2XPLA

Crystal structure of iws1(spn1) conserved domain from encephalitozoon cuniculi
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
142
structure length
142
Chain Sequence
HMDPGTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
molecule keywords IWS1
total genus 57
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2xplA00
3U88C 1EO0A 2XPNA 2B4JC 1WJTA 3F9KC 3HPGG 2XPOA 3NFQA 2XPPA 1Z9EA 3HPHE 3OAKA 2XPLA 3O8ZA 2N3AB
chains in the Genus database with same CATH superfamily
4JZ0A 5HKYA 3VRQA 3BI0A 3BUNB 4BTFA 5HKWA 2OR4A 2JBJA 2PVWA 4MCRA 3BI1A 4OC4A 4NGTA 5HKZA 3U88C 1EO0A 4A4CA 3S9MA 2XPNA 3S9LA 2C6GA 1YVHA 3FEEA 3HPGG 3NFQA 4OC2A 1Z9EA 3SJEA 3OAKA 2UV8G 3D7FA 3VGOA 1B47A 1Z8LA 4A4BA 4P4EA 4BPUB 2C6CA 3OP0A 3OB2B 3FEDA 2VKZG 4OC5A 3KASA 2N3AB 4JYWA 3S9NA 4NGPA 4OC1A 4NGMA 3OB1B 4NGQA 1DE4C 3SJFA 2DLAA 3RBUA 3BXMA 3BUWB 3BUOB 2B4JC 4P45A 3BUMB 3O8ZA 4RR2B 3SJXA 4MCSA 2Y1MA 3VRNA 3D7GA 2XPOA 4BPXB 4P4IA 4P44A 3BHXA 4NGRA 4P4FA 3SJGA 3ZNIA 3IWWA 5BY0A 4MCQA 5J3XA 5D29A 4OC0A 2OOTA 5F13A 4LQGA 2XEJA 4OMEA 4NGNA 3HMJG 4NGSA 3FECA 4W9YA 1FBVA 5ELYA 4OC3A 4P4JA 2XEIA 4P4DA 3F9KC 3PT1A 4BPWB 2Y1NA 2C6PA 3HPHE 2XEGA 1CX8A 4MCPA 2CIJA 1WJTA 3PFVA 5AXIA 5F09A 2XPLA 2XPPA 2CBLA 3PLFB 3VRPA 2XEFA 3VROA 2PVVA 4P4BA 4X3RA 4GPLB 3BUXB 3D7HA 3VRRA 3D7DA 3FF3A 2JBKA
chains in the Genus database with same CATH topology
3U88C 1EO0A 2XPNA 2B4JC 1WJTA 3F9KC 3HPGG 2XPOA 3NFQA 2XPPA 1Z9EA 3HPHE 3OAKA 2XPLA 3O8ZA 2N3AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U88 C;  1EO0 A;  2XPN A;  2B4J C;  1WJT A;  3F9K C;  3HPG G;  2XPO A;  3NFQ A;  2XPP A;  1Z9E A;  3HPH E;  3OAK A;  2XPL A;  3O8Z A;  2N3A B; 
#chains in the Genus database with same CATH topology
 4JZ0 A;  5HKY A;  3VRQ A;  3BI0 A;  3BUN B;  4BTF A;  5HKW A;  2OR4 A;  2JBJ A;  2PVW A;  4MCR A;  3BI1 A;  4OC4 A;  4NGT A;  5HKZ A;  3U88 C;  1EO0 A;  4A4C A;  3S9M A;  2XPN A;  3S9L A;  2C6G A;  1YVH A;  3FEE A;  3HPG G;  3NFQ A;  4OC2 A;  1Z9E A;  3SJE A;  3OAK A;  2UV8 G;  3D7F A;  3VGO A;  1B47 A;  1Z8L A;  4A4B A;  4P4E A;  4BPU B;  2C6C A;  3OP0 A;  3OB2 B;  3FED A;  2VKZ G;  4OC5 A;  3KAS A;  2N3A B;  4JYW A;  3S9N A;  4NGP A;  4OC1 A;  4NGM A;  3OB1 B;  4NGQ A;  1DE4 C;  3SJF A;  2DLA A;  3RBU A;  3BXM A;  3BUW B;  3BUO B;  2B4J C;  4P45 A;  3BUM B;  3O8Z A;  4RR2 B;  3SJX A;  4MCS A;  2Y1M A;  3VRN A;  3D7G A;  2XPO A;  4BPX B;  4P4I A;  4P44 A;  3BHX A;  4NGR A;  4P4F A;  3SJG A;  3ZNI A;  3IWW A;  5BY0 A;  4MCQ A;  5J3X A;  5D29 A;  4OC0 A;  2OOT A;  5F13 A;  4LQG A;  2XEJ A;  4OME A;  4NGN A;  3HMJ G;  4NGS A;  3FEC A;  4W9Y A;  1FBV A;  5ELY A;  4OC3 A;  4P4J A;  2XEI A;  4P4D A;  3F9K C;  3PT1 A;  4BPW B;  2Y1N A;  2C6P A;  3HPH E;  2XEG A;  1CX8 A;  4MCP A;  2CIJ A;  1WJT A;  3PFV A;  5AXI A;  5F09 A;  2XPL A;  2XPP A;  2CBL A;  3PLF B;  3VRP A;  2XEF A;  3VRO A;  2PVV A;  4P4B A;  4X3R A;  4GPL B;  3BUX B;  3D7H A;  3VRR A;  3D7D A;  3FF3 A;  2JBK A; 
#chains in the Genus database with same CATH homology
 3U88 C;  1EO0 A;  2XPN A;  2B4J C;  1WJT A;  3F9K C;  3HPG G;  2XPO A;  3NFQ A;  2XPP A;  1Z9E A;  3HPH E;  3OAK A;  2XPL A;  3O8Z A;  2N3A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...