3D7HA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcibzl, a urea-based inhibitor
Total Genus 269
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
269
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
total genus 269
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7hA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7hA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7hA02
3IC1A 2PJ6A 2ZEHA 3PFOA 1BAVA 5IB9A 3NA6A 3SI1A 1ZLIA 4UIBA 3KR4A 2QJ8A 4ZY0A 4BD9A 1BPMA 2G9DA 4B6ZA 3B3SA 3IEHA 4OC2A 2ZENA 2PJBA 2XEJA 2DEAA 3DLJA 1LCPA 3IFEA 5LYIA 3CPAA 2XEIA 3LMSA 1YSJA 3H8GA 4AXVA 4R76A 4CDJA 2AFZA 1TKHA 3BI1A 1V6CA 4OC5A 2PJ8A 5HVGA 2JEWA 2IQ6A 4H2KA 2OR4A 1ZLHA 1CBXA 3WC5A 2PJCA 4OIWA 4P4BA 2ZEFA 3GLJA 3IJ3A 3B35A 4FAIA 3HUVA 2PCUA 2AFUA 5HXDA 2C6GA 1VHOA 1BLLE 4FBEA 1PCAA 4JZ0A 3D68A 2C1CA 2JBKA 3DGVA 4MXUA 2AFOA 3RBUA 1VGYA 3PB7X 5LRKA 3FECA 3L2NA 5JM6A 3BXMA 4F9VA 1Q7LA 1TKFA 1AYEA 3PBEA 2GLFA 4C9RA 4ONWA 3RAMA 5K8PA 3B7IA 2RB7A 1HDQA 1Y9ZA 2NYQA 4P4EA 3S9MA 4YU9A 3B3WA 5LYLA 2PE3A 2BCOA 2QYVA 2POKA 4P10A 2V8VA 1XFOA 4GM5A 4C8UA 4OIDA 1YLOA 1H8LA 3WABA 4NJQA 4UIAA 4C8PA 4OMEA 3QNVA 3EIFA 4OC4A 4NGTA 2ZEEA 4R6TA 3D7HA 2PJ4A 2O53A 1ARLA 3JRUA 3K9TA 4C9UA 1EE3P 3D7FA 1CPXA 4DYOA 2WYRA 3SJGA 2PJ2A 4O23A 4OC0A 2PJ0A 3RZAA 2PVWA 1ELMP 1FT7A 1ELLP 1ZG8A 1M4LA 3B3VA 4PXDA 4ZX9A 6CPAA 3KQZA 4PXCA 4MCQA 4OC1A 2PJ7A 3KR5A 1Y7EA 4MHNA 3VH9A 4KNGE 2ZEOA 2V8HA 4X8IA 3GB0A 3KHXA 3LWUA 1TXRA 2ZEGA 2GLJA 3PBBA 1TKJA 4P44A 1XMBA 7CPAA 5I4MA 4ZX8A 4EMEA 4UEZA 1XBUA 2FVGA 4Q7AA 5HVHA 4ZYQA 2V77A 3B3TA 2CTBA 2C6PA 4IK2A 3ISZA 5F09A 3I74A 4P4DA 1FNOA 3IWWA 1Y0YA 4PQAA 2AFWA 5HVFA 3FH4A 4TNUA 5THWA 1LOKA 3H8EA 4YN3A 2Q51A 1AMPA 4Z65A 4C9VA 2V8GA 3FEEA 4P4FA 1TF9A 3KHZA 2BOAA 5CBMA 4P4IA 3PRTA 4A37A 3D7DA 2ANPA 4X2TA 3WC6A 2AFXA 4ZY1A 5J1QA 2RFHA 3FMCA 3PB9X 2CTCA 1YMEA 4R8FA 2XEFA 3KZWA 3PFEA 3NH8A 2OOTA 4P6YA 3TX8A 3BHXA 2F7VA 4C8CA 3ISXA 4F9UA 3WC7A 2C6CA 4C8FA 1CP6A 3PB4X 1XRYA 5CPAA 4DUKA 4UEFA 4OC3A 4PPZA 1DE4C 3NH5A 4C86A 2ZOFA 4NGPA 3KGQA 1IGBA 5D29A 3H8FA 4EWTA 4NGSA 4C85A 2HC9A 1CPSA 5LRGA 3KL9A 2PJAA 4MHYA 3FVLA 2ZELA 3S9NA 4P4JA 5LRJA 2PJ3A 4CPAA 8CPAA 2PJ9A 2WZNA 4A94A 2PVVA 3ICUA 1R3NA 2O4HA 3V38A 3VARA 1VHEA 2EK9A 3SI2A 2GREA 3PB8X 5LYFA 4G1PA 2AFSA 1QQ9A 3KQXA 2XEGA 5K8MA 4X3RA 2NSMA 1CX8A 1OBRA 3NH4A 1R43A 3FJUA 4MCRA 4P45A 3TC8A 1F2PA 2F8HA 1Z5RA 4OP4A 3SJFA 4TJXA 1QMUA 1TF8A 4F8ZA 1LANA 3SJEA 3SI0A 4UEEA 1ARMA 5K8OA 1IY7A 4ZI6A 4K3NA 4MMOA 4TJVA 3FX6A 3PB6X 4KSIA 3D7GA 2ZEMA 4MRIA 1WVMA 1KWMA 4C9AA 2VL1A 2ZEDA 1YW6A 3CPXA 3MN8A 3MRUA 4A38A 4LQGA 2AFMA 1DTDA 2PIYA 2CIJA 4WJBA 1UWYA 3FF3A 4C99A 1F2OA 2JBJA 3KI9A 4IAVA 2HB6A 2QVPA 1PYTB 4A39A 4WWVA 4CDKA 1NSAA 1HEEA 4C9EA 2J9AA 1JQGA 1LAPA 3GUXA 3VATA 2Q43A 2CF4A 1Z8LA 2ZEPA 5DS0A 1LFWA 2EK8A 3SJXA 4OKOA 3KASA 1VIXA 3IO1A 2IJZA 1ZG7A 1XJOA 4DJLA 1XF1A 4YWYA 1ZG9A 2PJ1A 3S9LA 3D4UA 1CG2A 4RUHA 3HLPA 2I3CA 4FUUA 3B2YA 3WT4A 4JYWA 3T8WA 1F57A 4W9YA 4UF4A 3FEDA 2V8DA 1LAMA 3BI0A 1GYTA 4TWEA 5JGFA 4NGNA 3I1UA 4PXBA 5LYDA 2PIZA 4NFRA 5K8NA 2Q4ZA 3I6SA 4NGQA 3NFZA 4MHPA 2EWBA 1Y0RA 1RTQA 3PEIA 3VTAA 4R7MA 1CP7A 4IHMA 2ABZA 4PXEA 1Z2LA 1YW4A 4NJRA 4MCSA 4C8AA 2PRQA 2GU2A 3V7ZA 5ELYA 1HDUA 3IIBA 4FWUA 4C8TA 4EFDA 3K2KA 4MCPA 4MHZA 3CDXA 2PJ5A 2ZOGA 1BPNA 4C84A 3D67A 2IMOA 3D66A 5D8NA 3N5FA 4NGRA 5JH9A 4NGMA 3CT9A 3B3CA 2BO9A 4ZY2A
chains in the Genus database with same CATH superfamily
1J4JA 3T9YA 3N7ZA 2HV2A 3I3GA 3IC1A 4B5PB 2PJ6A 5AG7A 4ONUA 1IIDA 1KZFA 2H5MA 1IYLA 2ZEHA 3PFOA 2QIRA 1BAVA 4UCNA 2N3AB 1X10A 4F6AA 4U9ZA 2OZHA 1NXJA 1S60A 2ZW7A 3VWEA 5IB9A 3NA6A 1NMTA 1ZLIA 3SI1A 4UIBA 2REFA 3KR4A 4HPSA 3TO7A 4XNHB 4FD6A 3TLZA 1P4NA 2QJ8A 3NE8A 4QBJA 4ZY0A 4XPDC 1RO5A 4BD9A 5F1YA 5JVLA 1BPMA 5G22A 4KOWA 2G9DA 4B6ZA 2HQYA 3B3SA 3IEHA 4OC2A 1Z4RA 2ZENA 5BY0A 2PJBA 1DIKA 1Y9KA 2XEJA 4CYPA 3T05A 2DEAA 4CAEA 2J8NA 1LCPA 3DLJA 3IFEA 5LYIA 1KC7A 4CYQA 2GP4A 3CPAA 3TLCA 2XEIA 3EO4A 2P6FA 4OLLA 2VQYA 3LMSA 1YSJA 2ZPAA 2VZZA 3H8GA 2GFQA 3E0KA 3NE7A 1XOVA 4AXVA 4R76A 3BUMB 2AFZA 1TKHA 4CDJA 2R8VA 3BI1A 4MFJA 5F48A 1VBGA 1V6CA 4OC5A 2PJ8A 4AB7A 4MFLA 5HVGA 2JEWA 2IQ6A 4H2KA 4GXHA 2OR4A 1S7NA 1CBXA 1JWQA 1ZLHA 2PJCA 2YNEA 3PP9A 1X12A 3WC5A 1C30B 4OIWA 4JXQA 4MY3A 4P4BA 2ZEFA 3GLJA 3IJ3A 4A4BA 3B35A 4FAIA 2EUIA 3HUVA 3V8IA 2PCUA 2AFUA 4E5SA 5IV0A 1NSLA 5HXDA 1VHOA 2C6GA 1BLLE 2XPLA 4KOUA 4FBEA 1YX0A 3T07A 4KS9A 3FRMA 2D4PA 3GJZA 5JYBA 1PCAA 3R9GA 4JZ0A 4C8UA 3D68A 2C1CA 5AG6A 4CGOA 2JBKA 4Y49B 5CNPA 3DGVA 1MJBA 1M6VB 4MXUA 2YJVA 2EVNA 2D0OA 5I0CA 3JVNA 2AFOA 1PU9A 3RBUA 2G3TA 2Y1MA 3TYXA 1VGYA 4ORFA 1Y9WA 3PB7X 1M4DA 5LRKA 3FECA 3L2NA 3W6XA 5JM6A 1A9XB 3BXMA 4F9VA 4KOTA 1KBLA 1Q7LA 3F0AA 4MFZA 2C5QA 3OAKA 1TKFA 4INJA 1AYEA 5IB0A 2A4NA 2REEA 3PBEA 2GLFA 1CS0B 2GIVA 4LQ6A 4ONWA 4BINA 4C9RA 2PCNA 2WPWA 3TTHA 3RAMA 5K8PA 3B7IA 2RB7A 1HDQA 1Y9ZA 2NYQA 4KUBA 3DSBA 4P4EA 2PRBA 5J8CA 2B5GB 1XE4A 3S9MA 1YQEA 4YU9A 3B3WA 4EVYA 5LYLA 1R61A 2PE3A 5HKZA 2B58A 2KCWA 3KKWA 2BCOA 4IF5A 3R9FA 2XPPA 2QYVA 4Y49C 5J3XA 3G8WA 2POKA 4P10A 2V8VA 1XFOA 2VI7A 4GM5A 4KZTA 5F49A 2HI6A 3C8OA 4OIDA 3KRVA 1YLOA 3WR7A 1BOBA 1H8LA 1IB1E 1ON0A 2ZXVA 3WABA 5FD8A 3EY5A 3QB8A 2Z3MA 4I49A 4NJQA 3K4IA 4BTFA 4UIAA 2DPTA 3D2PA 1YR0A 4C8PA 4KSAA 4OMEA 3QNVA 4C7IA 3EIFA 4OC4A 4NGTA 3JUWA 3SR3A 2ZEEA 4K30A 3SHPA 1Z9EA 3HMJG 4R6TA 4YFJA 2I79A 3D7HA 4FD7A 1M4IA 2PJ4A 2AUMA 4JD6A 3NFQA 2O53A 1ARLA 3JRUA 3VRQA 3K9TA 4B14A 3TFYA 3ZNIA 3VRPA 1EE3P 1QSTA 2VKZG 3D7FA 2FS5A 4YGOA 2EZBA 4C9UA 1CPXA 2WUUA 2VZYA 4DYOA 2WYRA 3SJGA 2DLAA 2PJ2A 4O23A 2VEZA 4OC0A 4KVOE 1Z8XA 2PJ0A 4B10A 5C82A 1ZO0A 3RZAA 4CGNA 3TLGB 2PVWA 1CE8B 4C2ZA 2FT0A 1ELMP 1FT7A 1Q2YA 1ELLP 4KVME 1NBWA 4M8DA 1ZG8A 1M4LA 2EO8A 3B3VA 4PXDA 4ZX9A 1GHEA 1K4JA 3KQZA 4PXCA 4AG7A 6CPAA 4MCQA 4OC1A 1IYKA 2PJ7A 1QSNA 3KR5A 3LACA 5ISVA 1Y7EA 2IL4A 4KOXA 5H86A 4MHNA 3VH9A 2X7BA 4E2AA 4Q36A 1JDEA 1VKCA 4KNGE 5HH1A 4IIYA 2ZEOA 2V8HA 2R98A 5F5XA 1YLEA 5IX3A 4M6IA 1QSRA 3B8GA 3GB0A 3KHXA 1Z8TA 4X8IA 3LWUA 4KVXA 1TXRA 1M1DA 4QVTA 4B11A 2R7HA 3RYOA 4R87A 1S7KA 2ZEGA 1R57A 2GLJA 2OH1A 3FXTA 2B4DA 1MJ9A 3FYNA 1TKJA 3PBBA 2ZW6A 4NXYA 2Z0ZA 4LX9A 4II9A 4MY0A 4P44A 2R82A 3EZBA 4QUSA 1XMBA 7CPAA 5I4MA 2Q4VA 4ZX8A 4EMEA 2PSWA 4H6UA 4UEZA 4CGPA 1XBUA 2B3UA 2FVGA 3GIUA 2ATRA 4Q7AA 5HVHA 4ZYQA 2EZCA 4GPLB 4MI4A 2V77A 2YNDA 3H5ZA 3O8ZA 2YNCA 2CTBA 3B3TA 4B13A 1P0HA 1YK3A 4MJ8A 1M44A 2C6PA 2Q44A 4IK2A 2Q7BA 1YVHA 5F09A 3ISZA 4BPWB 4A31A 3I74A 4P4DA 1FNOA 4UA3A 5F13A 3IWWA 4KORA 1Y0YA 1VI4A 4PQAA 2AFWA 5HVFA 3G3SA 3FH4A 4TNUA 5JQ4A 2FXFA 2OB0A 1M4GA 5THWA 1I21A 1LOKA 3H8EA 3GKRA 4YN3A 2Q51A 3U1BA 5G1ZA 1AMPA 1IOIA 3R95A 4HNWB 1FY7A 4Z65A 4C9VA 2V8GA 4M6HA 5JPHA 4A33A 3TOBA 3FEEA 5AGEA 4P4FA 1TF9A 2Q0YA 2ARHA 3KHZA 4XNHC 4NCZA 4A30A 3JTKA 2BOAA 1QSOA 5A28A 1NE9A 5CBMA 4P4IA 2YGWA 3PRTA 4A37A 3D7DA 2Q7SA 2ANPA 2QECA 4HKFA 4E8OA 5IR2A 4X2TA 3WC6A 5HKWA 2AFXA 5KTAA 2B3VA 4ZY1A 5J1QA 2RFHA 1KUYA 3HPGG 3FMCA 4NF1A 1VBHA 3PB9X 4MJXA 1YVOA 3BUOB 1IICA 2CTCA 1YMEA 4R8FA 2XEFA 3KZWA 1B6BA 1TIQA 2BSWA 2DF5A 3PFEA 2Z11A 1ZYMA 1YGHA 3NH8A 2OOTA 3RNZA 4P6YA 1VHSA 4R57A 3TX8A 3BHXA 2F7VA 4C8CA 2HWGA 3ISXA 5EC4A 4F9UA 4KOSA 2C6CA 3WC7A 4C8FA 2PQ8A 1CP6A 3PB4X 1XRYA 5CPAA 4L8AA 2I00A 4DUKA 4UEFA 4OC3A 4GS4A 4PPZA 3S6KA 3S6GA 1DE4C 3NH5A 4J0NA 4XPKA 3R9EA 4H6ZA 4C86A 3HPHE 1A2ZA 1XIXA 2G0BA 1JDBC 3OB2B 2ZOFA 2D4OA 4B12A 4NGPA 3KGQA 1IGBA 1S7LA 5D29A 3H8FA 5HMNA 2EBJA 4EWTA 4NGSA 2B4BA 4LUAA 4NEXA 1WWZA 4CYOA 3T0TA 4C85A 1WJTA 2HC9A 1S3ZA 1CPSA 4J3GA 5LRGA 3EC4A 2OZUA 3KL9A 2E28A 2MP0A 5AG5A 2PJAA 2CY2A 4MHYA 3FVLA 4MFPA 2P6GA 3S9NA 2ZELA 2C27A 5H84A 4P4JA 1L0CA 1RXTA 2NMTA 4UCMA 2PJ3A 5AXIA 5LRJA 5J8FA 1I12A 4UFXA 4CPAA 4EYSA 4CGLA 2K5TA 1SQHA 3FBUA 2D0PA 2J8RA 2B4JC 8CPAA 2FIAA 2PJ9A 2WZNA 1PUAA 3IWEA 1GGOA 1B47A 3S6FA 5DWNA 4A94A 2PVVA 4IUSA 3ICUA 1R3NA 2O4HA 2Z3LA 3V38A 4KUAA 3VARA 5FVJA 1VHEA 2EK9A 2Y1NA 3SI2A 2GREA 4FD4A 1XEBA 3PB8X 3BUWB 1AUGA 4R9MA 5LYFA 2BEIA 4G1PA 2YJTA 3QAHA 2R1IA 2AFSA 1QQ9A 3D8PA 3KQXA 2XEGA 3EXNA 5K8MA 4BBHA 4ZBGA 3LODA 4RR2B 3P2FA 4X3RA 3IGRA 4A4CA 2NSMA 1CX8A 4HNYB 3T90A 3TCVA 1OBRA 4A2ZA 5F46A 2EZAA 3NH4A 2XPOA 1EZAA 1R43A 4M6GA 3T5MA 3DNSA 3FJUA 4MCRA 4P45A 1Y7RA 1F2PA 4XPLA 3TC8A 4KSFA 2F8HA 1Z5RA 4OP4A 3GYAA 3SJFA 4TJXA 3FNCA 1QMUA 1TF8A 2B5GA 3IU1A 4F8ZA 1LANA 1ZRSA 2OLSA 3SJEA 1U6MA 3DR8A 4PK3A 4OADA 3SI0A 2FL4A 1KUXA 3CXQA 4UEEA 1ARMA 4CRZB 5K8OA 1IY7A 2DIKA 4ZI6A 3PFVA 4K3NA 4MMOA 4TJVA 4CAFA 2Z3NA 3FX6A 2WSAA 3PB6X 2XPNA 4KSIA 3D7GA 3BUNB 3DDDA 2Z3OA 2JLMA 2F5IA 4NSQA 2ZEMA 4MRIA 5K99A 3NOJA 1WVMA 3SXNA 1KWMA 4C9AA 2VL1A 2ZEDA 3UY5A 3F8KA 3IU2A 1YW6A 4MBUA 4CYNA 4C2XA 4HNXB 3CPXA 3CZXA 4QC6A 3F9KC 3MN8A 4IIXA 3MRUA 4UFWA 4A38A 4LQGA 1J3LA 2OZGA 4KOYA 2AFMA 4MI1A 2ODFA 1DTDA 2JDDA 3OP0A 4A32A 2PIYA 2CIJA 4B5OA 4WJBA 3VWDA 3EZAA 2GANA 3A9LA 3R96A 2Z3KA 3P2HA 4UBRA 3TLEA 4BPXB 4F0XA 1C3OB 2O28A 2Y0MA 5AG4A 1UWYA 4DNCA 4COBA 3FF3A 4C99A 3TLGA 1BXRB 1F2OA 2JBJA 3KI9A 4MFKA 4KOVA 4COGA 3TOAA 3S6HA 4QB9A 4IAVA 5F9MA 2HB6A 2QVPA 3MGDA 1PYTB 4A39A 4Q38A 4CGMA 1T36B 4CAXA 2FSRA 4WWVA 4CDKA 1NSAA 1HEEA 3PLFB 1B87A 5G20A 4BMHA 4C9EA 5A27A 2ZW5A 2J9AA 1JQGA 1LAPA 3LD2A 3GUXA 1WK4A 2FCKA 2QMLA 2VXKA 2Z10A 3ZJ0A 4OAEA 4JJXA 4M3SA 2J8MA 2CF4A 1Z8LA 2Q43A 2Z3PA 4PSXA 3VATA 4B5PA 1Q5XA 4YRHA 2ZEPA 5DS0A 1LFWA 2EK8A 3W91A 3EZEA 1N71A 3SJXA 2DXQA 1Z9UA 4OKOA 4E94A 3G23A 4PSWA 3BUXB 3KASA 2CXAA 4R3LA 4H1HA 1VIXA 3IO1A 4CS0B 1UFHA 2P6EA 1I1DA 3I9SA 2IJZA 5KTCA 2PDOA 3ZZIA 1ZG7A 4UFVA 5F47A 1XJOA 3K9UA 1S5KA 4DJLA 5KTDA 1XF1A 3F5BA 4YWYA 2HROA 1ZG9A 2PJ1A 4X5KA 3S9LA 3D4UA 4F0YA 1LRZA 2AUNA 1CG2A 4RUHA 4L89A 3W6SA 3SXOA 3TE4A 4AVAA 2BL1A 2I3CA 3HLPA 3TT2A 1EZBA 4CRYB 4FUUA 2CBLA 1YREA 3QAYA 4UWJA 4CO9A 2BUEA 4AG9A 3B2YA 4UCPA 2Q04A 3WT4A 1Q2DA 4JYWA 4A95A 5C88A 3T8WA 1F57A 3GY9A 2VBQA 2G3AA 4W9YA 2AE6A 3U88C 1YVKA 5GCNA 5BWAB 4UF4A 3FEDA 1BO4A 4RI1A 2ZW4A 2V8DA 1LAMA 3BI0A 1GYTA 4U5YA 4TWEA 1FBVA 1S7FA 3D2MA 4NGNA 2RC4A 3D3SA 3H4QA 4MHDA 4PV6A 3VRRA 3C26A 5EMIA 2OU2A 4C68A 2X0SA 3VGOA 3I1UA 2FM4A 4C2YA 4PXBA 2B0AA 2CNTA 1EO0A 3PZJA 3TLYA 2JDCA 1MJAA 5LYDA 4RS2A 2PIZA 2WPXA 4NFRA 1KUVA 5K8NA 2Q4ZA 3I6SA 4NGQA 2B4DB 3TLAA 3OB1B 3NFZA 2DPSA 2CNMA 2P0WA 4KLWA 2EWBA 4M85A 1Y0RA 4MHPA 3PT1A 1RTQA 4JXRA 3TO9A 5G21A 3FIXA 3PEIA 4H89A 2JEVA 3VTAA 4R7MA 1CP7A 2HUZA 4IHMA 2ABZA 3TO6A 1OZPA 5JGFA 1IU8A 1QSMA 4PXEA 4ZGYB 4AVCA 1Z2LA 4U9YA 2UV8G 4R3KA 3CXSA 1YW4A 3RO0A 2Q4YA 4NJRA 2CNSA 1ZL0A 4MCSA 4C8AA 2PRQA 3IWGA 2GU2A 3TLBA 3V7ZA 4PK2A 5ELYA 1HDUA 1MK4A 4JWPA 1Q2CA 3EFAA 3BJ8A 3IIBA 4FWUA 4C8TA 4CZ1A 5DWMA 4EFDA 3K2KA 4BPUB 2PC1A 2FIWA 4MCPA 2PR8A 3DR6A 4E0AA 4MHZA 2FE7A 3FB3A 3CDXA 3VROA 2PJ5A 3BJ7A 3OWCA 4JLYA 4RN7A 2ZOGA 3VRNA 1BPNA 1V0CA 4C84A 1KEEB 3D67A 1Z4EA 3PGPA 4UWIA 4KLVA 4FD5A 4XPDB 2PR1A 1IOFA 3CXPA 2GE3A 2IMOA 3D66A 5D8NA 3N5FA 3R1KA 5HKYA 4NGRA 1XMTA 2AJ6A 4CAVA 5JH9A 4JVOA 4NGMA 4C7HA 1XF8A 2YNCC 3BLNA 4MFQA 5EBVA 5E96A 3CT9A 3B3CA 1Z8WA 2BO9A 1CM0A 4ZY2A 1CJWA 4AVBA 4CAWA
chains in the Genus database with same CATH topology
3IC1A 2PJ6A 2ZEHA 3PFOA 1BAVA 5IB9A 3NA6A 3SI1A 1ZLIA 4UIBA 3KR4A 2QJ8A 4ZY0A 4BD9A 1BPMA 2G9DA 4B6ZA 3B3SA 3IEHA 4OC2A 2ZENA 2PJBA 2XEJA 2DEAA 3DLJA 1LCPA 3IFEA 5LYIA 2GP4A 3CPAA 2XEIA 3LMSA 1YSJA 3H8GA 4AXVA 4R76A 4CDJA 2AFZA 1TKHA 3BI1A 1V6CA 4OC5A 2PJ8A 5HVGA 2JEWA 2IQ6A 4H2KA 2OR4A 1ZLHA 1CBXA 3WC5A 2PJCA 4OIWA 4P4BA 2ZEFA 3GLJA 3IJ3A 3B35A 4FAIA 3HUVA 2PCUA 2AFUA 5HXDA 2C6GA 1VHOA 1BLLE 4FBEA 1PCAA 4JZ0A 3D68A 2C1CA 2JBKA 3DGVA 4MXUA 2AFOA 3RBUA 1VGYA 3PB7X 5LRKA 3FECA 3L2NA 5JM6A 3BXMA 4F9VA 1Q7LA 2C5QA 1TKFA 1AYEA 3PBEA 2GLFA 4C9RA 4ONWA 3RAMA 5K8PA 3B7IA 2RB7A 1HDQA 1Y9ZA 2NYQA 4P4EA 3S9MA 4YU9A 3B3WA 5LYLA 2PE3A 2BCOA 2QYVA 2POKA 4P10A 2V8VA 1XFOA 4GM5A 4C8UA 4OIDA 1YLOA 1H8LA 3WABA 4NJQA 4UIAA 4C8PA 4OMEA 3QNVA 3EIFA 4OC4A 4NGTA 2ZEEA 4R6TA 3D7HA 2PJ4A 2O53A 1ARLA 3JRUA 3K9TA 4C9UA 1EE3P 3D7FA 1CPXA 4DYOA 2WYRA 3SJGA 2PJ2A 4O23A 4OC0A 2PJ0A 3RZAA 2PVWA 1ELMP 1FT7A 1ELLP 1ZG8A 1M4LA 3B3VA 4PXDA 4ZX9A 6CPAA 3KQZA 4PXCA 4MCQA 4OC1A 2PJ7A 3KR5A 1Y7EA 4MHNA 3VH9A 4KNGE 2ZEOA 2V8HA 4X8IA 3GB0A 3KHXA 3LWUA 1TXRA 2ZEGA 2GLJA 3PBBA 1TKJA 4P44A 1XMBA 7CPAA 5I4MA 4ZX8A 4EMEA 4UEZA 1XBUA 2FVGA 4Q7AA 5HVHA 4ZYQA 2V77A 3B3TA 2CTBA 2C6PA 4IK2A 3ISZA 5F09A 3I74A 4P4DA 1FNOA 3IWWA 1Y0YA 4PQAA 2AFWA 5HVFA 3FH4A 4TNUA 5THWA 1LOKA 3H8EA 4YN3A 2Q51A 1AMPA 4Z65A 4C9VA 2V8GA 3FEEA 4P4FA 1TF9A 3KHZA 2BOAA 5CBMA 4P4IA 3PRTA 4A37A 3D7DA 5IR2A 2ANPA 4X2TA 3WC6A 2AFXA 4ZY1A 5J1QA 2RFHA 3FMCA 3PB9X 2CTCA 1YMEA 4R8FA 2XEFA 3KZWA 3PFEA 3NH8A 2OOTA 4P6YA 3TX8A 3BHXA 2F7VA 4C8CA 3ISXA 4F9UA 3WC7A 2C6CA 4C8FA 1CP6A 3PB4X 1XRYA 5CPAA 4DUKA 4UEFA 4OC3A 4PPZA 1DE4C 3NH5A 4C86A 2ZOFA 4NGPA 3KGQA 1IGBA 5D29A 3H8FA 4EWTA 4NGSA 4C85A 2HC9A 1CPSA 5LRGA 3KL9A 2PJAA 4MHYA 3FVLA 2ZELA 3S9NA 4P4JA 5LRJA 2PJ3A 4CPAA 8CPAA 2PJ9A 2WZNA 4A94A 2PVVA 3ICUA 1R3NA 2O4HA 3V38A 3VARA 1VHEA 2EK9A 3SI2A 2GREA 3PB8X 5LYFA 4G1PA 2AFSA 1QQ9A 3KQXA 2XEGA 5K8MA 4X3RA 2NSMA 1CX8A 1OBRA 3NH4A 1R43A 3FJUA 4MCRA 4P45A 3TC8A 1F2PA 2F8HA 1Z5RA 4OP4A 3SJFA 4TJXA 1QMUA 1TF8A 4F8ZA 1LANA 3SJEA 3SI0A 4UEEA 1ARMA 5K8OA 1IY7A 4ZI6A 4K3NA 4MMOA 4TJVA 3FX6A 3PB6X 4KSIA 3D7GA 2ZEMA 4MRIA 1WVMA 1KWMA 4C9AA 2VL1A 2ZEDA 1YW6A 3CPXA 3MN8A 3MRUA 4A38A 4LQGA 2AFMA 1DTDA 2PIYA 2CIJA 4WJBA 1UWYA 3FF3A 4C99A 1F2OA 2JBJA 3KI9A 4IAVA 2HB6A 2QVPA 1PYTB 4A39A 4WWVA 4CDKA 1NSAA 1HEEA 4C9EA 2J9AA 1JQGA 1LAPA 3GUXA 3VATA 2Q43A 2CF4A 1Z8LA 2ZEPA 5DS0A 1LFWA 2EK8A 3SJXA 4OKOA 3KASA 1VIXA 3IO1A 2IJZA 1ZG7A 1XJOA 4DJLA 1XF1A 4YWYA 1ZG9A 2PJ1A 3S9LA 3D4UA 1CG2A 4RUHA 3HLPA 2I3CA 4FUUA 3B2YA 3WT4A 4JYWA 3T8WA 1F57A 4W9YA 4UF4A 3FEDA 2V8DA 1LAMA 3BI0A 1GYTA 4TWEA 5JGFA 4NGNA 3I1UA 4PXBA 5LYDA 2PIZA 4NFRA 5K8NA 2Q4ZA 3I6SA 4NGQA 3NFZA 4MHPA 2EWBA 1Y0RA 1RTQA 3PEIA 3VTAA 4R7MA 1CP7A 4IHMA 2ABZA 4PXEA 1Z2LA 1YW4A 4NJRA 4MCSA 4C8AA 2PRQA 2GU2A 3V7ZA 5ELYA 1HDUA 3IIBA 4FWUA 4C8TA 4EFDA 3K2KA 4MCPA 4MHZA 3CDXA 2PJ5A 2ZOGA 1BPNA 4C84A 3D67A 2IMOA 3D66A 5D8NA 3N5FA 4NGRA 5JH9A 4NGMA 3CT9A 3B3CA 2BO9A 4ZY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IC1 A;  2PJ6 A;  2ZEH A;  3PFO A;  1BAV A;  5IB9 A;  3NA6 A;  3SI1 A;  1ZLI A;  4UIB A;  3KR4 A;  2QJ8 A;  4ZY0 A;  4BD9 A;  1BPM A;  2G9D A;  4B6Z A;  3B3S A;  3IEH A;  4OC2 A;  2ZEN A;  2PJB A;  2XEJ A;  2DEA A;  3DLJ A;  1LCP A;  3IFE A;  5LYI A;  3CPA A;  2XEI A;  3LMS A;  1YSJ A;  3H8G A;  4AXV A;  4R76 A;  4CDJ A;  2AFZ A;  1TKH A;  3BI1 A;  1V6C A;  4OC5 A;  2PJ8 A;  5HVG A;  2JEW A;  2IQ6 A;  4H2K A;  2OR4 A;  1ZLH A;  1CBX A;  3WC5 A;  2PJC A;  4OIW A;  4P4B A;  2ZEF A;  3GLJ A;  3IJ3 A;  3B35 A;  4FAI A;  3HUV A;  2PCU A;  2AFU A;  5HXD A;  2C6G A;  1VHO A;  1BLL E;  4FBE A;  1PCA A;  4JZ0 A;  3D68 A;  2C1C A;  2JBK A;  3DGV A;  4MXU A;  2AFO A;  3RBU A;  1VGY A;  3PB7 X;  5LRK A;  3FEC A;  3L2N A;  5JM6 A;  3BXM A;  4F9V A;  1Q7L A;  1TKF A;  1AYE A;  3PBE A;  2GLF A;  4C9R A;  4ONW A;  3RAM A;  5K8P A;  3B7I A;  2RB7 A;  1HDQ A;  1Y9Z A;  2NYQ A;  4P4E A;  3S9M A;  4YU9 A;  3B3W A;  5LYL A;  2PE3 A;  2BCO A;  2QYV A;  2POK A;  4P10 A;  2V8V A;  1XFO A;  4GM5 A;  4C8U A;  4OID A;  1YLO A;  1H8L A;  3WAB A;  4NJQ A;  4UIA A;  4C8P A;  4OME A;  3QNV A;  3EIF A;  4OC4 A;  4NGT A;  2ZEE A;  4R6T A;  3D7H A;  2PJ4 A;  2O53 A;  1ARL A;  3JRU A;  3K9T A;  4C9U A;  1EE3 P;  3D7F A;  1CPX A;  4DYO A;  2WYR A;  3SJG A;  2PJ2 A;  4O23 A;  4OC0 A;  2PJ0 A;  3RZA A;  2PVW A;  1ELM P;  1FT7 A;  1ELL P;  1ZG8 A;  1M4L A;  3B3V A;  4PXD A;  4ZX9 A;  6CPA A;  3KQZ A;  4PXC A;  4MCQ A;  4OC1 A;  2PJ7 A;  3KR5 A;  1Y7E A;  4MHN A;  3VH9 A;  4KNG E;  2ZEO A;  2V8H A;  4X8I A;  3GB0 A;  3KHX A;  3LWU A;  1TXR A;  2ZEG A;  2GLJ A;  3PBB A;  1TKJ A;  4P44 A;  1XMB A;  7CPA A;  5I4M A;  4ZX8 A;  4EME A;  4UEZ A;  1XBU A;  2FVG A;  4Q7A A;  5HVH A;  4ZYQ A;  2V77 A;  3B3T A;  2CTB A;  2C6P A;  4IK2 A;  3ISZ A;  5F09 A;  3I74 A;  4P4D A;  1FNO A;  3IWW A;  1Y0Y A;  4PQA A;  2AFW A;  5HVF A;  3FH4 A;  4TNU A;  5THW A;  1LOK A;  3H8E A;  4YN3 A;  2Q51 A;  1AMP A;  4Z65 A;  4C9V A;  2V8G A;  3FEE A;  4P4F A;  1TF9 A;  3KHZ A;  2BOA A;  5CBM A;  4P4I A;  3PRT A;  4A37 A;  3D7D A;  2ANP A;  4X2T A;  3WC6 A;  2AFX A;  4ZY1 A;  5J1Q A;  2RFH A;  3FMC A;  3PB9 X;  2CTC A;  1YME A;  4R8F A;  2XEF A;  3KZW A;  3PFE A;  3NH8 A;  2OOT A;  4P6Y A;  3TX8 A;  3BHX A;  2F7V A;  4C8C A;  3ISX A;  4F9U A;  3WC7 A;  2C6C A;  4C8F A;  1CP6 A;  3PB4 X;  1XRY A;  5CPA A;  4DUK A;  4UEF A;  4OC3 A;  4PPZ A;  1DE4 C;  3NH5 A;  4C86 A;  2ZOF A;  4NGP A;  3KGQ A;  1IGB A;  5D29 A;  3H8F A;  4EWT A;  4NGS A;  4C85 A;  2HC9 A;  1CPS A;  5LRG A;  3KL9 A;  2PJA A;  4MHY A;  3FVL A;  2ZEL A;  3S9N A;  4P4J A;  5LRJ A;  2PJ3 A;  4CPA A;  8CPA A;  2PJ9 A;  2WZN A;  4A94 A;  2PVV A;  3ICU A;  1R3N A;  2O4H A;  3V38 A;  3VAR A;  1VHE A;  2EK9 A;  3SI2 A;  2GRE A;  3PB8 X;  5LYF A;  4G1P A;  2AFS A;  1QQ9 A;  3KQX A;  2XEG A;  5K8M A;  4X3R A;  2NSM A;  1CX8 A;  1OBR A;  3NH4 A;  1R43 A;  3FJU A;  4MCR A;  4P45 A;  3TC8 A;  1F2P A;  2F8H A;  1Z5R A;  4OP4 A;  3SJF A;  4TJX A;  1QMU A;  1TF8 A;  4F8Z A;  1LAN A;  3SJE A;  3SI0 A;  4UEE A;  1ARM A;  5K8O A;  1IY7 A;  4ZI6 A;  4K3N A;  4MMO A;  4TJV A;  3FX6 A;  3PB6 X;  4KSI A;  3D7G A;  2ZEM A;  4MRI A;  1WVM A;  1KWM A;  4C9A A;  2VL1 A;  2ZED A;  1YW6 A;  3CPX A;  3MN8 A;  3MRU A;  4A38 A;  4LQG A;  2AFM A;  1DTD A;  2PIY A;  2CIJ A;  4WJB A;  1UWY A;  3FF3 A;  4C99 A;  1F2O A;  2JBJ A;  3KI9 A;  4IAV A;  2HB6 A;  2QVP A;  1PYT B;  4A39 A;  4WWV A;  4CDK A;  1NSA A;  1HEE A;  4C9E A;  2J9A A;  1JQG A;  1LAP A;  3GUX A;  3VAT A;  2Q43 A;  2CF4 A;  1Z8L A;  2ZEP A;  5DS0 A;  1LFW A;  2EK8 A;  3SJX A;  4OKO A;  3KAS A;  1VIX A;  3IO1 A;  2IJZ A;  1ZG7 A;  1XJO A;  4DJL A;  1XF1 A;  4YWY A;  1ZG9 A;  2PJ1 A;  3S9L A;  3D4U A;  1CG2 A;  4RUH A;  3HLP A;  2I3C A;  4FUU A;  3B2Y A;  3WT4 A;  4JYW A;  3T8W A;  1F57 A;  4W9Y A;  4UF4 A;  3FED A;  2V8D A;  1LAM A;  3BI0 A;  1GYT A;  4TWE A;  5JGF A;  4NGN A;  3I1U A;  4PXB A;  5LYD A;  2PIZ A;  4NFR A;  5K8N A;  2Q4Z A;  3I6S A;  4NGQ A;  3NFZ A;  4MHP A;  2EWB A;  1Y0R A;  1RTQ A;  3PEI A;  3VTA A;  4R7M A;  1CP7 A;  4IHM A;  2ABZ A;  4PXE A;  1Z2L A;  1YW4 A;  4NJR A;  4MCS A;  4C8A A;  2PRQ A;  2GU2 A;  3V7Z A;  5ELY A;  1HDU A;  3IIB A;  4FWU A;  4C8T A;  4EFD A;  3K2K A;  4MCP A;  4MHZ A;  3CDX A;  2PJ5 A;  2ZOG A;  1BPN A;  4C84 A;  3D67 A;  2IMO A;  3D66 A;  5D8N A;  3N5F A;  4NGR A;  5JH9 A;  4NGM A;  3CT9 A;  3B3C A;  2BO9 A;  4ZY2 A; 
#chains in the Genus database with same CATH topology
 1J4J A;  3T9Y A;  3N7Z A;  2HV2 A;  3I3G A;  3IC1 A;  4B5P B;  2PJ6 A;  5AG7 A;  4ONU A;  1IID A;  1KZF A;  2H5M A;  1IYL A;  2ZEH A;  3PFO A;  2QIR A;  1BAV A;  4UCN A;  2N3A B;  1X10 A;  4F6A A;  4U9Z A;  2OZH A;  1NXJ A;  1S60 A;  2ZW7 A;  3VWE A;  5IB9 A;  3NA6 A;  1NMT A;  1ZLI A;  3SI1 A;  4UIB A;  2REF A;  3KR4 A;  4HPS A;  3TO7 A;  4XNH B;  4FD6 A;  3TLZ A;  1P4N A;  2QJ8 A;  3NE8 A;  4QBJ A;  4ZY0 A;  4XPD C;  1RO5 A;  4BD9 A;  5F1Y A;  5JVL A;  1BPM A;  5G22 A;  4KOW A;  2G9D A;  4B6Z A;  2HQY A;  3B3S A;  3IEH A;  4OC2 A;  1Z4R A;  2ZEN A;  5BY0 A;  2PJB A;  1DIK A;  1Y9K A;  2XEJ A;  4CYP A;  3T05 A;  2DEA A;  4CAE A;  2J8N A;  1LCP A;  3DLJ A;  3IFE A;  5LYI A;  1KC7 A;  4CYQ A;  2GP4 A;  3CPA A;  3TLC A;  2XEI A;  3EO4 A;  2P6F A;  4OLL A;  2VQY A;  3LMS A;  1YSJ A;  2ZPA A;  2VZZ A;  3H8G A;  2GFQ A;  3E0K A;  3NE7 A;  1XOV A;  4AXV A;  4R76 A;  3BUM B;  2AFZ A;  1TKH A;  4CDJ A;  2R8V A;  3BI1 A;  4MFJ A;  5F48 A;  1VBG A;  1V6C A;  4OC5 A;  2PJ8 A;  4AB7 A;  4MFL A;  5HVG A;  2JEW A;  2IQ6 A;  4H2K A;  4GXH A;  2OR4 A;  1S7N A;  1CBX A;  1JWQ A;  1ZLH A;  2PJC A;  2YNE A;  3PP9 A;  1X12 A;  3WC5 A;  1C30 B;  4OIW A;  4JXQ A;  4MY3 A;  4P4B A;  2ZEF A;  3GLJ A;  3IJ3 A;  4A4B A;  3B35 A;  4FAI A;  2EUI A;  3HUV A;  3V8I A;  2PCU A;  2AFU A;  4E5S A;  5IV0 A;  1NSL A;  5HXD A;  1VHO A;  2C6G A;  1BLL E;  2XPL A;  4KOU A;  4FBE A;  1YX0 A;  3T07 A;  4KS9 A;  3FRM A;  2D4P A;  3GJZ A;  5JYB A;  1PCA A;  3R9G A;  4JZ0 A;  4C8U A;  3D68 A;  2C1C A;  5AG6 A;  4CGO A;  2JBK A;  4Y49 B;  5CNP A;  3DGV A;  1MJB A;  1M6V B;  4MXU A;  2YJV A;  2EVN A;  2D0O A;  5I0C A;  3JVN A;  2AFO A;  1PU9 A;  3RBU A;  2G3T A;  2Y1M A;  3TYX A;  1VGY A;  4ORF A;  1Y9W A;  3PB7 X;  1M4D A;  5LRK A;  3FEC A;  3L2N A;  3W6X A;  5JM6 A;  1A9X B;  3BXM A;  4F9V A;  4KOT A;  1KBL A;  1Q7L A;  3F0A A;  4MFZ A;  2C5Q A;  3OAK A;  1TKF A;  4INJ A;  1AYE A;  5IB0 A;  2A4N A;  2REE A;  3PBE A;  2GLF A;  1CS0 B;  2GIV A;  4LQ6 A;  4ONW A;  4BIN A;  4C9R A;  2PCN A;  2WPW A;  3TTH A;  3RAM A;  5K8P A;  3B7I A;  2RB7 A;  1HDQ A;  1Y9Z A;  2NYQ A;  4KUB A;  3DSB A;  4P4E A;  2PRB A;  5J8C A;  2B5G B;  1XE4 A;  3S9M A;  1YQE A;  4YU9 A;  3B3W A;  4EVY A;  5LYL A;  1R61 A;  2PE3 A;  5HKZ A;  2B58 A;  2KCW A;  3KKW A;  2BCO A;  4IF5 A;  3R9F A;  2XPP A;  2QYV A;  4Y49 C;  5J3X A;  3G8W A;  2POK A;  4P10 A;  2V8V A;  1XFO A;  2VI7 A;  4GM5 A;  4KZT A;  5F49 A;  2HI6 A;  3C8O A;  4OID A;  3KRV A;  1YLO A;  3WR7 A;  1BOB A;  1H8L A;  1IB1 E;  1ON0 A;  2ZXV A;  3WAB A;  5FD8 A;  3EY5 A;  3QB8 A;  2Z3M A;  4I49 A;  4NJQ A;  3K4I A;  4BTF A;  4UIA A;  2DPT A;  3D2P A;  1YR0 A;  4C8P A;  4KSA A;  4OME A;  3QNV A;  4C7I A;  3EIF A;  4OC4 A;  4NGT A;  3JUW A;  3SR3 A;  2ZEE A;  4K30 A;  3SHP A;  1Z9E A;  3HMJ G;  4R6T A;  4YFJ A;  2I79 A;  3D7H A;  4FD7 A;  1M4I A;  2PJ4 A;  2AUM A;  4JD6 A;  3NFQ A;  2O53 A;  1ARL A;  3JRU A;  3VRQ A;  3K9T A;  4B14 A;  3TFY A;  3ZNI A;  3VRP A;  1EE3 P;  1QST A;  2VKZ G;  3D7F A;  2FS5 A;  4YGO A;  2EZB A;  4C9U A;  1CPX A;  2WUU A;  2VZY A;  4DYO A;  2WYR A;  3SJG A;  2DLA A;  2PJ2 A;  4O23 A;  2VEZ A;  4OC0 A;  4KVO E;  1Z8X A;  2PJ0 A;  4B10 A;  5C82 A;  1ZO0 A;  3RZA A;  4CGN A;  3TLG B;  2PVW A;  1CE8 B;  4C2Z A;  2FT0 A;  1ELM P;  1FT7 A;  1Q2Y A;  1ELL P;  4KVM E;  1NBW A;  4M8D A;  1ZG8 A;  1M4L A;  2EO8 A;  3B3V A;  4PXD A;  4ZX9 A;  1GHE A;  1K4J A;  3KQZ A;  4PXC A;  4AG7 A;  6CPA A;  4MCQ A;  4OC1 A;  1IYK A;  2PJ7 A;  1QSN A;  3KR5 A;  3LAC A;  5ISV A;  1Y7E A;  2IL4 A;  4KOX A;  5H86 A;  4MHN A;  3VH9 A;  2X7B A;  4E2A A;  4Q36 A;  1JDE A;  1VKC A;  4KNG E;  5HH1 A;  4IIY A;  2ZEO A;  2V8H A;  2R98 A;  5F5X A;  1YLE A;  5IX3 A;  4M6I A;  1QSR A;  3B8G A;  3GB0 A;  3KHX A;  1Z8T A;  4X8I A;  3LWU A;  4KVX A;  1TXR A;  1M1D A;  4QVT A;  4B11 A;  2R7H A;  3RYO A;  4R87 A;  1S7K A;  2ZEG A;  1R57 A;  2GLJ A;  2OH1 A;  3FXT A;  2B4D A;  1MJ9 A;  3FYN A;  1TKJ A;  3PBB A;  2ZW6 A;  4NXY A;  2Z0Z A;  4LX9 A;  4II9 A;  4MY0 A;  4P44 A;  2R82 A;  3EZB A;  4QUS A;  1XMB A;  7CPA A;  5I4M A;  2Q4V A;  4ZX8 A;  4EME A;  2PSW A;  4H6U A;  4UEZ A;  4CGP A;  1XBU A;  2B3U A;  2FVG A;  3GIU A;  2ATR A;  4Q7A A;  5HVH A;  4ZYQ A;  2EZC A;  4GPL B;  4MI4 A;  2V77 A;  2YND A;  3H5Z A;  3O8Z A;  2YNC A;  2CTB A;  3B3T A;  4B13 A;  1P0H A;  1YK3 A;  4MJ8 A;  1M44 A;  2C6P A;  2Q44 A;  4IK2 A;  2Q7B A;  1YVH A;  5F09 A;  3ISZ A;  4BPW B;  4A31 A;  3I74 A;  4P4D A;  1FNO A;  4UA3 A;  5F13 A;  3IWW A;  4KOR A;  1Y0Y A;  1VI4 A;  4PQA A;  2AFW A;  5HVF A;  3G3S A;  3FH4 A;  4TNU A;  5JQ4 A;  2FXF A;  2OB0 A;  1M4G A;  5THW A;  1I21 A;  1LOK A;  3H8E A;  3GKR A;  4YN3 A;  2Q51 A;  3U1B A;  5G1Z A;  1AMP A;  1IOI A;  3R95 A;  4HNW B;  1FY7 A;  4Z65 A;  4C9V A;  2V8G A;  4M6H A;  5JPH A;  4A33 A;  3TOB A;  3FEE A;  5AGE A;  4P4F A;  1TF9 A;  2Q0Y A;  2ARH A;  3KHZ A;  4XNH C;  4NCZ A;  4A30 A;  3JTK A;  2BOA A;  1QSO A;  5A28 A;  1NE9 A;  5CBM A;  4P4I A;  2YGW A;  3PRT A;  4A37 A;  3D7D A;  2Q7S A;  2ANP A;  2QEC A;  4HKF A;  4E8O A;  5IR2 A;  4X2T A;  3WC6 A;  5HKW A;  2AFX A;  5KTA A;  2B3V A;  4ZY1 A;  5J1Q A;  2RFH A;  1KUY A;  3HPG G;  3FMC A;  4NF1 A;  1VBH A;  3PB9 X;  4MJX A;  1YVO A;  3BUO B;  1IIC A;  2CTC A;  1YME A;  4R8F A;  2XEF A;  3KZW A;  1B6B A;  1TIQ A;  2BSW A;  2DF5 A;  3PFE A;  2Z11 A;  1ZYM A;  1YGH A;  3NH8 A;  2OOT A;  3RNZ A;  4P6Y A;  1VHS A;  4R57 A;  3TX8 A;  3BHX A;  2F7V A;  4C8C A;  2HWG A;  3ISX A;  5EC4 A;  4F9U A;  4KOS A;  2C6C A;  3WC7 A;  4C8F A;  2PQ8 A;  1CP6 A;  3PB4 X;  1XRY A;  5CPA A;  4L8A A;  2I00 A;  4DUK A;  4UEF A;  4OC3 A;  4GS4 A;  4PPZ A;  3S6K A;  3S6G A;  1DE4 C;  3NH5 A;  4J0N A;  4XPK A;  3R9E A;  4H6Z A;  4C86 A;  3HPH E;  1A2Z A;  1XIX A;  2G0B A;  1JDB C;  3OB2 B;  2ZOF A;  2D4O A;  4B12 A;  4NGP A;  3KGQ A;  1IGB A;  1S7L A;  5D29 A;  3H8F A;  5HMN A;  2EBJ A;  4EWT A;  4NGS A;  2B4B A;  4LUA A;  4NEX A;  1WWZ A;  4CYO A;  3T0T A;  4C85 A;  1WJT A;  2HC9 A;  1S3Z A;  1CPS A;  4J3G A;  5LRG A;  3EC4 A;  2OZU A;  3KL9 A;  2E28 A;  2MP0 A;  5AG5 A;  2PJA A;  2CY2 A;  4MHY A;  3FVL A;  4MFP A;  2P6G A;  3S9N A;  2ZEL A;  2C27 A;  5H84 A;  4P4J A;  1L0C A;  1RXT A;  2NMT A;  4UCM A;  2PJ3 A;  5AXI A;  5LRJ A;  5J8F A;  1I12 A;  4UFX A;  4CPA A;  4EYS A;  4CGL A;  2K5T A;  1SQH A;  3FBU A;  2D0P A;  2J8R A;  2B4J C;  8CPA A;  2FIA A;  2PJ9 A;  2WZN A;  1PUA A;  3IWE A;  1GGO A;  1B47 A;  3S6F A;  5DWN A;  4A94 A;  2PVV A;  4IUS A;  3ICU A;  1R3N A;  2O4H A;  2Z3L A;  3V38 A;  4KUA A;  3VAR A;  5FVJ A;  1VHE A;  2EK9 A;  2Y1N A;  3SI2 A;  2GRE A;  4FD4 A;  1XEB A;  3PB8 X;  3BUW B;  1AUG A;  4R9M A;  5LYF A;  2BEI A;  4G1P A;  2YJT A;  3QAH A;  2R1I A;  2AFS A;  1QQ9 A;  3D8P A;  3KQX A;  2XEG A;  3EXN A;  5K8M A;  4BBH A;  4ZBG A;  3LOD A;  4RR2 B;  3P2F A;  4X3R A;  3IGR A;  4A4C A;  2NSM A;  1CX8 A;  4HNY B;  3T90 A;  3TCV A;  1OBR A;  4A2Z A;  5F46 A;  2EZA A;  3NH4 A;  2XPO A;  1EZA A;  1R43 A;  4M6G A;  3T5M A;  3DNS A;  3FJU A;  4MCR A;  4P45 A;  1Y7R A;  1F2P A;  4XPL A;  3TC8 A;  4KSF A;  2F8H A;  1Z5R A;  4OP4 A;  3GYA A;  3SJF A;  4TJX A;  3FNC A;  1QMU A;  1TF8 A;  2B5G A;  3IU1 A;  4F8Z A;  1LAN A;  1ZRS A;  2OLS A;  3SJE A;  1U6M A;  3DR8 A;  4PK3 A;  4OAD A;  3SI0 A;  2FL4 A;  1KUX A;  3CXQ A;  4UEE A;  1ARM A;  4CRZ B;  5K8O A;  1IY7 A;  2DIK A;  4ZI6 A;  3PFV A;  4K3N A;  4MMO A;  4TJV A;  4CAF A;  2Z3N A;  3FX6 A;  2WSA A;  3PB6 X;  2XPN A;  4KSI A;  3D7G A;  3BUN B;  3DDD A;  2Z3O A;  2JLM A;  2F5I A;  4NSQ A;  2ZEM A;  4MRI A;  5K99 A;  3NOJ A;  1WVM A;  3SXN A;  1KWM A;  4C9A A;  2VL1 A;  2ZED A;  3UY5 A;  3F8K A;  3IU2 A;  1YW6 A;  4MBU A;  4CYN A;  4C2X A;  4HNX B;  3CPX A;  3CZX A;  4QC6 A;  3F9K C;  3MN8 A;  4IIX A;  3MRU A;  4UFW A;  4A38 A;  4LQG A;  1J3L A;  2OZG A;  4KOY A;  2AFM A;  4MI1 A;  2ODF A;  1DTD A;  2JDD A;  3OP0 A;  4A32 A;  2PIY A;  2CIJ A;  4B5O A;  4WJB A;  3VWD A;  3EZA A;  2GAN A;  3A9L A;  3R96 A;  2Z3K A;  3P2H A;  4UBR A;  3TLE A;  4BPX B;  4F0X A;  1C3O B;  2O28 A;  2Y0M A;  5AG4 A;  1UWY A;  4DNC A;  4COB A;  3FF3 A;  4C99 A;  3TLG A;  1BXR B;  1F2O A;  2JBJ A;  3KI9 A;  4MFK A;  4KOV A;  4COG A;  3TOA A;  3S6H A;  4QB9 A;  4IAV A;  5F9M A;  2HB6 A;  2QVP A;  3MGD A;  1PYT B;  4A39 A;  4Q38 A;  4CGM A;  1T36 B;  4CAX A;  2FSR A;  4WWV A;  4CDK A;  1NSA A;  1HEE A;  3PLF B;  1B87 A;  5G20 A;  4BMH A;  4C9E A;  5A27 A;  2ZW5 A;  2J9A A;  1JQG A;  1LAP A;  3LD2 A;  3GUX A;  1WK4 A;  2FCK A;  2QML A;  2VXK A;  2Z10 A;  3ZJ0 A;  4OAE A;  4JJX A;  4M3S A;  2J8M A;  2CF4 A;  1Z8L A;  2Q43 A;  2Z3P A;  4PSX A;  3VAT A;  4B5P A;  1Q5X A;  4YRH A;  2ZEP A;  5DS0 A;  1LFW A;  2EK8 A;  3W91 A;  3EZE A;  1N71 A;  3SJX A;  2DXQ A;  1Z9U A;  4OKO A;  4E94 A;  3G23 A;  4PSW A;  3BUX B;  3KAS A;  2CXA A;  4R3L A;  4H1H A;  1VIX A;  3IO1 A;  4CS0 B;  1UFH A;  2P6E A;  1I1D A;  3I9S A;  2IJZ A;  5KTC A;  2PDO A;  3ZZI A;  1ZG7 A;  4UFV A;  5F47 A;  1XJO A;  3K9U A;  1S5K A;  4DJL A;  5KTD A;  1XF1 A;  3F5B A;  4YWY A;  2HRO A;  1ZG9 A;  2PJ1 A;  4X5K A;  3S9L A;  3D4U A;  4F0Y A;  1LRZ A;  2AUN A;  1CG2 A;  4RUH A;  4L89 A;  3W6S A;  3SXO A;  3TE4 A;  4AVA A;  2BL1 A;  2I3C A;  3HLP A;  3TT2 A;  1EZB A;  4CRY B;  4FUU A;  2CBL A;  1YRE A;  3QAY A;  4UWJ A;  4CO9 A;  2BUE A;  4AG9 A;  3B2Y A;  4UCP A;  2Q04 A;  3WT4 A;  1Q2D A;  4JYW A;  4A95 A;  5C88 A;  3T8W A;  1F57 A;  3GY9 A;  2VBQ A;  2G3A A;  4W9Y A;  2AE6 A;  3U88 C;  1YVK A;  5GCN A;  5BWA B;  4UF4 A;  3FED A;  1BO4 A;  4RI1 A;  2ZW4 A;  2V8D A;  1LAM A;  3BI0 A;  1GYT A;  4U5Y A;  4TWE A;  1FBV A;  1S7F A;  3D2M A;  4NGN A;  2RC4 A;  3D3S A;  3H4Q A;  4MHD A;  4PV6 A;  3VRR A;  3C26 A;  5EMI A;  2OU2 A;  4C68 A;  2X0S A;  3VGO A;  3I1U A;  2FM4 A;  4C2Y A;  4PXB A;  2B0A A;  2CNT A;  1EO0 A;  3PZJ A;  3TLY A;  2JDC A;  1MJA A;  5LYD A;  4RS2 A;  2PIZ A;  2WPX A;  4NFR A;  1KUV A;  5K8N A;  2Q4Z A;  3I6S A;  4NGQ A;  2B4D B;  3TLA A;  3OB1 B;  3NFZ A;  2DPS A;  2CNM A;  2P0W A;  4KLW A;  2EWB A;  4M85 A;  1Y0R A;  4MHP A;  3PT1 A;  1RTQ A;  4JXR A;  3TO9 A;  5G21 A;  3FIX A;  3PEI A;  4H89 A;  2JEV A;  3VTA A;  4R7M A;  1CP7 A;  2HUZ A;  4IHM A;  2ABZ A;  3TO6 A;  1OZP A;  5JGF A;  1IU8 A;  1QSM A;  4PXE A;  4ZGY B;  4AVC A;  1Z2L A;  4U9Y A;  2UV8 G;  4R3K A;  3CXS A;  1YW4 A;  3RO0 A;  2Q4Y A;  4NJR A;  2CNS A;  1ZL0 A;  4MCS A;  4C8A A;  2PRQ A;  3IWG A;  2GU2 A;  3TLB A;  3V7Z A;  4PK2 A;  5ELY A;  1HDU A;  1MK4 A;  4JWP A;  1Q2C A;  3EFA A;  3BJ8 A;  3IIB A;  4FWU A;  4C8T A;  4CZ1 A;  5DWM A;  4EFD A;  3K2K A;  4BPU B;  2PC1 A;  2FIW A;  4MCP A;  2PR8 A;  3DR6 A;  4E0A A;  4MHZ A;  2FE7 A;  3FB3 A;  3CDX A;  3VRO A;  2PJ5 A;  3BJ7 A;  3OWC A;  4JLY A;  4RN7 A;  2ZOG A;  3VRN A;  1BPN A;  1V0C A;  4C84 A;  1KEE B;  3D67 A;  1Z4E A;  3PGP A;  4UWI A;  4KLV A;  4FD5 A;  4XPD B;  2PR1 A;  1IOF A;  3CXP A;  2GE3 A;  2IMO A;  3D66 A;  5D8N A;  3N5F A;  3R1K A;  5HKY A;  4NGR A;  1XMT A;  2AJ6 A;  4CAV A;  5JH9 A;  4JVO A;  4NGM A;  4C7H A;  1XF8 A;  2YNC C;  3BLN A;  4MFQ A;  5EBV A;  5E96 A;  3CT9 A;  3B3C A;  1Z8W A;  2BO9 A;  1CM0 A;  4ZY2 A;  1CJW A;  4AVB A;  4CAW A; 
#chains in the Genus database with same CATH homology
 3IC1 A;  2PJ6 A;  2ZEH A;  3PFO A;  1BAV A;  5IB9 A;  3NA6 A;  3SI1 A;  1ZLI A;  4UIB A;  3KR4 A;  2QJ8 A;  4ZY0 A;  4BD9 A;  1BPM A;  2G9D A;  4B6Z A;  3B3S A;  3IEH A;  4OC2 A;  2ZEN A;  2PJB A;  2XEJ A;  2DEA A;  3DLJ A;  1LCP A;  3IFE A;  5LYI A;  2GP4 A;  3CPA A;  2XEI A;  3LMS A;  1YSJ A;  3H8G A;  4AXV A;  4R76 A;  4CDJ A;  2AFZ A;  1TKH A;  3BI1 A;  1V6C A;  4OC5 A;  2PJ8 A;  5HVG A;  2JEW A;  2IQ6 A;  4H2K A;  2OR4 A;  1ZLH A;  1CBX A;  3WC5 A;  2PJC A;  4OIW A;  4P4B A;  2ZEF A;  3GLJ A;  3IJ3 A;  3B35 A;  4FAI A;  3HUV A;  2PCU A;  2AFU A;  5HXD A;  2C6G A;  1VHO A;  1BLL E;  4FBE A;  1PCA A;  4JZ0 A;  3D68 A;  2C1C A;  2JBK A;  3DGV A;  4MXU A;  2AFO A;  3RBU A;  1VGY A;  3PB7 X;  5LRK A;  3FEC A;  3L2N A;  5JM6 A;  3BXM A;  4F9V A;  1Q7L A;  2C5Q A;  1TKF A;  1AYE A;  3PBE A;  2GLF A;  4C9R A;  4ONW A;  3RAM A;  5K8P A;  3B7I A;  2RB7 A;  1HDQ A;  1Y9Z A;  2NYQ A;  4P4E A;  3S9M A;  4YU9 A;  3B3W A;  5LYL A;  2PE3 A;  2BCO A;  2QYV A;  2POK A;  4P10 A;  2V8V A;  1XFO A;  4GM5 A;  4C8U A;  4OID A;  1YLO A;  1H8L A;  3WAB A;  4NJQ A;  4UIA A;  4C8P A;  4OME A;  3QNV A;  3EIF A;  4OC4 A;  4NGT A;  2ZEE A;  4R6T A;  3D7H A;  2PJ4 A;  2O53 A;  1ARL A;  3JRU A;  3K9T A;  4C9U A;  1EE3 P;  3D7F A;  1CPX A;  4DYO A;  2WYR A;  3SJG A;  2PJ2 A;  4O23 A;  4OC0 A;  2PJ0 A;  3RZA A;  2PVW A;  1ELM P;  1FT7 A;  1ELL P;  1ZG8 A;  1M4L A;  3B3V A;  4PXD A;  4ZX9 A;  6CPA A;  3KQZ A;  4PXC A;  4MCQ A;  4OC1 A;  2PJ7 A;  3KR5 A;  1Y7E A;  4MHN A;  3VH9 A;  4KNG E;  2ZEO A;  2V8H A;  4X8I A;  3GB0 A;  3KHX A;  3LWU A;  1TXR A;  2ZEG A;  2GLJ A;  3PBB A;  1TKJ A;  4P44 A;  1XMB A;  7CPA A;  5I4M A;  4ZX8 A;  4EME A;  4UEZ A;  1XBU A;  2FVG A;  4Q7A A;  5HVH A;  4ZYQ A;  2V77 A;  3B3T A;  2CTB A;  2C6P A;  4IK2 A;  3ISZ A;  5F09 A;  3I74 A;  4P4D A;  1FNO A;  3IWW A;  1Y0Y A;  4PQA A;  2AFW A;  5HVF A;  3FH4 A;  4TNU A;  5THW A;  1LOK A;  3H8E A;  4YN3 A;  2Q51 A;  1AMP A;  4Z65 A;  4C9V A;  2V8G A;  3FEE A;  4P4F A;  1TF9 A;  3KHZ A;  2BOA A;  5CBM A;  4P4I A;  3PRT A;  4A37 A;  3D7D A;  5IR2 A;  2ANP A;  4X2T A;  3WC6 A;  2AFX A;  4ZY1 A;  5J1Q A;  2RFH A;  3FMC A;  3PB9 X;  2CTC A;  1YME A;  4R8F A;  2XEF A;  3KZW A;  3PFE A;  3NH8 A;  2OOT A;  4P6Y A;  3TX8 A;  3BHX A;  2F7V A;  4C8C A;  3ISX A;  4F9U A;  3WC7 A;  2C6C A;  4C8F A;  1CP6 A;  3PB4 X;  1XRY A;  5CPA A;  4DUK A;  4UEF A;  4OC3 A;  4PPZ A;  1DE4 C;  3NH5 A;  4C86 A;  2ZOF A;  4NGP A;  3KGQ A;  1IGB A;  5D29 A;  3H8F A;  4EWT A;  4NGS A;  4C85 A;  2HC9 A;  1CPS A;  5LRG A;  3KL9 A;  2PJA A;  4MHY A;  3FVL A;  2ZEL A;  3S9N A;  4P4J A;  5LRJ A;  2PJ3 A;  4CPA A;  8CPA A;  2PJ9 A;  2WZN A;  4A94 A;  2PVV A;  3ICU A;  1R3N A;  2O4H A;  3V38 A;  3VAR A;  1VHE A;  2EK9 A;  3SI2 A;  2GRE A;  3PB8 X;  5LYF A;  4G1P A;  2AFS A;  1QQ9 A;  3KQX A;  2XEG A;  5K8M A;  4X3R A;  2NSM A;  1CX8 A;  1OBR A;  3NH4 A;  1R43 A;  3FJU A;  4MCR A;  4P45 A;  3TC8 A;  1F2P A;  2F8H A;  1Z5R A;  4OP4 A;  3SJF A;  4TJX A;  1QMU A;  1TF8 A;  4F8Z A;  1LAN A;  3SJE A;  3SI0 A;  4UEE A;  1ARM A;  5K8O A;  1IY7 A;  4ZI6 A;  4K3N A;  4MMO A;  4TJV A;  3FX6 A;  3PB6 X;  4KSI A;  3D7G A;  2ZEM A;  4MRI A;  1WVM A;  1KWM A;  4C9A A;  2VL1 A;  2ZED A;  1YW6 A;  3CPX A;  3MN8 A;  3MRU A;  4A38 A;  4LQG A;  2AFM A;  1DTD A;  2PIY A;  2CIJ A;  4WJB A;  1UWY A;  3FF3 A;  4C99 A;  1F2O A;  2JBJ A;  3KI9 A;  4IAV A;  2HB6 A;  2QVP A;  1PYT B;  4A39 A;  4WWV A;  4CDK A;  1NSA A;  1HEE A;  4C9E A;  2J9A A;  1JQG A;  1LAP A;  3GUX A;  3VAT A;  2Q43 A;  2CF4 A;  1Z8L A;  2ZEP A;  5DS0 A;  1LFW A;  2EK8 A;  3SJX A;  4OKO A;  3KAS A;  1VIX A;  3IO1 A;  2IJZ A;  1ZG7 A;  1XJO A;  4DJL A;  1XF1 A;  4YWY A;  1ZG9 A;  2PJ1 A;  3S9L A;  3D4U A;  1CG2 A;  4RUH A;  3HLP A;  2I3C A;  4FUU A;  3B2Y A;  3WT4 A;  4JYW A;  3T8W A;  1F57 A;  4W9Y A;  4UF4 A;  3FED A;  2V8D A;  1LAM A;  3BI0 A;  1GYT A;  4TWE A;  5JGF A;  4NGN A;  3I1U A;  4PXB A;  5LYD A;  2PIZ A;  4NFR A;  5K8N A;  2Q4Z A;  3I6S A;  4NGQ A;  3NFZ A;  4MHP A;  2EWB A;  1Y0R A;  1RTQ A;  3PEI A;  3VTA A;  4R7M A;  1CP7 A;  4IHM A;  2ABZ A;  4PXE A;  1Z2L A;  1YW4 A;  4NJR A;  4MCS A;  4C8A A;  2PRQ A;  2GU2 A;  3V7Z A;  5ELY A;  1HDU A;  3IIB A;  4FWU A;  4C8T A;  4EFD A;  3K2K A;  4MCP A;  4MHZ A;  3CDX A;  2PJ5 A;  2ZOG A;  1BPN A;  4C84 A;  3D67 A;  2IMO A;  3D66 A;  5D8N A;  3N5F A;  4NGR A;  5JH9 A;  4NGM A;  3CT9 A;  3B3C A;  2BO9 A;  4ZY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...