3D7HA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcibzl, a urea-based inhibitor
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 269
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7hA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7hA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7hA02
4BD9A 2PJBA 4R8FA 2ZEGA 3B3CA 1HDQA 2JEWA 4C9VA 3D7HA 3SJGA 4KNGE 2F8HA 4UIAA 4C8CA 3PFOA 2HC9A 2C6PA 2O4HA 1F2PA 3ISZA 4CPAA 1WVMA 3V38A 4P6YA 4DUKA 2RFHA 3FVLA 3S9LA 4AXVA 2GU2A 1AMPA 3KASA 1ZLIA 2QVPA 1ZG8A 3RZAA 5LYLA 3NA6A 1XJOA 4NGSA 4IK2A 4YWYA 1YLOA 5K8NA 2JBJA 1JQGA 2WYRA 2PJCA 4TJXA 1BLLE 2XEGA 4TWEA 5JH9A 4ONWA 2PJ1A 3SI0A 3PEIA 3PB7X 3KQXA 2ZOGA 4A38A 4ZX8A 1CPXA 3WABA 2PJ0A 4NGMA 3PRTA 1XBUA 4CDKA 2PJ5A 2I3CA 4ZX9A 4KSIA 1VHEA 4OC4A 1FT7A 3BXMA 3KR4A 4UIBA 1XRYA 4ZY0A 4OP4A 4PXBA 4MCQA 1IY7A 4MHPA 4P44A 2FVGA 2POKA 1CBXA 3IWWA 2PRQA 1IGBA 1CP7A 4PQAA 4C84A 1EE3P 1XMBA 4R7MA 2PJAA 4FAIA 2WZNA 7CPAA 1Y9ZA 2V8DA 1Z8LA 4C8AA 3FF3A 3ISXA 8CPAA 5LRGA 4H2KA 5F09A 1TF9A 3FECA 2XEJA 4PXCA 1TKJA 1YMEA 4C8TA 3DGVA 3RAMA 5IB9A 4W9YA 2PJ9A 2PE3A 4PPZA 2JBKA 4R76A 3GB0A 2CTCA 2CTBA 4MXUA 2C6CA 1CX8A 4A94A 3KHXA 3T8WA 1LAPA 3IEHA 1BPNA 3D67A 4X2TA 4OMEA 1ELLP 3SI1A 2F7VA 4MHZA 2ZEFA 1OBRA 5THWA 2PVWA 3IO1A 1PYTB 4F9UA 2V77A 1Z5RA 4OKOA 1HEEA 3WC5A 4UEEA 2VL1A 4NGTA 4EWTA 1ZG7A 3IIBA 1AYEA 1CG2A 2AFWA 1V6CA 2G9DA 2BCOA 2CIJA 1HDUA 3S9NA 4C9RA 2ZEPA 3HUVA 2ZEMA 1LAMA 3IFEA 1FNOA 3BI0A 2ZELA 2PJ6A 2C1CA 3GLJA 3B3VA 1YW6A 4PXDA 3WT4A 1TKFA 2PJ7A 5LYDA 1ELMP 3PB4X 1DE4C 2GREA 3LWUA 1ZG9A 2BO9A 3KZWA 2ZEDA 5HVHA 3B35A 4O23A 2HB6A 3KGQA 4DYOA 1R3NA 3CDXA 3TX8A 2DEAA 6CPAA 4MHNA 4ZYQA 1ZLHA 3K2KA 3H8EA 3WC6A 1CP6A 4FBEA 2EWBA 2IJZA 2QYVA 4C86A 3NH4A 1ARMA 5ELYA 4P4FA 2OOTA 4YN3A 3FEDA 3L2NA 3VH9A 2V8VA 4DJLA 3KR5A 4EFDA 2IQ6A 3D4UA 3FEEA 4P10A 3IC1A 5I4MA 2ZEOA 3FMCA 4C9EA 4OC1A 3KL9A 3VTAA 1TXRA 5HVFA 3FX6A 2C6GA 1ARLA 4K3NA 1Y0RA 1Y0YA 3K9TA 2PVVA 2Q4ZA 1Y7EA 5D8NA 3MRUA 3QNVA 5DS0A 5D29A 1R43A 3NFZA 2QJ8A 3CPXA 4JYWA 1TF8A 1LOKA 1NSAA 3WC7A 3B3TA 3H8FA 1YSJA 1Z2LA 1XFOA 4OC0A 4C8PA 1TKHA 4P4EA 2AFSA 2CF4A 4UF4A 4CDJA 3KHZA 3VATA 3CT9A 3JRUA 2EK8A 2AFZA 3NH5A 4NJQA 3KQZA 3B7IA 1BAVA 5K8OA 4OIDA 4R6TA 4MCRA 4C8FA 3NH8A 3GUXA 3DLJA 2Q43A 4ZY1A 3I1UA 4P4IA 1UWYA 4GM5A 1RTQA 3MN8A 4RUHA 4Z65A 4MMOA 3HLPA 2V8HA 2PCUA 3PB6X 2V8GA 3B3WA 4ZY2A 1H8LA 1VHOA 3LMSA 4NGRA 4NGQA 3RBUA 4P45A 2RB7A 3I74A 3PBEA 2AFUA 4P4JA 4A37A 3SJXA 2Q51A 4P4BA 1CPSA 4UEZA 2ZEHA 4F9VA 1PCAA 3IJ3A 4UEFA 3I6SA 3FJUA 5J1QA 2IMOA 3PFEA 4ZI6A 3D7DA 2ZEEA 3D68A 4NFRA 2GLFA 1VIXA 5LRKA 2AFMA 1LCPA 4A39A 3N5FA 3CPAA 5K8MA 4X8IA 4LQGA 2PIZA 1DTDA 3D7FA 3ICUA 4MCSA 3S9MA 4OC2A 3VARA 4NJRA 1YW4A 2ZENA 5CBMA 5HVGA 1F2OA 3FH4A 2XEIA 4NGNA 1GYTA 2BOAA 4C85A 4C9UA 1QMUA 4TJVA 2NYQA 2OR4A 2AFOA 3SI2A 4C8UA 1QQ9A 4FWUA 2ZOFA 5CPAA 4OC3A 4P4DA 1LANA 1F57A 1M4LA 4PXEA 4C9AA 3D66A 4TNUA 4MHYA 1BPMA 4B6ZA 5K8PA 4YU9A 2PJ3A 5JM6A 2GLJA 4F8ZA 4IAVA 5HXDA 4FUUA 2J9AA 2PJ2A 3D7GA 3TC8A 3PB8X 1LFWA 3SJFA 2PJ8A 4WJBA 5LYIA 4OC5A 3B2YA 4IHMA 4MRIA 3EIFA 3PB9X 2NSMA 3SJEA 3V7ZA 3BHXA 1Q7LA 2EK9A 3H8GA 5LYFA 1KWMA 4MCPA 4OIWA 3BI1A 2ABZA 2AFXA 4JZ0A 2PJ4A 4EMEA 4NGPA 2XEFA 4G1PA 2PIYA 4WWVA 4Q7AA 2ANPA 5JGFA 1XF1A 3PBBA 3B3SA 1VGYA 5LRJA 2O53A 3KI9A 4C99A 4X3RA
chains in the Genus database with same CATH superfamily
5KTAA 4Q38A 2ZW4A 2AJ6A 3FBUA 3IU1A 4BD9A 4CRZB 2PJBA 4R8FA 1B87A 2ZW6A 2J8NA 2ZEGA 3B3CA 1HDQA 3D3SA 4E2AA 1VBGA 2JEWA 4C9VA 3D7HA 3SJGA 4JXRA 3S6HA 4KNGE 2F8HA 2BSWA 4UIAA 4C8CA 3PFOA 2HC9A 2C6PA 3TYXA 2O4HA 4XPKA 5F49A 4E5SA 1F2PA 2J8RA 3ISZA 4CPAA 2OLSA 1WVMA 3V38A 4P6YA 4UCPA 4XPDB 2N3AB 1Z4EA 4DUKA 4KOUA 2Y0MA 4M85A 4AVAA 3BUNB 1TIQA 2PSWA 2RFHA 3W91A 3FVLA 4E8OA 3S9LA 1EO0A 1CM0A 4AXVA 2GU2A 4XNHC 2HV2A 3U88C 1AMPA 3KASA 1ZLIA 2QVPA 1ZG8A 4OLLA 1EZBA 3RZAA 4C2YA 3CZXA 1U6MA 3NA6A 1XJOA 4CRYB 4NGSA 4IK2A 1AUGA 1YLOA 2YNEA 4YWYA 2JBJA 1JQGA 2WYRA 4PK3A 2PJCA 4UA3A 4CGOA 2VI7A 5I0CA 1BLLE 4TJXA 2DPSA 2XEGA 4UBRA 4TWEA 5G20A 4B13A 4CAEA 5JH9A 1Y7RA 4ONWA 2PJ1A 3SI0A 3PEIA 3PB7X 3TO6A 3BLNA 4Q36A 1IIDA 4R87A 4FD7A 1M6VB 3KQXA 2ZOGA 4A38A 4AB7A 4AVCA 2MP0A 5F48A 4ZX8A 3VGOA 3DSBA 4C7HA 2RC4A 4H89A 1CPXA 3WABA 4NXYA 2PJ0A 4NGMA 3PRTA 4HNYB 2ZPAA 1XBUA 3K9UA 4QB9A 4CAXA 2E28A 4CDKA 1IU8A 2PJ5A 4CGNA 2BUEA 2PR1A 2I3CA 2O28A 4KSAA 2Q4VA 4ZX9A 4KSIA 1M44A 1VHEA 5HKYA 2VQYA 3F0AA 4OC4A 4GXHA 4BMHA 3BXMA 3EO4A 3IWEA 3KR4A 4PSWA 2OZGA 2QMLA 3SHPA 4UIBA 1XRYA 1J4JA 4ZY0A 3HMJG 4OP4A 4PXBA 1Z8XA 5K8NA 3I9SA 4MCQA 1YGHA 1IY7A 2WUUA 3CXQA 4MHPA 4M6HA 3EZEA 5F1YA 5F5XA 3PLFB 4P44A 1RO5A 2BL1A 2FVGA 2POKA 1CBXA 3IWWA 2R1IA 1NMTA 2PRQA 2Z3LA 3BJ7A 1QSOA 2OZUA 1DIKA 4CYNA 1IGBA 3G3SA 1CP7A 5A27A 5AXIA 3H4QA 1P4NA 4PQAA 4C84A 1EE3P 1XMBA 4R7MA 4AVBA 2ARHA 2YGWA 5HH1A 2PJAA 1PUAA 1YX0A 3U1BA 4FAIA 2WZNA 5C88A 5JPHA 3GJZA 1R57A 4MY0A 7CPAA 4CAWA 1Y9ZA 4ZBGA 4CZ1A 3KI9A 1I21A 1VKCA 2X0SA 2V8DA 4CO9A 1Z8LA 1FY7A 4C8AA 2XPPA 3FF3A 3A9LA 3ISXA 2Q04A 4IIXA 3IU2A 2UV8G 8CPAA 3V8IA 5LRGA 4H2KA 2OZHA 5A28A 1YR0A 2FM4A 5F09A 3VRNA 4KOSA 4FD5A 4C2ZA 1TF9A 4PV6A 4HNXB 5AG6A 2AUMA 3FXTA 3FECA 2XEJA 1Q2DA 2YNCC 4PXCA 3OP0A 1TKJA 2FE7A 2BEIA 2YNDA 1YMEA 2AUNA 2FT0A 4C8TA 1CS0B 4I49A 4NSQA 2WPXA 5JYBA 4JD6A 3DGVA 2FS5A 3EFAA 4MFKA 3RAMA 1WWZA 4KVME 2H5MA 5IB9A 4MFJA 5FD8A 4W9YA 2PJ9A 2YNCA 2PE3A 4QC6A 2D0OA 2PCNA 3EZAA 4PPZA 1IYLA 2JLMA 4RN7A 4YGOA 4HNWB 2JBKA 5HKWA 2VZYA 4MI4A 4R76A 3GB0A 1KZFA 1MJBA 2CTCA 4MFLA 3F8KA 4C2XA 3TOBA 2CTBA 4MXUA 2C6CA 2CNTA 4MHDA 1CX8A 1GHEA 2IL4A 3KHXA 5EC4A 3T8WA 1FBVA 4A94A 1LAPA 2Z3NA 1B6BA 3IEHA 1BPNA 1X12A 3D2PA 3D67A 5DWNA 4A2ZA 2B3VA 5G22A 4X2TA 4OMEA 1ELLP 3SI1A 2F7VA 2Z0ZA 4C68A 2XPNA 5HMNA 4MHZA 2Z10A 2ZEFA 2D0PA 2OU2A 1IOIA 3I3GA 3OWCA 2Z3KA 1I1DA 4LQ6A 3T9YA 4A4CA 2VZZA 5H84A 5F9MA 1OBRA 2FXFA 1ZRSA 3PP9A 4XPDC 5THWA 2YJTA 2PVWA 1XEBA 1EZAA 3IO1A 1PYTB 4F9UA 4B10A 1Z8TA 2I79A 2EZBA 2V77A 5FVJA 1Z5RA 4OKOA 1HEEA 3D8PA 3WC5A 4UEEA 3EZBA 2VL1A 5KTDA 4CS0B 4NGTA 4EWTA 2G3AA 4KOXA 1ZG7A 3IIBA 5AG7A 3TCVA 1AYEA 1CG2A 2AFWA 1V6CA 3FB3A 2G9DA 5GCNA 4RS2A 1A2ZA 4F0YA 2BCOA 2WSAA 1QSTA 2CIJA 1HDUA 1QSRA 4H6UA 4M6GA 1NSLA 1IICA 3S9NA 2PDOA 4KSFA 3OB1B 5AGEA 1Q5XA 2EO8A 4C9RA 4QUSA 2ZEPA 4B12A 1PU9A 1BOBA 3HUVA 1Q2CA 2Z3MA 3O8ZA 2ZEMA 4MFZA 1LAMA 3WR7A 3C26A 5G1ZA 3T0TA 4ONUA 4PK2A 3IFEA 1FNOA 3BI0A 1S5KA 3BUWB 2ZELA 2NMTA 2C1CA 2PJ6A 3GLJA 4HKFA 2Q7BA 3B3VA 1YW6A 1XF8A 4PXDA 4R3LA 4EYSA 3WT4A 3B8GA 1TKFA 2PJ7A 5LYDA 4QVTA 1ELMP 5G21A 2HROA 3ZJ0A 1Z4RA 4UFXA 2B0AA 3S6GA 3EC4A 3PB4X 4JVOA 1DE4C 2GREA 2ZW5A 3LWUA 1ZG9A 2BO9A 5HKZA 4UCNA 1VI4A 3KZWA 1T36B 2DXQA 2ZEDA 3S6KA 5HVHA 2CXAA 3B35A 2QECA 4MFQA 3TO9A 3TFYA 4O23A 4KZTA 2HB6A 4KVXA 5CNPA 4KOVA 3KGQA 4DYOA 1R3NA 2P6EA 3CDXA 3TX8A 5BWAB 4R9MA 3SR3A 1YVKA 3G8WA 2DEAA 6CPAA 4MHNA 4B5PB 1I12A 1ZLHA 4KVOE 5J3XA 1KUXA 1LRZA 3PGPA 3RO0A 4ZYQA 3TE4A 3K2KA 3CXSA 3H8EA 3WC6A 4COGA 4ZGYB 1WJTA 1MJAA 1CP6A 3R9FA 4KLWA 2Z3PA 2HI6A 1ZL0A 4J3GA 1KEEB 1M4DA 4YRHA 4U5YA 4FD4A 4J0NA 2C27A 4FBEA 4BBHA 2CBLA 2EWBA 1S7KA 2IJZA 2QYVA 1KBLA 3FIXA 4C86A 3NH4A 1ARMA 5ELYA 3JTKA 4KS9A 5EBVA 4PSXA 4CGPA 4C7IA 2KCWA 3TLGB 1QSNA 1S3ZA 4OADA 4M8DA 4U9YA 1A9XB 3UY5A 4II9A 4P4FA 2OOTA 4YN3A 3FEDA 1YVHA 3IGRA 3L2NA 3VH9A 2V8VA 4DJLA 5AG4A 3PT1A 3KR5A 2IQ6A 3D4UA 3FEEA 4P10A 4EFDA 4EVYA 2FIAA 4MJ8A 3TLCA 3BJ8A 4MBUA 2HQYA 3VRQA 1M4IA 3IC1A 3OAKA 2ZEOA 5I4MA 1VBHA 1ZO0A 3FMCA 4C9EA 4OC1A 5C82A 3BUMB 4BPWB 3KL9A 3G23A 4MI1A 2Q0YA 4B14A 3VTAA 1Z8WA 4A95A 1BXRB 2B5GB 3EXNA 1TXRA 4KUBA 4DNCA 5HVFA 1JDEA 3FX6A 2C6GA 2B58A 2B4DB 4KLVA 1C3OB 1Z9UA 3TLYA 4B5OA 4M3SA 1ARLA 1XOVA 2ZW7A 4K3NA 1Y0RA 3QB8A 3E0KA 1CE8B 1Y0YA 1Y9WA 2D4PA 3K9TA 2PVVA 1V0CA 1Y7EA 2Q4ZA 5D8NA 1GGOA 3MRUA 3QNVA 5DS0A 5D29A 1M1DA 1R43A 1SQHA 2ATRA 4JYWA 1TF8A 2QJ8A 1LOKA 2D4OA 3CPXA 4R3KA 1NSAA 4BPUB 2DF5A 2EUIA 3WC7A 3NE8A 3B3TA 4A30A 3CXPA 4IF5A 2P0WA 1BO4A 1YSJA 3GYAA 2FCKA 3H8FA 1YVOA 1Z2LA 2G3TA 2Y1NA 1XFOA 4OC0A 4GS4A 4C8PA 1TKHA 4P4EA 2AFSA 3SXOA 4A4BA 2CF4A 4UF4A 4F0XA 4CDJA 3MGDA 3ZZIA 4Y49B 3JUWA 1KUVA 1WK4A 3DR6A 3W6SA 3KHZA 3PFVA 2DIKA 3VATA 3CT9A 3JRUA 3TO7A 2EK8A 2AFZA 3NH5A 1Q2YA 3KQZA 4JLYA 4NJQA 3R1KA 3B7IA 1BAVA 4H6ZA 2PRBA 5K8OA 4OIDA 4R6TA 3GY9A 4MCRA 4C8FA 1XIXA 2CNSA 3NH8A 4R57A 5BY0A 3NE7A 4CYQA 3GUXA 3DLJA 2P6GA 4GPLB 1S60A 2Q43A 2VXKA 3I1UA 2R8VA 2GFQA 4ZY1A 4P4IA 2OB0A 3FRMA 4A32A 2JEVA 2CY2A 1XMTA 2P6FA 1UWYA 2Z11A 4GM5A 4MY3A 1UFHA 1RXTA 1S7LA 4NEXA 5K99A 5LYLA 1RTQA 1IB1E 3MN8A 4RUHA 4Z65A 5JQ4A 4MMOA 3HLPA 4MJXA 2V8HA 2GP4A 2PCUA 3TLZA 3B3WA 2V8GA 3PB6X 4ZY2A 1H8LA 2GIVA 2X7BA 3ZNIA 2ODFA 3IWGA 2QIRA 3P2FA 4BPXB 4KOWA 1VHOA 1CJWA 3DR8A 2JDDA 1NBWA 1YLEA 4YFJA 3NFZA 3TLAA 1Z9EA 3LMSA 4NGRA 4CGLA 2Q44A 4NGQA 3RBUA 5J8CA 3KKWA 4CAFA 4P45A 4RR2B 2RB7A 3PBEA 3R96A 2AFUA 3I74A 4P4JA 1JDBC 4A37A 3SJXA 1IYKA 3OB2B 4COBA 2Q51A 4P4BA 1CPSA 3TOAA 4UEZA 4QBJA 5J8FA 2ZEHA 5DWMA 1ZYMA 2K5TA 4E0AA 4F9VA 4CGMA 1ON0A 1PCAA 2HUZA 3BUXB 3IJ3A 2C5QA 2R82A 4UEFA 3I6SA 2I00A 3D2MA 3FJUA 2F5IA 4XNHB 5J1QA 2IMOA 3PFEA 2REEA 2FL4A 2FSRA 1IOFA 3D7DA 4ZI6A 5IV0A 3GIUA 2ZEEA 4KUAA 3D68A 2EVNA 3LACA 4NFRA 2XPLA 1X10A 3F5BA 4JJXA 2GLFA 1VIXA 5LRKA 2AFMA 1LCPA 3GKRA 2VKZG 4B5PA 4A39A 5H86A 3P2HA 3N5FA 3VRPA 1B47A 2ZXVA 3CPAA 4BINA 4X5KA 3S6FA 3TTHA 4X8IA 5K8MA 4LQGA 1N71A 2AE6A 4KOTA 2PIZA 1DTDA 3D7FA 2EZAA 2J8MA 4A31A 3ICUA 4MCSA 3S9MA 2A4NA 4OC2A 1S7FA 3LODA 4LUAA 4LX9A 3VARA 2HWGA 4BTFA 2JDCA 4NJRA 1YW4A 1VHSA 2ZENA 3T90A 4FD6A 2R98A 2R7HA 1YK3A 4CYPA 4A33A 5CBMA 3TLGA 5HVGA 1F2OA 3W6XA 3FH4A 4JXQA 2Q7SA 1NXJA 2XEIA 4NGNA 1GYTA 4RI1A 2FIWA 4KOYA 1R61A 2Z3OA 4E94A 2BOAA 3N7ZA 4C85A 2Y1MA 3HPGG 2WPWA 4C9UA 1QMUA 1NE9A 3K4IA 4TJVA 3PZJA 1K4JA 4MFPA 2NYQA 3VROA 2OR4A 3T05A 2AFOA 4JWPA 2OH1A 3SI2A 2XPOA 2PQ8A 4UCMA 3SXNA 2DPTA 4C8UA 1QQ9A 1L0CA 1YQEA 4FWUA 1C30B 2VBQA 1S7NA 2ZOFA 3T07A 5CPAA 4NCZA 5F13A 3FYNA 2B5GA 4M6IA 3JVNA 4OC3A 4P4DA 1M4GA 1LANA 2B3UA 1F57A 1M4LA 3EY5A 3H5ZA 4PXEA 2B4DA 2DLAA 4C9AA 1KC7A 5AG5A 3DDDA 4U9ZA 3D66A 4TNUA 4B11A 4MHYA 1BPMA 3R95A 4CYOA 5IX3A 3TLEA 4B6ZA 5K8PA 4L89A 4KORA 4YU9A 4AG7A 4UWIA 1JWQA 3QAHA 3LD2A 2PJ3A 5JM6A 4ORFA 3TLBA 2GLJA 2G0BA 4IAVA 4F8ZA 5HXDA 4FUUA 2J9AA 2PJ2A 5IB0A 3D7GA 3TC8A 1OZPA 4Y49C 3PB8X 4NF1A 1LFWA 1XE4A 3SJFA 2B4JC 2PJ8A 2EZCA 4WJBA 4UWJA 3NFQA 5LYIA 5IR2A 3R9GA 4XPLA 4OC5A 2GE3A 3B2YA 4IHMA 3RYOA 4MRIA 1MJ9A 4K30A 4UFWA 1Y9KA 3TT2A 3C8OA 3PB9X 3EIFA 2REFA 3NOJA 2NSMA 3SJEA 3RNZA 3V7ZA 1P0HA 3KRVA 3BHXA 1Q7LA 5E96A 4INJA 3T5MA 2EK9A 3H8GA 4HPSA 5EMIA 5LYFA 5ISVA 1KUYA 1KWMA 3QAYA 4OAEA 1J3LA 4AG9A 4CAVA 4IIYA 3F9KC 2GANA 4MCPA 4OIWA 3BI1A 3R9EA 2ABZA 2AFXA 4JZ0A 2PJ4A 4L8AA 4EMEA 4NGPA 2XEFA 5F46A 4G1PA 1QSMA 2PIYA 1YREA 4WWVA 2PC1A 3VWEA 3DNSA 2CNMA 4H1HA 4Q7AA 3VWDA 4F6AA 3BUOB 3HPHE 2ANPA 3VRRA 5JGFA 1XF1A 4IUSA 3PBBA 2B4BA 5F47A 3B3SA 1VGYA 5KTCA 5JVLA 2YJVA 4UFVA 2VEZA 5LRJA 2PR8A 3FNCA 2O53A 2EBJA 1MK4A 2Q4YA 1FT7A 4C99A 4X3RA
chains in the Genus database with same CATH topology
4BD9A 2PJBA 4R8FA 2ZEGA 3B3CA 1HDQA 2JEWA 4C9VA 3D7HA 3SJGA 4KNGE 2F8HA 4UIAA 4C8CA 3PFOA 2HC9A 2C6PA 2O4HA 1F2PA 3ISZA 4CPAA 1WVMA 3V38A 4P6YA 4DUKA 2RFHA 3FVLA 3S9LA 4AXVA 2GU2A 1AMPA 3KASA 1ZLIA 2QVPA 1ZG8A 3RZAA 5LYLA 3NA6A 1XJOA 4NGSA 4IK2A 4YWYA 1YLOA 5K8NA 2JBJA 1JQGA 2WYRA 2PJCA 4TJXA 1BLLE 2XEGA 4TWEA 5JH9A 4ONWA 2PJ1A 3SI0A 3PEIA 3PB7X 3KQXA 2ZOGA 4A38A 4ZX8A 1CPXA 3WABA 2PJ0A 4NGMA 3PRTA 1XBUA 4CDKA 2PJ5A 2I3CA 4ZX9A 4KSIA 1VHEA 4OC4A 1FT7A 3BXMA 3KR4A 4UIBA 1XRYA 4ZY0A 4OP4A 4PXBA 4MCQA 1IY7A 4MHPA 4P44A 2FVGA 2POKA 1CBXA 3IWWA 2PRQA 1IGBA 1CP7A 4PQAA 4C84A 1EE3P 1XMBA 4R7MA 2PJAA 4FAIA 2WZNA 7CPAA 1Y9ZA 2V8DA 1Z8LA 4C8AA 3FF3A 3ISXA 8CPAA 5LRGA 4H2KA 5F09A 1TF9A 3FECA 2XEJA 4PXCA 1TKJA 1YMEA 4C8TA 3DGVA 3RAMA 5IB9A 4W9YA 2PJ9A 2PE3A 4PPZA 2JBKA 4R76A 3GB0A 2CTCA 2CTBA 4MXUA 2C6CA 1CX8A 4A94A 3KHXA 3T8WA 1LAPA 3IEHA 1BPNA 3D67A 4X2TA 4OMEA 1ELLP 3SI1A 2F7VA 4MHZA 2ZEFA 1OBRA 5THWA 2PVWA 3IO1A 1PYTB 4F9UA 2V77A 1Z5RA 4OKOA 1HEEA 3WC5A 4UEEA 2VL1A 4NGTA 4EWTA 1ZG7A 3IIBA 1AYEA 1CG2A 2AFWA 1V6CA 2G9DA 2BCOA 2CIJA 1HDUA 3S9NA 4C9RA 2ZEPA 3HUVA 2ZEMA 1LAMA 3IFEA 1FNOA 3BI0A 2ZELA 2PJ6A 2C1CA 3GLJA 3B3VA 1YW6A 4PXDA 3WT4A 1TKFA 2PJ7A 5LYDA 1ELMP 3PB4X 1DE4C 2GREA 3LWUA 1ZG9A 2BO9A 3KZWA 2ZEDA 5HVHA 3B35A 4O23A 2HB6A 3KGQA 4DYOA 1R3NA 3CDXA 3TX8A 2DEAA 6CPAA 4MHNA 4ZYQA 1ZLHA 3K2KA 3H8EA 3WC6A 1CP6A 4FBEA 2EWBA 2IJZA 2QYVA 4C86A 3NH4A 1ARMA 5ELYA 4P4FA 2OOTA 4YN3A 3FEDA 3L2NA 3VH9A 2V8VA 4DJLA 3KR5A 4EFDA 2IQ6A 3D4UA 3FEEA 4P10A 3IC1A 5I4MA 2ZEOA 3FMCA 4C9EA 4OC1A 3KL9A 3VTAA 1TXRA 5HVFA 3FX6A 2C6GA 1ARLA 4K3NA 1Y0RA 1Y0YA 3K9TA 2PVVA 2Q4ZA 1Y7EA 5D8NA 3MRUA 3QNVA 5DS0A 5D29A 1R43A 3NFZA 2QJ8A 3CPXA 4JYWA 1TF8A 1LOKA 1NSAA 3WC7A 3B3TA 3H8FA 1YSJA 1Z2LA 1XFOA 4OC0A 4C8PA 1TKHA 4P4EA 2AFSA 2CF4A 4UF4A 4CDJA 3KHZA 3VATA 3CT9A 3JRUA 2EK8A 2AFZA 3NH5A 4NJQA 3KQZA 3B7IA 1BAVA 5K8OA 4OIDA 4R6TA 4MCRA 4C8FA 3NH8A 3GUXA 3DLJA 2Q43A 4ZY1A 3I1UA 4P4IA 1UWYA 4GM5A 1RTQA 3MN8A 4RUHA 4Z65A 4MMOA 3HLPA 2V8HA 2GP4A 2PCUA 3PB6X 2V8GA 3B3WA 4ZY2A 1H8LA 1VHOA 3LMSA 4NGRA 4NGQA 3RBUA 4P45A 2RB7A 3I74A 3PBEA 2AFUA 4P4JA 4A37A 3SJXA 2Q51A 4P4BA 1CPSA 4UEZA 2ZEHA 4F9VA 1PCAA 3IJ3A 2C5QA 4UEFA 3I6SA 3FJUA 5J1QA 2IMOA 3PFEA 4ZI6A 3D7DA 2ZEEA 3D68A 4NFRA 2GLFA 1VIXA 5LRKA 2AFMA 1LCPA 4A39A 3N5FA 3CPAA 5K8MA 4X8IA 4LQGA 2PIZA 1DTDA 3D7FA 3ICUA 4MCSA 3S9MA 4OC2A 3VARA 4NJRA 1YW4A 2ZENA 5CBMA 5HVGA 1F2OA 3FH4A 2XEIA 4NGNA 1GYTA 2BOAA 4C85A 4C9UA 1QMUA 4TJVA 2NYQA 2OR4A 2AFOA 3SI2A 4C8UA 1QQ9A 4FWUA 2ZOFA 5CPAA 4OC3A 4P4DA 1LANA 1F57A 1M4LA 4PXEA 4C9AA 3D66A 4TNUA 4MHYA 1BPMA 4B6ZA 5K8PA 4YU9A 2PJ3A 5JM6A 2GLJA 4F8ZA 4IAVA 5HXDA 4FUUA 2J9AA 2PJ2A 3D7GA 3TC8A 3PB8X 1LFWA 3SJFA 2PJ8A 4WJBA 5LYIA 5IR2A 4OC5A 3B2YA 4IHMA 4MRIA 3EIFA 3PB9X 2NSMA 3SJEA 3V7ZA 3BHXA 1Q7LA 2EK9A 3H8GA 5LYFA 1KWMA 4MCPA 4OIWA 3BI1A 2ABZA 2AFXA 4JZ0A 2PJ4A 4EMEA 4NGPA 2XEFA 4G1PA 2PIYA 4WWVA 4Q7AA 2ANPA 5JGFA 1XF1A 3PBBA 3B3SA 1VGYA 5LRJA 2O53A 3KI9A 4C99A 4X3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BD9 A;  2PJB A;  4R8F A;  2ZEG A;  3B3C A;  1HDQ A;  2JEW A;  4C9V A;  3D7H A;  3SJG A;  4KNG E;  2F8H A;  4UIA A;  4C8C A;  3PFO A;  2HC9 A;  2C6P A;  2O4H A;  1F2P A;  3ISZ A;  4CPA A;  1WVM A;  3V38 A;  4P6Y A;  4DUK A;  2RFH A;  3FVL A;  3S9L A;  4AXV A;  2GU2 A;  1AMP A;  3KAS A;  1ZLI A;  2QVP A;  1ZG8 A;  3RZA A;  5LYL A;  3NA6 A;  1XJO A;  4NGS A;  4IK2 A;  4YWY A;  1YLO A;  5K8N A;  2JBJ A;  1JQG A;  2WYR A;  2PJC A;  4TJX A;  1BLL E;  2XEG A;  4TWE A;  5JH9 A;  4ONW A;  2PJ1 A;  3SI0 A;  3PEI A;  3PB7 X;  3KQX A;  2ZOG A;  4A38 A;  4ZX8 A;  1CPX A;  3WAB A;  2PJ0 A;  4NGM A;  3PRT A;  1XBU A;  4CDK A;  2PJ5 A;  2I3C A;  4ZX9 A;  4KSI A;  1VHE A;  4OC4 A;  1FT7 A;  3BXM A;  3KR4 A;  4UIB A;  1XRY A;  4ZY0 A;  4OP4 A;  4PXB A;  4MCQ A;  1IY7 A;  4MHP A;  4P44 A;  2FVG A;  2POK A;  1CBX A;  3IWW A;  2PRQ A;  1IGB A;  1CP7 A;  4PQA A;  4C84 A;  1EE3 P;  1XMB A;  4R7M A;  2PJA A;  4FAI A;  2WZN A;  7CPA A;  1Y9Z A;  2V8D A;  1Z8L A;  4C8A A;  3FF3 A;  3ISX A;  8CPA A;  5LRG A;  4H2K A;  5F09 A;  1TF9 A;  3FEC A;  2XEJ A;  4PXC A;  1TKJ A;  1YME A;  4C8T A;  3DGV A;  3RAM A;  5IB9 A;  4W9Y A;  2PJ9 A;  2PE3 A;  4PPZ A;  2JBK A;  4R76 A;  3GB0 A;  2CTC A;  2CTB A;  4MXU A;  2C6C A;  1CX8 A;  4A94 A;  3KHX A;  3T8W A;  1LAP A;  3IEH A;  1BPN A;  3D67 A;  4X2T A;  4OME A;  1ELL P;  3SI1 A;  2F7V A;  4MHZ A;  2ZEF A;  1OBR A;  5THW A;  2PVW A;  3IO1 A;  1PYT B;  4F9U A;  2V77 A;  1Z5R A;  4OKO A;  1HEE A;  3WC5 A;  4UEE A;  2VL1 A;  4NGT A;  4EWT A;  1ZG7 A;  3IIB A;  1AYE A;  1CG2 A;  2AFW A;  1V6C A;  2G9D A;  2BCO A;  2CIJ A;  1HDU A;  3S9N A;  4C9R A;  2ZEP A;  3HUV A;  2ZEM A;  1LAM A;  3IFE A;  1FNO A;  3BI0 A;  2ZEL A;  2PJ6 A;  2C1C A;  3GLJ A;  3B3V A;  1YW6 A;  4PXD A;  3WT4 A;  1TKF A;  2PJ7 A;  5LYD A;  1ELM P;  3PB4 X;  1DE4 C;  2GRE A;  3LWU A;  1ZG9 A;  2BO9 A;  3KZW A;  2ZED A;  5HVH A;  3B35 A;  4O23 A;  2HB6 A;  3KGQ A;  4DYO A;  1R3N A;  3CDX A;  3TX8 A;  2DEA A;  6CPA A;  4MHN A;  4ZYQ A;  1ZLH A;  3K2K A;  3H8E A;  3WC6 A;  1CP6 A;  4FBE A;  2EWB A;  2IJZ A;  2QYV A;  4C86 A;  3NH4 A;  1ARM A;  5ELY A;  4P4F A;  2OOT A;  4YN3 A;  3FED A;  3L2N A;  3VH9 A;  2V8V A;  4DJL A;  3KR5 A;  4EFD A;  2IQ6 A;  3D4U A;  3FEE A;  4P10 A;  3IC1 A;  5I4M A;  2ZEO A;  3FMC A;  4C9E A;  4OC1 A;  3KL9 A;  3VTA A;  1TXR A;  5HVF A;  3FX6 A;  2C6G A;  1ARL A;  4K3N A;  1Y0R A;  1Y0Y A;  3K9T A;  2PVV A;  2Q4Z A;  1Y7E A;  5D8N A;  3MRU A;  3QNV A;  5DS0 A;  5D29 A;  1R43 A;  3NFZ A;  2QJ8 A;  3CPX A;  4JYW A;  1TF8 A;  1LOK A;  1NSA A;  3WC7 A;  3B3T A;  3H8F A;  1YSJ A;  1Z2L A;  1XFO A;  4OC0 A;  4C8P A;  1TKH A;  4P4E A;  2AFS A;  2CF4 A;  4UF4 A;  4CDJ A;  3KHZ A;  3VAT A;  3CT9 A;  3JRU A;  2EK8 A;  2AFZ A;  3NH5 A;  4NJQ A;  3KQZ A;  3B7I A;  1BAV A;  5K8O A;  4OID A;  4R6T A;  4MCR A;  4C8F A;  3NH8 A;  3GUX A;  3DLJ A;  2Q43 A;  4ZY1 A;  3I1U A;  4P4I A;  1UWY A;  4GM5 A;  1RTQ A;  3MN8 A;  4RUH A;  4Z65 A;  4MMO A;  3HLP A;  2V8H A;  2PCU A;  3PB6 X;  2V8G A;  3B3W A;  4ZY2 A;  1H8L A;  1VHO A;  3LMS A;  4NGR A;  4NGQ A;  3RBU A;  4P45 A;  2RB7 A;  3I74 A;  3PBE A;  2AFU A;  4P4J A;  4A37 A;  3SJX A;  2Q51 A;  4P4B A;  1CPS A;  4UEZ A;  2ZEH A;  4F9V A;  1PCA A;  3IJ3 A;  4UEF A;  3I6S A;  3FJU A;  5J1Q A;  2IMO A;  3PFE A;  4ZI6 A;  3D7D A;  2ZEE A;  3D68 A;  4NFR A;  2GLF A;  1VIX A;  5LRK A;  2AFM A;  1LCP A;  4A39 A;  3N5F A;  3CPA A;  5K8M A;  4X8I A;  4LQG A;  2PIZ A;  1DTD A;  3D7F A;  3ICU A;  4MCS A;  3S9M A;  4OC2 A;  3VAR A;  4NJR A;  1YW4 A;  2ZEN A;  5CBM A;  5HVG A;  1F2O A;  3FH4 A;  2XEI A;  4NGN A;  1GYT A;  2BOA A;  4C85 A;  4C9U A;  1QMU A;  4TJV A;  2NYQ A;  2OR4 A;  2AFO A;  3SI2 A;  4C8U A;  1QQ9 A;  4FWU A;  2ZOF A;  5CPA A;  4OC3 A;  4P4D A;  1LAN A;  1F57 A;  1M4L A;  4PXE A;  4C9A A;  3D66 A;  4TNU A;  4MHY A;  1BPM A;  4B6Z A;  5K8P A;  4YU9 A;  2PJ3 A;  5JM6 A;  2GLJ A;  4F8Z A;  4IAV A;  5HXD A;  4FUU A;  2J9A A;  2PJ2 A;  3D7G A;  3TC8 A;  3PB8 X;  1LFW A;  3SJF A;  2PJ8 A;  4WJB A;  5LYI A;  4OC5 A;  3B2Y A;  4IHM A;  4MRI A;  3EIF A;  3PB9 X;  2NSM A;  3SJE A;  3V7Z A;  3BHX A;  1Q7L A;  2EK9 A;  3H8G A;  5LYF A;  1KWM A;  4MCP A;  4OIW A;  3BI1 A;  2ABZ A;  2AFX A;  4JZ0 A;  2PJ4 A;  4EME A;  4NGP A;  2XEF A;  4G1P A;  2PIY A;  4WWV A;  4Q7A A;  2ANP A;  5JGF A;  1XF1 A;  3PBB A;  3B3S A;  1VGY A;  5LRJ A;  2O53 A;  3KI9 A;  4C99 A;  4X3R A; 
#chains in the Genus database with same CATH topology
 5KTA A;  4Q38 A;  2ZW4 A;  2AJ6 A;  3FBU A;  3IU1 A;  4BD9 A;  4CRZ B;  2PJB A;  4R8F A;  1B87 A;  2ZW6 A;  2J8N A;  2ZEG A;  3B3C A;  1HDQ A;  3D3S A;  4E2A A;  1VBG A;  2JEW A;  4C9V A;  3D7H A;  3SJG A;  4JXR A;  3S6H A;  4KNG E;  2F8H A;  2BSW A;  4UIA A;  4C8C A;  3PFO A;  2HC9 A;  2C6P A;  3TYX A;  2O4H A;  4XPK A;  5F49 A;  4E5S A;  1F2P A;  2J8R A;  3ISZ A;  4CPA A;  2OLS A;  1WVM A;  3V38 A;  4P6Y A;  4UCP A;  4XPD B;  2N3A B;  1Z4E A;  4DUK A;  4KOU A;  2Y0M A;  4M85 A;  4AVA A;  3BUN B;  1TIQ A;  2PSW A;  2RFH A;  3W91 A;  3FVL A;  4E8O A;  3S9L A;  1EO0 A;  1CM0 A;  4AXV A;  2GU2 A;  4XNH C;  2HV2 A;  3U88 C;  1AMP A;  3KAS A;  1ZLI A;  2QVP A;  1ZG8 A;  4OLL A;  1EZB A;  3RZA A;  4C2Y A;  3CZX A;  1U6M A;  3NA6 A;  1XJO A;  4CRY B;  4NGS A;  4IK2 A;  1AUG A;  1YLO A;  2YNE A;  4YWY A;  2JBJ A;  1JQG A;  2WYR A;  4PK3 A;  2PJC A;  4UA3 A;  4CGO A;  2VI7 A;  5I0C A;  1BLL E;  4TJX A;  2DPS A;  2XEG A;  4UBR A;  4TWE A;  5G20 A;  4B13 A;  4CAE A;  5JH9 A;  1Y7R A;  4ONW A;  2PJ1 A;  3SI0 A;  3PEI A;  3PB7 X;  3TO6 A;  3BLN A;  4Q36 A;  1IID A;  4R87 A;  4FD7 A;  1M6V B;  3KQX A;  2ZOG A;  4A38 A;  4AB7 A;  4AVC A;  2MP0 A;  5F48 A;  4ZX8 A;  3VGO A;  3DSB A;  4C7H A;  2RC4 A;  4H89 A;  1CPX A;  3WAB A;  4NXY A;  2PJ0 A;  4NGM A;  3PRT A;  4HNY B;  2ZPA A;  1XBU A;  3K9U A;  4QB9 A;  4CAX A;  2E28 A;  4CDK A;  1IU8 A;  2PJ5 A;  4CGN A;  2BUE A;  2PR1 A;  2I3C A;  2O28 A;  4KSA A;  2Q4V A;  4ZX9 A;  4KSI A;  1M44 A;  1VHE A;  5HKY A;  2VQY A;  3F0A A;  4OC4 A;  4GXH A;  4BMH A;  3BXM A;  3EO4 A;  3IWE A;  3KR4 A;  4PSW A;  2OZG A;  2QML A;  3SHP A;  4UIB A;  1XRY A;  1J4J A;  4ZY0 A;  3HMJ G;  4OP4 A;  4PXB A;  1Z8X A;  5K8N A;  3I9S A;  4MCQ A;  1YGH A;  1IY7 A;  2WUU A;  3CXQ A;  4MHP A;  4M6H A;  3EZE A;  5F1Y A;  5F5X A;  3PLF B;  4P44 A;  1RO5 A;  2BL1 A;  2FVG A;  2POK A;  1CBX A;  3IWW A;  2R1I A;  1NMT A;  2PRQ A;  2Z3L A;  3BJ7 A;  1QSO A;  2OZU A;  1DIK A;  4CYN A;  1IGB A;  3G3S A;  1CP7 A;  5A27 A;  5AXI A;  3H4Q A;  1P4N A;  4PQA A;  4C84 A;  1EE3 P;  1XMB A;  4R7M A;  4AVB A;  2ARH A;  2YGW A;  5HH1 A;  2PJA A;  1PUA A;  1YX0 A;  3U1B A;  4FAI A;  2WZN A;  5C88 A;  5JPH A;  3GJZ A;  1R57 A;  4MY0 A;  7CPA A;  4CAW A;  1Y9Z A;  4ZBG A;  4CZ1 A;  3KI9 A;  1I21 A;  1VKC A;  2X0S A;  2V8D A;  4CO9 A;  1Z8L A;  1FY7 A;  4C8A A;  2XPP A;  3FF3 A;  3A9L A;  3ISX A;  2Q04 A;  4IIX A;  3IU2 A;  2UV8 G;  8CPA A;  3V8I A;  5LRG A;  4H2K A;  2OZH A;  5A28 A;  1YR0 A;  2FM4 A;  5F09 A;  3VRN A;  4KOS A;  4FD5 A;  4C2Z A;  1TF9 A;  4PV6 A;  4HNX B;  5AG6 A;  2AUM A;  3FXT A;  3FEC A;  2XEJ A;  1Q2D A;  2YNC C;  4PXC A;  3OP0 A;  1TKJ A;  2FE7 A;  2BEI A;  2YND A;  1YME A;  2AUN A;  2FT0 A;  4C8T A;  1CS0 B;  4I49 A;  4NSQ A;  2WPX A;  5JYB A;  4JD6 A;  3DGV A;  2FS5 A;  3EFA A;  4MFK A;  3RAM A;  1WWZ A;  4KVM E;  2H5M A;  5IB9 A;  4MFJ A;  5FD8 A;  4W9Y A;  2PJ9 A;  2YNC A;  2PE3 A;  4QC6 A;  2D0O A;  2PCN A;  3EZA A;  4PPZ A;  1IYL A;  2JLM A;  4RN7 A;  4YGO A;  4HNW B;  2JBK A;  5HKW A;  2VZY A;  4MI4 A;  4R76 A;  3GB0 A;  1KZF A;  1MJB A;  2CTC A;  4MFL A;  3F8K A;  4C2X A;  3TOB A;  2CTB A;  4MXU A;  2C6C A;  2CNT A;  4MHD A;  1CX8 A;  1GHE A;  2IL4 A;  3KHX A;  5EC4 A;  3T8W A;  1FBV A;  4A94 A;  1LAP A;  2Z3N A;  1B6B A;  3IEH A;  1BPN A;  1X12 A;  3D2P A;  3D67 A;  5DWN A;  4A2Z A;  2B3V A;  5G22 A;  4X2T A;  4OME A;  1ELL P;  3SI1 A;  2F7V A;  2Z0Z A;  4C68 A;  2XPN A;  5HMN A;  4MHZ A;  2Z10 A;  2ZEF A;  2D0P A;  2OU2 A;  1IOI A;  3I3G A;  3OWC A;  2Z3K A;  1I1D A;  4LQ6 A;  3T9Y A;  4A4C A;  2VZZ A;  5H84 A;  5F9M A;  1OBR A;  2FXF A;  1ZRS A;  3PP9 A;  4XPD C;  5THW A;  2YJT A;  2PVW A;  1XEB A;  1EZA A;  3IO1 A;  1PYT B;  4F9U A;  4B10 A;  1Z8T A;  2I79 A;  2EZB A;  2V77 A;  5FVJ A;  1Z5R A;  4OKO A;  1HEE A;  3D8P A;  3WC5 A;  4UEE A;  3EZB A;  2VL1 A;  5KTD A;  4CS0 B;  4NGT A;  4EWT A;  2G3A A;  4KOX A;  1ZG7 A;  3IIB A;  5AG7 A;  3TCV A;  1AYE A;  1CG2 A;  2AFW A;  1V6C A;  3FB3 A;  2G9D A;  5GCN A;  4RS2 A;  1A2Z A;  4F0Y A;  2BCO A;  2WSA A;  1QST A;  2CIJ A;  1HDU A;  1QSR A;  4H6U A;  4M6G A;  1NSL A;  1IIC A;  3S9N A;  2PDO A;  4KSF A;  3OB1 B;  5AGE A;  1Q5X A;  2EO8 A;  4C9R A;  4QUS A;  2ZEP A;  4B12 A;  1PU9 A;  1BOB A;  3HUV A;  1Q2C A;  2Z3M A;  3O8Z A;  2ZEM A;  4MFZ A;  1LAM A;  3WR7 A;  3C26 A;  5G1Z A;  3T0T A;  4ONU A;  4PK2 A;  3IFE A;  1FNO A;  3BI0 A;  1S5K A;  3BUW B;  2ZEL A;  2NMT A;  2C1C A;  2PJ6 A;  3GLJ A;  4HKF A;  2Q7B A;  3B3V A;  1YW6 A;  1XF8 A;  4PXD A;  4R3L A;  4EYS A;  3WT4 A;  3B8G A;  1TKF A;  2PJ7 A;  5LYD A;  4QVT A;  1ELM P;  5G21 A;  2HRO A;  3ZJ0 A;  1Z4R A;  4UFX A;  2B0A A;  3S6G A;  3EC4 A;  3PB4 X;  4JVO A;  1DE4 C;  2GRE A;  2ZW5 A;  3LWU A;  1ZG9 A;  2BO9 A;  5HKZ A;  4UCN A;  1VI4 A;  3KZW A;  1T36 B;  2DXQ A;  2ZED A;  3S6K A;  5HVH A;  2CXA A;  3B35 A;  2QEC A;  4MFQ A;  3TO9 A;  3TFY A;  4O23 A;  4KZT A;  2HB6 A;  4KVX A;  5CNP A;  4KOV A;  3KGQ A;  4DYO A;  1R3N A;  2P6E A;  3CDX A;  3TX8 A;  5BWA B;  4R9M A;  3SR3 A;  1YVK A;  3G8W A;  2DEA A;  6CPA A;  4MHN A;  4B5P B;  1I12 A;  1ZLH A;  4KVO E;  5J3X A;  1KUX A;  1LRZ A;  3PGP A;  3RO0 A;  4ZYQ A;  3TE4 A;  3K2K A;  3CXS A;  3H8E A;  3WC6 A;  4COG A;  4ZGY B;  1WJT A;  1MJA A;  1CP6 A;  3R9F A;  4KLW A;  2Z3P A;  2HI6 A;  1ZL0 A;  4J3G A;  1KEE B;  1M4D A;  4YRH A;  4U5Y A;  4FD4 A;  4J0N A;  2C27 A;  4FBE A;  4BBH A;  2CBL A;  2EWB A;  1S7K A;  2IJZ A;  2QYV A;  1KBL A;  3FIX A;  4C86 A;  3NH4 A;  1ARM A;  5ELY A;  3JTK A;  4KS9 A;  5EBV A;  4PSX A;  4CGP A;  4C7I A;  2KCW A;  3TLG B;  1QSN A;  1S3Z A;  4OAD A;  4M8D A;  4U9Y A;  1A9X B;  3UY5 A;  4II9 A;  4P4F A;  2OOT A;  4YN3 A;  3FED A;  1YVH A;  3IGR A;  3L2N A;  3VH9 A;  2V8V A;  4DJL A;  5AG4 A;  3PT1 A;  3KR5 A;  2IQ6 A;  3D4U A;  3FEE A;  4P10 A;  4EFD A;  4EVY A;  2FIA A;  4MJ8 A;  3TLC A;  3BJ8 A;  4MBU A;  2HQY A;  3VRQ A;  1M4I A;  3IC1 A;  3OAK A;  2ZEO A;  5I4M A;  1VBH A;  1ZO0 A;  3FMC A;  4C9E A;  4OC1 A;  5C82 A;  3BUM B;  4BPW B;  3KL9 A;  3G23 A;  4MI1 A;  2Q0Y A;  4B14 A;  3VTA A;  1Z8W A;  4A95 A;  1BXR B;  2B5G B;  3EXN A;  1TXR A;  4KUB A;  4DNC A;  5HVF A;  1JDE A;  3FX6 A;  2C6G A;  2B58 A;  2B4D B;  4KLV A;  1C3O B;  1Z9U A;  3TLY A;  4B5O A;  4M3S A;  1ARL A;  1XOV A;  2ZW7 A;  4K3N A;  1Y0R A;  3QB8 A;  3E0K A;  1CE8 B;  1Y0Y A;  1Y9W A;  2D4P A;  3K9T A;  2PVV A;  1V0C A;  1Y7E A;  2Q4Z A;  5D8N A;  1GGO A;  3MRU A;  3QNV A;  5DS0 A;  5D29 A;  1M1D A;  1R43 A;  1SQH A;  2ATR A;  4JYW A;  1TF8 A;  2QJ8 A;  1LOK A;  2D4O A;  3CPX A;  4R3K A;  1NSA A;  4BPU B;  2DF5 A;  2EUI A;  3WC7 A;  3NE8 A;  3B3T A;  4A30 A;  3CXP A;  4IF5 A;  2P0W A;  1BO4 A;  1YSJ A;  3GYA A;  2FCK A;  3H8F A;  1YVO A;  1Z2L A;  2G3T A;  2Y1N A;  1XFO A;  4OC0 A;  4GS4 A;  4C8P A;  1TKH A;  4P4E A;  2AFS A;  3SXO A;  4A4B A;  2CF4 A;  4UF4 A;  4F0X A;  4CDJ A;  3MGD A;  3ZZI A;  4Y49 B;  3JUW A;  1KUV A;  1WK4 A;  3DR6 A;  3W6S A;  3KHZ A;  3PFV A;  2DIK A;  3VAT A;  3CT9 A;  3JRU A;  3TO7 A;  2EK8 A;  2AFZ A;  3NH5 A;  1Q2Y A;  3KQZ A;  4JLY A;  4NJQ A;  3R1K A;  3B7I A;  1BAV A;  4H6Z A;  2PRB A;  5K8O A;  4OID A;  4R6T A;  3GY9 A;  4MCR A;  4C8F A;  1XIX A;  2CNS A;  3NH8 A;  4R57 A;  5BY0 A;  3NE7 A;  4CYQ A;  3GUX A;  3DLJ A;  2P6G A;  4GPL B;  1S60 A;  2Q43 A;  2VXK A;  3I1U A;  2R8V A;  2GFQ A;  4ZY1 A;  4P4I A;  2OB0 A;  3FRM A;  4A32 A;  2JEV A;  2CY2 A;  1XMT A;  2P6F A;  1UWY A;  2Z11 A;  4GM5 A;  4MY3 A;  1UFH A;  1RXT A;  1S7L A;  4NEX A;  5K99 A;  5LYL A;  1RTQ A;  1IB1 E;  3MN8 A;  4RUH A;  4Z65 A;  5JQ4 A;  4MMO A;  3HLP A;  4MJX A;  2V8H A;  2GP4 A;  2PCU A;  3TLZ A;  3B3W A;  2V8G A;  3PB6 X;  4ZY2 A;  1H8L A;  2GIV A;  2X7B A;  3ZNI A;  2ODF A;  3IWG A;  2QIR A;  3P2F A;  4BPX B;  4KOW A;  1VHO A;  1CJW A;  3DR8 A;  2JDD A;  1NBW A;  1YLE A;  4YFJ A;  3NFZ A;  3TLA A;  1Z9E A;  3LMS A;  4NGR A;  4CGL A;  2Q44 A;  4NGQ A;  3RBU A;  5J8C A;  3KKW A;  4CAF A;  4P45 A;  4RR2 B;  2RB7 A;  3PBE A;  3R96 A;  2AFU A;  3I74 A;  4P4J A;  1JDB C;  4A37 A;  3SJX A;  1IYK A;  3OB2 B;  4COB A;  2Q51 A;  4P4B A;  1CPS A;  3TOA A;  4UEZ A;  4QBJ A;  5J8F A;  2ZEH A;  5DWM A;  1ZYM A;  2K5T A;  4E0A A;  4F9V A;  4CGM A;  1ON0 A;  1PCA A;  2HUZ A;  3BUX B;  3IJ3 A;  2C5Q A;  2R82 A;  4UEF A;  3I6S A;  2I00 A;  3D2M A;  3FJU A;  2F5I A;  4XNH B;  5J1Q A;  2IMO A;  3PFE A;  2REE A;  2FL4 A;  2FSR A;  1IOF A;  3D7D A;  4ZI6 A;  5IV0 A;  3GIU A;  2ZEE A;  4KUA A;  3D68 A;  2EVN A;  3LAC A;  4NFR A;  2XPL A;  1X10 A;  3F5B A;  4JJX A;  2GLF A;  1VIX A;  5LRK A;  2AFM A;  1LCP A;  3GKR A;  2VKZ G;  4B5P A;  4A39 A;  5H86 A;  3P2H A;  3N5F A;  3VRP A;  1B47 A;  2ZXV A;  3CPA A;  4BIN A;  4X5K A;  3S6F A;  3TTH A;  4X8I A;  5K8M A;  4LQG A;  1N71 A;  2AE6 A;  4KOT A;  2PIZ A;  1DTD A;  3D7F A;  2EZA A;  2J8M A;  4A31 A;  3ICU A;  4MCS A;  3S9M A;  2A4N A;  4OC2 A;  1S7F A;  3LOD A;  4LUA A;  4LX9 A;  3VAR A;  2HWG A;  4BTF A;  2JDC A;  4NJR A;  1YW4 A;  1VHS A;  2ZEN A;  3T90 A;  4FD6 A;  2R98 A;  2R7H A;  1YK3 A;  4CYP A;  4A33 A;  5CBM A;  3TLG A;  5HVG A;  1F2O A;  3W6X A;  3FH4 A;  4JXQ A;  2Q7S A;  1NXJ A;  2XEI A;  4NGN A;  1GYT A;  4RI1 A;  2FIW A;  4KOY A;  1R61 A;  2Z3O A;  4E94 A;  2BOA A;  3N7Z A;  4C85 A;  2Y1M A;  3HPG G;  2WPW A;  4C9U A;  1QMU A;  1NE9 A;  3K4I A;  4TJV A;  3PZJ A;  1K4J A;  4MFP A;  2NYQ A;  3VRO A;  2OR4 A;  3T05 A;  2AFO A;  4JWP A;  2OH1 A;  3SI2 A;  2XPO A;  2PQ8 A;  4UCM A;  3SXN A;  2DPT A;  4C8U A;  1QQ9 A;  1L0C A;  1YQE A;  4FWU A;  1C30 B;  2VBQ A;  1S7N A;  2ZOF A;  3T07 A;  5CPA A;  4NCZ A;  5F13 A;  3FYN A;  2B5G A;  4M6I A;  3JVN A;  4OC3 A;  4P4D A;  1M4G A;  1LAN A;  2B3U A;  1F57 A;  1M4L A;  3EY5 A;  3H5Z A;  4PXE A;  2B4D A;  2DLA A;  4C9A A;  1KC7 A;  5AG5 A;  3DDD A;  4U9Z A;  3D66 A;  4TNU A;  4B11 A;  4MHY A;  1BPM A;  3R95 A;  4CYO A;  5IX3 A;  3TLE A;  4B6Z A;  5K8P A;  4L89 A;  4KOR A;  4YU9 A;  4AG7 A;  4UWI A;  1JWQ A;  3QAH A;  3LD2 A;  2PJ3 A;  5JM6 A;  4ORF A;  3TLB A;  2GLJ A;  2G0B A;  4IAV A;  4F8Z A;  5HXD A;  4FUU A;  2J9A A;  2PJ2 A;  5IB0 A;  3D7G A;  3TC8 A;  1OZP A;  4Y49 C;  3PB8 X;  4NF1 A;  1LFW A;  1XE4 A;  3SJF A;  2B4J C;  2PJ8 A;  2EZC A;  4WJB A;  4UWJ A;  3NFQ A;  5LYI A;  5IR2 A;  3R9G A;  4XPL A;  4OC5 A;  2GE3 A;  3B2Y A;  4IHM A;  3RYO A;  4MRI A;  1MJ9 A;  4K30 A;  4UFW A;  1Y9K A;  3TT2 A;  3C8O A;  3PB9 X;  3EIF A;  2REF A;  3NOJ A;  2NSM A;  3SJE A;  3RNZ A;  3V7Z A;  1P0H A;  3KRV A;  3BHX A;  1Q7L A;  5E96 A;  4INJ A;  3T5M A;  2EK9 A;  3H8G A;  4HPS A;  5EMI A;  5LYF A;  5ISV A;  1KUY A;  1KWM A;  3QAY A;  4OAE A;  1J3L A;  4AG9 A;  4CAV A;  4IIY A;  3F9K C;  2GAN A;  4MCP A;  4OIW A;  3BI1 A;  3R9E A;  2ABZ A;  2AFX A;  4JZ0 A;  2PJ4 A;  4L8A A;  4EME A;  4NGP A;  2XEF A;  5F46 A;  4G1P A;  1QSM A;  2PIY A;  1YRE A;  4WWV A;  2PC1 A;  3VWE A;  3DNS A;  2CNM A;  4H1H A;  4Q7A A;  3VWD A;  4F6A A;  3BUO B;  3HPH E;  2ANP A;  3VRR A;  5JGF A;  1XF1 A;  4IUS A;  3PBB A;  2B4B A;  5F47 A;  3B3S A;  1VGY A;  5KTC A;  5JVL A;  2YJV A;  4UFV A;  2VEZ A;  5LRJ A;  2PR8 A;  3FNC A;  2O53 A;  2EBJ A;  1MK4 A;  2Q4Y A;  1FT7 A;  4C99 A;  4X3R A; 
#chains in the Genus database with same CATH homology
 4BD9 A;  2PJB A;  4R8F A;  2ZEG A;  3B3C A;  1HDQ A;  2JEW A;  4C9V A;  3D7H A;  3SJG A;  4KNG E;  2F8H A;  4UIA A;  4C8C A;  3PFO A;  2HC9 A;  2C6P A;  2O4H A;  1F2P A;  3ISZ A;  4CPA A;  1WVM A;  3V38 A;  4P6Y A;  4DUK A;  2RFH A;  3FVL A;  3S9L A;  4AXV A;  2GU2 A;  1AMP A;  3KAS A;  1ZLI A;  2QVP A;  1ZG8 A;  3RZA A;  5LYL A;  3NA6 A;  1XJO A;  4NGS A;  4IK2 A;  4YWY A;  1YLO A;  5K8N A;  2JBJ A;  1JQG A;  2WYR A;  2PJC A;  4TJX A;  1BLL E;  2XEG A;  4TWE A;  5JH9 A;  4ONW A;  2PJ1 A;  3SI0 A;  3PEI A;  3PB7 X;  3KQX A;  2ZOG A;  4A38 A;  4ZX8 A;  1CPX A;  3WAB A;  2PJ0 A;  4NGM A;  3PRT A;  1XBU A;  4CDK A;  2PJ5 A;  2I3C A;  4ZX9 A;  4KSI A;  1VHE A;  4OC4 A;  1FT7 A;  3BXM A;  3KR4 A;  4UIB A;  1XRY A;  4ZY0 A;  4OP4 A;  4PXB A;  4MCQ A;  1IY7 A;  4MHP A;  4P44 A;  2FVG A;  2POK A;  1CBX A;  3IWW A;  2PRQ A;  1IGB A;  1CP7 A;  4PQA A;  4C84 A;  1EE3 P;  1XMB A;  4R7M A;  2PJA A;  4FAI A;  2WZN A;  7CPA A;  1Y9Z A;  2V8D A;  1Z8L A;  4C8A A;  3FF3 A;  3ISX A;  8CPA A;  5LRG A;  4H2K A;  5F09 A;  1TF9 A;  3FEC A;  2XEJ A;  4PXC A;  1TKJ A;  1YME A;  4C8T A;  3DGV A;  3RAM A;  5IB9 A;  4W9Y A;  2PJ9 A;  2PE3 A;  4PPZ A;  2JBK A;  4R76 A;  3GB0 A;  2CTC A;  2CTB A;  4MXU A;  2C6C A;  1CX8 A;  4A94 A;  3KHX A;  3T8W A;  1LAP A;  3IEH A;  1BPN A;  3D67 A;  4X2T A;  4OME A;  1ELL P;  3SI1 A;  2F7V A;  4MHZ A;  2ZEF A;  1OBR A;  5THW A;  2PVW A;  3IO1 A;  1PYT B;  4F9U A;  2V77 A;  1Z5R A;  4OKO A;  1HEE A;  3WC5 A;  4UEE A;  2VL1 A;  4NGT A;  4EWT A;  1ZG7 A;  3IIB A;  1AYE A;  1CG2 A;  2AFW A;  1V6C A;  2G9D A;  2BCO A;  2CIJ A;  1HDU A;  3S9N A;  4C9R A;  2ZEP A;  3HUV A;  2ZEM A;  1LAM A;  3IFE A;  1FNO A;  3BI0 A;  2ZEL A;  2PJ6 A;  2C1C A;  3GLJ A;  3B3V A;  1YW6 A;  4PXD A;  3WT4 A;  1TKF A;  2PJ7 A;  5LYD A;  1ELM P;  3PB4 X;  1DE4 C;  2GRE A;  3LWU A;  1ZG9 A;  2BO9 A;  3KZW A;  2ZED A;  5HVH A;  3B35 A;  4O23 A;  2HB6 A;  3KGQ A;  4DYO A;  1R3N A;  3CDX A;  3TX8 A;  2DEA A;  6CPA A;  4MHN A;  4ZYQ A;  1ZLH A;  3K2K A;  3H8E A;  3WC6 A;  1CP6 A;  4FBE A;  2EWB A;  2IJZ A;  2QYV A;  4C86 A;  3NH4 A;  1ARM A;  5ELY A;  4P4F A;  2OOT A;  4YN3 A;  3FED A;  3L2N A;  3VH9 A;  2V8V A;  4DJL A;  3KR5 A;  4EFD A;  2IQ6 A;  3D4U A;  3FEE A;  4P10 A;  3IC1 A;  5I4M A;  2ZEO A;  3FMC A;  4C9E A;  4OC1 A;  3KL9 A;  3VTA A;  1TXR A;  5HVF A;  3FX6 A;  2C6G A;  1ARL A;  4K3N A;  1Y0R A;  1Y0Y A;  3K9T A;  2PVV A;  2Q4Z A;  1Y7E A;  5D8N A;  3MRU A;  3QNV A;  5DS0 A;  5D29 A;  1R43 A;  3NFZ A;  2QJ8 A;  3CPX A;  4JYW A;  1TF8 A;  1LOK A;  1NSA A;  3WC7 A;  3B3T A;  3H8F A;  1YSJ A;  1Z2L A;  1XFO A;  4OC0 A;  4C8P A;  1TKH A;  4P4E A;  2AFS A;  2CF4 A;  4UF4 A;  4CDJ A;  3KHZ A;  3VAT A;  3CT9 A;  3JRU A;  2EK8 A;  2AFZ A;  3NH5 A;  4NJQ A;  3KQZ A;  3B7I A;  1BAV A;  5K8O A;  4OID A;  4R6T A;  4MCR A;  4C8F A;  3NH8 A;  3GUX A;  3DLJ A;  2Q43 A;  4ZY1 A;  3I1U A;  4P4I A;  1UWY A;  4GM5 A;  1RTQ A;  3MN8 A;  4RUH A;  4Z65 A;  4MMO A;  3HLP A;  2V8H A;  2GP4 A;  2PCU A;  3PB6 X;  2V8G A;  3B3W A;  4ZY2 A;  1H8L A;  1VHO A;  3LMS A;  4NGR A;  4NGQ A;  3RBU A;  4P45 A;  2RB7 A;  3I74 A;  3PBE A;  2AFU A;  4P4J A;  4A37 A;  3SJX A;  2Q51 A;  4P4B A;  1CPS A;  4UEZ A;  2ZEH A;  4F9V A;  1PCA A;  3IJ3 A;  2C5Q A;  4UEF A;  3I6S A;  3FJU A;  5J1Q A;  2IMO A;  3PFE A;  4ZI6 A;  3D7D A;  2ZEE A;  3D68 A;  4NFR A;  2GLF A;  1VIX A;  5LRK A;  2AFM A;  1LCP A;  4A39 A;  3N5F A;  3CPA A;  5K8M A;  4X8I A;  4LQG A;  2PIZ A;  1DTD A;  3D7F A;  3ICU A;  4MCS A;  3S9M A;  4OC2 A;  3VAR A;  4NJR A;  1YW4 A;  2ZEN A;  5CBM A;  5HVG A;  1F2O A;  3FH4 A;  2XEI A;  4NGN A;  1GYT A;  2BOA A;  4C85 A;  4C9U A;  1QMU A;  4TJV A;  2NYQ A;  2OR4 A;  2AFO A;  3SI2 A;  4C8U A;  1QQ9 A;  4FWU A;  2ZOF A;  5CPA A;  4OC3 A;  4P4D A;  1LAN A;  1F57 A;  1M4L A;  4PXE A;  4C9A A;  3D66 A;  4TNU A;  4MHY A;  1BPM A;  4B6Z A;  5K8P A;  4YU9 A;  2PJ3 A;  5JM6 A;  2GLJ A;  4F8Z A;  4IAV A;  5HXD A;  4FUU A;  2J9A A;  2PJ2 A;  3D7G A;  3TC8 A;  3PB8 X;  1LFW A;  3SJF A;  2PJ8 A;  4WJB A;  5LYI A;  5IR2 A;  4OC5 A;  3B2Y A;  4IHM A;  4MRI A;  3EIF A;  3PB9 X;  2NSM A;  3SJE A;  3V7Z A;  3BHX A;  1Q7L A;  2EK9 A;  3H8G A;  5LYF A;  1KWM A;  4MCP A;  4OIW A;  3BI1 A;  2ABZ A;  2AFX A;  4JZ0 A;  2PJ4 A;  4EME A;  4NGP A;  2XEF A;  4G1P A;  2PIY A;  4WWV A;  4Q7A A;  2ANP A;  5JGF A;  1XF1 A;  3PBB A;  3B3S A;  1VGY A;  5LRJ A;  2O53 A;  3KI9 A;  4C99 A;  4X3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...