3D7HA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcibzl, a urea-based inhibitor
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 269
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7hA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7hA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7hA02
1ELLP 3KZWA 2VL1A 4ZY2A 1OBRA 2G9DA 4YWYA 3L2NA 2EK9A 4RUHA 4IK2A 3FF3A 1UWYA 2PJ5A 3D7GA 1AMPA 4NGPA 3V7ZA 1QQ9A 3D67A 4TJXA 3PBBA 4B6ZA 4A94A 3S9NA 4JZ0A 2AFXA 4A38A 3GB0A 2C6CA 4DUKA 2ABZA 3FEEA 4DJLA 3B2YA 5HXDA 1F57A 2OR4A 3H8EA 1CBXA 4R7MA 3SJGA 1DE4C 4LQGA 1DTDA 5K8MA 1BAVA 2ZELA 4OC4A 2GREA 3CT9A 1ZG8A 3WC7A 3BXMA 5D8NA 1FT7A 1KWMA 3SJXA 3IFEA 1XRYA 1LANA 4PQAA 4C99A 2EK8A 4MCPA 1R43A 3HLPA 3I6SA 4EFDA 4ZY1A 1ARMA 5J1QA 3BI1A 3NA6A 4ZX8A 5CPAA 1BPMA 3GUXA 4NGSA 4OIDA 4IHMA 3PBEA 1XBUA 1IY7A 3D7FA 2I3CA 4F8ZA 2OOTA 5LRJA 4MHZA 3GLJA 3LWUA 4FWUA 4MHYA 5HVGA 2PE3A 1CP6A 4R8FA 1GYTA 2DEAA 1YW4A 3N5FA 3K9TA 4P10A 1Q7LA 4UIBA 4PXDA 4P45A 8CPAA 1CG2A 1XFOA 5JGFA 3NFZA 4P4JA 5DS0A 4C9EA 3EIFA 3ISXA 4KSIA 1Z8LA 2AFOA 3PEIA 4UIAA 3KL9A 5F09A 2ZENA 1ZLHA 1XMBA 3IJ3A 1HDUA 1EE3P 2CTBA 2QVPA 3IIBA 1YLOA 2O4HA 4NGQA 4H2KA 2JBJA 4MCQA 3RBUA 2RB7A 4TWEA 1Y0RA 3D7HA 2JEWA 4PPZA 4UEEA 2POKA 5LRKA 2AFWA 3T8WA 5K8NA 4O23A 3PFOA 3ISZA 2HB6A 5K8OA 2ZEHA 2XEFA 3SI2A 3DLJA 3PRTA 3H8FA 2V77A 3PB4X 3KHZA 1NSAA 4NGNA 2XEJA 1Y9ZA 4ZY0A 1VIXA 4EWTA 4C85A 4CDKA 3VARA 2RFHA 3B35A 4C84A 4YU9A 1JQGA 4WWVA 1Z5RA 4PXEA 2QJ8A 4R76A 2CTCA 3B3WA 4C8TA 1XJOA 2PJ4A 4C8UA 4OIWA 2V8VA 1YW6A 3B3TA 1TXRA 4TJVA 1HEEA 3WC6A 2BO9A 2WZNA 5THWA 3RAMA 4R6TA 2C6GA 4C8PA 5D29A 3KQZA 1ZG9A 3PB9X 4OC2A 4UF4A 2ZOFA 3PB8X 3S9MA 3FX6A 2JBKA 3DGVA 5LYDA 3SI1A 5JM6A 4W9YA 4AXVA 4DYOA 4C86A 3V38A 2ZOGA 3SJEA 1QMUA 3HUVA 4ONWA 1TF8A 4OC1A 1ELMP 3D66A 4FBEA 2IMOA 2Q51A 1XF1A 4ZX9A 4C9UA 3D7DA 3NH5A 4Z65A 1YMEA 4NJRA 2PJ6A 2PJAA 4A39A 3KGQA 5LYFA 4JYWA 4BD9A 4YN3A 1LCPA 1WVMA 2NSMA 2PVWA 2ZEFA 3FMCA 4ZYQA 3B3VA 4X3RA 2GU2A 5IB9A 4OMEA 2BCOA 1TKFA 4PXCA 1M4LA 1CX8A 3I1UA 1ZG7A 2V8GA 1FNOA 3IC1A 2PJ8A 1ZLIA 3FEDA 1PCAA 3K2KA 3KR4A 4OKOA 2PCUA 1CPXA 4C9AA 3CPXA 2FVGA 3NH8A 3B3SA 5K8PA 5LYLA 2V8HA 2IJZA 2PIZA 1LAPA 2ZEPA 4F9UA 5I4MA 2ZEDA 1PYTB 4MXUA 3PB6X 4P4IA 1IGBA 3KI9A 2F8HA 3ICUA 5HVFA 3NH4A 4MCSA 2PJ0A 3I74A 1RTQA 4OC3A 1F2PA 3MRUA 3KR5A 2GLFA 3VH9A 4GM5A 2BOAA 2PJ9A 1Y7EA 4UEFA 2PJ7A 4FUUA 4ZI6A 4MHPA 4NGMA 3D4UA 1V6CA 1CP7A 2HC9A 2PJ1A 3JRUA 4IAVA 2C1CA 3FECA 2PIYA 3WC5A 1AYEA 4NGTA 1Z2LA 2QYVA 2XEGA 4C8FA 2PRQA 2ZEGA 4NGRA 2NYQA 4C8AA 2O53A 4KNGE 2AFUA 3IEHA 1R3NA 4EMEA 2PJ3A 3BHXA 4P44A 4X2TA 3LMSA 3SJFA 1HDQA 4FAIA 3FVLA 1VGYA 3B3CA 3KASA 3PFEA 3QNVA 3D68A 4MRIA 3IWWA 2ZEMA 3FH4A 4NFRA 3B7IA 4P4FA 3WABA 2AFZA 1ARLA 4OC0A 4P4EA 3H8GA 2AFMA 3MN8A 3CDXA 4K3NA 1LFWA 2IQ6A 3VATA 1YSJA 5HVHA 1LAMA 1VHOA 4CPAA 2EWBA 3IO1A 3S9LA 4NJQA 2WYRA 4C9RA 2CIJA 3CPAA 7CPAA 4OC5A 3FJUA 2Q4ZA 4Q7AA 4MHNA 4C9VA 3KQXA 4F9VA 3RZAA 2F7VA 2XEIA 3VTAA 4X8IA 5ELYA 5CBMA 2ANPA 3WT4A 4UEZA 2ZEOA 4C8CA 1F2OA 4MMOA 2PJ2A 2GLJA 6CPAA 2PJBA 2J9AA 2V8DA 2PVVA 1VHEA 2ZEEA 4P4DA 4G1PA 3TC8A 5JH9A 4TNUA 1H8LA 2PJCA 4WJBA 5LRGA 3PB7X 4P6YA 3SI0A 5LYIA 4P4BA 1TKHA 4MCRA 1TF9A 3KHXA 1LOKA 4PXBA 3TX8A 1BLLE 2Q43A 1BPNA 1Y0YA 4A37A 2AFSA 2C6PA 1TKJA 3BI0A 2CF4A 4OP4A 4CDJA 1CPSA
chains in the Genus database with same CATH superfamily
1ELLP 2PQ8A 2DPSA 1XIXA 1ZO0A 2VL1A 3KZWA 2DXQA 2QECA 1BO4A 3JTKA 4ZY2A 1XEBA 1OBRA 2G9DA 4YWYA 3L2NA 2EK9A 2PR1A 4RUHA 2AE6A 4IK2A 3FF3A 1V0CA 1UWYA 4NF1A 2PJ5A 3D7GA 1AMPA 4GPLB 1XMTA 3VRRA 4NGPA 2YNDA 1NBWA 3QB8A 3ZJ0A 4CYOA 5G21A 3V7ZA 1CJWA 2R8VA 1QQ9A 4JD6A 1GHEA 1M4DA 2B4JC 3D3SA 1ZRSA 3D67A 3TLBA 4TJXA 3PBBA 4B6ZA 5BWAB 4A94A 3S9NA 4MI4A 2AFXA 4JZ0A 4A38A 2JLMA 3DR6A 3GB0A 3VRPA 2GE3A 4MJ8A 4B5OA 2C6CA 3R1KA 1K4JA 3CXPA 4DUKA 4CZ1A 2N3AB 1T36B 2ABZA 3B8GA 5GCNA 3DNSA 3ZNIA 4BPUB 3FEEA 1YLEA 2VXKA 4DJLA 3DDDA 3PZJA 3B2YA 5HXDA 3T07A 1F57A 2OR4A 3W6SA 3H8EA 1IYLA 1CBXA 3U1BA 1QSNA 5G1ZA 4EVYA 4R7MA 3SJGA 2ZW4A 4M6IA 5H84A 1DE4C 4LQGA 2YNCA 3I9SA 1DTDA 3DR8A 4A95A 2YGWA 3HPHE 4FD5A 5K8MA 2PDOA 3A9LA 1BAVA 4CYPA 2ZELA 5AG5A 4OC4A 2FCKA 2GREA 5F49A 4C2ZA 4JVOA 3TLGB 3CT9A 1ZG8A 2Q04A 1EZBA 1BOBA 5F47A 3BUWB 3BXMA 3WC7A 2XPNA 4OAEA 5D8NA 2BSWA 1KUVA 4R9MA 4CAFA 3TLAA 1FT7A 3GYAA 5BY0A 3SJXA 1KWMA 3IFEA 4GS4A 2ZW7A 1XRYA 5KTCA 3NFQA 1LANA 2H5MA 4KLVA 2Z3OA 2I00A 4PQAA 2EUIA 3EZBA 3S6HA 2EBJA 4C99A 2YJVA 1CM0A 2EK8A 4NSQA 3MGDA 1YVHA 4MCPA 1R43A 2Y1MA 2CNTA 3HLPA 1M4GA 3I6SA 1LRZA 1S7NA 2UV8G 4BPXB 4EFDA 2B3VA 3PGPA 4MFPA 2YNEA 4ZY1A 1ARMA 4KVOE 5J1QA 4R3LA 5KTAA 3BI1A 3C8OA 2PCNA 2C5QA 3NA6A 1B87A 4ZX8A 5CPAA 4CGLA 2AUNA 4CS0B 2MP0A 1BPMA 3GUXA 3EXNA 4KSAA 2DIKA 1VBGA 4B5PB 4NGSA 4OIDA 3TO9A 5F46A 2HV2A 2OZGA 3D8PA 3LD2A 3PBEA 4IHMA 4LX9A 1NSLA 2Q7BA 2QIRA 4PK2A 4KOWA 5FVJA 1S7KA 1XBUA 1IY7A 3D7FA 2I3CA 4A2ZA 5J8FA 5J3XA 4F8ZA 4UWJA 2OOTA 4CRYB 3CZXA 3G3SA 5LRJA 4C7HA 3BUNB 4MHZA 5IR2A 2ZW5A 3GLJA 3LWUA 4UA3A 2WSAA 5DWNA 1J4JA 4FWUA 4MHYA 2PE3A 5HVGA 2X0SA 1KEEB 4IF5A 1CP6A 4R8FA 1GYTA 1IB1E 3OB2B 1S3ZA 2DEAA 4CYQA 2Z3LA 1YW4A 3N5FA 3K9TA 4P10A 1Q7LA 4UIBA 4IIXA 4PXDA 2XPOA 1Z8WA 4MHDA 4B14A 4P45A 3NE7A 1YVOA 2RC4A 4AVBA 2OZUA 2VKZG 4IUSA 3TT2A 1WJTA 4KS9A 2J8NA 1CG2A 2ZPAA 3N7ZA 1XFOA 3HPGG 4FD4A 4KLWA 8CPAA 2FT0A 4YRHA 4RN7A 5JGFA 3C26A 4P4JA 1Q2CA 3NFZA 4R87A 5DS0A 3S6KA 4C9EA 1S60A 3EIFA 3ISXA 4KSIA 2P6FA 1Z8LA 1WWZA 2AFOA 2BL1A 3PEIA 4UBRA 4XPDB 5HH1A 1R61A 4UIAA 1JDEA 3BUMB 3PFVA 3KL9A 2D0OA 5F09A 2ZENA 4B5PA 1ZLHA 1XMBA 3IJ3A 1HDUA 1EE3P 2CTBA 2QVPA 4BTFA 3EO4A 2GANA 4K30A 4PV6A 4CGPA 1J3LA 2YJTA 3IIBA 3QAHA 1YLOA 4MJXA 2O4HA 2P0WA 4NGQA 4H2KA 2JBJA 4MCQA 3RBUA 3R9EA 2OLSA 2RB7A 4TWEA 1Y0RA 2R7HA 3D7HA 2JEWA 2WPWA 3TLGA 4PPZA 4UEEA 3RO0A 2POKA 2VI7A 2CNSA 2OH1A 4UCNA 2AFWA 2WUUA 3T8WA 5LRKA 5K8NA 4AVCA 5HKYA 4O23A 3PFOA 4CGOA 2Q4VA 3FRMA 3ISZA 1Y9WA 2JDDA 2Z3NA 2QMLA 2HB6A 5K8OA 2D0PA 2ZEHA 2XEFA 1XE4A 4C68A 1MJAA 4H89A 5EBVA 3SI2A 4QUSA 3DLJA 3FXTA 3PRTA 4R57A 3H8FA 2V77A 4A33A 4RI1A 4A4BA 4ZBGA 4C2YA 3PB4X 2CXAA 3KHZA 1NSAA 4NGNA 2XEJA 1Z9EA 4RR2B 4HKFA 4KOTA 1VIXA 4ZY0A 4EWTA 1Y9ZA 4C85A 2ARHA 4Q38A 5JM6A 3UY5A 3T90A 1M1DA 4CDKA 3VARA 1I21A 2DF5A 4H1HA 1I1DA 2RFHA 2CY2A 4JLYA 4XPKA 4JWPA 3B35A 3IU1A 3K9UA 4C2XA 3NOJA 5FD8A 4C84A 3G23A 4YU9A 2ZW6A 4Y49B 1JQGA 2PSWA 5A28A 4WWVA 3HMJG 3FBUA 1Z5RA 4PXEA 2QJ8A 4R76A 3VRNA 2CTCA 3B3WA 4MBUA 4QVTA 4MI1A 4C8TA 1XJOA 2PJ4A 4C8UA 3LACA 2ODFA 3SHPA 3FNCA 5AXIA 2V8VA 4OIWA 4E8OA 1MK4A 1YW6A 3GKRA 4BBHA 4COGA 3B3TA 2CBLA 1M4IA 1TXRA 3FYNA 3SXNA 3OP0A 4TJVA 2HQYA 2HWGA 4CYNA 1HEEA 2J8RA 4KOSA 4Q36A 2A4NA 3OB1B 3WC6A 5ISVA 4E94A 2BO9A 1Q5XA 2FIAA 2WZNA 2O28A 5THWA 3RAMA 4R6TA 5JQ4A 2C6GA 4C8PA 4M6GA 5D29A 3KKWA 3KQZA 3R95A 2GP4A 2IL4A 2GFQA 2R98A 5F9MA 3TFYA 3BJ8A 3TYXA 4B10A 1ZG9A 5JVLA 2D4PA 3PB9X 4OC2A 5EMIA 4UF4A 2ZOFA 3PB8X 3S9MA 2REFA 2JBKA 3DGVA 2K5TA 2FL4A 2B4BA 2Z10A 3CXSA 3FX6A 4KUBA 4L8AA 4W9YA 4MFQA 4UFVA 5LYDA 3SI1A 2D4OA 3RNZA 4AXVA 1Z4RA 1AUGA 2JDCA 2Q0YA 5H86A 3V38A 4C86A 2ZOGA 4OADA 3SJEA 2Q44A 1QMUA 1FY7A 2OZHA 2Z11A 4F0YA 1TIQA 3HUVA 4ONWA 1TF8A 4QC6A 4OC1A 1PU9A 1ELMP 4MFZA 1PUAA 4J3GA 1XOVA 3D66A 4FBEA 2IMOA 1QSOA 2Q51A 3TO7A 1VBHA 1XF1A 2EZCA 3VGOA 1NE9A 4ZX9A 5IV0A 4MFJA 4C9UA 2HROA 4HPSA 1C30B 5G20A 3T9YA 1EO0A 4KOVA 3D7DA 1S7FA 3NH5A 4KVXA 4E0AA 4Z65A 4COBA 2NMTA 1YMEA 4A4CA 4NJRA 4OLLA 2PJ6A 4HNWB 2PJAA 4A39A 4KSFA 3KGQA 5LYFA 1C3OB 1A2ZA 2Z3KA 4EYSA 1B6BA 4DYOA 4FD6A 4JYWA 1NMTA 4BD9A 4YN3A 5F1YA 1LCPA 4QBJA 1WVMA 2NSMA 3JUWA 5AG6A 4BMHA 2PVWA 2ZEFA 4ONUA 4II9A 3TO6A 3FMCA 3WR7A 5HKZA 1KUXA 1Y9KA 2B3UA 3B3VA 4X3RA 1ON0A 2GU2A 4OMEA 4ZYQA 5IB9A 2BCOA 2FSRA 1TKFA 4PXCA 2FM4A 1M4LA 2G3TA 1CX8A 3I1UA 4RS2A 5E96A 2EZBA 1ZG7A 2V8GA 1FNOA 3IC1A 2G3AA 2PJ8A 1ZLIA 3FEDA 1PCAA 5AGEA 3K2KA 4KUAA 4L89A 1P4NA 4Y49C 3KR4A 5HMNA 4OKOA 1RXTA 3R9GA 2PCUA 1CPXA 4C9AA 3CPXA 3O8ZA 1Z8XA 2FVGA 2OU2A 3FIXA 3NH8A 2Y0MA 5A27A 2Y1NA 3B3SA 5K8PA 4UWIA 5LYLA 3U88C 2J8MA 4PK3A 4F6AA 2V8HA 2B4DB 5C82A 2IJZA 2PIZA 1LAPA 2ZEPA 1YR0A 3VWEA 2ZEDA 4F9UA 1PYTB 3TOBA 4A31A 5I4MA 2GIVA 3PB6X 4MXUA 1YVKA 4P4IA 1IGBA 3KI9A 1UFHA 2F8HA 4M85A 1EZAA 1FBVA 4ZGYB 3ICUA 2Q4YA 5HVFA 4PSXA 3NH4A 4MCSA 2PJ0A 3I74A 3F9KC 5C88A 1RTQA 4OC3A 2VZZA 1F2PA 3KRVA 3R96A 3RYOA 3MRUA 1R57A 3KR5A 5IB0A 2HI6A 2HUZA 1IU8A 4X5KA 4QB9A 2GLFA 1Q2DA 1U6MA 4UFXA 3VH9A 4IIYA 4I49A 4NCZA 4GM5A 3BLNA 3TOAA 2BOAA 2PJ9A 3PLFB 1I12A 3JVNA 1Y7EA 3IGRA 3ZZIA 1MJ9A 1RO5A 3SR3A 4UEFA 2PJ7A 4H6ZA 4HNYB 3TE4A 4MFKA 5JPHA 1VHSA 4U9YA 4FUUA 3BJ7A 4HNXB 1Z9UA 4ZI6A 4MHPA 4NGMA 3D4UA 4JXRA 4CGNA 4AG7A 1V6CA 1CP7A 2HC9A 2PJ1A 1JDBC 4LQ6A 4A30A 5AG7A 3JRUA 4IAVA 4AB7A 1IIDA 1BXRB 2C1CA 1MJBA 3FECA 4BPWB 2ZXVA 2PIYA 3CXQA 4FD7A 3WC5A 1AYEA 2FXFA 4NGTA 1Z2LA 3H5ZA 5K99A 3IWGA 2QYVA 2XEGA 3P2HA 4MY0A 2DLAA 1A9XB 2B0AA 2PRQA 3EY5A 4C8FA 2BEIA 5CNPA 2ZEGA 1B47A 2DPTA 2Z3PA 4NGRA 2NYQA 2F5IA 1SQHA 5G22A 4M6HA 4C8AA 3IWEA 3K4IA 1CS0B 1X12A 4INJA 4MFLA 1JWQA 2O53A 3EFAA 4KNGE 1QSMA 2YNCC 2B4DA 4NEXA 2AFUA 3IEHA 3T5MA 1L0CA 1R3NA 3F0AA 4YFJA 4EMEA 3T0TA 2PJ3A 3BHXA 4P44A 2VZYA 4U9ZA 4X2TA 3VWDA 5JYBA 2Z0ZA 2X7BA 3LMSA 3SJFA 1HDQA 1ZYMA 2AJ6A 3FVLA 1VGYA 4FAIA 4E5SA 1YK3A 3KASA 2XPPA 2P6EA 3B3CA 3G8WA 3PFEA 3P2FA 3QNVA 5AG4A 3T05A 3D68A 3V8IA 2EVNA 1YQEA 4MRIA 3IWWA 2ZEMA 3FH4A 4NFRA 4R3KA 2XPLA 4KVME 3B7IA 4P4FA 4UFWA 4U5YA 4XNHC 3WABA 2AFZA 3TLYA 4OC0A 1ARLA 4J0NA 4P4EA 3H8GA 2AFMA 1QSTA 5KTDA 2VQYA 4NXYA 2R82A 2WPXA 3FB3A 3MN8A 2BUEA 1M6VB 3CDXA 4K3NA 1LFWA 2IQ6A 3VATA 4B13A 1YSJA 5HVHA 5F48A 1LAMA 1VHOA 4CPAA 4BINA 2EWBA 2PR8A 4B12A 1OZPA 3IO1A 3F5BA 3S9LA 3IU2A 4NJQA 2WYRA 5DWMA 3OAKA 4KOYA 4XPLA 5F5XA 4C9RA 2Q7SA 3H4QA 2CIJA 1S7LA 3CPAA 3GY9A 7CPAA 4OC5A 3FJUA 2Q4ZA 5F13A 4Q7AA 4JXQA 2I79A 4CAXA 3DSBA 2B58A 3F8KA 4MHNA 3GJZA 3KQXA 4F9VA 4C9VA 3RZAA 1KZFA 2C27A 2F7VA 2XEIA 1YGHA 1KUYA 4CAEA 4LUAA 1XF8A 1YX0A 2B5GA 2CNMA 1P0HA 3VTAA 4KZTA 3GIUA 4X8IA 4UCMA 5ELYA 2B5GB 3TCVA 4DNCA 2ANPA 1Z8TA 3WT4A 5CBMA 1NXJA 4UEZA 5I0CA 2ZEOA 3EC4A 3W91A 3BUOB 2EO8A 2Z3MA 4C8CA 4PSWA 2OB0A 1F2OA 4MMOA 3TLCA 2PJ2A 4CAVA 1X10A 2GLJA 1IICA 1Z4EA 1CE8B 6CPAA 2EZAA 2PJBA 2P6GA 4CAWA 4CRZB 3TTHA 2J9AA 2JEVA 1WK4A 1M44A 4M3SA 4UCPA 1IOIA 2V8DA 4CGMA 2PVVA 1VHEA 1Q2YA 1VI4A 2ZEEA 1KBLA 1KC7A 4P4DA 4G1PA 2KCWA 3D2MA 3TC8A 5JH9A 4TNUA 4JJXA 1H8LA 4CO9A 2PJCA 4XPDC 4WJBA 3TLZA 1VKCA 5HKWA 2AUMA 5LRGA 3PB7X 4P6YA 3SI0A 4AG9A 3S6FA 5LYIA 3TLEA 4P4BA 1TKHA 4KOUA 2FS5A 3S6GA 3SXOA 4MCRA 1TF9A 3W6XA 3KHXA 3BUXB 4KORA 1IYKA 3PP9A 1LOKA 1DIKA 5IX3A 3LODA 2PC1A 4GXHA 4PXBA 3OWCA 3TX8A 1Y7RA 4A32A 2E28A 2R1IA 1BLLE 4YGOA 3D2PA 2FIWA 2FE7A 1N71A 2Q43A 4H6UA 4AVAA 1BPNA 1ZL0A 4XNHB 3EZEA 3VRQA 5J8CA 1Y0YA 3NE8A 2VEZA 1YREA 4A37A 4F0XA 4C7IA 4M8DA 4B11A 2REEA 2AFSA 2ATRA 3I3GA 1GGOA 2C6PA 3E0KA 1TKJA 4MY3A 3BI0A 3QAYA 2CF4A 5EC4A 4OP4A 2PRBA 1QSRA 4E2AA 3EZAA 1S5KA 3R9FA 4KOXA 3PT1A 4ORFA 3VROA 2G0BA 2VBQA 4CDJA 1CPSA 1IOFA
chains in the Genus database with same CATH topology
1ELLP 3KZWA 2VL1A 4ZY2A 1OBRA 2G9DA 4YWYA 3L2NA 2EK9A 4RUHA 4IK2A 3FF3A 1UWYA 2PJ5A 3D7GA 1AMPA 4NGPA 3V7ZA 1QQ9A 3D67A 4TJXA 3PBBA 4B6ZA 4A94A 3S9NA 4JZ0A 2AFXA 4A38A 3GB0A 2C6CA 4DUKA 2ABZA 3FEEA 4DJLA 3B2YA 5HXDA 1F57A 2OR4A 3H8EA 1CBXA 4R7MA 3SJGA 1DE4C 4LQGA 1DTDA 5K8MA 1BAVA 2ZELA 4OC4A 2GREA 3CT9A 1ZG8A 3WC7A 3BXMA 5D8NA 1FT7A 1KWMA 3SJXA 3IFEA 1XRYA 1LANA 4PQAA 4C99A 2EK8A 4MCPA 1R43A 3HLPA 3I6SA 4EFDA 4ZY1A 1ARMA 5J1QA 3BI1A 2C5QA 3NA6A 4ZX8A 5CPAA 1BPMA 3GUXA 4NGSA 4OIDA 4IHMA 3PBEA 1XBUA 1IY7A 3D7FA 2I3CA 4F8ZA 2OOTA 5LRJA 5IR2A 4MHZA 3GLJA 3LWUA 4FWUA 4MHYA 5HVGA 2PE3A 1CP6A 4R8FA 1GYTA 2DEAA 1YW4A 3N5FA 3K9TA 4P10A 1Q7LA 4UIBA 4PXDA 4P45A 8CPAA 1CG2A 1XFOA 5JGFA 3NFZA 4P4JA 5DS0A 4C9EA 3EIFA 3ISXA 4KSIA 1Z8LA 2AFOA 3PEIA 4UIAA 3KL9A 5F09A 2ZENA 1ZLHA 1XMBA 3IJ3A 1HDUA 1EE3P 2CTBA 2QVPA 3IIBA 1YLOA 2O4HA 4NGQA 4H2KA 2JBJA 4MCQA 3RBUA 2RB7A 4TWEA 1Y0RA 3D7HA 2JEWA 4PPZA 4UEEA 2POKA 5LRKA 2AFWA 3T8WA 5K8NA 4O23A 3PFOA 3ISZA 2HB6A 5K8OA 2ZEHA 2XEFA 3SI2A 3DLJA 3PRTA 3H8FA 2V77A 3PB4X 3KHZA 1NSAA 4NGNA 2XEJA 1Y9ZA 4ZY0A 1VIXA 4EWTA 4C85A 4CDKA 3VARA 2RFHA 3B35A 4C84A 4YU9A 1JQGA 4WWVA 1Z5RA 4PXEA 2QJ8A 4R76A 2CTCA 3B3WA 4C8TA 1XJOA 2PJ4A 4C8UA 4OIWA 2V8VA 1YW6A 3B3TA 1TXRA 4TJVA 1HEEA 3WC6A 2BO9A 2WZNA 5THWA 3RAMA 4R6TA 2C6GA 4C8PA 5D29A 3KQZA 2GP4A 1ZG9A 3PB9X 4OC2A 4UF4A 2ZOFA 3PB8X 3S9MA 3FX6A 2JBKA 3DGVA 5LYDA 3SI1A 5JM6A 4W9YA 4AXVA 4DYOA 4C86A 3V38A 2ZOGA 3SJEA 1QMUA 3HUVA 4ONWA 1TF8A 4OC1A 1ELMP 3D66A 4FBEA 2IMOA 2Q51A 1XF1A 4ZX9A 4C9UA 3D7DA 3NH5A 4Z65A 1YMEA 4NJRA 2PJ6A 2PJAA 4A39A 3KGQA 5LYFA 4JYWA 4BD9A 4YN3A 1LCPA 1WVMA 2NSMA 2PVWA 2ZEFA 3FMCA 4ZYQA 3B3VA 4X3RA 2GU2A 5IB9A 4OMEA 2BCOA 1TKFA 4PXCA 1M4LA 1CX8A 3I1UA 1ZG7A 2V8GA 1FNOA 3IC1A 2PJ8A 1ZLIA 3FEDA 1PCAA 3K2KA 3KR4A 4OKOA 2PCUA 1CPXA 4C9AA 3CPXA 2FVGA 3NH8A 3B3SA 5K8PA 5LYLA 2V8HA 2IJZA 2PIZA 1LAPA 2ZEPA 4F9UA 5I4MA 2ZEDA 1PYTB 4MXUA 3PB6X 4P4IA 1IGBA 3KI9A 2F8HA 3ICUA 5HVFA 3NH4A 4MCSA 2PJ0A 3I74A 1RTQA 4OC3A 1F2PA 3MRUA 3KR5A 2GLFA 3VH9A 4GM5A 2BOAA 2PJ9A 1Y7EA 4UEFA 2PJ7A 4FUUA 4ZI6A 4MHPA 4NGMA 3D4UA 1V6CA 1CP7A 2HC9A 2PJ1A 3JRUA 4IAVA 2C1CA 3FECA 2PIYA 3WC5A 1AYEA 4NGTA 1Z2LA 2QYVA 2XEGA 4C8FA 2PRQA 2ZEGA 4NGRA 2NYQA 4C8AA 2O53A 4KNGE 2AFUA 3IEHA 1R3NA 4EMEA 2PJ3A 3BHXA 4P44A 4X2TA 3LMSA 3SJFA 1HDQA 4FAIA 3FVLA 1VGYA 3B3CA 3KASA 3PFEA 3QNVA 3D68A 4MRIA 3IWWA 2ZEMA 3FH4A 4NFRA 3B7IA 4P4FA 3WABA 2AFZA 1ARLA 4OC0A 4P4EA 3H8GA 2AFMA 3MN8A 3CDXA 4K3NA 1LFWA 2IQ6A 3VATA 1YSJA 5HVHA 1LAMA 1VHOA 4CPAA 2EWBA 3IO1A 3S9LA 4NJQA 2WYRA 4C9RA 2CIJA 3CPAA 7CPAA 4OC5A 3FJUA 2Q4ZA 4Q7AA 4MHNA 4C9VA 3KQXA 4F9VA 3RZAA 2F7VA 2XEIA 3VTAA 4X8IA 5ELYA 5CBMA 2ANPA 3WT4A 4UEZA 2ZEOA 4C8CA 1F2OA 4MMOA 2PJ2A 2GLJA 6CPAA 2PJBA 2J9AA 2V8DA 2PVVA 1VHEA 2ZEEA 4P4DA 4G1PA 3TC8A 5JH9A 4TNUA 1H8LA 2PJCA 4WJBA 5LRGA 3PB7X 4P6YA 3SI0A 5LYIA 4P4BA 1TKHA 4MCRA 1TF9A 3KHXA 1LOKA 4PXBA 3TX8A 1BLLE 2Q43A 1BPNA 1Y0YA 4A37A 2AFSA 2C6PA 1TKJA 3BI0A 2CF4A 4OP4A 4CDJA 1CPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELL P;  3KZW A;  2VL1 A;  4ZY2 A;  1OBR A;  2G9D A;  4YWY A;  3L2N A;  2EK9 A;  4RUH A;  4IK2 A;  3FF3 A;  1UWY A;  2PJ5 A;  3D7G A;  1AMP A;  4NGP A;  3V7Z A;  1QQ9 A;  3D67 A;  4TJX A;  3PBB A;  4B6Z A;  4A94 A;  3S9N A;  4JZ0 A;  2AFX A;  4A38 A;  3GB0 A;  2C6C A;  4DUK A;  2ABZ A;  3FEE A;  4DJL A;  3B2Y A;  5HXD A;  1F57 A;  2OR4 A;  3H8E A;  1CBX A;  4R7M A;  3SJG A;  1DE4 C;  4LQG A;  1DTD A;  5K8M A;  1BAV A;  2ZEL A;  4OC4 A;  2GRE A;  3CT9 A;  1ZG8 A;  3WC7 A;  3BXM A;  5D8N A;  1FT7 A;  1KWM A;  3SJX A;  3IFE A;  1XRY A;  1LAN A;  4PQA A;  4C99 A;  2EK8 A;  4MCP A;  1R43 A;  3HLP A;  3I6S A;  4EFD A;  4ZY1 A;  1ARM A;  5J1Q A;  3BI1 A;  3NA6 A;  4ZX8 A;  5CPA A;  1BPM A;  3GUX A;  4NGS A;  4OID A;  4IHM A;  3PBE A;  1XBU A;  1IY7 A;  3D7F A;  2I3C A;  4F8Z A;  2OOT A;  5LRJ A;  4MHZ A;  3GLJ A;  3LWU A;  4FWU A;  4MHY A;  5HVG A;  2PE3 A;  1CP6 A;  4R8F A;  1GYT A;  2DEA A;  1YW4 A;  3N5F A;  3K9T A;  4P10 A;  1Q7L A;  4UIB A;  4PXD A;  4P45 A;  8CPA A;  1CG2 A;  1XFO A;  5JGF A;  3NFZ A;  4P4J A;  5DS0 A;  4C9E A;  3EIF A;  3ISX A;  4KSI A;  1Z8L A;  2AFO A;  3PEI A;  4UIA A;  3KL9 A;  5F09 A;  2ZEN A;  1ZLH A;  1XMB A;  3IJ3 A;  1HDU A;  1EE3 P;  2CTB A;  2QVP A;  3IIB A;  1YLO A;  2O4H A;  4NGQ A;  4H2K A;  2JBJ A;  4MCQ A;  3RBU A;  2RB7 A;  4TWE A;  1Y0R A;  3D7H A;  2JEW A;  4PPZ A;  4UEE A;  2POK A;  5LRK A;  2AFW A;  3T8W A;  5K8N A;  4O23 A;  3PFO A;  3ISZ A;  2HB6 A;  5K8O A;  2ZEH A;  2XEF A;  3SI2 A;  3DLJ A;  3PRT A;  3H8F A;  2V77 A;  3PB4 X;  3KHZ A;  1NSA A;  4NGN A;  2XEJ A;  1Y9Z A;  4ZY0 A;  1VIX A;  4EWT A;  4C85 A;  4CDK A;  3VAR A;  2RFH A;  3B35 A;  4C84 A;  4YU9 A;  1JQG A;  4WWV A;  1Z5R A;  4PXE A;  2QJ8 A;  4R76 A;  2CTC A;  3B3W A;  4C8T A;  1XJO A;  2PJ4 A;  4C8U A;  4OIW A;  2V8V A;  1YW6 A;  3B3T A;  1TXR A;  4TJV A;  1HEE A;  3WC6 A;  2BO9 A;  2WZN A;  5THW A;  3RAM A;  4R6T A;  2C6G A;  4C8P A;  5D29 A;  3KQZ A;  1ZG9 A;  3PB9 X;  4OC2 A;  4UF4 A;  2ZOF A;  3PB8 X;  3S9M A;  3FX6 A;  2JBK A;  3DGV A;  5LYD A;  3SI1 A;  5JM6 A;  4W9Y A;  4AXV A;  4DYO A;  4C86 A;  3V38 A;  2ZOG A;  3SJE A;  1QMU A;  3HUV A;  4ONW A;  1TF8 A;  4OC1 A;  1ELM P;  3D66 A;  4FBE A;  2IMO A;  2Q51 A;  1XF1 A;  4ZX9 A;  4C9U A;  3D7D A;  3NH5 A;  4Z65 A;  1YME A;  4NJR A;  2PJ6 A;  2PJA A;  4A39 A;  3KGQ A;  5LYF A;  4JYW A;  4BD9 A;  4YN3 A;  1LCP A;  1WVM A;  2NSM A;  2PVW A;  2ZEF A;  3FMC A;  4ZYQ A;  3B3V A;  4X3R A;  2GU2 A;  5IB9 A;  4OME A;  2BCO A;  1TKF A;  4PXC A;  1M4L A;  1CX8 A;  3I1U A;  1ZG7 A;  2V8G A;  1FNO A;  3IC1 A;  2PJ8 A;  1ZLI A;  3FED A;  1PCA A;  3K2K A;  3KR4 A;  4OKO A;  2PCU A;  1CPX A;  4C9A A;  3CPX A;  2FVG A;  3NH8 A;  3B3S A;  5K8P A;  5LYL A;  2V8H A;  2IJZ A;  2PIZ A;  1LAP A;  2ZEP A;  4F9U A;  5I4M A;  2ZED A;  1PYT B;  4MXU A;  3PB6 X;  4P4I A;  1IGB A;  3KI9 A;  2F8H A;  3ICU A;  5HVF A;  3NH4 A;  4MCS A;  2PJ0 A;  3I74 A;  1RTQ A;  4OC3 A;  1F2P A;  3MRU A;  3KR5 A;  2GLF A;  3VH9 A;  4GM5 A;  2BOA A;  2PJ9 A;  1Y7E A;  4UEF A;  2PJ7 A;  4FUU A;  4ZI6 A;  4MHP A;  4NGM A;  3D4U A;  1V6C A;  1CP7 A;  2HC9 A;  2PJ1 A;  3JRU A;  4IAV A;  2C1C A;  3FEC A;  2PIY A;  3WC5 A;  1AYE A;  4NGT A;  1Z2L A;  2QYV A;  2XEG A;  4C8F A;  2PRQ A;  2ZEG A;  4NGR A;  2NYQ A;  4C8A A;  2O53 A;  4KNG E;  2AFU A;  3IEH A;  1R3N A;  4EME A;  2PJ3 A;  3BHX A;  4P44 A;  4X2T A;  3LMS A;  3SJF A;  1HDQ A;  4FAI A;  3FVL A;  1VGY A;  3B3C A;  3KAS A;  3PFE A;  3QNV A;  3D68 A;  4MRI A;  3IWW A;  2ZEM A;  3FH4 A;  4NFR A;  3B7I A;  4P4F A;  3WAB A;  2AFZ A;  1ARL A;  4OC0 A;  4P4E A;  3H8G A;  2AFM A;  3MN8 A;  3CDX A;  4K3N A;  1LFW A;  2IQ6 A;  3VAT A;  1YSJ A;  5HVH A;  1LAM A;  1VHO A;  4CPA A;  2EWB A;  3IO1 A;  3S9L A;  4NJQ A;  2WYR A;  4C9R A;  2CIJ A;  3CPA A;  7CPA A;  4OC5 A;  3FJU A;  2Q4Z A;  4Q7A A;  4MHN A;  4C9V A;  3KQX A;  4F9V A;  3RZA A;  2F7V A;  2XEI A;  3VTA A;  4X8I A;  5ELY A;  5CBM A;  2ANP A;  3WT4 A;  4UEZ A;  2ZEO A;  4C8C A;  1F2O A;  4MMO A;  2PJ2 A;  2GLJ A;  6CPA A;  2PJB A;  2J9A A;  2V8D A;  2PVV A;  1VHE A;  2ZEE A;  4P4D A;  4G1P A;  3TC8 A;  5JH9 A;  4TNU A;  1H8L A;  2PJC A;  4WJB A;  5LRG A;  3PB7 X;  4P6Y A;  3SI0 A;  5LYI A;  4P4B A;  1TKH A;  4MCR A;  1TF9 A;  3KHX A;  1LOK A;  4PXB A;  3TX8 A;  1BLL E;  2Q43 A;  1BPN A;  1Y0Y A;  4A37 A;  2AFS A;  2C6P A;  1TKJ A;  3BI0 A;  2CF4 A;  4OP4 A;  4CDJ A;  1CPS A; 
#chains in the Genus database with same CATH topology
 1ELL P;  2PQ8 A;  2DPS A;  1XIX A;  1ZO0 A;  2VL1 A;  3KZW A;  2DXQ A;  2QEC A;  1BO4 A;  3JTK A;  4ZY2 A;  1XEB A;  1OBR A;  2G9D A;  4YWY A;  3L2N A;  2EK9 A;  2PR1 A;  4RUH A;  2AE6 A;  4IK2 A;  3FF3 A;  1V0C A;  1UWY A;  4NF1 A;  2PJ5 A;  3D7G A;  1AMP A;  4GPL B;  1XMT A;  3VRR A;  4NGP A;  2YND A;  1NBW A;  3QB8 A;  3ZJ0 A;  4CYO A;  5G21 A;  3V7Z A;  1CJW A;  2R8V A;  1QQ9 A;  4JD6 A;  1GHE A;  1M4D A;  2B4J C;  3D3S A;  1ZRS A;  3D67 A;  3TLB A;  4TJX A;  3PBB A;  4B6Z A;  5BWA B;  4A94 A;  3S9N A;  4MI4 A;  2AFX A;  4JZ0 A;  4A38 A;  2JLM A;  3DR6 A;  3GB0 A;  3VRP A;  2GE3 A;  4MJ8 A;  4B5O A;  2C6C A;  3R1K A;  1K4J A;  3CXP A;  4DUK A;  4CZ1 A;  2N3A B;  1T36 B;  2ABZ A;  3B8G A;  5GCN A;  3DNS A;  3ZNI A;  4BPU B;  3FEE A;  1YLE A;  2VXK A;  4DJL A;  3DDD A;  3PZJ A;  3B2Y A;  5HXD A;  3T07 A;  1F57 A;  2OR4 A;  3W6S A;  3H8E A;  1IYL A;  1CBX A;  3U1B A;  1QSN A;  5G1Z A;  4EVY A;  4R7M A;  3SJG A;  2ZW4 A;  4M6I A;  5H84 A;  1DE4 C;  4LQG A;  2YNC A;  3I9S A;  1DTD A;  3DR8 A;  4A95 A;  2YGW A;  3HPH E;  4FD5 A;  5K8M A;  2PDO A;  3A9L A;  1BAV A;  4CYP A;  2ZEL A;  5AG5 A;  4OC4 A;  2FCK A;  2GRE A;  5F49 A;  4C2Z A;  4JVO A;  3TLG B;  3CT9 A;  1ZG8 A;  2Q04 A;  1EZB A;  1BOB A;  5F47 A;  3BUW B;  3BXM A;  3WC7 A;  2XPN A;  4OAE A;  5D8N A;  2BSW A;  1KUV A;  4R9M A;  4CAF A;  3TLA A;  1FT7 A;  3GYA A;  5BY0 A;  3SJX A;  1KWM A;  3IFE A;  4GS4 A;  2ZW7 A;  1XRY A;  5KTC A;  3NFQ A;  1LAN A;  2H5M A;  4KLV A;  2Z3O A;  2I00 A;  4PQA A;  2EUI A;  3EZB A;  3S6H A;  2EBJ A;  4C99 A;  2YJV A;  1CM0 A;  2EK8 A;  4NSQ A;  3MGD A;  1YVH A;  4MCP A;  1R43 A;  2Y1M A;  2CNT A;  3HLP A;  1M4G A;  3I6S A;  1LRZ A;  1S7N A;  2UV8 G;  4BPX B;  4EFD A;  2B3V A;  3PGP A;  4MFP A;  2YNE A;  4ZY1 A;  1ARM A;  4KVO E;  5J1Q A;  4R3L A;  5KTA A;  3BI1 A;  3C8O A;  2PCN A;  2C5Q A;  3NA6 A;  1B87 A;  4ZX8 A;  5CPA A;  4CGL A;  2AUN A;  4CS0 B;  2MP0 A;  1BPM A;  3GUX A;  3EXN A;  4KSA A;  2DIK A;  1VBG A;  4B5P B;  4NGS A;  4OID A;  3TO9 A;  5F46 A;  2HV2 A;  2OZG A;  3D8P A;  3LD2 A;  3PBE A;  4IHM A;  4LX9 A;  1NSL A;  2Q7B A;  2QIR A;  4PK2 A;  4KOW A;  5FVJ A;  1S7K A;  1XBU A;  1IY7 A;  3D7F A;  2I3C A;  4A2Z A;  5J8F A;  5J3X A;  4F8Z A;  4UWJ A;  2OOT A;  4CRY B;  3CZX A;  3G3S A;  5LRJ A;  4C7H A;  3BUN B;  4MHZ A;  5IR2 A;  2ZW5 A;  3GLJ A;  3LWU A;  4UA3 A;  2WSA A;  5DWN A;  1J4J A;  4FWU A;  4MHY A;  2PE3 A;  5HVG A;  2X0S A;  1KEE B;  4IF5 A;  1CP6 A;  4R8F A;  1GYT A;  1IB1 E;  3OB2 B;  1S3Z A;  2DEA A;  4CYQ A;  2Z3L A;  1YW4 A;  3N5F A;  3K9T A;  4P10 A;  1Q7L A;  4UIB A;  4IIX A;  4PXD A;  2XPO A;  1Z8W A;  4MHD A;  4B14 A;  4P45 A;  3NE7 A;  1YVO A;  2RC4 A;  4AVB A;  2OZU A;  2VKZ G;  4IUS A;  3TT2 A;  1WJT A;  4KS9 A;  2J8N A;  1CG2 A;  2ZPA A;  3N7Z A;  1XFO A;  3HPG G;  4FD4 A;  4KLW A;  8CPA A;  2FT0 A;  4YRH A;  4RN7 A;  5JGF A;  3C26 A;  4P4J A;  1Q2C A;  3NFZ A;  4R87 A;  5DS0 A;  3S6K A;  4C9E A;  1S60 A;  3EIF A;  3ISX A;  4KSI A;  2P6F A;  1Z8L A;  1WWZ A;  2AFO A;  2BL1 A;  3PEI A;  4UBR A;  4XPD B;  5HH1 A;  1R61 A;  4UIA A;  1JDE A;  3BUM B;  3PFV A;  3KL9 A;  2D0O A;  5F09 A;  2ZEN A;  4B5P A;  1ZLH A;  1XMB A;  3IJ3 A;  1HDU A;  1EE3 P;  2CTB A;  2QVP A;  4BTF A;  3EO4 A;  2GAN A;  4K30 A;  4PV6 A;  4CGP A;  1J3L A;  2YJT A;  3IIB A;  3QAH A;  1YLO A;  4MJX A;  2O4H A;  2P0W A;  4NGQ A;  4H2K A;  2JBJ A;  4MCQ A;  3RBU A;  3R9E A;  2OLS A;  2RB7 A;  4TWE A;  1Y0R A;  2R7H A;  3D7H A;  2JEW A;  2WPW A;  3TLG A;  4PPZ A;  4UEE A;  3RO0 A;  2POK A;  2VI7 A;  2CNS A;  2OH1 A;  4UCN A;  2AFW A;  2WUU A;  3T8W A;  5LRK A;  5K8N A;  4AVC A;  5HKY A;  4O23 A;  3PFO A;  4CGO A;  2Q4V A;  3FRM A;  3ISZ A;  1Y9W A;  2JDD A;  2Z3N A;  2QML A;  2HB6 A;  5K8O A;  2D0P A;  2ZEH A;  2XEF A;  1XE4 A;  4C68 A;  1MJA A;  4H89 A;  5EBV A;  3SI2 A;  4QUS A;  3DLJ A;  3FXT A;  3PRT A;  4R57 A;  3H8F A;  2V77 A;  4A33 A;  4RI1 A;  4A4B A;  4ZBG A;  4C2Y A;  3PB4 X;  2CXA A;  3KHZ A;  1NSA A;  4NGN A;  2XEJ A;  1Z9E A;  4RR2 B;  4HKF A;  4KOT A;  1VIX A;  4ZY0 A;  4EWT A;  1Y9Z A;  4C85 A;  2ARH A;  4Q38 A;  5JM6 A;  3UY5 A;  3T90 A;  1M1D A;  4CDK A;  3VAR A;  1I21 A;  2DF5 A;  4H1H A;  1I1D A;  2RFH A;  2CY2 A;  4JLY A;  4XPK A;  4JWP A;  3B35 A;  3IU1 A;  3K9U A;  4C2X A;  3NOJ A;  5FD8 A;  4C84 A;  3G23 A;  4YU9 A;  2ZW6 A;  4Y49 B;  1JQG A;  2PSW A;  5A28 A;  4WWV A;  3HMJ G;  3FBU A;  1Z5R A;  4PXE A;  2QJ8 A;  4R76 A;  3VRN A;  2CTC A;  3B3W A;  4MBU A;  4QVT A;  4MI1 A;  4C8T A;  1XJO A;  2PJ4 A;  4C8U A;  3LAC A;  2ODF A;  3SHP A;  3FNC A;  5AXI A;  2V8V A;  4OIW A;  4E8O A;  1MK4 A;  1YW6 A;  3GKR A;  4BBH A;  4COG A;  3B3T A;  2CBL A;  1M4I A;  1TXR A;  3FYN A;  3SXN A;  3OP0 A;  4TJV A;  2HQY A;  2HWG A;  4CYN A;  1HEE A;  2J8R A;  4KOS A;  4Q36 A;  2A4N A;  3OB1 B;  3WC6 A;  5ISV A;  4E94 A;  2BO9 A;  1Q5X A;  2FIA A;  2WZN A;  2O28 A;  5THW A;  3RAM A;  4R6T A;  5JQ4 A;  2C6G A;  4C8P A;  4M6G A;  5D29 A;  3KKW A;  3KQZ A;  3R95 A;  2GP4 A;  2IL4 A;  2GFQ A;  2R98 A;  5F9M A;  3TFY A;  3BJ8 A;  3TYX A;  4B10 A;  1ZG9 A;  5JVL A;  2D4P A;  3PB9 X;  4OC2 A;  5EMI A;  4UF4 A;  2ZOF A;  3PB8 X;  3S9M A;  2REF A;  2JBK A;  3DGV A;  2K5T A;  2FL4 A;  2B4B A;  2Z10 A;  3CXS A;  3FX6 A;  4KUB A;  4L8A A;  4W9Y A;  4MFQ A;  4UFV A;  5LYD A;  3SI1 A;  2D4O A;  3RNZ A;  4AXV A;  1Z4R A;  1AUG A;  2JDC A;  2Q0Y A;  5H86 A;  3V38 A;  4C86 A;  2ZOG A;  4OAD A;  3SJE A;  2Q44 A;  1QMU A;  1FY7 A;  2OZH A;  2Z11 A;  4F0Y A;  1TIQ A;  3HUV A;  4ONW A;  1TF8 A;  4QC6 A;  4OC1 A;  1PU9 A;  1ELM P;  4MFZ A;  1PUA A;  4J3G A;  1XOV A;  3D66 A;  4FBE A;  2IMO A;  1QSO A;  2Q51 A;  3TO7 A;  1VBH A;  1XF1 A;  2EZC A;  3VGO A;  1NE9 A;  4ZX9 A;  5IV0 A;  4MFJ A;  4C9U A;  2HRO A;  4HPS A;  1C30 B;  5G20 A;  3T9Y A;  1EO0 A;  4KOV A;  3D7D A;  1S7F A;  3NH5 A;  4KVX A;  4E0A A;  4Z65 A;  4COB A;  2NMT A;  1YME A;  4A4C A;  4NJR A;  4OLL A;  2PJ6 A;  4HNW B;  2PJA A;  4A39 A;  4KSF A;  3KGQ A;  5LYF A;  1C3O B;  1A2Z A;  2Z3K A;  4EYS A;  1B6B A;  4DYO A;  4FD6 A;  4JYW A;  1NMT A;  4BD9 A;  4YN3 A;  5F1Y A;  1LCP A;  4QBJ A;  1WVM A;  2NSM A;  3JUW A;  5AG6 A;  4BMH A;  2PVW A;  2ZEF A;  4ONU A;  4II9 A;  3TO6 A;  3FMC A;  3WR7 A;  5HKZ A;  1KUX A;  1Y9K A;  2B3U A;  3B3V A;  4X3R A;  1ON0 A;  2GU2 A;  4OME A;  4ZYQ A;  5IB9 A;  2BCO A;  2FSR A;  1TKF A;  4PXC A;  2FM4 A;  1M4L A;  2G3T A;  1CX8 A;  3I1U A;  4RS2 A;  5E96 A;  2EZB A;  1ZG7 A;  2V8G A;  1FNO A;  3IC1 A;  2G3A A;  2PJ8 A;  1ZLI A;  3FED A;  1PCA A;  5AGE A;  3K2K A;  4KUA A;  4L89 A;  1P4N A;  4Y49 C;  3KR4 A;  5HMN A;  4OKO A;  1RXT A;  3R9G A;  2PCU A;  1CPX A;  4C9A A;  3CPX A;  3O8Z A;  1Z8X A;  2FVG A;  2OU2 A;  3FIX A;  3NH8 A;  2Y0M A;  5A27 A;  2Y1N A;  3B3S A;  5K8P A;  4UWI A;  5LYL A;  3U88 C;  2J8M A;  4PK3 A;  4F6A A;  2V8H A;  2B4D B;  5C82 A;  2IJZ A;  2PIZ A;  1LAP A;  2ZEP A;  1YR0 A;  3VWE A;  2ZED A;  4F9U A;  1PYT B;  3TOB A;  4A31 A;  5I4M A;  2GIV A;  3PB6 X;  4MXU A;  1YVK A;  4P4I A;  1IGB A;  3KI9 A;  1UFH A;  2F8H A;  4M85 A;  1EZA A;  1FBV A;  4ZGY B;  3ICU A;  2Q4Y A;  5HVF A;  4PSX A;  3NH4 A;  4MCS A;  2PJ0 A;  3I74 A;  3F9K C;  5C88 A;  1RTQ A;  4OC3 A;  2VZZ A;  1F2P A;  3KRV A;  3R96 A;  3RYO A;  3MRU A;  1R57 A;  3KR5 A;  5IB0 A;  2HI6 A;  2HUZ A;  1IU8 A;  4X5K A;  4QB9 A;  2GLF A;  1Q2D A;  1U6M A;  4UFX A;  3VH9 A;  4IIY A;  4I49 A;  4NCZ A;  4GM5 A;  3BLN A;  3TOA A;  2BOA A;  2PJ9 A;  3PLF B;  1I12 A;  3JVN A;  1Y7E A;  3IGR A;  3ZZI A;  1MJ9 A;  1RO5 A;  3SR3 A;  4UEF A;  2PJ7 A;  4H6Z A;  4HNY B;  3TE4 A;  4MFK A;  5JPH A;  1VHS A;  4U9Y A;  4FUU A;  3BJ7 A;  4HNX B;  1Z9U A;  4ZI6 A;  4MHP A;  4NGM A;  3D4U A;  4JXR A;  4CGN A;  4AG7 A;  1V6C A;  1CP7 A;  2HC9 A;  2PJ1 A;  1JDB C;  4LQ6 A;  4A30 A;  5AG7 A;  3JRU A;  4IAV A;  4AB7 A;  1IID A;  1BXR B;  2C1C A;  1MJB A;  3FEC A;  4BPW B;  2ZXV A;  2PIY A;  3CXQ A;  4FD7 A;  3WC5 A;  1AYE A;  2FXF A;  4NGT A;  1Z2L A;  3H5Z A;  5K99 A;  3IWG A;  2QYV A;  2XEG A;  3P2H A;  4MY0 A;  2DLA A;  1A9X B;  2B0A A;  2PRQ A;  3EY5 A;  4C8F A;  2BEI A;  5CNP A;  2ZEG A;  1B47 A;  2DPT A;  2Z3P A;  4NGR A;  2NYQ A;  2F5I A;  1SQH A;  5G22 A;  4M6H A;  4C8A A;  3IWE A;  3K4I A;  1CS0 B;  1X12 A;  4INJ A;  4MFL A;  1JWQ A;  2O53 A;  3EFA A;  4KNG E;  1QSM A;  2YNC C;  2B4D A;  4NEX A;  2AFU A;  3IEH A;  3T5M A;  1L0C A;  1R3N A;  3F0A A;  4YFJ A;  4EME A;  3T0T A;  2PJ3 A;  3BHX A;  4P44 A;  2VZY A;  4U9Z A;  4X2T A;  3VWD A;  5JYB A;  2Z0Z A;  2X7B A;  3LMS A;  3SJF A;  1HDQ A;  1ZYM A;  2AJ6 A;  3FVL A;  1VGY A;  4FAI A;  4E5S A;  1YK3 A;  3KAS A;  2XPP A;  2P6E A;  3B3C A;  3G8W A;  3PFE A;  3P2F A;  3QNV A;  5AG4 A;  3T05 A;  3D68 A;  3V8I A;  2EVN A;  1YQE A;  4MRI A;  3IWW A;  2ZEM A;  3FH4 A;  4NFR A;  4R3K A;  2XPL A;  4KVM E;  3B7I A;  4P4F A;  4UFW A;  4U5Y A;  4XNH C;  3WAB A;  2AFZ A;  3TLY A;  4OC0 A;  1ARL A;  4J0N A;  4P4E A;  3H8G A;  2AFM A;  1QST A;  5KTD A;  2VQY A;  4NXY A;  2R82 A;  2WPX A;  3FB3 A;  3MN8 A;  2BUE A;  1M6V B;  3CDX A;  4K3N A;  1LFW A;  2IQ6 A;  3VAT A;  4B13 A;  1YSJ A;  5HVH A;  5F48 A;  1LAM A;  1VHO A;  4CPA A;  4BIN A;  2EWB A;  2PR8 A;  4B12 A;  1OZP A;  3IO1 A;  3F5B A;  3S9L A;  3IU2 A;  4NJQ A;  2WYR A;  5DWM A;  3OAK A;  4KOY A;  4XPL A;  5F5X A;  4C9R A;  2Q7S A;  3H4Q A;  2CIJ A;  1S7L A;  3CPA A;  3GY9 A;  7CPA A;  4OC5 A;  3FJU A;  2Q4Z A;  5F13 A;  4Q7A A;  4JXQ A;  2I79 A;  4CAX A;  3DSB A;  2B58 A;  3F8K A;  4MHN A;  3GJZ A;  3KQX A;  4F9V A;  4C9V A;  3RZA A;  1KZF A;  2C27 A;  2F7V A;  2XEI A;  1YGH A;  1KUY A;  4CAE A;  4LUA A;  1XF8 A;  1YX0 A;  2B5G A;  2CNM A;  1P0H A;  3VTA A;  4KZT A;  3GIU A;  4X8I A;  4UCM A;  5ELY A;  2B5G B;  3TCV A;  4DNC A;  2ANP A;  1Z8T A;  3WT4 A;  5CBM A;  1NXJ A;  4UEZ A;  5I0C A;  2ZEO A;  3EC4 A;  3W91 A;  3BUO B;  2EO8 A;  2Z3M A;  4C8C A;  4PSW A;  2OB0 A;  1F2O A;  4MMO A;  3TLC A;  2PJ2 A;  4CAV A;  1X10 A;  2GLJ A;  1IIC A;  1Z4E A;  1CE8 B;  6CPA A;  2EZA A;  2PJB A;  2P6G A;  4CAW A;  4CRZ B;  3TTH A;  2J9A A;  2JEV A;  1WK4 A;  1M44 A;  4M3S A;  4UCP A;  1IOI A;  2V8D A;  4CGM A;  2PVV A;  1VHE A;  1Q2Y A;  1VI4 A;  2ZEE A;  1KBL A;  1KC7 A;  4P4D A;  4G1P A;  2KCW A;  3D2M A;  3TC8 A;  5JH9 A;  4TNU A;  4JJX A;  1H8L A;  4CO9 A;  2PJC A;  4XPD C;  4WJB A;  3TLZ A;  1VKC A;  5HKW A;  2AUM A;  5LRG A;  3PB7 X;  4P6Y A;  3SI0 A;  4AG9 A;  3S6F A;  5LYI A;  3TLE A;  4P4B A;  1TKH A;  4KOU A;  2FS5 A;  3S6G A;  3SXO A;  4MCR A;  1TF9 A;  3W6X A;  3KHX A;  3BUX B;  4KOR A;  1IYK A;  3PP9 A;  1LOK A;  1DIK A;  5IX3 A;  3LOD A;  2PC1 A;  4GXH A;  4PXB A;  3OWC A;  3TX8 A;  1Y7R A;  4A32 A;  2E28 A;  2R1I A;  1BLL E;  4YGO A;  3D2P A;  2FIW A;  2FE7 A;  1N71 A;  2Q43 A;  4H6U A;  4AVA A;  1BPN A;  1ZL0 A;  4XNH B;  3EZE A;  3VRQ A;  5J8C A;  1Y0Y A;  3NE8 A;  2VEZ A;  1YRE A;  4A37 A;  4F0X A;  4C7I A;  4M8D A;  4B11 A;  2REE A;  2AFS A;  2ATR A;  3I3G A;  1GGO A;  2C6P A;  3E0K A;  1TKJ A;  4MY3 A;  3BI0 A;  3QAY A;  2CF4 A;  5EC4 A;  4OP4 A;  2PRB A;  1QSR A;  4E2A A;  3EZA A;  1S5K A;  3R9F A;  4KOX A;  3PT1 A;  4ORF A;  3VRO A;  2G0B A;  2VBQ A;  4CDJ A;  1CPS A;  1IOF A; 
#chains in the Genus database with same CATH homology
 1ELL P;  3KZW A;  2VL1 A;  4ZY2 A;  1OBR A;  2G9D A;  4YWY A;  3L2N A;  2EK9 A;  4RUH A;  4IK2 A;  3FF3 A;  1UWY A;  2PJ5 A;  3D7G A;  1AMP A;  4NGP A;  3V7Z A;  1QQ9 A;  3D67 A;  4TJX A;  3PBB A;  4B6Z A;  4A94 A;  3S9N A;  4JZ0 A;  2AFX A;  4A38 A;  3GB0 A;  2C6C A;  4DUK A;  2ABZ A;  3FEE A;  4DJL A;  3B2Y A;  5HXD A;  1F57 A;  2OR4 A;  3H8E A;  1CBX A;  4R7M A;  3SJG A;  1DE4 C;  4LQG A;  1DTD A;  5K8M A;  1BAV A;  2ZEL A;  4OC4 A;  2GRE A;  3CT9 A;  1ZG8 A;  3WC7 A;  3BXM A;  5D8N A;  1FT7 A;  1KWM A;  3SJX A;  3IFE A;  1XRY A;  1LAN A;  4PQA A;  4C99 A;  2EK8 A;  4MCP A;  1R43 A;  3HLP A;  3I6S A;  4EFD A;  4ZY1 A;  1ARM A;  5J1Q A;  3BI1 A;  2C5Q A;  3NA6 A;  4ZX8 A;  5CPA A;  1BPM A;  3GUX A;  4NGS A;  4OID A;  4IHM A;  3PBE A;  1XBU A;  1IY7 A;  3D7F A;  2I3C A;  4F8Z A;  2OOT A;  5LRJ A;  5IR2 A;  4MHZ A;  3GLJ A;  3LWU A;  4FWU A;  4MHY A;  5HVG A;  2PE3 A;  1CP6 A;  4R8F A;  1GYT A;  2DEA A;  1YW4 A;  3N5F A;  3K9T A;  4P10 A;  1Q7L A;  4UIB A;  4PXD A;  4P45 A;  8CPA A;  1CG2 A;  1XFO A;  5JGF A;  3NFZ A;  4P4J A;  5DS0 A;  4C9E A;  3EIF A;  3ISX A;  4KSI A;  1Z8L A;  2AFO A;  3PEI A;  4UIA A;  3KL9 A;  5F09 A;  2ZEN A;  1ZLH A;  1XMB A;  3IJ3 A;  1HDU A;  1EE3 P;  2CTB A;  2QVP A;  3IIB A;  1YLO A;  2O4H A;  4NGQ A;  4H2K A;  2JBJ A;  4MCQ A;  3RBU A;  2RB7 A;  4TWE A;  1Y0R A;  3D7H A;  2JEW A;  4PPZ A;  4UEE A;  2POK A;  5LRK A;  2AFW A;  3T8W A;  5K8N A;  4O23 A;  3PFO A;  3ISZ A;  2HB6 A;  5K8O A;  2ZEH A;  2XEF A;  3SI2 A;  3DLJ A;  3PRT A;  3H8F A;  2V77 A;  3PB4 X;  3KHZ A;  1NSA A;  4NGN A;  2XEJ A;  1Y9Z A;  4ZY0 A;  1VIX A;  4EWT A;  4C85 A;  4CDK A;  3VAR A;  2RFH A;  3B35 A;  4C84 A;  4YU9 A;  1JQG A;  4WWV A;  1Z5R A;  4PXE A;  2QJ8 A;  4R76 A;  2CTC A;  3B3W A;  4C8T A;  1XJO A;  2PJ4 A;  4C8U A;  4OIW A;  2V8V A;  1YW6 A;  3B3T A;  1TXR A;  4TJV A;  1HEE A;  3WC6 A;  2BO9 A;  2WZN A;  5THW A;  3RAM A;  4R6T A;  2C6G A;  4C8P A;  5D29 A;  3KQZ A;  2GP4 A;  1ZG9 A;  3PB9 X;  4OC2 A;  4UF4 A;  2ZOF A;  3PB8 X;  3S9M A;  3FX6 A;  2JBK A;  3DGV A;  5LYD A;  3SI1 A;  5JM6 A;  4W9Y A;  4AXV A;  4DYO A;  4C86 A;  3V38 A;  2ZOG A;  3SJE A;  1QMU A;  3HUV A;  4ONW A;  1TF8 A;  4OC1 A;  1ELM P;  3D66 A;  4FBE A;  2IMO A;  2Q51 A;  1XF1 A;  4ZX9 A;  4C9U A;  3D7D A;  3NH5 A;  4Z65 A;  1YME A;  4NJR A;  2PJ6 A;  2PJA A;  4A39 A;  3KGQ A;  5LYF A;  4JYW A;  4BD9 A;  4YN3 A;  1LCP A;  1WVM A;  2NSM A;  2PVW A;  2ZEF A;  3FMC A;  4ZYQ A;  3B3V A;  4X3R A;  2GU2 A;  5IB9 A;  4OME A;  2BCO A;  1TKF A;  4PXC A;  1M4L A;  1CX8 A;  3I1U A;  1ZG7 A;  2V8G A;  1FNO A;  3IC1 A;  2PJ8 A;  1ZLI A;  3FED A;  1PCA A;  3K2K A;  3KR4 A;  4OKO A;  2PCU A;  1CPX A;  4C9A A;  3CPX A;  2FVG A;  3NH8 A;  3B3S A;  5K8P A;  5LYL A;  2V8H A;  2IJZ A;  2PIZ A;  1LAP A;  2ZEP A;  4F9U A;  5I4M A;  2ZED A;  1PYT B;  4MXU A;  3PB6 X;  4P4I A;  1IGB A;  3KI9 A;  2F8H A;  3ICU A;  5HVF A;  3NH4 A;  4MCS A;  2PJ0 A;  3I74 A;  1RTQ A;  4OC3 A;  1F2P A;  3MRU A;  3KR5 A;  2GLF A;  3VH9 A;  4GM5 A;  2BOA A;  2PJ9 A;  1Y7E A;  4UEF A;  2PJ7 A;  4FUU A;  4ZI6 A;  4MHP A;  4NGM A;  3D4U A;  1V6C A;  1CP7 A;  2HC9 A;  2PJ1 A;  3JRU A;  4IAV A;  2C1C A;  3FEC A;  2PIY A;  3WC5 A;  1AYE A;  4NGT A;  1Z2L A;  2QYV A;  2XEG A;  4C8F A;  2PRQ A;  2ZEG A;  4NGR A;  2NYQ A;  4C8A A;  2O53 A;  4KNG E;  2AFU A;  3IEH A;  1R3N A;  4EME A;  2PJ3 A;  3BHX A;  4P44 A;  4X2T A;  3LMS A;  3SJF A;  1HDQ A;  4FAI A;  3FVL A;  1VGY A;  3B3C A;  3KAS A;  3PFE A;  3QNV A;  3D68 A;  4MRI A;  3IWW A;  2ZEM A;  3FH4 A;  4NFR A;  3B7I A;  4P4F A;  3WAB A;  2AFZ A;  1ARL A;  4OC0 A;  4P4E A;  3H8G A;  2AFM A;  3MN8 A;  3CDX A;  4K3N A;  1LFW A;  2IQ6 A;  3VAT A;  1YSJ A;  5HVH A;  1LAM A;  1VHO A;  4CPA A;  2EWB A;  3IO1 A;  3S9L A;  4NJQ A;  2WYR A;  4C9R A;  2CIJ A;  3CPA A;  7CPA A;  4OC5 A;  3FJU A;  2Q4Z A;  4Q7A A;  4MHN A;  4C9V A;  3KQX A;  4F9V A;  3RZA A;  2F7V A;  2XEI A;  3VTA A;  4X8I A;  5ELY A;  5CBM A;  2ANP A;  3WT4 A;  4UEZ A;  2ZEO A;  4C8C A;  1F2O A;  4MMO A;  2PJ2 A;  2GLJ A;  6CPA A;  2PJB A;  2J9A A;  2V8D A;  2PVV A;  1VHE A;  2ZEE A;  4P4D A;  4G1P A;  3TC8 A;  5JH9 A;  4TNU A;  1H8L A;  2PJC A;  4WJB A;  5LRG A;  3PB7 X;  4P6Y A;  3SI0 A;  5LYI A;  4P4B A;  1TKH A;  4MCR A;  1TF9 A;  3KHX A;  1LOK A;  4PXB A;  3TX8 A;  1BLL E;  2Q43 A;  1BPN A;  1Y0Y A;  4A37 A;  2AFS A;  2C6P A;  1TKJ A;  3BI0 A;  2CF4 A;  4OP4 A;  4CDJ A;  1CPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...