3O8ZA

Crystal structure of spn1 (iws1) core domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
152
structure length
152
Chain Sequence
b'DPFTDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPIIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor IWS1
publication title Structure and biological importance of the spn1-spt6 interaction, and its regulatory role in nucleosome binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 60
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3o8zA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3o8zA02
5APWA 4DZOA 3IR9A 2H7HA 2C9NY 2P7JA 3OAKA 2P67A 5APTA 4C7NB 3HE4A 3T97A 2KP8A 1WJTA 5AW4B 2P2UA 1OXZA 4B86A 1SP4A 3SWFA 5AVRB 4I2LC 2C9LY 5AW3B 3NFQA 2WPSA 5AVWB 3P7KA 2E43A 5CMZA 2XPNA 3P32A 4I6MC 2R3CA 1CZQA 3VTPC 4LC1A 2R32A 1JUNA 3L37A 3LIEA 3M0AA 5AVQB 2XPLA 2WPQA 3O8ZA 5AW8B 2VRSA 5APUA 3B8EB 1MUUA 2N3AB 3HE5B 3HPGG 2Q3IA 4RESB 1FOSF 1HWTC 4AYCA 3VN0A 5AVSB 4C7NA 3M0DA 3VYIA 4JYBA 1H8AA 2XV5A 1GTWA 2ZXEB 3HTKA 1CI6A 4GKGA 2QM8A 3TYYA 3V4QA 1DH3A 2ZFCA 5AW1B 2WT7A 3M9HA 5AW9B 1H88A 5APQA 5AVZB 1H89A 1GD2E 3V4WA 1HUCA 2XPOA 4XE5B 2YO2A 1IO4A 1MFZA 3MD0A 2XPPA 5APXA 3TNUB 1T2KC 3M06A 2BASA 1NAFA 2W27A 3M91A 4EOTA 3HE4B 3U88C 3MGNA 3HE5A 2XU6A 1NWQA 3A3YB 2E42A 3P8MC 1G2CB 2WPRA 3M9BA 2IPPA 2YNYA 3V5BA 1EO0A 2Q5UA 1HJBA 5APSA 1SLQA 1CSBA 3I5CA 2R5DA 2WTYA 5AW5B 2XZRA 2WWWA 1JNMA 3KDPB 1MV8A 2B4JC 5AW2B 1KQLA 2JJLA 2N9BA 5AVUB 4AQRD 1HBWA 3LIDA 4HYTB 3L35A 1GU4A 5AVXB 5AW6B 3A2AA 1S9KD 1A02J 2Q7CA 4M3LA 1J2JB 3A7OA 5AVYB 3VMYA 3TNUA 5AW7B 1YYCA 4JYCA 5AVVB 3KQGA 5APVA 1A02F 1X8YA 3L36A 4KHXA 3TK1A 3VMXA 1CI6B 3NTNA 2R5BA 3UIAA 4C46A 2WT7B 1FAVA 3F9KC 1FOSE 2QM7A 2Z5IA 1GU5A 2YO3A 1GZLA 2W6AA 1GK4A 5APYA 1Z9EA 1OWAA 3NXSA 1T2KD 1S9KE 3HPHE 5AVTB 5AW0B 4AUWA 4GT1A 2Z5HA 1GK6A 3A5TA 3NMDA 3VMZA
chains in the Genus database with same CATH superfamily
1YITP 2YMKA 1P84E 3MHVA 4PJ0H 3HTKB 3L70D 1Q90D 4OC0A 5KJ7D 3H1HD 5AVWB 1J1EC 1OFCX 2OYHA 5F13A 3S4RA 5ELYA 3SWYA 4RO0A 1KFMA 1KQGB 2RMZA 4H13D 1BGYD 2ZVOB 1RF1B 2N9YB 5CCGA 1H89A 3L70G 4HKZH 4R4MA 1VDFA 2G8YA 3H1HG 2OOTA 1URQC 1LT9B 1SFCD 2NPSC 2YNYA 1RQVA 2XZRA 1JMBA 4HB1A 2Y0DA 5KJ7C 1SQXK 1BGYG 4ASWA 3H1IE 4M3LA 1YJNP 4A4CA 1ZN5A 2PFXA 4KJMA 2KSJA 3FEDA 5BY0A 2E5YA 4P4DA 2JWDA 3CC4P 4XFJA 2R5BA 3L4FA 3RK2C 2C6GA 2E75B 3WUTA 2FYUJ 3VROA 2WSFJ 2C0XA 1GL2D 1X22A 1DD3A 1PZQA 3CC7P 1SQQJ 1LT1A 3CX5H 3CPWO 5CBOA 1SQPD 4C7NB 2A45I 2WSFH 1NGMB 4OVNF 2Y9YA 1JY3P 1SFCC 3AE7C 3SFDC 3EQ2A 1PP9D 3HD7C 2K9JB 1G1JA 5KLVK 1ZLLA 4NPFX 4H0LB 3CCRP 3A0HH 1R5SA 1DE4C 2E75D 1NKZB 3L74J 1QL2A 3S9OA 4KT0J 1Q81Q 1KN7A 3M0DA 3MTUE 5KAIE 4W7YA 4P45A 1YVHA 2ZVNB 1SQPG 3HRNA 2XPOA 1IO4A 1EXIA 4BTFA 4WY4C 1NH4A 1PP9G 3TNUB 1KMIZ 2BASA 2RH0A 3BCCE 3C9IA 3K5BA 2I8DA 1RE4C 2OTJP 4H0LD 3AE4C 2GA1A 4Y99C 1WRGA 1M8OB 1L4AB 2E74C 4K35A 2W6BA 3OP0A 3V2QA 1GU4A 2Q7CA 3EFGA 2KS1A 2PVWA 2R44A 3MIWA 1ZXGA 3C1LA 4L76A 2WVRA 2JBJA 3AEGC 2WMMA 2OYHB 1VQNP 4H44B 4DZOA 1NTKD 3B5ND 3S1KA 3OAKA 2AEMA 5AW4B 1OXZA 5TISH 3SWFA 2Q9IA 2FYZA 1NTMJ 2D2CC 1LNQA 1N2DC 1EZVD 1PGJA 4LQGA 3FWNA 1L0NK 1MUUA 4PV1B 3U1CA 4RESB 1FOSF 3TDKA 1WT6A 2FY8A 2YKPA 3ZDMA 3VYIA 3SJFA 3A0BE 1CI6A 3TYYA 1DH3A 3L74D 4P4FA 2ZT9D 2RKLA 2L91A 3GHGB 2YO2A 4I1LA 4L74A 1N73A 5J3XA 1OW8A 2FXPA 2IFMA 2QJKB 3AEEC 1R8EA 1BSHA 2MKVA 3SJXA 5CCGD 3CX5E 1HH0A 1BSNA 2FYUE 1M1JC 2IYPA 3RK3C 3CCSP 3H1LJ 5B66H 3KASA 3L71E 2YIUB 1EZVG 3AE9C 4OGQC 2K37A 3IFMA 1SQQE 2FFDA 4PV1D 2C6CA 3KZIE 3LIDA 3A0HE 1QLED 1IFDA 2J59M 3L74G 1J2JB 1EDLA 3SFEC 3CXHH 2ZYDA 5KLIC 4MCPA 2ZAEB 4C46A 1X0TA 3FEEA 1AQ5A 2N1TA 2BCCJ 1PGOA 2ZT9C 1ZW0A 1LTTC 1UIXA 1EXJA 1GK6A 4D6TJ 1HGVA 3E1IA 3TGUJ 2JR8A 1KB9D 1WJTA 5CBNA 2QJPC 1EQ7A 3D71A 1YJ9P 3NFQA 3Q2YA 2XPLA 3II6A 5APUA 1KILB 5AVSB 1JO5A 3IWWA 1KD1Q 1LP1B 1H8AA 3VP9A 3QWOC 1NTMD 1OW7A 5CCHA 2B9BA 4XE5B 1MFZA 3IN6A 1NAFA 3HE4B 4BXLA 2XU6A 1G2CB 1PPJD 3R4YA 3H6PA 2I1JA 2E76B 2JO1A 3LW5J 5DJUB 1SLQA 3D70A 2A06E 2WSEH 5TISE 3I5CA 5HKWA 2FXMA 3BASA 1L0LK 1KILD 4OH8B 4AQRD 2UWJE 2AXTH 1EDKA 3CX5I 3H1LD 1ZMEC 1NTMG 1OW6A 1SQBK 2HR3A 4P4JA 1PV3A 4KHXA 2XEIA 1AA0A 4U3FE 1NTME 3KPEA 1PPJG 1IFMA 1VQ4P 2JP3A 1JOCA 3BRVB 1USEA 2E76D 1IZNB 3AEDC 2QJYC 1JMMA 4N3YB 5APWA 3RL0D 3B71A 5B5EH 1PPJE 1QX8A 3E7KA 2PVVA 5B66E 3H1LG 2BCCD 2NZ2A 4QMAA 2YKOA 1MZ9A 3R2PA 4LLHA 1VQ7P 1IK7A 5AXIA 1J1DB 2MJZA 1KILE 4I2LC 3U1AA 4D6TD 3Q5SA 1NTZK 1CZQA 3AE5C 1ZRTD 2UV8G 4YTPC 3CXHE 3H1IJ 2CBLA 2ITAA 1NJIQ 1DEEG 1YTZI 2BCCG 1DIPA 3TSIA 1JY3O 1NU1D 4RJTA 3FF3A 3QH9A 3SWKA 4D6TG 2B87B 1LGHB 2KUBA 2BCCE 2Q5UA 3M9QA 1GMJA 3L73J 3CWBJ 2PAJA 3U59A 2LXCB 1LTJC 1ZP0C 4I7ZB 1S3JA 3TGUE 2WPVB 1L2PA 2WZ7A 4JYCA 3G3ZA 1KYOH 1FOSE 3MZWB 1GZLA 3WU2H 2A45G 2OYIA 3A5TA 4IFFA 2K9YA 2N1TD 3CCMP 2WITA 3JC22 1N73C 2B88A 3SJEA 5KKZB 5CJ0A 1L4AA 1BCCJ 1YIJP 2VRSA 3F89A 3PLFB 2FFDC 3GLMA 3I56P 4ZKUA 1T8ZA 1VQ9P 1KQFB 5D29A 3CI9A 1Z8LA 2OYOA 1Y47A 3USSA 3H1ID 3G6EP 2H8PD 1SQXJ 1KORA 3CXHI 5CCHD 2Y1MA 2N1TC 1FZBA 3CMEP 1FBVA 1RF0C 2WWWA 3HUSA 5K5GB 2AXCA 1HBWA 3HD7B 4X3RA 2Y0EA 2M5AB 4WB4A 3VRPA 3L73D 3CWBD 5APVA 1A02F 3IAOA 3TK1A 1FC2C 1T3JA 1JCDA 1LWUC 3H1IG 1SQPK 1DX7A 2WT7B 1VL2A 5GTIE 1NHLA 1OMIA 3BI0A 1M7LA 2XEFA 5KLVJ 4WVZA 4IL6H 3MP7B 3FXEA 1HGZA 3BUWB 4BPXB 1OVVA 3GHGA 2I1KA 2IZ0A 4A7PA 1YHQP 3WUUA 3F5HA 4CPGA 1ZR4A 1VQPP 3L73G 2XKMA 3CWBG 4ASVA 4UB6H 4H13C 5AW3B 2W90A 2WPSA 2FBWC 2M3EA 2QG4A 3P7KA 2E43A 3L71J 3MUDC 2FKWB 4TT3H 3B8EB 3BCCD 2N3AB 3L73E 3CWBE 1KC8Q 1B47A 1W2BO 2JWAA 2KI7B 3V2RA 4A4BA 2HODB 1NVOA 1S2EA 2QM8A 1BCCD 4GODA 4EI2A 2IBZE 1N7SA 3WU2E 3KHUA 4EOTA 4O9BA 3MGNA 1RF1C 3SJGA 2XNDH 4OWFA 1MKMA 3BCCG 1EDIA 1MV8A 5AW2B 5AVUB 2N9BA 5H2FE 1XTGB 3L75J 3V6IA 2WSCJ 1GL2C 2OYIB 1A02J 4MCRA 1LT9C 1BCCG 1W5CE 5AVVB 3RBUA 1CW5A 1U57A 4RKUJ 1KILA 1NTKK 5HKYA 2ZJSE 4PJ0E 2KK7A 3UIAA 1LP1A 2K1AA 1BCCE 2WSCH 4OC4A 1GU5A 1GK4A 5APYA 1JY2O 2ZYGA 1T2KD 1QEXA 3VMZA 3AE2C 2E75C 2P7JA 1L0NJ 3HE4A 1GW4A 1G2CA 2H43A 4HJGH 1YI2P 1SP4A 2V7QH 1ZV8A 1SQXE 4OC3A 2RN0A 4PD4H 1VPCA 5GTHH 1FJKA 2CPSA 3CX5D 1L4AD 2FYUD 4JF7A 3OW2O 3D7DA 1Q86Q 4OMEA 2XV5A 4H0LC 3L71D 4GKGA 1X79B 5E79H 2O01H 3H32A 3HUSB 1Q2NA 1SQQD 2CPBA 1VF5B 4U3FJ 4IL6E 1VQLP 1SQVK 1MFTA 1N8RQ 1T2KC 3M06A 2Q6QA 1KYOI 2Y1NA 4L73A 3V5BA 2C6PA 1EO0A 4NGPA 5KLVE 1AV1A 4H44D 3CD6P 1DEBA 3D6ZA 2IBZI 4UB6E 1D7MA 2FYUG 2QSIA 3B4SA 3O6QB 3L71G 2OGUA 4MN4C 1FZCC 1SQQG 4DT0A 2HPCA 3B5NC 1L4AC 2V4HA 1FAVA 2YO3A 1AVYA 3NXSA 3HPHE 3RK3E 3IR9A 3KXDA 2IYOA 2KP8A 2YMYA 1PGQA 2B87A 1PL5A 5DJTB 2M0BA 2OYHC 4H44C 4DCKA 1N7SB 4NGTA 2XNXA 3PLNA 4EDFA 1K8AQ 1XTCC 1BDCA 1VQOP 5CCGC 2M8RA 4NGRA 1M90Q 2A06D 3L75E 4RR2B 1Y8AA 3FXDA 2AEFA 1FJPA 2H88C 1HUCA 1L0LJ 3V4WA 3WMM0 4PV1C 3H1JJ 3FX0A 3MD0A 1OVUA 3BXMA 1JY3N 1N7SD 2QJYB 3P8MC 1SQBJ 1M1KQ 2AEJA 4U3FD 3E1RA 1CSBA 3D7GA 1URQA 2NPSA 3PFVA 1KQLA 4PD4E 4HYTB 2R3SA 2WSEJ 1L0NE 1LTAC 2A06G 3H1KJ 4OC5A 1CX8A 5KTBA 3A7OA 5AVYB 2YIUC 1KQSO 3S9MA 1H0TA 3VMXA 2HG5D 2OTKE 3C8VA 5E79E 2QIWA 2QM7A 4N78E 4ZKPA 2VKZG 2HFED 4U3FG 4IL6X 3NMDA 2FYNB 1FE6A 2KYVA 2P67A 1K73Q 3RL0g 3CXHD 3T97A 2GUSA 3VGOA 2BEQD 4NGMA 3H32B 4BRYA 2QA4P 1IFNA 3VTPC 3LIEA 3AE1C 3HD7A 3M0DC 5AVQB 1NU1K 2M5AA 1YBKA 1P84H 2IDBA 2WSSH 3AEBC 1GTWA 1QVGO 1S4XA 2WT7A 3M9HA 1QL1A 2KNCA 1KILC 1JCCA 3TGUD 2XPPA 3D7HA 2IX7C 1R5LA 2SPZA 1HTLC 3U88C 4WY4A 2HPCB 1NOHA 1YQ3C 3P8CE 1RE4A 2KZIA 3L70J 3AECC 3HMJG 5KAFH 1N7LA 3G9RA 2E76C 3ZNIA 1IFPA 3RL0C 3TGUG 3RBZA 2HODA 4PD4I 3S9NA 2Y9ZA 1BGYJ 2JEEA 2W8ZA 3PTZA 1OWAA 2OARA 5HKZA 4GT1A 1J1EB 2H7HA 2C9NY 2M3BA 1EDJA 4OC2A 1L0LE 4B86A 3H1JE 1S5LH 1QVFO 3L72J 1OIPA 1K9MQ 3PT1A 1SQBE 4GPLB 3D7FA 2NRGA 4BWNA 1HWTC 4JZ0A 1T3UA 4NPEA 3VN0A 1J1DC 1OX3A 1K05A 1URQB 2NPSB 5AW1B 1LWUB 3H1KE 2PGDA 4JQ0D 3FECA 2AXTE 3GF7A 2P10A 3CCLP 1H0TB 3A3YB 2JDIH 4EYYQ 2XEGA 5KAIH 1HVVA 1HJBA 4W9YA 1JNMA 1Z56A 3RK2B 3BUXB 4WBAA 1PP9J 4H13B 1BE3E 5BU8B 3BUNB 3VMYA 2HYNA 1URQD 2NPSD 3EWKA 2POHA 4Z1MH 3JCUH 3AEFC 3PRJA 3T97B 3BI1A 5B5EE 4BRYB 4I7ZC 2P58A 1FZFA 1PFIA 1SFCB 1AVOA 1S9KE 4AUWA 1IFJA 2QEXP 3CCJP 1JY2N 3V2PA 3RK2D 3AEAC 4BPUB 1KYOD 4HH2A 4GOFA 5AVRB 2W83C 2O1KA 1TU3F 2KNCB 2O3JA 1G1IA 3P32A 2IBZD 5KAFE 1Y9BA 2R32A 3L37A 3O6QA 1YJWP 1WMKA 1AFOA 1T6AA 3HPGG 1GL2B 4WY4B 1LTSC 1ZOYC 1RE3A 5CCHC 5KKZC 3VRQA 3HD7D 3L70E 3L72D 4JYBA 1FZEA 1BDDA 4C7RA 1VQKP 4OC1A 2ZFCA 1W2EA 2B89A 3H1HE 5AW9B 1LTGC 5L8RJ 4Y99B 4MCQA 4NPDA 3GMAA 4JYWA 2E74B 2Q3EA 4MCSA 4BPWB 2IBZG 1Q82Q 3BRTB 3G71P 3A0BH 1BGYE 1KYOE 1NTKJ 2C0WA 1S5LE 4YXDC 1NKNA 4WY4D 2B4JC 4GOEA 3L72G 3BUOB 4EIJA 3L35A 5AW6B 2XDJA 1YYCA 1E5WA 4DJGA 3KQGA 3VP8A 4NGNA 3H25A 2J5UA 3L72E 3WUVA 1RQUA 3VRRA 2E74D 3ITKA 4ZMDA 2Z5IA 3KZIH 1YTZT 1SQXD 3CMAP 3Q3DA 1VQ6P 1Z9EA 4NGQA 1UIIA 1VQ8P 1FZGA 1P84I 2D2CB 1KZUB 4TLFA 3PJSK 2FYUK 3JSVC 2CIJA 3ABVC 1EC5A 1SQQK 2CK3H 2V7QJ 3W68A 2QE7H 2WPQA 3GW6A 1SQVJ 3SSUA 1SQXG 3JCUE 2QVAA 1SQPE 1FZCB 1GW3A 1LJ2A 1FDOA 1NYHA 4NGSA 5KLVD 3GF3A 1PP9E 1M1JB 3RK3B 3B5NB 1H88A 5AVZB 2D2CD 1KV4A 4OGQB 2P1JA 2OR4A 2O01J 3S9LA 2W27A 3M91A 2DLAA 3HE5A 1NWQA 1FBMA 2IPPA 2KXPB 2R5DA 5KLIB 2LXBA 5BU5A 2PP6A 4U7JA 4XA4A 5BVZA 2JJLA 2YXQB 4P44A 5AVXB 5KLVG 1LTBC 3RK3D 3IF4A 1AQTA 2ZT9B 2XEJA 1LTJA 1X8YA 2OQQA 3V2NA 4OGQD 1KB9H 4JPZB 2IFNA 4W80A 1PIXA 3VOPA 5C39A 4R4LA 2OYIC 2HLOA 2KIKA 2QJPB 5AVTB 1SVFA 2GUVA 1S72P 5EFWB 3BUMB 1JB0J 5APTA 5TJHA 1VF5D 4P4EA 1NTKG 3W67A 2BEZF 1AJYA 2JBKA 3G4SP 3L75D 1S5LX 2IZ1A 2YXRB 1JUNA 2H89C 2J58A 1K04A 2K88A 3O8ZA 5AW8B 1NTKE 2Z4EA 1IFIA 3AE3C 3AE6C 3PH0A 1NAYA 3V4QA 1M57D 4W7ZA 1SQVD 4IFDK 1NTMK 3RBXA 4PD4D 3Q1MA 1IK9A 1USDA 2O1JA 1L0ND 1EZVE 4IFMA 3L75G 2YKQA 4UB8H 2K3RA 3HUSC 1KFNA 2WQYC 1VF5C 2L5GB 1OVRA 3PP5A 3L74E 2WTYA 5AW5B 2ZYAA 4N78D 1FU1A 4N6JA 1RF0A 2JKVA 1KTMA 1U7JA 3BVHA 1SQVG 1PGPA 3Q5RA 1DD4A 1L0NG 1U7MA 3FGAD 3GHGC 3OA7A 2QJKC 1LWUA 1N86A 1SQVE 1RE3C 3OB1B 5F09A 3BATA 5GTHE 2PRRA 3RGUA 4LGDE 1NU1J 3I55P 5KJ7A 1S1CX 5M1BA 1JTHA 1VQ5P 2G3AA 2C9LY 5CMZA 1M56D 1QGKB 1GDTA 4P4BA 1NTZJ 1ZR2A 2KS1B 3HE5B 3CCEP 3MUDA 3GG2A 1KB9E 1BE3J 1JY2P 3P8CD 3HTKA 1N7SC 2A45H 1HF9A 2W6JH 3RL0B 2KB7P 5APQA 1GD2E 1SFCA 3KYQA 3VMAA 3LW5H 5APXA 3FWLA 2DW3A 3CLQA 1LTJB 2E42A 2LKMA 3M9BA 5APSA 3TF5A 1RF1A 3VRNA 3OJAB 4K3AA 2KOGA 1EZVI 4YPCA 1VQMP 4L75A 5AW7B 4ZNCA 1FDIA 3L36A 1GL2A 1LT9A 1CI6B 3CC2P 1RHZB 1SS1A 2KZJA 2QRXA 1L0LD 3H1JD 1FDMA 2W6AA 3EFFK 1N73B 3H1LE 2ZXXA 2Z5HA 1SQBD 3H1HJ 2Q1KA 4P4IA 4UB8E 5CJ4A 1JEKA 2P2UA 2FFDB 2KLVA 5GTIH 1NO4A 1Q7YQ 3H1KD 2FYNC 2XPNA 1IJDB 2KLUA 4I6MC 2R3CA 4LC1A 1L0LG 1FS0E 3M0AA 1LTIC 3H1JG 2Y0CA 1JM0A 3N7NA 2Q3IA 2E5TA 4Y28J 4AYCA 4C7NA 1SQBG 2ZXEB 2O01N 1X9VA 1FZAA 2N1TB 1NTZD 2K9JA 2OTLP 1RY3A 2KSEA 4D6TE 3Q5PA 2LR2A 3AE8C 3CCVP 1BE3D 1ZRTE 3CCQP 4IOIH 3H1KG 1KB9I 1P84D 4YXWH 1NU1G 4DOJA 2WPRA 1IC2A 3CCUP 1RH5B 3OB2B 3KDPB 1OZHA 2GM4A 1NU1E 1S9KD 3A2AA 1YQ4C 3BHXA 3CL3D 3N4XA 1NTZG 3TNUA 3D6YA 1E79H 2FXOA 4GIFA 1FZCA 1BE3G 3NTNA 4JBZA 3BCCJ 1JTHB 5CHXA 4WWIA 3F9KC 1SQPJ 1M1JA 1NTZE 3B5NA 3PHLA 4GDOA 5H2FH 5AW0B 1HJ0A
chains in the Genus database with same CATH topology
5APWA 3IR9A 3RL0D 1KZUB 2KP8A 2YMYA 3HTKB 2FYUK 2YKOA 1MZ9A 3R2PA 4LLHA 2OYHC 1J1DB 5KJ7D 2MJZA 4I2LC 3U1AA 5AVWB 1N7SB 1J1EC 1SQQK 1NTZK 1CZQA 2XNXA 2OYHA 2WPQA 3SWYA 1KFMA 1XTCC 1GW3A 1FZCB 5CCGC 2M8RA 1M1JB 1RF1B 3RK3B 3B5NB 1H88A 5AVZB 5CCGA 1YTZI 1H89A 1FJPA 3V4WA 1HUCA 3TSIA 3WMM0 2P1JA 1JY3O 1VDFA 3MD0A 2W27A 3M91A 3HE5A 1NWQA 1JY3N 1N7SD 3P8MC 1URQC 1LGHB 1LT9B 1SFCD 2NPSC 1FBMA 2IPPA 2YNYA 2Q5UA 3M9QA 1CSBA 2R5DA 2XZRA 1URQA 2PAJA 2NPSA 3U59A 5BU5A 2PP6A 4XA4A 5BVZA 1KQLA 2JJLA 5KJ7C 1LTJC 4HYTB 1SQXK 5AVXB 1LTAC 4M3LA 1LTBC 5KTBA 3A7OA 5AVYB 3RK3D 1ZN5A 2WZ7A 2KSJA 4JYCA 1LTJA 1X8YA 3V2NA 3VMXA 2HG5D 3G3ZA 2IFNA 4W80A 2R5BA 3L4FA 3RK2C 3VOPA 2OYIC 2QM7A 1FOSE 2HLOA 4N78E 4ZKPA 2C0XA 1GZLA 1GL2D 2HFED 5AVTB 1SVFA 2A45G 2OYIA 2GUVA 3A5TA 3NMDA 4IFFA 2KYVA 2N1TD 2P67A 2WITA 5APTA 4C7NB 3T97A 2A45I 2WSFH 2GUSA 1JY3P 1SFCC 1N73C 3H32B 3EQ2A 3HD7C 1G1JA 5KLVK 5CJ0A 1ZLLA 1IFNA 1L4AA 3VTPC 1JUNA 2J58A 3LIEA 1NKZB 3HD7A 1QL2A 3M0DC 5AVQB 1NU1K 3O8ZA 5AW8B 2VRSA 2Z4EA 1IFIA 2FFDC 3M0DA 3MTUE 4ZKUA 1T8ZA 1GTWA 4W7YA 3V4QA 2WT7A 3M9HA 3CI9A 3HRNA 4W7ZA 4IFDK 2XPOA 1QL1A 1NTMK 1IO4A 1IK9A 1KILC 1JCCA 4WY4C 2O1JA 2XPPA 1NH4A 2H8PD 4IFMA 3TNUB 2YKQA 2BASA 5CCHD 2IX7C 3C9IA 1HTLC 3U88C 1RE4C 2N1TC 1FZBA 3HUSC 4WY4A 2HPCB 1KFNA 1NOHA 3P8CE 2L5GB 4Y99C 1WRGA 3PP5A 1RF0C 1RE4A 2WTYA 5AW5B 2WWWA 3HUSA 4N78D 1L4AB 1FU1A 2W6BA 1HBWA 3V2QA 3HD7B 4N6JA 1N7LA 1GU4A 1RF0A 2Q7CA 3EFGA 4WB4A 3BVHA 5APVA 1A02F 3TK1A 3RL0C 1T3JA 1JCDA 1LWUC 1SQPK 3MIWA 1DX7A 2HODA 2WT7B 3GHGC 3OA7A 1NHLA 1LWUA 1N86A 2JEEA 1M7LA 1OWAA 2OARA 1RE3C 2OYHB 1HGZA 4GT1A 3GHGA 2I1KA 3BATA 4DZOA 1J1EB 2H7HA 4LGDE 2C9NY 2M3BA 3B5ND 3OAKA 5KJ7A 1ZR4A 5AW4B 1OXZA 4B86A 1JTHA 2XKMA 3SWFA 2C9LY 5AW3B 2WPSA 3P7KA 2E43A 5CMZA 2Q9IA 2FYZA 2FKWB 1GDTA 1N2DC 1ZR2A 1L0NK 3B8EB 1MUUA 2N3AB 3HE5B 3U1CA 4RESB 1FOSF 1HWTC 1WT6A 3MUDA 2YKPA 1T3UA 3VN0A 1J1DC 3V2RA 1JY2P 2HODB 3VYIA 3P8CD 3HTKA 1N7SC 1CI6A 2A45H 2QM8A 3TYYA 3RL0B 1URQB 2KB7P 1DH3A 2NPSB 5AW1B 1LWUB 5APQA 1GD2E 1N7SA 3GHGB 2YO2A 4I1LA 1SFCA 3KYQA 1N73A 2IFMA 3LW5H 5APXA 3CLQA 5CCGD 1LTJB 4EOTA 4O9BA 1HH0A 3MGNA 3A3YB 1M1JC 1RF1C 3RK3C 2E42A 2LKMA 3M9BA 1HVVA 1HJBA 5APSA 3IFMA 1JNMA 1RF1A 2FFDA 3OJAB 1Z56A 1MV8A 5AW2B 5AVUB 2N9BA 2KOGA 3RK2B 3LIDA 4WBAA 2OYIB 1IFDA 1XTGB 1GL2C 2J59M 5BU8B 1A02J 1LT9C 1J2JB 2HYNA 1URQD 3VMYA 2NPSD 5AW7B 2POHA 5AVVB 1CW5A 3L36A 1KILA 1NTKK 1GL2A 1LT9A 1CI6B 3UIAA 4C46A 2WSCH 1GU5A 1AQ5A 1FZFA 2N1TA 1FDMA 1PFIA 2W6AA 1GK4A 1SFCB 5APYA 1JY2O 1N73B 1LTTC 1T2KD 1S9KE 4AUWA 1IFJA 2Z5HA 1GK6A 3VMZA 5CJ4A 2P7JA 1JY2N 3V2PA 1HGVA 3E1IA 3RK2D 3HE4A 1WJTA 2P2UA 1GW4A 1G2CA 2H43A 1EQ7A 4HH2A 2FFDB 1SP4A 2KLVA 1ZV8A 5AVRB 1NO4A 2O1KA 3NFQA 2XPNA 1IJDB 1G1IA 3P32A 4I6MC 2R3CA 4LC1A 1VPCA 2R32A 3L37A 3M0AA 1LTIC 2XPLA 1FJKA 2CPSA 3II6A 5APUA 1AFOA 1KILB 3HPGG 1GL2B 3N7NA 2Q3IA 4WY4B 1LTSC 1L4AD 1RE3A 4JF7A 4AYCA 5AVSB 5CCHC 4C7NA 1JO5A 3HD7D 4JYBA 1H8AA 1FZEA 2XV5A 2ZXEB 3VP9A 4C7RA 4GKGA 1X9VA 1FZAA 1X79B 2N1TB 2O01H 1W2EA 2ZFCA 3H32A 3HUSB 5AW9B 5CCHA 1RY3A 2CPBA 1LTGC 4Y99B 4XE5B 1MFZA 1SQVK 1T2KC 3M06A 1NAFA 3HE4B 2XU6A 1G2CB 4DOJA 2WPRA 3H6PA 1IC2A 2I1JA 3V5BA 1EO0A 3BRTB 1SLQA 2C0WA 2WSEH 3I5CA 2FXMA 1DEBA 3BASA 1L0LK 1KILD 1NKNA 3KDPB 4OH8B 4WY4D 2B4JC 4AQRD 2GM4A 4EIJA 3L35A 5AW6B 3A2AA 1S9KD 1FZCC 3CL3D 3N4XA 3TNUA 2XDJA 1SQBK 1YYCA 1E5WA 3KQGA 3VP8A 4KHXA 4GIFA 1FZCA 3NTNA 2HPCA 3B5NC 1L4AC 1JTHB 5CHXA 1FAVA 3F9KC 2Z5IA 3KPEA 2YO3A 1M1JA 1YTZT 1IFMA 3BRVB 1JOCA 3B5NA 1Z9EA 3NXSA 3HPHE 5AW0B 1FZGA 1JMMA 4N3YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5APW A;  4DZO A;  3IR9 A;  2H7H A;  2C9N Y;  2P7J A;  3OAK A;  2P67 A;  5APT A;  4C7N B;  3HE4 A;  3T97 A;  2KP8 A;  1WJT A;  5AW4 B;  2P2U A;  1OXZ A;  4B86 A;  1SP4 A;  3SWF A;  5AVR B;  4I2L C;  2C9L Y;  5AW3 B;  3NFQ A;  2WPS A;  5AVW B;  3P7K A;  2E43 A;  5CMZ A;  2XPN A;  3P32 A;  4I6M C;  2R3C A;  1CZQ A;  3VTP C;  4LC1 A;  2R32 A;  1JUN A;  3L37 A;  3LIE A;  3M0A A;  5AVQ B;  2XPL A;  2WPQ A;  3O8Z A;  5AW8 B;  2VRS A;  5APU A;  3B8E B;  1MUU A;  2N3A B;  3HE5 B;  3HPG G;  2Q3I A;  4RES B;  1FOS F;  1HWT C;  4AYC A;  3VN0 A;  5AVS B;  4C7N A;  3M0D A;  3VYI A;  4JYB A;  1H8A A;  2XV5 A;  1GTW A;  2ZXE B;  3HTK A;  1CI6 A;  4GKG A;  2QM8 A;  3TYY A;  3V4Q A;  1DH3 A;  2ZFC A;  5AW1 B;  2WT7 A;  3M9H A;  5AW9 B;  1H88 A;  5APQ A;  5AVZ B;  1H89 A;  1GD2 E;  3V4W A;  1HUC A;  2XPO A;  4XE5 B;  2YO2 A;  1IO4 A;  1MFZ A;  3MD0 A;  2XPP A;  5APX A;  3TNU B;  1T2K C;  3M06 A;  2BAS A;  1NAF A;  2W27 A;  3M91 A;  4EOT A;  3HE4 B;  3U88 C;  3MGN A;  3HE5 A;  2XU6 A;  1NWQ A;  3A3Y B;  2E42 A;  3P8M C;  1G2C B;  2WPR A;  3M9B A;  2IPP A;  2YNY A;  3V5B A;  1EO0 A;  2Q5U A;  1HJB A;  5APS A;  1SLQ A;  1CSB A;  3I5C A;  2R5D A;  2WTY A;  5AW5 B;  2XZR A;  2WWW A;  1JNM A;  3KDP B;  1MV8 A;  2B4J C;  5AW2 B;  1KQL A;  2JJL A;  2N9B A;  5AVU B;  4AQR D;  1HBW A;  3LID A;  4HYT B;  3L35 A;  1GU4 A;  5AVX B;  5AW6 B;  3A2A A;  1S9K D;  1A02 J;  2Q7C A;  4M3L A;  1J2J B;  3A7O A;  5AVY B;  3VMY A;  3TNU A;  5AW7 B;  1YYC A;  4JYC A;  5AVV B;  3KQG A;  5APV A;  1A02 F;  1X8Y A;  3L36 A;  4KHX A;  3TK1 A;  3VMX A;  1CI6 B;  3NTN A;  2R5B A;  3UIA A;  4C46 A;  2WT7 B;  1FAV A;  3F9K C;  1FOS E;  2QM7 A;  2Z5I A;  1GU5 A;  2YO3 A;  1GZL A;  2W6A A;  1GK4 A;  5APY A;  1Z9E A;  1OWA A;  3NXS A;  1T2K D;  1S9K E;  3HPH E;  5AVT B;  5AW0 B;  4AUW A;  4GT1 A;  2Z5H A;  1GK6 A;  3A5T A;  3NMD A;  3VMZ A; 
#chains in the Genus database with same CATH topology
 1YIT P;  2YMK A;  1P84 E;  3MHV A;  4PJ0 H;  3HTK B;  3L70 D;  1Q90 D;  4OC0 A;  5KJ7 D;  3H1H D;  5AVW B;  1J1E C;  1OFC X;  2OYH A;  5F13 A;  3S4R A;  5ELY A;  3SWY A;  4RO0 A;  1KFM A;  1KQG B;  2RMZ A;  4H13 D;  1BGY D;  2ZVO B;  1RF1 B;  2N9Y B;  5CCG A;  1H89 A;  3L70 G;  4HKZ H;  4R4M A;  1VDF A;  2G8Y A;  3H1H G;  2OOT A;  1URQ C;  1LT9 B;  1SFC D;  2NPS C;  2YNY A;  1RQV A;  2XZR A;  1JMB A;  4HB1 A;  2Y0D A;  5KJ7 C;  1SQX K;  1BGY G;  4ASW A;  3H1I E;  4M3L A;  1YJN P;  4A4C A;  1ZN5 A;  2PFX A;  4KJM A;  2KSJ A;  3FED A;  5BY0 A;  2E5Y A;  4P4D A;  2JWD A;  3CC4 P;  4XFJ A;  2R5B A;  3L4F A;  3RK2 C;  2C6G A;  2E75 B;  3WUT A;  2FYU J;  3VRO A;  2WSF J;  2C0X A;  1GL2 D;  1X22 A;  1DD3 A;  1PZQ A;  3CC7 P;  1SQQ J;  1LT1 A;  3CX5 H;  3CPW O;  5CBO A;  1SQP D;  4C7N B;  2A45 I;  2WSF H;  1NGM B;  4OVN F;  2Y9Y A;  1JY3 P;  1SFC C;  3AE7 C;  3SFD C;  3EQ2 A;  1PP9 D;  3HD7 C;  2K9J B;  1G1J A;  5KLV K;  1ZLL A;  4NPF X;  4H0L B;  3CCR P;  3A0H H;  1R5S A;  1DE4 C;  2E75 D;  1NKZ B;  3L74 J;  1QL2 A;  3S9O A;  4KT0 J;  1Q81 Q;  1KN7 A;  3M0D A;  3MTU E;  5KAI E;  4W7Y A;  4P45 A;  1YVH A;  2ZVN B;  1SQP G;  3HRN A;  2XPO A;  1IO4 A;  1EXI A;  4BTF A;  4WY4 C;  1NH4 A;  1PP9 G;  3TNU B;  1KMI Z;  2BAS A;  2RH0 A;  3BCC E;  3C9I A;  3K5B A;  2I8D A;  1RE4 C;  2OTJ P;  4H0L D;  3AE4 C;  2GA1 A;  4Y99 C;  1WRG A;  1M8O B;  1L4A B;  2E74 C;  4K35 A;  2W6B A;  3OP0 A;  3V2Q A;  1GU4 A;  2Q7C A;  3EFG A;  2KS1 A;  2PVW A;  2R44 A;  3MIW A;  1ZXG A;  3C1L A;  4L76 A;  2WVR A;  2JBJ A;  3AEG C;  2WMM A;  2OYH B;  1VQN P;  4H44 B;  4DZO A;  1NTK D;  3B5N D;  3S1K A;  3OAK A;  2AEM A;  5AW4 B;  1OXZ A;  5TIS H;  3SWF A;  2Q9I A;  2FYZ A;  1NTM J;  2D2C C;  1LNQ A;  1N2D C;  1EZV D;  1PGJ A;  4LQG A;  3FWN A;  1L0N K;  1MUU A;  4PV1 B;  3U1C A;  4RES B;  1FOS F;  3TDK A;  1WT6 A;  2FY8 A;  2YKP A;  3ZDM A;  3VYI A;  3SJF A;  3A0B E;  1CI6 A;  3TYY A;  1DH3 A;  3L74 D;  4P4F A;  2ZT9 D;  2RKL A;  2L91 A;  3GHG B;  2YO2 A;  4I1L A;  4L74 A;  1N73 A;  5J3X A;  1OW8 A;  2FXP A;  2IFM A;  2QJK B;  3AEE C;  1R8E A;  1BSH A;  2MKV A;  3SJX A;  5CCG D;  3CX5 E;  1HH0 A;  1BSN A;  2FYU E;  1M1J C;  2IYP A;  3RK3 C;  3CCS P;  3H1L J;  5B66 H;  3KAS A;  3L71 E;  2YIU B;  1EZV G;  3AE9 C;  4OGQ C;  2K37 A;  3IFM A;  1SQQ E;  2FFD A;  4PV1 D;  2C6C A;  3KZI E;  3LID A;  3A0H E;  1QLE D;  1IFD A;  2J59 M;  3L74 G;  1J2J B;  1EDL A;  3SFE C;  3CXH H;  2ZYD A;  5KLI C;  4MCP A;  2ZAE B;  4C46 A;  1X0T A;  3FEE A;  1AQ5 A;  2N1T A;  2BCC J;  1PGO A;  2ZT9 C;  1ZW0 A;  1LTT C;  1UIX A;  1EXJ A;  1GK6 A;  4D6T J;  1HGV A;  3E1I A;  3TGU J;  2JR8 A;  1KB9 D;  1WJT A;  5CBN A;  2QJP C;  1EQ7 A;  3D71 A;  1YJ9 P;  3NFQ A;  3Q2Y A;  2XPL A;  3II6 A;  5APU A;  1KIL B;  5AVS B;  1JO5 A;  3IWW A;  1KD1 Q;  1LP1 B;  1H8A A;  3VP9 A;  3QWO C;  1NTM D;  1OW7 A;  5CCH A;  2B9B A;  4XE5 B;  1MFZ A;  3IN6 A;  1NAF A;  3HE4 B;  4BXL A;  2XU6 A;  1G2C B;  1PPJ D;  3R4Y A;  3H6P A;  2I1J A;  2E76 B;  2JO1 A;  3LW5 J;  5DJU B;  1SLQ A;  3D70 A;  2A06 E;  2WSE H;  5TIS E;  3I5C A;  5HKW A;  2FXM A;  3BAS A;  1L0L K;  1KIL D;  4OH8 B;  4AQR D;  2UWJ E;  2AXT H;  1EDK A;  3CX5 I;  3H1L D;  1ZME C;  1NTM G;  1OW6 A;  1SQB K;  2HR3 A;  4P4J A;  1PV3 A;  4KHX A;  2XEI A;  1AA0 A;  4U3F E;  1NTM E;  3KPE A;  1PPJ G;  1IFM A;  1VQ4 P;  2JP3 A;  1JOC A;  3BRV B;  1USE A;  2E76 D;  1IZN B;  3AED C;  2QJY C;  1JMM A;  4N3Y B;  5APW A;  3RL0 D;  3B71 A;  5B5E H;  1PPJ E;  1QX8 A;  3E7K A;  2PVV A;  5B66 E;  3H1L G;  2BCC D;  2NZ2 A;  4QMA A;  2YKO A;  1MZ9 A;  3R2P A;  4LLH A;  1VQ7 P;  1IK7 A;  5AXI A;  1J1D B;  2MJZ A;  1KIL E;  4I2L C;  3U1A A;  4D6T D;  3Q5S A;  1NTZ K;  1CZQ A;  3AE5 C;  1ZRT D;  2UV8 G;  4YTP C;  3CXH E;  3H1I J;  2CBL A;  2ITA A;  1NJI Q;  1DEE G;  1YTZ I;  2BCC G;  1DIP A;  3TSI A;  1JY3 O;  1NU1 D;  4RJT A;  3FF3 A;  3QH9 A;  3SWK A;  4D6T G;  2B87 B;  1LGH B;  2KUB A;  2BCC E;  2Q5U A;  3M9Q A;  1GMJ A;  3L73 J;  3CWB J;  2PAJ A;  3U59 A;  2LXC B;  1LTJ C;  1ZP0 C;  4I7Z B;  1S3J A;  3TGU E;  2WPV B;  1L2P A;  2WZ7 A;  4JYC A;  3G3Z A;  1KYO H;  1FOS E;  3MZW B;  1GZL A;  3WU2 H;  2A45 G;  2OYI A;  3A5T A;  4IFF A;  2K9Y A;  2N1T D;  3CCM P;  2WIT A;  3JC2 2;  1N73 C;  2B88 A;  3SJE A;  5KKZ B;  5CJ0 A;  1L4A A;  1BCC J;  1YIJ P;  2VRS A;  3F89 A;  3PLF B;  2FFD C;  3GLM A;  3I56 P;  4ZKU A;  1T8Z A;  1VQ9 P;  1KQF B;  5D29 A;  3CI9 A;  1Z8L A;  2OYO A;  1Y47 A;  3USS A;  3H1I D;  3G6E P;  2H8P D;  1SQX J;  1KOR A;  3CXH I;  5CCH D;  2Y1M A;  2N1T C;  1FZB A;  3CME P;  1FBV A;  1RF0 C;  2WWW A;  3HUS A;  5K5G B;  2AXC A;  1HBW A;  3HD7 B;  4X3R A;  2Y0E A;  2M5A B;  4WB4 A;  3VRP A;  3L73 D;  3CWB D;  5APV A;  1A02 F;  3IAO A;  3TK1 A;  1FC2 C;  1T3J A;  1JCD A;  1LWU C;  3H1I G;  1SQP K;  1DX7 A;  2WT7 B;  1VL2 A;  5GTI E;  1NHL A;  1OMI A;  3BI0 A;  1M7L A;  2XEF A;  5KLV J;  4WVZ A;  4IL6 H;  3MP7 B;  3FXE A;  1HGZ A;  3BUW B;  4BPX B;  1OVV A;  3GHG A;  2I1K A;  2IZ0 A;  4A7P A;  1YHQ P;  3WUU A;  3F5H A;  4CPG A;  1ZR4 A;  1VQP P;  3L73 G;  2XKM A;  3CWB G;  4ASV A;  4UB6 H;  4H13 C;  5AW3 B;  2W90 A;  2WPS A;  2FBW C;  2M3E A;  2QG4 A;  3P7K A;  2E43 A;  3L71 J;  3MUD C;  2FKW B;  4TT3 H;  3B8E B;  3BCC D;  2N3A B;  3L73 E;  3CWB E;  1KC8 Q;  1B47 A;  1W2B O;  2JWA A;  2KI7 B;  3V2R A;  4A4B A;  2HOD B;  1NVO A;  1S2E A;  2QM8 A;  1BCC D;  4GOD A;  4EI2 A;  2IBZ E;  1N7S A;  3WU2 E;  3KHU A;  4EOT A;  4O9B A;  3MGN A;  1RF1 C;  3SJG A;  2XND H;  4OWF A;  1MKM A;  3BCC G;  1EDI A;  1MV8 A;  5AW2 B;  5AVU B;  2N9B A;  5H2F E;  1XTG B;  3L75 J;  3V6I A;  2WSC J;  1GL2 C;  2OYI B;  1A02 J;  4MCR A;  1LT9 C;  1BCC G;  1W5C E;  5AVV B;  3RBU A;  1CW5 A;  1U57 A;  4RKU J;  1KIL A;  1NTK K;  5HKY A;  2ZJS E;  4PJ0 E;  2KK7 A;  3UIA A;  1LP1 A;  2K1A A;  1BCC E;  2WSC H;  4OC4 A;  1GU5 A;  1GK4 A;  5APY A;  1JY2 O;  2ZYG A;  1T2K D;  1QEX A;  3VMZ A;  3AE2 C;  2E75 C;  2P7J A;  1L0N J;  3HE4 A;  1GW4 A;  1G2C A;  2H43 A;  4HJG H;  1YI2 P;  1SP4 A;  2V7Q H;  1ZV8 A;  1SQX E;  4OC3 A;  2RN0 A;  4PD4 H;  1VPC A;  5GTH H;  1FJK A;  2CPS A;  3CX5 D;  1L4A D;  2FYU D;  4JF7 A;  3OW2 O;  3D7D A;  1Q86 Q;  4OME A;  2XV5 A;  4H0L C;  3L71 D;  4GKG A;  1X79 B;  5E79 H;  2O01 H;  3H32 A;  3HUS B;  1Q2N A;  1SQQ D;  2CPB A;  1VF5 B;  4U3F J;  4IL6 E;  1VQL P;  1SQV K;  1MFT A;  1N8R Q;  1T2K C;  3M06 A;  2Q6Q A;  1KYO I;  2Y1N A;  4L73 A;  3V5B A;  2C6P A;  1EO0 A;  4NGP A;  5KLV E;  1AV1 A;  4H44 D;  3CD6 P;  1DEB A;  3D6Z A;  2IBZ I;  4UB6 E;  1D7M A;  2FYU G;  2QSI A;  3B4S A;  3O6Q B;  3L71 G;  2OGU A;  4MN4 C;  1FZC C;  1SQQ G;  4DT0 A;  2HPC A;  3B5N C;  1L4A C;  2V4H A;  1FAV A;  2YO3 A;  1AVY A;  3NXS A;  3HPH E;  3RK3 E;  3IR9 A;  3KXD A;  2IYO A;  2KP8 A;  2YMY A;  1PGQ A;  2B87 A;  1PL5 A;  5DJT B;  2M0B A;  2OYH C;  4H44 C;  4DCK A;  1N7S B;  4NGT A;  2XNX A;  3PLN A;  4EDF A;  1K8A Q;  1XTC C;  1BDC A;  1VQO P;  5CCG C;  2M8R A;  4NGR A;  1M90 Q;  2A06 D;  3L75 E;  4RR2 B;  1Y8A A;  3FXD A;  2AEF A;  1FJP A;  2H88 C;  1HUC A;  1L0L J;  3V4W A;  3WMM 0;  4PV1 C;  3H1J J;  3FX0 A;  3MD0 A;  1OVU A;  3BXM A;  1JY3 N;  1N7S D;  2QJY B;  3P8M C;  1SQB J;  1M1K Q;  2AEJ A;  4U3F D;  3E1R A;  1CSB A;  3D7G A;  1URQ A;  2NPS A;  3PFV A;  1KQL A;  4PD4 E;  4HYT B;  2R3S A;  2WSE J;  1L0N E;  1LTA C;  2A06 G;  3H1K J;  4OC5 A;  1CX8 A;  5KTB A;  3A7O A;  5AVY B;  2YIU C;  1KQS O;  3S9M A;  1H0T A;  3VMX A;  2HG5 D;  2OTK E;  3C8V A;  5E79 E;  2QIW A;  2QM7 A;  4N78 E;  4ZKP A;  2VKZ G;  2HFE D;  4U3F G;  4IL6 X;  3NMD A;  2FYN B;  1FE6 A;  2KYV A;  2P67 A;  1K73 Q;  3RL0 g;  3CXH D;  3T97 A;  2GUS A;  3VGO A;  2BEQ D;  4NGM A;  3H32 B;  4BRY A;  2QA4 P;  1IFN A;  3VTP C;  3LIE A;  3AE1 C;  3HD7 A;  3M0D C;  5AVQ B;  1NU1 K;  2M5A A;  1YBK A;  1P84 H;  2IDB A;  2WSS H;  3AEB C;  1GTW A;  1QVG O;  1S4X A;  2WT7 A;  3M9H A;  1QL1 A;  2KNC A;  1KIL C;  1JCC A;  3TGU D;  2XPP A;  3D7H A;  2IX7 C;  1R5L A;  2SPZ A;  1HTL C;  3U88 C;  4WY4 A;  2HPC B;  1NOH A;  1YQ3 C;  3P8C E;  1RE4 A;  2KZI A;  3L70 J;  3AEC C;  3HMJ G;  5KAF H;  1N7L A;  3G9R A;  2E76 C;  3ZNI A;  1IFP A;  3RL0 C;  3TGU G;  3RBZ A;  2HOD A;  4PD4 I;  3S9N A;  2Y9Z A;  1BGY J;  2JEE A;  2W8Z A;  3PTZ A;  1OWA A;  2OAR A;  5HKZ A;  4GT1 A;  1J1E B;  2H7H A;  2C9N Y;  2M3B A;  1EDJ A;  4OC2 A;  1L0L E;  4B86 A;  3H1J E;  1S5L H;  1QVF O;  3L72 J;  1OIP A;  1K9M Q;  3PT1 A;  1SQB E;  4GPL B;  3D7F A;  2NRG A;  4BWN A;  1HWT C;  4JZ0 A;  1T3U A;  4NPE A;  3VN0 A;  1J1D C;  1OX3 A;  1K05 A;  1URQ B;  2NPS B;  5AW1 B;  1LWU B;  3H1K E;  2PGD A;  4JQ0 D;  3FEC A;  2AXT E;  3GF7 A;  2P10 A;  3CCL P;  1H0T B;  3A3Y B;  2JDI H;  4EYY Q;  2XEG A;  5KAI H;  1HVV A;  1HJB A;  4W9Y A;  1JNM A;  1Z56 A;  3RK2 B;  3BUX B;  4WBA A;  1PP9 J;  4H13 B;  1BE3 E;  5BU8 B;  3BUN B;  3VMY A;  2HYN A;  1URQ D;  2NPS D;  3EWK A;  2POH A;  4Z1M H;  3JCU H;  3AEF C;  3PRJ A;  3T97 B;  3BI1 A;  5B5E E;  4BRY B;  4I7Z C;  2P58 A;  1FZF A;  1PFI A;  1SFC B;  1AVO A;  1S9K E;  4AUW A;  1IFJ A;  2QEX P;  3CCJ P;  1JY2 N;  3V2P A;  3RK2 D;  3AEA C;  4BPU B;  1KYO D;  4HH2 A;  4GOF A;  5AVR B;  2W83 C;  2O1K A;  1TU3 F;  2KNC B;  2O3J A;  1G1I A;  3P32 A;  2IBZ D;  5KAF E;  1Y9B A;  2R32 A;  3L37 A;  3O6Q A;  1YJW P;  1WMK A;  1AFO A;  1T6A A;  3HPG G;  1GL2 B;  4WY4 B;  1LTS C;  1ZOY C;  1RE3 A;  5CCH C;  5KKZ C;  3VRQ A;  3HD7 D;  3L70 E;  3L72 D;  4JYB A;  1FZE A;  1BDD A;  4C7R A;  1VQK P;  4OC1 A;  2ZFC A;  1W2E A;  2B89 A;  3H1H E;  5AW9 B;  1LTG C;  5L8R J;  4Y99 B;  4MCQ A;  4NPD A;  3GMA A;  4JYW A;  2E74 B;  2Q3E A;  4MCS A;  4BPW B;  2IBZ G;  1Q82 Q;  3BRT B;  3G71 P;  3A0B H;  1BGY E;  1KYO E;  1NTK J;  2C0W A;  1S5L E;  4YXD C;  1NKN A;  4WY4 D;  2B4J C;  4GOE A;  3L72 G;  3BUO B;  4EIJ A;  3L35 A;  5AW6 B;  2XDJ A;  1YYC A;  1E5W A;  4DJG A;  3KQG A;  3VP8 A;  4NGN A;  3H25 A;  2J5U A;  3L72 E;  3WUV A;  1RQU A;  3VRR A;  2E74 D;  3ITK A;  4ZMD A;  2Z5I A;  3KZI H;  1YTZ T;  1SQX D;  3CMA P;  3Q3D A;  1VQ6 P;  1Z9E A;  4NGQ A;  1UII A;  1VQ8 P;  1FZG A;  1P84 I;  2D2C B;  1KZU B;  4TLF A;  3PJS K;  2FYU K;  3JSV C;  2CIJ A;  3ABV C;  1EC5 A;  1SQQ K;  2CK3 H;  2V7Q J;  3W68 A;  2QE7 H;  2WPQ A;  3GW6 A;  1SQV J;  3SSU A;  1SQX G;  3JCU E;  2QVA A;  1SQP E;  1FZC B;  1GW3 A;  1LJ2 A;  1FDO A;  1NYH A;  4NGS A;  5KLV D;  3GF3 A;  1PP9 E;  1M1J B;  3RK3 B;  3B5N B;  1H88 A;  5AVZ B;  2D2C D;  1KV4 A;  4OGQ B;  2P1J A;  2OR4 A;  2O01 J;  3S9L A;  2W27 A;  3M91 A;  2DLA A;  3HE5 A;  1NWQ A;  1FBM A;  2IPP A;  2KXP B;  2R5D A;  5KLI B;  2LXB A;  5BU5 A;  2PP6 A;  4U7J A;  4XA4 A;  5BVZ A;  2JJL A;  2YXQ B;  4P44 A;  5AVX B;  5KLV G;  1LTB C;  3RK3 D;  3IF4 A;  1AQT A;  2ZT9 B;  2XEJ A;  1LTJ A;  1X8Y A;  2OQQ A;  3V2N A;  4OGQ D;  1KB9 H;  4JPZ B;  2IFN A;  4W80 A;  1PIX A;  3VOP A;  5C39 A;  4R4L A;  2OYI C;  2HLO A;  2KIK A;  2QJP B;  5AVT B;  1SVF A;  2GUV A;  1S72 P;  5EFW B;  3BUM B;  1JB0 J;  5APT A;  5TJH A;  1VF5 D;  4P4E A;  1NTK G;  3W67 A;  2BEZ F;  1AJY A;  2JBK A;  3G4S P;  3L75 D;  1S5L X;  2IZ1 A;  2YXR B;  1JUN A;  2H89 C;  2J58 A;  1K04 A;  2K88 A;  3O8Z A;  5AW8 B;  1NTK E;  2Z4E A;  1IFI A;  3AE3 C;  3AE6 C;  3PH0 A;  1NAY A;  3V4Q A;  1M57 D;  4W7Z A;  1SQV D;  4IFD K;  1NTM K;  3RBX A;  4PD4 D;  3Q1M A;  1IK9 A;  1USD A;  2O1J A;  1L0N D;  1EZV E;  4IFM A;  3L75 G;  2YKQ A;  4UB8 H;  2K3R A;  3HUS C;  1KFN A;  2WQY C;  1VF5 C;  2L5G B;  1OVR A;  3PP5 A;  3L74 E;  2WTY A;  5AW5 B;  2ZYA A;  4N78 D;  1FU1 A;  4N6J A;  1RF0 A;  2JKV A;  1KTM A;  1U7J A;  3BVH A;  1SQV G;  1PGP A;  3Q5R A;  1DD4 A;  1L0N G;  1U7M A;  3FGA D;  3GHG C;  3OA7 A;  2QJK C;  1LWU A;  1N86 A;  1SQV E;  1RE3 C;  3OB1 B;  5F09 A;  3BAT A;  5GTH E;  2PRR A;  3RGU A;  4LGD E;  1NU1 J;  3I55 P;  5KJ7 A;  1S1C X;  5M1B A;  1JTH A;  1VQ5 P;  2G3A A;  2C9L Y;  5CMZ A;  1M56 D;  1QGK B;  1GDT A;  4P4B A;  1NTZ J;  1ZR2 A;  2KS1 B;  3HE5 B;  3CCE P;  3MUD A;  3GG2 A;  1KB9 E;  1BE3 J;  1JY2 P;  3P8C D;  3HTK A;  1N7S C;  2A45 H;  1HF9 A;  2W6J H;  3RL0 B;  2KB7 P;  5APQ A;  1GD2 E;  1SFC A;  3KYQ A;  3VMA A;  3LW5 H;  5APX A;  3FWL A;  2DW3 A;  3CLQ A;  1LTJ B;  2E42 A;  2LKM A;  3M9B A;  5APS A;  3TF5 A;  1RF1 A;  3VRN A;  3OJA B;  4K3A A;  2KOG A;  1EZV I;  4YPC A;  1VQM P;  4L75 A;  5AW7 B;  4ZNC A;  1FDI A;  3L36 A;  1GL2 A;  1LT9 A;  1CI6 B;  3CC2 P;  1RHZ B;  1SS1 A;  2KZJ A;  2QRX A;  1L0L D;  3H1J D;  1FDM A;  2W6A A;  3EFF K;  1N73 B;  3H1L E;  2ZXX A;  2Z5H A;  1SQB D;  3H1H J;  2Q1K A;  4P4I A;  4UB8 E;  5CJ4 A;  1JEK A;  2P2U A;  2FFD B;  2KLV A;  5GTI H;  1NO4 A;  1Q7Y Q;  3H1K D;  2FYN C;  2XPN A;  1IJD B;  2KLU A;  4I6M C;  2R3C A;  4LC1 A;  1L0L G;  1FS0 E;  3M0A A;  1LTI C;  3H1J G;  2Y0C A;  1JM0 A;  3N7N A;  2Q3I A;  2E5T A;  4Y28 J;  4AYC A;  4C7N A;  1SQB G;  2ZXE B;  2O01 N;  1X9V A;  1FZA A;  2N1T B;  1NTZ D;  2K9J A;  2OTL P;  1RY3 A;  2KSE A;  4D6T E;  3Q5P A;  2LR2 A;  3AE8 C;  3CCV P;  1BE3 D;  1ZRT E;  3CCQ P;  4IOI H;  3H1K G;  1KB9 I;  1P84 D;  4YXW H;  1NU1 G;  4DOJ A;  2WPR A;  1IC2 A;  3CCU P;  1RH5 B;  3OB2 B;  3KDP B;  1OZH A;  2GM4 A;  1NU1 E;  1S9K D;  3A2A A;  1YQ4 C;  3BHX A;  3CL3 D;  3N4X A;  1NTZ G;  3TNU A;  3D6Y A;  1E79 H;  2FXO A;  4GIF A;  1FZC A;  1BE3 G;  3NTN A;  4JBZ A;  3BCC J;  1JTH B;  5CHX A;  4WWI A;  3F9K C;  1SQP J;  1M1J A;  1NTZ E;  3B5N A;  3PHL A;  4GDO A;  5H2F H;  5AW0 B;  1HJ0 A; 
#chains in the Genus database with same CATH homology
 5APW A;  3IR9 A;  3RL0 D;  1KZU B;  2KP8 A;  2YMY A;  3HTK B;  2FYU K;  2YKO A;  1MZ9 A;  3R2P A;  4LLH A;  2OYH C;  1J1D B;  5KJ7 D;  2MJZ A;  4I2L C;  3U1A A;  5AVW B;  1N7S B;  1J1E C;  1SQQ K;  1NTZ K;  1CZQ A;  2XNX A;  2OYH A;  2WPQ A;  3SWY A;  1KFM A;  1XTC C;  1GW3 A;  1FZC B;  5CCG C;  2M8R A;  1M1J B;  1RF1 B;  3RK3 B;  3B5N B;  1H88 A;  5AVZ B;  5CCG A;  1YTZ I;  1H89 A;  1FJP A;  3V4W A;  1HUC A;  3TSI A;  3WMM 0;  2P1J A;  1JY3 O;  1VDF A;  3MD0 A;  2W27 A;  3M91 A;  3HE5 A;  1NWQ A;  1JY3 N;  1N7S D;  3P8M C;  1URQ C;  1LGH B;  1LT9 B;  1SFC D;  2NPS C;  1FBM A;  2IPP A;  2YNY A;  2Q5U A;  3M9Q A;  1CSB A;  2R5D A;  2XZR A;  1URQ A;  2PAJ A;  2NPS A;  3U59 A;  5BU5 A;  2PP6 A;  4XA4 A;  5BVZ A;  1KQL A;  2JJL A;  5KJ7 C;  1LTJ C;  4HYT B;  1SQX K;  5AVX B;  1LTA C;  4M3L A;  1LTB C;  5KTB A;  3A7O A;  5AVY B;  3RK3 D;  1ZN5 A;  2WZ7 A;  2KSJ A;  4JYC A;  1LTJ A;  1X8Y A;  3V2N A;  3VMX A;  2HG5 D;  3G3Z A;  2IFN A;  4W80 A;  2R5B A;  3L4F A;  3RK2 C;  3VOP A;  2OYI C;  2QM7 A;  1FOS E;  2HLO A;  4N78 E;  4ZKP A;  2C0X A;  1GZL A;  1GL2 D;  2HFE D;  5AVT B;  1SVF A;  2A45 G;  2OYI A;  2GUV A;  3A5T A;  3NMD A;  4IFF A;  2KYV A;  2N1T D;  2P67 A;  2WIT A;  5APT A;  4C7N B;  3T97 A;  2A45 I;  2WSF H;  2GUS A;  1JY3 P;  1SFC C;  1N73 C;  3H32 B;  3EQ2 A;  3HD7 C;  1G1J A;  5KLV K;  5CJ0 A;  1ZLL A;  1IFN A;  1L4A A;  3VTP C;  1JUN A;  2J58 A;  3LIE A;  1NKZ B;  3HD7 A;  1QL2 A;  3M0D C;  5AVQ B;  1NU1 K;  3O8Z A;  5AW8 B;  2VRS A;  2Z4E A;  1IFI A;  2FFD C;  3M0D A;  3MTU E;  4ZKU A;  1T8Z A;  1GTW A;  4W7Y A;  3V4Q A;  2WT7 A;  3M9H A;  3CI9 A;  3HRN A;  4W7Z A;  4IFD K;  2XPO A;  1QL1 A;  1NTM K;  1IO4 A;  1IK9 A;  1KIL C;  1JCC A;  4WY4 C;  2O1J A;  2XPP A;  1NH4 A;  2H8P D;  4IFM A;  3TNU B;  2YKQ A;  2BAS A;  5CCH D;  2IX7 C;  3C9I A;  1HTL C;  3U88 C;  1RE4 C;  2N1T C;  1FZB A;  3HUS C;  4WY4 A;  2HPC B;  1KFN A;  1NOH A;  3P8C E;  2L5G B;  4Y99 C;  1WRG A;  3PP5 A;  1RF0 C;  1RE4 A;  2WTY A;  5AW5 B;  2WWW A;  3HUS A;  4N78 D;  1L4A B;  1FU1 A;  2W6B A;  1HBW A;  3V2Q A;  3HD7 B;  4N6J A;  1N7L A;  1GU4 A;  1RF0 A;  2Q7C A;  3EFG A;  4WB4 A;  3BVH A;  5APV A;  1A02 F;  3TK1 A;  3RL0 C;  1T3J A;  1JCD A;  1LWU C;  1SQP K;  3MIW A;  1DX7 A;  2HOD A;  2WT7 B;  3GHG C;  3OA7 A;  1NHL A;  1LWU A;  1N86 A;  2JEE A;  1M7L A;  1OWA A;  2OAR A;  1RE3 C;  2OYH B;  1HGZ A;  4GT1 A;  3GHG A;  2I1K A;  3BAT A;  4DZO A;  1J1E B;  2H7H A;  4LGD E;  2C9N Y;  2M3B A;  3B5N D;  3OAK A;  5KJ7 A;  1ZR4 A;  5AW4 B;  1OXZ A;  4B86 A;  1JTH A;  2XKM A;  3SWF A;  2C9L Y;  5AW3 B;  2WPS A;  3P7K A;  2E43 A;  5CMZ A;  2Q9I A;  2FYZ A;  2FKW B;  1GDT A;  1N2D C;  1ZR2 A;  1L0N K;  3B8E B;  1MUU A;  2N3A B;  3HE5 B;  3U1C A;  4RES B;  1FOS F;  1HWT C;  1WT6 A;  3MUD A;  2YKP A;  1T3U A;  3VN0 A;  1J1D C;  3V2R A;  1JY2 P;  2HOD B;  3VYI A;  3P8C D;  3HTK A;  1N7S C;  1CI6 A;  2A45 H;  2QM8 A;  3TYY A;  3RL0 B;  1URQ B;  2KB7 P;  1DH3 A;  2NPS B;  5AW1 B;  1LWU B;  5APQ A;  1GD2 E;  1N7S A;  3GHG B;  2YO2 A;  4I1L A;  1SFC A;  3KYQ A;  1N73 A;  2IFM A;  3LW5 H;  5APX A;  3CLQ A;  5CCG D;  1LTJ B;  4EOT A;  4O9B A;  1HH0 A;  3MGN A;  3A3Y B;  1M1J C;  1RF1 C;  3RK3 C;  2E42 A;  2LKM A;  3M9B A;  1HVV A;  1HJB A;  5APS A;  3IFM A;  1JNM A;  1RF1 A;  2FFD A;  3OJA B;  1Z56 A;  1MV8 A;  5AW2 B;  5AVU B;  2N9B A;  2KOG A;  3RK2 B;  3LID A;  4WBA A;  2OYI B;  1IFD A;  1XTG B;  1GL2 C;  2J59 M;  5BU8 B;  1A02 J;  1LT9 C;  1J2J B;  2HYN A;  1URQ D;  3VMY A;  2NPS D;  5AW7 B;  2POH A;  5AVV B;  1CW5 A;  3L36 A;  1KIL A;  1NTK K;  1GL2 A;  1LT9 A;  1CI6 B;  3UIA A;  4C46 A;  2WSC H;  1GU5 A;  1AQ5 A;  1FZF A;  2N1T A;  1FDM A;  1PFI A;  2W6A A;  1GK4 A;  1SFC B;  5APY A;  1JY2 O;  1N73 B;  1LTT C;  1T2K D;  1S9K E;  4AUW A;  1IFJ A;  2Z5H A;  1GK6 A;  3VMZ A;  5CJ4 A;  2P7J A;  1JY2 N;  3V2P A;  1HGV A;  3E1I A;  3RK2 D;  3HE4 A;  1WJT A;  2P2U A;  1GW4 A;  1G2C A;  2H43 A;  1EQ7 A;  4HH2 A;  2FFD B;  1SP4 A;  2KLV A;  1ZV8 A;  5AVR B;  1NO4 A;  2O1K A;  3NFQ A;  2XPN A;  1IJD B;  1G1I A;  3P32 A;  4I6M C;  2R3C A;  4LC1 A;  1VPC A;  2R32 A;  3L37 A;  3M0A A;  1LTI C;  2XPL A;  1FJK A;  2CPS A;  3II6 A;  5APU A;  1AFO A;  1KIL B;  3HPG G;  1GL2 B;  3N7N A;  2Q3I A;  4WY4 B;  1LTS C;  1L4A D;  1RE3 A;  4JF7 A;  4AYC A;  5AVS B;  5CCH C;  4C7N A;  1JO5 A;  3HD7 D;  4JYB A;  1H8A A;  1FZE A;  2XV5 A;  2ZXE B;  3VP9 A;  4C7R A;  4GKG A;  1X9V A;  1FZA A;  1X79 B;  2N1T B;  2O01 H;  1W2E A;  2ZFC A;  3H32 A;  3HUS B;  5AW9 B;  5CCH A;  1RY3 A;  2CPB A;  1LTG C;  4Y99 B;  4XE5 B;  1MFZ A;  1SQV K;  1T2K C;  3M06 A;  1NAF A;  3HE4 B;  2XU6 A;  1G2C B;  4DOJ A;  2WPR A;  3H6P A;  1IC2 A;  2I1J A;  3V5B A;  1EO0 A;  3BRT B;  1SLQ A;  2C0W A;  2WSE H;  3I5C A;  2FXM A;  1DEB A;  3BAS A;  1L0L K;  1KIL D;  1NKN A;  3KDP B;  4OH8 B;  4WY4 D;  2B4J C;  4AQR D;  2GM4 A;  4EIJ A;  3L35 A;  5AW6 B;  3A2A A;  1S9K D;  1FZC C;  3CL3 D;  3N4X A;  3TNU A;  2XDJ A;  1SQB K;  1YYC A;  1E5W A;  3KQG A;  3VP8 A;  4KHX A;  4GIF A;  1FZC A;  3NTN A;  2HPC A;  3B5N C;  1L4A C;  1JTH B;  5CHX A;  1FAV A;  3F9K C;  2Z5I A;  3KPE A;  2YO3 A;  1M1J A;  1YTZ T;  1IFM A;  3BRV B;  1JOC A;  3B5N A;  1Z9E A;  3NXS A;  3HPH E;  5AW0 B;  1FZG A;  1JMM A;  4N3Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...