The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
57
|
sequence length |
142
|
structure length |
142
|
Chain Sequence |
HMDPGTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVFKP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
pubmed doi rcsb |
| molecule keywords |
IWS1
|
| molecule tags |
Transcription
|
| source organism |
Encephalitozoon cuniculi
|
| total genus |
57
|
| structure length |
142
|
| sequence length |
142
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2010-08-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08711 | Med26 | TFIIS helical bundle-like domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Transcription Elongation Factor S-II; Chain A | Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 |
#chains in the Genus database with same CATH superfamily 2XPO A; 3NFQ A; 1Z9E A; 2XPN A; 2XPP A; 3OAK A; 2XPL A; 3O8Z A; 3F9K C; 3U88 C; 1WJT A; 3HPH E; 1EO0 A; 3HPG G; 2B4J C; 2N3A B; #chains in the Genus database with same CATH topology 5ELY A; 5BY0 A; 3VRP A; 5HKW A; 4A4C A; 4NGQ A; 3OB2 B; 2CIJ A; 4BPX B; 2XPL A; 3VRR A; 4OC4 A; 3S9L A; 2XPO A; 3BUN B; 3BUX B; 3FF3 A; 3D7D A; 4NGN A; 3PLF B; 3U88 C; 2UV8 G; 4MCP A; 4MCQ A; 2XPP A; 5F09 A; 4OC3 A; 5J3X A; 1DE4 C; 3RBU A; 4P4E A; 2PVV A; 2XEG A; 3KAS A; 4P4F A; 4W9Y A; 3O8Z A; 3F9K C; 4OC1 A; 2PVW A; 2Y1N A; 4OME A; 3BI0 A; 3OP0 A; 4P4J A; 5AXI A; 3SJG A; 4OC2 A; 4NGM A; 4RR2 B; 3VGO A; 3D7F A; 3BHX A; 4LQG A; 2VKZ G; 4MCR A; 3PFV A; 3S9N A; 4P4I A; 4NGR A; 2CBL A; 3VRO A; 4BTF A; 2OR4 A; 3PT1 A; 2OOT A; 1B47 A; 5D29 A; 3S9M A; 2N3A B; 2JBJ A; 3D7G A; 2XPN A; 3SJX A; 4NGT A; 2C6C A; 3FEC A; 4X3R A; 2B4J C; 1Z8L A; 3OB1 B; 4P44 A; 4OC5 A; 5HKY A; 2XEI A; 3SJE A; 4BPU B; 4JZ0 A; 4BPW B; 1YVH A; 3VRQ A; 2C6G A; 5HKZ A; 3BXM A; 2C6P A; 3BUO B; 2JBK A; 4NGS A; 2DLA A; 3NFQ A; 1Z9E A; 3OAK A; 3SJF A; 4P45 A; 4GPL B; 5F13 A; 3HMJ G; 4NGP A; 1CX8 A; 4A4B A; 4JYW A; 3FEE A; 3IWW A; 2Y1M A; 3BUW B; 1FBV A; 3D7H A; 1EO0 A; 3FED A; 3BUM B; 3BI1 A; 4P4B A; 3HPG G; 3VRN A; 4OC0 A; 2XEJ A; 4P4D A; 3ZNI A; 3HPH E; 4MCS A; 2XEF A; 1WJT A; #chains in the Genus database with same CATH homology 2XPO A; 3NFQ A; 1Z9E A; 2XPN A; 2XPP A; 3OAK A; 2XPL A; 3O8Z A; 3F9K C; 3U88 C; 1WJT A; 3HPH E; 1EO0 A; 3HPG G; 2B4J C; 2N3A B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
