4NGNA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 258
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
258
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 258
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngnA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngnA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngnA02
4ZI6A 5LRKA 4RUHA 3BI1A 3KL9A 1PCAA 2Q51A 3IIBA 5K8OA 4UEEA 4MCPA 1TKHA 4MHNA 3KR4A 4MCSA 1ZLHA 2IQ6A 1YW4A 3VTAA 3PFOA 4YU9A 4NGRA 2ZEGA 1UWYA 5LYDA 4C8AA 1HDQA 4MHYA 2PJCA 3CPXA 2PJ3A 3SI0A 2XEIA 1HDUA 1WVMA 4OC3A 3FMCA 7CPAA 4P4BA 2V8GA 4OP4A 1YLOA 2PJ2A 4C9EA 1YSJA 2V8HA 2AFZA 4C9AA 3FEDA 4LQGA 1CX8A 4R7MA 5LYIA 1Y0RA 4NGSA 2EK9A 4R6TA 1Y7EA 4P4FA 4MMOA 2PJ0A 5D8NA 4ZYQA 4A39A 1XBUA 4GM5A 1R3NA 4KSIA 2WZNA 1Q7LA 4P4EA 2PE3A 3CDXA 2ZOFA 1TF8A 3VARA 4EFDA 2NSMA 2PJ8A 4PXBA 3L2NA 3B3SA 4CDJA 4B6ZA 1CP7A 3WABA 2ZEDA 4C99A 5CBMA 1LANA 4MRIA 4C9UA 2PJ6A 3FX6A 4JYWA 1BAVA 3ISXA 3BI0A 4MCQA 4R8FA 3LMSA 2XEJA 4P4IA 2ABZA 3LWUA 4ZX8A 4IAVA 3D7GA 1ARMA 4TNUA 4A37A 3DLJA 1ARLA 2RFHA 4P10A 3FEEA 1F57A 2JEWA 4K3NA 1Y9ZA 1QMUA 3I6SA 4C9VA 3TC8A 2C6CA 3PFEA 1LAMA 2ZOGA 2AFUA 1Y0YA 2OOTA 1TXRA 4P4DA 3B2YA 2IMOA 4ZY2A 4FUUA 2FVGA 2GU2A 3D7DA 3GLJA 3PBEA 5LRGA 4NJQA 4P45A 3SJFA 2F7VA 1VHOA 2V8DA 3MN8A 4X2TA 1AYEA 2QJ8A 4MHZA 5LYLA 2EK8A 3NH8A 1YW6A 2ZEEA 4F9UA 1Z5RA 3KQXA 5DS0A 3I74A 2XEFA 8CPAA 1BPNA 3H8EA 1ELMP 3MRUA 5HVHA 2C6GA 3FH4A 1HEEA 4OKOA 3D7FA 3WC6A 2BCOA 4C8CA 2G9DA 1TF9A 3ICUA 4WJBA 1IY7A 4FBEA 3PEIA 5K8NA 1VGYA 2CTCA 3SJGA 3GUXA 3FJUA 2PCUA 4FAIA 4EMEA 1FNOA 2PIZA 3D4UA 1JQGA 4NGQA 4R76A 3B35A 1CBXA 5THWA 4OIDA 2PJ1A 3SI1A 3T8WA 3SJXA 2VL1A 4TWEA 4C8TA 4TJVA 4UIAA 2AFOA 5F09A 3CT9A 2GLJA 2NYQA 1CPXA 4UEZA 2ZEPA 1Z8LA 3PB8X 5JM6A 5D29A 4DUKA 4G1PA 2JBJA 3TX8A 4NJRA 2J9AA 2Q43A 2XEGA 1ZG7A 3H8GA 1F2OA 2QYVA 1NSAA 2PJ7A 2GLFA 2CTBA 1RTQA 4NGMA 4CPAA 1VIXA 4C8PA 5LYFA 2POKA 3S9NA 4H2KA 4DYOA 5HVGA 4A94A 3PB9X 4PPZA 2JBKA 2C1CA 4MHPA 3B3CA 3D7HA 4BD9A 2CIJA 3D68A 5CPAA 3K2KA 5K8PA 2PJAA 2ZELA 3NA6A 1ZLIA 2ZEOA 4AXVA 1CP6A 2OR4A 1GYTA 5ELYA 4ZY0A 5K8MA 4EWTA 4C8FA 2HB6A 4NGPA 2AFMA 3S9LA 1YMEA 3RAMA 5HVFA 4MXUA 6CPAA 2IJZA 3V38A 3IEHA 3V7ZA 3WC5A 1LAPA 3KHZA 4OC0A 1TKJA 3S9MA 4TJXA 1R43A 2I3CA 4Q7AA 2AFSA 3N5FA 1DTDA 5JGFA 2ZEFA 3PBBA 4F8ZA 4NGTA 1EE3P 1OBRA 1DE4C 1LFWA 1M4LA 4PQAA 1V6CA 2GREA 4NFRA 3KQZA 1QQ9A 3IC1A 1XF1A 4OC1A 1H8LA 3FF3A 4MCRA 2EWBA 3KI9A 3PB4X 4PXCA 5LRJA 2WYRA 2ANPA 2ZENA 4P4JA 1AMPA 2BOAA 2PVVA 4W9YA 1TKFA 4WWVA 2AFXA 3HLPA 4F9VA 3CPAA 4C85A 3RBUA 1BLLE 3IJ3A 4OC4A 5J1QA 4UF4A 5HXDA 3FECA 3KZWA 4ZX9A 2F8HA 3HUVA 4ZY1A 1IGBA 5I4MA 3B3TA 3SJEA 2V77A 3PRTA 3GB0A 4OMEA 2DEAA 1XRYA 3PB7X 1XJOA 2O4HA 5JH9A 3KR5A 4C8UA 3DGVA 4PXDA 4JZ0A 1Z2LA 4OIWA 4KNGE 3IFEA 2PJ9A 4O23A 3NH5A 3ISZA 1ELLP 1BPMA 4FWUA 4YN3A 1PYTB 4C86A 3KGQA 4OC5A 4DJLA 1LOKA 3I1UA 4NGNA 4P44A 2ZEHA 4ONWA 4X3RA 2ZEMA 3VH9A 1XFOA 2AFWA 1CPSA 4UEFA 2PIYA 3D66A 4YWYA 3RZAA 3BHXA 2O53A 3WC7A 3KASA 4A38A 1XMBA 4IHMA 4PXEA 3EIFA 4C9RA 2PRQA 3FVLA 3JRUA 2PJBA 3IO1A 3VATA 1LCPA 2QVPA 3NH4A 2Q4ZA 3IWWA 3BXMA 3PB6X 3K9TA 3D67A 4UIBA 4C84A 3NFZA 3KHXA 2C6PA 4OC2A 3WT4A 4CDKA 3QNVA 5IB9A 3SI2A 1KWMA 4X8IA 1FT7A 3B7IA 4IK2A 2PJ5A 2RB7A 1ZG9A 2PJ4A 1CG2A 2PVWA 4P6YA 3H8FA 1ZG8A 4Z65A 3B3VA 1VHEA 3B3WA 2BO9A 2V8VA 1F2PA 2HC9A 2CF4A
chains in the Genus database with same CATH superfamily
2J8MA 3S6FA 4ZI6A 2DIKA 3F9KC 2OLSA 5LRKA 4RUHA 3TLEA 3BI1A 2Q44A 4QUSA 2Y0MA 3KL9A 3HPHE 1JDEA 1PCAA 3IWGA 2Q51A 3IIBA 5HKYA 1QSNA 4UEEA 4MCPA 1TKHA 3FB3A 5K8OA 1QSTA 2BSWA 2EZAA 3KRVA 1GHEA 1EZAA 3NOJA 4MHNA 4EYSA 3KR4A 4MCSA 3EC4A 1ZLHA 2DLAA 2JEVA 5KTAA 2IQ6A 2B5GA 1YW4A 3VTAA 3W91A 3PFOA 4UWJA 2CNMA 3GYAA 4YU9A 4NGRA 2ZEGA 4CAEA 3QAHA 1XOVA 2FCKA 1UWYA 2FXFA 2Z3KA 3D3SA 3IGRA 5LYDA 3TLCA 4C8AA 4KORA 5EC4A 1HDQA 5FVJA 4MHYA 2PJCA 4A30A 3CPXA 2PJ3A 4KUBA 3SI0A 2XEIA 3FBUA 1Z8TA 2OZGA 3BJ8A 5F9MA 1HDUA 1WVMA 4DNCA 3T05A 3VROA 4OC3A 1S7FA 2R7HA 3FMCA 2C5QA 7CPAA 2Q4YA 4P4BA 2V8GA 4M6GA 4OP4A 3U1BA 1DIKA 1YLOA 4LX9A 2GE3A 2PJ2A 4UFWA 1RO5A 1YSJA 2V8HA 3BUMB 2AFZA 5AG7A 2J8NA 3T07A 4C9AA 2PCNA 3FEDA 5J8CA 2XPOA 4LQGA 1CX8A 1Z8XA 4HNXB 4BPXB 4R7MA 5LYIA 4HKFA 4JLYA 1Y0RA 5F47A 1K4JA 4NGSA 2EK9A 4PSWA 4R6TA 1Y7EA 1KUXA 4P4FA 1Z9UA 1YVHA 2IL4A 4MMOA 4B13A 2PJ0A 5D8NA 1Z4EA 3JVNA 4ZYQA 2FE7A 5AG6A 3OB1B 3NE8A 1Q2YA 4A39A 3VRRA 1XBUA 2GFQA 2VZYA 4GM5A 1CS0B 4QVTA 4PSXA 4CAVA 1NE9A 4MJXA 1R3NA 1ZYMA 4KSIA 2WZNA 1Q7LA 2Y1NA 4OAEA 4BMHA 4P4EA 3TOBA 2PE3A 3CDXA 2ATRA 3ZZIA 3OP0A 3BUWB 1X10A 1TF8A 1UFHA 2ZOFA 4BTFA 3NFQA 2Q4VA 3VARA 2D4OA 3JTKA 4UFXA 4EFDA 2NSMA 2PJ8A 1YVOA 4KLVA 3L2NA 4PXBA 5AG5A 1U6MA 3B3SA 5BWAB 4CZ1A 4C9EA 4CDJA 3G23A 4B6ZA 4CGNA 3S6HA 1CP7A 4KVXA 3WABA 2ZEDA 4XNHC 3IU1A 1IB1E 4MFZA 1KZFA 1QSRA 5CBMA 4C99A 1LANA 4MRIA 4C9UA 4CS0B 2WPWA 2PJ6A 4INJA 2AJ6A 2XPPA 3FX6A 4JYWA 1BAVA 1CJWA 1V0CA 1NXJA 3ISXA 3BI0A 2G3AA 4R3KA 4MCQA 4R8FA 5C88A 2OZUA 3LMSA 3TYXA 2XEJA 4P4IA 2ABZA 2REFA 3LWUA 4ZX8A 4IAVA 3SXNA 3D7GA 1ARMA 2OU2A 4TNUA 1XMTA 3CZXA 4A37A 3DLJA 3LODA 1ARLA 2J8RA 3I9SA 3IU2A 4II9A 2RFHA 5IV0A 4P10A 3FEEA 5F13A 3TOAA 3EZAA 1F57A 4Y49B 3HMJG 2DXQA 3I3GA 2JEWA 4K3NA 1Y9ZA 3DSBA 1QMUA 3EZEA 4H6UA 3I6SA 3TC8A 2B3UA 4JXQA 2C6CA 2Q0YA 2YNCA 5F46A 4C9VA 4ZGYB 2FSRA 2GIVA 1LAMA 3PFEA 2ZOGA 2AFUA 2WUUA 1CE8B 1J3LA 1CM0A 1WK4A 1Y0YA 2PQ8A 3VRQA 2VBQA 3W6SA 2OOTA 1TXRA 1P0HA 2R98A 3R95A 4COGA 4P4DA 3B2YA 4A33A 2IMOA 4KZTA 4ZY2A 4FUUA 1TIQA 4UCPA 2FVGA 2GU2A 3D7DA 3GLJA 5F48A 2FL4A 1M1DA 3PBEA 4U5YA 5LRGA 4B5OA 4NJQA 3G3SA 4P45A 3SJFA 2F7VA 2B4DB 4KOVA 3GJZA 2F5IA 2JDCA 3R9EA 2HWGA 4C2YA 1VHOA 1XIXA 4MHDA 3SHPA 2V8DA 3EXNA 3MN8A 4X2TA 3RYOA 1AYEA 3R9GA 2QJ8A 2D0OA 4OLLA 1M6VB 1VKCA 4MHZA 2X0SA 3MGDA 5LYLA 3EZBA 1Y9WA 1MJ9A 1YQEA 2EK8A 2P0WA 3NH8A 1YW6A 2ZEEA 4UWIA 1GGOA 4F9UA 1Z5RA 2R8VA 3KQXA 5DS0A 3I74A 4CGLA 5IB0A 2XEFA 2P6GA 8CPAA 3PT1A 1BPNA 1J4JA 1ELMP 3H8EA 1VBHA 3MRUA 3TO7A 5HVHA 2C6GA 4AB7A 2DPTA 4MFKA 3FH4A 2PR8A 4AVCA 3TFYA 3H5ZA 1HEEA 1QSMA 2JLMA 4OKOA 3D7FA 1XE4A 5G1ZA 2BCOA 2YNEA 3QAYA 2G9DA 3WC6A 4C8CA 4GPLB 2ZXVA 1TF9A 2H5MA 3ICUA 3OAKA 3F8KA 1MJAA 1IY7A 4H6ZA 4WJBA 4CGPA 5HKZA 3PEIA 4FBEA 4QB9A 3C8OA 5K8NA 1VGYA 4M3SA 1BXRB 2CTCA 1S7KA 3SJGA 4YRHA 2D4PA 3T5MA 2X7BA 3GUXA 3FJUA 3TCVA 5JQ4A 2PCUA 4K30A 2G0BA 1S3ZA 4FAIA 4I49A 3FIXA 4EMEA 2EVNA 4B5PA 1KBLA 1FNOA 2Z3NA 2PIZA 3D4UA 3O8ZA 4NGQA 1JQGA 4R76A 3B35A 2BUEA 4IF5A 2GP4A 2Z3LA 2RC4A 1CBXA 3C26A 5THWA 4PV6A 4OIDA 4CYPA 5FD8A 2WSAA 4C2ZA 2PJ1A 3SI1A 3BUOB 2VZZA 3R96A 2CBLA 4OADA 3EFAA 3SJXA 2VL1A 4MFPA 4TWEA 5G21A 3T8WA 4BINA 4TJVA 4AG7A 4C8TA 4UIAA 2AFOA 5F09A 3CT9A 1XEBA 2GLJA 1CPXA 2NYQA 4NF1A 4KLWA 4R57A 4UEZA 4B5PB 5J8FA 2ZW4A 1S7LA 3F0AA 2ZEPA 3LACA 4RS2A 3HPGG 1S7NA 3H4QA 1Z4RA 1Z8LA 3PB8X 1Q2CA 2CXAA 2ZW5A 5JM6A 3TLZA 5D29A 2JDDA 1WJTA 4R87A 4DUKA 4G1PA 2JBJA 1S60A 3BLNA 3QB8A 3TX8A 4CAWA 4M8DA 4KOWA 5I0CA 2EBJA 2PSWA 4NJRA 4J3GA 3TLYA 2J9AA 2Q43A 1ZL0A 2XEGA 1WWZA 2B58A 2KCWA 1ZG7A 1NMTA 2DF5A 3H8GA 4JXRA 5AG4A 4MFLA 4BPWB 4R3LA 4QBJA 2FT0A 1F2OA 2QYVA 1KEEB 3B8GA 4C7HA 1NSAA 2PJ7A 2GLFA 3OB2B 2CTBA 2K5TA 2B4DA 1YK3A 1RTQA 3A9LA 2HUZA 4NGMA 4YGOA 2AE6A 4CPAA 1C30B 3FYNA 1VIXA 2CNTA 4C8PA 5LYFA 2POKA 3S9NA 2PRBA 3IWEA 4KVOE 4HPSA 4CRZB 2A4NA 1KC7A 2EZCA 4H2KA 3SXOA 1I1DA 4CGOA 4DYOA 4EVYA 5HVGA 1B47A 4KOUA 3UY5A 3PB9X 4PPZA 4A94A 4BBHA 3D8PA 2JBKA 1YGHA 2C1CA 4MHPA 3VWEA 5BY0A 3B3CA 3D7HA 4A4CA 2PDOA 2CIJA 3D68A 4BD9A 5CPAA 3K2KA 5F5XA 2Z11A 4CAXA 5K8PA 2QIRA 2PJAA 2VQYA 2ZELA 3NA6A 1ZLIA 2ZEOA 4L8AA 2Q7BA 1CP6A 2OR4A 3BUXB 1GYTA 1N71A 2ZW7A 3DR6A 3TLGB 5ELYA 4CYQA 2C27A 4ZY0A 1M4DA 5K8MA 4A2ZA 4EWTA 5ISVA 3G8WA 2HB6A 4J0NA 4NGPA 4AVBA 2AFMA 4C8FA 3S9LA 1YMEA 1NBWA 3RAMA 5HVFA 4MXUA 4COBA 4LUAA 4U9ZA 6CPAA 2IJZA 2I00A 3IEHA 2XPNA 3V38A 1PUAA 5EMIA 3V7ZA 5J3XA 4GS4A 3OWCA 3T9YA 1LAPA 3TTHA 3ZNIA 3WC5A 4CO9A 2HQYA 4E94A 4IIYA 2E28A 3WR7A 4FD6A 4A95A 4E8OA 1PU9A 2DPSA 3KHZA 2FIWA 4CGMA 1I12A 2YNCC 5A28A 1XF8A 4KS9A 4OC0A 1TKJA 2I79A 4H89A 3S9MA 4JWPA 3S6GA 4E2AA 2EZBA 2MP0A 1R43A 4JVOA 2UV8G 2I3CA 4PK2A 4Q7AA 4UBRA 3N7ZA 2AFSA 3N5FA 1DTDA 5JGFA 2ZEFA 3PBBA 4B14A 4NGTA 4F8ZA 2AUNA 3D2PA 3NE7A 1EE3P 1MK4A 4XPDC 1OBRA 5A27A 1DE4C 1LFWA 4CYNA 1M4LA 1C3OB 1YREA 4PQAA 4AG9A 1KUVA 1V6CA 4A32A 3TLGA 4F6AA 4F0YA 2GREA 4NFRA 3KQZA 5C82A 2Y1MA 1RXTA 1QQ9A 3CXQA 1ON0A 3IC1A 1XF1A 1S5KA 4OC1A 1KUYA 1H8LA 3FNCA 4KOTA 3DR8A 4MFQA 1IYLA 3BJ7A 2AUMA 3FF3A 5JPHA 4MCRA 3W6XA 3RO0A 4MY0A 4UA3A 4C7IA 2EWBA 3KI9A 3PB4X 4MBUA 2PC1A 4NXYA 4PXCA 5LRJA 2HI6A 3D2MA 2WYRA 2ANPA 3VWDA 4MI1A 2ZENA 4M6HA 4P4JA 2B4BA 4AVAA 1AMPA 4LQ6A 2EUIA 2R1IA 2FM4A 2BOAA 5KTDA 2HV2A 4UFVA 2O28A 2PVVA 4W9YA 1TKFA 1EO0A 3GY9A 4WWVA 4FD7A 2AFXA 2REEA 4JD6A 4NSQA 4QC6A 3HLPA 4F9VA 3CPAA 4C85A 2QECA 5E96A 4RR2B 3RBUA 4U9YA 2YJVA 1FBVA 3VRPA 1BLLE 3IJ3A 4OC4A 5J1QA 1VHSA 4B10A 1YLEA 2VI7A 2Q7SA 4UF4A 1JWQA 5HXDA 3FECA 3KZWA 4RI1A 1EZBA 1B6BA 1QSOA 2B3VA 3CXSA 4NEXA 4ZX9A 1M4GA 3PZJA 1Q5XA 2F8HA 2YJTA 1I21A 2GANA 3HUVA 3P2FA 2ZW6A 1IGBA 4RN7A 4ZY1A 3BUNB 4XPDB 5CNPA 5I4MA 3B3TA 3SJEA 2V77A 4MFJA 3PRTA 4Y49C 4X5KA 3V8IA 4IIXA 3GB0A 4BPUB 2QMLA 4OMEA 4M6IA 2VXKA 4FD5A 5AGEA 4C2XA 5HMNA 3JUWA 2HROA 3TO6A 3TT2A 2DEAA 4H1HA 1XRYA 2NMTA 2B4JC 1IYKA 3CXPA 3PB7X 4NCZA 4KOYA 4UCMA 1XJOA 2O4HA 2FIAA 3KR5A 5JH9A 4C8UA 2YNDA 2N3AB 2VKZG 3DDDA 3DGVA 4PXDA 4JZ0A 4IUSA 4TJXA 3S6KA 2Q04A 3LD2A 1Z2LA 4OIWA 4MI4A 1ZRSA 4KNGE 1P4NA 5HH1A 5KTCA 3IFEA 2PJ9A 1T36B 4PK3A 4KSAA 4F0XA 2R82A 4O23A 5F1YA 1X12A 2BEIA 1M44A 3NH5A 3ISZA 3RNZA 1ELLP 1BPMA 4ORFA 3U88C 4FWUA 2YGWA 4YN3A 1PYTB 4CYOA 4C68A 4C86A 1Y9KA 3PGPA 4L89A 3KGQA 4OC5A 4XNHB 5DWMA 1A2ZA 4DJLA 2ARHA 3EY5A 5G22A 3TLAA 3TE4A 5DWNA 1IIDA 1LOKA 3I1UA 4NGNA 3PP9A 4P44A 3T0TA 3FXTA 2ZEHA 2Z3PA 4ONWA 4X3RA 3R9FA 4GXHA 2ODFA 5HKWA 2ZEMA 3VH9A 4HNYB 4M85A 1XFOA 1AUGA 2AFWA 2Z10A 2Z3MA 3SR3A 3TLBA 2PR1A 4CRYB 1Q2DA 4KOXA 4HNWB 4Q38A 5IX3A 3VGOA 3DNSA 1CPSA 4YFJA 4UEFA 1BO4A 2PIYA 3D66A 1BOBA 1IOFA 4YWYA 4E5SA 3RZAA 1L0CA 3BHXA 2O53A 4MJ8A 3WC7A 4B12A 3KASA 4A38A 1XMBA 2Z3OA 4KUAA 5EBVA 4ONUA 2WPXA 3GKRA 4IHMA 3TO9A 2EO8A 1ZO0A 4PXEA 4AXVA 3EIFA 4A31A 2PRQA 4C9RA 3PFVA 5JVLA 3FVLA 3JRUA 3K4IA 2PJBA 3IO1A 5G20A 2B0AA 3VATA 1LCPA 3FRMA 1YX0A 4CAFA 2QVPA 3NH4A 1Y7RA 2Q4ZA 1IOIA 3IWWA 1FY7A 3BXMA 3PB6X 1LRZA 3PLFB 3D67A 3K9TA 3R1KA 4UIBA 3NFZA 4C84A 3K9UA 3F5BA 3KHXA 4B11A 2C6PA 3EO4A 2B5GB 1Z9EA 5GCNA 5K99A 4KSFA 4OC2A 1R61A 3WT4A 1VI4A 3QNVA 4UCNA 4CDKA 2OZHA 1YVKA 2XPLA 5IB9A 5H86A 3SI2A 3KKWA 4MY3A 1B87A 1KWMA 3T90A 4X8IA 2D0PA 2P6EA 1JDBC 1FT7A 3B7IA 2BL1A 4IK2A 4Q36A 1M4IA 1IU8A 1MJBA 2G3TA 2PJ5A 3P2HA 1VBGA 2RB7A 1ZG9A 5AXIA 2PJ4A 1CG2A 2CNSA 2VEZA 2PVWA 4P6YA 4FD4A 1SQHA 4KVME 5F49A 2OB0A 2P6FA 3H8FA 1ZG8A 1OZPA 1R57A 4KOSA 4Z65A 5JYBA 1A9XB 3B3VA 1VHEA 4JJXA 4A4BA 2CY2A 1YR0A 3B3WA 3GIUA 2OH1A 5H84A 2BO9A 2V8VA 3VRNA 4E0AA 4R9MA 4XPLA 4ZBGA 2FS5A 1F2PA 1IICA 1NSLA 5IR2A 2HC9A 2ZPAA 1Z8WA 3E0KA 4XPKA 3ZJ0A 2CF4A 2Z0ZA
chains in the Genus database with same CATH topology
4ZI6A 5LRKA 4RUHA 3BI1A 3KL9A 1PCAA 2Q51A 3IIBA 5K8OA 4UEEA 4MCPA 1TKHA 4MHNA 3KR4A 4MCSA 1ZLHA 2IQ6A 1YW4A 3VTAA 3PFOA 4YU9A 4NGRA 2ZEGA 1UWYA 5LYDA 4C8AA 1HDQA 4MHYA 2PJCA 3CPXA 2PJ3A 3SI0A 2XEIA 1HDUA 1WVMA 4OC3A 3FMCA 2C5QA 7CPAA 4P4BA 2V8GA 4OP4A 1YLOA 2PJ2A 4C9EA 1YSJA 2V8HA 2AFZA 4C9AA 3FEDA 4LQGA 1CX8A 4R7MA 5LYIA 1Y0RA 4NGSA 2EK9A 4R6TA 1Y7EA 4P4FA 4MMOA 2PJ0A 5D8NA 4ZYQA 4A39A 1XBUA 4GM5A 1R3NA 4KSIA 2WZNA 1Q7LA 4P4EA 2PE3A 3CDXA 2ZOFA 1TF8A 3VARA 4EFDA 2NSMA 2PJ8A 4PXBA 3L2NA 3B3SA 4CDJA 4B6ZA 1CP7A 3WABA 2ZEDA 4C99A 5CBMA 1LANA 4MRIA 4C9UA 2PJ6A 3FX6A 4JYWA 1BAVA 3ISXA 3BI0A 4MCQA 4R8FA 3LMSA 2XEJA 4P4IA 2ABZA 3LWUA 4ZX8A 4IAVA 3D7GA 1ARMA 4TNUA 4A37A 3DLJA 1ARLA 2RFHA 4P10A 3FEEA 1F57A 2JEWA 4K3NA 1Y9ZA 1QMUA 3I6SA 4C9VA 3TC8A 2C6CA 3PFEA 1LAMA 2ZOGA 2AFUA 1Y0YA 2OOTA 1TXRA 4P4DA 3B2YA 2IMOA 4ZY2A 4FUUA 2FVGA 2GU2A 3D7DA 3GLJA 3PBEA 5LRGA 4NJQA 4P45A 3SJFA 2F7VA 1VHOA 2V8DA 3MN8A 4X2TA 1AYEA 2QJ8A 4MHZA 5LYLA 2EK8A 3NH8A 1YW6A 2ZEEA 4F9UA 1Z5RA 3KQXA 5DS0A 3I74A 2XEFA 8CPAA 1BPNA 3H8EA 1ELMP 3MRUA 5HVHA 2C6GA 3FH4A 1HEEA 4OKOA 3D7FA 3WC6A 2BCOA 4C8CA 2G9DA 1TF9A 3ICUA 4WJBA 1IY7A 4FBEA 3PEIA 5K8NA 1VGYA 2CTCA 3SJGA 3GUXA 3FJUA 2PCUA 4FAIA 4EMEA 1FNOA 2PIZA 3D4UA 1JQGA 4NGQA 4R76A 2GP4A 3B35A 1CBXA 5THWA 4OIDA 2PJ1A 3SI1A 3T8WA 3SJXA 2VL1A 4TWEA 4C8TA 4TJVA 4UIAA 2AFOA 5F09A 3CT9A 2GLJA 2NYQA 1CPXA 4UEZA 2ZEPA 1Z8LA 3PB8X 5JM6A 5D29A 4DUKA 4G1PA 2JBJA 3TX8A 4NJRA 2J9AA 2Q43A 2XEGA 1ZG7A 3H8GA 1F2OA 2QYVA 1NSAA 2PJ7A 2GLFA 2CTBA 1RTQA 4NGMA 4CPAA 1VIXA 4C8PA 5LYFA 2POKA 3S9NA 4H2KA 4DYOA 5HVGA 4A94A 3PB9X 4PPZA 2JBKA 2C1CA 4MHPA 3B3CA 3D7HA 4BD9A 2CIJA 3D68A 5CPAA 3K2KA 5K8PA 2PJAA 2ZELA 3NA6A 1ZLIA 2ZEOA 4AXVA 1CP6A 2OR4A 1GYTA 5ELYA 4ZY0A 5K8MA 4EWTA 4C8FA 2HB6A 4NGPA 2AFMA 3S9LA 1YMEA 3RAMA 5HVFA 4MXUA 6CPAA 2IJZA 3V38A 3IEHA 3V7ZA 3WC5A 1LAPA 3KHZA 4OC0A 1TKJA 3S9MA 4TJXA 1R43A 2I3CA 4Q7AA 2AFSA 3N5FA 1DTDA 5JGFA 2ZEFA 3PBBA 4F8ZA 4NGTA 1EE3P 1OBRA 1DE4C 1LFWA 1M4LA 4PQAA 1V6CA 2GREA 4NFRA 3KQZA 1QQ9A 3IC1A 1XF1A 4OC1A 1H8LA 3FF3A 4MCRA 2EWBA 3KI9A 3PB4X 4PXCA 5LRJA 2WYRA 2ANPA 2ZENA 4P4JA 1AMPA 2BOAA 2PVVA 4W9YA 1TKFA 4WWVA 2AFXA 3HLPA 4F9VA 3CPAA 4C85A 3RBUA 1BLLE 3IJ3A 4OC4A 5J1QA 4UF4A 5HXDA 3FECA 3KZWA 4ZX9A 2F8HA 3HUVA 4ZY1A 1IGBA 5I4MA 3B3TA 3SJEA 2V77A 3PRTA 3GB0A 4OMEA 2DEAA 1XRYA 3PB7X 1XJOA 2O4HA 5JH9A 3KR5A 4C8UA 3DGVA 4PXDA 4JZ0A 1Z2LA 4OIWA 4KNGE 3IFEA 2PJ9A 4O23A 3NH5A 3ISZA 1ELLP 1BPMA 4FWUA 4YN3A 1PYTB 4C86A 3KGQA 4OC5A 4DJLA 1LOKA 3I1UA 4NGNA 4P44A 2ZEHA 4ONWA 4X3RA 2ZEMA 3VH9A 1XFOA 2AFWA 1CPSA 4UEFA 2PIYA 3D66A 4YWYA 3RZAA 3BHXA 2O53A 3WC7A 3KASA 4A38A 1XMBA 4IHMA 4PXEA 3EIFA 4C9RA 2PRQA 3FVLA 3JRUA 2PJBA 3IO1A 3VATA 1LCPA 2QVPA 3NH4A 2Q4ZA 3IWWA 3BXMA 3PB6X 3K9TA 3D67A 4UIBA 4C84A 3NFZA 3KHXA 2C6PA 4OC2A 3WT4A 4CDKA 3QNVA 5IB9A 3SI2A 1KWMA 4X8IA 1FT7A 3B7IA 4IK2A 2PJ5A 2RB7A 1ZG9A 2PJ4A 1CG2A 2PVWA 4P6YA 3H8FA 1ZG8A 4Z65A 3B3VA 1VHEA 3B3WA 2BO9A 2V8VA 1F2PA 5IR2A 2HC9A 2CF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI6 A;  5LRK A;  4RUH A;  3BI1 A;  3KL9 A;  1PCA A;  2Q51 A;  3IIB A;  5K8O A;  4UEE A;  4MCP A;  1TKH A;  4MHN A;  3KR4 A;  4MCS A;  1ZLH A;  2IQ6 A;  1YW4 A;  3VTA A;  3PFO A;  4YU9 A;  4NGR A;  2ZEG A;  1UWY A;  5LYD A;  4C8A A;  1HDQ A;  4MHY A;  2PJC A;  3CPX A;  2PJ3 A;  3SI0 A;  2XEI A;  1HDU A;  1WVM A;  4OC3 A;  3FMC A;  7CPA A;  4P4B A;  2V8G A;  4OP4 A;  1YLO A;  2PJ2 A;  4C9E A;  1YSJ A;  2V8H A;  2AFZ A;  4C9A A;  3FED A;  4LQG A;  1CX8 A;  4R7M A;  5LYI A;  1Y0R A;  4NGS A;  2EK9 A;  4R6T A;  1Y7E A;  4P4F A;  4MMO A;  2PJ0 A;  5D8N A;  4ZYQ A;  4A39 A;  1XBU A;  4GM5 A;  1R3N A;  4KSI A;  2WZN A;  1Q7L A;  4P4E A;  2PE3 A;  3CDX A;  2ZOF A;  1TF8 A;  3VAR A;  4EFD A;  2NSM A;  2PJ8 A;  4PXB A;  3L2N A;  3B3S A;  4CDJ A;  4B6Z A;  1CP7 A;  3WAB A;  2ZED A;  4C99 A;  5CBM A;  1LAN A;  4MRI A;  4C9U A;  2PJ6 A;  3FX6 A;  4JYW A;  1BAV A;  3ISX A;  3BI0 A;  4MCQ A;  4R8F A;  3LMS A;  2XEJ A;  4P4I A;  2ABZ A;  3LWU A;  4ZX8 A;  4IAV A;  3D7G A;  1ARM A;  4TNU A;  4A37 A;  3DLJ A;  1ARL A;  2RFH A;  4P10 A;  3FEE A;  1F57 A;  2JEW A;  4K3N A;  1Y9Z A;  1QMU A;  3I6S A;  4C9V A;  3TC8 A;  2C6C A;  3PFE A;  1LAM A;  2ZOG A;  2AFU A;  1Y0Y A;  2OOT A;  1TXR A;  4P4D A;  3B2Y A;  2IMO A;  4ZY2 A;  4FUU A;  2FVG A;  2GU2 A;  3D7D A;  3GLJ A;  3PBE A;  5LRG A;  4NJQ A;  4P45 A;  3SJF A;  2F7V A;  1VHO A;  2V8D A;  3MN8 A;  4X2T A;  1AYE A;  2QJ8 A;  4MHZ A;  5LYL A;  2EK8 A;  3NH8 A;  1YW6 A;  2ZEE A;  4F9U A;  1Z5R A;  3KQX A;  5DS0 A;  3I74 A;  2XEF A;  8CPA A;  1BPN A;  3H8E A;  1ELM P;  3MRU A;  5HVH A;  2C6G A;  3FH4 A;  1HEE A;  4OKO A;  3D7F A;  3WC6 A;  2BCO A;  4C8C A;  2G9D A;  1TF9 A;  3ICU A;  4WJB A;  1IY7 A;  4FBE A;  3PEI A;  5K8N A;  1VGY A;  2CTC A;  3SJG A;  3GUX A;  3FJU A;  2PCU A;  4FAI A;  4EME A;  1FNO A;  2PIZ A;  3D4U A;  1JQG A;  4NGQ A;  4R76 A;  3B35 A;  1CBX A;  5THW A;  4OID A;  2PJ1 A;  3SI1 A;  3T8W A;  3SJX A;  2VL1 A;  4TWE A;  4C8T A;  4TJV A;  4UIA A;  2AFO A;  5F09 A;  3CT9 A;  2GLJ A;  2NYQ A;  1CPX A;  4UEZ A;  2ZEP A;  1Z8L A;  3PB8 X;  5JM6 A;  5D29 A;  4DUK A;  4G1P A;  2JBJ A;  3TX8 A;  4NJR A;  2J9A A;  2Q43 A;  2XEG A;  1ZG7 A;  3H8G A;  1F2O A;  2QYV A;  1NSA A;  2PJ7 A;  2GLF A;  2CTB A;  1RTQ A;  4NGM A;  4CPA A;  1VIX A;  4C8P A;  5LYF A;  2POK A;  3S9N A;  4H2K A;  4DYO A;  5HVG A;  4A94 A;  3PB9 X;  4PPZ A;  2JBK A;  2C1C A;  4MHP A;  3B3C A;  3D7H A;  4BD9 A;  2CIJ A;  3D68 A;  5CPA A;  3K2K A;  5K8P A;  2PJA A;  2ZEL A;  3NA6 A;  1ZLI A;  2ZEO A;  4AXV A;  1CP6 A;  2OR4 A;  1GYT A;  5ELY A;  4ZY0 A;  5K8M A;  4EWT A;  4C8F A;  2HB6 A;  4NGP A;  2AFM A;  3S9L A;  1YME A;  3RAM A;  5HVF A;  4MXU A;  6CPA A;  2IJZ A;  3V38 A;  3IEH A;  3V7Z A;  3WC5 A;  1LAP A;  3KHZ A;  4OC0 A;  1TKJ A;  3S9M A;  4TJX A;  1R43 A;  2I3C A;  4Q7A A;  2AFS A;  3N5F A;  1DTD A;  5JGF A;  2ZEF A;  3PBB A;  4F8Z A;  4NGT A;  1EE3 P;  1OBR A;  1DE4 C;  1LFW A;  1M4L A;  4PQA A;  1V6C A;  2GRE A;  4NFR A;  3KQZ A;  1QQ9 A;  3IC1 A;  1XF1 A;  4OC1 A;  1H8L A;  3FF3 A;  4MCR A;  2EWB A;  3KI9 A;  3PB4 X;  4PXC A;  5LRJ A;  2WYR A;  2ANP A;  2ZEN A;  4P4J A;  1AMP A;  2BOA A;  2PVV A;  4W9Y A;  1TKF A;  4WWV A;  2AFX A;  3HLP A;  4F9V A;  3CPA A;  4C85 A;  3RBU A;  1BLL E;  3IJ3 A;  4OC4 A;  5J1Q A;  4UF4 A;  5HXD A;  3FEC A;  3KZW A;  4ZX9 A;  2F8H A;  3HUV A;  4ZY1 A;  1IGB A;  5I4M A;  3B3T A;  3SJE A;  2V77 A;  3PRT A;  3GB0 A;  4OME A;  2DEA A;  1XRY A;  3PB7 X;  1XJO A;  2O4H A;  5JH9 A;  3KR5 A;  4C8U A;  3DGV A;  4PXD A;  4JZ0 A;  1Z2L A;  4OIW A;  4KNG E;  3IFE A;  2PJ9 A;  4O23 A;  3NH5 A;  3ISZ A;  1ELL P;  1BPM A;  4FWU A;  4YN3 A;  1PYT B;  4C86 A;  3KGQ A;  4OC5 A;  4DJL A;  1LOK A;  3I1U A;  4NGN A;  4P44 A;  2ZEH A;  4ONW A;  4X3R A;  2ZEM A;  3VH9 A;  1XFO A;  2AFW A;  1CPS A;  4UEF A;  2PIY A;  3D66 A;  4YWY A;  3RZA A;  3BHX A;  2O53 A;  3WC7 A;  3KAS A;  4A38 A;  1XMB A;  4IHM A;  4PXE A;  3EIF A;  4C9R A;  2PRQ A;  3FVL A;  3JRU A;  2PJB A;  3IO1 A;  3VAT A;  1LCP A;  2QVP A;  3NH4 A;  2Q4Z A;  3IWW A;  3BXM A;  3PB6 X;  3K9T A;  3D67 A;  4UIB A;  4C84 A;  3NFZ A;  3KHX A;  2C6P A;  4OC2 A;  3WT4 A;  4CDK A;  3QNV A;  5IB9 A;  3SI2 A;  1KWM A;  4X8I A;  1FT7 A;  3B7I A;  4IK2 A;  2PJ5 A;  2RB7 A;  1ZG9 A;  2PJ4 A;  1CG2 A;  2PVW A;  4P6Y A;  3H8F A;  1ZG8 A;  4Z65 A;  3B3V A;  1VHE A;  3B3W A;  2BO9 A;  2V8V A;  1F2P A;  2HC9 A;  2CF4 A; 
#chains in the Genus database with same CATH topology
 2J8M A;  3S6F A;  4ZI6 A;  2DIK A;  3F9K C;  2OLS A;  5LRK A;  4RUH A;  3TLE A;  3BI1 A;  2Q44 A;  4QUS A;  2Y0M A;  3KL9 A;  3HPH E;  1JDE A;  1PCA A;  3IWG A;  2Q51 A;  3IIB A;  5HKY A;  1QSN A;  4UEE A;  4MCP A;  1TKH A;  3FB3 A;  5K8O A;  1QST A;  2BSW A;  2EZA A;  3KRV A;  1GHE A;  1EZA A;  3NOJ A;  4MHN A;  4EYS A;  3KR4 A;  4MCS A;  3EC4 A;  1ZLH A;  2DLA A;  2JEV A;  5KTA A;  2IQ6 A;  2B5G A;  1YW4 A;  3VTA A;  3W91 A;  3PFO A;  4UWJ A;  2CNM A;  3GYA A;  4YU9 A;  4NGR A;  2ZEG A;  4CAE A;  3QAH A;  1XOV A;  2FCK A;  1UWY A;  2FXF A;  2Z3K A;  3D3S A;  3IGR A;  5LYD A;  3TLC A;  4C8A A;  4KOR A;  5EC4 A;  1HDQ A;  5FVJ A;  4MHY A;  2PJC A;  4A30 A;  3CPX A;  2PJ3 A;  4KUB A;  3SI0 A;  2XEI A;  3FBU A;  1Z8T A;  2OZG A;  3BJ8 A;  5F9M A;  1HDU A;  1WVM A;  4DNC A;  3T05 A;  3VRO A;  4OC3 A;  1S7F A;  2R7H A;  3FMC A;  2C5Q A;  7CPA A;  2Q4Y A;  4P4B A;  2V8G A;  4M6G A;  4OP4 A;  3U1B A;  1DIK A;  1YLO A;  4LX9 A;  2GE3 A;  2PJ2 A;  4UFW A;  1RO5 A;  1YSJ A;  2V8H A;  3BUM B;  2AFZ A;  5AG7 A;  2J8N A;  3T07 A;  4C9A A;  2PCN A;  3FED A;  5J8C A;  2XPO A;  4LQG A;  1CX8 A;  1Z8X A;  4HNX B;  4BPX B;  4R7M A;  5LYI A;  4HKF A;  4JLY A;  1Y0R A;  5F47 A;  1K4J A;  4NGS A;  2EK9 A;  4PSW A;  4R6T A;  1Y7E A;  1KUX A;  4P4F A;  1Z9U A;  1YVH A;  2IL4 A;  4MMO A;  4B13 A;  2PJ0 A;  5D8N A;  1Z4E A;  3JVN A;  4ZYQ A;  2FE7 A;  5AG6 A;  3OB1 B;  3NE8 A;  1Q2Y A;  4A39 A;  3VRR A;  1XBU A;  2GFQ A;  2VZY A;  4GM5 A;  1CS0 B;  4QVT A;  4PSX A;  4CAV A;  1NE9 A;  4MJX A;  1R3N A;  1ZYM A;  4KSI A;  2WZN A;  1Q7L A;  2Y1N A;  4OAE A;  4BMH A;  4P4E A;  3TOB A;  2PE3 A;  3CDX A;  2ATR A;  3ZZI A;  3OP0 A;  3BUW B;  1X10 A;  1TF8 A;  1UFH A;  2ZOF A;  4BTF A;  3NFQ A;  2Q4V A;  3VAR A;  2D4O A;  3JTK A;  4UFX A;  4EFD A;  2NSM A;  2PJ8 A;  1YVO A;  4KLV A;  3L2N A;  4PXB A;  5AG5 A;  1U6M A;  3B3S A;  5BWA B;  4CZ1 A;  4C9E A;  4CDJ A;  3G23 A;  4B6Z A;  4CGN A;  3S6H A;  1CP7 A;  4KVX A;  3WAB A;  2ZED A;  4XNH C;  3IU1 A;  1IB1 E;  4MFZ A;  1KZF A;  1QSR A;  5CBM A;  4C99 A;  1LAN A;  4MRI A;  4C9U A;  4CS0 B;  2WPW A;  2PJ6 A;  4INJ A;  2AJ6 A;  2XPP A;  3FX6 A;  4JYW A;  1BAV A;  1CJW A;  1V0C A;  1NXJ A;  3ISX A;  3BI0 A;  2G3A A;  4R3K A;  4MCQ A;  4R8F A;  5C88 A;  2OZU A;  3LMS A;  3TYX A;  2XEJ A;  4P4I A;  2ABZ A;  2REF A;  3LWU A;  4ZX8 A;  4IAV A;  3SXN A;  3D7G A;  1ARM A;  2OU2 A;  4TNU A;  1XMT A;  3CZX A;  4A37 A;  3DLJ A;  3LOD A;  1ARL A;  2J8R A;  3I9S A;  3IU2 A;  4II9 A;  2RFH A;  5IV0 A;  4P10 A;  3FEE A;  5F13 A;  3TOA A;  3EZA A;  1F57 A;  4Y49 B;  3HMJ G;  2DXQ A;  3I3G A;  2JEW A;  4K3N A;  1Y9Z A;  3DSB A;  1QMU A;  3EZE A;  4H6U A;  3I6S A;  3TC8 A;  2B3U A;  4JXQ A;  2C6C A;  2Q0Y A;  2YNC A;  5F46 A;  4C9V A;  4ZGY B;  2FSR A;  2GIV A;  1LAM A;  3PFE A;  2ZOG A;  2AFU A;  2WUU A;  1CE8 B;  1J3L A;  1CM0 A;  1WK4 A;  1Y0Y A;  2PQ8 A;  3VRQ A;  2VBQ A;  3W6S A;  2OOT A;  1TXR A;  1P0H A;  2R98 A;  3R95 A;  4COG A;  4P4D A;  3B2Y A;  4A33 A;  2IMO A;  4KZT A;  4ZY2 A;  4FUU A;  1TIQ A;  4UCP A;  2FVG A;  2GU2 A;  3D7D A;  3GLJ A;  5F48 A;  2FL4 A;  1M1D A;  3PBE A;  4U5Y A;  5LRG A;  4B5O A;  4NJQ A;  3G3S A;  4P45 A;  3SJF A;  2F7V A;  2B4D B;  4KOV A;  3GJZ A;  2F5I A;  2JDC A;  3R9E A;  2HWG A;  4C2Y A;  1VHO A;  1XIX A;  4MHD A;  3SHP A;  2V8D A;  3EXN A;  3MN8 A;  4X2T A;  3RYO A;  1AYE A;  3R9G A;  2QJ8 A;  2D0O A;  4OLL A;  1M6V B;  1VKC A;  4MHZ A;  2X0S A;  3MGD A;  5LYL A;  3EZB A;  1Y9W A;  1MJ9 A;  1YQE A;  2EK8 A;  2P0W A;  3NH8 A;  1YW6 A;  2ZEE A;  4UWI A;  1GGO A;  4F9U A;  1Z5R A;  2R8V A;  3KQX A;  5DS0 A;  3I74 A;  4CGL A;  5IB0 A;  2XEF A;  2P6G A;  8CPA A;  3PT1 A;  1BPN A;  1J4J A;  1ELM P;  3H8E A;  1VBH A;  3MRU A;  3TO7 A;  5HVH A;  2C6G A;  4AB7 A;  2DPT A;  4MFK A;  3FH4 A;  2PR8 A;  4AVC A;  3TFY A;  3H5Z A;  1HEE A;  1QSM A;  2JLM A;  4OKO A;  3D7F A;  1XE4 A;  5G1Z A;  2BCO A;  2YNE A;  3QAY A;  2G9D A;  3WC6 A;  4C8C A;  4GPL B;  2ZXV A;  1TF9 A;  2H5M A;  3ICU A;  3OAK A;  3F8K A;  1MJA A;  1IY7 A;  4H6Z A;  4WJB A;  4CGP A;  5HKZ A;  3PEI A;  4FBE A;  4QB9 A;  3C8O A;  5K8N A;  1VGY A;  4M3S A;  1BXR B;  2CTC A;  1S7K A;  3SJG A;  4YRH A;  2D4P A;  3T5M A;  2X7B A;  3GUX A;  3FJU A;  3TCV A;  5JQ4 A;  2PCU A;  4K30 A;  2G0B A;  1S3Z A;  4FAI A;  4I49 A;  3FIX A;  4EME A;  2EVN A;  4B5P A;  1KBL A;  1FNO A;  2Z3N A;  2PIZ A;  3D4U A;  3O8Z A;  4NGQ A;  1JQG A;  4R76 A;  3B35 A;  2BUE A;  4IF5 A;  2GP4 A;  2Z3L A;  2RC4 A;  1CBX A;  3C26 A;  5THW A;  4PV6 A;  4OID A;  4CYP A;  5FD8 A;  2WSA A;  4C2Z A;  2PJ1 A;  3SI1 A;  3BUO B;  2VZZ A;  3R96 A;  2CBL A;  4OAD A;  3EFA A;  3SJX A;  2VL1 A;  4MFP A;  4TWE A;  5G21 A;  3T8W A;  4BIN A;  4TJV A;  4AG7 A;  4C8T A;  4UIA A;  2AFO A;  5F09 A;  3CT9 A;  1XEB A;  2GLJ A;  1CPX A;  2NYQ A;  4NF1 A;  4KLW A;  4R57 A;  4UEZ A;  4B5P B;  5J8F A;  2ZW4 A;  1S7L A;  3F0A A;  2ZEP A;  3LAC A;  4RS2 A;  3HPG G;  1S7N A;  3H4Q A;  1Z4R A;  1Z8L A;  3PB8 X;  1Q2C A;  2CXA A;  2ZW5 A;  5JM6 A;  3TLZ A;  5D29 A;  2JDD A;  1WJT A;  4R87 A;  4DUK A;  4G1P A;  2JBJ A;  1S60 A;  3BLN A;  3QB8 A;  3TX8 A;  4CAW A;  4M8D A;  4KOW A;  5I0C A;  2EBJ A;  2PSW A;  4NJR A;  4J3G A;  3TLY A;  2J9A A;  2Q43 A;  1ZL0 A;  2XEG A;  1WWZ A;  2B58 A;  2KCW A;  1ZG7 A;  1NMT A;  2DF5 A;  3H8G A;  4JXR A;  5AG4 A;  4MFL A;  4BPW B;  4R3L A;  4QBJ A;  2FT0 A;  1F2O A;  2QYV A;  1KEE B;  3B8G A;  4C7H A;  1NSA A;  2PJ7 A;  2GLF A;  3OB2 B;  2CTB A;  2K5T A;  2B4D A;  1YK3 A;  1RTQ A;  3A9L A;  2HUZ A;  4NGM A;  4YGO A;  2AE6 A;  4CPA A;  1C30 B;  3FYN A;  1VIX A;  2CNT A;  4C8P A;  5LYF A;  2POK A;  3S9N A;  2PRB A;  3IWE A;  4KVO E;  4HPS A;  4CRZ B;  2A4N A;  1KC7 A;  2EZC A;  4H2K A;  3SXO A;  1I1D A;  4CGO A;  4DYO A;  4EVY A;  5HVG A;  1B47 A;  4KOU A;  3UY5 A;  3PB9 X;  4PPZ A;  4A94 A;  4BBH A;  3D8P A;  2JBK A;  1YGH A;  2C1C A;  4MHP A;  3VWE A;  5BY0 A;  3B3C A;  3D7H A;  4A4C A;  2PDO A;  2CIJ A;  3D68 A;  4BD9 A;  5CPA A;  3K2K A;  5F5X A;  2Z11 A;  4CAX A;  5K8P A;  2QIR A;  2PJA A;  2VQY A;  2ZEL A;  3NA6 A;  1ZLI A;  2ZEO A;  4L8A A;  2Q7B A;  1CP6 A;  2OR4 A;  3BUX B;  1GYT A;  1N71 A;  2ZW7 A;  3DR6 A;  3TLG B;  5ELY A;  4CYQ A;  2C27 A;  4ZY0 A;  1M4D A;  5K8M A;  4A2Z A;  4EWT A;  5ISV A;  3G8W A;  2HB6 A;  4J0N A;  4NGP A;  4AVB A;  2AFM A;  4C8F A;  3S9L A;  1YME A;  1NBW A;  3RAM A;  5HVF A;  4MXU A;  4COB A;  4LUA A;  4U9Z A;  6CPA A;  2IJZ A;  2I00 A;  3IEH A;  2XPN A;  3V38 A;  1PUA A;  5EMI A;  3V7Z A;  5J3X A;  4GS4 A;  3OWC A;  3T9Y A;  1LAP A;  3TTH A;  3ZNI A;  3WC5 A;  4CO9 A;  2HQY A;  4E94 A;  4IIY A;  2E28 A;  3WR7 A;  4FD6 A;  4A95 A;  4E8O A;  1PU9 A;  2DPS A;  3KHZ A;  2FIW A;  4CGM A;  1I12 A;  2YNC C;  5A28 A;  1XF8 A;  4KS9 A;  4OC0 A;  1TKJ A;  2I79 A;  4H89 A;  3S9M A;  4JWP A;  3S6G A;  4E2A A;  2EZB A;  2MP0 A;  1R43 A;  4JVO A;  2UV8 G;  2I3C A;  4PK2 A;  4Q7A A;  4UBR A;  3N7Z A;  2AFS A;  3N5F A;  1DTD A;  5JGF A;  2ZEF A;  3PBB A;  4B14 A;  4NGT A;  4F8Z A;  2AUN A;  3D2P A;  3NE7 A;  1EE3 P;  1MK4 A;  4XPD C;  1OBR A;  5A27 A;  1DE4 C;  1LFW A;  4CYN A;  1M4L A;  1C3O B;  1YRE A;  4PQA A;  4AG9 A;  1KUV A;  1V6C A;  4A32 A;  3TLG A;  4F6A A;  4F0Y A;  2GRE A;  4NFR A;  3KQZ A;  5C82 A;  2Y1M A;  1RXT A;  1QQ9 A;  3CXQ A;  1ON0 A;  3IC1 A;  1XF1 A;  1S5K A;  4OC1 A;  1KUY A;  1H8L A;  3FNC A;  4KOT A;  3DR8 A;  4MFQ A;  1IYL A;  3BJ7 A;  2AUM A;  3FF3 A;  5JPH A;  4MCR A;  3W6X A;  3RO0 A;  4MY0 A;  4UA3 A;  4C7I A;  2EWB A;  3KI9 A;  3PB4 X;  4MBU A;  2PC1 A;  4NXY A;  4PXC A;  5LRJ A;  2HI6 A;  3D2M A;  2WYR A;  2ANP A;  3VWD A;  4MI1 A;  2ZEN A;  4M6H A;  4P4J A;  2B4B A;  4AVA A;  1AMP A;  4LQ6 A;  2EUI A;  2R1I A;  2FM4 A;  2BOA A;  5KTD A;  2HV2 A;  4UFV A;  2O28 A;  2PVV A;  4W9Y A;  1TKF A;  1EO0 A;  3GY9 A;  4WWV A;  4FD7 A;  2AFX A;  2REE A;  4JD6 A;  4NSQ A;  4QC6 A;  3HLP A;  4F9V A;  3CPA A;  4C85 A;  2QEC A;  5E96 A;  4RR2 B;  3RBU A;  4U9Y A;  2YJV A;  1FBV A;  3VRP A;  1BLL E;  3IJ3 A;  4OC4 A;  5J1Q A;  1VHS A;  4B10 A;  1YLE A;  2VI7 A;  2Q7S A;  4UF4 A;  1JWQ A;  5HXD A;  3FEC A;  3KZW A;  4RI1 A;  1EZB A;  1B6B A;  1QSO A;  2B3V A;  3CXS A;  4NEX A;  4ZX9 A;  1M4G A;  3PZJ A;  1Q5X A;  2F8H A;  2YJT A;  1I21 A;  2GAN A;  3HUV A;  3P2F A;  2ZW6 A;  1IGB A;  4RN7 A;  4ZY1 A;  3BUN B;  4XPD B;  5CNP A;  5I4M A;  3B3T A;  3SJE A;  2V77 A;  4MFJ A;  3PRT A;  4Y49 C;  4X5K A;  3V8I A;  4IIX A;  3GB0 A;  4BPU B;  2QML A;  4OME A;  4M6I A;  2VXK A;  4FD5 A;  5AGE A;  4C2X A;  5HMN A;  3JUW A;  2HRO A;  3TO6 A;  3TT2 A;  2DEA A;  4H1H A;  1XRY A;  2NMT A;  2B4J C;  1IYK A;  3CXP A;  3PB7 X;  4NCZ A;  4KOY A;  4UCM A;  1XJO A;  2O4H A;  2FIA A;  3KR5 A;  5JH9 A;  4C8U A;  2YND A;  2N3A B;  2VKZ G;  3DDD A;  3DGV A;  4PXD A;  4JZ0 A;  4IUS A;  4TJX A;  3S6K A;  2Q04 A;  3LD2 A;  1Z2L A;  4OIW A;  4MI4 A;  1ZRS A;  4KNG E;  1P4N A;  5HH1 A;  5KTC A;  3IFE A;  2PJ9 A;  1T36 B;  4PK3 A;  4KSA A;  4F0X A;  2R82 A;  4O23 A;  5F1Y A;  1X12 A;  2BEI A;  1M44 A;  3NH5 A;  3ISZ A;  3RNZ A;  1ELL P;  1BPM A;  4ORF A;  3U88 C;  4FWU A;  2YGW A;  4YN3 A;  1PYT B;  4CYO A;  4C68 A;  4C86 A;  1Y9K A;  3PGP A;  4L89 A;  3KGQ A;  4OC5 A;  4XNH B;  5DWM A;  1A2Z A;  4DJL A;  2ARH A;  3EY5 A;  5G22 A;  3TLA A;  3TE4 A;  5DWN A;  1IID A;  1LOK A;  3I1U A;  4NGN A;  3PP9 A;  4P44 A;  3T0T A;  3FXT A;  2ZEH A;  2Z3P A;  4ONW A;  4X3R A;  3R9F A;  4GXH A;  2ODF A;  5HKW A;  2ZEM A;  3VH9 A;  4HNY B;  4M85 A;  1XFO A;  1AUG A;  2AFW A;  2Z10 A;  2Z3M A;  3SR3 A;  3TLB A;  2PR1 A;  4CRY B;  1Q2D A;  4KOX A;  4HNW B;  4Q38 A;  5IX3 A;  3VGO A;  3DNS A;  1CPS A;  4YFJ A;  4UEF A;  1BO4 A;  2PIY A;  3D66 A;  1BOB A;  1IOF A;  4YWY A;  4E5S A;  3RZA A;  1L0C A;  3BHX A;  2O53 A;  4MJ8 A;  3WC7 A;  4B12 A;  3KAS A;  4A38 A;  1XMB A;  2Z3O A;  4KUA A;  5EBV A;  4ONU A;  2WPX A;  3GKR A;  4IHM A;  3TO9 A;  2EO8 A;  1ZO0 A;  4PXE A;  4AXV A;  3EIF A;  4A31 A;  2PRQ A;  4C9R A;  3PFV A;  5JVL A;  3FVL A;  3JRU A;  3K4I A;  2PJB A;  3IO1 A;  5G20 A;  2B0A A;  3VAT A;  1LCP A;  3FRM A;  1YX0 A;  4CAF A;  2QVP A;  3NH4 A;  1Y7R A;  2Q4Z A;  1IOI A;  3IWW A;  1FY7 A;  3BXM A;  3PB6 X;  1LRZ A;  3PLF B;  3D67 A;  3K9T A;  3R1K A;  4UIB A;  3NFZ A;  4C84 A;  3K9U A;  3F5B A;  3KHX A;  4B11 A;  2C6P A;  3EO4 A;  2B5G B;  1Z9E A;  5GCN A;  5K99 A;  4KSF A;  4OC2 A;  1R61 A;  3WT4 A;  1VI4 A;  3QNV A;  4UCN A;  4CDK A;  2OZH A;  1YVK A;  2XPL A;  5IB9 A;  5H86 A;  3SI2 A;  3KKW A;  4MY3 A;  1B87 A;  1KWM A;  3T90 A;  4X8I A;  2D0P A;  2P6E A;  1JDB C;  1FT7 A;  3B7I A;  2BL1 A;  4IK2 A;  4Q36 A;  1M4I A;  1IU8 A;  1MJB A;  2G3T A;  2PJ5 A;  3P2H A;  1VBG A;  2RB7 A;  1ZG9 A;  5AXI A;  2PJ4 A;  1CG2 A;  2CNS A;  2VEZ A;  2PVW A;  4P6Y A;  4FD4 A;  1SQH A;  4KVM E;  5F49 A;  2OB0 A;  2P6F A;  3H8F A;  1ZG8 A;  1OZP A;  1R57 A;  4KOS A;  4Z65 A;  5JYB A;  1A9X B;  3B3V A;  1VHE A;  4JJX A;  4A4B A;  2CY2 A;  1YR0 A;  3B3W A;  3GIU A;  2OH1 A;  5H84 A;  2BO9 A;  2V8V A;  3VRN A;  4E0A A;  4R9M A;  4XPL A;  4ZBG A;  2FS5 A;  1F2P A;  1IIC A;  1NSL A;  5IR2 A;  2HC9 A;  2ZPA A;  1Z8W A;  3E0K A;  4XPK A;  3ZJ0 A;  2CF4 A;  2Z0Z A; 
#chains in the Genus database with same CATH homology
 4ZI6 A;  5LRK A;  4RUH A;  3BI1 A;  3KL9 A;  1PCA A;  2Q51 A;  3IIB A;  5K8O A;  4UEE A;  4MCP A;  1TKH A;  4MHN A;  3KR4 A;  4MCS A;  1ZLH A;  2IQ6 A;  1YW4 A;  3VTA A;  3PFO A;  4YU9 A;  4NGR A;  2ZEG A;  1UWY A;  5LYD A;  4C8A A;  1HDQ A;  4MHY A;  2PJC A;  3CPX A;  2PJ3 A;  3SI0 A;  2XEI A;  1HDU A;  1WVM A;  4OC3 A;  3FMC A;  2C5Q A;  7CPA A;  4P4B A;  2V8G A;  4OP4 A;  1YLO A;  2PJ2 A;  4C9E A;  1YSJ A;  2V8H A;  2AFZ A;  4C9A A;  3FED A;  4LQG A;  1CX8 A;  4R7M A;  5LYI A;  1Y0R A;  4NGS A;  2EK9 A;  4R6T A;  1Y7E A;  4P4F A;  4MMO A;  2PJ0 A;  5D8N A;  4ZYQ A;  4A39 A;  1XBU A;  4GM5 A;  1R3N A;  4KSI A;  2WZN A;  1Q7L A;  4P4E A;  2PE3 A;  3CDX A;  2ZOF A;  1TF8 A;  3VAR A;  4EFD A;  2NSM A;  2PJ8 A;  4PXB A;  3L2N A;  3B3S A;  4CDJ A;  4B6Z A;  1CP7 A;  3WAB A;  2ZED A;  4C99 A;  5CBM A;  1LAN A;  4MRI A;  4C9U A;  2PJ6 A;  3FX6 A;  4JYW A;  1BAV A;  3ISX A;  3BI0 A;  4MCQ A;  4R8F A;  3LMS A;  2XEJ A;  4P4I A;  2ABZ A;  3LWU A;  4ZX8 A;  4IAV A;  3D7G A;  1ARM A;  4TNU A;  4A37 A;  3DLJ A;  1ARL A;  2RFH A;  4P10 A;  3FEE A;  1F57 A;  2JEW A;  4K3N A;  1Y9Z A;  1QMU A;  3I6S A;  4C9V A;  3TC8 A;  2C6C A;  3PFE A;  1LAM A;  2ZOG A;  2AFU A;  1Y0Y A;  2OOT A;  1TXR A;  4P4D A;  3B2Y A;  2IMO A;  4ZY2 A;  4FUU A;  2FVG A;  2GU2 A;  3D7D A;  3GLJ A;  3PBE A;  5LRG A;  4NJQ A;  4P45 A;  3SJF A;  2F7V A;  1VHO A;  2V8D A;  3MN8 A;  4X2T A;  1AYE A;  2QJ8 A;  4MHZ A;  5LYL A;  2EK8 A;  3NH8 A;  1YW6 A;  2ZEE A;  4F9U A;  1Z5R A;  3KQX A;  5DS0 A;  3I74 A;  2XEF A;  8CPA A;  1BPN A;  3H8E A;  1ELM P;  3MRU A;  5HVH A;  2C6G A;  3FH4 A;  1HEE A;  4OKO A;  3D7F A;  3WC6 A;  2BCO A;  4C8C A;  2G9D A;  1TF9 A;  3ICU A;  4WJB A;  1IY7 A;  4FBE A;  3PEI A;  5K8N A;  1VGY A;  2CTC A;  3SJG A;  3GUX A;  3FJU A;  2PCU A;  4FAI A;  4EME A;  1FNO A;  2PIZ A;  3D4U A;  1JQG A;  4NGQ A;  4R76 A;  2GP4 A;  3B35 A;  1CBX A;  5THW A;  4OID A;  2PJ1 A;  3SI1 A;  3T8W A;  3SJX A;  2VL1 A;  4TWE A;  4C8T A;  4TJV A;  4UIA A;  2AFO A;  5F09 A;  3CT9 A;  2GLJ A;  2NYQ A;  1CPX A;  4UEZ A;  2ZEP A;  1Z8L A;  3PB8 X;  5JM6 A;  5D29 A;  4DUK A;  4G1P A;  2JBJ A;  3TX8 A;  4NJR A;  2J9A A;  2Q43 A;  2XEG A;  1ZG7 A;  3H8G A;  1F2O A;  2QYV A;  1NSA A;  2PJ7 A;  2GLF A;  2CTB A;  1RTQ A;  4NGM A;  4CPA A;  1VIX A;  4C8P A;  5LYF A;  2POK A;  3S9N A;  4H2K A;  4DYO A;  5HVG A;  4A94 A;  3PB9 X;  4PPZ A;  2JBK A;  2C1C A;  4MHP A;  3B3C A;  3D7H A;  4BD9 A;  2CIJ A;  3D68 A;  5CPA A;  3K2K A;  5K8P A;  2PJA A;  2ZEL A;  3NA6 A;  1ZLI A;  2ZEO A;  4AXV A;  1CP6 A;  2OR4 A;  1GYT A;  5ELY A;  4ZY0 A;  5K8M A;  4EWT A;  4C8F A;  2HB6 A;  4NGP A;  2AFM A;  3S9L A;  1YME A;  3RAM A;  5HVF A;  4MXU A;  6CPA A;  2IJZ A;  3V38 A;  3IEH A;  3V7Z A;  3WC5 A;  1LAP A;  3KHZ A;  4OC0 A;  1TKJ A;  3S9M A;  4TJX A;  1R43 A;  2I3C A;  4Q7A A;  2AFS A;  3N5F A;  1DTD A;  5JGF A;  2ZEF A;  3PBB A;  4F8Z A;  4NGT A;  1EE3 P;  1OBR A;  1DE4 C;  1LFW A;  1M4L A;  4PQA A;  1V6C A;  2GRE A;  4NFR A;  3KQZ A;  1QQ9 A;  3IC1 A;  1XF1 A;  4OC1 A;  1H8L A;  3FF3 A;  4MCR A;  2EWB A;  3KI9 A;  3PB4 X;  4PXC A;  5LRJ A;  2WYR A;  2ANP A;  2ZEN A;  4P4J A;  1AMP A;  2BOA A;  2PVV A;  4W9Y A;  1TKF A;  4WWV A;  2AFX A;  3HLP A;  4F9V A;  3CPA A;  4C85 A;  3RBU A;  1BLL E;  3IJ3 A;  4OC4 A;  5J1Q A;  4UF4 A;  5HXD A;  3FEC A;  3KZW A;  4ZX9 A;  2F8H A;  3HUV A;  4ZY1 A;  1IGB A;  5I4M A;  3B3T A;  3SJE A;  2V77 A;  3PRT A;  3GB0 A;  4OME A;  2DEA A;  1XRY A;  3PB7 X;  1XJO A;  2O4H A;  5JH9 A;  3KR5 A;  4C8U A;  3DGV A;  4PXD A;  4JZ0 A;  1Z2L A;  4OIW A;  4KNG E;  3IFE A;  2PJ9 A;  4O23 A;  3NH5 A;  3ISZ A;  1ELL P;  1BPM A;  4FWU A;  4YN3 A;  1PYT B;  4C86 A;  3KGQ A;  4OC5 A;  4DJL A;  1LOK A;  3I1U A;  4NGN A;  4P44 A;  2ZEH A;  4ONW A;  4X3R A;  2ZEM A;  3VH9 A;  1XFO A;  2AFW A;  1CPS A;  4UEF A;  2PIY A;  3D66 A;  4YWY A;  3RZA A;  3BHX A;  2O53 A;  3WC7 A;  3KAS A;  4A38 A;  1XMB A;  4IHM A;  4PXE A;  3EIF A;  4C9R A;  2PRQ A;  3FVL A;  3JRU A;  2PJB A;  3IO1 A;  3VAT A;  1LCP A;  2QVP A;  3NH4 A;  2Q4Z A;  3IWW A;  3BXM A;  3PB6 X;  3K9T A;  3D67 A;  4UIB A;  4C84 A;  3NFZ A;  3KHX A;  2C6P A;  4OC2 A;  3WT4 A;  4CDK A;  3QNV A;  5IB9 A;  3SI2 A;  1KWM A;  4X8I A;  1FT7 A;  3B7I A;  4IK2 A;  2PJ5 A;  2RB7 A;  1ZG9 A;  2PJ4 A;  1CG2 A;  2PVW A;  4P6Y A;  3H8F A;  1ZG8 A;  4Z65 A;  3B3V A;  1VHE A;  3B3W A;  2BO9 A;  2V8V A;  1F2P A;  5IR2 A;  2HC9 A;  2CF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...