 4OIDA 3SI1A 2EK8A 1WJTA 5A27A 3NH8A 4QB9A 1Q2YA 2ZPAA 1ZLHA 2WSAA 4KUAA 1TKFA 1OBRA 4NGSA 5HKWA 3I6SA 2VBQA 2ODFA 1VBHA 4PXCA 4A4CA 4JXRA 2VZYA 2YNCA 4OC1A 2Z0ZA 1HEEA 3IO1A 4ONWA 1DTDA 1V0CA 2Z3OA 3TFYA 4IIYA 4IHMA 1F2OA 4QVTA 4P45A 1KUXA 3NFZA 2GP4A 3IJ3A 3IEHA 3D7HA 4IK2A 3CXSA 2QYVA 4WWVA 4OAEA 1C30B 1XE4A 1Z8LA 1M4GA 2ABZA 1ARMA 4KVOE 1RXTA 3FMCA 5F9MA 3T07A 3PEIA 4G1PA 4M3SA 4P44A 4CDJA 4P6YA 2GIVA 1AYEA 5K8OA 2FVGA 2XEGA 4O23A 4R8FA 4Q38A 4C9AA 5K99A 3T0TA 2XPNA 4C9UA 2ZEGA 3KQXA 3PBEA 3PFEA 4A33A 4EFDA 2FSRA 3B35A 3S9NA 5KTAA 3EY5A 4C8AA 4W9YA 1YK3A 2B58A 2R7HA 1LCPA 1SQHA 3VTAA 1LFWA 2BEIA 3KL9A 4AB7A 2D0OA 2ZEPA 2AFXA 1MJBA 3PB4X 5C88A 3IGRA 3R9FA 3KASA 4L89A 5F49A 2CNSA 2DXQA 4ZBGA 3GIUA 4C2ZA 2PJ0A 3VARA 2B0AA 1S60A 2VZZA 4NEXA 4M6HA 4R87A 5F09A 4NGNA 4XPDB 3TLGB 3TTHA 4BD9A 3ZJ0A 2AFOA 2IL4A 4OADA 1TKHA 5HH1A 2WPXA 2Q0YA 1Z5RA 1GGOA 3N5FA 4C9EA 3VRNA 1IICA 4BPWB 4P4BA 3TLEA 4A31A 1K4JA 4NGQA 3GUXA 2Z10A 4TJXA 4NGMA 3BUMB 1R43A 2Z11A 1CP6A 4MFJA 3S9LA 1U6MA 2ANPA 5E96A 1HDUA 3RAMA 3ISZA 3T9YA 4TWEA 3V8IA 3SJGA 4F9UA 3DNSA 4DUKA 2B5GB 3BJ8A 2BCOA 2PC1A 3W91A 2HWGA 1UWYA 1NMTA 4MCSA 4X5KA 3CT9A 1EZAA 4COGA 3TO6A 5JYBA 1ZG7A 2JDDA 3TLAA 2P6GA 3D68A 1IGBA 4KOTA 4UCPA 2BUEA 3ZNIA 2EWBA 2Q4YA 2R1IA 4YU9A 2AUNA 2HUZA 4RN7A 4MMOA 1AUGA 4OKOA 3NH4A 4FD4A 3PT1A 1YW6A 1XOVA 2ZEHA 4CAVA 3WC5A 4ZI6A 5THWA 4C9VA 1YLEA 5KTDA 1VHEA 2GLFA 4KOSA 2NSMA 4B6ZA 1TIQA 4KZTA 3VGOA 2Q44A 1Z4EA 4C86A 3GKRA 3PGPA 3D2PA 2N3AB 4A94A 4PK2A 2ZW6A 3FF3A 4BMHA 3EXNA 2V8GA 3FBUA 2PJ7A 4MI4A 5K8MA 4E94A 3IC1A 4OC2A 3H4QA 2DLAA 3OB1B 2C27A 4L8AA 5EMIA 4A37A 1Q5XA 1M4DA 5HVGA 2JEWA 4QC6A 2EZCA 4C99A 4F6AA 5H86A 2D4PA 4P4FA 2B4JC 1RO5A 4LQGA 1KZFA 1ELMP 1WK4A 1YREA 4ONUA 2Z3KA 5ISVA 1ZL0A 4R3KA 1FY7A 4U5YA 4UEZA 3T05A 1VI4A 4X2TA 2EZAA 4CAWA 5JQ4A 4F0YA 1F57A 2PDOA 2ZW5A 2YJTA 4C8UA 4AVBA 3TLCA 2EVNA 2GREA 1S7FA 3TOAA 4ZY2A 1S7LA 4NSQA 4MY0A 4C68A 4PV6A 1XMTA 3TO9A 1QSNA 1BAVA 4Y49B 3V38A 2MP0A 1R61A 2FS5A 4M8DA 2VXKA 3B3TA 4H6ZA 2PJ8A 4Q7AA 2PR1A 4AVAA 1CP7A 1UFHA 1YR0A 2PIYA 2QMLA 4CAFA 3TLBA 1YMEA 1TXRA 4C84A 5BY0A 1BOBA 1YLOA 4Q36A 1CE8B 4CDKA 2CF4A 2ZEOA 2X0SA 2Y1MA 2CXAA 5JVLA 1KBLA 3PB6X 4HNYB 3FYNA 1LAPA 2ZEMA 2VKZG 3K2KA 4KOXA 5LYDA 3WC7A 1XJOA 3G8WA 1TF9A 2JDCA 2PSWA 2V8DA 4A32A 2VEZA 4XNHB 2WPWA 2B3UA 3RBUA 4COBA 4OC0A 1IU8A 1Z8TA 1A2ZA 1YW4A 3D7FA 1P4NA 2CY2A 4KLVA 2XPLA 2E28A 5F46A 1X12A 3TOBA 3EFAA 4FD7A 2D4OA 3WR7A 1EZBA 3I74A 1NSLA 4EMEA 1PU9A 1QQ9A 2QIRA 2CNTA 2RB7A 5G20A 4EVYA 4OP4A 3KHZA 1QSRA 3S6FA 1ZG9A 1Q2CA 1X10A 2HV2A 3IIBA 3N7ZA 2ZEEA 2VQYA 3D7GA 1S5KA 3RYOA 1L0CA 1JDEA 2OR4A 2XPOA 3S9MA 1AMPA 3QAHA 2V8VA 3VWDA 2PVWA 2Q4ZA 5KTCA 3TYXA 4ZY0A 3D4UA 4MHPA 3S6HA 5CPAA 1Z4RA 2AJ6A 2Z3LA 4OLLA 5K8PA 2Z3NA 2B4BA 4P10A 4CYOA 4H1HA 2XEIA 2P6FA 2F8HA 4MBUA 4PK3A 2ATRA 4JLYA 2Y1NA 2Q7BA 3OB2B 3MRUA 1Y7EA 3I3GA 3PB7X 4PXBA 5GCNA 2CTBA 3WT4A 2Q04A 1NBWA 3FRMA 3FECA 4KOYA 4CYPA 1WVMA 2CTCA 1V6CA 3TT2A 3D7DA 1B6BA 3S6KA 1M4IA 3PLFB 1QMUA 2PCUA 3VH9A 3FXTA 3KI9A 5EC4A 4B13A 2C6CA 2ZXVA 4TJVA 1VIXA 4JD6A 2FXFA 2DIKA 2HQYA 5BWAB 4J0NA 2FCKA 2HC9A 4CGLA 3V7ZA 4B12A 2AE6A 3IU1A 4TNUA 2YNEA 4C85A 5G22A 4RR2B 2XEJA 3CXQA 4LX9A 3PFOA 2PQ8A 4GPLB 3KKWA 3VROA 4OC5A 1Y9KA 2PCNA 2IQ6A 1M1DA 1MK4A 2PE3A 4MJ8A 3U88C 1FNOA 1MJAA 1VGYA 3G3SA 3P2FA 4FWUA 3SHPA 4AVCA 2PRBA 4UEFA 4E5SA 5CNPA 5F47A 1BLLE 3CXPA 1TF8A 2PJ6A 3B2YA 2C6GA 2ZOFA 3I1UA 1YSJA 3D3SA 3PFVA 1IIDA 3JRUA 1Z9EA 3H8FA 2P6EA 3MGDA 4KOVA 4CZ1A 3FB3A 1QSOA 1IYKA 1PUAA 5DWNA 4MRIA 2B4DA 3PBBA 6CPAA 3O8ZA 5AXIA 4A4BA 4MY3A 5LYFA 4OC3A 4JWPA 5EBVA 4MI1A 1YX0A 3T5MA 4INJA 3KZWA 4F9VA 3H8EA 1R3NA 3SXOA 2BSWA 4NGPA 2GFQA 3HUVA 4PPZA 2EBJA 4PQAA 3TC8A 4A95A 4F0XA 3EZBA 4MXUA 2V8HA 4R76A 1EO0A 2Q7SA 3FH4A 4C7HA 4UEEA 5D29A 1IOIA 3IFEA 2EUIA 2Q4VA 2IMOA 4MFZA 2JBKA 2RC4A 1XEBA 1B47A 3S6GA 4Z65A 3D2MA 2IJZA 3BUNB 4KSAA 4P4EA 1S7KA 3VATA 1I21A 4KLWA 3RO0A 4CGOA 4M85A 3TLYA 4LUAA 1S3ZA 2OB0A 1LAMA
chains in the Genus database with same CATH topology
3BXMA 4F8ZA 4C9RA 1ELLP 2QJ8A 4CPAA 4A39A 2ZELA 4C8TA 4DJLA 4NGRA 1Z2LA 5LRKA 1LOKA 1PCAA 1Q7LA 3SJXA 3K9TA 2C1CA 4PXEA 1RTQA 4MCQA 4JYWA 4FAIA 1XFOA 2AFWA 1LANA 2PJ3A 4R6TA 5LRJA 8CPAA 3BHXA 1VHOA 3CPXA 5HVFA 1CPSA 2PIZA 3DGVA 1FT7A 2POKA 2CIJA 4ZX9A 2PRQA 1CBXA 2AFMA 2QVPA 1M4LA 3QNVA 3BI0A 1IY7A 4NJQA 4ZY1A 3D66A 2BO9A 4MHNA 2XEFA 4C8CA 3L2NA 1TKJA 4P4DA 4P4IA 4K3NA 4YWYA 4NFRA 1ZLIA 1EE3P 2Q43A 5D8NA 1Y9ZA 5LRGA 4UF4A 5I4MA 2PJ9A 4EWTA 3FX6A 3GLJA 3ISXA 3EIFA 4PXDA 4GM5A 4DYOA 5HXDA 3KR4A 3SJFA 4IAVA 3BI1A 3FEEA 3FJUA 1XBUA 1BPMA 2PJBA 3PB9X 3CPAA 5JGFA 5J1QA 1HDQA 2WYRA 4MHYA 5JM6A 4NGTA 2PJ5A 1H8LA 4AXVA 2PJCA 3KR5A 4H2KA 2F7VA 4KSIA 2DEAA 2Q51A 1NSAA 3NH5A 3IWWA 1ZG8A 3WC6A 2C5QA 2PVVA 4R7MA 1CPXA 3KGQA 2JBJA 2OOTA 4X3RA 1PYTB 2RFHA 5HVHA 1JQGA 5ELYA 4MHZA 4WJBA 2AFSA 2WZNA 4OMEA 1CG2A 3B7IA 3PRTA 1GYTA 2HB6A 4MCRA 2AFZA 3H8GA 4MCPA 4NJRA 2PJ2A 2NYQA 1F2PA 4YN3A 3KHXA 2PJ1A 3D67A 2EK9A 1Y0YA 3RZAA 5LYIA 3T8WA 2PJAA 4FUUA 3CDXA 2ZEFA 4RUHA 1CX8A 5CBMA 5LYLA 3DLJA 3TX8A 2BOAA 2ZOGA 2J9AA 5K8NA 5DS0A 4FBEA 4OIWA 3FEDA 4X8IA 5IB9A 1BPNA 3B3SA 2G9DA 3HLPA 1XMBA 1ARLA 2PJ4A 2O53A 4ZYQA 1XRYA 7CPAA 3B3WA 3WABA 3SJEA 2VL1A 2V77A 4UIBA 2GU2A 1XF1A 4C8PA 3PB8X 3B3CA 4C8FA 2O4HA 3B3VA 2GLJA 2ZEDA 2ZENA 3NA6A 4P4JA 1DE4C 3GB0A 4ZX8A 2C6PA 2AFUA 3SI2A 3SI0A 4JZ0A 3KQZA 5IR2A 1KWMA 4OC4A 4KNGE 1Y0RA 3FVLA 5JH9A 4UIAA 3LMSA 4A38A 3MN8A 3LWUA 2I3CA 4OIDA 3SI1A 2EK8A 3NH8A 1ZLHA 1TKFA 1OBRA 4NGSA 3I6SA 4PXCA 4OC1A 3IO1A 1HEEA 4ONWA 1DTDA 4IHMA 1F2OA 4P45A 3NFZA 2GP4A 3IJ3A 3IEHA 3D7HA 4IK2A 4WWVA 2QYVA 1Z8LA 2ABZA 1ARMA 3FMCA 3PEIA 4G1PA 4P44A 4CDJA 4P6YA 1AYEA 5K8OA 2FVGA 2XEGA 4O23A 4R8FA 4C9AA 4C9UA 2ZEGA 3KQXA 3PBEA 3PFEA 4EFDA 3B35A 3S9NA 4C8AA 4W9YA 1LCPA 3VTAA 1LFWA 3KL9A 2ZEPA 2AFXA 3PB4X 3KASA 3ICUA 2PJ0A 3VARA 5F09A 4NGNA 4BD9A 2AFOA 4C9EA 1TKHA 1Z5RA 3N5FA 4P4BA 4NGQA 3GUXA 4TJXA 4NGMA 1R43A 1CP6A 3S9LA 2ANPA 3RAMA 1HDUA 4F9UA 3ISZA 4TWEA 3SJGA 4DUKA 2BCOA 1UWYA 4MCSA 3CT9A 1ZG7A 3D68A 1IGBA 2EWBA 4YU9A 4MMOA 4OKOA 3NH4A 1YW6A 2ZEHA 3WC5A 4ZI6A 5THWA 4C9VA 1VHEA 2GLFA 4B6ZA 2NSMA 4C86A 4A94A 3FF3A 2V8GA 2PJ7A 5K8MA 3IC1A 4OC2A 4A37A 5HVGA 2JEWA 4C99A 4P4FA 4LQGA 1ELMP 4UEZA 4X2TA 1F57A 4C8UA 2GREA 4ZY2A 3V38A 1BAVA 3B3TA 2PJ8A 4Q7AA 1CP7A 2PIYA 1YMEA 1TXRA 4C84A 1YLOA 4CDKA 2CF4A 2ZEOA 3PB6X 1LAPA 2ZEMA 3K2KA 5LYDA 3WC7A 1XJOA 1TF9A 2V8DA 3RBUA 4OC0A 1YW4A 3D7FA 3I74A 4EMEA 1QQ9A 2RB7A 4OP4A 3KHZA 1ZG9A 3IIBA 2ZEEA 3D7GA 2OR4A 1AMPA 3S9MA 2V8VA 2PVWA 2Q4ZA 4ZY0A 3D4UA 4MHPA 5CPAA 5K8PA 4P10A 2XEIA 2F8HA 3MRUA 1Y7EA 3PB7X 4PXBA 3WT4A 2CTBA 3FECA 1WVMA 2CTCA 1V6CA 3D7DA 1QMUA 2PCUA 3VH9A 3KI9A 2C6CA 4TJVA 1VIXA 2HC9A 3V7ZA 4TNUA 4C85A 2XEJA 3PFOA 4OC5A 2IQ6A 2PE3A 1FNOA 1VGYA 4FWUA 4UEFA 1BLLE 1TF8A 2PJ6A 3B2YA 2C6GA 2ZOFA 3I1UA 1YSJA 3JRUA 3H8FA 4MRIA 3PBBA 6CPAA 5LYFA 4OC3A 3KZWA 4F9VA 3H8EA 1R3NA 4NGPA 3HUVA 4PPZA 4PQAA 3TC8A 4MXUA 2V8HA 4R76A 3FH4A 4UEEA 5D29A 3IFEA 2IMOA 2JBKA 4Z65A 2IJZA 4P4EA 3VATA 1LAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXM A;  4F8Z A;  4C9R A;  1ELL P;  2QJ8 A;  4CPA A;  4A39 A;  2ZEL A;  4C8T A;  4DJL A;  4NGR A;  1Z2L A;  5LRK A;  1LOK A;  1PCA A;  1Q7L A;  3SJX A;  3K9T A;  2C1C A;  4PXE A;  1RTQ A;  4MCQ A;  4JYW A;  4FAI A;  1XFO A;  2AFW A;  1LAN A;  2PJ3 A;  4R6T A;  5LRJ A;  8CPA A;  3BHX A;  1VHO A;  3CPX A;  5HVF A;  1CPS A;  2PIZ A;  3DGV A;  1FT7 A;  2POK A;  2CIJ A;  4ZX9 A;  2PRQ A;  1CBX A;  2AFM A;  2QVP A;  1M4L A;  3QNV A;  3BI0 A;  1IY7 A;  4NJQ A;  4ZY1 A;  3D66 A;  2BO9 A;  4MHN A;  2XEF A;  4C8C A;  3L2N A;  1TKJ A;  4P4D A;  4P4I A;  4K3N A;  4YWY A;  4NFR A;  1ZLI A;  1EE3 P;  2Q43 A;  5D8N A;  1Y9Z A;  5LRG A;  4UF4 A;  5I4M A;  2PJ9 A;  4EWT A;  3FX6 A;  3GLJ A;  3ISX A;  3EIF A;  4PXD A;  4GM5 A;  4DYO A;  5HXD A;  3KR4 A;  3SJF A;  4IAV A;  3BI1 A;  3FEE A;  3FJU A;  1XBU A;  1BPM A;  2PJB A;  3PB9 X;  3CPA A;  5JGF A;  5J1Q A;  1HDQ A;  2WYR A;  4MHY A;  5JM6 A;  4NGT A;  2PJ5 A;  1H8L A;  4AXV A;  2PJC A;  3KR5 A;  4H2K A;  2F7V A;  4KSI A;  2DEA A;  2Q51 A;  1NSA A;  3NH5 A;  3IWW A;  1ZG8 A;  3WC6 A;  2PVV A;  4R7M A;  1CPX A;  3KGQ A;  2JBJ A;  2OOT A;  4X3R A;  1PYT B;  2RFH A;  5HVH A;  1JQG A;  5ELY A;  4MHZ A;  4WJB A;  2AFS A;  2WZN A;  4OME A;  1CG2 A;  3B7I A;  3PRT A;  1GYT A;  2HB6 A;  4MCR A;  2AFZ A;  3H8G A;  4MCP A;  4NJR A;  2PJ2 A;  2NYQ A;  1F2P A;  4YN3 A;  3KHX A;  2PJ1 A;  3D67 A;  2EK9 A;  1Y0Y A;  3RZA A;  5LYI A;  3T8W A;  2PJA A;  4FUU A;  3CDX A;  2ZEF A;  4RUH A;  1CX8 A;  5CBM A;  5LYL A;  3DLJ A;  3TX8 A;  2BOA A;  2ZOG A;  2J9A A;  5K8N A;  5DS0 A;  4FBE A;  4OIW A;  3FED A;  4X8I A;  5IB9 A;  1BPN A;  3B3S A;  2G9D A;  3HLP A;  1XMB A;  1ARL A;  2PJ4 A;  2O53 A;  4ZYQ A;  1XRY A;  7CPA A;  3B3W A;  3WAB A;  3SJE A;  2VL1 A;  2V77 A;  4UIB A;  2GU2 A;  1XF1 A;  4C8P A;  3PB8 X;  3B3C A;  4C8F A;  2O4H A;  3B3V A;  2GLJ A;  2ZED A;  2ZEN A;  3NA6 A;  4P4J A;  1DE4 C;  3GB0 A;  4ZX8 A;  2C6P A;  2AFU A;  3SI2 A;  3SI0 A;  4JZ0 A;  3KQZ A;  1KWM A;  4OC4 A;  4KNG E;  1Y0R A;  3FVL A;  5JH9 A;  4UIA A;  3LMS A;  4A38 A;  3MN8 A;  3LWU A;  2I3C A;  4OID A;  3SI1 A;  2EK8 A;  3NH8 A;  1ZLH A;  1TKF A;  1OBR A;  4NGS A;  3I6S A;  4PXC A;  4OC1 A;  3IO1 A;  1HEE A;  4ONW A;  1DTD A;  4IHM A;  1F2O A;  4P45 A;  3NFZ A;  3IJ3 A;  3IEH A;  3D7H A;  4IK2 A;  4WWV A;  2QYV A;  1Z8L A;  2ABZ A;  1ARM A;  3FMC A;  3PEI A;  4G1P A;  4P44 A;  4CDJ A;  4P6Y A;  1AYE A;  5K8O A;  2FVG A;  2XEG A;  4O23 A;  4R8F A;  4C9A A;  4C9U A;  2ZEG A;  3KQX A;  3PBE A;  3PFE A;  4EFD A;  3B35 A;  3S9N A;  4C8A A;  4W9Y A;  1LCP A;  3VTA A;  1LFW A;  3KL9 A;  2ZEP A;  2AFX A;  3PB4 X;  3KAS A;  3ICU A;  2PJ0 A;  3VAR A;  5F09 A;  4NGN A;  4BD9 A;  2AFO A;  4C9E A;  1TKH A;  1Z5R A;  3N5F A;  4P4B A;  4NGQ A;  3GUX A;  4TJX A;  4NGM A;  1R43 A;  1CP6 A;  3S9L A;  2ANP A;  3RAM A;  1HDU A;  4F9U A;  3ISZ A;  4TWE A;  3SJG A;  4DUK A;  2BCO A;  1UWY A;  4MCS A;  3CT9 A;  1ZG7 A;  3D68 A;  1IGB A;  2EWB A;  4YU9 A;  4MMO A;  4OKO A;  3NH4 A;  1YW6 A;  2ZEH A;  3WC5 A;  4ZI6 A;  5THW A;  4C9V A;  1VHE A;  2GLF A;  4B6Z A;  2NSM A;  4C86 A;  4A94 A;  3FF3 A;  2V8G A;  2PJ7 A;  5K8M A;  3IC1 A;  4OC2 A;  4A37 A;  5HVG A;  2JEW A;  4C99 A;  4P4F A;  4LQG A;  1ELM P;  4UEZ A;  4X2T A;  1F57 A;  4C8U A;  2GRE A;  4ZY2 A;  3V38 A;  1BAV A;  3B3T A;  2PJ8 A;  4Q7A A;  1CP7 A;  2PIY A;  1YME A;  1TXR A;  4C84 A;  1YLO A;  4CDK A;  2CF4 A;  2ZEO A;  3PB6 X;  1LAP A;  2ZEM A;  3K2K A;  5LYD A;  3WC7 A;  1XJO A;  1TF9 A;  2V8D A;  3RBU A;  4OC0 A;  1YW4 A;  3D7F A;  3I74 A;  4EME A;  1QQ9 A;  2RB7 A;  4OP4 A;  3KHZ A;  1ZG9 A;  3IIB A;  2ZEE A;  3D7G A;  2OR4 A;  1AMP A;  3S9M A;  2V8V A;  2PVW A;  2Q4Z A;  4ZY0 A;  3D4U A;  4MHP A;  5CPA A;  5K8P A;  4P10 A;  2XEI A;  2F8H A;  3MRU A;  1Y7E A;  3PB7 X;  4PXB A;  3WT4 A;  2CTB A;  3FEC A;  1WVM A;  2CTC A;  1V6C A;  3D7D A;  1QMU A;  2PCU A;  3VH9 A;  3KI9 A;  2C6C A;  4TJV A;  1VIX A;  2HC9 A;  3V7Z A;  4TNU A;  4C85 A;  2XEJ A;  3PFO A;  4OC5 A;  2IQ6 A;  2PE3 A;  1FNO A;  1VGY A;  4FWU A;  4UEF A;  1BLL E;  1TF8 A;  2PJ6 A;  3B2Y A;  2C6G A;  2ZOF A;  3I1U A;  1YSJ A;  3JRU A;  3H8F A;  4MRI A;  3PBB A;  6CPA A;  5LYF A;  4OC3 A;  3KZW A;  4F9V A;  3H8E A;  1R3N A;  4NGP A;  3HUV A;  4PPZ A;  4PQA A;  3TC8 A;  4MXU A;  2V8H A;  4R76 A;  3FH4 A;  4UEE A;  5D29 A;  3IFE A;  2IMO A;  2JBK A;  4Z65 A;  2IJZ A;  4P4E A;  3VAT A;  1LAM A; 
#chains in the Genus database with same CATH topology
 3BXM A;  4F8Z A;  4C9R A;  1ELL P;  2F5I A;  2QJ8 A;  2WUU A;  3JVN A;  4CYN A;  4M6G A;  4CPA A;  3P2H A;  4YGO A;  3NE8 A;  5HKZ A;  4A39 A;  2Z3M A;  2ZEL A;  3VRR A;  4A30 A;  4B11 A;  4C8T A;  3T90 A;  1ZO0 A;  4IIX A;  3R95 A;  2J8M A;  4DJL A;  4NGR A;  1Z2L A;  1Z9U A;  5LRK A;  4B10 A;  2OZU A;  1LOK A;  1PCA A;  3EO4 A;  3W6X A;  4AXV A;  2FL4 A;  1KEE B;  5J3X A;  1Q7L A;  2O28 A;  3SJX A;  2Y0M A;  4NF1 A;  3K9T A;  4B5P A;  2R8V A;  4MFL A;  2C1C A;  4PXE A;  1RTQ A;  3VRP A;  1CS0 B;  1DIK A;  4H6U A;  1KUV A;  4UFX A;  1ZRS A;  5F1Y A;  2FT0 A;  4MCQ A;  2UV8 G;  4FD6 A;  4JYW A;  4FAI A;  1KC7 A;  2P0W A;  1QSM A;  5I0C A;  1XFO A;  2AFW A;  1LAN A;  2PJ3 A;  3JTK A;  3R1K A;  4GXH A;  4K30 A;  4JXQ A;  4R6T A;  4UWI A;  5LRJ A;  5J8F A;  3BHX A;  1VHO A;  3CPX A;  5HVF A;  1CPS A;  3F8K A;  4E0A A;  2OZH A;  2PIZ A;  3DGV A;  5AG6 A;  4UCM A;  4YFJ A;  1FT7 A;  2POK A;  2CIJ A;  1Q2D A;  4ZX9 A;  2PRQ A;  1CBX A;  2AFM A;  3F9K C;  4CGP A;  2I79 A;  2YND A;  4BIN A;  4CYQ A;  2QVP A;  3IU2 A;  5G21 A;  1M4L A;  2J8N A;  5DWM A;  3A9L A;  3QNV A;  2HI6 A;  2JEV A;  3BI0 A;  1IY7 A;  2OU2 A;  2R98 A;  2J8R A;  4NJQ A;  4ZY1 A;  3D66 A;  1Y7R A;  2BO9 A;  2Z3P A;  4MHN A;  4UFV A;  3TE4 A;  2XEF A;  2EZB A;  4C8C A;  5AG4 A;  3L2N A;  4R3L A;  5JPH A;  1TKJ A;  4P4D A;  4P4I A;  5HKY A;  4H89 A;  4K3N A;  4YWY A;  4NFR A;  2JLM A;  1ZLI A;  4DNC A;  1EE3 P;  4E2A A;  3GJZ A;  2Q43 A;  5D8N A;  1Y9Z A;  5LRG A;  3VWE A;  4UF4 A;  3R96 A;  4CGN A;  5I4M A;  2OH1 A;  2PJ9 A;  4EWT A;  5IX3 A;  4XPL A;  2EO8 A;  2R82 A;  3K9U A;  3FX6 A;  3GLJ A;  3ISX A;  1ON0 A;  3TCV A;  3EIF A;  4PXD A;  4GM5 A;  4DYO A;  4JVO A;  4MFK A;  5HXD A;  3KR4 A;  3SJF A;  4IAV A;  3JUW A;  4HKF A;  3BI1 A;  4KOR A;  3FEE A;  3FJU A;  4A2Z A;  4UA3 A;  3KRV A;  3BJ7 A;  2FIW A;  3IWE A;  2CBL A;  1IB1 E;  1XBU A;  3TO7 A;  5F5X A;  1BPM A;  2FE7 A;  2YGW A;  4UWJ A;  2PJB A;  3PB9 X;  5AG5 A;  3C8O A;  4EYS A;  3TLZ A;  3B8G A;  3CPA A;  1FBV A;  4QBJ A;  4PSW A;  3BUX B;  3EC4 A;  5JGF A;  3LOD A;  4XPD C;  5J1Q A;  1WWZ A;  4KOW A;  3SXN A;  4CO9 A;  1HDQ A;  2WYR A;  4MHY A;  5JM6 A;  3QAY A;  5AGE A;  1GHE A;  1YVK A;  4NGT A;  3K4I A;  2G3T A;  1XF8 A;  2CNM A;  2PJ5 A;  1H8L A;  3NFQ A;  2REF A;  4KVM E;  4R57 A;  4UFW A;  2PJC A;  1OZP A;  3KR5 A;  4H2K A;  5F48 A;  2OZG A;  3OAK A;  2F7V A;  4C7I A;  1M6V B;  3NOJ A;  2PR8 A;  2FIA A;  3FNC A;  2DF5 A;  2DEA A;  3GYA A;  4KSI A;  5IB0 A;  2Q51 A;  2G3A A;  4CAX A;  3U1B A;  4C2X A;  1NSA A;  1LRZ A;  3NH5 A;  3HPH E;  3IWW A;  4CRY B;  1VKC A;  3E0K A;  4KS9 A;  4MJX A;  4E8O A;  1YVH A;  2XPP A;  4HNX B;  2B5G A;  1B87 A;  1R57 A;  4I49 A;  3TLG A;  4PSX A;  1ZG8 A;  3PZJ A;  3WC6 A;  3CZX A;  2C5Q A;  1P0H A;  1Z8W A;  2QEC A;  2PVV A;  1J4J A;  1CPX A;  4NCZ A;  4R7M A;  3KGQ A;  4ZGY B;  2JBJ A;  2OOT A;  3D8P A;  3FIX A;  4BBH A;  2BL1 A;  5H84 A;  4X3R A;  4JJX A;  4GS4 A;  1PYT B;  4ORF A;  2RFH A;  5HVH A;  1JQG A;  4RS2 A;  2ZW7 A;  1CM0 A;  5ELY A;  1QST A;  3F5B A;  4MHZ A;  4AG7 A;  3NE7 A;  4M6I A;  4WJB A;  2AFS A;  3H5Z A;  2FM4 A;  1YQE A;  2WZN A;  1YGH A;  4OME A;  1CG2 A;  3B7I A;  3PRT A;  3R9E A;  1GYT A;  4IF5 A;  4KOU A;  1VBG A;  4BTF A;  2HB6 A;  4MCR A;  3QB8 A;  4CAE A;  2AFZ A;  2B4D B;  2NMT A;  4KVX A;  3H8G A;  4NXY A;  4XPK A;  5HMN A;  4MCP A;  4NJR A;  4R9M A;  3EZA A;  2PJ2 A;  2NYQ A;  2B3V A;  2H5M A;  3BLN A;  3EZE A;  1F2P A;  3SR3 A;  4YN3 A;  4C2Y A;  3KHX A;  2PJ1 A;  3D67 A;  2EK9 A;  3IWG A;  1IYL A;  4LQ6 A;  5FD8 A;  1Y0Y A;  2K5T A;  3RZA A;  2VI7 A;  4Y49 C;  5LYI A;  4BPX B;  3T8W A;  3ICU A;  2KCW A;  1VHS A;  2ARH A;  2PJA A;  3DR6 A;  4FUU A;  4MFQ A;  2OLS A;  1I1D A;  4IUS A;  1JWQ A;  4U9Z A;  3CDX A;  5J8C A;  1MJ9 A;  2ZEF A;  8CPA A;  4RUH A;  1CX8 A;  5CBM A;  5LYL A;  4KUB A;  3DLJ A;  3I9S A;  4UCN A;  3TX8 A;  2BOA A;  1I12 A;  2ZOG A;  2J9A A;  4CS0 B;  5K8N A;  1BO4 A;  4HPS A;  3PP9 A;  4BPU B;  1N71 A;  5DS0 A;  3HPG G;  1M44 A;  4FBE A;  4OIW A;  3FED A;  4X8I A;  3OP0 A;  4B14 A;  5IB9 A;  4XNH C;  2AUM A;  4AG9 A;  1BPN A;  3B3S A;  1NE9 A;  3VRQ A;  2G9D A;  3HLP A;  3ZZI A;  1CJW A;  1XMB A;  2REE A;  3DSB A;  4B5O A;  1NXJ A;  1ARL A;  2PJ4 A;  2O53 A;  5G1Z A;  1XRY A;  3W6S A;  3B3W A;  3GY9 A;  4B5P B;  4ZYQ A;  7CPA A;  1C3O B;  3RNZ A;  3SJE A;  2VL1 A;  3BUO B;  1KUY A;  2V77 A;  4FD5 A;  3WAB A;  4RI1 A;  2GU2 A;  3LAC A;  1S7N A;  4UIB A;  1XF1 A;  4C8P A;  3UY5 A;  3PB8 X;  2ZW4 A;  3B3C A;  5A28 A;  5F13 A;  5AG7 A;  2O4H A;  4C8F A;  3B3V A;  4UBR A;  1YVO A;  1IOF A;  3OWC A;  3G23 A;  2GLJ A;  3DDD A;  2ZED A;  1A9X B;  4HNW B;  1Z8X A;  2GAN A;  5FVJ A;  2YJV A;  2ZEN A;  4MHD A;  4KSF A;  2DPS A;  4U9Y A;  3F0A A;  3NA6 A;  2I00 A;  1BXR B;  4P4J A;  1DE4 C;  3GB0 A;  3DR8 A;  4ZX8 A;  4II9 A;  1T36 B;  2C6P A;  1Y9W A;  2AFU A;  3SI2 A;  3SI0 A;  4JZ0 A;  3KQZ A;  5IR2 A;  1KWM A;  4OC4 A;  1XIX A;  1Y0R A;  3FVL A;  3R9G A;  4KNG E;  5JH9 A;  1J3L A;  3BUW B;  2D0P A;  4UIA A;  2DPT A;  2X7B A;  3C26 A;  4YRH A;  3HMJ G;  2GE3 A;  4QUS A;  2HRO A;  3LMS A;  5C82 A;  4A38 A;  2A4N A;  5IV0 A;  3LD2 A;  3MN8 A;  1JDB C;  4J3G A;  4CGM A;  2YNC C;  3LWU A;  2I3C A;  1ZYM A;  4CRZ B;  4MFP A;  2G0B A;  4OID A;  3SI1 A;  2EK8 A;  1WJT A;  5A27 A;  3NH8 A;  4QB9 A;  1Q2Y A;  2ZPA A;  1ZLH A;  2WSA A;  4KUA A;  1TKF A;  1OBR A;  4NGS A;  5HKW A;  3I6S A;  2VBQ A;  2ODF A;  1VBH A;  4PXC A;  4A4C A;  4JXR A;  2VZY A;  2YNC A;  4OC1 A;  2Z0Z A;  1HEE A;  3IO1 A;  4ONW A;  1DTD A;  1V0C A;  2Z3O A;  3TFY A;  4IIY A;  4IHM A;  1F2O A;  4QVT A;  4P45 A;  1KUX A;  3NFZ A;  2GP4 A;  3IJ3 A;  3IEH A;  3D7H A;  4IK2 A;  3CXS A;  2QYV A;  4WWV A;  4OAE A;  1C30 B;  1XE4 A;  1Z8L A;  1M4G A;  2ABZ A;  1ARM A;  4KVO E;  1RXT A;  3FMC A;  5F9M A;  3T07 A;  3PEI A;  4G1P A;  4M3S A;  4P44 A;  4CDJ A;  4P6Y A;  2GIV A;  1AYE A;  5K8O A;  2FVG A;  2XEG A;  4O23 A;  4R8F A;  4Q38 A;  4C9A A;  5K99 A;  3T0T A;  2XPN A;  4C9U A;  2ZEG A;  3KQX A;  3PBE A;  3PFE A;  4A33 A;  4EFD A;  2FSR A;  3B35 A;  3S9N A;  5KTA A;  3EY5 A;  4C8A A;  4W9Y A;  1YK3 A;  2B58 A;  2R7H A;  1LCP A;  1SQH A;  3VTA A;  1LFW A;  2BEI A;  3KL9 A;  4AB7 A;  2D0O A;  2ZEP A;  2AFX A;  1MJB A;  3PB4 X;  5C88 A;  3IGR A;  3R9F A;  3KAS A;  4L89 A;  5F49 A;  2CNS A;  2DXQ A;  4ZBG A;  3GIU A;  4C2Z A;  2PJ0 A;  3VAR A;  2B0A A;  1S60 A;  2VZZ A;  4NEX A;  4M6H A;  4R87 A;  5F09 A;  4NGN A;  4XPD B;  3TLG B;  3TTH A;  4BD9 A;  3ZJ0 A;  2AFO A;  2IL4 A;  4OAD A;  1TKH A;  5HH1 A;  2WPX A;  2Q0Y A;  1Z5R A;  1GGO A;  3N5F A;  4C9E A;  3VRN A;  1IIC A;  4BPW B;  4P4B A;  3TLE A;  4A31 A;  1K4J A;  4NGQ A;  3GUX A;  2Z10 A;  4TJX A;  4NGM A;  3BUM B;  1R43 A;  2Z11 A;  1CP6 A;  4MFJ A;  3S9L A;  1U6M A;  2ANP A;  5E96 A;  1HDU A;  3RAM A;  3ISZ A;  3T9Y A;  4TWE A;  3V8I A;  3SJG A;  4F9U A;  3DNS A;  4DUK A;  2B5G B;  3BJ8 A;  2BCO A;  2PC1 A;  3W91 A;  2HWG A;  1UWY A;  1NMT A;  4MCS A;  4X5K A;  3CT9 A;  1EZA A;  4COG A;  3TO6 A;  5JYB A;  1ZG7 A;  2JDD A;  3TLA A;  2P6G A;  3D68 A;  1IGB A;  4KOT A;  4UCP A;  2BUE A;  3ZNI A;  2EWB A;  2Q4Y A;  2R1I A;  4YU9 A;  2AUN A;  2HUZ A;  4RN7 A;  4MMO A;  1AUG A;  4OKO A;  3NH4 A;  4FD4 A;  3PT1 A;  1YW6 A;  1XOV A;  2ZEH A;  4CAV A;  3WC5 A;  4ZI6 A;  5THW A;  4C9V A;  1YLE A;  5KTD A;  1VHE A;  2GLF A;  4KOS A;  2NSM A;  4B6Z A;  1TIQ A;  4KZT A;  3VGO A;  2Q44 A;  1Z4E A;  4C86 A;  3GKR A;  3PGP A;  3D2P A;  2N3A B;  4A94 A;  4PK2 A;  2ZW6 A;  3FF3 A;  4BMH A;  3EXN A;  2V8G A;  3FBU A;  2PJ7 A;  4MI4 A;  5K8M A;  4E94 A;  3IC1 A;  4OC2 A;  3H4Q A;  2DLA A;  3OB1 B;  2C27 A;  4L8A A;  5EMI A;  4A37 A;  1Q5X A;  1M4D A;  5HVG A;  2JEW A;  4QC6 A;  2EZC A;  4C99 A;  4F6A A;  5H86 A;  2D4P A;  4P4F A;  2B4J C;  1RO5 A;  4LQG A;  1KZF A;  1ELM P;  1WK4 A;  1YRE A;  4ONU A;  2Z3K A;  5ISV A;  1ZL0 A;  4R3K A;  1FY7 A;  4U5Y A;  4UEZ A;  3T05 A;  1VI4 A;  4X2T A;  2EZA A;  4CAW A;  5JQ4 A;  4F0Y A;  1F57 A;  2PDO A;  2ZW5 A;  2YJT A;  4C8U A;  4AVB A;  3TLC A;  2EVN A;  2GRE A;  1S7F A;  3TOA A;  4ZY2 A;  1S7L A;  4NSQ A;  4MY0 A;  4C68 A;  4PV6 A;  1XMT A;  3TO9 A;  1QSN A;  1BAV A;  4Y49 B;  3V38 A;  2MP0 A;  1R61 A;  2FS5 A;  4M8D A;  2VXK A;  3B3T A;  4H6Z A;  2PJ8 A;  4Q7A A;  2PR1 A;  4AVA A;  1CP7 A;  1UFH A;  1YR0 A;  2PIY A;  2QML A;  4CAF A;  3TLB A;  1YME A;  1TXR A;  4C84 A;  5BY0 A;  1BOB A;  1YLO A;  4Q36 A;  1CE8 B;  4CDK A;  2CF4 A;  2ZEO A;  2X0S A;  2Y1M A;  2CXA A;  5JVL A;  1KBL A;  3PB6 X;  4HNY B;  3FYN A;  1LAP A;  2ZEM A;  2VKZ G;  3K2K A;  4KOX A;  5LYD A;  3WC7 A;  1XJO A;  3G8W A;  1TF9 A;  2JDC A;  2PSW A;  2V8D A;  4A32 A;  2VEZ A;  4XNH B;  2WPW A;  2B3U A;  3RBU A;  4COB A;  4OC0 A;  1IU8 A;  1Z8T A;  1A2Z A;  1YW4 A;  3D7F A;  1P4N A;  2CY2 A;  4KLV A;  2XPL A;  2E28 A;  5F46 A;  1X12 A;  3TOB A;  3EFA A;  4FD7 A;  2D4O A;  3WR7 A;  1EZB A;  3I74 A;  1NSL A;  4EME A;  1PU9 A;  1QQ9 A;  2QIR A;  2CNT A;  2RB7 A;  5G20 A;  4EVY A;  4OP4 A;  3KHZ A;  1QSR A;  3S6F A;  1ZG9 A;  1Q2C A;  1X10 A;  2HV2 A;  3IIB A;  3N7Z A;  2ZEE A;  2VQY A;  3D7G A;  1S5K A;  3RYO A;  1L0C A;  1JDE A;  2OR4 A;  2XPO A;  3S9M A;  1AMP A;  3QAH A;  2V8V A;  3VWD A;  2PVW A;  2Q4Z A;  5KTC A;  3TYX A;  4ZY0 A;  3D4U A;  4MHP A;  3S6H A;  5CPA A;  1Z4R A;  2AJ6 A;  2Z3L A;  4OLL A;  5K8P A;  2Z3N A;  2B4B A;  4P10 A;  4CYO A;  4H1H A;  2XEI A;  2P6F A;  2F8H A;  4MBU A;  4PK3 A;  2ATR A;  4JLY A;  2Y1N A;  2Q7B A;  3OB2 B;  3MRU A;  1Y7E A;  3I3G A;  3PB7 X;  4PXB A;  5GCN A;  2CTB A;  3WT4 A;  2Q04 A;  1NBW A;  3FRM A;  3FEC A;  4KOY A;  4CYP A;  1WVM A;  2CTC A;  1V6C A;  3TT2 A;  3D7D A;  1B6B A;  3S6K A;  1M4I A;  3PLF B;  1QMU A;  2PCU A;  3VH9 A;  3FXT A;  3KI9 A;  5EC4 A;  4B13 A;  2C6C A;  2ZXV A;  4TJV A;  1VIX A;  4JD6 A;  2FXF A;  2DIK A;  2HQY A;  5BWA B;  4J0N A;  2FCK A;  2HC9 A;  4CGL A;  3V7Z A;  4B12 A;  2AE6 A;  3IU1 A;  4TNU A;  2YNE A;  4C85 A;  5G22 A;  4RR2 B;  2XEJ A;  3CXQ A;  4LX9 A;  3PFO A;  2PQ8 A;  4GPL B;  3KKW A;  3VRO A;  4OC5 A;  1Y9K A;  2PCN A;  2IQ6 A;  1M1D A;  1MK4 A;  2PE3 A;  4MJ8 A;  3U88 C;  1FNO A;  1MJA A;  1VGY A;  3G3S A;  3P2F A;  4FWU A;  3SHP A;  4AVC A;  2PRB A;  4UEF A;  4E5S A;  5CNP A;  5F47 A;  1BLL E;  3CXP A;  1TF8 A;  2PJ6 A;  3B2Y A;  2C6G A;  2ZOF A;  3I1U A;  1YSJ A;  3D3S A;  3PFV A;  1IID A;  3JRU A;  1Z9E A;  3H8F A;  2P6E A;  3MGD A;  4KOV A;  4CZ1 A;  3FB3 A;  1QSO A;  1IYK A;  1PUA A;  5DWN A;  4MRI A;  2B4D A;  3PBB A;  6CPA A;  3O8Z A;  5AXI A;  4A4B A;  4MY3 A;  5LYF A;  4OC3 A;  4JWP A;  5EBV A;  4MI1 A;  1YX0 A;  3T5M A;  4INJ A;  3KZW A;  4F9V A;  3H8E A;  1R3N A;  3SXO A;  2BSW A;  4NGP A;  2GFQ A;  3HUV A;  4PPZ A;  2EBJ A;  4PQA A;  3TC8 A;  4A95 A;  4F0X A;  3EZB A;  4MXU A;  2V8H A;  4R76 A;  1EO0 A;  2Q7S A;  3FH4 A;  4C7H A;  4UEE A;  5D29 A;  1IOI A;  3IFE A;  2EUI A;  2Q4V A;  2IMO A;  4MFZ A;  2JBK A;  2RC4 A;  1XEB A;  1B47 A;  3S6G A;  4Z65 A;  3D2M A;  2IJZ A;  3BUN B;  4KSA A;  4P4E A;  1S7K A;  3VAT A;  1I21 A;  4KLW A;  3RO0 A;  4CGO A;  4M85 A;  3TLY A;  4LUA A;  1S3Z A;  2OB0 A;  1LAM A; 
#chains in the Genus database with same CATH homology
 3BXM A;  4F8Z A;  4C9R A;  1ELL P;  2QJ8 A;  4CPA A;  4A39 A;  2ZEL A;  4C8T A;  4DJL A;  4NGR A;  1Z2L A;  5LRK A;  1LOK A;  1PCA A;  1Q7L A;  3SJX A;  3K9T A;  2C1C A;  4PXE A;  1RTQ A;  4MCQ A;  4JYW A;  4FAI A;  1XFO A;  2AFW A;  1LAN A;  2PJ3 A;  4R6T A;  5LRJ A;  8CPA A;  3BHX A;  1VHO A;  3CPX A;  5HVF A;  1CPS A;  2PIZ A;  3DGV A;  1FT7 A;  2POK A;  2CIJ A;  4ZX9 A;  2PRQ A;  1CBX A;  2AFM A;  2QVP A;  1M4L A;  3QNV A;  3BI0 A;  1IY7 A;  4NJQ A;  4ZY1 A;  3D66 A;  2BO9 A;  4MHN A;  2XEF A;  4C8C A;  3L2N A;  1TKJ A;  4P4D A;  4P4I A;  4K3N A;  4YWY A;  4NFR A;  1ZLI A;  1EE3 P;  2Q43 A;  5D8N A;  1Y9Z A;  5LRG A;  4UF4 A;  5I4M A;  2PJ9 A;  4EWT A;  3FX6 A;  3GLJ A;  3ISX A;  3EIF A;  4PXD A;  4GM5 A;  4DYO A;  5HXD A;  3KR4 A;  3SJF A;  4IAV A;  3BI1 A;  3FEE A;  3FJU A;  1XBU A;  1BPM A;  2PJB A;  3PB9 X;  3CPA A;  5JGF A;  5J1Q A;  1HDQ A;  2WYR A;  4MHY A;  5JM6 A;  4NGT A;  2PJ5 A;  1H8L A;  4AXV A;  2PJC A;  3KR5 A;  4H2K A;  2F7V A;  4KSI A;  2DEA A;  2Q51 A;  1NSA A;  3NH5 A;  3IWW A;  1ZG8 A;  3WC6 A;  2C5Q A;  2PVV A;  4R7M A;  1CPX A;  3KGQ A;  2JBJ A;  2OOT A;  4X3R A;  1PYT B;  2RFH A;  5HVH A;  1JQG A;  5ELY A;  4MHZ A;  4WJB A;  2AFS A;  2WZN A;  4OME A;  1CG2 A;  3B7I A;  3PRT A;  1GYT A;  2HB6 A;  4MCR A;  2AFZ A;  3H8G A;  4MCP A;  4NJR A;  2PJ2 A;  2NYQ A;  1F2P A;  4YN3 A;  3KHX A;  2PJ1 A;  3D67 A;  2EK9 A;  1Y0Y A;  3RZA A;  5LYI A;  3T8W A;  2PJA A;  4FUU A;  3CDX A;  2ZEF A;  4RUH A;  1CX8 A;  5CBM A;  5LYL A;  3DLJ A;  3TX8 A;  2BOA A;  2ZOG A;  2J9A A;  5K8N A;  5DS0 A;  4FBE A;  4OIW A;  3FED A;  4X8I A;  5IB9 A;  1BPN A;  3B3S A;  2G9D A;  3HLP A;  1XMB A;  1ARL A;  2PJ4 A;  2O53 A;  4ZYQ A;  1XRY A;  7CPA A;  3B3W A;  3WAB A;  3SJE A;  2VL1 A;  2V77 A;  4UIB A;  2GU2 A;  1XF1 A;  4C8P A;  3PB8 X;  3B3C A;  4C8F A;  2O4H A;  3B3V A;  2GLJ A;  2ZED A;  2ZEN A;  3NA6 A;  4P4J A;  1DE4 C;  3GB0 A;  4ZX8 A;  2C6P A;  2AFU A;  3SI2 A;  3SI0 A;  4JZ0 A;  3KQZ A;  5IR2 A;  1KWM A;  4OC4 A;  4KNG E;  1Y0R A;  3FVL A;  5JH9 A;  4UIA A;  3LMS A;  4A38 A;  3MN8 A;  3LWU A;  2I3C A;  4OID A;  3SI1 A;  2EK8 A;  3NH8 A;  1ZLH A;  1TKF A;  1OBR A;  4NGS A;  3I6S A;  4PXC A;  4OC1 A;  3IO1 A;  1HEE A;  4ONW A;  1DTD A;  4IHM A;  1F2O A;  4P45 A;  3NFZ A;  2GP4 A;  3IJ3 A;  3IEH A;  3D7H A;  4IK2 A;  4WWV A;  2QYV A;  1Z8L A;  2ABZ A;  1ARM A;  3FMC A;  3PEI A;  4G1P A;  4P44 A;  4CDJ A;  4P6Y A;  1AYE A;  5K8O A;  2FVG A;  2XEG A;  4O23 A;  4R8F A;  4C9A A;  4C9U A;  2ZEG A;  3KQX A;  3PBE A;  3PFE A;  4EFD A;  3B35 A;  3S9N A;  4C8A A;  4W9Y A;  1LCP A;  3VTA A;  1LFW A;  3KL9 A;  2ZEP A;  2AFX A;  3PB4 X;  3KAS A;  3ICU A;  2PJ0 A;  3VAR A;  5F09 A;  4NGN A;  4BD9 A;  2AFO A;  4C9E A;  1TKH A;  1Z5R A;  3N5F A;  4P4B A;  4NGQ A;  3GUX A;  4TJX A;  4NGM A;  1R43 A;  1CP6 A;  3S9L A;  2ANP A;  3RAM A;  1HDU A;  4F9U A;  3ISZ A;  4TWE A;  3SJG A;  4DUK A;  2BCO A;  1UWY A;  4MCS A;  3CT9 A;  1ZG7 A;  3D68 A;  1IGB A;  2EWB A;  4YU9 A;  4MMO A;  4OKO A;  3NH4 A;  1YW6 A;  2ZEH A;  3WC5 A;  4ZI6 A;  5THW A;  4C9V A;  1VHE A;  2GLF A;  4B6Z A;  2NSM A;  4C86 A;  4A94 A;  3FF3 A;  2V8G A;  2PJ7 A;  5K8M A;  3IC1 A;  4OC2 A;  4A37 A;  5HVG A;  2JEW A;  4C99 A;  4P4F A;  4LQG A;  1ELM P;  4UEZ A;  4X2T A;  1F57 A;  4C8U A;  2GRE A;  4ZY2 A;  3V38 A;  1BAV A;  3B3T A;  2PJ8 A;  4Q7A A;  1CP7 A;  2PIY A;  1YME A;  1TXR A;  4C84 A;  1YLO A;  4CDK A;  2CF4 A;  2ZEO A;  3PB6 X;  1LAP A;  2ZEM A;  3K2K A;  5LYD A;  3WC7 A;  1XJO A;  1TF9 A;  2V8D A;  3RBU A;  4OC0 A;  1YW4 A;  3D7F A;  3I74 A;  4EME A;  1QQ9 A;  2RB7 A;  4OP4 A;  3KHZ A;  1ZG9 A;  3IIB A;  2ZEE A;  3D7G A;  2OR4 A;  1AMP A;  3S9M A;  2V8V A;  2PVW A;  2Q4Z A;  4ZY0 A;  3D4U A;  4MHP A;  5CPA A;  5K8P A;  4P10 A;  2XEI A;  2F8H A;  3MRU A;  1Y7E A;  3PB7 X;  4PXB A;  3WT4 A;  2CTB A;  3FEC A;  1WVM A;  2CTC A;  1V6C A;  3D7D A;  1QMU A;  2PCU A;  3VH9 A;  3KI9 A;  2C6C A;  4TJV A;  1VIX A;  2HC9 A;  3V7Z A;  4TNU A;  4C85 A;  2XEJ A;  3PFO A;  4OC5 A;  2IQ6 A;  2PE3 A;  1FNO A;  1VGY A;  4FWU A;  4UEF A;  1BLL E;  1TF8 A;  2PJ6 A;  3B2Y A;  2C6G A;  2ZOF A;  3I1U A;  1YSJ A;  3JRU A;  3H8F A;  4MRI A;  3PBB A;  6CPA A;  5LYF A;  4OC3 A;  3KZW A;  4F9V A;  3H8E A;  1R3N A;  4NGP A;  3HUV A;  4PPZ A;  4PQA A;  3TC8 A;  4MXU A;  2V8H A;  4R76 A;  3FH4 A;  4UEE A;  5D29 A;  3IFE A;  2IMO A;  2JBK A;  4Z65 A;  2IJZ A;  4P4E A;  3VAT A;  1LAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...