2XPLA

Crystal structure of iws1(spn1) conserved domain from encephalitozoon cuniculi
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
142
structure length
142
Chain Sequence
HMDPGTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords IWS1
publication title The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
pubmed doi rcsb
source organism Encephalitozoon cuniculi
total genus 57
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2xplA00
3HPGG 1WJTA 1Z9EA 3O8ZA 2XPLA 2XPOA 1EO0A 3F9KC 3HPHE 3OAKA 3U88C 2B4JC 2XPNA 3NFQA 2XPPA 2N3AB
chains in the Genus database with same CATH superfamily
4NGSA 2VKZG 4NGRA 4W9YA 2C6GA 1WJTA 3BHXA 3BI0A 3D7HA 2PVVA 4OC3A 3RBUA 2JBJA 2OOTA 2XPNA 4MCSA 5HKZA 3VRRA 4MCQA 3VGOA 5HKYA 2XPLA 3VRQA 3BUOB 2N3AB 4JZ0A 1Z8LA 4NGTA 4BPWB 3S9NA 2XEIA 3O8ZA 3SJFA 4OC1A 2C6PA 4P4JA 4P44A 5AXIA 3HMJG 3F9KC 2OR4A 4MCPA 3PFVA 4GPLB 2XPOA 4P4BA 4P4IA 1CX8A 1EO0A 4OC2A 3OP0A 4P45A 4X3RA 4A4CA 4NGQA 3OB2B 5F09A 3VRPA 2PVWA 1Z9EA 3S9MA 1YVHA 3VROA 2JBKA 4OC0A 4P4FA 4P4EA 3D7DA 2UV8G 3PT1A 5BY0A 2DLAA 3BUMB 4NGNA 3D7FA 4OC5A 3FEDA 1B47A 3FEEA 4BTFA 3PLFB 4JYWA 5HKWA 3SJGA 4P4DA 3VRNA 4OC4A 2B4JC 3HPGG 2CIJA 4A4BA 4MCRA 3BI1A 3HPHE 3OB1B 2XEJA 3U88C 3BUNB 3NFQA 4BPXB 2Y1NA 3S9LA 4RR2B 3BUXB 4NGMA 4NGPA 2XPPA 1FBVA 3ZNIA 3OAKA 3BUWB 5J3XA 2Y1MA 3BXMA 3SJXA 5F13A 3SJEA 3FF3A 4BPUB 3FECA 5D29A 3D7GA 3IWWA 2XEGA 5ELYA 4OMEA 1DE4C 2C6CA 2XEFA 3KASA 2CBLA 4LQGA
chains in the Genus database with same CATH topology
3HPGG 1WJTA 1Z9EA 3O8ZA 2XPLA 2XPOA 1EO0A 3F9KC 3HPHE 3OAKA 3U88C 2B4JC 2XPNA 3NFQA 2XPPA 2N3AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPG G;  1WJT A;  1Z9E A;  3O8Z A;  2XPL A;  2XPO A;  1EO0 A;  3F9K C;  3HPH E;  3OAK A;  3U88 C;  2B4J C;  2XPN A;  3NFQ A;  2XPP A;  2N3A B; 
#chains in the Genus database with same CATH topology
 4NGS A;  2VKZ G;  4NGR A;  4W9Y A;  2C6G A;  1WJT A;  3BHX A;  3BI0 A;  3D7H A;  2PVV A;  4OC3 A;  3RBU A;  2JBJ A;  2OOT A;  2XPN A;  4MCS A;  5HKZ A;  3VRR A;  4MCQ A;  3VGO A;  5HKY A;  2XPL A;  3VRQ A;  3BUO B;  2N3A B;  4JZ0 A;  1Z8L A;  4NGT A;  4BPW B;  3S9N A;  2XEI A;  3O8Z A;  3SJF A;  4OC1 A;  2C6P A;  4P4J A;  4P44 A;  5AXI A;  3HMJ G;  3F9K C;  2OR4 A;  4MCP A;  3PFV A;  4GPL B;  2XPO A;  4P4B A;  4P4I A;  1CX8 A;  1EO0 A;  4OC2 A;  3OP0 A;  4P45 A;  4X3R A;  4A4C A;  4NGQ A;  3OB2 B;  5F09 A;  3VRP A;  2PVW A;  1Z9E A;  3S9M A;  1YVH A;  3VRO A;  2JBK A;  4OC0 A;  4P4F A;  4P4E A;  3D7D A;  2UV8 G;  3PT1 A;  5BY0 A;  2DLA A;  3BUM B;  4NGN A;  3D7F A;  4OC5 A;  3FED A;  1B47 A;  3FEE A;  4BTF A;  3PLF B;  4JYW A;  5HKW A;  3SJG A;  4P4D A;  3VRN A;  4OC4 A;  2B4J C;  3HPG G;  2CIJ A;  4A4B A;  4MCR A;  3BI1 A;  3HPH E;  3OB1 B;  2XEJ A;  3U88 C;  3BUN B;  3NFQ A;  4BPX B;  2Y1N A;  3S9L A;  4RR2 B;  3BUX B;  4NGM A;  4NGP A;  2XPP A;  1FBV A;  3ZNI A;  3OAK A;  3BUW B;  5J3X A;  2Y1M A;  3BXM A;  3SJX A;  5F13 A;  3SJE A;  3FF3 A;  4BPU B;  3FEC A;  5D29 A;  3D7G A;  3IWW A;  2XEG A;  5ELY A;  4OME A;  1DE4 C;  2C6C A;  2XEF A;  3KAS A;  2CBL A;  4LQG A; 
#chains in the Genus database with same CATH homology
 3HPG G;  1WJT A;  1Z9E A;  3O8Z A;  2XPL A;  2XPO A;  1EO0 A;  3F9K C;  3HPH E;  3OAK A;  3U88 C;  2B4J C;  2XPN A;  3NFQ A;  2XPP A;  2N3A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...