2XPLA

Crystal structure of iws1(spn1) conserved domain from encephalitozoon cuniculi
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
142
structure length
142
Chain Sequence
HMDPGTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IWS1
publication title The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
total genus 57
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2xplA00
2XPLA 3U88C 3HPGG 1WJTA 3OAKA 1EO0A 3F9KC 3NFQA 2XPPA 1Z9EA 2XPNA 3O8ZA 2N3AB 3HPHE 2XPOA 2B4JC
chains in the Genus database with same CATH superfamily
3D7DA 3RBUA 3F9KC 2Y1NA 3FECA 3BUNB 3S9NA 4A4BA 4JYWA 3D7HA 3VRQA 3VROA 4OC1A 5F13A 4NGTA 1B47A 4P4DA 4OC2A 4OMEA 3S9MA 3IWWA 3FEEA 4MCSA 3VRPA 3BHXA 3SJEA 2C6CA 2XEGA 3OB2B 2CIJA 4MCRA 3PT1A 4P4JA 2XPNA 3BUXB 4NGQA 2Y1MA 2UV8G 3OAKA 3SJGA 4P4FA 5AXIA 4BPWB 3BXMA 3SJFA 4NGPA 3D7FA 4OC0A 3PLFB 4NGRA 5BY0A 3BUWB 2XEIA 2XPOA 1DE4C 3BUOB 4MCQA 5HKWA 4GPLB 3FF3A 2XEFA 2CBLA 3S9LA 2PVVA 2N3AB 4BTFA 4NGNA 4OC5A 2JBKA 4P45A 3D7GA 2XPLA 3PFVA 4W9YA 4X3RA 5ELYA 5J3XA 5HKYA 4JZ0A 3VRNA 4P4BA 5D29A 3HPHE 2PVWA 2DLAA 4LQGA 1Z8LA 4OC4A 3FEDA 4P4IA 2OR4A 5HKZA 1WJTA 2VKZG 3NFQA 4BPUB 3OP0A 2OOTA 3HPGG 1EO0A 3BUMB 3BI1A 2B4JC 4A4CA 1YVHA 4P44A 3VRRA 1FBVA 2XPPA 4RR2B 4BPXB 3VGOA 5F09A 4MCPA 3U88C 3OB1B 2JBJA 4NGMA 1CX8A 3HMJG 2C6GA 4P4EA 3KASA 3O8ZA 3ZNIA 3SJXA 3BI0A 4OC3A 1Z9EA 2XEJA 2C6PA 4NGSA
chains in the Genus database with same CATH topology
2XPLA 3U88C 3HPGG 1WJTA 3OAKA 1EO0A 3F9KC 3NFQA 2XPPA 1Z9EA 2XPNA 3O8ZA 2N3AB 3HPHE 2XPOA 2B4JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPL A;  3U88 C;  3HPG G;  1WJT A;  3OAK A;  1EO0 A;  3F9K C;  3NFQ A;  2XPP A;  1Z9E A;  2XPN A;  3O8Z A;  2N3A B;  3HPH E;  2XPO A;  2B4J C; 
#chains in the Genus database with same CATH topology
 3D7D A;  3RBU A;  3F9K C;  2Y1N A;  3FEC A;  3BUN B;  3S9N A;  4A4B A;  4JYW A;  3D7H A;  3VRQ A;  3VRO A;  4OC1 A;  5F13 A;  4NGT A;  1B47 A;  4P4D A;  4OC2 A;  4OME A;  3S9M A;  3IWW A;  3FEE A;  4MCS A;  3VRP A;  3BHX A;  3SJE A;  2C6C A;  2XEG A;  3OB2 B;  2CIJ A;  4MCR A;  3PT1 A;  4P4J A;  2XPN A;  3BUX B;  4NGQ A;  2Y1M A;  2UV8 G;  3OAK A;  3SJG A;  4P4F A;  5AXI A;  4BPW B;  3BXM A;  3SJF A;  4NGP A;  3D7F A;  4OC0 A;  3PLF B;  4NGR A;  5BY0 A;  3BUW B;  2XEI A;  2XPO A;  1DE4 C;  3BUO B;  4MCQ A;  5HKW A;  4GPL B;  3FF3 A;  2XEF A;  2CBL A;  3S9L A;  2PVV A;  2N3A B;  4BTF A;  4NGN A;  4OC5 A;  2JBK A;  4P45 A;  3D7G A;  2XPL A;  3PFV A;  4W9Y A;  4X3R A;  5ELY A;  5J3X A;  5HKY A;  4JZ0 A;  3VRN A;  4P4B A;  5D29 A;  3HPH E;  2PVW A;  2DLA A;  4LQG A;  1Z8L A;  4OC4 A;  3FED A;  4P4I A;  2OR4 A;  5HKZ A;  1WJT A;  2VKZ G;  3NFQ A;  4BPU B;  3OP0 A;  2OOT A;  3HPG G;  1EO0 A;  3BUM B;  3BI1 A;  2B4J C;  4A4C A;  1YVH A;  4P44 A;  3VRR A;  1FBV A;  2XPP A;  4RR2 B;  4BPX B;  3VGO A;  5F09 A;  4MCP A;  3U88 C;  3OB1 B;  2JBJ A;  4NGM A;  1CX8 A;  3HMJ G;  2C6G A;  4P4E A;  3KAS A;  3O8Z A;  3ZNI A;  3SJX A;  3BI0 A;  4OC3 A;  1Z9E A;  2XEJ A;  2C6P A;  4NGS A; 
#chains in the Genus database with same CATH homology
 2XPL A;  3U88 C;  3HPG G;  1WJT A;  3OAK A;  1EO0 A;  3F9K C;  3NFQ A;  2XPP A;  1Z9E A;  2XPN A;  3O8Z A;  2N3A B;  3HPH E;  2XPO A;  2B4J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...