3D7HA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcibzl, a urea-based inhibitor
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
molecule tags Hydrolase
source organism Homo sapiens
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
total genus 269
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7hA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7hA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7hA02
1Q7LA 4DJLA 4ZYQA 4WWVA 4MHPA 2V8DA 2ABZA 5K8PA 2GLFA 3LWUA 2C6CA 4X3RA 4MCQA 3KHXA 4FUUA 3WC6A 4P45A 2BCOA 4IHMA 4C9VA 1RTQA 1TF9A 4P4EA 4DUKA 3D7GA 2POKA 4ZI6A 2ZEEA 1XMBA 4UIAA 4RUHA 3PB6X 3FH4A 5JM6A 2EK8A 4TWEA 4OC5A 4C9RA 2CTCA 4UEZA 5CPAA 2DEAA 3CT9A 2PVVA 3PBBA 1IY7A 2ZEMA 3D4UA 2NSMA 4F9UA 3B3SA 3HUVA 4GM5A 2GU2A 4MCPA 2CIJA 4OC3A 4JZ0A 3WC7A 1CPXA 3DGVA 1EE3P 3D66A 2I3CA 5LYLA 4MCSA 5HVHA 3H8EA 3ICUA 2PJ6A 1WVMA 5J1QA 4R76A 1YMEA 5JH9A 2PE3A 4AXVA 2PJ5A 3PBEA 2PJ4A 2QYVA 2C6GA 5LYIA 2PJ1A 4NGNA 4H2KA 3VTAA 3GUXA 2AFOA 4UIBA 1ARLA 2XEGA 2J9AA 2PIYA 3D7DA 4ZX8A 3IWWA 2V8HA 4OC2A 1CPSA 1VGYA 3ISZA 1Z8LA 3KHZA 2ZOFA 1F2OA 3EIFA 2QVPA 1YW4A 4UEEA 5THWA 2EK9A 4R6TA 4Z65A 3KQXA 3B3TA 3CPAA 3IJ3A 4PXDA 4G1PA 2HB6A 1KWMA 3B3CA 2WYRA 4P6YA 5D29A 5LYFA 4CDJA 2XEJA 3FX6A 2RB7A 1UWYA 1LANA 3S9LA 4R8FA 3B2YA 2PJ2A 1XF1A 5JGFA 2ANPA 3KR5A 1TKHA 3FECA 3KR4A 1IGBA 2ZENA 2ZEGA 3NA6A 4CPAA 1R43A 5LRGA 1LAPA 2NYQA 5F09A 4DYOA 3GLJA 1XRYA 3PB4X 4O23A 2ZEPA 2PIZA 4NGPA 3SJEA 4NFRA 4LQGA 1H8LA 5I4MA 5IB9A 2OOTA 5LRKA 4NJRA 4MHYA 3KASA 4OC1A 4OKOA 2GLJA 3FEEA 1CX8A 3VATA 4C9UA 3ISXA 3T8WA 2WZNA 3FF3A 3QNVA 4TNUA 4YWYA 1BPNA 3HLPA 2PJ0A 3I1UA 4X2TA 4W9YA 2EWBA 1NSAA 2C1CA 1XFOA 4OC0A 4F8ZA 3PFOA 3BI1A 4P44A 3K9TA 3H8GA 3NFZA 4EWTA 2QJ8A 4KSIA 1BPMA 3KGQA 1ZG9A 3SJFA 3RZAA 4NJQA 4P10A 3RBUA 4P4BA 4K3NA 1CG2A 1TF8A 4MMOA 4P4IA 2O4HA 1HDUA 2AFSA 2IMOA 1XJOA 4C8AA 3SI0A 4X8IA 3S9MA 3TC8A 1Y9ZA 2JBJA 4IAVA 5LRJA 2PJBA 3NH5A 3CPXA 3D7FA 5HVGA 1LFWA 4C8CA 2PJ7A 4OIWA 3I6SA 2Q43A 3BXMA 2PJ8A 4PXEA 1FNOA 3WABA 4C86A 1GYTA 4OP4A 3BI0A 4FWUA 4A38A 3SI2A 2CF4A 6CPAA 1LCPA 3PB9X 2F8HA 5K8OA 2V8VA 4MHNA 1OBRA 1TXRA 3KZWA 4R7MA 3PFEA 3S9NA 4ZY2A 2PVWA 1Y0YA 3N5FA 4C99A 4WJBA 3JRUA 3V7ZA 4C8UA 2O53A 1HDQA 4EFDA 3B3VA 1F2PA 3SJGA 2PJAA 1F57A 1Y0RA 2BO9A 4P4JA 3MRUA 4UF4A 3V38A 3PB8X 2IJZA 4C8PA 2IQ6A 2AFZA 1BAVA 1PCAA 4IK2A 3VH9A 4NGMA 3FEDA 3KI9A 3KL9A 3WT4A 2G9DA 2ZOGA 1M4LA 2V77A 3L2NA 1YLOA 3B35A 4NGQA 1CP7A 1Y7EA 1DE4C 1PYTB 1ZLIA 3IC1A 3K2KA 3B7IA 5K8NA 4A94A 1LAMA 2HC9A 2JEWA 4MRIA 3KQZA 2ZEDA 2FVGA 2PRQA 3D7HA 4FAIA 4KNGE 4Q7AA 4FBEA 4MXUA 4MCRA 3NH8A 4PXCA 8CPAA 4PPZA 3GB0A 1Z5RA 3FMCA 4P4FA 4MHZA 2PCUA 5DS0A 4A39A 3WC5A 3D68A 2V8GA 4NGRA 2PJCA 3BHXA 3TX8A 1QQ9A 1TKJA 4F9VA 1DTDA 4OIDA 3SJXA 4PQAA 3PB7X 4JYWA 4ONWA 2VL1A 5ELYA 2PJ9A 3SI1A 4C9EA 4C9AA 1AMPA 1ELLP 3IFEA 4P4DA 1ARMA 4BD9A 4C85A 3B3WA 1R3NA 4OC4A 2Q4ZA 1V6CA 3FVLA 3I74A 1ZG8A 3FJUA 4C8FA 5K8MA 4A37A 4NGTA 3IIBA 2F7VA 3RAMA 2C6PA 4YU9A 4YN3A 3PRTA 1CP6A 1VHOA 2Q51A 2XEIA 3MN8A 1AYEA 3PEIA 3NH4A 2AFMA 5LYDA 1TKFA 2AFWA 1LOKA 2PJ3A 4ZY0A 2AFXA 2JBKA 4B6ZA 3DLJA 1YW6A 1HEEA 1YSJA 1CBXA 3H8FA 4ZY1A 1QMUA 5HVFA 5CBMA 2CTBA 4C8TA 4OMEA 3LMSA 2ZEOA 2XEFA 4ZX9A 5HXDA 2AFUA 4TJXA 4PXBA 2BOAA 2ZEHA 2OR4A 1Z2LA 3VARA 2ZEFA 3CDXA 3IO1A 4EMEA 7CPAA 5D8NA 4C84A 4NGSA 1ZLHA 1JQGA 1VIXA 2RFHA 1FT7A 4TJVA 4CDKA 3D67A 1BLLE 2ZELA 1ELMP 4UEFA 1XBUA 1ZG7A 2GREA 1VHEA 3IEHA
chains in the Genus database with same CATH superfamily
2CNTA 5F47A 1Q7LA 2CNSA 4JLYA 4DJLA 1J3LA 4ZYQA 2OZGA 4WWVA 4MHPA 3HPGG 2V8DA 2PRBA 3G23A 2Y1MA 2ABZA 4DNCA 5K8PA 1IU8A 2GLFA 3DR6A 1T36B 2YNCA 3JTKA 3RYOA 4M6GA 5JVLA 5EMIA 4BMHA 2ATRA 1XIXA 4PV6A 2FL4A 2CNMA 3LWUA 3T9YA 3T05A 2C6CA 3T5MA 3TO9A 4X3RA 4MCQA 2Y1NA 3N7ZA 3SR3A 3R9FA 3VRNA 3KHXA 3DDDA 4FUUA 1CS0B 2HI6A 2EZAA 3WC6A 1CJWA 4P45A 2BCOA 2PC1A 4IHMA 4KOYA 4UWIA 4CAXA 4C9VA 1RTQA 1S7KA 1SQHA 1BOBA 3CXSA 4KZTA 4RR2B 4CRZB 1YQEA 1TF9A 4H6UA 4P4EA 4DUKA 2BL1A 5FVJA 3FNCA 3D7GA 2POKA 4GS4A 1X10A 1Z8TA 5KTAA 3T07A 4E5SA 4ZI6A 2O28A 2DIKA 4XPDC 2ZEEA 1XMBA 2FIWA 4MFPA 4UIAA 2R98A 3PGPA 4KLWA 3EZAA 2Z3NA 1NSLA 4XPLA 3BJ8A 4RUHA 2EUIA 3PB6X 2B4JC 1RO5A 1K4JA 2DF5A 3FRMA 4MFZA 4RI1A 1P4NA 3FH4A 3GYAA 4H89A 2EK8A 4C2ZA 5JM6A 4TWEA 2E28A 2QIRA 3JUWA 4LQ6A 1M1DA 4E0AA 5C82A 3OB1B 4OC5A 2B58A 4XPDB 4C9RA 5F1YA 1I12A 3S6KA 5IV0A 2VZYA 1QSNA 2CTCA 5J8CA 4UEZA 4FD6A 1V0CA 1R61A 4BPXB 2YNEA 5CPAA 2DEAA 3CT9A 1YREA 2PVVA 3BUWB 1IY7A 4A4BA 2GIVA 3PBBA 3R95A 2ZEMA 3OB2B 3D4UA 1WWZA 5IR2A 2NSMA 4F9UA 3B3SA 3HUVA 3S6GA 1J4JA 4PK2A 4GM5A 2GU2A 4YGOA 4CGMA 4CYOA 2FM4A 1JDEA 4MCPA 2CIJA 4OC3A 4B5PB 3NFQA 5AG6A 1KBLA 4JZ0A 2R8VA 1CPXA 3DGVA 1I21A 1EE3P 1IOFA 3WC7A 5AG4A 3D66A 4ONUA 1EZBA 1KUXA 2I3CA 4KVXA 3UY5A 1JWQA 4MCSA 2CY2A 3H8EA 5HVHA 5LYLA 1EZAA 3ICUA 2PJ6A 3VWDA 4RS2A 3IGRA 4R76A 1YMEA 5JH9A 5J1QA 1WVMA 2PE3A 4AXVA 2PJ5A 1KEEB 2HV2A 1ZRSA 2Z3PA 3PBEA 3EY5A 1DIKA 3QB8A 1VBHA 3D3SA 5FD8A 2AUNA 4F0XA 4ZBGA 3U1BA 4Y49C 3DR8A 3DNSA 2PJ4A 1S60A 4HNWB 2QYVA 4HNXB 4J3GA 3MGDA 4FD4A 4NXYA 4B13A 4CYQA 2OZUA 3IWGA 1KC7A 2C6GA 2C27A 1M4DA 3VRQA 2ZPAA 4UFVA 5LYIA 2VEZA 2PJ1A 4NGNA 2P6FA 3PFVA 3IWEA 3GUXA 4H2KA 2AFOA 4UIBA 3K9UA 1ARLA 3T0TA 3VTAA 2K5TA 2XEGA 2J9AA 2PIYA 3D7DA 2DLAA 4ZX8A 4A31A 3IWWA 2V8HA 4OC2A 1CPSA 1VGYA 3GY9A 2VBQA 1ZO0A 1RXTA 2VI7A 1Z8LA 3ISZA 3KHZA 4U9YA 1KUYA 2ZOFA 5G22A 1F2OA 3WR7A 4A95A 4EVYA 5C88A 3EIFA 3VRRA 1YW4A 2QVPA 4UEEA 3W6SA 5THWA 2EK9A 2R7HA 2GFQA 4CYPA 4R6TA 4Z65A 1MJBA 1B47A 3KQXA 1YGHA 3TO7A 3B3TA 5F48A 4BBHA 1BXRB 3CPAA 3D2MA 3IJ3A 4MFLA 2B4DB 4PXDA 4G1PA 2HB6A 4R9MA 2PCNA 4YRHA 1KWMA 3B3CA 2AE6A 4UCMA 2WYRA 2R1IA 4QVTA 3K4IA 2JLMA 2Q7BA 4P6YA 5D29A 5LYFA 5IB0A 4CDJA 2XEJA 1QSOA 3FX6A 2RB7A 4MHDA 1JDBC 1UWYA 3HPHE 1LANA 2FSRA 2G3TA 4M6HA 3S9LA 4R8FA 4QB9A 3B2YA 2R82A 2CBLA 2PJ2A 1XF1A 3EXNA 5JGFA 2ANPA 4INJA 4C7HA 1CE8B 3KR5A 4MI4A 1TKHA 3G3SA 4Q36A 2ZW6A 3FECA 4IUSA 5IX3A 2BUEA 1Q2DA 3GIUA 3KR4A 4R3LA 1IGBA 5G1ZA 2ZENA 4CAVA 4XNHB 1M4GA 3LODA 4A4CA 2G0BA 2ZEGA 3TLYA 3NA6A 1VI4A 3TLGB 4CPAA 3SXNA 5ISVA 2D0OA 4OADA 1R43A 5LRGA 1LAPA 4MJ8A 1NXJA 2NYQA 5F09A 1IYLA 4JXRA 3ZNIA 4DYOA 4AG9A 3GLJA 1XRYA 3PB4X 4UA3A 4B5OA 2A4NA 1PU9A 1GGOA 4O23A 2ZEPA 1C30B 4L8AA 2PIZA 3H4QA 4NGPA 3SJEA 2J8NA 4LQGA 2GANA 1H8LA 2PSWA 4NFRA 5H84A 3T90A 5KTDA 1WJTA 5I4MA 5IB9A 4CRYB 2VKZG 2OOTA 1Z9UA 5LRKA 1A9XB 5BWAB 1C3OB 4NJRA 4MHYA 1TIQA 3KASA 1XF8A 3C8OA 4CZ1A 4OC1A 4OKOA 2GLJA 3FEEA 4F0YA 1CX8A 3VATA 2BSWA 4C9UA 2EVNA 3ISXA 3T8WA 4RN7A 3RO0A 4XNHC 2WZNA 4QUSA 3FF3A 4CGLA 3QNVA 4K30A 4TNUA 4CAEA 4MI1A 4YWYA 1BPNA 1QSTA 4AVCA 4B11A 3HLPA 2PJ0A 4M6IA 2WSAA 2Q4VA 4GPLB 3I1UA 4X2TA 1VBGA 3FBUA 4W9YA 4JD6A 4KVME 4C2YA 3I3GA 4LX9A 2EWBA 1NSAA 5G20A 2CXAA 2C1CA 1XFOA 1NMTA 5E96A 4NEXA 3OP0A 1VKCA 4OC0A 4F8ZA 3PFOA 3BI1A 4AVBA 2DPTA 1NBWA 2HROA 3IU2A 2YJVA 2VZZA 1BO4A 4P44A 3K9TA 2Z3OA 4UBRA 3H8GA 5A27A 3NFZA 2N3AB 2F5IA 4EWTA 1KUVA 3GJZA 5K99A 4H6ZA 3O8ZA 2WPWA 4ORFA 2EZCA 3G8WA 2REEA 2QJ8A 4I49A 4KSIA 1BPMA 1VHSA 1ZG9A 3KGQA 3SJFA 3RZAA 2GP4A 4NJQA 5HKYA 3NE8A 4P10A 4PSXA 4UCNA 1Q2CA 3RBUA 2HQYA 2B5GA 1N71A 4P4BA 1CG2A 2VQYA 2X7BA 1M44A 2PQ8A 4K3NA 4Q38A 1TF8A 4MMOA 1Z4EA 4CAWA 2Z3LA 1M6VB 4P4IA 2X0SA 2EZBA 4J0NA 2O4HA 3CXPA 2UV8G 1HDUA 1PUAA 1P0HA 1CM0A 3FIXA 2AFSA 4KVOE 2IMOA 5AG7A 5I0CA 5JYBA 1UFHA 1XJOA 4HKFA 4MFQA 3VGOA 4AG7A 3SI0A 4C8AA 3TFYA 4COGA 3PP9A 4X8IA 3S9MA 3TC8A 4C2XA 1Y9ZA 2JBJA 2VXKA 4IAVA 5LRJA 1GHEA 2D4OA 4FD7A 3TTHA 2PJBA 3EZEA 3NH5A 1IB1E 3D7FA 3CPXA 5HVGA 3W6XA 1LFWA 2YNDA 4C8CA 2PJ7A 1IICA 4OIWA 3I6SA 2HUZA 5AG5A 4L89A 2FCKA 2Q43A 3BXMA 2PJ8A 3S6FA 4PXEA 1FNOA 3WABA 4C86A 1S7NA 4R57A 5AGEA 1X12A 1GYTA 2DPSA 4OP4A 2B3UA 3BI0A 4FWUA 4PSWA 4A38A 3PLFB 2CF4A 2JDDA 4KOUA 3SI2A 6CPAA 5F9MA 1LCPA 1FBVA 3PB9X 1YK3A 2P6EA 4M3SA 3TOAA 5H86A 3EC4A 1M4IA 1A2ZA 2F8HA 5K8OA 4AB7A 3TLBA 4LUAA 2V8VA 4KOWA 3VARA 1YLEA 4MHNA 4KOXA 4C68A 1OBRA 4IIXA 3TLCA 2I79A 1TXRA 1YX0A 1MJ9A 2Z0ZA 3KZWA 3F5BA 3P2FA 4R7MA 3TLAA 4QBJA 2IL4A 3R1KA 2BEIA 2ODFA 4MBUA 3TLGA 3PFEA 4YFJA 1XEBA 4IF5A 5F49A 3S9NA 1QSMA 4ZY2A 2PVWA 1Y0YA 4B5PA 3TT2A 3EO4A 3N5FA 4C99A 4WJBA 2P0WA 2G3AA 2YJTA 5A28A 3JRUA 3HMJG 3V7ZA 5G21A 4C8UA 2Q44A 2O53A 3PT1A 2C5QA 1HDQA 4EFDA 7CPAA 1ZYMA 3B3VA 1F2PA 4AVAA 3SJGA 2PJAA 4X5KA 5HKWA 1Z8XA 1F57A 3E0KA 2HWGA 2PR1A 1Y0RA 2BO9A 4A30A 2ZXVA 2PDOA 4P4JA 2XPNA 1ON0A 4IIYA 3MRUA 4UF4A 3PZJA 5CNPA 2XPLA 3BUNB 3BJ7A 3PB8X 3BLNA 3V38A 2IJZA 3BUOB 4CAFA 4C8PA 3BUXB 5J8FA 1R57A 4OLLA 2IQ6A 2AFZA 2OH1A 1BAVA 1PCAA 3FYNA 4IK2A 2QECA 3VH9A 5EBVA 1YVHA 4NGMA 3FEDA 2Q7SA 3CXQA 3KI9A 4JVOA 4COBA 4CGPA 3KL9A 4KLVA 3EFAA 4HNYB 4OAEA 3I9SA 2OB0A 3WT4A 2OZHA 2DXQA 1Q2YA 2YNCC 2B4DA 4UFXA 4E8OA 3TLZA 2Z10A 2G9DA 2ZOGA 4R3KA 1M4LA 2XPOA 1QSRA 2V77A 3L2NA 5KTCA 1YLOA 3RNZA 3ZZIA 4KOVA 3B35A 2OLSA 4NGQA 2EBJA 1AUGA 4UFWA 1CP7A 1Y9WA 3TE4A 1Y7EA 1DE4C 4CGNA 1PYTB 1ZLIA 3P2HA 3IC1A 2GE3A 2P6GA 3K2KA 3SXOA 2B3VA 1B87A 4UCPA 3B7IA 3V8IA 5F46A 1Z8WA 5K8NA 4JWPA 3D2PA 4B12A 5JQ4A 5J3XA 4A94A 1LAMA 2HC9A 2JEWA 4A32A 4MRIA 3NOJA 3KQZA 4JXQA 3D8PA 4M85A 4CO9A 4BPWB 3QAYA 4CYNA 1S7LA 1YVOA 2ZEDA 2FVGA 2PRQA 3FXTA 4NSQA 4UWJA 4EYSA 3D7HA 4FAIA 4KNGE 4Q7AA 1IOIA 4FBEA 3VROA 1B6BA 1KZFA 3U88C 4MXUA 2REFA 2Q0YA 4XPKA 5DWNA 4MCRA 3NH8A 4PXCA 1XMTA 1WK4A 2B5GB 4PPZA 4NCZA 8CPAA 3BUMB 3GB0A 2H5MA 2J8RA 4MY0A 4A33A 1S5KA 5DWMA 1Z5RA 2Z11A 3H5ZA 3FMCA 3TCVA 2Z3MA 4P4FA 4MHZA 3VRPA 2PCUA 5DS0A 4HPSA 2I00A 4A39A 3WC5A 3D68A 2V8GA 4KUBA 4NGRA 1Z4RA 2PJCA 4KS9A 3BHXA 4R87A 5BY0A 3TX8A 1QQ9A 1IIDA 2NMTA 2RC4A 1TKJA 4F9VA 1DTDA 2WPXA 4OIDA 4BPUB 3TO6A 3SJXA 2EO8A 4KUAA 4MFJA 4PQAA 1L0CA 3PB7X 3R9GA 4JYWA 4ONWA 2VL1A 4CS0B 5ELYA 2PJ9A 3SI1A 4C9EA 4F6AA 4C9AA 1AMPA 1ELLP 3CZXA 3IFEA 4P4DA 5HH1A 2KCWA 4H1HA 1ARMA 3OAKA 4JJXA 4BD9A 4C85A 3B3WA 5HKZA 1LRZA 1R3NA 4FD5A 3KKWA 5GCNA 4U9ZA 4OC4A 3TOBA 5HMNA 4ZGYB 5JPHA 5F5XA 2AJ6A 4KSFA 2Q4ZA 2Q4YA 2ZW4A 3FVLA 2PR8A 1V6CA 3I74A 1ZG8A 1Y9KA 3FJUA 1MK4A 1NE9A 4A37A 5K8MA 4C8FA 4NGTA 3IIBA 2FE7A 2D0PA 2F7VA 3A9LA 2JEVA 3RAMA 4CGOA 4II9A 4MY3A 1ZL0A 3FB3A 2XPPA 2C6PA 4GXHA 3W91A 4YU9A 3ZJ0A 4YN3A 2QMLA 1YVKA 1OZPA 2FT0A 3TYXA 3PRTA 1CP6A 2WUUA 1VHOA 2Q51A 2XEIA 3LD2A 3LACA 3R9EA 1Q5XA 4MJXA 3TLEA 4E2AA 3MN8A 1MJAA 1AYEA 3PEIA 3NH4A 2AFMA 3QAHA 1XE4A 1TKFA 2AFWA 5LYDA 4KOTA 1IYKA 1LOKA 2PJ3A 4KOSA 5EC4A 4B10A 4ZY0A 3EZBA 2AFXA 2JBKA 4B6ZA 1S3ZA 3DLJA 1YW6A 1HEEA 1YSJA 1CBXA 3H8FA 1I1DA 4QC6A 1QMUA 5HVFA 4B14A 4ZY1A 5CBMA 4E94A 2CTBA 4BINA 4C8TA 1XOVA 4A2ZA 2ARHA 4OMEA 2AUMA 3GKRA 2YGWA 1Y7RA 3LMSA 2ZEOA 2XEFA 4KSAA 4ZX9A 3R96A 5AXIA 5HXDA 2MP0A 2ZW5A 2B0AA 2AFUA 2ZW7A 4U5YA 4TJXA 4PXBA 5F13A 2FXFA 4Y49B 2BOAA 2Y0MA 2OR4A 1Z2LA 2FS5A 2FIAA 2Z3KA 1YR0A 2D4PA 2ZEHA 2J8MA 2ZEFA 3CDXA 3F0AA 3B8GA 3C26A 3IO1A 3F9KC 5D8NA 1Z9EA 1U6MA 3SHPA 4EMEA 4M8DA 4C84A 2Q04A 3DSBA 4PK3A 4NGSA 3NE7A 1ZLHA 1JQGA 1VIXA 2RFHA 1FT7A 3OWCA 4KORA 4NF1A 3IU1A 4TJVA 3KRVA 1FY7A 3S6HA 4CDKA 3D67A 3F8KA 2OU2A 1BLLE 4C7IA 2ZELA 1ELMP 4UEFA 2B4BA 1XBUA 1ZG7A 2GREA 1S7FA 4MFKA 1VHEA 3VWEA 3JVNA 1EO0A 4BTFA 2JDCA 3IEHA
chains in the Genus database with same CATH topology
1Q7LA 4DJLA 4ZYQA 4WWVA 4MHPA 2V8DA 2ABZA 5K8PA 2GLFA 3LWUA 2C6CA 4X3RA 4MCQA 3KHXA 4FUUA 3WC6A 4P45A 2BCOA 4IHMA 4C9VA 1RTQA 1TF9A 4P4EA 4DUKA 3D7GA 2POKA 4ZI6A 2ZEEA 1XMBA 4UIAA 4RUHA 3PB6X 3FH4A 5JM6A 2EK8A 4TWEA 4OC5A 4C9RA 2CTCA 4UEZA 5CPAA 2DEAA 3CT9A 2PVVA 3PBBA 1IY7A 2ZEMA 3D4UA 5IR2A 2NSMA 4F9UA 3B3SA 3HUVA 4GM5A 2GU2A 4MCPA 2CIJA 4OC3A 4JZ0A 3WC7A 1CPXA 3DGVA 1EE3P 3D66A 2I3CA 5LYLA 4MCSA 5HVHA 3H8EA 3ICUA 2PJ6A 1WVMA 5J1QA 4R76A 1YMEA 5JH9A 2PE3A 4AXVA 2PJ5A 3PBEA 2PJ4A 2QYVA 2C6GA 5LYIA 2PJ1A 4NGNA 4H2KA 3VTAA 3GUXA 2AFOA 4UIBA 1ARLA 2XEGA 2J9AA 2PIYA 3D7DA 4ZX8A 3IWWA 2V8HA 4OC2A 1CPSA 1VGYA 3ISZA 1Z8LA 3KHZA 2ZOFA 1F2OA 3EIFA 2QVPA 1YW4A 4UEEA 5THWA 2EK9A 4R6TA 4Z65A 3KQXA 3B3TA 3CPAA 3IJ3A 4PXDA 4G1PA 2HB6A 1KWMA 3B3CA 2WYRA 4P6YA 5D29A 5LYFA 4CDJA 2XEJA 3FX6A 2RB7A 1UWYA 1LANA 3S9LA 4R8FA 3B2YA 2PJ2A 1XF1A 5JGFA 2ANPA 3KR5A 1TKHA 3FECA 3KR4A 1IGBA 2ZENA 2ZEGA 3NA6A 4CPAA 1R43A 5LRGA 1LAPA 2NYQA 5F09A 4DYOA 3GLJA 1XRYA 3PB4X 4O23A 2ZEPA 2PIZA 4NGPA 3SJEA 4NFRA 4LQGA 1H8LA 5I4MA 5IB9A 2OOTA 5LRKA 4NJRA 4MHYA 3KASA 4OC1A 4OKOA 2GLJA 3FEEA 1CX8A 3VATA 4C9UA 3ISXA 3T8WA 2WZNA 3FF3A 3QNVA 4TNUA 4YWYA 1BPNA 3HLPA 2PJ0A 3I1UA 4X2TA 4W9YA 2EWBA 1NSAA 2C1CA 1XFOA 4OC0A 4F8ZA 3PFOA 3BI1A 4P44A 3K9TA 3H8GA 3NFZA 4EWTA 2QJ8A 4KSIA 1BPMA 3KGQA 1ZG9A 2GP4A 3SJFA 3RZAA 4NJQA 4P10A 3RBUA 4P4BA 4K3NA 1CG2A 1TF8A 4MMOA 4P4IA 2O4HA 1HDUA 2AFSA 2IMOA 1XJOA 4C8AA 3SI0A 4X8IA 3S9MA 3TC8A 1Y9ZA 2JBJA 4IAVA 5LRJA 2PJBA 3NH5A 3CPXA 3D7FA 5HVGA 1LFWA 4C8CA 2PJ7A 4OIWA 3I6SA 2Q43A 3BXMA 2PJ8A 4PXEA 1FNOA 3WABA 4C86A 1GYTA 4OP4A 3BI0A 4FWUA 4A38A 3SI2A 2CF4A 6CPAA 1LCPA 3PB9X 2F8HA 5K8OA 2V8VA 4MHNA 1OBRA 1TXRA 3KZWA 4R7MA 3PFEA 3S9NA 4ZY2A 2PVWA 1Y0YA 3N5FA 4C99A 4WJBA 3JRUA 3V7ZA 4C8UA 2O53A 2C5QA 1HDQA 4EFDA 3B3VA 1F2PA 3SJGA 2PJAA 1F57A 1Y0RA 2BO9A 4P4JA 3MRUA 4UF4A 3V38A 3PB8X 2IJZA 4C8PA 2IQ6A 2AFZA 1BAVA 1PCAA 4IK2A 3VH9A 4NGMA 3FEDA 3KI9A 3KL9A 3WT4A 2G9DA 2ZOGA 1M4LA 2V77A 3L2NA 1YLOA 3B35A 4NGQA 1CP7A 1Y7EA 1DE4C 1PYTB 1ZLIA 3IC1A 3K2KA 3B7IA 5K8NA 4A94A 1LAMA 2HC9A 2JEWA 4MRIA 3KQZA 2ZEDA 2FVGA 2PRQA 3D7HA 4FAIA 4KNGE 4Q7AA 4FBEA 4MXUA 4MCRA 3NH8A 4PXCA 8CPAA 4PPZA 3GB0A 1Z5RA 3FMCA 4P4FA 4MHZA 2PCUA 5DS0A 4A39A 3WC5A 3D68A 2V8GA 4NGRA 2PJCA 3BHXA 3TX8A 1QQ9A 1TKJA 4F9VA 1DTDA 4OIDA 3SJXA 4PQAA 3PB7X 4JYWA 4ONWA 2VL1A 5ELYA 2PJ9A 3SI1A 4C9EA 4C9AA 1AMPA 1ELLP 3IFEA 4P4DA 1ARMA 4BD9A 4C85A 3B3WA 1R3NA 4OC4A 2Q4ZA 1V6CA 3FVLA 3I74A 1ZG8A 3FJUA 4C8FA 5K8MA 4A37A 4NGTA 3IIBA 2F7VA 3RAMA 2C6PA 4YU9A 4YN3A 3PRTA 1CP6A 1VHOA 2Q51A 2XEIA 3MN8A 1AYEA 3PEIA 3NH4A 2AFMA 5LYDA 1TKFA 2AFWA 1LOKA 2PJ3A 4ZY0A 2AFXA 2JBKA 4B6ZA 3DLJA 1YW6A 1HEEA 1YSJA 1CBXA 3H8FA 4ZY1A 1QMUA 5HVFA 5CBMA 2CTBA 4C8TA 4OMEA 3LMSA 2ZEOA 2XEFA 4ZX9A 5HXDA 2AFUA 4TJXA 4PXBA 2BOAA 2ZEHA 2OR4A 1Z2LA 3VARA 2ZEFA 3CDXA 3IO1A 4EMEA 7CPAA 5D8NA 4C84A 4NGSA 1ZLHA 1JQGA 1VIXA 2RFHA 1FT7A 4TJVA 4CDKA 3D67A 1BLLE 2ZELA 1ELMP 4UEFA 1XBUA 1ZG7A 2GREA 1VHEA 3IEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7L A;  4DJL A;  4ZYQ A;  4WWV A;  4MHP A;  2V8D A;  2ABZ A;  5K8P A;  2GLF A;  3LWU A;  2C6C A;  4X3R A;  4MCQ A;  3KHX A;  4FUU A;  3WC6 A;  4P45 A;  2BCO A;  4IHM A;  4C9V A;  1RTQ A;  1TF9 A;  4P4E A;  4DUK A;  3D7G A;  2POK A;  4ZI6 A;  2ZEE A;  1XMB A;  4UIA A;  4RUH A;  3PB6 X;  3FH4 A;  5JM6 A;  2EK8 A;  4TWE A;  4OC5 A;  4C9R A;  2CTC A;  4UEZ A;  5CPA A;  2DEA A;  3CT9 A;  2PVV A;  3PBB A;  1IY7 A;  2ZEM A;  3D4U A;  2NSM A;  4F9U A;  3B3S A;  3HUV A;  4GM5 A;  2GU2 A;  4MCP A;  2CIJ A;  4OC3 A;  4JZ0 A;  3WC7 A;  1CPX A;  3DGV A;  1EE3 P;  3D66 A;  2I3C A;  5LYL A;  4MCS A;  5HVH A;  3H8E A;  3ICU A;  2PJ6 A;  1WVM A;  5J1Q A;  4R76 A;  1YME A;  5JH9 A;  2PE3 A;  4AXV A;  2PJ5 A;  3PBE A;  2PJ4 A;  2QYV A;  2C6G A;  5LYI A;  2PJ1 A;  4NGN A;  4H2K A;  3VTA A;  3GUX A;  2AFO A;  4UIB A;  1ARL A;  2XEG A;  2J9A A;  2PIY A;  3D7D A;  4ZX8 A;  3IWW A;  2V8H A;  4OC2 A;  1CPS A;  1VGY A;  3ISZ A;  1Z8L A;  3KHZ A;  2ZOF A;  1F2O A;  3EIF A;  2QVP A;  1YW4 A;  4UEE A;  5THW A;  2EK9 A;  4R6T A;  4Z65 A;  3KQX A;  3B3T A;  3CPA A;  3IJ3 A;  4PXD A;  4G1P A;  2HB6 A;  1KWM A;  3B3C A;  2WYR A;  4P6Y A;  5D29 A;  5LYF A;  4CDJ A;  2XEJ A;  3FX6 A;  2RB7 A;  1UWY A;  1LAN A;  3S9L A;  4R8F A;  3B2Y A;  2PJ2 A;  1XF1 A;  5JGF A;  2ANP A;  3KR5 A;  1TKH A;  3FEC A;  3KR4 A;  1IGB A;  2ZEN A;  2ZEG A;  3NA6 A;  4CPA A;  1R43 A;  5LRG A;  1LAP A;  2NYQ A;  5F09 A;  4DYO A;  3GLJ A;  1XRY A;  3PB4 X;  4O23 A;  2ZEP A;  2PIZ A;  4NGP A;  3SJE A;  4NFR A;  4LQG A;  1H8L A;  5I4M A;  5IB9 A;  2OOT A;  5LRK A;  4NJR A;  4MHY A;  3KAS A;  4OC1 A;  4OKO A;  2GLJ A;  3FEE A;  1CX8 A;  3VAT A;  4C9U A;  3ISX A;  3T8W A;  2WZN A;  3FF3 A;  3QNV A;  4TNU A;  4YWY A;  1BPN A;  3HLP A;  2PJ0 A;  3I1U A;  4X2T A;  4W9Y A;  2EWB A;  1NSA A;  2C1C A;  1XFO A;  4OC0 A;  4F8Z A;  3PFO A;  3BI1 A;  4P44 A;  3K9T A;  3H8G A;  3NFZ A;  4EWT A;  2QJ8 A;  4KSI A;  1BPM A;  3KGQ A;  1ZG9 A;  3SJF A;  3RZA A;  4NJQ A;  4P10 A;  3RBU A;  4P4B A;  4K3N A;  1CG2 A;  1TF8 A;  4MMO A;  4P4I A;  2O4H A;  1HDU A;  2AFS A;  2IMO A;  1XJO A;  4C8A A;  3SI0 A;  4X8I A;  3S9M A;  3TC8 A;  1Y9Z A;  2JBJ A;  4IAV A;  5LRJ A;  2PJB A;  3NH5 A;  3CPX A;  3D7F A;  5HVG A;  1LFW A;  4C8C A;  2PJ7 A;  4OIW A;  3I6S A;  2Q43 A;  3BXM A;  2PJ8 A;  4PXE A;  1FNO A;  3WAB A;  4C86 A;  1GYT A;  4OP4 A;  3BI0 A;  4FWU A;  4A38 A;  3SI2 A;  2CF4 A;  6CPA A;  1LCP A;  3PB9 X;  2F8H A;  5K8O A;  2V8V A;  4MHN A;  1OBR A;  1TXR A;  3KZW A;  4R7M A;  3PFE A;  3S9N A;  4ZY2 A;  2PVW A;  1Y0Y A;  3N5F A;  4C99 A;  4WJB A;  3JRU A;  3V7Z A;  4C8U A;  2O53 A;  1HDQ A;  4EFD A;  3B3V A;  1F2P A;  3SJG A;  2PJA A;  1F57 A;  1Y0R A;  2BO9 A;  4P4J A;  3MRU A;  4UF4 A;  3V38 A;  3PB8 X;  2IJZ A;  4C8P A;  2IQ6 A;  2AFZ A;  1BAV A;  1PCA A;  4IK2 A;  3VH9 A;  4NGM A;  3FED A;  3KI9 A;  3KL9 A;  3WT4 A;  2G9D A;  2ZOG A;  1M4L A;  2V77 A;  3L2N A;  1YLO A;  3B35 A;  4NGQ A;  1CP7 A;  1Y7E A;  1DE4 C;  1PYT B;  1ZLI A;  3IC1 A;  3K2K A;  3B7I A;  5K8N A;  4A94 A;  1LAM A;  2HC9 A;  2JEW A;  4MRI A;  3KQZ A;  2ZED A;  2FVG A;  2PRQ A;  3D7H A;  4FAI A;  4KNG E;  4Q7A A;  4FBE A;  4MXU A;  4MCR A;  3NH8 A;  4PXC A;  8CPA A;  4PPZ A;  3GB0 A;  1Z5R A;  3FMC A;  4P4F A;  4MHZ A;  2PCU A;  5DS0 A;  4A39 A;  3WC5 A;  3D68 A;  2V8G A;  4NGR A;  2PJC A;  3BHX A;  3TX8 A;  1QQ9 A;  1TKJ A;  4F9V A;  1DTD A;  4OID A;  3SJX A;  4PQA A;  3PB7 X;  4JYW A;  4ONW A;  2VL1 A;  5ELY A;  2PJ9 A;  3SI1 A;  4C9E A;  4C9A A;  1AMP A;  1ELL P;  3IFE A;  4P4D A;  1ARM A;  4BD9 A;  4C85 A;  3B3W A;  1R3N A;  4OC4 A;  2Q4Z A;  1V6C A;  3FVL A;  3I74 A;  1ZG8 A;  3FJU A;  4C8F A;  5K8M A;  4A37 A;  4NGT A;  3IIB A;  2F7V A;  3RAM A;  2C6P A;  4YU9 A;  4YN3 A;  3PRT A;  1CP6 A;  1VHO A;  2Q51 A;  2XEI A;  3MN8 A;  1AYE A;  3PEI A;  3NH4 A;  2AFM A;  5LYD A;  1TKF A;  2AFW A;  1LOK A;  2PJ3 A;  4ZY0 A;  2AFX A;  2JBK A;  4B6Z A;  3DLJ A;  1YW6 A;  1HEE A;  1YSJ A;  1CBX A;  3H8F A;  4ZY1 A;  1QMU A;  5HVF A;  5CBM A;  2CTB A;  4C8T A;  4OME A;  3LMS A;  2ZEO A;  2XEF A;  4ZX9 A;  5HXD A;  2AFU A;  4TJX A;  4PXB A;  2BOA A;  2ZEH A;  2OR4 A;  1Z2L A;  3VAR A;  2ZEF A;  3CDX A;  3IO1 A;  4EME A;  7CPA A;  5D8N A;  4C84 A;  4NGS A;  1ZLH A;  1JQG A;  1VIX A;  2RFH A;  1FT7 A;  4TJV A;  4CDK A;  3D67 A;  1BLL E;  2ZEL A;  1ELM P;  4UEF A;  1XBU A;  1ZG7 A;  2GRE A;  1VHE A;  3IEH A; 
#chains in the Genus database with same CATH topology
 2CNT A;  5F47 A;  1Q7L A;  2CNS A;  4JLY A;  4DJL A;  1J3L A;  4ZYQ A;  2OZG A;  4WWV A;  4MHP A;  3HPG G;  2V8D A;  2PRB A;  3G23 A;  2Y1M A;  2ABZ A;  4DNC A;  5K8P A;  1IU8 A;  2GLF A;  3DR6 A;  1T36 B;  2YNC A;  3JTK A;  3RYO A;  4M6G A;  5JVL A;  5EMI A;  4BMH A;  2ATR A;  1XIX A;  4PV6 A;  2FL4 A;  2CNM A;  3LWU A;  3T9Y A;  3T05 A;  2C6C A;  3T5M A;  3TO9 A;  4X3R A;  4MCQ A;  2Y1N A;  3N7Z A;  3SR3 A;  3R9F A;  3VRN A;  3KHX A;  3DDD A;  4FUU A;  1CS0 B;  2HI6 A;  2EZA A;  3WC6 A;  1CJW A;  4P45 A;  2BCO A;  2PC1 A;  4IHM A;  4KOY A;  4UWI A;  4CAX A;  4C9V A;  1RTQ A;  1S7K A;  1SQH A;  1BOB A;  3CXS A;  4KZT A;  4RR2 B;  4CRZ B;  1YQE A;  1TF9 A;  4H6U A;  4P4E A;  4DUK A;  2BL1 A;  5FVJ A;  3FNC A;  3D7G A;  2POK A;  4GS4 A;  1X10 A;  1Z8T A;  5KTA A;  3T07 A;  4E5S A;  4ZI6 A;  2O28 A;  2DIK A;  4XPD C;  2ZEE A;  1XMB A;  2FIW A;  4MFP A;  4UIA A;  2R98 A;  3PGP A;  4KLW A;  3EZA A;  2Z3N A;  1NSL A;  4XPL A;  3BJ8 A;  4RUH A;  2EUI A;  3PB6 X;  2B4J C;  1RO5 A;  1K4J A;  2DF5 A;  3FRM A;  4MFZ A;  4RI1 A;  1P4N A;  3FH4 A;  3GYA A;  4H89 A;  2EK8 A;  4C2Z A;  5JM6 A;  4TWE A;  2E28 A;  2QIR A;  3JUW A;  4LQ6 A;  1M1D A;  4E0A A;  5C82 A;  3OB1 B;  4OC5 A;  2B58 A;  4XPD B;  4C9R A;  5F1Y A;  1I12 A;  3S6K A;  5IV0 A;  2VZY A;  1QSN A;  2CTC A;  5J8C A;  4UEZ A;  4FD6 A;  1V0C A;  1R61 A;  4BPX B;  2YNE A;  5CPA A;  2DEA A;  3CT9 A;  1YRE A;  2PVV A;  3BUW B;  1IY7 A;  4A4B A;  2GIV A;  3PBB A;  3R95 A;  2ZEM A;  3OB2 B;  3D4U A;  1WWZ A;  5IR2 A;  2NSM A;  4F9U A;  3B3S A;  3HUV A;  3S6G A;  1J4J A;  4PK2 A;  4GM5 A;  2GU2 A;  4YGO A;  4CGM A;  4CYO A;  2FM4 A;  1JDE A;  4MCP A;  2CIJ A;  4OC3 A;  4B5P B;  3NFQ A;  5AG6 A;  1KBL A;  4JZ0 A;  2R8V A;  1CPX A;  3DGV A;  1I21 A;  1EE3 P;  1IOF A;  3WC7 A;  5AG4 A;  3D66 A;  4ONU A;  1EZB A;  1KUX A;  2I3C A;  4KVX A;  3UY5 A;  1JWQ A;  4MCS A;  2CY2 A;  3H8E A;  5HVH A;  5LYL A;  1EZA A;  3ICU A;  2PJ6 A;  3VWD A;  4RS2 A;  3IGR A;  4R76 A;  1YME A;  5JH9 A;  5J1Q A;  1WVM A;  2PE3 A;  4AXV A;  2PJ5 A;  1KEE B;  2HV2 A;  1ZRS A;  2Z3P A;  3PBE A;  3EY5 A;  1DIK A;  3QB8 A;  1VBH A;  3D3S A;  5FD8 A;  2AUN A;  4F0X A;  4ZBG A;  3U1B A;  4Y49 C;  3DR8 A;  3DNS A;  2PJ4 A;  1S60 A;  4HNW B;  2QYV A;  4HNX B;  4J3G A;  3MGD A;  4FD4 A;  4NXY A;  4B13 A;  4CYQ A;  2OZU A;  3IWG A;  1KC7 A;  2C6G A;  2C27 A;  1M4D A;  3VRQ A;  2ZPA A;  4UFV A;  5LYI A;  2VEZ A;  2PJ1 A;  4NGN A;  2P6F A;  3PFV A;  3IWE A;  3GUX A;  4H2K A;  2AFO A;  4UIB A;  3K9U A;  1ARL A;  3T0T A;  3VTA A;  2K5T A;  2XEG A;  2J9A A;  2PIY A;  3D7D A;  2DLA A;  4ZX8 A;  4A31 A;  3IWW A;  2V8H A;  4OC2 A;  1CPS A;  1VGY A;  3GY9 A;  2VBQ A;  1ZO0 A;  1RXT A;  2VI7 A;  1Z8L A;  3ISZ A;  3KHZ A;  4U9Y A;  1KUY A;  2ZOF A;  5G22 A;  1F2O A;  3WR7 A;  4A95 A;  4EVY A;  5C88 A;  3EIF A;  3VRR A;  1YW4 A;  2QVP A;  4UEE A;  3W6S A;  5THW A;  2EK9 A;  2R7H A;  2GFQ A;  4CYP A;  4R6T A;  4Z65 A;  1MJB A;  1B47 A;  3KQX A;  1YGH A;  3TO7 A;  3B3T A;  5F48 A;  4BBH A;  1BXR B;  3CPA A;  3D2M A;  3IJ3 A;  4MFL A;  2B4D B;  4PXD A;  4G1P A;  2HB6 A;  4R9M A;  2PCN A;  4YRH A;  1KWM A;  3B3C A;  2AE6 A;  4UCM A;  2WYR A;  2R1I A;  4QVT A;  3K4I A;  2JLM A;  2Q7B A;  4P6Y A;  5D29 A;  5LYF A;  5IB0 A;  4CDJ A;  2XEJ A;  1QSO A;  3FX6 A;  2RB7 A;  4MHD A;  1JDB C;  1UWY A;  3HPH E;  1LAN A;  2FSR A;  2G3T A;  4M6H A;  3S9L A;  4R8F A;  4QB9 A;  3B2Y A;  2R82 A;  2CBL A;  2PJ2 A;  1XF1 A;  3EXN A;  5JGF A;  2ANP A;  4INJ A;  4C7H A;  1CE8 B;  3KR5 A;  4MI4 A;  1TKH A;  3G3S A;  4Q36 A;  2ZW6 A;  3FEC A;  4IUS A;  5IX3 A;  2BUE A;  1Q2D A;  3GIU A;  3KR4 A;  4R3L A;  1IGB A;  5G1Z A;  2ZEN A;  4CAV A;  4XNH B;  1M4G A;  3LOD A;  4A4C A;  2G0B A;  2ZEG A;  3TLY A;  3NA6 A;  1VI4 A;  3TLG B;  4CPA A;  3SXN A;  5ISV A;  2D0O A;  4OAD A;  1R43 A;  5LRG A;  1LAP A;  4MJ8 A;  1NXJ A;  2NYQ A;  5F09 A;  1IYL A;  4JXR A;  3ZNI A;  4DYO A;  4AG9 A;  3GLJ A;  1XRY A;  3PB4 X;  4UA3 A;  4B5O A;  2A4N A;  1PU9 A;  1GGO A;  4O23 A;  2ZEP A;  1C30 B;  4L8A A;  2PIZ A;  3H4Q A;  4NGP A;  3SJE A;  2J8N A;  4LQG A;  2GAN A;  1H8L A;  2PSW A;  4NFR A;  5H84 A;  3T90 A;  5KTD A;  1WJT A;  5I4M A;  5IB9 A;  4CRY B;  2VKZ G;  2OOT A;  1Z9U A;  5LRK A;  1A9X B;  5BWA B;  1C3O B;  4NJR A;  4MHY A;  1TIQ A;  3KAS A;  1XF8 A;  3C8O A;  4CZ1 A;  4OC1 A;  4OKO A;  2GLJ A;  3FEE A;  4F0Y A;  1CX8 A;  3VAT A;  2BSW A;  4C9U A;  2EVN A;  3ISX A;  3T8W A;  4RN7 A;  3RO0 A;  4XNH C;  2WZN A;  4QUS A;  3FF3 A;  4CGL A;  3QNV A;  4K30 A;  4TNU A;  4CAE A;  4MI1 A;  4YWY A;  1BPN A;  1QST A;  4AVC A;  4B11 A;  3HLP A;  2PJ0 A;  4M6I A;  2WSA A;  2Q4V A;  4GPL B;  3I1U A;  4X2T A;  1VBG A;  3FBU A;  4W9Y A;  4JD6 A;  4KVM E;  4C2Y A;  3I3G A;  4LX9 A;  2EWB A;  1NSA A;  5G20 A;  2CXA A;  2C1C A;  1XFO A;  1NMT A;  5E96 A;  4NEX A;  3OP0 A;  1VKC A;  4OC0 A;  4F8Z A;  3PFO A;  3BI1 A;  4AVB A;  2DPT A;  1NBW A;  2HRO A;  3IU2 A;  2YJV A;  2VZZ A;  1BO4 A;  4P44 A;  3K9T A;  2Z3O A;  4UBR A;  3H8G A;  5A27 A;  3NFZ A;  2N3A B;  2F5I A;  4EWT A;  1KUV A;  3GJZ A;  5K99 A;  4H6Z A;  3O8Z A;  2WPW A;  4ORF A;  2EZC A;  3G8W A;  2REE A;  2QJ8 A;  4I49 A;  4KSI A;  1BPM A;  1VHS A;  1ZG9 A;  3KGQ A;  3SJF A;  3RZA A;  2GP4 A;  4NJQ A;  5HKY A;  3NE8 A;  4P10 A;  4PSX A;  4UCN A;  1Q2C A;  3RBU A;  2HQY A;  2B5G A;  1N71 A;  4P4B A;  1CG2 A;  2VQY A;  2X7B A;  1M44 A;  2PQ8 A;  4K3N A;  4Q38 A;  1TF8 A;  4MMO A;  1Z4E A;  4CAW A;  2Z3L A;  1M6V B;  4P4I A;  2X0S A;  2EZB A;  4J0N A;  2O4H A;  3CXP A;  2UV8 G;  1HDU A;  1PUA A;  1P0H A;  1CM0 A;  3FIX A;  2AFS A;  4KVO E;  2IMO A;  5AG7 A;  5I0C A;  5JYB A;  1UFH A;  1XJO A;  4HKF A;  4MFQ A;  3VGO A;  4AG7 A;  3SI0 A;  4C8A A;  3TFY A;  4COG A;  3PP9 A;  4X8I A;  3S9M A;  3TC8 A;  4C2X A;  1Y9Z A;  2JBJ A;  2VXK A;  4IAV A;  5LRJ A;  1GHE A;  2D4O A;  4FD7 A;  3TTH A;  2PJB A;  3EZE A;  3NH5 A;  1IB1 E;  3D7F A;  3CPX A;  5HVG A;  3W6X A;  1LFW A;  2YND A;  4C8C A;  2PJ7 A;  1IIC A;  4OIW A;  3I6S A;  2HUZ A;  5AG5 A;  4L89 A;  2FCK A;  2Q43 A;  3BXM A;  2PJ8 A;  3S6F A;  4PXE A;  1FNO A;  3WAB A;  4C86 A;  1S7N A;  4R57 A;  5AGE A;  1X12 A;  1GYT A;  2DPS A;  4OP4 A;  2B3U A;  3BI0 A;  4FWU A;  4PSW A;  4A38 A;  3PLF B;  2CF4 A;  2JDD A;  4KOU A;  3SI2 A;  6CPA A;  5F9M A;  1LCP A;  1FBV A;  3PB9 X;  1YK3 A;  2P6E A;  4M3S A;  3TOA A;  5H86 A;  3EC4 A;  1M4I A;  1A2Z A;  2F8H A;  5K8O A;  4AB7 A;  3TLB A;  4LUA A;  2V8V A;  4KOW A;  3VAR A;  1YLE A;  4MHN A;  4KOX A;  4C68 A;  1OBR A;  4IIX A;  3TLC A;  2I79 A;  1TXR A;  1YX0 A;  1MJ9 A;  2Z0Z A;  3KZW A;  3F5B A;  3P2F A;  4R7M A;  3TLA A;  4QBJ A;  2IL4 A;  3R1K A;  2BEI A;  2ODF A;  4MBU A;  3TLG A;  3PFE A;  4YFJ A;  1XEB A;  4IF5 A;  5F49 A;  3S9N A;  1QSM A;  4ZY2 A;  2PVW A;  1Y0Y A;  4B5P A;  3TT2 A;  3EO4 A;  3N5F A;  4C99 A;  4WJB A;  2P0W A;  2G3A A;  2YJT A;  5A28 A;  3JRU A;  3HMJ G;  3V7Z A;  5G21 A;  4C8U A;  2Q44 A;  2O53 A;  3PT1 A;  2C5Q A;  1HDQ A;  4EFD A;  7CPA A;  1ZYM A;  3B3V A;  1F2P A;  4AVA A;  3SJG A;  2PJA A;  4X5K A;  5HKW A;  1Z8X A;  1F57 A;  3E0K A;  2HWG A;  2PR1 A;  1Y0R A;  2BO9 A;  4A30 A;  2ZXV A;  2PDO A;  4P4J A;  2XPN A;  1ON0 A;  4IIY A;  3MRU A;  4UF4 A;  3PZJ A;  5CNP A;  2XPL A;  3BUN B;  3BJ7 A;  3PB8 X;  3BLN A;  3V38 A;  2IJZ A;  3BUO B;  4CAF A;  4C8P A;  3BUX B;  5J8F A;  1R57 A;  4OLL A;  2IQ6 A;  2AFZ A;  2OH1 A;  1BAV A;  1PCA A;  3FYN A;  4IK2 A;  2QEC A;  3VH9 A;  5EBV A;  1YVH A;  4NGM A;  3FED A;  2Q7S A;  3CXQ A;  3KI9 A;  4JVO A;  4COB A;  4CGP A;  3KL9 A;  4KLV A;  3EFA A;  4HNY B;  4OAE A;  3I9S A;  2OB0 A;  3WT4 A;  2OZH A;  2DXQ A;  1Q2Y A;  2YNC C;  2B4D A;  4UFX A;  4E8O A;  3TLZ A;  2Z10 A;  2G9D A;  2ZOG A;  4R3K A;  1M4L A;  2XPO A;  1QSR A;  2V77 A;  3L2N A;  5KTC A;  1YLO A;  3RNZ A;  3ZZI A;  4KOV A;  3B35 A;  2OLS A;  4NGQ A;  2EBJ A;  1AUG A;  4UFW A;  1CP7 A;  1Y9W A;  3TE4 A;  1Y7E A;  1DE4 C;  4CGN A;  1PYT B;  1ZLI A;  3P2H A;  3IC1 A;  2GE3 A;  2P6G A;  3K2K A;  3SXO A;  2B3V A;  1B87 A;  4UCP A;  3B7I A;  3V8I A;  5F46 A;  1Z8W A;  5K8N A;  4JWP A;  3D2P A;  4B12 A;  5JQ4 A;  5J3X A;  4A94 A;  1LAM A;  2HC9 A;  2JEW A;  4A32 A;  4MRI A;  3NOJ A;  3KQZ A;  4JXQ A;  3D8P A;  4M85 A;  4CO9 A;  4BPW B;  3QAY A;  4CYN A;  1S7L A;  1YVO A;  2ZED A;  2FVG A;  2PRQ A;  3FXT A;  4NSQ A;  4UWJ A;  4EYS A;  3D7H A;  4FAI A;  4KNG E;  4Q7A A;  1IOI A;  4FBE A;  3VRO A;  1B6B A;  1KZF A;  3U88 C;  4MXU A;  2REF A;  2Q0Y A;  4XPK A;  5DWN A;  4MCR A;  3NH8 A;  4PXC A;  1XMT A;  1WK4 A;  2B5G B;  4PPZ A;  4NCZ A;  8CPA A;  3BUM B;  3GB0 A;  2H5M A;  2J8R A;  4MY0 A;  4A33 A;  1S5K A;  5DWM A;  1Z5R A;  2Z11 A;  3H5Z A;  3FMC A;  3TCV A;  2Z3M A;  4P4F A;  4MHZ A;  3VRP A;  2PCU A;  5DS0 A;  4HPS A;  2I00 A;  4A39 A;  3WC5 A;  3D68 A;  2V8G A;  4KUB A;  4NGR A;  1Z4R A;  2PJC A;  4KS9 A;  3BHX A;  4R87 A;  5BY0 A;  3TX8 A;  1QQ9 A;  1IID A;  2NMT A;  2RC4 A;  1TKJ A;  4F9V A;  1DTD A;  2WPX A;  4OID A;  4BPU B;  3TO6 A;  3SJX A;  2EO8 A;  4KUA A;  4MFJ A;  4PQA A;  1L0C A;  3PB7 X;  3R9G A;  4JYW A;  4ONW A;  2VL1 A;  4CS0 B;  5ELY A;  2PJ9 A;  3SI1 A;  4C9E A;  4F6A A;  4C9A A;  1AMP A;  1ELL P;  3CZX A;  3IFE A;  4P4D A;  5HH1 A;  2KCW A;  4H1H A;  1ARM A;  3OAK A;  4JJX A;  4BD9 A;  4C85 A;  3B3W A;  5HKZ A;  1LRZ A;  1R3N A;  4FD5 A;  3KKW A;  5GCN A;  4U9Z A;  4OC4 A;  3TOB A;  5HMN A;  4ZGY B;  5JPH A;  5F5X A;  2AJ6 A;  4KSF A;  2Q4Z A;  2Q4Y A;  2ZW4 A;  3FVL A;  2PR8 A;  1V6C A;  3I74 A;  1ZG8 A;  1Y9K A;  3FJU A;  1MK4 A;  1NE9 A;  4A37 A;  5K8M A;  4C8F A;  4NGT A;  3IIB A;  2FE7 A;  2D0P A;  2F7V A;  3A9L A;  2JEV A;  3RAM A;  4CGO A;  4II9 A;  4MY3 A;  1ZL0 A;  3FB3 A;  2XPP A;  2C6P A;  4GXH A;  3W91 A;  4YU9 A;  3ZJ0 A;  4YN3 A;  2QML A;  1YVK A;  1OZP A;  2FT0 A;  3TYX A;  3PRT A;  1CP6 A;  2WUU A;  1VHO A;  2Q51 A;  2XEI A;  3LD2 A;  3LAC A;  3R9E A;  1Q5X A;  4MJX A;  3TLE A;  4E2A A;  3MN8 A;  1MJA A;  1AYE A;  3PEI A;  3NH4 A;  2AFM A;  3QAH A;  1XE4 A;  1TKF A;  2AFW A;  5LYD A;  4KOT A;  1IYK A;  1LOK A;  2PJ3 A;  4KOS A;  5EC4 A;  4B10 A;  4ZY0 A;  3EZB A;  2AFX A;  2JBK A;  4B6Z A;  1S3Z A;  3DLJ A;  1YW6 A;  1HEE A;  1YSJ A;  1CBX A;  3H8F A;  1I1D A;  4QC6 A;  1QMU A;  5HVF A;  4B14 A;  4ZY1 A;  5CBM A;  4E94 A;  2CTB A;  4BIN A;  4C8T A;  1XOV A;  4A2Z A;  2ARH A;  4OME A;  2AUM A;  3GKR A;  2YGW A;  1Y7R A;  3LMS A;  2ZEO A;  2XEF A;  4KSA A;  4ZX9 A;  3R96 A;  5AXI A;  5HXD A;  2MP0 A;  2ZW5 A;  2B0A A;  2AFU A;  2ZW7 A;  4U5Y A;  4TJX A;  4PXB A;  5F13 A;  2FXF A;  4Y49 B;  2BOA A;  2Y0M A;  2OR4 A;  1Z2L A;  2FS5 A;  2FIA A;  2Z3K A;  1YR0 A;  2D4P A;  2ZEH A;  2J8M A;  2ZEF A;  3CDX A;  3F0A A;  3B8G A;  3C26 A;  3IO1 A;  3F9K C;  5D8N A;  1Z9E A;  1U6M A;  3SHP A;  4EME A;  4M8D A;  4C84 A;  2Q04 A;  3DSB A;  4PK3 A;  4NGS A;  3NE7 A;  1ZLH A;  1JQG A;  1VIX A;  2RFH A;  1FT7 A;  3OWC A;  4KOR A;  4NF1 A;  3IU1 A;  4TJV A;  3KRV A;  1FY7 A;  3S6H A;  4CDK A;  3D67 A;  3F8K A;  2OU2 A;  1BLL E;  4C7I A;  2ZEL A;  1ELM P;  4UEF A;  2B4B A;  1XBU A;  1ZG7 A;  2GRE A;  1S7F A;  4MFK A;  1VHE A;  3VWE A;  3JVN A;  1EO0 A;  4BTF A;  2JDC A;  3IEH A; 
#chains in the Genus database with same CATH homology
 1Q7L A;  4DJL A;  4ZYQ A;  4WWV A;  4MHP A;  2V8D A;  2ABZ A;  5K8P A;  2GLF A;  3LWU A;  2C6C A;  4X3R A;  4MCQ A;  3KHX A;  4FUU A;  3WC6 A;  4P45 A;  2BCO A;  4IHM A;  4C9V A;  1RTQ A;  1TF9 A;  4P4E A;  4DUK A;  3D7G A;  2POK A;  4ZI6 A;  2ZEE A;  1XMB A;  4UIA A;  4RUH A;  3PB6 X;  3FH4 A;  5JM6 A;  2EK8 A;  4TWE A;  4OC5 A;  4C9R A;  2CTC A;  4UEZ A;  5CPA A;  2DEA A;  3CT9 A;  2PVV A;  3PBB A;  1IY7 A;  2ZEM A;  3D4U A;  5IR2 A;  2NSM A;  4F9U A;  3B3S A;  3HUV A;  4GM5 A;  2GU2 A;  4MCP A;  2CIJ A;  4OC3 A;  4JZ0 A;  3WC7 A;  1CPX A;  3DGV A;  1EE3 P;  3D66 A;  2I3C A;  5LYL A;  4MCS A;  5HVH A;  3H8E A;  3ICU A;  2PJ6 A;  1WVM A;  5J1Q A;  4R76 A;  1YME A;  5JH9 A;  2PE3 A;  4AXV A;  2PJ5 A;  3PBE A;  2PJ4 A;  2QYV A;  2C6G A;  5LYI A;  2PJ1 A;  4NGN A;  4H2K A;  3VTA A;  3GUX A;  2AFO A;  4UIB A;  1ARL A;  2XEG A;  2J9A A;  2PIY A;  3D7D A;  4ZX8 A;  3IWW A;  2V8H A;  4OC2 A;  1CPS A;  1VGY A;  3ISZ A;  1Z8L A;  3KHZ A;  2ZOF A;  1F2O A;  3EIF A;  2QVP A;  1YW4 A;  4UEE A;  5THW A;  2EK9 A;  4R6T A;  4Z65 A;  3KQX A;  3B3T A;  3CPA A;  3IJ3 A;  4PXD A;  4G1P A;  2HB6 A;  1KWM A;  3B3C A;  2WYR A;  4P6Y A;  5D29 A;  5LYF A;  4CDJ A;  2XEJ A;  3FX6 A;  2RB7 A;  1UWY A;  1LAN A;  3S9L A;  4R8F A;  3B2Y A;  2PJ2 A;  1XF1 A;  5JGF A;  2ANP A;  3KR5 A;  1TKH A;  3FEC A;  3KR4 A;  1IGB A;  2ZEN A;  2ZEG A;  3NA6 A;  4CPA A;  1R43 A;  5LRG A;  1LAP A;  2NYQ A;  5F09 A;  4DYO A;  3GLJ A;  1XRY A;  3PB4 X;  4O23 A;  2ZEP A;  2PIZ A;  4NGP A;  3SJE A;  4NFR A;  4LQG A;  1H8L A;  5I4M A;  5IB9 A;  2OOT A;  5LRK A;  4NJR A;  4MHY A;  3KAS A;  4OC1 A;  4OKO A;  2GLJ A;  3FEE A;  1CX8 A;  3VAT A;  4C9U A;  3ISX A;  3T8W A;  2WZN A;  3FF3 A;  3QNV A;  4TNU A;  4YWY A;  1BPN A;  3HLP A;  2PJ0 A;  3I1U A;  4X2T A;  4W9Y A;  2EWB A;  1NSA A;  2C1C A;  1XFO A;  4OC0 A;  4F8Z A;  3PFO A;  3BI1 A;  4P44 A;  3K9T A;  3H8G A;  3NFZ A;  4EWT A;  2QJ8 A;  4KSI A;  1BPM A;  3KGQ A;  1ZG9 A;  2GP4 A;  3SJF A;  3RZA A;  4NJQ A;  4P10 A;  3RBU A;  4P4B A;  4K3N A;  1CG2 A;  1TF8 A;  4MMO A;  4P4I A;  2O4H A;  1HDU A;  2AFS A;  2IMO A;  1XJO A;  4C8A A;  3SI0 A;  4X8I A;  3S9M A;  3TC8 A;  1Y9Z A;  2JBJ A;  4IAV A;  5LRJ A;  2PJB A;  3NH5 A;  3CPX A;  3D7F A;  5HVG A;  1LFW A;  4C8C A;  2PJ7 A;  4OIW A;  3I6S A;  2Q43 A;  3BXM A;  2PJ8 A;  4PXE A;  1FNO A;  3WAB A;  4C86 A;  1GYT A;  4OP4 A;  3BI0 A;  4FWU A;  4A38 A;  3SI2 A;  2CF4 A;  6CPA A;  1LCP A;  3PB9 X;  2F8H A;  5K8O A;  2V8V A;  4MHN A;  1OBR A;  1TXR A;  3KZW A;  4R7M A;  3PFE A;  3S9N A;  4ZY2 A;  2PVW A;  1Y0Y A;  3N5F A;  4C99 A;  4WJB A;  3JRU A;  3V7Z A;  4C8U A;  2O53 A;  2C5Q A;  1HDQ A;  4EFD A;  3B3V A;  1F2P A;  3SJG A;  2PJA A;  1F57 A;  1Y0R A;  2BO9 A;  4P4J A;  3MRU A;  4UF4 A;  3V38 A;  3PB8 X;  2IJZ A;  4C8P A;  2IQ6 A;  2AFZ A;  1BAV A;  1PCA A;  4IK2 A;  3VH9 A;  4NGM A;  3FED A;  3KI9 A;  3KL9 A;  3WT4 A;  2G9D A;  2ZOG A;  1M4L A;  2V77 A;  3L2N A;  1YLO A;  3B35 A;  4NGQ A;  1CP7 A;  1Y7E A;  1DE4 C;  1PYT B;  1ZLI A;  3IC1 A;  3K2K A;  3B7I A;  5K8N A;  4A94 A;  1LAM A;  2HC9 A;  2JEW A;  4MRI A;  3KQZ A;  2ZED A;  2FVG A;  2PRQ A;  3D7H A;  4FAI A;  4KNG E;  4Q7A A;  4FBE A;  4MXU A;  4MCR A;  3NH8 A;  4PXC A;  8CPA A;  4PPZ A;  3GB0 A;  1Z5R A;  3FMC A;  4P4F A;  4MHZ A;  2PCU A;  5DS0 A;  4A39 A;  3WC5 A;  3D68 A;  2V8G A;  4NGR A;  2PJC A;  3BHX A;  3TX8 A;  1QQ9 A;  1TKJ A;  4F9V A;  1DTD A;  4OID A;  3SJX A;  4PQA A;  3PB7 X;  4JYW A;  4ONW A;  2VL1 A;  5ELY A;  2PJ9 A;  3SI1 A;  4C9E A;  4C9A A;  1AMP A;  1ELL P;  3IFE A;  4P4D A;  1ARM A;  4BD9 A;  4C85 A;  3B3W A;  1R3N A;  4OC4 A;  2Q4Z A;  1V6C A;  3FVL A;  3I74 A;  1ZG8 A;  3FJU A;  4C8F A;  5K8M A;  4A37 A;  4NGT A;  3IIB A;  2F7V A;  3RAM A;  2C6P A;  4YU9 A;  4YN3 A;  3PRT A;  1CP6 A;  1VHO A;  2Q51 A;  2XEI A;  3MN8 A;  1AYE A;  3PEI A;  3NH4 A;  2AFM A;  5LYD A;  1TKF A;  2AFW A;  1LOK A;  2PJ3 A;  4ZY0 A;  2AFX A;  2JBK A;  4B6Z A;  3DLJ A;  1YW6 A;  1HEE A;  1YSJ A;  1CBX A;  3H8F A;  4ZY1 A;  1QMU A;  5HVF A;  5CBM A;  2CTB A;  4C8T A;  4OME A;  3LMS A;  2ZEO A;  2XEF A;  4ZX9 A;  5HXD A;  2AFU A;  4TJX A;  4PXB A;  2BOA A;  2ZEH A;  2OR4 A;  1Z2L A;  3VAR A;  2ZEF A;  3CDX A;  3IO1 A;  4EME A;  7CPA A;  5D8N A;  4C84 A;  4NGS A;  1ZLH A;  1JQG A;  1VIX A;  2RFH A;  1FT7 A;  4TJV A;  4CDK A;  3D67 A;  1BLL E;  2ZEL A;  1ELM P;  4UEF A;  1XBU A;  1ZG7 A;  2GRE A;  1VHE A;  3IEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...