3O8ZA

Crystal structure of spn1 (iws1) core domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
152
structure length
152
Chain Sequence
DPFTDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor IWS1
publication title Structure and biological importance of the spn1-spt6 interaction, and its regulatory role in nucleosome binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 60
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3o8zA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3o8zA02
3M06A 2XPLA 2WWWA 4HYTB 3B8EB 2Q7CA 3HTKA 3MGNA 5APQA 2R5BA 4C7NA 4KHXA 5AW3B 1GK6A 3TK1A 3A3YB 1OXZA 1GU5A 1MUUA 3HE4A 1H88A 5AW1B 3VYIA 3UIAA 3TYYA 3KQGA 5APSA 4C46A 5AW7B 3L37A 5AW9B 5AW4B 5AVSB 3SWFA 3U88C 1FAVA 1DH3A 2E43A 5AVTB 1MV8A 2N9BA 2XZRA 2H7HA 1SLQA 3VMYA 2P67A 3M0DA 1A02J 1CSBA 1Z9EA 4RESB 1JNMA 1HUCA 2ZFCA 2BASA 2C9LY 1NWQA 3HE5B 3P8MC 3MD0A 1GD2E 3VN0A 3IR9A 4XE5B 3M9BA 3NTNA 5AVRB 5AW5B 1T2KD 3A7OA 4B86A 2QM8A 5AVYB 3HPGG 5AW6B 5AVVB 1CZQA 5CMZA 3VMXA 1X8YA 3A5TA 3P32A 3NMDA 1SP4A 2C9NY 3OAKA 2ZXEB 2XPNA 1CI6B 1HJBA 1IO4A 1CI6A 1H8AA 4JYCA 5AVWB 4DZOA 1FOSF 4EOTA 2WPSA 5AW2B 2WPQA 2WT7B 5AVXB 1T2KC 3I5CA 1HBWA 4I6MC 2Q5UA 4GT1A 1H89A 3VMZA 2YO3A 3VTPC 2QM7A 2WTYA 2P2UA 3NFQA 2W6AA 3HE5A 2N3AB 4AQRD 1GK4A 3T97A 1OWAA 2R5DA 2KP8A 2YO2A 5AW0B 2W27A 2XU6A 2JJLA 3M91A 3NXSA 3HPHE 5APYA 5AVQB 4JYBA 1WJTA 3KDPB 3V5BA 4C7NB 1J2JB 1S9KE 3LIDA 4AYCA 5AW8B 1YYCA 2XPOA 3F9KC 4GKGA 1S9KD 3L36A 3O8ZA 2Z5IA 4AUWA 1G2CB 1GU4A 2XV5A 3HE4B 3TNUB 4LC1A 5APXA 2IPPA 2R3CA 3A2AA 2WT7A 5APUA 3TNUA 3V4QA 2B4JC 2Q3IA 1GZLA 2Z5HA 2VRSA 1HWTC 3M0AA 1JUNA 3L35A 5APTA 2YNYA 1MFZA 5AVZB 2E42A 3V4WA 2XPPA 4I2LC 5AVUB 1GTWA 3LIEA 3P7KA 2P7JA 1FOSE 4M3LA 2WPRA 1A02F 2R32A 1KQLA 5APWA 1EO0A 1NAFA 5APVA 3M9HA
chains in the Genus database with same CATH superfamily
1EDJA 3B8EB 2M3BA 3FEDA 1QVGO 1OXZA 1YQ4C 3MP7B 1SQQJ 5HKWA 5BVZA 2D2CD 3H1LE 4EDFA 4BRYA 2LXBA 3VMYA 1KORA 2FKWB 3EWKA 4XE5B 2OARA 3A7OA 1X8YA 3SSUA 1EDLA 3RK3C 2QEXP 1LWUC 3BCCJ 2Q1KA 3GHGA 5CCGD 4NGTA 5DJTB 1HJBA 1NTMJ 1J1EC 1X9VA 1VQLP 2WPVB 1SFCA 1PGJA 1FJPA 1GW3A 3L73E 4NGQA 3T97B 2N3AB 3L73D 2Q3EA 3L74G 2YO2A 2KOGA 1L0LJ 2H89C 2XPOA 1J2JB 1NTKJ 2NPSB 2IYPA 1VQPP 3CCEP 3AE3C 3LW5H 4U3FJ 1N86A 1VPCA 1LWUA 1HWTC 1NAYA 1MFZA 1S4XA 2ZVOB 4IFDK 1DEEG 1SQPE 1A02F 1P84E 3KASA 3AEDC 2ZVNB 1P84D 3B4SA 3HUSB 1NTZE 3BUNB 1SQQK 3AE7C 2B87B 1NTZD 2K37A 1S2EA 2G8YA 2R5BA 4KHXA 2YIUB 4OWFA 4I1LA 2KSJA 1KC8Q 1NYHA 3AE6C 1GU5A 2WITA 5AW1B 3L72J 4GODA 1VQ9P 3KHUA 1A02J 5B66H 1NU1J 3MZWB 1YI2P 3BCCD 2IDBA 3VN0A 3IR9A 3VRQA 2NPSC 2HFED 1NTMK 4W7ZA 4N3YB 3PP5A 1NTMD 5E79E 1W5CE 4H13B 3P32A 2OYOA 3CCUP 1LNQA 4O9BA 1B47A 3H32B 1OZHA 1SQVK 3D7GA 1SQVD 1VQ6P 1H8AA 3SJXA 2WPSA 4I7ZB 1L0LK 3AEAC 5KJ7D 1N7SB 4L74A 1FZAA 3HUSC 3CWBG 5DJUB 2WSSH 1IFDA 1OW6A 3GG2A 1GK4A 3T97A 2IFMA 3HPHE 1BGYE 3USSA 3VGOA 4U3FD 1BGYD 1ZP0C 4GKGA 4MCPA 4HB1A 4W7YA 2NPSA 1PGPA 2B4JC 4IL6E 1IK9A 1ZR4A 5AVZB 1GDTA 3V4WA 1T8ZA 3H1HJ 3PFVA 4RKUJ 1NKZB 1PGQA 3P8CE 3W68A 3P8CD 1AJYA 5APVA 4H13C 5ELYA 3HUSA 1QGKB 3D6YA 2XKMA 1OIPA 4OH8B 2V4HA 4NGPA 3N4XA 1NU1K 3RGUA 3TYYA 3G4SP 1N7SC 3CL3D 3U88C 1FAVA 2AXTE 1LTSC 3BXMA 1SQBJ 4YTPC 3HD7D 3HE5B 1ZRTD 3JCUE 3WUTA 3L75E 3L75D 4H0LB 1CZQA 3ZNIA 3VRPA 3OA7A 3OW2O 1ZR2A 2C9NY 4ASVA 3WMM0 1K04A 2E74D 4LLHA 5AVWB 3H25A 2CBLA 1IFMA 3KXDA 5CBOA 2WTYA 4OMEA 1VQMP 4JYBA 5GTHH 1R5LA 5KLVJ 3C9IA 1NOHA 1FBMA 5BY0A 1VF5D 3H1HD 3VP9A 1EZVG 3HMJG 2Z5HA 1W2BO 1JY2N 5AVUB 3LW5J 1LP1B 3SWKA 2H8PD 2KK7A 4H0LC 1PP9J 3PTZA 1URQB 1Y9BA 1OMIA 3M9HA 5KJ7C 3FGAD 3E7KA 1WT6A 1RQUA 1BCCJ 4R4MA 1G1IA 1S5LX 1FZBA 1SQBK 2FFDB 3HD7B 1X0TA 2OGUA 2XZRA 4WY4D 1FBVA 3V2NA 1HF9A 4ZNCA 3SWYA 1HVVA 2WMMA 3GF7A 2G3AA 3RL0B 2W90A 2DLAA 1UIIA 2UWJE 3CX5I 1JB0J 1JMMA 5KJ7A 3L74E 2ZYDA 2QRXA 4OC4A 1SQQG 1IO4A 4MCRA 1USDA 4JYCA 1KTMA 2UV8G 3CCRP 3I5CA 4IOIH 1LTGC 4P4IA 1IZNB 2E75D 3BUMB 3KZIE 1URQC 5KLVK 2O1JA 2W6AA 1KQFB 1R8EA 5KLVD 3H1KG 2R5DA 2FXPA 1JY3P 1U57A 2W27A 3GMAA 4A4BA 5AVQB 5KAFH 3O8ZA 3BCCG 4NPDA 3HD7C 1LT9B 1QL1A 1UIXA 3II6A 3CI9A 2C6CA 2PRRA 1S72P 1JUNA 3I55P 2K9YA 3L35A 4HJGH 2GM4A 3V2RA 3RL0C 2WPRA 3V2QA 1QLED 2JWDA 4UB8H 2XNXA 3TDKA 1L0LG 3G6EP 1VQ7P 1XTCC 1NTKG 1JTHB 2GUSA 3U59A 3AE4C 3BUOB 3KQGA 4DJGA 3FXDA 1M90Q 1NGMB 3RK3E 3HD7A 3ZDMA 2M5AB 2N9BA 3VRRA 3L71J 3CCQP 2FYUJ 1EZVI 2QJYB 1L4AB 3A0BE 1QX8A 3BRVB 5H2FH 2HODB 5AVYB 3CWBE 3CWBD 1IC2A 3AE9C 3O6QA 4IFFA 2DW3A 4BTFA 2JDIH 3L72G 1TU3F 1IFPA 2WT7B 4CPGA 2FYNC 2WSEJ 2J5UA 3L70G 1NU1G 3VTPC 4XA4A 2P2UA 4OC0A 4YXWH 2OOTA 2ITAA 3IAOA 4KT0J 1E5WA 1YHQP 1AVYA 3U1AA 1WJTA 3CC4P 1Y8AA 1LGHB 3LIDA 3E1RA 2AXTH 1YTZI 3TGUJ 1GU4A 2JWAA 1M56D 1BE3E 3CX5E 3I56P 4LC1A 4UB6E 5APXA 3CX5D 4A4CA 1KQGB 1JY2O 3JCUH 1M1JB 3V4QA 2Q3IA 1DE4C 2QJYC 1L4AC 4W9YA 2VRSA 1K9MQ 1PGOA 2YNYA 2ZAEB 4OC5A 1OW8A 1KZUB 1Q2NA 2B88A 1FOSE 4P4FA 1VQNP 4PJ0H 5APWA 3CC2P 3PT1A 2O01N 3MGNA 3A3YB 3HE4A 2FYUK 1JTHA 4KJMA 5BU5A 2FYUD 4WY4A 2NPSD 4NPFX 1HJ0A 4DOJA 3SWFA 3D7DA 2KSEA 4BPXB 1S5LH 2A45H 1J1DB 3CXHI 2RH0A 1HUCA 3CCMP 2ZFCA 4WB4A 2R3SA 1VQOP 3SJGA 5AW5B 3A0HE 2HODA 2KNCB 1Q81Q 1M1JC 1GMJA 1SQXG 1Q7YQ 1N2DC 3GLMA 1ZOYC 1DD4A 4EOTA 2WPQA 1JO5A 3G9RA 3H1KJ 5TISE 1EZVE 2QJPB 1EZVD 1SQBG 2POHA 4AQRD 5KKZC 4WWIA 1OWAA 3EFFK 1KN7A 1DIPA 1GL2B 2JBKA 2YKPA 4AYCA 5BU8B 2R3CA 3OP0A 4H13D 4ZMDA 2AEJA 2AEMA 2XPPA 3RBZA 3CC7P 3JSVC 1YVHA 2I1KA 1GW4A 2OYIB 1N7SD 1NAFA 4GPLB 4W80A 5APQA 5B5EE 5KLVG 1FE6A 4N6JA 3C8VA 2R44A 1HGZA 2BCCJ 2ZT9B 5AW7B 3CCLP 5KAIH 3QH9A 1AA0A 2P67A 2K9JB 1M1KQ 1KB9H 1SQQE 1GL2C 1SQQD 1PP9G 2W8ZA 3P8MC 2P10A 2HPCB 3OJAB 1ZW0A 2P58A 1L2PA 1BCCG 2GA1A 4GOFA 3H1KD 3PHLA 3VROA 1ZV8A 3L70J 3D70A 1PPJG 1D7MA 3BCCE 4GT1A 1IFNA 3FWNA 3FX0A 2I8DA 2WSFH 1NTME 4BPWB 3CXHD 1RF1B 3GW6A 3QWOC 1PV3A 1YYCA 3S1KA 1SQVE 2Z5IA 3R2PA 3E1IA 4PD4H 4H0LD 3A0BH 3CLQA 3JC22 1L0LE 2IPPA 1L0LD 1OFCX 4H44D 1NTKK 1NTKE 1GZLA 1NTKD 3M0AA 3CD6P 2E42A 4BXLA 2YIUC 3BATA 1QVFO 4U3FE 1HTLC 2OTKE 1HH0A 1N73B 1YIJP 4P4EA 4C7NB 2BCCD 2PVVA 5CJ0A 1OX3A 3Q5PA 2HR3A 2YMKA 1KYOH 5APSA 2KZJA 2OYHB 4DCKA 1LTBC 3H1JG 2YKQA 3Q2YA 4BWNA 3CCSP 2KIKA 1QEXA 2V7QH 1VDFA 1FZFA 2QA4P 3AEGC 3L72E 3L72D 1RY3A 1JEKA 4UB6H 2QSIA 1BDCA 1GD2E 2B87A 2N1TB 3M9BA 2QM8A 3HPGG 1NU1E 2YKOA 4I7ZC 1URQD 1NU1D 2IZ0A 3KYQA 3L70D 1SQXJ 2RMZA 1G1JA 2W6JH 4NPEA 1JOCA 1T3UA 4X3RA 2Z4EA 2CPSA 2KB7P 4IL6X 2IFNA 2H43A 3L71G 4IFMA 4I6MC 3VP8A 1ZRTE 2FYUG 4YPCA 1FS0E 2Y9YA 1SS1A 3RK2D 2KP8A 2NRGA 2YXQB 4PV1B 4H44B 2BEZF 1BSNA 3F9KC 2LKMA 1PIXA 3HTKB 3RL0D 3H32A 3CPWO 1M8OB 1VQKP 1KILD 3A0HH 4EIJA 1XTGB 2M3EA 1N7SA 2IX7C 3P7KA 1YTZT 2N1TC 2XEIA 4HH2A 1X79B 2Q7CA 4XFJA 2PFXA 3H1HE 1DEBA 4C7NA 3TGUG 1GK6A 4OGQD 3H1IJ 5TISH 2M0BA 2Q9IA 3VYIA 3PLNA 1PL5A 3UIAA 3BI0A 3H1LG 1WRGA 2KXPB 4RJTA 3HRNA 3TSIA 1CSBA 1SQXK 4RESB 1JNMA 4OC2A 1SQXD 4H44C 3RBXA 2WVRA 4JPZB 2GUVA 4EI2A 3VMXA 3IF4A 1SQBE 1SQBD 3OAKA 2O1KA 2HYNA 3FWLA 1LJ2A 3RK2B 5AVXB 2Y0EA 3BI1A 2Q5UA 3ITKA 5B5EH 3MTUE 3CMEP 1NHLA 3HE5A 3AE8C 1RHZB 2ZXXA 1L4AD 4L73A 2JJLA 1KILB 4GOEA 3V5BA 2HG5D 1P84H 2WSFJ 2JO1A 4AUWA 1G2CB 2O01H 3D6ZA 3MIWA 2LXCB 1OW7A 3MHVA 1SQPG 5KLVE 5APTA 4HKZH 3G3ZA 1ZMEC 2FBWC 4OGQB 4OVNF 2C6PA 1FJKA 3SJEA 3M06A 1CX8A 2FFDC 1JY3O 2C0WA 1MKMA 3D7HA 3PRJA 1MUUA 1NVOA 3H1JJ 1PP9E 4OC3A 3RK2C 1PP9D 3FECA 5E79H 3B5NB 1AV1A 2RN0A 1BCCE 2XNDH 1KQSO 1BCCD 1LP1A 1KILC 1URQA 2W6BA 5TJHA 1RE4C 1PPJE 2V7QJ 1PPJD 5AVRB 1VQ4P 5AVVB 5CMZA 2J59M 4D6TJ 2N9YB 2IBZG 3KPEA 2ZXEB 2FFDA 3B71A 2BCCG 2PVWA 1PZQA 4QMAA 5B66E 4N78D 2ZJSE 4OGQC 2KS1B 4ZKPA 1RE3C 1H89A 1RF0C 2QG4A 2KUBA 1L0NJ 2CIJA 4IL6H 1LT9C 3IFMA 1JCCA 5CCHC 4ZKUA 1YBKA 4OC1A 3Q1MA 4Y99B 1KILA 2JKVA 3B5NC 1RE4A 2L5GB 3EFGA 1S1CX 4K35A 2Y9ZA 3A2AA 3Q5SA 5EFWB 2FYZA 3FF3A 4U7JA 3LIEA 1FZCB 3H1JD 1LTJB 1RE3A 1YJNP 1AQ5A 2AXCA 1RF0A 3PH0A 1IFIA 3H1LJ 4JQ0D 5F09A 1LT9A 1GL2D 1M57D 1Z8LA 3GHGB 5CBNA 2JP3A 3L37A 2KLVA 2A06G 3S9OA 1JY2P 4Z1MH 1R5SA 3MUDC 3AEFC 1SLQA 1SFCB 4LQGA 2C9LY 4Y99C 3MD0A 4WBAA 1AFOA 1MZ9A 3L71E 3F89A 4EYYQ 2FYUE 3L71D 3OB2B 2B9BA 2E5YA 2KI7B 3M9QA 2QIWA 2PAJA 3BUWB 3VRNA 3VMAA 3NMDA 5J3XA 4MCQA 5CHXA 3L73J 4RR2B 2QJKB 4TLFA 1FZCC 2M5AA 1T2KC 2ZT9D 1LWUB 1L4AA 2KS1A 1LTJC 3NFQA 4JF7A 1E79H 1K8AQ 2A45G 5F13A 3L36A 2WSCH 1N8RQ 4MCSA 3TNUB 1SQPJ 3V6IA 2WT7A 1SFCC 3S9MA 3TGUE 2IBZI 2O01J 3Q3DA 3TGUD 1NTZJ 4WVZA 5GTHE 3H1LD 1H0TB 1FZCA 5AXIA 2E76D 1EO0A 2CPBA 2XEJA 1LTJA 3IN6A 1RH5B 3WU2E 1JMBA 1H88A 2QJKC 1J1DC 2Q6QA 3G71P 4P4JA 2JBJA 2WQYC 1M1JA 4P4BA 1ZN5A 3Q5RA 2Y0CA 1FDMA 3KZIH 2ZYAA 1LTAC 1SQVJ 1BDDA 5AW6B 1KD1Q 4DT0A 3H1IG 4A7PA 1MFTA 2VKZG 1LTTC 5GTIE 1EQ7A 2QJPC 3SFEC 1T6AA 4C7RA 1BGYJ 3AEEC 3BVHA 1SQPK 3N7NA 3TF5A 5AW0B 1EDKA 1SQPD 3H1KE 3KDPB 5AW8B 2KNCA 2N1TD 1NTZK 1EDIA 2K1AA 1KMIZ 2D2CB 2FXOA 5HKYA 4LGDE 2XDJA 2OYIC 3TNUA 2E76B 3CXHE 4I2LC 2KZIA 2OR4A 1FZGA 1LTIC 5KAFE 1JCDA 2OQQA 2K3RA 1H0TA 2ZT9C 1GL2A 4HYTB 2PP6A 4PV1D 2A45I 1Q90D 4P45A 2KYVA 4P44A 1FDIA 4UB8E 5KLIB 2IBZE 3L75J 2IBZD 2BCCE 3S9NA 1EC5A 2O3JA 2OYIA 2BASA 3AEBC 1NO4A 1JY3N 2ZYGA 3PJSK 2D2CC 2E76C 3FXEA 1CI6B 2AEFA 1K05A 1T3JA 1BSHA 1RF1C 3BRTB 2K9JA 3CX5H 2OTJP 3BASA 2YO3A 3CMAP 5H2FE 3AE5C 4L76A 2YMYA 3L70E 5CCGC 4JYWA 2HPCA 2XU6A 1BE3G 4D6TG 4GDOA 3H6PA 3OB1B 5KLIC 5L8RJ 1N73C 2QVAA 2WSCJ 3CCVP 1Y47A 2JR8A 1L0NG 1RF1A 1OVUA 1KQLA 2A06E 3WUUA 2A06D 2OYHC 2XPLA 4L75A 4MN4C 1USEA 3S9LA 2FY8A 1KILE 3K5BA 5CCGA 1VQ5P 1AQTA 4R4LA 1DD3A 1KB9I 2WSEH 4PJ0E 1DH3A 2E43A 5AVTB 1OVRA 1IJDB 1N73A 3SJFA 1FZEA 1W2EA 3L74J 4TT3H 2FXMA 4B86A 3PLFB 2M8RA 1U7MA 1EXJA 3WUVA 1SP4A 3R4YA 2OYHA 1S5LE 5CCHD 1CI6A 1PFIA 1SQXE 2KLUA 1YJ9P 4PV1C 3B5ND 3WU2H 5HKZA 2LR2A 2XEFA 2N1TA 2E5TA 4PD4I 2Y1NA 1WMKA 1Z56A 1YITP 2Y0DA 1HGVA 2K88A 3L73G 1Q82Q 1K73Q 1FC2C 3AE2C 3S4RA 1S3JA 1NH4A 1GTWA 4JBZA 1U7JA 3D71A 5GTIH 1IK7A 4K3AA 3BUXB 1KYOI 1YQ3C 2WWWA 3HTKA 3L4FA 2B89A 5AW3B 3RBUA 1AVOA 2E74B 2H88C 3O6QB 2P1JA 2PGDA 4JZ0A 3VOPA 3H1IE 3L74D 1NTZG 2H7HA 3BHXA 3H1ID 1Z9EA 3CWBJ 1NWQA 4ASWA 3EQ2A 4NGRA 1T2KD 3SFDC 1OVVA 3CXHH 1VF5B 1KFMA 5KAIE 4NGSA 1ZLLA 2XPNA 2RKLA 4DZOA 4P4DA 1FOSF 1KB9E 5AW2B 1KB9D 1CW5A 1NTMG 3ABVC 2C0XA 3GF3A 2QM7A 1FU1A 1SFCD 1BE3J 2SPZA 4RO0A 1SQVG 2E74C 2FYNB 3C1LA 2OTLP 3F5HA 1YJWP 1Q86Q 4N78E 2JEEA 2XV5A 3HE4B 3M0DC 4WY4B 1LT1A 2NZ2A 5M1BA 1KFNA 1N7LA 4BPUB 4U3FG 1BGYG 3D7FA 3CCJP 1M7LA 2W83C 4Y28J 5CJ4A 3RK3D 1ZXGA 1VF5C 1NKNA 4PD4E 4PD4D 1G2CA 3U1CA 3TK1A 1SVFA 1RQVA 3FEEA 2MKVA 2I1JA 4C46A 2E75B 5AW9B 1NJIQ 4BRYB 5AW4B 5AVSB 2HLOA 3V2PA 1MV8A 3H1JE 2IYOA 4NGMA 3M0DA 1QL2A 1KV4A 3RL0g 3NTNA 1JM0A 1KYOE 1KYOD 5CCHA 3A5TA 2J58A 1VL2A 4WY4C 3B5NA 5D29A 3AE1C 1EXIA 1BE3D 1X22A 4D6TE 1HBWA 3AECC 4D6TD 3L75G 3VMZA 4NGNA 5C39A 2BEQD 1P84I 5K5GB 2L91A 2MJZA 5KTBA 3M91A 3NXSA 5APYA 1IFJA 2CK3H 1S9KE 1L0NK 1L0NE 1S9KD 1L0ND 2E75C 1FDOA 2QE7H 3W67A 1DX7A 5KKZB 3RK3B 5APUA 3IWWA 2IZ1A 3MUDA 1J1EB 2P7JA 4M3LA 2YXRB 4YXDC 2C6GA 2R32A 2Y1MA 3H1HG 2WZ7A 1VQ8P 3GHGC 4GIFA 2XEGA
chains in the Genus database with same CATH topology
1X79B 4HYTB 3B8EB 2M3BA 2Q7CA 1DEBA 1XTCC 4C7NA 2PP6A 1JTHB 1GK6A 1OXZA 2GUSA 3U59A 2Q9IA 3VYIA 3UIAA 2A45I 3KQGA 1WRGA 2KYVA 3HRNA 3TSIA 5BVZA 3HD7A 2N9BA 3VMYA 1CSBA 1L4AB 1SQXK 2FKWB 4RESB 1JNMA 2OYIA 2BASA 1NO4A 4XE5B 2OARA 3BRVB 1JY3N 2GUVA 3A7OA 2HODB 5AVYB 3VMXA 1X8YA 3RK3C 1LWUC 1IC2A 3GHGA 2O1KA 3OAKA 4IFFA 2HYNA 5CCGD 1CI6B 1HJBA 1T3JA 1J1EC 1RF1C 1X9VA 3RK2B 2WT7B 3BRTB 5AVXB 1SFCA 2Q5UA 3BASA 3MTUE 2YO3A 4XA4A 3VTPC 1FJPA 1NHLA 2P2UA 1GW3A 3HE5A 2N3AB 1E5WA 2YMYA 5CCGC 1L4AD 2YO2A 2HPCA 2KOGA 2JJLA 2XU6A 1KILB 3U1AA 1WJTA 3V5BA 2HG5D 1J2JB 1LGHB 3LIDA 2XPOA 1YTZI 2NPSB 4AUWA 1G2CB 2O01H 1GU4A 3H6PA 3MIWA 4LC1A 5APXA 3LW5H 1JY2O 1N73C 1M1JB 1N86A 2Q3IA 1VPCA 1LWUA 1L4AC 3V4QA 2VRSA 1HWTC 5APTA 2YNYA 1MFZA 3G3ZA 1KZUB 4IFDK 1FOSE 1A02F 1RF1A 1FJKA 1KQLA 5APWA 3HUSB 3M06A 2OYHC 2FFDC 1SQQK 2XPLA 1JY3O 2C0WA 3MGNA 2R5BA 4KHXA 4I1LA 2KSJA 3A3YB 5CCGA 1GU5A 1MUUA 3HE4A 2FYUK 1JTHA 2WITA 5AW1B 5BU5A 3RK2C 4WY4A 2NPSD 3B5NB 2WSEH 4DOJA 3SWFA 1DH3A 2E43A 5AVTB 1A02J 1IJDB 1J1DB 2A45H 1HUCA 1N73A 2ZFCA 4WB4A 1KILC 1URQA 1FZEA 2W6BA 1RE4C 1W2EA 3VN0A 3IR9A 2NPSC 2HFED 5AVRB 5AW5B 1NTMK 4W7ZA 4N3YB 2FXMA 4B86A 3PP5A 2M8RA 5AVVB 5CMZA 2HODA 2J59M 3P32A 1SP4A 3KPEA 2ZXEB 1M1JC 4O9BA 2OYHA 3H32B 2FFDA 1N2DC 1SQVK 4N78D 5CCHD 1CI6A 1H8AA 1PFIA 4EOTA 2WPSA 2WPQA 1JO5A 1L0LK 4ZKPA 3B5ND 1RE3C 5KJ7D 1H89A 1N7SB 1FZAA 1RF0C 3HUSC 1IFDA 2POHA 4AQRD 1GK4A 1LT9C 2N1TA 3IFMA 3T97A 1JCCA 1OWAA 5CCHC 2IFMA 3HPHE 4ZKUA 1GL2B 4Y99B 1Z56A 2YKPA 4AYCA 1KILA 4GKGA 3B5NC 1RE4A 1HGVA 4W7YA 2L5GB 2NPSA 3EFGA 5BU8B 2R3CA 3A2AA 2B4JC 1IK9A 1ZR4A 2FYZA 5AVZB 1GDTA 3V4WA 1T8ZA 2XPPA 1NH4A 3LIEA 1GTWA 1FZCB 1NKZB 2I1KA 1GW4A 2OYIB 3P8CE 1N7SD 1LTJB 1RE3A 3P8CD 1NAFA 5APVA 1AQ5A 2WWWA 1RF0A 3HUSA 3HTKA 3L4FA 4W80A 5APQA 1IFIA 2XKMA 4OH8B 5AW3B 1LT9A 3N4XA 4N6JA 1GL2D 1NU1K 1HGZA 3TYYA 3GHGB 5AW7B 3L37A 2KLVA 2P1JA 1N7SC 3VOPA 1JY2P 3CL3D 3U88C 1FAVA 2H7HA 1SLQA 2P67A 1SFCB 1Z9EA 1LTSC 2C9LY 1GL2C 3HD7D 4Y99C 3HE5B 1NWQA 3P8MC 3MD0A 3EQ2A 4WBAA 1AFOA 1MZ9A 1T2KD 2HPCB 1CZQA 1KFMA 3M9QA 2PAJA 3OJAB 3OA7A 3NMDA 1ZR2A 2C9NY 1ZLLA 2XPNA 3WMM0 5CHXA 1ZV8A 4LLHA 5AVWB 4DZOA 1FOSF 1FZCC 5AW2B 1CW5A 1T2KC 1IFMA 1LWUB 1L4AA 4GT1A 2C0XA 1IFNA 1LTJC 2QM7A 2WTYA 3NFQA 2WSFH 4JF7A 1FU1A 1RF1B 1SFCD 2A45G 4JYBA 1YYCA 4N78E 3L36A 2WSCH 2Z5IA 3C9IA 1NOHA 3E1IA 3R2PA 1FBMA 2JEEA 2XV5A 3CLQA 3HE4B 3TNUB 3M0DC 3VP9A 2IPPA 4WY4B 1KFNA 2WT7A 1N7LA 1NTKK 1SFCC 1GZLA 2Z5HA 3M0AA 1JY2N 2E42A 1M7LA 5AVUB 5CJ4A 3BATA 3RK3D 1HTLC 1HH0A 2H8PD 1FZCA 1N73B 1EO0A 1URQB 1NKNA 3M9HA 4C7NB 2CPBA 5KJ7C 1LTJA 1G2CA 5CJ0A 3U1CA 3TK1A 1WT6A 1SVFA 1H88A 1J1DC 1G1IA 5APSA 1FZBA 1SQBK 2I1JA 1M1JA 4C46A 2FFDB 1LTBC 2OYHB 3HD7B 2YKQA 5AW9B 5AW4B 5AVSB 2HLOA 3V2PA 1MV8A 2XZRA 4WY4D 3M0DA 3V2NA 1VDFA 1FZFA 1QL2A 1RY3A 3SWYA 1HVVA 1ZN5A 1GD2E 1FDMA 2N1TB 3RL0B 3M9BA 1LTAC 3NTNA 2QM8A 3HPGG 5AW6B 2YKOA 5CCHA 1URQD 3KYQA 3A5TA 1G1JA 2J58A 4WY4C 1LTTC 3B5NA 1JMMA 5KJ7A 1EQ7A 1JOCA 1T3UA 1IO4A 4JYCA 2Z4EA 2CPSA 2KB7P 2IFNA 2H43A 4C7RA 3I5CA 1HBWA 4IFMA 4I6MC 1LTGC 3VP8A 3VMZA 1URQC 5KLVK 2O1JA 2W6AA 3BVHA 1SQPK 3N7NA 2R5DA 2KP8A 2MJZA 1JY3P 5AW0B 3RK2D 5KTBA 2W27A 3M91A 3NXSA 5APYA 5AVQB 1IFJA 3KDPB 1S9KE 3F9KC 5AW8B 1L0NK 2LKMA 3HTKB 1S9KD 2N1TD 3O8ZA 1NTZK 3RL0D 3HD7C 3H32A 1DX7A 1LT9B 1QL1A 4LGDE 3RK3B 2XDJA 3II6A 1KILD 3CI9A 2OYIC 5APUA 3TNUA 4EIJA 1XTGB 1JUNA 3L35A 1N7SA 3MUDA 2IX7C 1J1EB 4I2LC 2GM4A 3V2RA 3P7KA 1YTZT 2N1TC 2P7JA 3RL0C 4M3LA 2WPRA 3V2QA 1FZGA 2R32A 1LTIC 1JCDA 4HH2A 2WZ7A 2XNXA 3GHGC 4GIFA 1GL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M06 A;  2XPL A;  2WWW A;  4HYT B;  3B8E B;  2Q7C A;  3HTK A;  3MGN A;  5APQ A;  2R5B A;  4C7N A;  4KHX A;  5AW3 B;  1GK6 A;  3TK1 A;  3A3Y B;  1OXZ A;  1GU5 A;  1MUU A;  3HE4 A;  1H88 A;  5AW1 B;  3VYI A;  3UIA A;  3TYY A;  3KQG A;  5APS A;  4C46 A;  5AW7 B;  3L37 A;  5AW9 B;  5AW4 B;  5AVS B;  3SWF A;  3U88 C;  1FAV A;  1DH3 A;  2E43 A;  5AVT B;  1MV8 A;  2N9B A;  2XZR A;  2H7H A;  1SLQ A;  3VMY A;  2P67 A;  3M0D A;  1A02 J;  1CSB A;  1Z9E A;  4RES B;  1JNM A;  1HUC A;  2ZFC A;  2BAS A;  2C9L Y;  1NWQ A;  3HE5 B;  3P8M C;  3MD0 A;  1GD2 E;  3VN0 A;  3IR9 A;  4XE5 B;  3M9B A;  3NTN A;  5AVR B;  5AW5 B;  1T2K D;  3A7O A;  4B86 A;  2QM8 A;  5AVY B;  3HPG G;  5AW6 B;  5AVV B;  1CZQ A;  5CMZ A;  3VMX A;  1X8Y A;  3A5T A;  3P32 A;  3NMD A;  1SP4 A;  2C9N Y;  3OAK A;  2ZXE B;  2XPN A;  1CI6 B;  1HJB A;  1IO4 A;  1CI6 A;  1H8A A;  4JYC A;  5AVW B;  4DZO A;  1FOS F;  4EOT A;  2WPS A;  5AW2 B;  2WPQ A;  2WT7 B;  5AVX B;  1T2K C;  3I5C A;  1HBW A;  4I6M C;  2Q5U A;  4GT1 A;  1H89 A;  3VMZ A;  2YO3 A;  3VTP C;  2QM7 A;  2WTY A;  2P2U A;  3NFQ A;  2W6A A;  3HE5 A;  2N3A B;  4AQR D;  1GK4 A;  3T97 A;  1OWA A;  2R5D A;  2KP8 A;  2YO2 A;  5AW0 B;  2W27 A;  2XU6 A;  2JJL A;  3M91 A;  3NXS A;  3HPH E;  5APY A;  5AVQ B;  4JYB A;  1WJT A;  3KDP B;  3V5B A;  4C7N B;  1J2J B;  1S9K E;  3LID A;  4AYC A;  5AW8 B;  1YYC A;  2XPO A;  3F9K C;  4GKG A;  1S9K D;  3L36 A;  3O8Z A;  2Z5I A;  4AUW A;  1G2C B;  1GU4 A;  2XV5 A;  3HE4 B;  3TNU B;  4LC1 A;  5APX A;  2IPP A;  2R3C A;  3A2A A;  2WT7 A;  5APU A;  3TNU A;  3V4Q A;  2B4J C;  2Q3I A;  1GZL A;  2Z5H A;  2VRS A;  1HWT C;  3M0A A;  1JUN A;  3L35 A;  5APT A;  2YNY A;  1MFZ A;  5AVZ B;  2E42 A;  3V4W A;  2XPP A;  4I2L C;  5AVU B;  1GTW A;  3LIE A;  3P7K A;  2P7J A;  1FOS E;  4M3L A;  2WPR A;  1A02 F;  2R32 A;  1KQL A;  5APW A;  1EO0 A;  1NAF A;  5APV A;  3M9H A; 
#chains in the Genus database with same CATH topology
 1EDJ A;  3B8E B;  2M3B A;  3FED A;  1QVG O;  1OXZ A;  1YQ4 C;  3MP7 B;  1SQQ J;  5HKW A;  5BVZ A;  2D2C D;  3H1L E;  4EDF A;  4BRY A;  2LXB A;  3VMY A;  1KOR A;  2FKW B;  3EWK A;  4XE5 B;  2OAR A;  3A7O A;  1X8Y A;  3SSU A;  1EDL A;  3RK3 C;  2QEX P;  1LWU C;  3BCC J;  2Q1K A;  3GHG A;  5CCG D;  4NGT A;  5DJT B;  1HJB A;  1NTM J;  1J1E C;  1X9V A;  1VQL P;  2WPV B;  1SFC A;  1PGJ A;  1FJP A;  1GW3 A;  3L73 E;  4NGQ A;  3T97 B;  2N3A B;  3L73 D;  2Q3E A;  3L74 G;  2YO2 A;  2KOG A;  1L0L J;  2H89 C;  2XPO A;  1J2J B;  1NTK J;  2NPS B;  2IYP A;  1VQP P;  3CCE P;  3AE3 C;  3LW5 H;  4U3F J;  1N86 A;  1VPC A;  1LWU A;  1HWT C;  1NAY A;  1MFZ A;  1S4X A;  2ZVO B;  4IFD K;  1DEE G;  1SQP E;  1A02 F;  1P84 E;  3KAS A;  3AED C;  2ZVN B;  1P84 D;  3B4S A;  3HUS B;  1NTZ E;  3BUN B;  1SQQ K;  3AE7 C;  2B87 B;  1NTZ D;  2K37 A;  1S2E A;  2G8Y A;  2R5B A;  4KHX A;  2YIU B;  4OWF A;  4I1L A;  2KSJ A;  1KC8 Q;  1NYH A;  3AE6 C;  1GU5 A;  2WIT A;  5AW1 B;  3L72 J;  4GOD A;  1VQ9 P;  3KHU A;  1A02 J;  5B66 H;  1NU1 J;  3MZW B;  1YI2 P;  3BCC D;  2IDB A;  3VN0 A;  3IR9 A;  3VRQ A;  2NPS C;  2HFE D;  1NTM K;  4W7Z A;  4N3Y B;  3PP5 A;  1NTM D;  5E79 E;  1W5C E;  4H13 B;  3P32 A;  2OYO A;  3CCU P;  1LNQ A;  4O9B A;  1B47 A;  3H32 B;  1OZH A;  1SQV K;  3D7G A;  1SQV D;  1VQ6 P;  1H8A A;  3SJX A;  2WPS A;  4I7Z B;  1L0L K;  3AEA C;  5KJ7 D;  1N7S B;  4L74 A;  1FZA A;  3HUS C;  3CWB G;  5DJU B;  2WSS H;  1IFD A;  1OW6 A;  3GG2 A;  1GK4 A;  3T97 A;  2IFM A;  3HPH E;  1BGY E;  3USS A;  3VGO A;  4U3F D;  1BGY D;  1ZP0 C;  4GKG A;  4MCP A;  4HB1 A;  4W7Y A;  2NPS A;  1PGP A;  2B4J C;  4IL6 E;  1IK9 A;  1ZR4 A;  5AVZ B;  1GDT A;  3V4W A;  1T8Z A;  3H1H J;  3PFV A;  4RKU J;  1NKZ B;  1PGQ A;  3P8C E;  3W68 A;  3P8C D;  1AJY A;  5APV A;  4H13 C;  5ELY A;  3HUS A;  1QGK B;  3D6Y A;  2XKM A;  1OIP A;  4OH8 B;  2V4H A;  4NGP A;  3N4X A;  1NU1 K;  3RGU A;  3TYY A;  3G4S P;  1N7S C;  3CL3 D;  3U88 C;  1FAV A;  2AXT E;  1LTS C;  3BXM A;  1SQB J;  4YTP C;  3HD7 D;  3HE5 B;  1ZRT D;  3JCU E;  3WUT A;  3L75 E;  3L75 D;  4H0L B;  1CZQ A;  3ZNI A;  3VRP A;  3OA7 A;  3OW2 O;  1ZR2 A;  2C9N Y;  4ASV A;  3WMM 0;  1K04 A;  2E74 D;  4LLH A;  5AVW B;  3H25 A;  2CBL A;  1IFM A;  3KXD A;  5CBO A;  2WTY A;  4OME A;  1VQM P;  4JYB A;  5GTH H;  1R5L A;  5KLV J;  3C9I A;  1NOH A;  1FBM A;  5BY0 A;  1VF5 D;  3H1H D;  3VP9 A;  1EZV G;  3HMJ G;  2Z5H A;  1W2B O;  1JY2 N;  5AVU B;  3LW5 J;  1LP1 B;  3SWK A;  2H8P D;  2KK7 A;  4H0L C;  1PP9 J;  3PTZ A;  1URQ B;  1Y9B A;  1OMI A;  3M9H A;  5KJ7 C;  3FGA D;  3E7K A;  1WT6 A;  1RQU A;  1BCC J;  4R4M A;  1G1I A;  1S5L X;  1FZB A;  1SQB K;  2FFD B;  3HD7 B;  1X0T A;  2OGU A;  2XZR A;  4WY4 D;  1FBV A;  3V2N A;  1HF9 A;  4ZNC A;  3SWY A;  1HVV A;  2WMM A;  3GF7 A;  2G3A A;  3RL0 B;  2W90 A;  2DLA A;  1UII A;  2UWJ E;  3CX5 I;  1JB0 J;  1JMM A;  5KJ7 A;  3L74 E;  2ZYD A;  2QRX A;  4OC4 A;  1SQQ G;  1IO4 A;  4MCR A;  1USD A;  4JYC A;  1KTM A;  2UV8 G;  3CCR P;  3I5C A;  4IOI H;  1LTG C;  4P4I A;  1IZN B;  2E75 D;  3BUM B;  3KZI E;  1URQ C;  5KLV K;  2O1J A;  2W6A A;  1KQF B;  1R8E A;  5KLV D;  3H1K G;  2R5D A;  2FXP A;  1JY3 P;  1U57 A;  2W27 A;  3GMA A;  4A4B A;  5AVQ B;  5KAF H;  3O8Z A;  3BCC G;  4NPD A;  3HD7 C;  1LT9 B;  1QL1 A;  1UIX A;  3II6 A;  3CI9 A;  2C6C A;  2PRR A;  1S72 P;  1JUN A;  3I55 P;  2K9Y A;  3L35 A;  4HJG H;  2GM4 A;  3V2R A;  3RL0 C;  2WPR A;  3V2Q A;  1QLE D;  2JWD A;  4UB8 H;  2XNX A;  3TDK A;  1L0L G;  3G6E P;  1VQ7 P;  1XTC C;  1NTK G;  1JTH B;  2GUS A;  3U59 A;  3AE4 C;  3BUO B;  3KQG A;  4DJG A;  3FXD A;  1M90 Q;  1NGM B;  3RK3 E;  3HD7 A;  3ZDM A;  2M5A B;  2N9B A;  3VRR A;  3L71 J;  3CCQ P;  2FYU J;  1EZV I;  2QJY B;  1L4A B;  3A0B E;  1QX8 A;  3BRV B;  5H2F H;  2HOD B;  5AVY B;  3CWB E;  3CWB D;  1IC2 A;  3AE9 C;  3O6Q A;  4IFF A;  2DW3 A;  4BTF A;  2JDI H;  3L72 G;  1TU3 F;  1IFP A;  2WT7 B;  4CPG A;  2FYN C;  2WSE J;  2J5U A;  3L70 G;  1NU1 G;  3VTP C;  4XA4 A;  2P2U A;  4OC0 A;  4YXW H;  2OOT A;  2ITA A;  3IAO A;  4KT0 J;  1E5W A;  1YHQ P;  1AVY A;  3U1A A;  1WJT A;  3CC4 P;  1Y8A A;  1LGH B;  3LID A;  3E1R A;  2AXT H;  1YTZ I;  3TGU J;  1GU4 A;  2JWA A;  1M56 D;  1BE3 E;  3CX5 E;  3I56 P;  4LC1 A;  4UB6 E;  5APX A;  3CX5 D;  4A4C A;  1KQG B;  1JY2 O;  3JCU H;  1M1J B;  3V4Q A;  2Q3I A;  1DE4 C;  2QJY C;  1L4A C;  4W9Y A;  2VRS A;  1K9M Q;  1PGO A;  2YNY A;  2ZAE B;  4OC5 A;  1OW8 A;  1KZU B;  1Q2N A;  2B88 A;  1FOS E;  4P4F A;  1VQN P;  4PJ0 H;  5APW A;  3CC2 P;  3PT1 A;  2O01 N;  3MGN A;  3A3Y B;  3HE4 A;  2FYU K;  1JTH A;  4KJM A;  5BU5 A;  2FYU D;  4WY4 A;  2NPS D;  4NPF X;  1HJ0 A;  4DOJ A;  3SWF A;  3D7D A;  2KSE A;  4BPX B;  1S5L H;  2A45 H;  1J1D B;  3CXH I;  2RH0 A;  1HUC A;  3CCM P;  2ZFC A;  4WB4 A;  2R3S A;  1VQO P;  3SJG A;  5AW5 B;  3A0H E;  2HOD A;  2KNC B;  1Q81 Q;  1M1J C;  1GMJ A;  1SQX G;  1Q7Y Q;  1N2D C;  3GLM A;  1ZOY C;  1DD4 A;  4EOT A;  2WPQ A;  1JO5 A;  3G9R A;  3H1K J;  5TIS E;  1EZV E;  2QJP B;  1EZV D;  1SQB G;  2POH A;  4AQR D;  5KKZ C;  4WWI A;  1OWA A;  3EFF K;  1KN7 A;  1DIP A;  1GL2 B;  2JBK A;  2YKP A;  4AYC A;  5BU8 B;  2R3C A;  3OP0 A;  4H13 D;  4ZMD A;  2AEJ A;  2AEM A;  2XPP A;  3RBZ A;  3CC7 P;  3JSV C;  1YVH A;  2I1K A;  1GW4 A;  2OYI B;  1N7S D;  1NAF A;  4GPL B;  4W80 A;  5APQ A;  5B5E E;  5KLV G;  1FE6 A;  4N6J A;  3C8V A;  2R44 A;  1HGZ A;  2BCC J;  2ZT9 B;  5AW7 B;  3CCL P;  5KAI H;  3QH9 A;  1AA0 A;  2P67 A;  2K9J B;  1M1K Q;  1KB9 H;  1SQQ E;  1GL2 C;  1SQQ D;  1PP9 G;  2W8Z A;  3P8M C;  2P10 A;  2HPC B;  3OJA B;  1ZW0 A;  2P58 A;  1L2P A;  1BCC G;  2GA1 A;  4GOF A;  3H1K D;  3PHL A;  3VRO A;  1ZV8 A;  3L70 J;  3D70 A;  1PPJ G;  1D7M A;  3BCC E;  4GT1 A;  1IFN A;  3FWN A;  3FX0 A;  2I8D A;  2WSF H;  1NTM E;  4BPW B;  3CXH D;  1RF1 B;  3GW6 A;  3QWO C;  1PV3 A;  1YYC A;  3S1K A;  1SQV E;  2Z5I A;  3R2P A;  3E1I A;  4PD4 H;  4H0L D;  3A0B H;  3CLQ A;  3JC2 2;  1L0L E;  2IPP A;  1L0L D;  1OFC X;  4H44 D;  1NTK K;  1NTK E;  1GZL A;  1NTK D;  3M0A A;  3CD6 P;  2E42 A;  4BXL A;  2YIU C;  3BAT A;  1QVF O;  4U3F E;  1HTL C;  2OTK E;  1HH0 A;  1N73 B;  1YIJ P;  4P4E A;  4C7N B;  2BCC D;  2PVV A;  5CJ0 A;  1OX3 A;  3Q5P A;  2HR3 A;  2YMK A;  1KYO H;  5APS A;  2KZJ A;  2OYH B;  4DCK A;  1LTB C;  3H1J G;  2YKQ A;  3Q2Y A;  4BWN A;  3CCS P;  2KIK A;  1QEX A;  2V7Q H;  1VDF A;  1FZF A;  2QA4 P;  3AEG C;  3L72 E;  3L72 D;  1RY3 A;  1JEK A;  4UB6 H;  2QSI A;  1BDC A;  1GD2 E;  2B87 A;  2N1T B;  3M9B A;  2QM8 A;  3HPG G;  1NU1 E;  2YKO A;  4I7Z C;  1URQ D;  1NU1 D;  2IZ0 A;  3KYQ A;  3L70 D;  1SQX J;  2RMZ A;  1G1J A;  2W6J H;  4NPE A;  1JOC A;  1T3U A;  4X3R A;  2Z4E A;  2CPS A;  2KB7 P;  4IL6 X;  2IFN A;  2H43 A;  3L71 G;  4IFM A;  4I6M C;  3VP8 A;  1ZRT E;  2FYU G;  4YPC A;  1FS0 E;  2Y9Y A;  1SS1 A;  3RK2 D;  2KP8 A;  2NRG A;  2YXQ B;  4PV1 B;  4H44 B;  2BEZ F;  1BSN A;  3F9K C;  2LKM A;  1PIX A;  3HTK B;  3RL0 D;  3H32 A;  3CPW O;  1M8O B;  1VQK P;  1KIL D;  3A0H H;  4EIJ A;  1XTG B;  2M3E A;  1N7S A;  2IX7 C;  3P7K A;  1YTZ T;  2N1T C;  2XEI A;  4HH2 A;  1X79 B;  2Q7C A;  4XFJ A;  2PFX A;  3H1H E;  1DEB A;  4C7N A;  3TGU G;  1GK6 A;  4OGQ D;  3H1I J;  5TIS H;  2M0B A;  2Q9I A;  3VYI A;  3PLN A;  1PL5 A;  3UIA A;  3BI0 A;  3H1L G;  1WRG A;  2KXP B;  4RJT A;  3HRN A;  3TSI A;  1CSB A;  1SQX K;  4RES B;  1JNM A;  4OC2 A;  1SQX D;  4H44 C;  3RBX A;  2WVR A;  4JPZ B;  2GUV A;  4EI2 A;  3VMX A;  3IF4 A;  1SQB E;  1SQB D;  3OAK A;  2O1K A;  2HYN A;  3FWL A;  1LJ2 A;  3RK2 B;  5AVX B;  2Y0E A;  3BI1 A;  2Q5U A;  3ITK A;  5B5E H;  3MTU E;  3CME P;  1NHL A;  3HE5 A;  3AE8 C;  1RHZ B;  2ZXX A;  1L4A D;  4L73 A;  2JJL A;  1KIL B;  4GOE A;  3V5B A;  2HG5 D;  1P84 H;  2WSF J;  2JO1 A;  4AUW A;  1G2C B;  2O01 H;  3D6Z A;  3MIW A;  2LXC B;  1OW7 A;  3MHV A;  1SQP G;  5KLV E;  5APT A;  4HKZ H;  3G3Z A;  1ZME C;  2FBW C;  4OGQ B;  4OVN F;  2C6P A;  1FJK A;  3SJE A;  3M06 A;  1CX8 A;  2FFD C;  1JY3 O;  2C0W A;  1MKM A;  3D7H A;  3PRJ A;  1MUU A;  1NVO A;  3H1J J;  1PP9 E;  4OC3 A;  3RK2 C;  1PP9 D;  3FEC A;  5E79 H;  3B5N B;  1AV1 A;  2RN0 A;  1BCC E;  2XND H;  1KQS O;  1BCC D;  1LP1 A;  1KIL C;  1URQ A;  2W6B A;  5TJH A;  1RE4 C;  1PPJ E;  2V7Q J;  1PPJ D;  5AVR B;  1VQ4 P;  5AVV B;  5CMZ A;  2J59 M;  4D6T J;  2N9Y B;  2IBZ G;  3KPE A;  2ZXE B;  2FFD A;  3B71 A;  2BCC G;  2PVW A;  1PZQ A;  4QMA A;  5B66 E;  4N78 D;  2ZJS E;  4OGQ C;  2KS1 B;  4ZKP A;  1RE3 C;  1H89 A;  1RF0 C;  2QG4 A;  2KUB A;  1L0N J;  2CIJ A;  4IL6 H;  1LT9 C;  3IFM A;  1JCC A;  5CCH C;  4ZKU A;  1YBK A;  4OC1 A;  3Q1M A;  4Y99 B;  1KIL A;  2JKV A;  3B5N C;  1RE4 A;  2L5G B;  3EFG A;  1S1C X;  4K35 A;  2Y9Z A;  3A2A A;  3Q5S A;  5EFW B;  2FYZ A;  3FF3 A;  4U7J A;  3LIE A;  1FZC B;  3H1J D;  1LTJ B;  1RE3 A;  1YJN P;  1AQ5 A;  2AXC A;  1RF0 A;  3PH0 A;  1IFI A;  3H1L J;  4JQ0 D;  5F09 A;  1LT9 A;  1GL2 D;  1M57 D;  1Z8L A;  3GHG B;  5CBN A;  2JP3 A;  3L37 A;  2KLV A;  2A06 G;  3S9O A;  1JY2 P;  4Z1M H;  1R5S A;  3MUD C;  3AEF C;  1SLQ A;  1SFC B;  4LQG A;  2C9L Y;  4Y99 C;  3MD0 A;  4WBA A;  1AFO A;  1MZ9 A;  3L71 E;  3F89 A;  4EYY Q;  2FYU E;  3L71 D;  3OB2 B;  2B9B A;  2E5Y A;  2KI7 B;  3M9Q A;  2QIW A;  2PAJ A;  3BUW B;  3VRN A;  3VMA A;  3NMD A;  5J3X A;  4MCQ A;  5CHX A;  3L73 J;  4RR2 B;  2QJK B;  4TLF A;  1FZC C;  2M5A A;  1T2K C;  2ZT9 D;  1LWU B;  1L4A A;  2KS1 A;  1LTJ C;  3NFQ A;  4JF7 A;  1E79 H;  1K8A Q;  2A45 G;  5F13 A;  3L36 A;  2WSC H;  1N8R Q;  4MCS A;  3TNU B;  1SQP J;  3V6I A;  2WT7 A;  1SFC C;  3S9M A;  3TGU E;  2IBZ I;  2O01 J;  3Q3D A;  3TGU D;  1NTZ J;  4WVZ A;  5GTH E;  3H1L D;  1H0T B;  1FZC A;  5AXI A;  2E76 D;  1EO0 A;  2CPB A;  2XEJ A;  1LTJ A;  3IN6 A;  1RH5 B;  3WU2 E;  1JMB A;  1H88 A;  2QJK C;  1J1D C;  2Q6Q A;  3G71 P;  4P4J A;  2JBJ A;  2WQY C;  1M1J A;  4P4B A;  1ZN5 A;  3Q5R A;  2Y0C A;  1FDM A;  3KZI H;  2ZYA A;  1LTA C;  1SQV J;  1BDD A;  5AW6 B;  1KD1 Q;  4DT0 A;  3H1I G;  4A7P A;  1MFT A;  2VKZ G;  1LTT C;  5GTI E;  1EQ7 A;  2QJP C;  3SFE C;  1T6A A;  4C7R A;  1BGY J;  3AEE C;  3BVH A;  1SQP K;  3N7N A;  3TF5 A;  5AW0 B;  1EDK A;  1SQP D;  3H1K E;  3KDP B;  5AW8 B;  2KNC A;  2N1T D;  1NTZ K;  1EDI A;  2K1A A;  1KMI Z;  2D2C B;  2FXO A;  5HKY A;  4LGD E;  2XDJ A;  2OYI C;  3TNU A;  2E76 B;  3CXH E;  4I2L C;  2KZI A;  2OR4 A;  1FZG A;  1LTI C;  5KAF E;  1JCD A;  2OQQ A;  2K3R A;  1H0T A;  2ZT9 C;  1GL2 A;  4HYT B;  2PP6 A;  4PV1 D;  2A45 I;  1Q90 D;  4P45 A;  2KYV A;  4P44 A;  1FDI A;  4UB8 E;  5KLI B;  2IBZ E;  3L75 J;  2IBZ D;  2BCC E;  3S9N A;  1EC5 A;  2O3J A;  2OYI A;  2BAS A;  3AEB C;  1NO4 A;  1JY3 N;  2ZYG A;  3PJS K;  2D2C C;  2E76 C;  3FXE A;  1CI6 B;  2AEF A;  1K05 A;  1T3J A;  1BSH A;  1RF1 C;  3BRT B;  2K9J A;  3CX5 H;  2OTJ P;  3BAS A;  2YO3 A;  3CMA P;  5H2F E;  3AE5 C;  4L76 A;  2YMY A;  3L70 E;  5CCG C;  4JYW A;  2HPC A;  2XU6 A;  1BE3 G;  4D6T G;  4GDO A;  3H6P A;  3OB1 B;  5KLI C;  5L8R J;  1N73 C;  2QVA A;  2WSC J;  3CCV P;  1Y47 A;  2JR8 A;  1L0N G;  1RF1 A;  1OVU A;  1KQL A;  2A06 E;  3WUU A;  2A06 D;  2OYH C;  2XPL A;  4L75 A;  4MN4 C;  1USE A;  3S9L A;  2FY8 A;  1KIL E;  3K5B A;  5CCG A;  1VQ5 P;  1AQT A;  4R4L A;  1DD3 A;  1KB9 I;  2WSE H;  4PJ0 E;  1DH3 A;  2E43 A;  5AVT B;  1OVR A;  1IJD B;  1N73 A;  3SJF A;  1FZE A;  1W2E A;  3L74 J;  4TT3 H;  2FXM A;  4B86 A;  3PLF B;  2M8R A;  1U7M A;  1EXJ A;  3WUV A;  1SP4 A;  3R4Y A;  2OYH A;  1S5L E;  5CCH D;  1CI6 A;  1PFI A;  1SQX E;  2KLU A;  1YJ9 P;  4PV1 C;  3B5N D;  3WU2 H;  5HKZ A;  2LR2 A;  2XEF A;  2N1T A;  2E5T A;  4PD4 I;  2Y1N A;  1WMK A;  1Z56 A;  1YIT P;  2Y0D A;  1HGV A;  2K88 A;  3L73 G;  1Q82 Q;  1K73 Q;  1FC2 C;  3AE2 C;  3S4R A;  1S3J A;  1NH4 A;  1GTW A;  4JBZ A;  1U7J A;  3D71 A;  5GTI H;  1IK7 A;  4K3A A;  3BUX B;  1KYO I;  1YQ3 C;  2WWW A;  3HTK A;  3L4F A;  2B89 A;  5AW3 B;  3RBU A;  1AVO A;  2E74 B;  2H88 C;  3O6Q B;  2P1J A;  2PGD A;  4JZ0 A;  3VOP A;  3H1I E;  3L74 D;  1NTZ G;  2H7H A;  3BHX A;  3H1I D;  1Z9E A;  3CWB J;  1NWQ A;  4ASW A;  3EQ2 A;  4NGR A;  1T2K D;  3SFD C;  1OVV A;  3CXH H;  1VF5 B;  1KFM A;  5KAI E;  4NGS A;  1ZLL A;  2XPN A;  2RKL A;  4DZO A;  4P4D A;  1FOS F;  1KB9 E;  5AW2 B;  1KB9 D;  1CW5 A;  1NTM G;  3ABV C;  2C0X A;  3GF3 A;  2QM7 A;  1FU1 A;  1SFC D;  1BE3 J;  2SPZ A;  4RO0 A;  1SQV G;  2E74 C;  2FYN B;  3C1L A;  2OTL P;  3F5H A;  1YJW P;  1Q86 Q;  4N78 E;  2JEE A;  2XV5 A;  3HE4 B;  3M0D C;  4WY4 B;  1LT1 A;  2NZ2 A;  5M1B A;  1KFN A;  1N7L A;  4BPU B;  4U3F G;  1BGY G;  3D7F A;  3CCJ P;  1M7L A;  2W83 C;  4Y28 J;  5CJ4 A;  3RK3 D;  1ZXG A;  1VF5 C;  1NKN A;  4PD4 E;  4PD4 D;  1G2C A;  3U1C A;  3TK1 A;  1SVF A;  1RQV A;  3FEE A;  2MKV A;  2I1J A;  4C46 A;  2E75 B;  5AW9 B;  1NJI Q;  4BRY B;  5AW4 B;  5AVS B;  2HLO A;  3V2P A;  1MV8 A;  3H1J E;  2IYO A;  4NGM A;  3M0D A;  1QL2 A;  1KV4 A;  3RL0 g;  3NTN A;  1JM0 A;  1KYO E;  1KYO D;  5CCH A;  3A5T A;  2J58 A;  1VL2 A;  4WY4 C;  3B5N A;  5D29 A;  3AE1 C;  1EXI A;  1BE3 D;  1X22 A;  4D6T E;  1HBW A;  3AEC C;  4D6T D;  3L75 G;  3VMZ A;  4NGN A;  5C39 A;  2BEQ D;  1P84 I;  5K5G B;  2L91 A;  2MJZ A;  5KTB A;  3M91 A;  3NXS A;  5APY A;  1IFJ A;  2CK3 H;  1S9K E;  1L0N K;  1L0N E;  1S9K D;  1L0N D;  2E75 C;  1FDO A;  2QE7 H;  3W67 A;  1DX7 A;  5KKZ B;  3RK3 B;  5APU A;  3IWW A;  2IZ1 A;  3MUD A;  1J1E B;  2P7J A;  4M3L A;  2YXR B;  4YXD C;  2C6G A;  2R32 A;  2Y1M A;  3H1H G;  2WZ7 A;  1VQ8 P;  3GHG C;  4GIF A;  2XEG A; 
#chains in the Genus database with same CATH homology
 1X79 B;  4HYT B;  3B8E B;  2M3B A;  2Q7C A;  1DEB A;  1XTC C;  4C7N A;  2PP6 A;  1JTH B;  1GK6 A;  1OXZ A;  2GUS A;  3U59 A;  2Q9I A;  3VYI A;  3UIA A;  2A45 I;  3KQG A;  1WRG A;  2KYV A;  3HRN A;  3TSI A;  5BVZ A;  3HD7 A;  2N9B A;  3VMY A;  1CSB A;  1L4A B;  1SQX K;  2FKW B;  4RES B;  1JNM A;  2OYI A;  2BAS A;  1NO4 A;  4XE5 B;  2OAR A;  3BRV B;  1JY3 N;  2GUV A;  3A7O A;  2HOD B;  5AVY B;  3VMX A;  1X8Y A;  3RK3 C;  1LWU C;  1IC2 A;  3GHG A;  2O1K A;  3OAK A;  4IFF A;  2HYN A;  5CCG D;  1CI6 B;  1HJB A;  1T3J A;  1J1E C;  1RF1 C;  1X9V A;  3RK2 B;  2WT7 B;  3BRT B;  5AVX B;  1SFC A;  2Q5U A;  3BAS A;  3MTU E;  2YO3 A;  4XA4 A;  3VTP C;  1FJP A;  1NHL A;  2P2U A;  1GW3 A;  3HE5 A;  2N3A B;  1E5W A;  2YMY A;  5CCG C;  1L4A D;  2YO2 A;  2HPC A;  2KOG A;  2JJL A;  2XU6 A;  1KIL B;  3U1A A;  1WJT A;  3V5B A;  2HG5 D;  1J2J B;  1LGH B;  3LID A;  2XPO A;  1YTZ I;  2NPS B;  4AUW A;  1G2C B;  2O01 H;  1GU4 A;  3H6P A;  3MIW A;  4LC1 A;  5APX A;  3LW5 H;  1JY2 O;  1N73 C;  1M1J B;  1N86 A;  2Q3I A;  1VPC A;  1LWU A;  1L4A C;  3V4Q A;  2VRS A;  1HWT C;  5APT A;  2YNY A;  1MFZ A;  3G3Z A;  1KZU B;  4IFD K;  1FOS E;  1A02 F;  1RF1 A;  1FJK A;  1KQL A;  5APW A;  3HUS B;  3M06 A;  2OYH C;  2FFD C;  1SQQ K;  2XPL A;  1JY3 O;  2C0W A;  3MGN A;  2R5B A;  4KHX A;  4I1L A;  2KSJ A;  3A3Y B;  5CCG A;  1GU5 A;  1MUU A;  3HE4 A;  2FYU K;  1JTH A;  2WIT A;  5AW1 B;  5BU5 A;  3RK2 C;  4WY4 A;  2NPS D;  3B5N B;  2WSE H;  4DOJ A;  3SWF A;  1DH3 A;  2E43 A;  5AVT B;  1A02 J;  1IJD B;  1J1D B;  2A45 H;  1HUC A;  1N73 A;  2ZFC A;  4WB4 A;  1KIL C;  1URQ A;  1FZE A;  2W6B A;  1RE4 C;  1W2E A;  3VN0 A;  3IR9 A;  2NPS C;  2HFE D;  5AVR B;  5AW5 B;  1NTM K;  4W7Z A;  4N3Y B;  2FXM A;  4B86 A;  3PP5 A;  2M8R A;  5AVV B;  5CMZ A;  2HOD A;  2J59 M;  3P32 A;  1SP4 A;  3KPE A;  2ZXE B;  1M1J C;  4O9B A;  2OYH A;  3H32 B;  2FFD A;  1N2D C;  1SQV K;  4N78 D;  5CCH D;  1CI6 A;  1H8A A;  1PFI A;  4EOT A;  2WPS A;  2WPQ A;  1JO5 A;  1L0L K;  4ZKP A;  3B5N D;  1RE3 C;  5KJ7 D;  1H89 A;  1N7S B;  1FZA A;  1RF0 C;  3HUS C;  1IFD A;  2POH A;  4AQR D;  1GK4 A;  1LT9 C;  2N1T A;  3IFM A;  3T97 A;  1JCC A;  1OWA A;  5CCH C;  2IFM A;  3HPH E;  4ZKU A;  1GL2 B;  4Y99 B;  1Z56 A;  2YKP A;  4AYC A;  1KIL A;  4GKG A;  3B5N C;  1RE4 A;  1HGV A;  4W7Y A;  2L5G B;  2NPS A;  3EFG A;  5BU8 B;  2R3C A;  3A2A A;  2B4J C;  1IK9 A;  1ZR4 A;  2FYZ A;  5AVZ B;  1GDT A;  3V4W A;  1T8Z A;  2XPP A;  1NH4 A;  3LIE A;  1GTW A;  1FZC B;  1NKZ B;  2I1K A;  1GW4 A;  2OYI B;  3P8C E;  1N7S D;  1LTJ B;  1RE3 A;  3P8C D;  1NAF A;  5APV A;  1AQ5 A;  2WWW A;  1RF0 A;  3HUS A;  3HTK A;  3L4F A;  4W80 A;  5APQ A;  1IFI A;  2XKM A;  4OH8 B;  5AW3 B;  1LT9 A;  3N4X A;  4N6J A;  1GL2 D;  1NU1 K;  1HGZ A;  3TYY A;  3GHG B;  5AW7 B;  3L37 A;  2KLV A;  2P1J A;  1N7S C;  3VOP A;  1JY2 P;  3CL3 D;  3U88 C;  1FAV A;  2H7H A;  1SLQ A;  2P67 A;  1SFC B;  1Z9E A;  1LTS C;  2C9L Y;  1GL2 C;  3HD7 D;  4Y99 C;  3HE5 B;  1NWQ A;  3P8M C;  3MD0 A;  3EQ2 A;  4WBA A;  1AFO A;  1MZ9 A;  1T2K D;  2HPC B;  1CZQ A;  1KFM A;  3M9Q A;  2PAJ A;  3OJA B;  3OA7 A;  3NMD A;  1ZR2 A;  2C9N Y;  1ZLL A;  2XPN A;  3WMM 0;  5CHX A;  1ZV8 A;  4LLH A;  5AVW B;  4DZO A;  1FOS F;  1FZC C;  5AW2 B;  1CW5 A;  1T2K C;  1IFM A;  1LWU B;  1L4A A;  4GT1 A;  2C0X A;  1IFN A;  1LTJ C;  2QM7 A;  2WTY A;  3NFQ A;  2WSF H;  4JF7 A;  1FU1 A;  1RF1 B;  1SFC D;  2A45 G;  4JYB A;  1YYC A;  4N78 E;  3L36 A;  2WSC H;  2Z5I A;  3C9I A;  1NOH A;  3E1I A;  3R2P A;  1FBM A;  2JEE A;  2XV5 A;  3CLQ A;  3HE4 B;  3TNU B;  3M0D C;  3VP9 A;  2IPP A;  4WY4 B;  1KFN A;  2WT7 A;  1N7L A;  1NTK K;  1SFC C;  1GZL A;  2Z5H A;  3M0A A;  1JY2 N;  2E42 A;  1M7L A;  5AVU B;  5CJ4 A;  3BAT A;  3RK3 D;  1HTL C;  1HH0 A;  2H8P D;  1FZC A;  1N73 B;  1EO0 A;  1URQ B;  1NKN A;  3M9H A;  4C7N B;  2CPB A;  5KJ7 C;  1LTJ A;  1G2C A;  5CJ0 A;  3U1C A;  3TK1 A;  1WT6 A;  1SVF A;  1H88 A;  1J1D C;  1G1I A;  5APS A;  1FZB A;  1SQB K;  2I1J A;  1M1J A;  4C46 A;  2FFD B;  1LTB C;  2OYH B;  3HD7 B;  2YKQ A;  5AW9 B;  5AW4 B;  5AVS B;  2HLO A;  3V2P A;  1MV8 A;  2XZR A;  4WY4 D;  3M0D A;  3V2N A;  1VDF A;  1FZF A;  1QL2 A;  1RY3 A;  3SWY A;  1HVV A;  1ZN5 A;  1GD2 E;  1FDM A;  2N1T B;  3RL0 B;  3M9B A;  1LTA C;  3NTN A;  2QM8 A;  3HPG G;  5AW6 B;  2YKO A;  5CCH A;  1URQ D;  3KYQ A;  3A5T A;  1G1J A;  2J58 A;  4WY4 C;  1LTT C;  3B5N A;  1JMM A;  5KJ7 A;  1EQ7 A;  1JOC A;  1T3U A;  1IO4 A;  4JYC A;  2Z4E A;  2CPS A;  2KB7 P;  2IFN A;  2H43 A;  4C7R A;  3I5C A;  1HBW A;  4IFM A;  4I6M C;  1LTG C;  3VP8 A;  3VMZ A;  1URQ C;  5KLV K;  2O1J A;  2W6A A;  3BVH A;  1SQP K;  3N7N A;  2R5D A;  2KP8 A;  2MJZ A;  1JY3 P;  5AW0 B;  3RK2 D;  5KTB A;  2W27 A;  3M91 A;  3NXS A;  5APY A;  5AVQ B;  1IFJ A;  3KDP B;  1S9K E;  3F9K C;  5AW8 B;  1L0N K;  2LKM A;  3HTK B;  1S9K D;  2N1T D;  3O8Z A;  1NTZ K;  3RL0 D;  3HD7 C;  3H32 A;  1DX7 A;  1LT9 B;  1QL1 A;  4LGD E;  3RK3 B;  2XDJ A;  3II6 A;  1KIL D;  3CI9 A;  2OYI C;  5APU A;  3TNU A;  4EIJ A;  1XTG B;  1JUN A;  3L35 A;  1N7S A;  3MUD A;  2IX7 C;  1J1E B;  4I2L C;  2GM4 A;  3V2R A;  3P7K A;  1YTZ T;  2N1T C;  2P7J A;  3RL0 C;  4M3L A;  2WPR A;  3V2Q A;  1FZG A;  2R32 A;  1LTI C;  1JCD A;  4HH2 A;  2WZ7 A;  2XNX A;  3GHG C;  4GIF A;  1GL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...