3O8ZA

Crystal structure of spn1 (iws1) core domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
152
structure length
152
Chain Sequence
DPFTDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and biological importance of the spn1-spt6 interaction, and its regulatory role in nucleosome binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcription factor IWS1
total genus 60
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3o8zA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3o8zA02
5AVQB 4DZOA 3TYYA 2YNYA 4EOTA 4B86A 5AVZB 2W27A 3LIEA 2WT7A 2XPOA 3LIDA 2ZFCA 3KQGA 3KDPB 1YYCA 3T97A 3A2AA 1J2JB 2N3AB 3NXSA 5AW9B 5AVVB 1H8AA 2WPRA 1GK4A 2Z5HA 3VTPC 5AW2B 5APVA 1GU5A 5AW1B 3NFQA 1CSBA 1FAVA 2R32A 2H7HA 3M9HA 2QM8A 1WJTA 3VMXA 2W6AA 3HE5B 2KP8A 1MFZA 2R5BA 2Z5IA 3HPHE 1FOSF 3O8ZA 4HYTB 1CI6B 2XPLA 4I6MC 5AVSB 1T2KC 1HJBA 3P32A 4GT1A 4I2LC 5AVRB 3VYIA 5AVYB 4C7NB 3UIAA 1S9KE 1H89A 1GD2E 5AW3B 2VRSA 4KHXA 2C9NY 3I5CA 1SLQA 4JYBA 1SP4A 3HPGG 3MD0A 3L37A 4GKGA 2E42A 1GK6A 1A02F 3B8EB 2Q5UA 2B4JC 2Q3IA 2YO2A 2JJLA 2P7JA 2R3CA 3SWFA 3M91A 1GTWA 1OXZA 5AW5B 5APXA 3VN0A 2E43A 3NTNA 2WWWA 4XE5B 5APTA 3HE4A 2BASA 1HBWA 5APYA 2P67A 3TK1A 3TNUA 2YO3A 3P8MC 5APQA 4RESB 1OWAA 2WPSA 4C46A 2WTYA 2IPPA 4JYCA 3VMYA 1HUCA 3M9BA 5APUA 1CZQA 5APWA 2ZXEB 3HTKA 5AW0B 5AW7B 1NWQA 4C7NA 5AVUB 1Z9EA 1EO0A 2WPQA 2Q7CA 2XU6A 5AVTB 3L35A 5AW4B 1CI6A 1DH3A 3V4WA 1NAFA 1JUNA 2P2UA 5APSA 5AW8B 3HE5A 4LC1A 3U88C 5CMZA 2XZRA 5AW6B 4AUWA 1MV8A 2QM7A 1A02J 3OAKA 3A5TA 1G2CB 2XV5A 3VMZA 3V5BA 4M3LA 3A3YB 1GU4A 1MUUA 5AVXB 3TNUB 2XPPA 2R5DA 2C9LY 3HE4B 2N9BA 1H88A 3IR9A 1X8YA 1T2KD 3F9KC 3A7OA 1S9KD 3MGNA 3M0AA 3M0DA 2XPNA 3NMDA 3V4QA 3P7KA 2WT7B 1KQLA 1FOSE 1IO4A 5AVWB 4AQRD 1HWTC 3M06A 1JNMA 4AYCA 1GZLA 3L36A
chains in the Genus database with same CATH superfamily
2LKMA 1ZW0A 3MUDA 2QE7H 1YJ9P 1QLED 2W90A 2PVWA 3B5ND 3TGUD 1SS1A 3ZDMA 3OP0A 3RBZA 1J2JB 1Q81Q 5KAFE 4PD4D 1RF0A 5APVA 1NU1K 1YITP 1MFTA 5B5EE 3OB1B 3NFQA 2P10A 3KYQA 2WSFJ 1ZN5A 1PGPA 3W67A 2SPZA 1N7SA 2P58A 2BEZF 1KB9I 4JYBA 1SP4A 3HPGG 4GKGA 1KQSO 5KAIE 2YKOA 3B8EB 2YO2A 1IFNA 3CWBG 1X79B 2E75C 2OYIA 2WVRA 4GIFA 2ZYDA 1GDTA 1OX3A 4P4EA 3S9MA 4U3FG 5GTIH 5E79H 3N4XA 1NTKD 1KYOH 1AVOA 3ABVC 5H2FE 1SQPE 2QM7A 3HUSC 1N7SD 1P84E 4JZ0A 4P4DA 4MCRA 1ZRTE 4YXWH 3CXHI 2OGUA 1JY2P 3L74E 1JB0J 1Z8LA 4D6TG 1NU1G 3PLFB 3H1KD 3CX5H 3HRNA 1SQPD 3FWNA 1FBMA 3SFDC 2XEIA 2VKZG 2YIUB 3MP7B 4L73A 5AVZB 3LIEA 2XPOA 1M57D 2ZVNB 1KV4A 4BTFA 2IFNA 4EYYQ 1G1IA 3KDPB 5CCGA 1OW8A 2BCCJ 3W68A 1GK4A 1NTZE 2NPSC 4NGRA 3EWKA 4ASVA 1AQTA 1PGOA 2IZ0A 1M7LA 3E1RA 1YQ4C 2FKWB 1CI6B 1FZBA 2OYHC 1HJBA 3HUSB 1GL2C 1SQBK 1Z56A 1KFMA 4HJGH 5AW3B 1LTJC 1VQLP 1JO5A 2KK7A 2N9YB 2HR3A 1FZCC 1LTBC 3JC22 3H1KJ 1Q2NA 4XE5B 2Q1KA 5KLVE 3H1LJ 3QWOC 1FDIA 5APUA 1W5CE 1QL1A 5F09A 1S1CX 1ZR2A 3PJSK 1KTMA 2CPBA 2IBZE 1NAFA 3CCMP 4BPUB 4WWIA 3L70E 4H0LC 2WSEH 1ZP0C 2HPCB 4W7ZA 2KLVA 4NPEA 1X9VA 5AXIA 1EZVI 2L5GB 4UB8H 3MTUE 1LT9C 2WSSH 3D7FA 3RBUA 5KJ7A 4N6JA 1KYOE 5AVUB 3H1JG 4OMEA 2ZAEB 2YNYA 4EOTA 1E79H 3JSVC 2PGDA 3AEDC 3KASA 1NKNA 5KLVG 2WPVB 1M8OB 2ZFCA 4Y99C 3PP5A 2B87A 3H6PA 4H44C 3VRQA 2K9YA 1CSBA 1KQGB 1LTAC 3IN6A 1JY3O 4L74A 3AE2C 2XEFA 5KAIH 3IAOA 2R5BA 5F13A 2MJZA 1NH4A 1SFCD 4DJGA 2IYOA 2FXOA 1VL2A 1L0LG 3PRJA 3TGUE 3D7HA 2JO1A 1LGHB 5EFWB 2Q3IA 5M1BA 3H32A 1SQVJ 1AV1A 3VN0A 2E43A 2WWWA 3HE4A 3TK1A 3D6YA 2MKVA 2YO3A 3CCUP 4YPCA 3FGAD 1EQ7A 1HGVA 2QJKC 4R4MA 4LQGA 3HTKA 1NWQA 4C7NA 2J59M 2PFXA 1NOHA 5AVTB 2OTJP 1SQXJ 3BI1A 3B5NC 4JF7A 3L75E 5CMZA 4H44B 1MV8A 2CBLA 1A02J 3H1JD 2XEGA 1PV3A 3BUOB 2R5DA 2W6JH 4WB4A 2OTKE 1JMBA 2K9JB 2QEXP 3H32B 4OC2A 2AXCA 3OW2O 1NU1E 1KQLA 2OR4A 1LTJB 1H0TB 1RF1B 3L73J 3SJXA 1USDA 1PPJD 3GHGA 2QG4A 1JOCA 4P4IA 4IFMA 2O1KA 2RH0A 4JPZB 2N3AB 1LP1B 5AVVB 3CCSP 3KPEA 2DW3A 1NTZG 1JMMA 4NPFX 2E76B 2B87B 4BPXB 2FYUK 1S5LH 1GD2E 3GW6A 1L0LD 2P1JA 1GMJA 1P84H 2B4JC 1E5WA 1S5LX 2JJLA 2R3CA 3CL3D 3L72D 1IK9A 4OH8B 5APYA 2KSJA 1BDCA 1G2CA 2A06G 1OFCX 4OVNF 4IL6X 4BPWB 3AE1C 1J1DB 3H1LE 1PZQA 1HVVA 1PL5A 2QA4P 1YJNP 1Q90D 2H43A 1USEA 5AW6B 1GL2B 4UB6E 3E7KA 2AXTH 2C9LY 3IR9A 1FZCA 1FZEA 3T97B 1HGZA 2I1KA 1NTMJ 3NMDA 1SQQG 3V4QA 1FOSE 2GM4A 4OC3A 1XTCC 1ZMEC 2WZ7A 3GG2A 3HD7A 5AVQB 4OGQB 1VQ6P 2FYUG 3L72J 4ZKUA 2HFED 1SFCC 2NPSA 4H0LB 1HTLC 4XA4A 4A7PA 5CCGC 2CIJA 2D2CD 5GTHH 3UIAA 2KS1A 3S4RA 3U1CA 5KKZB 1NGMB 4KHXA 2C9NY 1G1JA 2RKLA 2C0WA 2C6CA 1Y9BA 1L0NK 1SQQE 3G4SP 1DIPA 2AEJA 3VRPA 1IFIA 4LGDE 1HBWA 3G71P 1PGQA 2P67A 1OZHA 3M9BA 2KUBA 3AEAC 1SQVE 2FFDA 2POHA 2ZXEB 5CHXA 3CI9A 4GDOA 2OOTA 3K5BA 4H0LD 4IFFA 4BXLA 1L4AD 1SQVK 2RMZA 3BUMB 2KIKA 4I1LA 2M3EA 1VDFA 1G2CB 1BE3G 1EZVG 2QSIA 3B71A 5KAFH 1R5LA 1NTKG 4JQ0D 4N3YB 2AEMA 3M0AA 3BCCE 2JKVA 3H1LD 3QH9A 2A45I 4IL6H 2KS1B 1LNQA 3EFFK 1KB9E 1NU1J 1SQVG 3L73E 1KFNA 2WPRA 1FAVA 4DT0A 2NPSB 4WVZA 5BU5A 3AEBC 1QVGO 1MFZA 1IFDA 1L2PA 3PLNA 2XPLA 1GW4A 4D6TD 4GT1A 4I2LC 5AVRB 3V2RA 4I7ZB 3HD7B 4I7ZC 3RK3E 1S3JA 2JDIH 5ELYA 2WSCJ 2P7JA 1KORA 1SQBE 1W2EA 3TNUA 3PH0A 1QVFO 4GOFA 3CC7P 4MN4C 1NHLA 3CCLP 5CCHD 2Y9YA 1LTSC 1NTZK 1DH3A 2G8YA 2AEFA 3V4WA 1NU1D 4LC1A 2JBKA 1NJIQ 3E1IA 3H1IE 3AEGC 3WUTA 1NTMD 4M3LA 4PJ0H 1SQPJ 1VQMP 3U1AA 5KJ7C 2IYPA 3GF3A 2XPNA 1U7MA 3C1LA 3A0BE 3HD7C 4KT0J 3V2NA 2FYZA 3Q2YA 3L74J 2M8RA 1QX8A 1GW3A 1JY2O 1R8EA 1YYCA 4Y99B 3U59A 1K73Q 1PFIA 3BUWB 2CPSA 2Y1NA 2Z5HA 2WQYC 2BCCE 1EDLA 4NGSA 2E76C 1LTIC 1FOSF 4HYTB 4QMAA 3N7NA 4WY4D 4C7NB 1H0TA 2G3AA 3USSA 2W8ZA 4H13C 4HB1A 1IZNB 1Q86Q 3D7GA 4MCQA 4DCKA 1BCCE 3OA7A 1ZV8A 1GTWA 1U57A 2K9JA 5GTIE 2Q3EA 1L0LK 1K04A 3V6IA 4RESB 1OWAA 3KHUA 3PTZA 1SQQJ 1NO4A 5APWA 1WRGA 5AW0B 3H1KE 2HPCA 3H25A 3R4YA 2E75D 4RKUJ 2ZVOB 3G6EP 1YBKA 1T3UA 3L72G 3HTKB 3S9LA 5KKZC 1OVUA 2OARA 2QJPC 1VQ8P 2XPPA 3HE4B 2QJPB 4NGPA 1LT1A 5J3XA 5KLIC 1NTKE 2E76D 3GHGC 2B89A 3P7KA 3BCCG 4RO0A 1AVYA 2OQQA 4AQRD 2IFMA 1DE4C 4H13B 3H1ID 3CCEP 3C9IA 4DZOA 3HUSA 1LT9A 2J5UA 3R2PA 5HKZA 4BWNA 3I55P 1PIXA 2NZ2A 3WU2H 5CBNA 3RK3D 3FEDA 3D71A 3SWKA 3CXHD 1K9MQ 1FJKA 2R32A 1PGJA 4IL6E 2BCCD 2A45G 3EFGA 2O01N 3O8ZA 1LTGC 1SQXD 3GF7A 1PP9E 2HLOA 2FFDB 1SLQA 1N7SC 1ZXGA 3MD0A 4NGNA 3IF4A 3TSIA 3S9NA 1BE3J 3SWFA 1PPJG 1FZAA 1EXIA 3TGUJ 3TDKA 3C8VA 2WSEJ 3V2PA 1BDDA 3P8MC 2WTYA 1OVVA 2ZT9D 2IPPA 4UB8E 1RF0C 1SQBJ 1AA0A 1NTZD 2Q7CA 4W9YA 5CBOA 3PFVA 3F5HA 5KLVK 1P84I 1SQXE 3JCUE 3HMJG 2LXCB 1H88A 1K8AQ 3L75J 2B88A 3H1IJ 2KZIA 2D2CB 1YTZT 3IFMA 2XKMA 1M1JC 3VGOA 1B47A 1KMIZ 4P4BA 1L0LJ 1OMIA 1Q82Q 2O01J 2W27A 3LIDA 4NGMA 1T3JA 3JCUH 3A2AA 1N73C 2KLUA 3BASA 1M1KQ 2FY8A 2FYUJ 5TISH 1SQBD 4P45A 3FWLA 3GLMA 5B66E 1URQC 3ITKA 4I6MC 1DEBA 1OW6A 1SQXG 1ZOYC 2A06D 3S9OA 1CX8A 3P8CE 1FJPA 3L70G 2E42A 1GK6A 1N86A 5DJTB 3LW5H 3RL0D 2D2CC 1BGYD 1DX7A 1FZCB 2H89C 1QGKB 1RH5B 4OGQC 1BCCJ 3CPWO 1XTGB 4ZMDA 5AW7B 2OYHA 3L74G 5AW4B 4NPDA 1JUNA 1OIPA 1FZFA 3CWBE 4KJMA 3U88C 2Q6QA 1VQPP 1RQVA 1FZGA 2OYIB 1LP1A 1RE3C 1YVHA 1S5LE 3L73D 2KXPB 2QVAA 3MGNA 3CCRP 3L71J 1LT9B 3CX5I 3CX5E 1N7SB 3AEFC 1NTME 1SVFA 2YKQA 3ZNIA 3CC4P 3F89A 1JTHB 3CCQP 3T97A 2IX7C 3OJAB 4WY4A 2Z4EA 1ZR4A 5AW1B 3RK2D 2YXQB 3M9HA 1UIIA 1WMKA 3VMXA 2L91A 2QIWA 1IJDB 5KLIB 2C0XA 2IDBA 3GHGB 1KYOI 3VYIA 1RF1A 1NVOA 3FF3A 5CJ4A 2OYIC 2Q5UA 3L70D 3CCJP 1PP9J 4U3FJ 1SFCA 2IBZD 2XEJA 1OXZA 3D7DA 1OVRA 2YMYA 1PPJE 3NTNA 4NGTA 2QRXA 3H1HG 1NTMG 2W83C 4Z1MH 4ZNCA 2H8PD 4EI2A 1RQUA 1IFMA 2FXMA 3B5NA 2GUSA 3IWWA 1FE6A 3RK2B 1IFPA 1Q7YQ 3AE5C 2C6PA 1FDOA 1RY3A 3Q5PA 1X22A 3O6QB 1IFJA 1TU3F 1URQB 2IBZG 2UWJE 3BCCD 3MUDC 1T6AA 4OC1A 3RL0g 2W6BA 1U7JA 3CX5D 1EDKA 5CCGD 5AVWB 2K1AA 2V7QH 4AYCA 3L75D 1LTJA 4HH2A 3D70A 3H1HE 3KQGA 4K3AA 4W80A 2OYOA 5BU8B 1MKMA 3L4FA 1KC8Q 1H8AA 1L0LE 4PV1D 3SJFA 4PD4H 2W6AA 3PHLA 3HE5B 2GA1A 5L8RJ 3SFEC 3II6A 3G3ZA 4O9BA 4ZKPA 1T2KC 3RK2C 1YQ3C 2N1TD 3A0HH 3H1LG 1M90Q 2YXRB 4GOEA 2KB7P 5CJ0A 3WU2E 4PJ0E 3SWYA 2WITA 4C46A 3AEEC 4EDFA 3BRVB 3FXDA 2AXTE 4P4FA 1QEXA 1KILC 1S72P 3CXHH 3RK3C 1UIXA 1KILB 2RN0A 1KILA 2P2UA 2QJYC 4GODA 1AQ5A 1VQNP 3KXDA 2PRRA 2QJYB 1KQFB 3L71D 3VMZA 2FBWC 1EZVD 3CWBJ 3AE4C 1S9KD 1NKZB 2E5TA 2Y0DA 1IO4A 3SJEA 1JCDA 2JR8A 4OWFA 1JNMA 1M1JB 2JWDA 1BSNA 2WT7A 3A0HE 3MIWA 1VQKP 5H2FH 3S1KA 3RK3B 1Y47A 1WJTA 1S2EA 1DD3A 5B5EH 5TISE 2ZJSE 2Z5IA 2FYUD 3BRTB 3VOPA 3MHVA 1SQPK 2BEQD 4Y28J 3I56P 1S9KE 1VF5B 2FFDC 1KD1Q 2E74B 3CWBD 2YKPA 5APXA 4PD4I 2E74C 2BASA 1KILE 5KTBA 3VMYA 1HUCA 1ZRTD 4U3FD 3Q5SA 3AE6C 3TGUG 3BUNB 1FBVA 1CI6A 3B5NB 1L0NG 1VQOP 1BGYG 5AW8B 1Y8AA 1KYOD 2R44A 1FU1A 2UV8G 1HH0A 5HKWA 2Y1MA 1JY3N 2A06E 3L73G 3L74D 4L76A 3A7OA 2IZ1A 3BI0A 1W2BO 4JBZA 1BCCD 4RJTA 1RF1C 3BXMA 4PV1B 1NTKJ 4H44D 3L75G 3TYYA 3SSUA 1IK7A 1BE3D 3FECA 1NAYA 2C6GA 1R5SA 3VMAA 1KB9H 1EDIA 2K3RA 4H13D 5AW2B 1OW7A 1GU5A 2KSEA 4TLFA 4WY4B 1L0NE 1NTKK 1GL2A 5C39A 1VQ4P 4DOJA 3AE9C 4EIJA 1LJ2A 2FXPA 3CC2P 1KB9D 3WUUA 5E79E 1RE4C 3BATA 2DLAA 2A45H 2VRSA 5KLVJ 3RBXA 3Q1MA 3BUXB 2HG5D 1CW5A 4R4LA 1RE3A 3CXHE 1LWUA 3M0DC 1X0TA 1DEEG 3GMAA 4A4BA 2B9BA 1EDJA 1JEKA 3AE3C 3CLQA 1BE3E 4OC0A 1T8ZA 2O1JA 1CZQA 3VROA 1RE4A 2WPQA 4RR2B 4A4CA 2I1JA 1N73B 1SQQD 2O3JA 4XFJA 3VP9A 2OYHB 4D6TJ 4OC5A 3VP8A 1AFOA 3D6ZA 5HKYA 3TF5A 2IBZI 3A3YB 1GU4A 2Y0EA 2ZYGA 1KN7A 1T2KD 4W7YA 1VQ9P 1PP9D 3KZIE 1SQXK 2XDJA 1YHQP 2K88A 1J1EC 2HODA 1GZLA 2KOGA 2JP3A 2XNDH 1L4AC 3CMEP 3G9RA 2Y9ZA 5CCHC 1EC5A 2I8DA 2N1TA 2JWAA 3VRNA 1S4XA 1JCCA 1YI2P 2FYUE 3FXEA 3H1KG 2OTLP 1YTZI 1M1JA 4PD4E 5BY0A 2Q9IA 2J58A 2YMKA 2NRGA 3M91A 1BSHA 3RGUA 5APTA 4K35A 1KILD 3H1IG 4X3RA 2WPSA 1MZ9A 4BRYA 2V7QJ 3HD7D 2K37A 2E5YA 1EO0A 3WMM0 1NYHA 3L35A 1L4AB 2KNCA 2XZRA 1BGYE 2NPSD 3OAKA 3WUVA 1VQ5P 3VRRA 2Y0CA 1NTMK 1RHZB 1FDMA 1K05A 3H1JJ 5GTHE 1JY3P 3CMAP 2WT7B 2YIUC 3Q5RA 2LXBA 2M5AA 4B86A 3L71E 1P84D 2E74D 2WSFH 1EZVE 4TT3H 3NXSA 5AW9B 4MCSA 3Q3DA 3P8CD 4N78E 1LTTC 2N1TC 2H7HA 2O01H 2XNXA 3A0BH 4LLHA 2ZT9B 1VPCA 1N7LA 4P44A 1L4AA 1QL2A 5AVSB 3P32A 2M5AB 1L0NJ 5AVYB 1VQ7P 3I5CA 4PV1C 2KZJA 1A02F 1VF5C 2R3SA 1IC2A 3FX0A 2BCCG 3O6QA 4YTPC 3LW5J 3AE8C 5APQA 3H1HD 2QJKB 1J1EB 3L71G 1FS0E 4OGQD 4U3FE 5TJHA 5K5GB 4ASWA 3CD6P 4WY4C 4OC4A 1Z9EA 3RL0B 2XU6A 3CCVP 1SQQK 1SQPG 3RL0C 5APSA 3HE5A 1DD4A 1VF5D 5D29A 2N1TB 1SQBG 2PVVA 1JY2N 3EQ2A 5AVXB 1AJYA 2ZYAA 5B66H 2N9BA 2ITAA 2ZT9C 1X8YA 2V4HA 4D6TE 3F9KC 4UB6H 2FYNC 3M0DA 2JBJA 2WSCH 1ZLLA 1M56D 1L0ND 5DJUB 3AECC 3L72E 5BVZA 3FEEA 4NGQA 2GUVA 4IFDK 3BHXA 2HODB 2JEEA 3KZIH 3L36A 2M0BA 4L75A 1NTZJ 1GL2D 1N8RQ 5KJ7D 4IOIH 1PP9G 1SQVD 3VTPC 1WT6A 3H1HJ 2QM8A 5CCHA 1JTHA 4GPLB 2KNCB 2KP8A 2H88C 3HPHE 1N2DC 4CPGA 2HYNA 1HJ0A 2ZXXA 1H89A 4N78D 4YXDC 3B4SA 3MZWB 3L37A 4BRYB 3V2QA 3M9QA 2PP6A 1URQA 2FYNB 4WBAA 4U7JA 5AW5B 3BVHA 1SFCB 1JM0A 4C7RA 4JYWA 4JYCA 3L70J 3OB2B 1FC2C 2KI7B 1J1DC 1YJWP 1N73A 2M3BA 3PT1A 2PAJA 4AUWA 4HKZH 1BCCG 3BCCJ 3A5TA 3SJGA 2XV5A 3V5BA 1EXJA 5KLVD 1MUUA 3TNUB 4MCPA 2LR2A 1LWUB 1URQD 4P4JA 2CK3H 1BGYJ 2WMMA 3AE7C 1LWUC 2KYVA 1D7MA 1KZUB 2E75B 1HF9A 1YIJP 1HWTC 3H1JE 3M06A
chains in the Genus database with same CATH topology
2LKMA 5AVQB 3TYYA 3MUDA 2W27A 3LIDA 3B5ND 1T3JA 4ZKUA 2HFED 1SFCC 3A2AA 1J2JB 1N73C 2NPSA 1RF0A 1HTLC 5AW2B 5APVA 1NU1K 1GU5A 3BASA 4XA4A 4WY4B 5CCGC 3NFQA 1NTKK 1GL2A 4DOJA 4EIJA 3KYQA 1ZN5A 1URQC 4I6MC 1DEBA 1RE4C 3BATA 3UIAA 3U1CA 2A45H 1N7SA 3P8CE 2VRSA 4KHXA 2C9NY 1FJPA 1G1JA 4JYBA 1SP4A 3HPGG 4GKGA 2E42A 1GK6A 2C0WA 2HG5D 1L0NK 2YKOA 3B8EB 2YO2A 1N86A 3LW5H 1CW5A 1RE3A 3RL0D 1IFNA 1X79B 1DX7A 1LWUA 3M0DC 1FZCB 1IFIA 2OYIA 4LGDE 1HBWA 2P67A 4GIFA 1GDTA 3CLQA 3M9BA 1T8ZA 2O1JA 1CZQA 2FFDA 2POHA 2ZXEB 1RE4A 1XTGB 5AW7B 2OYHA 5CHXA 3CI9A 3N4XA 2WPQA 5AW4B 4IFFA 2I1JA 1L4AD 1SQVK 1JUNA 1N73B 1FZFA 4I1LA 3U88C 3VP9A 2OYHB 2QM7A 3HUSC 1N7SD 3VP8A 1VDFA 1AFOA 1G2CB 3A3YB 1GU4A 1FZGA 2OYIB 1RE3C 1T2KD 4W7YA 1JY2P 4N3YB 3MGNA 3M0AA 1SQXK 1LT9B 3HRNA 1FBMA 2XDJA 1J1EC 2A45I 1N7SB 2HODA 1GZLA 2KOGA 5AVZB 1SVFA 2YKQA 3LIEA 2XPOA 2IFNA 1G1IA 1L4AC 3KDPB 1JTHB 3T97A 5CCGA 2IX7C 3OJAB 5CCHC 1KFNA 2WPRA 1GK4A 4WY4A 2Z4EA 1ZR4A 2NPSC 5AW1B 1FAVA 2N1TA 2NPSB 3RK2D 5BU5A 3M9HA 1JCCA 3VMXA 1M7LA 1IJDB 1MFZA 1IFDA 2FKWB 1CI6B 2C0XA 1FZBA 3GHGB 2OYHC 2XPLA 1GW4A 1HJBA 3HUSB 1GL2C 4GT1A 4I2LC 5AVRB 1SQBK 3V2RA 1Z56A 3VYIA 1RF1A 1YTZI 1M1JA 3HD7B 1KFMA 5AW3B 1LTJC 5CJ4A 2OYIC 2Q9IA 1JO5A 2Q5UA 2J58A 2P7JA 1SFCA 3M91A 1FZCC 1OXZA 1LTBC 2YMYA 1W2EA 3NTNA 5APTA 4XE5B 1KILD 3TNUA 2WPSA 1MZ9A 5APUA 3HD7D 1NHLA 2H8PD 1QL1A 1ZR2A 5CCHD 1EO0A 2CPBA 3WMM0 1IFMA 2FXMA 3L35A 1LTSC 1L4AB 1NTZK 3B5NA 1DH3A 2GUSA 3V4WA 1NAFA 4LC1A 2WSEH 2XZRA 2HPCB 2NPSD 3E1IA 3RK2B 3OAKA 4W7ZA 2KLVA 4M3LA 1X9VA 1NTMK 1RY3A 1FDMA 3U1AA 5KJ7C 2L5GB 3MTUE 1IFJA 1LT9C 1JY3P 1URQB 2XPNA 2W6BA 2WT7B 5KJ7A 4N6JA 3HD7C 5CCGD 5AVWB 3V2NA 2FYZA 5AVUB 4AYCA 2M8RA 1LTJA 4HH2A 2YNYA 1GW3A 4EOTA 4B86A 1JY2O 1NKNA 2ZFCA 4Y99C 2WSFH 3KQGA 3PP5A 4W80A 1YYCA 4Y99B 5BU8B 3NXSA 3U59A 5AW9B 3L4FA 3H6PA 1H8AA 1PFIA 2CPSA 3P8CD 4N78E 2Z5HA 1LTTC 2N1TC 1CSBA 2H7HA 2O01H 1LTAC 1JY3O 2W6AA 2XNXA 3HE5B 4LLHA 1VPCA 1N7LA 2R5BA 1LTIC 1FOSF 2MJZA 1NH4A 4HYTB 1SFCD 1L4AA 3G3ZA 3II6A 4O9BA 3N7NA 1QL2A 4WY4D 5AVSB 4ZKPA 3RK2C 1T2KC 3P32A 5AVYB 4C7NB 2N1TD 3I5CA 1LGHB 2KB7P 1A02F 5CJ0A 2Q3IA 1IC2A 3H32A 3OA7A 1ZV8A 1GTWA 3VN0A 2E43A 1L0LK 2WWWA 3HE4A 3TK1A 3SWYA 2YO3A 2WITA 5APQA 4RESB 1OWAA 4C46A 3BRVB 1J1EB 1EQ7A 1NO4A 1HGVA 5APWA 1WRGA 5AW0B 3HTKA 2HPCA 4WY4C 1NWQA 4C7NA 1KILC 2J59M 3RK3C 1Z9EA 1NOHA 3RL0B 2XU6A 5AVTB 1KILB 1SQQK 1KILA 3RL0C 2P2UA 3B5NC 5APSA 1T3UA 3HE5A 4JF7A 5CMZA 1AQ5A 1MV8A 3HTKB 1A02J 2N1TB 3VMZA 1JY2N 2OARA 3EQ2A 5AVXB 2XPPA 2R5DA 3HE4B 2N9BA 4WB4A 1X8YA 3F9KC 1S9KD 1NKZB 3M0DA 3GHGC 3H32B 2WSCH 1ZLLA 3P7KA 1KQLA 5BVZA 1IO4A 4AQRD 2IFMA 1JCDA 2GUVA 1LTJB 1JNMA 3C9IA 2HODB 3L36A 1M1JB 2JEEA 4IFDK 1RF1B 4DZOA 3HUSA 3GHGA 2WT7A 1JOCA 1LT9A 1GL2D 4IFMA 2O1KA 3MIWA 3R2PA 5KJ7D 2N3AB 5AVVB 3RK3D 3KPEA 3VTPC 1WT6A 1FJKA 2R32A 1JMMA 3RK3B 2QM8A 1WJTA 5CCHA 1JTHA 2KP8A 2A45G 3EFGA 2Z5IA 3HPHE 1N2DC 3BRTB 3O8ZA 3VOPA 1LTGC 2HYNA 2FYUK 1SQPK 1S9KE 2HLOA 4N78D 1H89A 1GD2E 2FFDB 1SLQA 1N7SC 2P1JA 2FFDC 3MD0A 3L37A 3V2QA 3TSIA 2B4JC 3M9QA 1E5WA 2JJLA 1URQA 2PP6A 2R3CA 3CL3D 1FZAA 3SWFA 4WBAA 2YKPA 5AW5B 5APXA 3BVHA 1IK9A 4OH8B 1SFCB 2BASA 5APYA 3V2PA 2KSJA 3P8MC 2WTYA 2IPPA 4C7RA 4JYCA 5KTBA 1G2CA 1HUCA 3VMYA 1RF0C 1J1DC 2Q7CA 1N73A 2M3BA 1J1DB 1CI6A 3B5NB 2PAJA 1HVVA 2H43A 5AW8B 5AW6B 4AUWA 1GL2B 5KLVK 3A5TA 1FU1A 2XV5A 1HH0A 3V5BA 1MUUA 1JY3N 3TNUB 2C9LY 1H88A 3IR9A 1LWUB 1FZCA 1URQD 1FZEA 3A7OA 1LWUC 1HGZA 2I1KA 2KYVA 1YTZT 3NMDA 3V4QA 3IFMA 1KZUB 2XKMA 1FOSE 2GM4A 1XTCC 1M1JC 1HWTC 2WZ7A 1RF1C 3M06A 3HD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVQ B;  4DZO A;  3TYY A;  2YNY A;  4EOT A;  4B86 A;  5AVZ B;  2W27 A;  3LIE A;  2WT7 A;  2XPO A;  3LID A;  2ZFC A;  3KQG A;  3KDP B;  1YYC A;  3T97 A;  3A2A A;  1J2J B;  2N3A B;  3NXS A;  5AW9 B;  5AVV B;  1H8A A;  2WPR A;  1GK4 A;  2Z5H A;  3VTP C;  5AW2 B;  5APV A;  1GU5 A;  5AW1 B;  3NFQ A;  1CSB A;  1FAV A;  2R32 A;  2H7H A;  3M9H A;  2QM8 A;  1WJT A;  3VMX A;  2W6A A;  3HE5 B;  2KP8 A;  1MFZ A;  2R5B A;  2Z5I A;  3HPH E;  1FOS F;  3O8Z A;  4HYT B;  1CI6 B;  2XPL A;  4I6M C;  5AVS B;  1T2K C;  1HJB A;  3P32 A;  4GT1 A;  4I2L C;  5AVR B;  3VYI A;  5AVY B;  4C7N B;  3UIA A;  1S9K E;  1H89 A;  1GD2 E;  5AW3 B;  2VRS A;  4KHX A;  2C9N Y;  3I5C A;  1SLQ A;  4JYB A;  1SP4 A;  3HPG G;  3MD0 A;  3L37 A;  4GKG A;  2E42 A;  1GK6 A;  1A02 F;  3B8E B;  2Q5U A;  2B4J C;  2Q3I A;  2YO2 A;  2JJL A;  2P7J A;  2R3C A;  3SWF A;  3M91 A;  1GTW A;  1OXZ A;  5AW5 B;  5APX A;  3VN0 A;  2E43 A;  3NTN A;  2WWW A;  4XE5 B;  5APT A;  3HE4 A;  2BAS A;  1HBW A;  5APY A;  2P67 A;  3TK1 A;  3TNU A;  2YO3 A;  3P8M C;  5APQ A;  4RES B;  1OWA A;  2WPS A;  4C46 A;  2WTY A;  2IPP A;  4JYC A;  3VMY A;  1HUC A;  3M9B A;  5APU A;  1CZQ A;  5APW A;  2ZXE B;  3HTK A;  5AW0 B;  5AW7 B;  1NWQ A;  4C7N A;  5AVU B;  1Z9E A;  1EO0 A;  2WPQ A;  2Q7C A;  2XU6 A;  5AVT B;  3L35 A;  5AW4 B;  1CI6 A;  1DH3 A;  3V4W A;  1NAF A;  1JUN A;  2P2U A;  5APS A;  5AW8 B;  3HE5 A;  4LC1 A;  3U88 C;  5CMZ A;  2XZR A;  5AW6 B;  4AUW A;  1MV8 A;  2QM7 A;  1A02 J;  3OAK A;  3A5T A;  1G2C B;  2XV5 A;  3VMZ A;  3V5B A;  4M3L A;  3A3Y B;  1GU4 A;  1MUU A;  5AVX B;  3TNU B;  2XPP A;  2R5D A;  2C9L Y;  3HE4 B;  2N9B A;  1H88 A;  3IR9 A;  1X8Y A;  1T2K D;  3F9K C;  3A7O A;  1S9K D;  3MGN A;  3M0A A;  3M0D A;  2XPN A;  3NMD A;  3V4Q A;  3P7K A;  2WT7 B;  1KQL A;  1FOS E;  1IO4 A;  5AVW B;  4AQR D;  1HWT C;  3M06 A;  1JNM A;  4AYC A;  1GZL A;  3L36 A; 
#chains in the Genus database with same CATH topology
 2LKM A;  1ZW0 A;  3MUD A;  2QE7 H;  1YJ9 P;  1QLE D;  2W90 A;  2PVW A;  3B5N D;  3TGU D;  1SS1 A;  3ZDM A;  3OP0 A;  3RBZ A;  1J2J B;  1Q81 Q;  5KAF E;  4PD4 D;  1RF0 A;  5APV A;  1NU1 K;  1YIT P;  1MFT A;  5B5E E;  3OB1 B;  3NFQ A;  2P10 A;  3KYQ A;  2WSF J;  1ZN5 A;  1PGP A;  3W67 A;  2SPZ A;  1N7S A;  2P58 A;  2BEZ F;  1KB9 I;  4JYB A;  1SP4 A;  3HPG G;  4GKG A;  1KQS O;  5KAI E;  2YKO A;  3B8E B;  2YO2 A;  1IFN A;  3CWB G;  1X79 B;  2E75 C;  2OYI A;  2WVR A;  4GIF A;  2ZYD A;  1GDT A;  1OX3 A;  4P4E A;  3S9M A;  4U3F G;  5GTI H;  5E79 H;  3N4X A;  1NTK D;  1KYO H;  1AVO A;  3ABV C;  5H2F E;  1SQP E;  2QM7 A;  3HUS C;  1N7S D;  1P84 E;  4JZ0 A;  4P4D A;  4MCR A;  1ZRT E;  4YXW H;  3CXH I;  2OGU A;  1JY2 P;  3L74 E;  1JB0 J;  1Z8L A;  4D6T G;  1NU1 G;  3PLF B;  3H1K D;  3CX5 H;  3HRN A;  1SQP D;  3FWN A;  1FBM A;  3SFD C;  2XEI A;  2VKZ G;  2YIU B;  3MP7 B;  4L73 A;  5AVZ B;  3LIE A;  2XPO A;  1M57 D;  2ZVN B;  1KV4 A;  4BTF A;  2IFN A;  4EYY Q;  1G1I A;  3KDP B;  5CCG A;  1OW8 A;  2BCC J;  3W68 A;  1GK4 A;  1NTZ E;  2NPS C;  4NGR A;  3EWK A;  4ASV A;  1AQT A;  1PGO A;  2IZ0 A;  1M7L A;  3E1R A;  1YQ4 C;  2FKW B;  1CI6 B;  1FZB A;  2OYH C;  1HJB A;  3HUS B;  1GL2 C;  1SQB K;  1Z56 A;  1KFM A;  4HJG H;  5AW3 B;  1LTJ C;  1VQL P;  1JO5 A;  2KK7 A;  2N9Y B;  2HR3 A;  1FZC C;  1LTB C;  3JC2 2;  3H1K J;  1Q2N A;  4XE5 B;  2Q1K A;  5KLV E;  3H1L J;  3QWO C;  1FDI A;  5APU A;  1W5C E;  1QL1 A;  5F09 A;  1S1C X;  1ZR2 A;  3PJS K;  1KTM A;  2CPB A;  2IBZ E;  1NAF A;  3CCM P;  4BPU B;  4WWI A;  3L70 E;  4H0L C;  2WSE H;  1ZP0 C;  2HPC B;  4W7Z A;  2KLV A;  4NPE A;  1X9V A;  5AXI A;  1EZV I;  2L5G B;  4UB8 H;  3MTU E;  1LT9 C;  2WSS H;  3D7F A;  3RBU A;  5KJ7 A;  4N6J A;  1KYO E;  5AVU B;  3H1J G;  4OME A;  2ZAE B;  2YNY A;  4EOT A;  1E79 H;  3JSV C;  2PGD A;  3AED C;  3KAS A;  1NKN A;  5KLV G;  2WPV B;  1M8O B;  2ZFC A;  4Y99 C;  3PP5 A;  2B87 A;  3H6P A;  4H44 C;  3VRQ A;  2K9Y A;  1CSB A;  1KQG B;  1LTA C;  3IN6 A;  1JY3 O;  4L74 A;  3AE2 C;  2XEF A;  5KAI H;  3IAO A;  2R5B A;  5F13 A;  2MJZ A;  1NH4 A;  1SFC D;  4DJG A;  2IYO A;  2FXO A;  1VL2 A;  1L0L G;  3PRJ A;  3TGU E;  3D7H A;  2JO1 A;  1LGH B;  5EFW B;  2Q3I A;  5M1B A;  3H32 A;  1SQV J;  1AV1 A;  3VN0 A;  2E43 A;  2WWW A;  3HE4 A;  3TK1 A;  3D6Y A;  2MKV A;  2YO3 A;  3CCU P;  4YPC A;  3FGA D;  1EQ7 A;  1HGV A;  2QJK C;  4R4M A;  4LQG A;  3HTK A;  1NWQ A;  4C7N A;  2J59 M;  2PFX A;  1NOH A;  5AVT B;  2OTJ P;  1SQX J;  3BI1 A;  3B5N C;  4JF7 A;  3L75 E;  5CMZ A;  4H44 B;  1MV8 A;  2CBL A;  1A02 J;  3H1J D;  2XEG A;  1PV3 A;  3BUO B;  2R5D A;  2W6J H;  4WB4 A;  2OTK E;  1JMB A;  2K9J B;  2QEX P;  3H32 B;  4OC2 A;  2AXC A;  3OW2 O;  1NU1 E;  1KQL A;  2OR4 A;  1LTJ B;  1H0T B;  1RF1 B;  3L73 J;  3SJX A;  1USD A;  1PPJ D;  3GHG A;  2QG4 A;  1JOC A;  4P4I A;  4IFM A;  2O1K A;  2RH0 A;  4JPZ B;  2N3A B;  1LP1 B;  5AVV B;  3CCS P;  3KPE A;  2DW3 A;  1NTZ G;  1JMM A;  4NPF X;  2E76 B;  2B87 B;  4BPX B;  2FYU K;  1S5L H;  1GD2 E;  3GW6 A;  1L0L D;  2P1J A;  1GMJ A;  1P84 H;  2B4J C;  1E5W A;  1S5L X;  2JJL A;  2R3C A;  3CL3 D;  3L72 D;  1IK9 A;  4OH8 B;  5APY A;  2KSJ A;  1BDC A;  1G2C A;  2A06 G;  1OFC X;  4OVN F;  4IL6 X;  4BPW B;  3AE1 C;  1J1D B;  3H1L E;  1PZQ A;  1HVV A;  1PL5 A;  2QA4 P;  1YJN P;  1Q90 D;  2H43 A;  1USE A;  5AW6 B;  1GL2 B;  4UB6 E;  3E7K A;  2AXT H;  2C9L Y;  3IR9 A;  1FZC A;  1FZE A;  3T97 B;  1HGZ A;  2I1K A;  1NTM J;  3NMD A;  1SQQ G;  3V4Q A;  1FOS E;  2GM4 A;  4OC3 A;  1XTC C;  1ZME C;  2WZ7 A;  3GG2 A;  3HD7 A;  5AVQ B;  4OGQ B;  1VQ6 P;  2FYU G;  3L72 J;  4ZKU A;  2HFE D;  1SFC C;  2NPS A;  4H0L B;  1HTL C;  4XA4 A;  4A7P A;  5CCG C;  2CIJ A;  2D2C D;  5GTH H;  3UIA A;  2KS1 A;  3S4R A;  3U1C A;  5KKZ B;  1NGM B;  4KHX A;  2C9N Y;  1G1J A;  2RKL A;  2C0W A;  2C6C A;  1Y9B A;  1L0N K;  1SQQ E;  3G4S P;  1DIP A;  2AEJ A;  3VRP A;  1IFI A;  4LGD E;  1HBW A;  3G71 P;  1PGQ A;  2P67 A;  1OZH A;  3M9B A;  2KUB A;  3AEA C;  1SQV E;  2FFD A;  2POH A;  2ZXE B;  5CHX A;  3CI9 A;  4GDO A;  2OOT A;  3K5B A;  4H0L D;  4IFF A;  4BXL A;  1L4A D;  1SQV K;  2RMZ A;  3BUM B;  2KIK A;  4I1L A;  2M3E A;  1VDF A;  1G2C B;  1BE3 G;  1EZV G;  2QSI A;  3B71 A;  5KAF H;  1R5L A;  1NTK G;  4JQ0 D;  4N3Y B;  2AEM A;  3M0A A;  3BCC E;  2JKV A;  3H1L D;  3QH9 A;  2A45 I;  4IL6 H;  2KS1 B;  1LNQ A;  3EFF K;  1KB9 E;  1NU1 J;  1SQV G;  3L73 E;  1KFN A;  2WPR A;  1FAV A;  4DT0 A;  2NPS B;  4WVZ A;  5BU5 A;  3AEB C;  1QVG O;  1MFZ A;  1IFD A;  1L2P A;  3PLN A;  2XPL A;  1GW4 A;  4D6T D;  4GT1 A;  4I2L C;  5AVR B;  3V2R A;  4I7Z B;  3HD7 B;  4I7Z C;  3RK3 E;  1S3J A;  2JDI H;  5ELY A;  2WSC J;  2P7J A;  1KOR A;  1SQB E;  1W2E A;  3TNU A;  3PH0 A;  1QVF O;  4GOF A;  3CC7 P;  4MN4 C;  1NHL A;  3CCL P;  5CCH D;  2Y9Y A;  1LTS C;  1NTZ K;  1DH3 A;  2G8Y A;  2AEF A;  3V4W A;  1NU1 D;  4LC1 A;  2JBK A;  1NJI Q;  3E1I A;  3H1I E;  3AEG C;  3WUT A;  1NTM D;  4M3L A;  4PJ0 H;  1SQP J;  1VQM P;  3U1A A;  5KJ7 C;  2IYP A;  3GF3 A;  2XPN A;  1U7M A;  3C1L A;  3A0B E;  3HD7 C;  4KT0 J;  3V2N A;  2FYZ A;  3Q2Y A;  3L74 J;  2M8R A;  1QX8 A;  1GW3 A;  1JY2 O;  1R8E A;  1YYC A;  4Y99 B;  3U59 A;  1K73 Q;  1PFI A;  3BUW B;  2CPS A;  2Y1N A;  2Z5H A;  2WQY C;  2BCC E;  1EDL A;  4NGS A;  2E76 C;  1LTI C;  1FOS F;  4HYT B;  4QMA A;  3N7N A;  4WY4 D;  4C7N B;  1H0T A;  2G3A A;  3USS A;  2W8Z A;  4H13 C;  4HB1 A;  1IZN B;  1Q86 Q;  3D7G A;  4MCQ A;  4DCK A;  1BCC E;  3OA7 A;  1ZV8 A;  1GTW A;  1U57 A;  2K9J A;  5GTI E;  2Q3E A;  1L0L K;  1K04 A;  3V6I A;  4RES B;  1OWA A;  3KHU A;  3PTZ A;  1SQQ J;  1NO4 A;  5APW A;  1WRG A;  5AW0 B;  3H1K E;  2HPC A;  3H25 A;  3R4Y A;  2E75 D;  4RKU J;  2ZVO B;  3G6E P;  1YBK A;  1T3U A;  3L72 G;  3HTK B;  3S9L A;  5KKZ C;  1OVU A;  2OAR A;  2QJP C;  1VQ8 P;  2XPP A;  3HE4 B;  2QJP B;  4NGP A;  1LT1 A;  5J3X A;  5KLI C;  1NTK E;  2E76 D;  3GHG C;  2B89 A;  3P7K A;  3BCC G;  4RO0 A;  1AVY A;  2OQQ A;  4AQR D;  2IFM A;  1DE4 C;  4H13 B;  3H1I D;  3CCE P;  3C9I A;  4DZO A;  3HUS A;  1LT9 A;  2J5U A;  3R2P A;  5HKZ A;  4BWN A;  3I55 P;  1PIX A;  2NZ2 A;  3WU2 H;  5CBN A;  3RK3 D;  3FED A;  3D71 A;  3SWK A;  3CXH D;  1K9M Q;  1FJK A;  2R32 A;  1PGJ A;  4IL6 E;  2BCC D;  2A45 G;  3EFG A;  2O01 N;  3O8Z A;  1LTG C;  1SQX D;  3GF7 A;  1PP9 E;  2HLO A;  2FFD B;  1SLQ A;  1N7S C;  1ZXG A;  3MD0 A;  4NGN A;  3IF4 A;  3TSI A;  3S9N A;  1BE3 J;  3SWF A;  1PPJ G;  1FZA A;  1EXI A;  3TGU J;  3TDK A;  3C8V A;  2WSE J;  3V2P A;  1BDD A;  3P8M C;  2WTY A;  1OVV A;  2ZT9 D;  2IPP A;  4UB8 E;  1RF0 C;  1SQB J;  1AA0 A;  1NTZ D;  2Q7C A;  4W9Y A;  5CBO A;  3PFV A;  3F5H A;  5KLV K;  1P84 I;  1SQX E;  3JCU E;  3HMJ G;  2LXC B;  1H88 A;  1K8A Q;  3L75 J;  2B88 A;  3H1I J;  2KZI A;  2D2C B;  1YTZ T;  3IFM A;  2XKM A;  1M1J C;  3VGO A;  1B47 A;  1KMI Z;  4P4B A;  1L0L J;  1OMI A;  1Q82 Q;  2O01 J;  2W27 A;  3LID A;  4NGM A;  1T3J A;  3JCU H;  3A2A A;  1N73 C;  2KLU A;  3BAS A;  1M1K Q;  2FY8 A;  2FYU J;  5TIS H;  1SQB D;  4P45 A;  3FWL A;  3GLM A;  5B66 E;  1URQ C;  3ITK A;  4I6M C;  1DEB A;  1OW6 A;  1SQX G;  1ZOY C;  2A06 D;  3S9O A;  1CX8 A;  3P8C E;  1FJP A;  3L70 G;  2E42 A;  1GK6 A;  1N86 A;  5DJT B;  3LW5 H;  3RL0 D;  2D2C C;  1BGY D;  1DX7 A;  1FZC B;  2H89 C;  1QGK B;  1RH5 B;  4OGQ C;  1BCC J;  3CPW O;  1XTG B;  4ZMD A;  5AW7 B;  2OYH A;  3L74 G;  5AW4 B;  4NPD A;  1JUN A;  1OIP A;  1FZF A;  3CWB E;  4KJM A;  3U88 C;  2Q6Q A;  1VQP P;  1RQV A;  1FZG A;  2OYI B;  1LP1 A;  1RE3 C;  1YVH A;  1S5L E;  3L73 D;  2KXP B;  2QVA A;  3MGN A;  3CCR P;  3L71 J;  1LT9 B;  3CX5 I;  3CX5 E;  1N7S B;  3AEF C;  1NTM E;  1SVF A;  2YKQ A;  3ZNI A;  3CC4 P;  3F89 A;  1JTH B;  3CCQ P;  3T97 A;  2IX7 C;  3OJA B;  4WY4 A;  2Z4E A;  1ZR4 A;  5AW1 B;  3RK2 D;  2YXQ B;  3M9H A;  1UII A;  1WMK A;  3VMX A;  2L91 A;  2QIW A;  1IJD B;  5KLI B;  2C0X A;  2IDB A;  3GHG B;  1KYO I;  3VYI A;  1RF1 A;  1NVO A;  3FF3 A;  5CJ4 A;  2OYI C;  2Q5U A;  3L70 D;  3CCJ P;  1PP9 J;  4U3F J;  1SFC A;  2IBZ D;  2XEJ A;  1OXZ A;  3D7D A;  1OVR A;  2YMY A;  1PPJ E;  3NTN A;  4NGT A;  2QRX A;  3H1H G;  1NTM G;  2W83 C;  4Z1M H;  4ZNC A;  2H8P D;  4EI2 A;  1RQU A;  1IFM A;  2FXM A;  3B5N A;  2GUS A;  3IWW A;  1FE6 A;  3RK2 B;  1IFP A;  1Q7Y Q;  3AE5 C;  2C6P A;  1FDO A;  1RY3 A;  3Q5P A;  1X22 A;  3O6Q B;  1IFJ A;  1TU3 F;  1URQ B;  2IBZ G;  2UWJ E;  3BCC D;  3MUD C;  1T6A A;  4OC1 A;  3RL0 g;  2W6B A;  1U7J A;  3CX5 D;  1EDK A;  5CCG D;  5AVW B;  2K1A A;  2V7Q H;  4AYC A;  3L75 D;  1LTJ A;  4HH2 A;  3D70 A;  3H1H E;  3KQG A;  4K3A A;  4W80 A;  2OYO A;  5BU8 B;  1MKM A;  3L4F A;  1KC8 Q;  1H8A A;  1L0L E;  4PV1 D;  3SJF A;  4PD4 H;  2W6A A;  3PHL A;  3HE5 B;  2GA1 A;  5L8R J;  3SFE C;  3II6 A;  3G3Z A;  4O9B A;  4ZKP A;  1T2K C;  3RK2 C;  1YQ3 C;  2N1T D;  3A0H H;  3H1L G;  1M90 Q;  2YXR B;  4GOE A;  2KB7 P;  5CJ0 A;  3WU2 E;  4PJ0 E;  3SWY A;  2WIT A;  4C46 A;  3AEE C;  4EDF A;  3BRV B;  3FXD A;  2AXT E;  4P4F A;  1QEX A;  1KIL C;  1S72 P;  3CXH H;  3RK3 C;  1UIX A;  1KIL B;  2RN0 A;  1KIL A;  2P2U A;  2QJY C;  4GOD A;  1AQ5 A;  1VQN P;  3KXD A;  2PRR A;  2QJY B;  1KQF B;  3L71 D;  3VMZ A;  2FBW C;  1EZV D;  3CWB J;  3AE4 C;  1S9K D;  1NKZ B;  2E5T A;  2Y0D A;  1IO4 A;  3SJE A;  1JCD A;  2JR8 A;  4OWF A;  1JNM A;  1M1J B;  2JWD A;  1BSN A;  2WT7 A;  3A0H E;  3MIW A;  1VQK P;  5H2F H;  3S1K A;  3RK3 B;  1Y47 A;  1WJT A;  1S2E A;  1DD3 A;  5B5E H;  5TIS E;  2ZJS E;  2Z5I A;  2FYU D;  3BRT B;  3VOP A;  3MHV A;  1SQP K;  2BEQ D;  4Y28 J;  3I56 P;  1S9K E;  1VF5 B;  2FFD C;  1KD1 Q;  2E74 B;  3CWB D;  2YKP A;  5APX A;  4PD4 I;  2E74 C;  2BAS A;  1KIL E;  5KTB A;  3VMY A;  1HUC A;  1ZRT D;  4U3F D;  3Q5S A;  3AE6 C;  3TGU G;  3BUN B;  1FBV A;  1CI6 A;  3B5N B;  1L0N G;  1VQO P;  1BGY G;  5AW8 B;  1Y8A A;  1KYO D;  2R44 A;  1FU1 A;  2UV8 G;  1HH0 A;  5HKW A;  2Y1M A;  1JY3 N;  2A06 E;  3L73 G;  3L74 D;  4L76 A;  3A7O A;  2IZ1 A;  3BI0 A;  1W2B O;  4JBZ A;  1BCC D;  4RJT A;  1RF1 C;  3BXM A;  4PV1 B;  1NTK J;  4H44 D;  3L75 G;  3TYY A;  3SSU A;  1IK7 A;  1BE3 D;  3FEC A;  1NAY A;  2C6G A;  1R5S A;  3VMA A;  1KB9 H;  1EDI A;  2K3R A;  4H13 D;  5AW2 B;  1OW7 A;  1GU5 A;  2KSE A;  4TLF A;  4WY4 B;  1L0N E;  1NTK K;  1GL2 A;  5C39 A;  1VQ4 P;  4DOJ A;  3AE9 C;  4EIJ A;  1LJ2 A;  2FXP A;  3CC2 P;  1KB9 D;  3WUU A;  5E79 E;  1RE4 C;  3BAT A;  2DLA A;  2A45 H;  2VRS A;  5KLV J;  3RBX A;  3Q1M A;  3BUX B;  2HG5 D;  1CW5 A;  4R4L A;  1RE3 A;  3CXH E;  1LWU A;  3M0D C;  1X0T A;  1DEE G;  3GMA A;  4A4B A;  2B9B A;  1EDJ A;  1JEK A;  3AE3 C;  3CLQ A;  1BE3 E;  4OC0 A;  1T8Z A;  2O1J A;  1CZQ A;  3VRO A;  1RE4 A;  2WPQ A;  4RR2 B;  4A4C A;  2I1J A;  1N73 B;  1SQQ D;  2O3J A;  4XFJ A;  3VP9 A;  2OYH B;  4D6T J;  4OC5 A;  3VP8 A;  1AFO A;  3D6Z A;  5HKY A;  3TF5 A;  2IBZ I;  3A3Y B;  1GU4 A;  2Y0E A;  2ZYG A;  1KN7 A;  1T2K D;  4W7Y A;  1VQ9 P;  1PP9 D;  3KZI E;  1SQX K;  2XDJ A;  1YHQ P;  2K88 A;  1J1E C;  2HOD A;  1GZL A;  2KOG A;  2JP3 A;  2XND H;  1L4A C;  3CME P;  3G9R A;  2Y9Z A;  5CCH C;  1EC5 A;  2I8D A;  2N1T A;  2JWA A;  3VRN A;  1S4X A;  1JCC A;  1YI2 P;  2FYU E;  3FXE A;  3H1K G;  2OTL P;  1YTZ I;  1M1J A;  4PD4 E;  5BY0 A;  2Q9I A;  2J58 A;  2YMK A;  2NRG A;  3M91 A;  1BSH A;  3RGU A;  5APT A;  4K35 A;  1KIL D;  3H1I G;  4X3R A;  2WPS A;  1MZ9 A;  4BRY A;  2V7Q J;  3HD7 D;  2K37 A;  2E5Y A;  1EO0 A;  3WMM 0;  1NYH A;  3L35 A;  1L4A B;  2KNC A;  2XZR A;  1BGY E;  2NPS D;  3OAK A;  3WUV A;  1VQ5 P;  3VRR A;  2Y0C A;  1NTM K;  1RHZ B;  1FDM A;  1K05 A;  3H1J J;  5GTH E;  1JY3 P;  3CMA P;  2WT7 B;  2YIU C;  3Q5R A;  2LXB A;  2M5A A;  4B86 A;  3L71 E;  1P84 D;  2E74 D;  2WSF H;  1EZV E;  4TT3 H;  3NXS A;  5AW9 B;  4MCS A;  3Q3D A;  3P8C D;  4N78 E;  1LTT C;  2N1T C;  2H7H A;  2O01 H;  2XNX A;  3A0B H;  4LLH A;  2ZT9 B;  1VPC A;  1N7L A;  4P44 A;  1L4A A;  1QL2 A;  5AVS B;  3P32 A;  2M5A B;  1L0N J;  5AVY B;  1VQ7 P;  3I5C A;  4PV1 C;  2KZJ A;  1A02 F;  1VF5 C;  2R3S A;  1IC2 A;  3FX0 A;  2BCC G;  3O6Q A;  4YTP C;  3LW5 J;  3AE8 C;  5APQ A;  3H1H D;  2QJK B;  1J1E B;  3L71 G;  1FS0 E;  4OGQ D;  4U3F E;  5TJH A;  5K5G B;  4ASW A;  3CD6 P;  4WY4 C;  4OC4 A;  1Z9E A;  3RL0 B;  2XU6 A;  3CCV P;  1SQQ K;  1SQP G;  3RL0 C;  5APS A;  3HE5 A;  1DD4 A;  1VF5 D;  5D29 A;  2N1T B;  1SQB G;  2PVV A;  1JY2 N;  3EQ2 A;  5AVX B;  1AJY A;  2ZYA A;  5B66 H;  2N9B A;  2ITA A;  2ZT9 C;  1X8Y A;  2V4H A;  4D6T E;  3F9K C;  4UB6 H;  2FYN C;  3M0D A;  2JBJ A;  2WSC H;  1ZLL A;  1M56 D;  1L0N D;  5DJU B;  3AEC C;  3L72 E;  5BVZ A;  3FEE A;  4NGQ A;  2GUV A;  4IFD K;  3BHX A;  2HOD B;  2JEE A;  3KZI H;  3L36 A;  2M0B A;  4L75 A;  1NTZ J;  1GL2 D;  1N8R Q;  5KJ7 D;  4IOI H;  1PP9 G;  1SQV D;  3VTP C;  1WT6 A;  3H1H J;  2QM8 A;  5CCH A;  1JTH A;  4GPL B;  2KNC B;  2KP8 A;  2H88 C;  3HPH E;  1N2D C;  4CPG A;  2HYN A;  1HJ0 A;  2ZXX A;  1H89 A;  4N78 D;  4YXD C;  3B4S A;  3MZW B;  3L37 A;  4BRY B;  3V2Q A;  3M9Q A;  2PP6 A;  1URQ A;  2FYN B;  4WBA A;  4U7J A;  5AW5 B;  3BVH A;  1SFC B;  1JM0 A;  4C7R A;  4JYW A;  4JYC A;  3L70 J;  3OB2 B;  1FC2 C;  2KI7 B;  1J1D C;  1YJW P;  1N73 A;  2M3B A;  3PT1 A;  2PAJ A;  4AUW A;  4HKZ H;  1BCC G;  3BCC J;  3A5T A;  3SJG A;  2XV5 A;  3V5B A;  1EXJ A;  5KLV D;  1MUU A;  3TNU B;  4MCP A;  2LR2 A;  1LWU B;  1URQ D;  4P4J A;  2CK3 H;  1BGY J;  2WMM A;  3AE7 C;  1LWU C;  2KYV A;  1D7M A;  1KZU B;  2E75 B;  1HF9 A;  1YIJ P;  1HWT C;  3H1J E;  3M06 A; 
#chains in the Genus database with same CATH homology
 2LKM A;  5AVQ B;  3TYY A;  3MUD A;  2W27 A;  3LID A;  3B5N D;  1T3J A;  4ZKU A;  2HFE D;  1SFC C;  3A2A A;  1J2J B;  1N73 C;  2NPS A;  1RF0 A;  1HTL C;  5AW2 B;  5APV A;  1NU1 K;  1GU5 A;  3BAS A;  4XA4 A;  4WY4 B;  5CCG C;  3NFQ A;  1NTK K;  1GL2 A;  4DOJ A;  4EIJ A;  3KYQ A;  1ZN5 A;  1URQ C;  4I6M C;  1DEB A;  1RE4 C;  3BAT A;  3UIA A;  3U1C A;  2A45 H;  1N7S A;  3P8C E;  2VRS A;  4KHX A;  2C9N Y;  1FJP A;  1G1J A;  4JYB A;  1SP4 A;  3HPG G;  4GKG A;  2E42 A;  1GK6 A;  2C0W A;  2HG5 D;  1L0N K;  2YKO A;  3B8E B;  2YO2 A;  1N86 A;  3LW5 H;  1CW5 A;  1RE3 A;  3RL0 D;  1IFN A;  1X79 B;  1DX7 A;  1LWU A;  3M0D C;  1FZC B;  1IFI A;  2OYI A;  4LGD E;  1HBW A;  2P67 A;  4GIF A;  1GDT A;  3CLQ A;  3M9B A;  1T8Z A;  2O1J A;  1CZQ A;  2FFD A;  2POH A;  2ZXE B;  1RE4 A;  1XTG B;  5AW7 B;  2OYH A;  5CHX A;  3CI9 A;  3N4X A;  2WPQ A;  5AW4 B;  4IFF A;  2I1J A;  1L4A D;  1SQV K;  1JUN A;  1N73 B;  1FZF A;  4I1L A;  3U88 C;  3VP9 A;  2OYH B;  2QM7 A;  3HUS C;  1N7S D;  3VP8 A;  1VDF A;  1AFO A;  1G2C B;  3A3Y B;  1GU4 A;  1FZG A;  2OYI B;  1RE3 C;  1T2K D;  4W7Y A;  1JY2 P;  4N3Y B;  3MGN A;  3M0A A;  1SQX K;  1LT9 B;  3HRN A;  1FBM A;  2XDJ A;  1J1E C;  2A45 I;  1N7S B;  2HOD A;  1GZL A;  2KOG A;  5AVZ B;  1SVF A;  2YKQ A;  3LIE A;  2XPO A;  2IFN A;  1G1I A;  1L4A C;  3KDP B;  1JTH B;  3T97 A;  5CCG A;  2IX7 C;  3OJA B;  5CCH C;  1KFN A;  2WPR A;  1GK4 A;  4WY4 A;  2Z4E A;  1ZR4 A;  2NPS C;  5AW1 B;  1FAV A;  2N1T A;  2NPS B;  3RK2 D;  5BU5 A;  3M9H A;  1JCC A;  3VMX A;  1M7L A;  1IJD B;  1MFZ A;  1IFD A;  2FKW B;  1CI6 B;  2C0X A;  1FZB A;  3GHG B;  2OYH C;  2XPL A;  1GW4 A;  1HJB A;  3HUS B;  1GL2 C;  4GT1 A;  4I2L C;  5AVR B;  1SQB K;  3V2R A;  1Z56 A;  3VYI A;  1RF1 A;  1YTZ I;  1M1J A;  3HD7 B;  1KFM A;  5AW3 B;  1LTJ C;  5CJ4 A;  2OYI C;  2Q9I A;  1JO5 A;  2Q5U A;  2J58 A;  2P7J A;  1SFC A;  3M91 A;  1FZC C;  1OXZ A;  1LTB C;  2YMY A;  1W2E A;  3NTN A;  5APT A;  4XE5 B;  1KIL D;  3TNU A;  2WPS A;  1MZ9 A;  5APU A;  3HD7 D;  1NHL A;  2H8P D;  1QL1 A;  1ZR2 A;  5CCH D;  1EO0 A;  2CPB A;  3WMM 0;  1IFM A;  2FXM A;  3L35 A;  1LTS C;  1L4A B;  1NTZ K;  3B5N A;  1DH3 A;  2GUS A;  3V4W A;  1NAF A;  4LC1 A;  2WSE H;  2XZR A;  2HPC B;  2NPS D;  3E1I A;  3RK2 B;  3OAK A;  4W7Z A;  2KLV A;  4M3L A;  1X9V A;  1NTM K;  1RY3 A;  1FDM A;  3U1A A;  5KJ7 C;  2L5G B;  3MTU E;  1IFJ A;  1LT9 C;  1JY3 P;  1URQ B;  2XPN A;  2W6B A;  2WT7 B;  5KJ7 A;  4N6J A;  3HD7 C;  5CCG D;  5AVW B;  3V2N A;  2FYZ A;  5AVU B;  4AYC A;  2M8R A;  1LTJ A;  4HH2 A;  2YNY A;  1GW3 A;  4EOT A;  4B86 A;  1JY2 O;  1NKN A;  2ZFC A;  4Y99 C;  2WSF H;  3KQG A;  3PP5 A;  4W80 A;  1YYC A;  4Y99 B;  5BU8 B;  3NXS A;  3U59 A;  5AW9 B;  3L4F A;  3H6P A;  1H8A A;  1PFI A;  2CPS A;  3P8C D;  4N78 E;  2Z5H A;  1LTT C;  2N1T C;  1CSB A;  2H7H A;  2O01 H;  1LTA C;  1JY3 O;  2W6A A;  2XNX A;  3HE5 B;  4LLH A;  1VPC A;  1N7L A;  2R5B A;  1LTI C;  1FOS F;  2MJZ A;  1NH4 A;  4HYT B;  1SFC D;  1L4A A;  3G3Z A;  3II6 A;  4O9B A;  3N7N A;  1QL2 A;  4WY4 D;  5AVS B;  4ZKP A;  3RK2 C;  1T2K C;  3P32 A;  5AVY B;  4C7N B;  2N1T D;  3I5C A;  1LGH B;  2KB7 P;  1A02 F;  5CJ0 A;  2Q3I A;  1IC2 A;  3H32 A;  3OA7 A;  1ZV8 A;  1GTW A;  3VN0 A;  2E43 A;  1L0L K;  2WWW A;  3HE4 A;  3TK1 A;  3SWY A;  2YO3 A;  2WIT A;  5APQ A;  4RES B;  1OWA A;  4C46 A;  3BRV B;  1J1E B;  1EQ7 A;  1NO4 A;  1HGV A;  5APW A;  1WRG A;  5AW0 B;  3HTK A;  2HPC A;  4WY4 C;  1NWQ A;  4C7N A;  1KIL C;  2J59 M;  3RK3 C;  1Z9E A;  1NOH A;  3RL0 B;  2XU6 A;  5AVT B;  1KIL B;  1SQQ K;  1KIL A;  3RL0 C;  2P2U A;  3B5N C;  5APS A;  1T3U A;  3HE5 A;  4JF7 A;  5CMZ A;  1AQ5 A;  1MV8 A;  3HTK B;  1A02 J;  2N1T B;  3VMZ A;  1JY2 N;  2OAR A;  3EQ2 A;  5AVX B;  2XPP A;  2R5D A;  3HE4 B;  2N9B A;  4WB4 A;  1X8Y A;  3F9K C;  1S9K D;  1NKZ B;  3M0D A;  3GHG C;  3H32 B;  2WSC H;  1ZLL A;  3P7K A;  1KQL A;  5BVZ A;  1IO4 A;  4AQR D;  2IFM A;  1JCD A;  2GUV A;  1LTJ B;  1JNM A;  3C9I A;  2HOD B;  3L36 A;  1M1J B;  2JEE A;  4IFD K;  1RF1 B;  4DZO A;  3HUS A;  3GHG A;  2WT7 A;  1JOC A;  1LT9 A;  1GL2 D;  4IFM A;  2O1K A;  3MIW A;  3R2P A;  5KJ7 D;  2N3A B;  5AVV B;  3RK3 D;  3KPE A;  3VTP C;  1WT6 A;  1FJK A;  2R32 A;  1JMM A;  3RK3 B;  2QM8 A;  1WJT A;  5CCH A;  1JTH A;  2KP8 A;  2A45 G;  3EFG A;  2Z5I A;  3HPH E;  1N2D C;  3BRT B;  3O8Z A;  3VOP A;  1LTG C;  2HYN A;  2FYU K;  1SQP K;  1S9K E;  2HLO A;  4N78 D;  1H89 A;  1GD2 E;  2FFD B;  1SLQ A;  1N7S C;  2P1J A;  2FFD C;  3MD0 A;  3L37 A;  3V2Q A;  3TSI A;  2B4J C;  3M9Q A;  1E5W A;  2JJL A;  1URQ A;  2PP6 A;  2R3C A;  3CL3 D;  1FZA A;  3SWF A;  4WBA A;  2YKP A;  5AW5 B;  5APX A;  3BVH A;  1IK9 A;  4OH8 B;  1SFC B;  2BAS A;  5APY A;  3V2P A;  2KSJ A;  3P8M C;  2WTY A;  2IPP A;  4C7R A;  4JYC A;  5KTB A;  1G2C A;  1HUC A;  3VMY A;  1RF0 C;  1J1D C;  2Q7C A;  1N73 A;  2M3B A;  1J1D B;  1CI6 A;  3B5N B;  2PAJ A;  1HVV A;  2H43 A;  5AW8 B;  5AW6 B;  4AUW A;  1GL2 B;  5KLV K;  3A5T A;  1FU1 A;  2XV5 A;  1HH0 A;  3V5B A;  1MUU A;  1JY3 N;  3TNU B;  2C9L Y;  1H88 A;  3IR9 A;  1LWU B;  1FZC A;  1URQ D;  1FZE A;  3A7O A;  1LWU C;  1HGZ A;  2I1K A;  2KYV A;  1YTZ T;  3NMD A;  3V4Q A;  3IFM A;  1KZU B;  2XKM A;  1FOS E;  2GM4 A;  1XTC C;  1M1J C;  1HWT C;  2WZ7 A;  1RF1 C;  3M06 A;  3HD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...