2XPLA

Crystal structure of iws1(spn1) conserved domain from encephalitozoon cuniculi
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
142
structure length
142
Chain Sequence
b'HMDPGTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVFKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IWS1
publication title The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
total genus 57
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2xplA00
1Z9EA 1EO0A 2N3AB 1WJTA 3HPGG 3HPHE 2XPLA 3U88C 2XPOA 3OAKA 3F9KC 3O8ZA 2B4JC 2XPPA 3NFQA 2XPNA
chains in the Genus database with same CATH superfamily
3U88C 3S9NA 4BPWB 5F13A 2XEJA 3S9MA 3VGOA 4P45A 3HMJG 5HKZA 3D7HA 1FBVA 3PT1A 3O8ZA 4OC3A 4NGMA 1CX8A 2C6CA 3VRPA 3BUOB 4P4EA 3ZNIA 4BPXB 4OC2A 4OC1A 5AXIA 3KASA 1EO0A 2JBKA 5BY0A 3OAKA 3F9KC 4P4IA 4W9YA 3VROA 3VRQA 5F09A 4NGNA 5HKYA 4P4FA 3FEDA 1Z8LA 3PFVA 4NGRA 4NGTA 2CIJA 3PLFB 5D29A 3OB2B 3SJFA 2JBJA 3BUMB 4A4CA 3SJEA 5HKWA 2CBLA 2Y1NA 2VKZG 4BPUB 4NGPA 3FEEA 4JZ0A 3D7FA 2UV8G 4A4BA 2XEIA 4X3RA 1WJTA 3IWWA 4MCSA 4P44A 5J3XA 3BUXB 4P4DA 1DE4C 3BUNB 3FF3A 3OP0A 2OR4A 2C6PA 3BHXA 2XPLA 4MCQA 1Z9EA 3BI1A 3BXMA 2PVVA 1YVHA 2N3AB 3SJGA 2XPOA 4NGQA 2B4JC 4NGSA 3VRRA 3D7GA 4GPLB 4MCPA 2PVWA 2XEFA 3FECA 3BUWB 2Y1MA 4P4JA 4MCRA 4RR2B 3SJXA 3BI0A 4OC0A 4LQGA 4OC5A 2C6GA 1B47A 4BTFA 4OMEA 3OB1B 3NFQA 2OOTA 2XEGA 4JYWA 2DLAA 5ELYA 2XPNA 3VRNA 3RBUA 3S9LA 3HPGG 3HPHE 4P4BA 2XPPA 4OC4A 3D7DA
chains in the Genus database with same CATH topology
1Z9EA 1EO0A 2N3AB 1WJTA 3HPGG 3HPHE 2XPLA 3U88C 2XPOA 3OAKA 3F9KC 3O8ZA 2B4JC 2XPPA 3NFQA 2XPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9E A;  1EO0 A;  2N3A B;  1WJT A;  3HPG G;  3HPH E;  2XPL A;  3U88 C;  2XPO A;  3OAK A;  3F9K C;  3O8Z A;  2B4J C;  2XPP A;  3NFQ A;  2XPN A; 
#chains in the Genus database with same CATH topology
 3U88 C;  3S9N A;  4BPW B;  5F13 A;  2XEJ A;  3S9M A;  3VGO A;  4P45 A;  3HMJ G;  5HKZ A;  3D7H A;  1FBV A;  3PT1 A;  3O8Z A;  4OC3 A;  4NGM A;  1CX8 A;  2C6C A;  3VRP A;  3BUO B;  4P4E A;  3ZNI A;  4BPX B;  4OC2 A;  4OC1 A;  5AXI A;  3KAS A;  1EO0 A;  2JBK A;  5BY0 A;  3OAK A;  3F9K C;  4P4I A;  4W9Y A;  3VRO A;  3VRQ A;  5F09 A;  4NGN A;  5HKY A;  4P4F A;  3FED A;  1Z8L A;  3PFV A;  4NGR A;  4NGT A;  2CIJ A;  3PLF B;  5D29 A;  3OB2 B;  3SJF A;  2JBJ A;  3BUM B;  4A4C A;  3SJE A;  5HKW A;  2CBL A;  2Y1N A;  2VKZ G;  4BPU B;  4NGP A;  3FEE A;  4JZ0 A;  3D7F A;  2UV8 G;  4A4B A;  2XEI A;  4X3R A;  1WJT A;  3IWW A;  4MCS A;  4P44 A;  5J3X A;  3BUX B;  4P4D A;  1DE4 C;  3BUN B;  3FF3 A;  3OP0 A;  2OR4 A;  2C6P A;  3BHX A;  2XPL A;  4MCQ A;  1Z9E A;  3BI1 A;  3BXM A;  2PVV A;  1YVH A;  2N3A B;  3SJG A;  2XPO A;  4NGQ A;  2B4J C;  4NGS A;  3VRR A;  3D7G A;  4GPL B;  4MCP A;  2PVW A;  2XEF A;  3FEC A;  3BUW B;  2Y1M A;  4P4J A;  4MCR A;  4RR2 B;  3SJX A;  3BI0 A;  4OC0 A;  4LQG A;  4OC5 A;  2C6G A;  1B47 A;  4BTF A;  4OME A;  3OB1 B;  3NFQ A;  2OOT A;  2XEG A;  4JYW A;  2DLA A;  5ELY A;  2XPN A;  3VRN A;  3RBU A;  3S9L A;  3HPG G;  3HPH E;  4P4B A;  2XPP A;  4OC4 A;  3D7D A; 
#chains in the Genus database with same CATH homology
 1Z9E A;  1EO0 A;  2N3A B;  1WJT A;  3HPG G;  3HPH E;  2XPL A;  3U88 C;  2XPO A;  3OAK A;  3F9K C;  3O8Z A;  2B4J C;  2XPP A;  3NFQ A;  2XPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...