3D7HA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcibzl, a urea-based inhibitor
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 269
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7hA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7hA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7hA02
1ZG8A 2PJBA 2JBJA 2IQ6A 3T8WA 2NYQA 3VARA 4MRIA 3PB8X 5CPAA 4PQAA 3KQXA 5I4MA 1VHEA 4FWUA 1YMEA 4OKOA 1V6CA 3I1UA 1LFWA 4FBEA 3CPXA 4IK2A 1YLOA 1ZG9A 1Z8LA 1DE4C 4UEZA 2XEIA 3SJFA 1PCAA 3PFEA 3CT9A 3FJUA 2RFHA 1CPXA 3FH4A 2IJZA 3VTAA 2ANPA 3D7HA 4FAIA 3BXMA 2ZEEA 1H8LA 2JBKA 8CPAA 1CX8A 3BI0A 1DTDA 3LWUA 4MXUA 1TKFA 4DJLA 1TF8A 1Y9ZA 4OC5A 1Y0RA 5K8OA 4NGRA 3RAMA 2ZEFA 2G9DA 4JZ0A 4OC3A 4MCRA 3LMSA 4C8TA 3PRTA 3GB0A 7CPAA 2CF4A 1Y7EA 4OC4A 4TWEA 4EMEA 3KGQA 3D7FA 5LRKA 1TXRA 5LRGA 4NGSA 1XMBA 2WYRA 2PJ2A 2DEAA 4X8IA 3NA6A 4F9UA 3WC6A 2C1CA 4C8CA 3KR4A 4C9VA 1YW6A 4UF4A 1QQ9A 3BHXA 3D67A 3IC1A 4TJVA 1Z2LA 4YWYA 1EE3P 3FEEA 2EWBA 4F9VA 3VH9A 1CP7A 2WZNA 4F8ZA 4OC0A 1IY7A 3ICUA 2I3CA 4X3RA 2PVVA 3ISXA 3PB4X 1BLLE 3MN8A 2O53A 4ZY0A 2PE3A 5IB9A 4MHPA 4C8AA 3H8GA 3L2NA 3CDXA 2HB6A 1XF1A 2ABZA 3K9TA 1Z5RA 4P4IA 4R8FA 4IAVA 3KHZA 3RZAA 5K8MA 1XFOA 4GM5A 4A37A 5J1QA 2ZOFA 1BPNA 2RB7A 1ARMA 1BAVA 1JQGA 4R7MA 3S9MA 4MCSA 1IGBA 3PB6X 4LQGA 3IWWA 1HDUA 4P45A 2AFWA 2AFXA 1BPMA 2PJ9A 2BO9A 5DS0A 5THWA 4RUHA 5LRJA 3D7DA 5LYLA 1HDQA 3IIBA 4AXVA 2ZENA 3B3VA 3DGVA 2VL1A 1R3NA 3IEHA 4OIDA 3SI0A 3KQZA 3I74A 4PPZA 2AFZA 4A94A 3B3WA 4OP4A 3KASA 1R43A 1PYTB 2POKA 4Q7AA 4ZX8A 3FF3A 2PJCA 3QNVA 2PJ1A 4CDKA 2CTBA 4JYWA 2XEJA 2IMOA 1LANA 1ELMP 5HVFA 3D66A 4UEFA 4C9RA 1RTQA 5LYIA 4UIBA 3SJXA 4MMOA 1VIXA 2O4HA 4ONWA 3IO1A 2ZEHA 4OC1A 1M4LA 3B3TA 4H2KA 5HVHA 3B3CA 3WC5A 5LYDA 4P4EA 3DLJA 4P4FA 1OBRA 4OMEA 4ZY2A 1TF9A 3KHXA 4C8UA 4NJRA 1LCPA 3S9LA 2ZOGA 2ZELA 3NH8A 5K8PA 2Q43A 4UEEA 5JM6A 1QMUA 2AFMA 4KSIA 4KNGE 2OR4A 2XEFA 2PJ6A 1FNOA 2ZEMA 3PB7X 1Q7LA 4C8PA 4CPAA 4C99A 5D29A 5JGFA 1CBXA 2V8GA 5K8NA 2HC9A 3KL9A 4C84A 4WJBA 1NSAA 5ELYA 2PJ3A 1TKHA 4FUUA 4WWVA 3FMCA 2C6PA 4P4DA 4P4BA 4OIWA 4P44A 4MHNA 5HXDA 2ZEPA 4MCQA 3TX8A 2GLFA 4MHYA 3VATA 4ZY1A 3HUVA 1UWYA 4PXBA 3FEDA 2V8VA 3NH4A 4C8FA 4C86A 1ZLHA 4NGMA 4P10A 3SI2A 4Z65A 4W9YA 1AMPA 3HLPA 4PXDA 6CPAA 4A39A 1ZG7A 4C85A 1TKJA 2C6GA 3D68A 2V77A 1Y0YA 3I6SA 4ZX9A 3WC7A 1ARLA 4TJXA 5D8NA 4C9AA 2ZEOA 2AFUA 2PJAA 2PJ5A 2PRQA 3GLJA 1CP6A 3PB9X 3V7ZA 4P6YA 4G1PA 2EK9A 2J9AA 4DUKA 1HEEA 3N5FA 2JEWA 4ZYQA 3PBBA 1VGYA 1XBUA 3FECA 1LAMA 2QVPA 3B7IA 2PJ4A 2F8HA 3S9NA 2XEGA 2C6CA 1LOKA 3KI9A 4P4JA 1AYEA 3IJ3A 3H8FA 3NFZA 1CG2A 4NGNA 3RBUA 4R6TA 5JH9A 3K2KA 2AFSA 4YU9A 3EIFA 2PJ0A 3NH5A 2V8DA 2ZEGA 3PBEA 3FVLA 2PIZA 4NJQA 3SI1A 4NGPA 4ZI6A 1CPSA 2OOTA 2F7VA 2GREA 3PFOA 2QJ8A 3KR5A 4O23A 3D7GA 3B35A 4MHZA 4IHMA 3JRUA 2PCUA 2CTCA 1XJOA 5F09A 2PJ8A 1ELLP 2QYVA 4C9UA 2V8HA 4DYOA 3SJGA 3ISZA 1LAPA 1ZLIA 4EWTA 4NGTA 3IFEA 4B6ZA 4YN3A 1WVMA 2AFOA 2PJ7A 2GLJA 4C9EA 2BOAA 3FX6A 3TC8A 4BD9A 3GUXA 5CBMA 1XRYA 1YSJA 4UIAA 3B3SA 2NSMA 3WT4A 1F2PA 3PEIA 2FVGA 2BCOA 4X2TA 3WABA 4PXCA 3MRUA 2EK8A 3B2YA 3D4UA 2PVWA 1YW4A 1KWMA 4OC2A 1VHOA 4MCPA 4K3NA 3SJEA 2CIJA 1F57A 2Q4ZA 4PXEA 1GYTA 2Q51A 4EFDA 2PIYA 2GU2A 3CPAA 4NFRA 4TNUA 3H8EA 1FT7A 5HVGA 4R76A 5LYFA 4NGQA 1F2OA 3BI1A 2ZEDA 3V38A 4A38A 3KZWA 4CDJA
chains in the Genus database with same CATH superfamily
1ZG8A 2EVNA 5J3XA 1XE4A 5HKWA 2FS5A 2PJBA 4UFXA 4C68A 4A2ZA 2JBJA 1NE9A 3ICUA 2IQ6A 4EYSA 2GE3A 3T8WA 4PK2A 4UCNA 3QAHA 2NYQA 4NCZA 3VARA 4KOTA 1EZAA 3K9UA 4MRIA 3PB8X 5CPAA 4PQAA 3KQXA 4YGOA 3RO0A 4ONUA 5A28A 1VHEA 5I4MA 4I49A 4FWUA 4INJA 1A9XB 2DIKA 3PLFB 1YMEA 4OKOA 1V6CA 4MFLA 3I1UA 1S5KA 4MI4A 2Z11A 4U9YA 3W6SA 1LFWA 4HNWB 3S6GA 4FBEA 1FY7A 3CPXA 1YLOA 4IK2A 3MGDA 1MK4A 1ZG9A 2B0AA 4L89A 1Z8LA 2BEIA 2Y0MA 1DE4C 1S7LA 1WWZA 2XEIA 3SJFA 1PCAA 3PFEA 4UEZA 5EMIA 3CT9A 3FJUA 2RFHA 4YFJA 1CPXA 2PR1A 3FH4A 2IJZA 3VTAA 4Y49B 4HNYB 4OLLA 1Y7RA 2ANPA 2P6GA 3D7HA 2PDOA 4FAIA 3BXMA 4MFJA 1M1DA 2ZEEA 4UA3A 1H8LA 3TLZA 2FT0A 2A4NA 3DNSA 2WUUA 4B5OA 2JBKA 8CPAA 1CX8A 3BI0A 1Z8TA 2BUEA 4KLVA 4KLWA 1DTDA 2P6EA 3LWUA 4MXUA 4R57A 1TKFA 1XEBA 3TLCA 4DJLA 1YQEA 1TF8A 4KOWA 1Y9KA 1VKCA 4CAEA 1Y9ZA 1ZL0A 5F1YA 2EO8A 4OC5A 2EBJA 1Y0RA 5K8OA 2MP0A 2HROA 2X0SA 3TLBA 1KBLA 2ATRA 4NGRA 4CGPA 3RAMA 2ZEFA 5AGEA 3OB1B 4KORA 3D2MA 2G9DA 4J3GA 4JZ0A 4OC3A 2GP4A 4MCRA 4OAEA 1KUXA 3JUWA 1S7FA 2YNEA 2ZPAA 3LMSA 1KUVA 4NF1A 3PRTA 3GB0A 4NSQA 7CPAA 1XOVA 5IB0A 2CF4A 4UBRA 1Y7EA 4OC4A 1LRZA 3DDDA 3EXNA 3VRRA 4TWEA 4LQ6A 4EMEA 3KGQA 3D7FA 2O28A 1B6BA 1TXRA 5EC4A 3S6FA 3VGOA 5LRKA 2GFQA 4X5KA 3OP0A 3BJ8A 3C26A 3C8OA 2N3AB 5LRGA 1KUYA 4EVYA 2I00A 4NGSA 5C88A 1XMBA 2WYRA 1IU8A 2DEAA 2PJ2A 4X8IA 2OZGA 1VI4A 3NA6A 4F9UA 3LD2A 3WC6A 2C1CA 1IYKA 2CY2A 2OZUA 4C8CA 3KR4A 2Z3PA 4C9VA 4CGOA 1YW6A 4UF4A 1QQ9A 3BHXA 3HPHE 4KUAA 3IWEA 3D67A 2F5IA 3IC1A 1QSMA 2FIWA 4JWPA 1Z2LA 4UWIA 3KRVA 3T90A 4KOXA 4YWYA 1EE3P 4B5PB 1QSNA 3FEEA 2EWBA 5HKYA 2Q0YA 2VBQA 4H89A 4F9VA 2WSAA 3VH9A 2Z3LA 1CP7A 3QB8A 2R1IA 2WZNA 4F8ZA 2HWGA 4OC0A 1BO4A 3D8PA 1IY7A 2AUMA 1MJ9A 2I3CA 5AG7A 4X3RA 4B12A 1X12A 1M4DA 1CE8B 2PVVA 3ISXA 3PB4X 4TJVA 2OU2A 1BLLE 4CAVA 3MN8A 3SXNA 2O53A 4ZY0A 4UWJA 2PE3A 2R98A 3BUMB 5IB9A 4MHPA 5IV0A 4C8AA 3H8GA 1Z9UA 3TT2A 3L2NA 5J8CA 2R82A 3TO6A 1S60A 2ODFA 5A27A 3CDXA 4JJXA 2HB6A 1QSOA 1XF1A 2ABZA 3K9TA 4CGLA 4FD6A 4BINA 1Z5RA 2Q4VA 2ZW6A 2YJTA 5JVLA 4P4IA 2B3VA 4R8FA 4IIYA 2HV2A 4IAVA 3KHZA 4U9ZA 3RZAA 5K8MA 3TLGB 1XFOA 3GIUA 4GM5A 2QECA 4A37A 1ZYMA 5J1QA 3IGRA 3TLAA 4KVXA 2P6FA 1J4JA 4BBHA 2ZOFA 1BPNA 3NE7A 2RB7A 4MFPA 4UCPA 3F0AA 2FE7A 5CNPA 1GGOA 1YGHA 1ARMA 1T36B 1BAVA 1JQGA 4R7MA 3S9MA 4MCSA 1IGBA 1YVHA 3PB6X 3PGPA 4A4BA 3EC4A 2OH1A 3VRQA 1CJWA 5GCNA 4C2ZA 4JD6A 4II9A 4C8TA 2FSRA 4LQGA 3IWWA 1HDUA 4P45A 1ZO0A 2AFWA 1BPMA 2AFXA 2B4DA 2BO9A 3ZNIA 3R96A 5ISVA 4AB7A 5DS0A 1IOFA 3IWGA 4B14A 5KTAA 1KEEB 5THWA 4RUHA 1Z9EA 2CNSA 5LRJA 3D7DA 1YK3A 3TFYA 5LYLA 1HDQA 2ARHA 3EZEA 3IIBA 4AXVA 2ZENA 3B3VA 2P0WA 3DGVA 4FD4A 3T5MA 1S7NA 2VL1A 5JPHA 1R3NA 3IEHA 4OIDA 2B4JC 3EY5A 3SI0A 3KQZA 3TOBA 5HMNA 3TLYA 2EZAA 3P2FA 3EZBA 4CRZB 2R7HA 4ZBGA 3I74A 4PPZA 2UV8G 2AFZA 3GKRA 4XPDC 3B3WA 3NE8A 3H5ZA 2RC4A 3DR6A 4OP4A 3F9KC 3VRPA 4A94A 5F13A 3KASA 1R43A 1PYTB 2AE6A 2POKA 4Q7AA 1SQHA 1YVKA 4ZX8A 1PU9A 3FF3A 2PJCA 3U88C 3QNVA 5F9MA 2PJ1A 3OAKA 4RI1A 3VWEA 4CDKA 2YNDA 2ZXVA 2VEZA 2CTBA 4JYWA 2XEJA 2OZHA 5IX3A 4MJ8A 4BMHA 1B87A 1Z8WA 2IMOA 2FCKA 4A95A 1LANA 4KSAA 1ELMP 4E0AA 2NMTA 4R9MA 5HVFA 3D66A 2CNTA 4UEFA 4C9RA 1RTQA 4IUSA 5AG4A 5AG6A 3S6HA 3CXQA 2XPOA 5F48A 3T05A 2H5MA 4UIBA 5LYIA 3R9GA 2YNCA 4KUBA 3SJXA 5J8FA 4MMOA 4BPWB 1VIXA 2O4HA 4ONWA 3IO1A 2ZEHA 1IYLA 4HNXB 5AG5A 1GHEA 3KKWA 3PZJA 4MY0A 4OC1A 1M4LA 4UFWA 1KZFA 1XIXA 3B3TA 1JWQA 1OZPA 2AUNA 3PFVA 4H2KA 3E0KA 5HVHA 3H4QA 4ZGYB 4KZTA 3B3CA 1B47A 4JVOA 3N7ZA 2PC1A 4RS2A 2OLSA 2HQYA 1WJTA 3WC5A 4MI1A 5LYDA 4M85A 2B58A 4C7IA 4P4EA 3GJZA 2BL1A 2PRBA 1A2ZA 3DLJA 1YREA 2C5QA 3V8IA 4P4FA 1OBRA 4OMEA 4ZY2A 4AG9A 1TF9A 2I79A 3KHXA 4C8UA 4MFKA 4NJRA 1LCPA 3S9LA 1WK4A 2B5GB 2ZELA 2ZOGA 3NFQA 2DPSA 1CM0A 3VRNA 2OB0A 2ZW4A 3NH8A 3ZJ0A 2Q43A 4UEEA 4KVME 4A30A 4F6AA 5JM6A 5K8PA 4M8DA 3UY5A 4M6HA 1QMUA 2AFMA 1QSTA 4R3LA 4KSIA 4PSXA 4FD5A 2J8MA 2R8VA 4B5PA 2Z0ZA 4H6ZA 4KNGE 2OR4A 1AUGA 4KSFA 4CYNA 2WPXA 4UCMA 3LODA 2XEFA 2PJ6A 1FNOA 2ZEMA 3CXSA 3PB7X 4XNHB 1Q7LA 5DWNA 3R9FA 4A4CA 1C30B 1JDBC 2HUZA 2Q44A 4CPAA 4E2AA 4C99A 1QSRA 5D29A 5JGFA 1DIKA 1CBXA 2V8GA 5G21A 4KVOE 5K8NA 2HC9A 3KL9A 3R95A 3FIXA 4QBJA 4WJBA 1M6VB 3T0TA 4C84A 3F5BA 2DLAA 1NSAA 5ELYA 2PJ3A 2Z3KA 2GANA 1TKHA 2VQYA 2QMLA 4QB9A 4FUUA 1JDEA 4C2XA 4B11A 4WWVA 3FMCA 5HKZA 4MFZA 2C6PA 4P4DA 4P4BA 3BJ7A 4YRHA 4OIWA 4P44A 4MHNA 5G20A 1VBHA 1ON0A 3D3SA 2FL4A 5HXDA 2ZEPA 4MCQA 3TX8A 2PQ8A 2GLFA 4MHYA 4QUSA 3VATA 4ZY1A 2VXKA 3CXPA 3TLGA 4E94A 4M6GA 4AVBA 2REEA 3TYXA 3HUVA 4K30A 1UWYA 2D4OA 4PXBA 3FEDA 3RNZA 4A33A 4IIXA 3RYOA 1BXRB 2V8VA 3G3SA 3NH4A 5F49A 4C8FA 2EZBA 4RR2B 4CYQA 3SHPA 4C86A 1ZLHA 4NGMA 4P10A 3SI2A 2CXAA 2Z3OA 4HPSA 4Z65A 5F5XA 4W9YA 1AMPA 1M4IA 2Q7SA 2XPNA 5H84A 2BSWA 3HLPA 4PXDA 3G23A 3OWCA 2Y1MA 3O8ZA 6CPAA 4KOUA 4A39A 1ZG7A 3A9LA 3FRMA 1TKJA 4C85A 2C6GA 4CRYB 3D68A 5KTDA 2V77A 1Y0YA 4KOSA 4U5YA 4ZX9A 3I6SA 4Y49C 4AG7A 3WC7A 1ARLA 4TJXA 5JYBA 5D8NA 4C9AA 5FVJA 3U1BA 1PUAA 2PJ9A 1S3ZA 2Z3NA 2Y1NA 2ZEOA 4NXYA 2AFUA 2PJAA 2B3UA 2PJ5A 2PRQA 3GLJA 1CP6A 2JDDA 3DSBA 3PB9X 3F8KA 2EUIA 3V7ZA 4P6YA 4G1PA 5F47A 2EK9A 2G3TA 1J3LA 2J9AA 4DUKA 2REFA 4MJXA 3FXTA 4COBA 1FBVA 1HEEA 1MJBA 3SXOA 3N5FA 2FXFA 2JEWA 4ZYQA 2YNCC 3PBBA 1VGYA 1XBUA 2B4DB 2X7BA 3FECA 1LAMA 2QVPA 3FBUA 3B7IA 3S6KA 2PJ4A 2J8NA 2F8HA 2VZZA 4B13A 4HKFA 5FD8A 3S9NA 2XEGA 4AVCA 4BPXB 2Z3MA 2C27A 1BOBA 2C6CA 4MY3A 3SR3A 2B4BA 4JXRA 1Q2CA 1LOKA 2G0BA 3KI9A 4AVAA 3DR8A 4P4JA 2DXQA 5C82A 1AYEA 1NBWA 3EO4A 3R1KA 3IJ3A 4BTFA 2Z10A 3H8FA 3BUNB 4F0XA 5KTCA 2Q7BA 1S7KA 4F0YA 4J0NA 3NFZA 4IF5A 3P2HA 3D2PA 1CG2A 4JXQA 3B8GA 2CNMA 4UFVA 5H86A 3W91A 1U6MA 2PSWA 3GYAA 4CS0B 3TO9A 2IL4A 3TCVA 4NGNA 2Q04A 4KOYA 3RBUA 4R6TA 3FNCA 4XPKA 2XPPA 1M4GA 4OADA 4CAWA 5JH9A 3K2KA 1Z8XA 4H6UA 3BUXB 2AFSA 5K99A 3BLNA 4YU9A 4NEXA 3JTKA 3EIFA 1TIQA 1VHSA 2PJ0A 2ZW7A 3NH5A 1R61A 2V8DA 2ZEGA 1R57A 5AXIA 1IOIA 3FYNA 2Q4YA 3PBEA 1YR0A 2PR8A 3FVLA 1XF8A 2FIAA 4XNHC 2K5TA 3EFAA 2PIZA 4NJQA 1ZRSA 3SI1A 4NGPA 3K4IA 3VROA 4ZI6A 1CS0B 1CPSA 3TLEA 4XPDB 2OOTA 1EO0A 4MHDA 4CAXA 2F7VA 2GREA 2B5GA 4RN7A 4B10A 4M3SA 3PFOA 2QJ8A 3KR5A 4O23A 3D7GA 4XPLA 4L8AA 4R87A 4Q38A 4H1HA 2QIRA 3B35A 4IHMA 2JEVA 4MHZA 4R3KA 4GS4A 1Q5XA 4GXHA 1XMTA 2VZYA 3JRUA 1I1DA 1P4NA 3BUWB 2DPTA 2VKZG 2PCUA 1VBGA 3IU1A 5JQ4A 1Q2YA 1I12A 2CTCA 2VI7A 1XJOA 5F09A 2PJ8A 2ZW5A 3JVNA 4KS9A 3WR7A 4CGNA 3OB2B 1ELLP 4MFQA 3T9YA 1YVOA 5F46A 1Q2DA 4C8PA 2PCNA 2QYVA 4C9UA 3IU2A 2V8HA 4COGA 4DYOA 3SJGA 1Y9WA 4JLYA 3ISZA 5HH1A 2J8RA 2HI6A 1YLEA 4PK3A 3W6XA 4C2YA 1LAPA 4A32A 1ZLIA 2D4PA 4NGTA 3GY9A 3TOAA 3IFEA 1NSLA 2DF5A 4B6ZA 4EWTA 4YN3A 1NMTA 4LX9A 2XPLA 1IICA 2AFOA 1WVMA 1Z4RA 2PJ7A 5EBVA 4QC6A 2GLJA 4MBUA 3CZXA 4C9EA 5I0CA 2BOAA 5DWMA 4CZ1A 3FX6A 3PP9A 3TC8A 4BD9A 3NOJA 3GUXA 5CBMA 1I21A 1V0CA 4KOVA 1XRYA 1YSJA 2EZCA 1EZBA 3BUOB 4UIAA 3B3SA 3I9SA 1UFHA 2NSMA 5BY0A 1F2PA 2KCWA 3WT4A 3T07A 3PEIA 4QVTA 2FVGA 4E5SA 1IB1E 2BCOA 2JLMA 3G8WA 4X2TA 4DNCA 3VWDA 3WABA 1L0CA 2E28A 3PT1A 4PXCA 3ZZIA 1YX0A 1IIDA 3QAYA 4PV6A 4Q36A 2YJVA 3MRUA 5G22A 4M6IA 4PSWA 2EK8A 3B2YA 4FD7A 1KC7A 3LACA 3D4UA 2PVWA 1YW4A 1NXJA 4CO9A 3HPGG 1P0HA 1KWMA 2D0PA 4CYOA 5IR2A 4OC2A 1VHOA 2GIVA 2YGWA 1RXTA 4MCPA 2G3AA 4C7HA 2D0OA 4CYPA 1RO5A 4K3NA 3SJEA 1N71A 1M44A 2CIJA 5G1ZA 1Z4EA 1F57A 2Q4ZA 3I3GA 4LUAA 4PXEA 3TE4A 1MJAA 2CBLA 1GYTA 5E96A 4E8OA 3EZAA 2Q51A 3HMJG 4EFDA 2FM4A 2PIYA 2GU2A 4BPUB 1X10A 3R9EA 3CPAA 2AJ6A 4NFRA 4TNUA 3H8EA 1FT7A 5HVGA 4R76A 4ORFA 4A31A 5LYFA 1K4JA 3TTHA 2WPWA 5BWAB 1C3OB 4NGQA 1F2OA 3BI1A 2ZEDA 3V38A 4A38A 4CAFA 3TO7A 3KZWA 4CGMA 2JDCA 4GPLB 4CDJA 3FB3A
chains in the Genus database with same CATH topology
1ZG8A 2PJBA 2JBJA 2IQ6A 3T8WA 2NYQA 3VARA 4MRIA 3PB8X 5CPAA 4PQAA 3KQXA 5I4MA 1VHEA 4FWUA 1YMEA 4OKOA 1V6CA 3I1UA 1LFWA 4FBEA 3CPXA 4IK2A 1YLOA 1ZG9A 1Z8LA 1DE4C 4UEZA 2XEIA 3SJFA 1PCAA 3PFEA 3CT9A 3FJUA 2RFHA 1CPXA 3FH4A 2IJZA 3VTAA 2ANPA 3D7HA 4FAIA 3BXMA 2ZEEA 1H8LA 2JBKA 8CPAA 1CX8A 3BI0A 1DTDA 3LWUA 4MXUA 1TKFA 4DJLA 1TF8A 1Y9ZA 4OC5A 1Y0RA 5K8OA 4NGRA 3RAMA 2ZEFA 2G9DA 4JZ0A 4OC3A 2GP4A 4MCRA 3LMSA 4C8TA 3PRTA 3GB0A 7CPAA 2CF4A 1Y7EA 4OC4A 4TWEA 4EMEA 3KGQA 3D7FA 5LRKA 1TXRA 5LRGA 4NGSA 1XMBA 2WYRA 2PJ2A 2DEAA 4X8IA 3NA6A 4F9UA 3WC6A 2C1CA 4C8CA 3KR4A 4C9VA 1YW6A 4UF4A 1QQ9A 3BHXA 3D67A 3IC1A 4TJVA 1Z2LA 4YWYA 1EE3P 3FEEA 2EWBA 4F9VA 3VH9A 1CP7A 2WZNA 4F8ZA 4OC0A 1IY7A 3ICUA 2I3CA 4X3RA 2PVVA 3ISXA 3PB4X 1BLLE 3MN8A 2O53A 4ZY0A 2PE3A 5IB9A 4MHPA 4C8AA 3H8GA 3L2NA 3CDXA 2HB6A 1XF1A 2ABZA 3K9TA 1Z5RA 4P4IA 4R8FA 4IAVA 3KHZA 3RZAA 5K8MA 1XFOA 4GM5A 4A37A 5J1QA 2ZOFA 1BPNA 2RB7A 1ARMA 1BAVA 1JQGA 4R7MA 3S9MA 4MCSA 1IGBA 3PB6X 4LQGA 3IWWA 1HDUA 4P45A 2AFWA 2AFXA 1BPMA 2PJ9A 2BO9A 2C5QA 5DS0A 5THWA 4RUHA 5LRJA 3D7DA 5LYLA 1HDQA 3IIBA 4AXVA 2ZENA 3B3VA 3DGVA 2VL1A 1R3NA 3IEHA 4OIDA 3SI0A 3KQZA 3I74A 4PPZA 2AFZA 4A94A 3B3WA 4OP4A 3KASA 1R43A 1PYTB 2POKA 4Q7AA 4ZX8A 3FF3A 2PJCA 3QNVA 2PJ1A 4CDKA 2CTBA 4JYWA 2XEJA 2IMOA 1LANA 1ELMP 5HVFA 3D66A 4UEFA 4C9RA 1RTQA 5LYIA 4UIBA 3SJXA 4MMOA 1VIXA 2O4HA 4ONWA 3IO1A 2ZEHA 4OC1A 1M4LA 3B3TA 4H2KA 5HVHA 3B3CA 3WC5A 5LYDA 4P4EA 3DLJA 4P4FA 1OBRA 4OMEA 4ZY2A 1TF9A 3KHXA 4C8UA 4NJRA 1LCPA 3S9LA 2ZOGA 2ZELA 3NH8A 5K8PA 2Q43A 4UEEA 5JM6A 1QMUA 2AFMA 4KSIA 4KNGE 2OR4A 2XEFA 2PJ6A 1FNOA 2ZEMA 3PB7X 1Q7LA 4C8PA 4CPAA 4C99A 5D29A 5JGFA 1CBXA 2V8GA 5K8NA 2HC9A 3KL9A 4C84A 4WJBA 1NSAA 5ELYA 2PJ3A 1TKHA 4FUUA 4WWVA 3FMCA 2C6PA 4P4DA 4P4BA 4OIWA 4P44A 4MHNA 5HXDA 2ZEPA 4MCQA 3TX8A 2GLFA 4MHYA 3VATA 4ZY1A 3HUVA 1UWYA 4PXBA 3FEDA 2V8VA 3NH4A 4C8FA 4C86A 1ZLHA 4NGMA 4P10A 3SI2A 4Z65A 4W9YA 1AMPA 3HLPA 4PXDA 6CPAA 4A39A 1ZG7A 4C85A 1TKJA 2C6GA 3D68A 2V77A 1Y0YA 3I6SA 4ZX9A 3WC7A 1ARLA 4TJXA 5D8NA 4C9AA 2ZEOA 2AFUA 2PJAA 2PJ5A 2PRQA 3GLJA 1CP6A 3PB9X 3V7ZA 4P6YA 4G1PA 2EK9A 2J9AA 4DUKA 1HEEA 3N5FA 2JEWA 4ZYQA 3PBBA 1VGYA 1XBUA 3FECA 1LAMA 2QVPA 3B7IA 2PJ4A 2F8HA 3S9NA 2XEGA 2C6CA 1LOKA 3KI9A 4P4JA 1AYEA 3IJ3A 3H8FA 3NFZA 1CG2A 4NGNA 3RBUA 4R6TA 5JH9A 3K2KA 2AFSA 4YU9A 3EIFA 2PJ0A 3NH5A 2V8DA 2ZEGA 3PBEA 3FVLA 2PIZA 4NJQA 3SI1A 4NGPA 4ZI6A 1CPSA 2OOTA 2F7VA 2GREA 3PFOA 2QJ8A 3KR5A 4O23A 3D7GA 3B35A 4MHZA 4IHMA 3JRUA 2PCUA 2CTCA 1XJOA 5F09A 2PJ8A 1ELLP 2QYVA 4C9UA 2V8HA 4DYOA 3SJGA 3ISZA 1LAPA 1ZLIA 4EWTA 4NGTA 3IFEA 4B6ZA 4YN3A 1WVMA 2AFOA 2PJ7A 2GLJA 4C9EA 2BOAA 3FX6A 3TC8A 4BD9A 3GUXA 5CBMA 1XRYA 1YSJA 4UIAA 3B3SA 2NSMA 3WT4A 1F2PA 3PEIA 2FVGA 2BCOA 4X2TA 3WABA 4PXCA 3MRUA 2EK8A 3B2YA 3D4UA 2PVWA 1YW4A 1KWMA 5IR2A 4OC2A 1VHOA 4MCPA 4K3NA 3SJEA 2CIJA 1F57A 2Q4ZA 4PXEA 1GYTA 2Q51A 4EFDA 2PIYA 2GU2A 3CPAA 4NFRA 4TNUA 3H8EA 1FT7A 5HVGA 4R76A 5LYFA 4NGQA 1F2OA 3BI1A 2ZEDA 3V38A 4A38A 3KZWA 4CDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZG8 A;  2PJB A;  2JBJ A;  2IQ6 A;  3T8W A;  2NYQ A;  3VAR A;  4MRI A;  3PB8 X;  5CPA A;  4PQA A;  3KQX A;  5I4M A;  1VHE A;  4FWU A;  1YME A;  4OKO A;  1V6C A;  3I1U A;  1LFW A;  4FBE A;  3CPX A;  4IK2 A;  1YLO A;  1ZG9 A;  1Z8L A;  1DE4 C;  4UEZ A;  2XEI A;  3SJF A;  1PCA A;  3PFE A;  3CT9 A;  3FJU A;  2RFH A;  1CPX A;  3FH4 A;  2IJZ A;  3VTA A;  2ANP A;  3D7H A;  4FAI A;  3BXM A;  2ZEE A;  1H8L A;  2JBK A;  8CPA A;  1CX8 A;  3BI0 A;  1DTD A;  3LWU A;  4MXU A;  1TKF A;  4DJL A;  1TF8 A;  1Y9Z A;  4OC5 A;  1Y0R A;  5K8O A;  4NGR A;  3RAM A;  2ZEF A;  2G9D A;  4JZ0 A;  4OC3 A;  4MCR A;  3LMS A;  4C8T A;  3PRT A;  3GB0 A;  7CPA A;  2CF4 A;  1Y7E A;  4OC4 A;  4TWE A;  4EME A;  3KGQ A;  3D7F A;  5LRK A;  1TXR A;  5LRG A;  4NGS A;  1XMB A;  2WYR A;  2PJ2 A;  2DEA A;  4X8I A;  3NA6 A;  4F9U A;  3WC6 A;  2C1C A;  4C8C A;  3KR4 A;  4C9V A;  1YW6 A;  4UF4 A;  1QQ9 A;  3BHX A;  3D67 A;  3IC1 A;  4TJV A;  1Z2L A;  4YWY A;  1EE3 P;  3FEE A;  2EWB A;  4F9V A;  3VH9 A;  1CP7 A;  2WZN A;  4F8Z A;  4OC0 A;  1IY7 A;  3ICU A;  2I3C A;  4X3R A;  2PVV A;  3ISX A;  3PB4 X;  1BLL E;  3MN8 A;  2O53 A;  4ZY0 A;  2PE3 A;  5IB9 A;  4MHP A;  4C8A A;  3H8G A;  3L2N A;  3CDX A;  2HB6 A;  1XF1 A;  2ABZ A;  3K9T A;  1Z5R A;  4P4I A;  4R8F A;  4IAV A;  3KHZ A;  3RZA A;  5K8M A;  1XFO A;  4GM5 A;  4A37 A;  5J1Q A;  2ZOF A;  1BPN A;  2RB7 A;  1ARM A;  1BAV A;  1JQG A;  4R7M A;  3S9M A;  4MCS A;  1IGB A;  3PB6 X;  4LQG A;  3IWW A;  1HDU A;  4P45 A;  2AFW A;  2AFX A;  1BPM A;  2PJ9 A;  2BO9 A;  5DS0 A;  5THW A;  4RUH A;  5LRJ A;  3D7D A;  5LYL A;  1HDQ A;  3IIB A;  4AXV A;  2ZEN A;  3B3V A;  3DGV A;  2VL1 A;  1R3N A;  3IEH A;  4OID A;  3SI0 A;  3KQZ A;  3I74 A;  4PPZ A;  2AFZ A;  4A94 A;  3B3W A;  4OP4 A;  3KAS A;  1R43 A;  1PYT B;  2POK A;  4Q7A A;  4ZX8 A;  3FF3 A;  2PJC A;  3QNV A;  2PJ1 A;  4CDK A;  2CTB A;  4JYW A;  2XEJ A;  2IMO A;  1LAN A;  1ELM P;  5HVF A;  3D66 A;  4UEF A;  4C9R A;  1RTQ A;  5LYI A;  4UIB A;  3SJX A;  4MMO A;  1VIX A;  2O4H A;  4ONW A;  3IO1 A;  2ZEH A;  4OC1 A;  1M4L A;  3B3T A;  4H2K A;  5HVH A;  3B3C A;  3WC5 A;  5LYD A;  4P4E A;  3DLJ A;  4P4F A;  1OBR A;  4OME A;  4ZY2 A;  1TF9 A;  3KHX A;  4C8U A;  4NJR A;  1LCP A;  3S9L A;  2ZOG A;  2ZEL A;  3NH8 A;  5K8P A;  2Q43 A;  4UEE A;  5JM6 A;  1QMU A;  2AFM A;  4KSI A;  4KNG E;  2OR4 A;  2XEF A;  2PJ6 A;  1FNO A;  2ZEM A;  3PB7 X;  1Q7L A;  4C8P A;  4CPA A;  4C99 A;  5D29 A;  5JGF A;  1CBX A;  2V8G A;  5K8N A;  2HC9 A;  3KL9 A;  4C84 A;  4WJB A;  1NSA A;  5ELY A;  2PJ3 A;  1TKH A;  4FUU A;  4WWV A;  3FMC A;  2C6P A;  4P4D A;  4P4B A;  4OIW A;  4P44 A;  4MHN A;  5HXD A;  2ZEP A;  4MCQ A;  3TX8 A;  2GLF A;  4MHY A;  3VAT A;  4ZY1 A;  3HUV A;  1UWY A;  4PXB A;  3FED A;  2V8V A;  3NH4 A;  4C8F A;  4C86 A;  1ZLH A;  4NGM A;  4P10 A;  3SI2 A;  4Z65 A;  4W9Y A;  1AMP A;  3HLP A;  4PXD A;  6CPA A;  4A39 A;  1ZG7 A;  4C85 A;  1TKJ A;  2C6G A;  3D68 A;  2V77 A;  1Y0Y A;  3I6S A;  4ZX9 A;  3WC7 A;  1ARL A;  4TJX A;  5D8N A;  4C9A A;  2ZEO A;  2AFU A;  2PJA A;  2PJ5 A;  2PRQ A;  3GLJ A;  1CP6 A;  3PB9 X;  3V7Z A;  4P6Y A;  4G1P A;  2EK9 A;  2J9A A;  4DUK A;  1HEE A;  3N5F A;  2JEW A;  4ZYQ A;  3PBB A;  1VGY A;  1XBU A;  3FEC A;  1LAM A;  2QVP A;  3B7I A;  2PJ4 A;  2F8H A;  3S9N A;  2XEG A;  2C6C A;  1LOK A;  3KI9 A;  4P4J A;  1AYE A;  3IJ3 A;  3H8F A;  3NFZ A;  1CG2 A;  4NGN A;  3RBU A;  4R6T A;  5JH9 A;  3K2K A;  2AFS A;  4YU9 A;  3EIF A;  2PJ0 A;  3NH5 A;  2V8D A;  2ZEG A;  3PBE A;  3FVL A;  2PIZ A;  4NJQ A;  3SI1 A;  4NGP A;  4ZI6 A;  1CPS A;  2OOT A;  2F7V A;  2GRE A;  3PFO A;  2QJ8 A;  3KR5 A;  4O23 A;  3D7G A;  3B35 A;  4MHZ A;  4IHM A;  3JRU A;  2PCU A;  2CTC A;  1XJO A;  5F09 A;  2PJ8 A;  1ELL P;  2QYV A;  4C9U A;  2V8H A;  4DYO A;  3SJG A;  3ISZ A;  1LAP A;  1ZLI A;  4EWT A;  4NGT A;  3IFE A;  4B6Z A;  4YN3 A;  1WVM A;  2AFO A;  2PJ7 A;  2GLJ A;  4C9E A;  2BOA A;  3FX6 A;  3TC8 A;  4BD9 A;  3GUX A;  5CBM A;  1XRY A;  1YSJ A;  4UIA A;  3B3S A;  2NSM A;  3WT4 A;  1F2P A;  3PEI A;  2FVG A;  2BCO A;  4X2T A;  3WAB A;  4PXC A;  3MRU A;  2EK8 A;  3B2Y A;  3D4U A;  2PVW A;  1YW4 A;  1KWM A;  4OC2 A;  1VHO A;  4MCP A;  4K3N A;  3SJE A;  2CIJ A;  1F57 A;  2Q4Z A;  4PXE A;  1GYT A;  2Q51 A;  4EFD A;  2PIY A;  2GU2 A;  3CPA A;  4NFR A;  4TNU A;  3H8E A;  1FT7 A;  5HVG A;  4R76 A;  5LYF A;  4NGQ A;  1F2O A;  3BI1 A;  2ZED A;  3V38 A;  4A38 A;  3KZW A;  4CDJ A; 
#chains in the Genus database with same CATH topology
 1ZG8 A;  2EVN A;  5J3X A;  1XE4 A;  5HKW A;  2FS5 A;  2PJB A;  4UFX A;  4C68 A;  4A2Z A;  2JBJ A;  1NE9 A;  3ICU A;  2IQ6 A;  4EYS A;  2GE3 A;  3T8W A;  4PK2 A;  4UCN A;  3QAH A;  2NYQ A;  4NCZ A;  3VAR A;  4KOT A;  1EZA A;  3K9U A;  4MRI A;  3PB8 X;  5CPA A;  4PQA A;  3KQX A;  4YGO A;  3RO0 A;  4ONU A;  5A28 A;  1VHE A;  5I4M A;  4I49 A;  4FWU A;  4INJ A;  1A9X B;  2DIK A;  3PLF B;  1YME A;  4OKO A;  1V6C A;  4MFL A;  3I1U A;  1S5K A;  4MI4 A;  2Z11 A;  4U9Y A;  3W6S A;  1LFW A;  4HNW B;  3S6G A;  4FBE A;  1FY7 A;  3CPX A;  1YLO A;  4IK2 A;  3MGD A;  1MK4 A;  1ZG9 A;  2B0A A;  4L89 A;  1Z8L A;  2BEI A;  2Y0M A;  1DE4 C;  1S7L A;  1WWZ A;  2XEI A;  3SJF A;  1PCA A;  3PFE A;  4UEZ A;  5EMI A;  3CT9 A;  3FJU A;  2RFH A;  4YFJ A;  1CPX A;  2PR1 A;  3FH4 A;  2IJZ A;  3VTA A;  4Y49 B;  4HNY B;  4OLL A;  1Y7R A;  2ANP A;  2P6G A;  3D7H A;  2PDO A;  4FAI A;  3BXM A;  4MFJ A;  1M1D A;  2ZEE A;  4UA3 A;  1H8L A;  3TLZ A;  2FT0 A;  2A4N A;  3DNS A;  2WUU A;  4B5O A;  2JBK A;  8CPA A;  1CX8 A;  3BI0 A;  1Z8T A;  2BUE A;  4KLV A;  4KLW A;  1DTD A;  2P6E A;  3LWU A;  4MXU A;  4R57 A;  1TKF A;  1XEB A;  3TLC A;  4DJL A;  1YQE A;  1TF8 A;  4KOW A;  1Y9K A;  1VKC A;  4CAE A;  1Y9Z A;  1ZL0 A;  5F1Y A;  2EO8 A;  4OC5 A;  2EBJ A;  1Y0R A;  5K8O A;  2MP0 A;  2HRO A;  2X0S A;  3TLB A;  1KBL A;  2ATR A;  4NGR A;  4CGP A;  3RAM A;  2ZEF A;  5AGE A;  3OB1 B;  4KOR A;  3D2M A;  2G9D A;  4J3G A;  4JZ0 A;  4OC3 A;  2GP4 A;  4MCR A;  4OAE A;  1KUX A;  3JUW A;  1S7F A;  2YNE A;  2ZPA A;  3LMS A;  1KUV A;  4NF1 A;  3PRT A;  3GB0 A;  4NSQ A;  7CPA A;  1XOV A;  5IB0 A;  2CF4 A;  4UBR A;  1Y7E A;  4OC4 A;  1LRZ A;  3DDD A;  3EXN A;  3VRR A;  4TWE A;  4LQ6 A;  4EME A;  3KGQ A;  3D7F A;  2O28 A;  1B6B A;  1TXR A;  5EC4 A;  3S6F A;  3VGO A;  5LRK A;  2GFQ A;  4X5K A;  3OP0 A;  3BJ8 A;  3C26 A;  3C8O A;  2N3A B;  5LRG A;  1KUY A;  4EVY A;  2I00 A;  4NGS A;  5C88 A;  1XMB A;  2WYR A;  1IU8 A;  2DEA A;  2PJ2 A;  4X8I A;  2OZG A;  1VI4 A;  3NA6 A;  4F9U A;  3LD2 A;  3WC6 A;  2C1C A;  1IYK A;  2CY2 A;  2OZU A;  4C8C A;  3KR4 A;  2Z3P A;  4C9V A;  4CGO A;  1YW6 A;  4UF4 A;  1QQ9 A;  3BHX A;  3HPH E;  4KUA A;  3IWE A;  3D67 A;  2F5I A;  3IC1 A;  1QSM A;  2FIW A;  4JWP A;  1Z2L A;  4UWI A;  3KRV A;  3T90 A;  4KOX A;  4YWY A;  1EE3 P;  4B5P B;  1QSN A;  3FEE A;  2EWB A;  5HKY A;  2Q0Y A;  2VBQ A;  4H89 A;  4F9V A;  2WSA A;  3VH9 A;  2Z3L A;  1CP7 A;  3QB8 A;  2R1I A;  2WZN A;  4F8Z A;  2HWG A;  4OC0 A;  1BO4 A;  3D8P A;  1IY7 A;  2AUM A;  1MJ9 A;  2I3C A;  5AG7 A;  4X3R A;  4B12 A;  1X12 A;  1M4D A;  1CE8 B;  2PVV A;  3ISX A;  3PB4 X;  4TJV A;  2OU2 A;  1BLL E;  4CAV A;  3MN8 A;  3SXN A;  2O53 A;  4ZY0 A;  4UWJ A;  2PE3 A;  2R98 A;  3BUM B;  5IB9 A;  4MHP A;  5IV0 A;  4C8A A;  3H8G A;  1Z9U A;  3TT2 A;  3L2N A;  5J8C A;  2R82 A;  3TO6 A;  1S60 A;  2ODF A;  5A27 A;  3CDX A;  4JJX A;  2HB6 A;  1QSO A;  1XF1 A;  2ABZ A;  3K9T A;  4CGL A;  4FD6 A;  4BIN A;  1Z5R A;  2Q4V A;  2ZW6 A;  2YJT A;  5JVL A;  4P4I A;  2B3V A;  4R8F A;  4IIY A;  2HV2 A;  4IAV A;  3KHZ A;  4U9Z A;  3RZA A;  5K8M A;  3TLG B;  1XFO A;  3GIU A;  4GM5 A;  2QEC A;  4A37 A;  1ZYM A;  5J1Q A;  3IGR A;  3TLA A;  4KVX A;  2P6F A;  1J4J A;  4BBH A;  2ZOF A;  1BPN A;  3NE7 A;  2RB7 A;  4MFP A;  4UCP A;  3F0A A;  2FE7 A;  5CNP A;  1GGO A;  1YGH A;  1ARM A;  1T36 B;  1BAV A;  1JQG A;  4R7M A;  3S9M A;  4MCS A;  1IGB A;  1YVH A;  3PB6 X;  3PGP A;  4A4B A;  3EC4 A;  2OH1 A;  3VRQ A;  1CJW A;  5GCN A;  4C2Z A;  4JD6 A;  4II9 A;  4C8T A;  2FSR A;  4LQG A;  3IWW A;  1HDU A;  4P45 A;  1ZO0 A;  2AFW A;  1BPM A;  2AFX A;  2B4D A;  2BO9 A;  3ZNI A;  3R96 A;  5ISV A;  4AB7 A;  5DS0 A;  1IOF A;  3IWG A;  4B14 A;  5KTA A;  1KEE B;  5THW A;  4RUH A;  1Z9E A;  2CNS A;  5LRJ A;  3D7D A;  1YK3 A;  3TFY A;  5LYL A;  1HDQ A;  2ARH A;  3EZE A;  3IIB A;  4AXV A;  2ZEN A;  3B3V A;  2P0W A;  3DGV A;  4FD4 A;  3T5M A;  1S7N A;  2VL1 A;  5JPH A;  1R3N A;  3IEH A;  4OID A;  2B4J C;  3EY5 A;  3SI0 A;  3KQZ A;  3TOB A;  5HMN A;  3TLY A;  2EZA A;  3P2F A;  3EZB A;  4CRZ B;  2R7H A;  4ZBG A;  3I74 A;  4PPZ A;  2UV8 G;  2AFZ A;  3GKR A;  4XPD C;  3B3W A;  3NE8 A;  3H5Z A;  2RC4 A;  3DR6 A;  4OP4 A;  3F9K C;  3VRP A;  4A94 A;  5F13 A;  3KAS A;  1R43 A;  1PYT B;  2AE6 A;  2POK A;  4Q7A A;  1SQH A;  1YVK A;  4ZX8 A;  1PU9 A;  3FF3 A;  2PJC A;  3U88 C;  3QNV A;  5F9M A;  2PJ1 A;  3OAK A;  4RI1 A;  3VWE A;  4CDK A;  2YND A;  2ZXV A;  2VEZ A;  2CTB A;  4JYW A;  2XEJ A;  2OZH A;  5IX3 A;  4MJ8 A;  4BMH A;  1B87 A;  1Z8W A;  2IMO A;  2FCK A;  4A95 A;  1LAN A;  4KSA A;  1ELM P;  4E0A A;  2NMT A;  4R9M A;  5HVF A;  3D66 A;  2CNT A;  4UEF A;  4C9R A;  1RTQ A;  4IUS A;  5AG4 A;  5AG6 A;  3S6H A;  3CXQ A;  2XPO A;  5F48 A;  3T05 A;  2H5M A;  4UIB A;  5LYI A;  3R9G A;  2YNC A;  4KUB A;  3SJX A;  5J8F A;  4MMO A;  4BPW B;  1VIX A;  2O4H A;  4ONW A;  3IO1 A;  2ZEH A;  1IYL A;  4HNX B;  5AG5 A;  1GHE A;  3KKW A;  3PZJ A;  4MY0 A;  4OC1 A;  1M4L A;  4UFW A;  1KZF A;  1XIX A;  3B3T A;  1JWQ A;  1OZP A;  2AUN A;  3PFV A;  4H2K A;  3E0K A;  5HVH A;  3H4Q A;  4ZGY B;  4KZT A;  3B3C A;  1B47 A;  4JVO A;  3N7Z A;  2PC1 A;  4RS2 A;  2OLS A;  2HQY A;  1WJT A;  3WC5 A;  4MI1 A;  5LYD A;  4M85 A;  2B58 A;  4C7I A;  4P4E A;  3GJZ A;  2BL1 A;  2PRB A;  1A2Z A;  3DLJ A;  1YRE A;  2C5Q A;  3V8I A;  4P4F A;  1OBR A;  4OME A;  4ZY2 A;  4AG9 A;  1TF9 A;  2I79 A;  3KHX A;  4C8U A;  4MFK A;  4NJR A;  1LCP A;  3S9L A;  1WK4 A;  2B5G B;  2ZEL A;  2ZOG A;  3NFQ A;  2DPS A;  1CM0 A;  3VRN A;  2OB0 A;  2ZW4 A;  3NH8 A;  3ZJ0 A;  2Q43 A;  4UEE A;  4KVM E;  4A30 A;  4F6A A;  5JM6 A;  5K8P A;  4M8D A;  3UY5 A;  4M6H A;  1QMU A;  2AFM A;  1QST A;  4R3L A;  4KSI A;  4PSX A;  4FD5 A;  2J8M A;  2R8V A;  4B5P A;  2Z0Z A;  4H6Z A;  4KNG E;  2OR4 A;  1AUG A;  4KSF A;  4CYN A;  2WPX A;  4UCM A;  3LOD A;  2XEF A;  2PJ6 A;  1FNO A;  2ZEM A;  3CXS A;  3PB7 X;  4XNH B;  1Q7L A;  5DWN A;  3R9F A;  4A4C A;  1C30 B;  1JDB C;  2HUZ A;  2Q44 A;  4CPA A;  4E2A A;  4C99 A;  1QSR A;  5D29 A;  5JGF A;  1DIK A;  1CBX A;  2V8G A;  5G21 A;  4KVO E;  5K8N A;  2HC9 A;  3KL9 A;  3R95 A;  3FIX A;  4QBJ A;  4WJB A;  1M6V B;  3T0T A;  4C84 A;  3F5B A;  2DLA A;  1NSA A;  5ELY A;  2PJ3 A;  2Z3K A;  2GAN A;  1TKH A;  2VQY A;  2QML A;  4QB9 A;  4FUU A;  1JDE A;  4C2X A;  4B11 A;  4WWV A;  3FMC A;  5HKZ A;  4MFZ A;  2C6P A;  4P4D A;  4P4B A;  3BJ7 A;  4YRH A;  4OIW A;  4P44 A;  4MHN A;  5G20 A;  1VBH A;  1ON0 A;  3D3S A;  2FL4 A;  5HXD A;  2ZEP A;  4MCQ A;  3TX8 A;  2PQ8 A;  2GLF A;  4MHY A;  4QUS A;  3VAT A;  4ZY1 A;  2VXK A;  3CXP A;  3TLG A;  4E94 A;  4M6G A;  4AVB A;  2REE A;  3TYX A;  3HUV A;  4K30 A;  1UWY A;  2D4O A;  4PXB A;  3FED A;  3RNZ A;  4A33 A;  4IIX A;  3RYO A;  1BXR B;  2V8V A;  3G3S A;  3NH4 A;  5F49 A;  4C8F A;  2EZB A;  4RR2 B;  4CYQ A;  3SHP A;  4C86 A;  1ZLH A;  4NGM A;  4P10 A;  3SI2 A;  2CXA A;  2Z3O A;  4HPS A;  4Z65 A;  5F5X A;  4W9Y A;  1AMP A;  1M4I A;  2Q7S A;  2XPN A;  5H84 A;  2BSW A;  3HLP A;  4PXD A;  3G23 A;  3OWC A;  2Y1M A;  3O8Z A;  6CPA A;  4KOU A;  4A39 A;  1ZG7 A;  3A9L A;  3FRM A;  1TKJ A;  4C85 A;  2C6G A;  4CRY B;  3D68 A;  5KTD A;  2V77 A;  1Y0Y A;  4KOS A;  4U5Y A;  4ZX9 A;  3I6S A;  4Y49 C;  4AG7 A;  3WC7 A;  1ARL A;  4TJX A;  5JYB A;  5D8N A;  4C9A A;  5FVJ A;  3U1B A;  1PUA A;  2PJ9 A;  1S3Z A;  2Z3N A;  2Y1N A;  2ZEO A;  4NXY A;  2AFU A;  2PJA A;  2B3U A;  2PJ5 A;  2PRQ A;  3GLJ A;  1CP6 A;  2JDD A;  3DSB A;  3PB9 X;  3F8K A;  2EUI A;  3V7Z A;  4P6Y A;  4G1P A;  5F47 A;  2EK9 A;  2G3T A;  1J3L A;  2J9A A;  4DUK A;  2REF A;  4MJX A;  3FXT A;  4COB A;  1FBV A;  1HEE A;  1MJB A;  3SXO A;  3N5F A;  2FXF A;  2JEW A;  4ZYQ A;  2YNC C;  3PBB A;  1VGY A;  1XBU A;  2B4D B;  2X7B A;  3FEC A;  1LAM A;  2QVP A;  3FBU A;  3B7I A;  3S6K A;  2PJ4 A;  2J8N A;  2F8H A;  2VZZ A;  4B13 A;  4HKF A;  5FD8 A;  3S9N A;  2XEG A;  4AVC A;  4BPX B;  2Z3M A;  2C27 A;  1BOB A;  2C6C A;  4MY3 A;  3SR3 A;  2B4B A;  4JXR A;  1Q2C A;  1LOK A;  2G0B A;  3KI9 A;  4AVA A;  3DR8 A;  4P4J A;  2DXQ A;  5C82 A;  1AYE A;  1NBW A;  3EO4 A;  3R1K A;  3IJ3 A;  4BTF A;  2Z10 A;  3H8F A;  3BUN B;  4F0X A;  5KTC A;  2Q7B A;  1S7K A;  4F0Y A;  4J0N A;  3NFZ A;  4IF5 A;  3P2H A;  3D2P A;  1CG2 A;  4JXQ A;  3B8G A;  2CNM A;  4UFV A;  5H86 A;  3W91 A;  1U6M A;  2PSW A;  3GYA A;  4CS0 B;  3TO9 A;  2IL4 A;  3TCV A;  4NGN A;  2Q04 A;  4KOY A;  3RBU A;  4R6T A;  3FNC A;  4XPK A;  2XPP A;  1M4G A;  4OAD A;  4CAW A;  5JH9 A;  3K2K A;  1Z8X A;  4H6U A;  3BUX B;  2AFS A;  5K99 A;  3BLN A;  4YU9 A;  4NEX A;  3JTK A;  3EIF A;  1TIQ A;  1VHS A;  2PJ0 A;  2ZW7 A;  3NH5 A;  1R61 A;  2V8D A;  2ZEG A;  1R57 A;  5AXI A;  1IOI A;  3FYN A;  2Q4Y A;  3PBE A;  1YR0 A;  2PR8 A;  3FVL A;  1XF8 A;  2FIA A;  4XNH C;  2K5T A;  3EFA A;  2PIZ A;  4NJQ A;  1ZRS A;  3SI1 A;  4NGP A;  3K4I A;  3VRO A;  4ZI6 A;  1CS0 B;  1CPS A;  3TLE A;  4XPD B;  2OOT A;  1EO0 A;  4MHD A;  4CAX A;  2F7V A;  2GRE A;  2B5G A;  4RN7 A;  4B10 A;  4M3S A;  3PFO A;  2QJ8 A;  3KR5 A;  4O23 A;  3D7G A;  4XPL A;  4L8A A;  4R87 A;  4Q38 A;  4H1H A;  2QIR A;  3B35 A;  4IHM A;  2JEV A;  4MHZ A;  4R3K A;  4GS4 A;  1Q5X A;  4GXH A;  1XMT A;  2VZY A;  3JRU A;  1I1D A;  1P4N A;  3BUW B;  2DPT A;  2VKZ G;  2PCU A;  1VBG A;  3IU1 A;  5JQ4 A;  1Q2Y A;  1I12 A;  2CTC A;  2VI7 A;  1XJO A;  5F09 A;  2PJ8 A;  2ZW5 A;  3JVN A;  4KS9 A;  3WR7 A;  4CGN A;  3OB2 B;  1ELL P;  4MFQ A;  3T9Y A;  1YVO A;  5F46 A;  1Q2D A;  4C8P A;  2PCN A;  2QYV A;  4C9U A;  3IU2 A;  2V8H A;  4COG A;  4DYO A;  3SJG A;  1Y9W A;  4JLY A;  3ISZ A;  5HH1 A;  2J8R A;  2HI6 A;  1YLE A;  4PK3 A;  3W6X A;  4C2Y A;  1LAP A;  4A32 A;  1ZLI A;  2D4P A;  4NGT A;  3GY9 A;  3TOA A;  3IFE A;  1NSL A;  2DF5 A;  4B6Z A;  4EWT A;  4YN3 A;  1NMT A;  4LX9 A;  2XPL A;  1IIC A;  2AFO A;  1WVM A;  1Z4R A;  2PJ7 A;  5EBV A;  4QC6 A;  2GLJ A;  4MBU A;  3CZX A;  4C9E A;  5I0C A;  2BOA A;  5DWM A;  4CZ1 A;  3FX6 A;  3PP9 A;  3TC8 A;  4BD9 A;  3NOJ A;  3GUX A;  5CBM A;  1I21 A;  1V0C A;  4KOV A;  1XRY A;  1YSJ A;  2EZC A;  1EZB A;  3BUO B;  4UIA A;  3B3S A;  3I9S A;  1UFH A;  2NSM A;  5BY0 A;  1F2P A;  2KCW A;  3WT4 A;  3T07 A;  3PEI A;  4QVT A;  2FVG A;  4E5S A;  1IB1 E;  2BCO A;  2JLM A;  3G8W A;  4X2T A;  4DNC A;  3VWD A;  3WAB A;  1L0C A;  2E28 A;  3PT1 A;  4PXC A;  3ZZI A;  1YX0 A;  1IID A;  3QAY A;  4PV6 A;  4Q36 A;  2YJV A;  3MRU A;  5G22 A;  4M6I A;  4PSW A;  2EK8 A;  3B2Y A;  4FD7 A;  1KC7 A;  3LAC A;  3D4U A;  2PVW A;  1YW4 A;  1NXJ A;  4CO9 A;  3HPG G;  1P0H A;  1KWM A;  2D0P A;  4CYO A;  5IR2 A;  4OC2 A;  1VHO A;  2GIV A;  2YGW A;  1RXT A;  4MCP A;  2G3A A;  4C7H A;  2D0O A;  4CYP A;  1RO5 A;  4K3N A;  3SJE A;  1N71 A;  1M44 A;  2CIJ A;  5G1Z A;  1Z4E A;  1F57 A;  2Q4Z A;  3I3G A;  4LUA A;  4PXE A;  3TE4 A;  1MJA A;  2CBL A;  1GYT A;  5E96 A;  4E8O A;  3EZA A;  2Q51 A;  3HMJ G;  4EFD A;  2FM4 A;  2PIY A;  2GU2 A;  4BPU B;  1X10 A;  3R9E A;  3CPA A;  2AJ6 A;  4NFR A;  4TNU A;  3H8E A;  1FT7 A;  5HVG A;  4R76 A;  4ORF A;  4A31 A;  5LYF A;  1K4J A;  3TTH A;  2WPW A;  5BWA B;  1C3O B;  4NGQ A;  1F2O A;  3BI1 A;  2ZED A;  3V38 A;  4A38 A;  4CAF A;  3TO7 A;  3KZW A;  4CGM A;  2JDC A;  4GPL B;  4CDJ A;  3FB3 A; 
#chains in the Genus database with same CATH homology
 1ZG8 A;  2PJB A;  2JBJ A;  2IQ6 A;  3T8W A;  2NYQ A;  3VAR A;  4MRI A;  3PB8 X;  5CPA A;  4PQA A;  3KQX A;  5I4M A;  1VHE A;  4FWU A;  1YME A;  4OKO A;  1V6C A;  3I1U A;  1LFW A;  4FBE A;  3CPX A;  4IK2 A;  1YLO A;  1ZG9 A;  1Z8L A;  1DE4 C;  4UEZ A;  2XEI A;  3SJF A;  1PCA A;  3PFE A;  3CT9 A;  3FJU A;  2RFH A;  1CPX A;  3FH4 A;  2IJZ A;  3VTA A;  2ANP A;  3D7H A;  4FAI A;  3BXM A;  2ZEE A;  1H8L A;  2JBK A;  8CPA A;  1CX8 A;  3BI0 A;  1DTD A;  3LWU A;  4MXU A;  1TKF A;  4DJL A;  1TF8 A;  1Y9Z A;  4OC5 A;  1Y0R A;  5K8O A;  4NGR A;  3RAM A;  2ZEF A;  2G9D A;  4JZ0 A;  4OC3 A;  2GP4 A;  4MCR A;  3LMS A;  4C8T A;  3PRT A;  3GB0 A;  7CPA A;  2CF4 A;  1Y7E A;  4OC4 A;  4TWE A;  4EME A;  3KGQ A;  3D7F A;  5LRK A;  1TXR A;  5LRG A;  4NGS A;  1XMB A;  2WYR A;  2PJ2 A;  2DEA A;  4X8I A;  3NA6 A;  4F9U A;  3WC6 A;  2C1C A;  4C8C A;  3KR4 A;  4C9V A;  1YW6 A;  4UF4 A;  1QQ9 A;  3BHX A;  3D67 A;  3IC1 A;  4TJV A;  1Z2L A;  4YWY A;  1EE3 P;  3FEE A;  2EWB A;  4F9V A;  3VH9 A;  1CP7 A;  2WZN A;  4F8Z A;  4OC0 A;  1IY7 A;  3ICU A;  2I3C A;  4X3R A;  2PVV A;  3ISX A;  3PB4 X;  1BLL E;  3MN8 A;  2O53 A;  4ZY0 A;  2PE3 A;  5IB9 A;  4MHP A;  4C8A A;  3H8G A;  3L2N A;  3CDX A;  2HB6 A;  1XF1 A;  2ABZ A;  3K9T A;  1Z5R A;  4P4I A;  4R8F A;  4IAV A;  3KHZ A;  3RZA A;  5K8M A;  1XFO A;  4GM5 A;  4A37 A;  5J1Q A;  2ZOF A;  1BPN A;  2RB7 A;  1ARM A;  1BAV A;  1JQG A;  4R7M A;  3S9M A;  4MCS A;  1IGB A;  3PB6 X;  4LQG A;  3IWW A;  1HDU A;  4P45 A;  2AFW A;  2AFX A;  1BPM A;  2PJ9 A;  2BO9 A;  2C5Q A;  5DS0 A;  5THW A;  4RUH A;  5LRJ A;  3D7D A;  5LYL A;  1HDQ A;  3IIB A;  4AXV A;  2ZEN A;  3B3V A;  3DGV A;  2VL1 A;  1R3N A;  3IEH A;  4OID A;  3SI0 A;  3KQZ A;  3I74 A;  4PPZ A;  2AFZ A;  4A94 A;  3B3W A;  4OP4 A;  3KAS A;  1R43 A;  1PYT B;  2POK A;  4Q7A A;  4ZX8 A;  3FF3 A;  2PJC A;  3QNV A;  2PJ1 A;  4CDK A;  2CTB A;  4JYW A;  2XEJ A;  2IMO A;  1LAN A;  1ELM P;  5HVF A;  3D66 A;  4UEF A;  4C9R A;  1RTQ A;  5LYI A;  4UIB A;  3SJX A;  4MMO A;  1VIX A;  2O4H A;  4ONW A;  3IO1 A;  2ZEH A;  4OC1 A;  1M4L A;  3B3T A;  4H2K A;  5HVH A;  3B3C A;  3WC5 A;  5LYD A;  4P4E A;  3DLJ A;  4P4F A;  1OBR A;  4OME A;  4ZY2 A;  1TF9 A;  3KHX A;  4C8U A;  4NJR A;  1LCP A;  3S9L A;  2ZOG A;  2ZEL A;  3NH8 A;  5K8P A;  2Q43 A;  4UEE A;  5JM6 A;  1QMU A;  2AFM A;  4KSI A;  4KNG E;  2OR4 A;  2XEF A;  2PJ6 A;  1FNO A;  2ZEM A;  3PB7 X;  1Q7L A;  4C8P A;  4CPA A;  4C99 A;  5D29 A;  5JGF A;  1CBX A;  2V8G A;  5K8N A;  2HC9 A;  3KL9 A;  4C84 A;  4WJB A;  1NSA A;  5ELY A;  2PJ3 A;  1TKH A;  4FUU A;  4WWV A;  3FMC A;  2C6P A;  4P4D A;  4P4B A;  4OIW A;  4P44 A;  4MHN A;  5HXD A;  2ZEP A;  4MCQ A;  3TX8 A;  2GLF A;  4MHY A;  3VAT A;  4ZY1 A;  3HUV A;  1UWY A;  4PXB A;  3FED A;  2V8V A;  3NH4 A;  4C8F A;  4C86 A;  1ZLH A;  4NGM A;  4P10 A;  3SI2 A;  4Z65 A;  4W9Y A;  1AMP A;  3HLP A;  4PXD A;  6CPA A;  4A39 A;  1ZG7 A;  4C85 A;  1TKJ A;  2C6G A;  3D68 A;  2V77 A;  1Y0Y A;  3I6S A;  4ZX9 A;  3WC7 A;  1ARL A;  4TJX A;  5D8N A;  4C9A A;  2ZEO A;  2AFU A;  2PJA A;  2PJ5 A;  2PRQ A;  3GLJ A;  1CP6 A;  3PB9 X;  3V7Z A;  4P6Y A;  4G1P A;  2EK9 A;  2J9A A;  4DUK A;  1HEE A;  3N5F A;  2JEW A;  4ZYQ A;  3PBB A;  1VGY A;  1XBU A;  3FEC A;  1LAM A;  2QVP A;  3B7I A;  2PJ4 A;  2F8H A;  3S9N A;  2XEG A;  2C6C A;  1LOK A;  3KI9 A;  4P4J A;  1AYE A;  3IJ3 A;  3H8F A;  3NFZ A;  1CG2 A;  4NGN A;  3RBU A;  4R6T A;  5JH9 A;  3K2K A;  2AFS A;  4YU9 A;  3EIF A;  2PJ0 A;  3NH5 A;  2V8D A;  2ZEG A;  3PBE A;  3FVL A;  2PIZ A;  4NJQ A;  3SI1 A;  4NGP A;  4ZI6 A;  1CPS A;  2OOT A;  2F7V A;  2GRE A;  3PFO A;  2QJ8 A;  3KR5 A;  4O23 A;  3D7G A;  3B35 A;  4MHZ A;  4IHM A;  3JRU A;  2PCU A;  2CTC A;  1XJO A;  5F09 A;  2PJ8 A;  1ELL P;  2QYV A;  4C9U A;  2V8H A;  4DYO A;  3SJG A;  3ISZ A;  1LAP A;  1ZLI A;  4EWT A;  4NGT A;  3IFE A;  4B6Z A;  4YN3 A;  1WVM A;  2AFO A;  2PJ7 A;  2GLJ A;  4C9E A;  2BOA A;  3FX6 A;  3TC8 A;  4BD9 A;  3GUX A;  5CBM A;  1XRY A;  1YSJ A;  4UIA A;  3B3S A;  2NSM A;  3WT4 A;  1F2P A;  3PEI A;  2FVG A;  2BCO A;  4X2T A;  3WAB A;  4PXC A;  3MRU A;  2EK8 A;  3B2Y A;  3D4U A;  2PVW A;  1YW4 A;  1KWM A;  5IR2 A;  4OC2 A;  1VHO A;  4MCP A;  4K3N A;  3SJE A;  2CIJ A;  1F57 A;  2Q4Z A;  4PXE A;  1GYT A;  2Q51 A;  4EFD A;  2PIY A;  2GU2 A;  3CPA A;  4NFR A;  4TNU A;  3H8E A;  1FT7 A;  5HVG A;  4R76 A;  5LYF A;  4NGQ A;  1F2O A;  3BI1 A;  2ZED A;  3V38 A;  4A38 A;  3KZW A;  4CDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...