3O8ZA

Crystal structure of spn1 (iws1) core domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
152
structure length
152
Chain Sequence
DPFTDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription factor IWS1
publication title Structure and biological importance of the spn1-spt6 interaction, and its regulatory role in nucleosome binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 60
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3o8zA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3o8zA02
2WPRA 3M06A 3NMDA 3HE5A 1DH3A 5AW2B 1H8AA 2P2UA 3TK1A 2IPPA 4C46A 2YO3A 5CMZA 1JUNA 2R5BA 2XV5A 5APSA 5AW7B 1G2CB 2XPNA 4DZOA 1GZLA 3A7OA 1HWTC 3P8MC 3T97A 3HE4B 2ZXEB 1T2KD 1GU5A 3L37A 5AVXB 3MGNA 2Q5UA 5AVSB 3HE5B 1Z9EA 2N9BA 2P67A 1A02F 2XPPA 2C9NY 3F9KC 2R5DA 2YO2A 1MFZA 1MUUA 2YNYA 3NFQA 5AW3B 1HUCA 5AVWB 3VYIA 3M9HA 3V4QA 2XU6A 5AVVB 1OXZA 2WPQA 5APQA 1GD2E 1WJTA 4KHXA 2Q3IA 2WT7A 1S9KE 3TNUA 3NXSA 5AVQB 2E43A 3OAKA 5APXA 1CZQA 3I5CA 3UIAA 3A2AA 1CSBA 1GK4A 3TYYA 3B8EB 1CI6A 5APWA 1YYCA 2W6AA 3V5BA 2XPOA 4RESB 2R32A 1NWQA 2WWWA 5APVA 2QM8A 4I6MC 4JYBA 5APUA 4AYCA 5AW0B 2WT7B 3TNUB 3M0AA 2WPSA 4C7NA 1EO0A 1A02J 1CI6B 4GT1A 5AW1B 3P32A 5AW5B 2Z5IA 3LIDA 1J2JB 1MV8A 2N3AB 1GTWA 3LIEA 1JNMA 1S9KD 3VN0A 2H7HA 1H89A 1HJBA 1GK6A 5APYA 3NTNA 3A5TA 1FOSF 1X8YA 4EOTA 1NAFA 1OWAA 3V4WA 4C7NB 4LC1A 5APTA 5AW9B 3VMXA 4AQRD 5AVUB 4M3LA 5AW6B 2VRSA 3VTPC 3HE4A 5AW4B 3KDPB 5AVZB 2KP8A 1IO4A 2E42A 2P7JA 4AUWA 4XE5B 3IR9A 4GKGA 2XZRA 3VMYA 2QM7A 1GU4A 3L36A 3U88C 3HPGG 2ZFCA 3KQGA 3A3YB 2BASA 2R3CA 5AW8B 3L35A 2Q7CA 1H88A 1HBWA 2B4JC 5AVRB 1KQLA 1SP4A 2W27A 3P7KA 3M9BA 1FAVA 1T2KC 3HTKA 3MD0A 3O8ZA 3M91A 5AVTB 2JJLA 1FOSE 2Z5HA 1SLQA 4I2LC 2XPLA 2WTYA 2C9LY 3SWFA 3HPHE 5AVYB 4HYTB 3M0DA 4JYCA 4B86A 3VMZA
chains in the Genus database with same CATH superfamily
2B9BA 5KKZC 4RKUJ 3GG2A 1S4XA 2R5BA 4NGSA 1N7SC 3AE8C 2WVRA 3AE4C 3P8MC 3RBXA 2POHA 3L75G 1NTKE 3CCRP 5B66H 3F9KC 4R4MA 2YO2A 3L75J 2WSFJ 2H8PD 2YNYA 1EXIA 3S9MA 3TGUE 1AJYA 1S2EA 1S3JA 3C8VA 1S9KE 4W9YA 2IYOA 2Y0CA 2NZ2A 1KD1Q 2LXCB 4WVZA 3KZIE 1OIPA 4JYBA 4AYCA 3W68A 1EZVI 2YXQB 1GMJA 4NGTA 1A02J 3Q5PA 2J59M 2Z5IA 1T3JA 2WSCH 2O1JA 2ZVNB 2PP6A 3TDKA 4CPGA 1NAFA 2JBJA 2PVVA 4L76A 4ZNCA 4IL6H 3VMYA 2QM7A 4D6TD 1VQ9P 1FE6A 4MCRA 1LTIC 1S1CX 3HTKA 3BCCE 4RR2B 4HYTB 2NPSC 2UV8G 4B86A 3B5NC 1H8AA 3H1ID 3HMJG 4I1LA 1N86A 3RL0D 1BGYD 3S9LA 4U3FE 2M3BA 1HWTC 1XTGB 4UB6E 1LT9C 4H44D 3H32A 2OTLP 3I56P 2WZ7A 5K5GB 1PL5A 4OC5A 1MFZA 2KIKA 3AEGC 3BUMB 2CK3H 5AVVB 1KV4A 1AQTA 2KNCA 1Y47A 1OW6A 3OAKA 4DJGA 1GK4A 2KUBA 2W6AA 1FZCA 2R32A 2JO1A 1GL2C 2NRGA 1X79B 2W6JH 1AV1A 2KB7P 1EO0A 3H1JD 1VDFA 2Q3EA 1VQ8P 2A45I 3P32A 4L73A 1G1JA 3AE3C 4BPUB 1M1JA 5CHXA 3WUTA 1SQXE 2BCCE 1DIPA 5KTBA 1YIJP 1KC8Q 4C7NB 1PP9E 1BSNA 1H0TA 2BEQD 1ZLLA 3IFMA 4PV1C 3KDPB 4W7YA 5AVZB 2P7JA 1OX3A 1FDIA 1URQC 3V2PA 3AEEC 3CC4P 2JP3A 2QIWA 2E74C 3WUVA 1NU1G 3S1KA 3IWWA 2K1AA 3BVHA 2IBZD 1NTMG 1NU1J 2HG5D 3U1AA 3MZWB 1NTMJ 2JR8A 3B71A 3L74G 2K88A 3PLNA 2KYVA 1M8OB 3HD7C 2IPPA 1TU3F 3M0DC 3L74J 2YIUB 3GLMA 1JEKA 4N3YB 1EZVG 1GZLA 3MIWA 1LTAC 2SPZA 4KJMA 1T3UA 1SQQJ 3OA7A 1AQ5A 2R5DA 1BCCG 1KFNA 1IFNA 1U7JA 1BCCJ 2FXPA 4WY4B 3D6YA 3LW5J 3L71J 1N2DC 2AXTH 5APWA 2E76C 3P8CE 1NTKG 4JYWA 1ZRTE 3L72G 1VQKP 4JQ0D 4N78E 3QH9A 1LP1B 3L72J 4NPEA 1E79H 3L70D 1CI6B 1J2JB 3KHUA 4LQGA 3LIEA 2WMMA 3V4WA 3MHVA 5F13A 1G2CA 3HUSC 4GIFA 3CWBD 3PFVA 2XNDH 3FGAD 1T6AA 2QJPB 3RK3C 1SQBK 2ITAA 3O6QA 1EDKA 3A3YB 2JBKA 1PPJD 5BY0A 4HB1A 1T2KC 5KAFE 2AEMA 1FOSE 4GODA 1Q82Q 1KYOH 3E1RA 1FU1A 4YXWH 2ZT9D 1NTZE 5AW2B 1NU1K 3CCSP 1LWUB 2XV5A 2C0XA 4DZOA 3A7OA 3L73G 2I1KA 1P84E 3PT1A 1KYOI 1OVRA 2A45G 1R8EA 1SQVJ 3L73J 4YPCA 4Y99B 1RE3C 4H13D 2A06D 3VYIA 2IFNA 1D7MA 1U57A 2Y1NA 1SQQK 1PGQA 4WB4A 3CCVP 1K73Q 4U3FG 2YXRB 2YMYA 2HR3A 1YITP 2YKQA 3PLFB 2R44A 5J3XA 1MKMA 2W6BA 4I6MC 1FDMA 5TISE 1ZN5A 4RO0A 4C7NA 3VRQA 2M5AA 1LTGC 1ZOYC 1KILE 1ZP0C 3WU2E 1Q2NA 3L4FA 4DCKA 4RJTA 1L0LD 3PJSK 5APYA 1FOSF 3CXHE 2XEIA 4OC1A 2IFMA 1Q7YQ 1DE4C 1N73B 3GMAA 5APTA 4PD4E 2FYNC 2QJKB 3GW6A 2G8YA 4LLHA 1SQXG 2BCCG 4UB8E 1KZUB 2GM4A 1PP9G 5AVTB 1NHLA 3A0HH 2B87B 1QLED 1YTZT 3HD7D 1M7LA 2NPSB 2HFED 1YI2P 2ZT9B 4OC0A 3VROA 1AFOA 3MGNA 4WY4A 5AVSB 2M0BA 1A02F 1RE4A 2C9NY 1IC2A 2RN0A 4ASVA 3L75D 5EFWB 3CXHI 1HUCA 3H1KD 2XU6A 3FEEA 4OH8B 1SQVK 2WPQA 1XTCC 1VQ5P 1LP1A 3OJAB 3JSVC 2E76D 2LKMA 4HKZH 1CI6A 1VQ6P 4ZKPA 1CW5A 1UIIA 3H1HD 1OW8A 3CCUP 3H1LD 1KB9E 4OC2A 1HGVA 1VPCA 3A5TA 1SQBE 3CX5E 1DD3A 1IO4A 3RK3D 2E42A 4GKGA 4BRYB 3PRJA 4BXLA 2E5TA 3SWYA 1LTJB 2ZXXA 2BASA 2IDBA 1URQB 2B4JC 1KQLA 4GPLB 1LWUA 1VF5C 1NU1E 3VP9A 3BRVB 2ZVOB 2JJLA 3V2QA 1SQPG 3D7DA 2HODB 1K05A 3ABVC 2KSEA 1HTLC 3L74E 3MUDC 1SQPJ 1JUNA 5B66E 2G3AA 3BUOB 1S5LH 3AE1C 2YMKA 1ZXGA 1EZVE 3HD7B 1SQQE 1LTBC 3HE5B 2XPPA 2E5YA 3R4YA 3NFQA 1M56D 1ZR4A 1NTZG 3VRNA 3V6IA 1BCCE 2QJYB 4P4JA 3L71E 1NTZJ 3CX5I 2FBWC 5L8RJ 2WSEH 4OC4A 1YJWP 3L72E 2E76B 1BE3D 2L5GB 2OYIC 1N73A 1EXJA 5CBOA 5BU8B 1IK7A 3LIDA 4JZ0A 2OYOA 3AE7C 3B4SA 3CMEP 4IL6E 1OWAA 1X9VA 1R5SA 1W2BO 1LTTC 3RGUA 3HE4A 4OGQC 3A0BH 1QVFO 2GUVA 2KP8A 1BDDA 1MZ9A 3KASA 3CCQP 1JOCA 3KQGA 2B87A 5KLVG 1KQGB 3KYQA 3RK3B 5KLVJ 4N6JA 3G3ZA 2OGUA 1M1KQ 2NPSA 2C9LY 2OQQA 1USEA 1NTMD 1Q86Q 2YO3A 5AXIA 5HKYA 4OC3A 1G2CB 3JCUH 3W67A 1SQPK 3BUWB 3CCMP 3CCJP 1QEXA 2E75D 4XA4A 1SQVE 3L73E 1K8AQ 2AEFA 3SFDC 1OVVA 3O6QB 1MUUA 3CPWO 2CPSA 1QL1A 3V4QA 1JMMA 3KZIH 1HGZA 5AVQB 1QVGO 3G6EP 1RF1C 2K37A 4LGDE 1NTZK 4Z1MH 5D29A 2CPBA 1NTKD 4WY4D 2RMZA 1QGKB 4Y28J 1IZNB 4PJ0H 1RY3A 3PP5A 5AW5B 3TGUD 2BEZF 2OYHB 2H88C 3CL3D 4JBZA 5BVZA 5CJ4A 3K5BA 1S9KD 4BRYA 2OTJP 1FZEA 1L0NJ 2K9YA 1LTJA 2FYUE 5AW9B 1URQA 1EDLA 2JWAA 2ZYGA 3IR9A 1Z8LA 1NVOA 2K9JB 2FYNB 2HODA 3BHXA 5H2FH 2M3EA 3IF4A 5GTHH 1RQUA 1VF5D 1RHZB 3SSUA 1SFCD 1SQBG 4P4BA 3AEBC 1J1DC 2IBZI 2M5AB 1SQBJ 5CBNA 1RF0C 3HD7A 5AVYB 5KLVK 3M0DA 3M06A 3HE5A 1DH3A 1OW7A 5KLIB 4OMEA 3V2RA 2VKZG 2QEXP 3ZDMA 1GU5A 1M57D 3CMAP 5AVXB 2C6GA 2JDIH 3OW2O 1FZCC 1LJ2A 1R5LA 3BCCD 4NPDA 2AXTE 4EI2A 2E75B 1OXZA 4BTFA 5CCGC 2FFDC 2E43A 5DJTB 2O01H 1N7SD 3AEAC 3BUXB 3A2AA 2KOGA 4RESB 1SQQG 4U3FD 5DJUB 4D6TG 2GA1A 1IFIA 1L4AC 4D6TJ 3L71G 1MV8A 3AE2C 2Q6QA 4H0LC 2J58A 1QL2A 2XDJA 1FZGA 4GOEA 1LTSC 2Q1KA 4LC1A 3H1IG 1JTHB 4NGNA 1YVHA 1YTZI 2VRSA 5CCHC 1L0NK 2W8ZA 4P45A 5AW4B 2WSCJ 3H1IJ 1NYHA 1BGYG 1L2PA 2KI7B 3L36A 2Y0DA 1JY2P 1BGYJ 3GHGB 1KYOE 2R3CA 4GOFA 4ASWA 1KILC 1G1IA 1H88A 4TLFA 2KS1B 2FXOA 1SQXD 2BCCD 2ZYAA 3JC22 2RH0A 4I2LC 2WTYA 4JYCA 1PP9D 1SQPE 1VF5B 1SFCB 3MP7B 3TK1A 5TJHA 5C39A 1JY3P 1IFPA 1PZQA 1K04A 2HYNA 3C9IA 3BI1A 3RK2C 2C6CA 1PGPA 2ZXEB 1RE3A 2Q5UA 2Y0EA 3FWNA 3H1JG 2NPSD 4IL6X 2KK7A 1WRGA 2C0WA 2V7QH 3H1JJ 2IYPA 1FJPA 3B5ND 3N7NA 1WMKA 5APQA 3RBZA 5KJ7C 1X0TA 3Q5RA 3HRNA 3CCEP 1U7MA 3TYYA 5KKZB 1SQVG 3FWLA 2OYHA 3ZNIA 2WITA 1N7SB 1JY2O 1PFIA 1DD4A 3SJEA 2IBZG 2OYIB 4YTPC 2H7HA 3II6A 4W7ZA 1YQ3C 2K9JA 1GL2D 3P8CD 1ZRTD 4N78D 5E79E 5KAFH 5GTIH 3BATA 1JY3O 1NOHA 1SVFA 5KLVE 3CI9A 2GUSA 3AEFC 2FYUG 3M91A 5M1BA 3SWFA 2FYUJ 4PV1D 1JCCA 2W83C 1P84H 1URQD 2N1TC 4C46A 1UIXA 5CMZA 3EWKA 2WSFH 1FDOA 4I7ZC 3BASA 2E74D 2XPNA 4R4LA 3D71A 1VQ7P 3HE4B 1PGJA 3L37A 1RQVA 2O01J 2PGDA 1W2EA 4OVNF 1NTZD 3ITKA 1OVUA 3UIAA 3B5NB 2XPOA 1NWQA 3CWBJ 1P84D 1MFTA 1RF1B 1LT9B 1JTHA 1NO4A 3E7KA 4PD4H 3M9QA 2XNXA 5KAIH 1L0NE 2IX7C 1HJBA 2YKOA 4EOTA 3GHGA 1KQSO 1FS0E 3AE6C 1IFJA 2KS1A 4UB8H 3Q3DA 2P1JA 2ZFCA 4A4BA 1GL2B 2LR2A 2AEJA 3RL0C 1KILD 1Q81Q 1DX7A 1SFCA 5CJ0A 3SJGA 5AVRB 1VQPP 2D2CC 3BXMA 1T8ZA 2A06G 3MD0A 4H44C 3CXHD 1SLQA 3MUDA 1E5WA 3S9OA 1GU4A 4PD4D 3CD6P 1J1DB 4C7RA 4K3AA 2FYUK 1CX8A 4PV1B 1T2KD 1GW3A 4JPZB 1FZFA 4MCQA 2I1JA 2E74B 3BI0A 3WMM0 3Q2YA 1GD2E 3SWKA 4A7PA 1DEBA 1N7SA 1JB0J 2H89C 4KT0J 1W5CE 5B5EH 3V5BA 2FFDB 4TT3H 1KB9H 2MKVA 2IZ1A 2OYIA 1ZV8A 2WT7B 3M0AA 2PFXA 4D6TE 3PTZA 4GT1A 5AW1B 1BDCA 4MN4C 1NKZB 3A0BE 1L4AB 4JF7A 3VN0A 2P10A 3BRTB 1LWUC 4H0LB 3VMXA 1JM0A 1JCDA 3H1IE 1BGYE 1PIXA 2IZ0A 4Y99C 5AW8B 1HBWA 1KB9D 1HH0A 1SP4A 1FBMA 1X22A 3H1KG 1KILB 1SQBD 3H1KJ 3JCUE 3NMDA 2N1TD 3CX5D 2P2UA 3SJFA 2H43A 3I55P 3HUSB 2HPCB 1B47A 2MJZA 5APSA 4IFMA 1VQNP 4NGMA 2JKVA 1K9MQ 1BSHA 3USSA 3LW5H 1Z9EA 2P67A 2C6PA 3RK2B 3H1HG 1NU1D 3H1JE 3B5NA 1AVOA 3H1LG 2CIJA 3PH0A 1J1EC 5AW3B 3H1HJ 3H1LJ 1RF1A 3L74D 1N73C 1CZQA 1LT9A 1VL2A 1YBKA 4PJ0E 2QJKC 4WWIA 2B89A 2WWWA 3CC7P 1EZVD 1L0LK 1M90Q 1SQQD 1VQOP 3D7GA 1YQ4C 1BCCD 2B88A 1JNMA 2KLVA 4NGQA 3L71D 2IBZE 1GK6A 1GL2A 1HVVA 5H2FE 4IFFA 5GTHE 3L72D 1GDTA 1FBVA 2ZT9C 2Z4EA 2XZRA 1IFMA 3TF5A 1KORA 1L0NG 3L35A 2D2CD 3M9BA 4P4DA 1RF0A 2WSSH 1JY2N 4H13C 3VMZA 3Q5SA 1NKNA 2DLAA 2KXPB 3D70A 3EQ2A 3OB1B 2A45H 1IK9A 2M8RA 4W80A 5AW7B 1YHQP 3G9RA 2N1TB 1GW4A 3AE9C 3GF3A 1YJNP 3IN6A 1BE3G 4I7ZB 5ELYA 3C1LA 3L70E 1BE3J 5CCGA 3KPEA 1JY3N 5AVWB 2FFDA 4UB6H 1FJKA 4NGRA 1DEEG 2L91A 2WT7A 3VP8A 3CC2P 1ZR2A 3I5CA 3B8EB 3CWBE 4EDFA 1LTJC 1L4AA 1SQVD 3L73D 3TNUB 2J5UA 4IFDK 4A4CA 1PPJE 2AXCA 1S5LX 2O3JA 2I8DA 2WSEJ 1WT6A 3PHLA 3RBUA 4P4FA 1M1JC 2QRXA 5CCHA 1HJ0A 1KN7A 4XE5B 3F5HA 3U88C 1KILA 1NAYA 4EIJA 3Q1MA 3MTUE 3P7KA 1FAVA 3HUSA 2HPCA 2QJYC 3RL0B 2A06E 3BUNB 5F09A 4OGQD 2D2CB 2FYUD 3FEDA 2PRRA 1AVYA 4H44B 3G71P 3RL0g 1Y9BA 2Y9ZA 1EC5A 2FXMA 1OFCX 1FZBA 3H6PA 2QE7H 2N9BA 1PV3A 1NTKJ 5HKWA 4ZMDA 3FF3A 4BPXB 2P58A 3R2PA 3TGUG 5KJ7A 4NGPA 3WUUA 3FXEA 3TGUJ 3SFEC 1WJTA 3T97B 4KHXA 2Q3IA 2JWDA 3OB2B 1L0LE 1YJ9P 2RKLA 4XFJA 1CSBA 3QWOC 3G4SP 1OMIA 4O9BA 5APUA 4QMAA 5AW0B 2WPSA 2KZIA 3V2NA 1HF9A 2N3AB 1GTWA 4WBAA 2ZJSE 3GF7A 5GTIE 4EYYQ 1Z56A 5AVUB 3FX0A 5AW6B 1N8RQ 3CLQA 1NH4A 1NGMB 1N7LA 3HPGG 2Q9IA 1NTMK 4NPFX 1JO5A 1Y8AA 2ZYDA 4MCSA 2OR4A 3BCCG 3L75E 2OOTA 3H1KE 3AE5C 1OZHA 3BCCJ 2N1TA 1KTMA 2DW3A 1RH5B 2WQYC 3SJXA 4U7JA 4OGQB 1EDJA 3U59A 3A0HE 2JEEA 4U3FJ 1KYOD 3S4RA 2FY8A 2CBLA 1EDIA 2PVWA 2QA4P 2OYHC 3EFGA 1KMIZ 1QX8A 3H1HE 3KXDA 3H1LE 1NTKK 1SQPD 3TNUA 3NXSA 1J1EB 4P4EA 1YYCA 4P4IA 2FYZA 2QSIA 3FECA 4ZKUA 3L70G 3RK3E 5KAIE 1P84I 2QVAA 3L70J 3AECC 4L75A 5BU5A 5CCGD 1LNQA 2Y1MA 2KSJA 2FKWB 5TISH 3N4XA 2XEFA 1JMBA 5E79H 1H89A 3E1IA 3NTNA 1X8YA 1SQXJ 3CWBG 4HH2A 2BCCJ 3WU2H 4AQRD 1S72P 4M3LA 1PP9J 5KLIC 2YKPA 1LGHB 1L4AD 1PPJG 4AUWA 3CXHH 2KLUA 1IJDB 3S9NA 4H0LD 2Q7CA 3D7HA 2W90A 2W27A 3CCLP 4DOJA 2E75C 1LT1A 3O8ZA 2LXBA 2YIUC 5CCHD 2QG4A 1ZW0A 2WPRA 4BWNA 4PD4I 2XEGA 3HTKB 4H13B 4OWFA 1KQFB 2O1KA 2XEJA 4MCPA 1SS1A 3T97A 5KLVD 1USDA 4X3RA 1EQ7A 1BE3E 2K3RA 3H25A 1NJIQ 4K35A 4WY4C 1S5LE 1RE4C 3M9HA 5B5EE 2V4HA 3F89A 3H32B 5APXA 3RK2D 2KZJA 3VRPA 2OARA 2V7QJ 3VMAA 5APVA 2QM8A 2KNCB 3GHGC 2Y9YA 3U1CA 3OP0A 5KJ7D 1KFMA 1FZAA 1FC2C 1L0LG 1VQMP 3D7FA 1FZCB 2ZAEB 4BPWB 3D6ZA 1VQ4P 1L0LJ 4P44A 3AEDC 2R3SA 1SFCC 4GDOA 2HLOA 2QJPC 1NTME 1Q90D 4IOIH 3VRRA 3VTPC 1PGOA 3IAOA 2N9YB 1M1JB 4YXDC 1SQXK 1VQLP 5HKZA 2O01N 3CX5H 4DT0A 1H0TB 1ZMEC 3EFFK 1KB9I 1L0ND 4L74A 2UWJE 2XKMA 1AA0A 2OTKE 1IFDA 4HJGH 2WPVB 2Z5HA 3FXDA 2XPLA 3VGOA 2PAJA 3HPHE 3VOPA 3TSIA
chains in the Genus database with same CATH topology
1NKNA 1SFCB 1YTZT 3HD7D 3EQ2A 3TK1A 2R5BA 2A45H 1IK9A 1M7LA 2M8RA 4W80A 2NPSB 1JY3P 5AW7B 1N7SC 2HYNA 3C9IA 3RK2C 2HFED 2N1TB 3P8MC 1GW4A 2POHA 2ZXEB 1RE3A 1AFOA 3MGNA 4WY4A 2Q5UA 5AVSB 1A02F 1RE4A 2C9NY 1IC2A 3F9KC 2YO2A 5CCGA 2NPSD 3KPEA 2H8PD 2YNYA 1WRGA 2C0WA 1JY3N 1HUCA 5AVWB 2FFDA 1FJPA 3B5ND 2XU6A 1FJKA 4OH8B 3N7NA 5KJ7C 1SQVK 2WPQA 1XTCC 5APQA 2WT7A 1S9KE 3VP8A 3OJAB 3HRNA 1ZR2A 3I5CA 2LKMA 3TYYA 3B8EB 1CI6A 2OYHA 2WITA 4JYBA 4AYCA 1LTJC 1L4AA 1N7SB 3TNUB 4ZKPA 4IFDK 1CW5A 1A02J 1JY2O 1PFIA 2J59M 2Z5IA 1T3JA 2WSCH 1WT6A 2O1JA 2OYIB 2PP6A 1HGVA 1VPCA 2H7HA 3A5TA 1M1JC 3II6A 4W7ZA 1NAFA 5CCHA 1GL2D 3P8CD 4N78D 1IO4A 3RK3D 2E42A 4XE5B 4GKGA 3VMYA 2QM7A 3BATA 1JY3O 3U88C 1KILA 3SWYA 1LTJB 1NOHA 1SVFA 4EIJA 2BASA 3CI9A 1LTIC 3MTUE 1URQB 2B4JC 1KQLA 1LWUA 2GUSA 3P7KA 1FAVA 3HUSA 2HPCA 3HTKA 3M91A 3RL0B 3VP9A 3BRVB 2JJLA 3V2QA 3SWFA 4HYTB 2NPSC 2HODB 4B86A 1JCCA 1HTLC 1URQD 3B5NC 1H8AA 2N1TC 4C46A 5CMZA 1JUNA 2WSFH 4I1LA 1N86A 3RL0D 3BASA 2FXMA 2M3BA 2XPNA 1FZBA 1HWTC 3HD7B 1XTGB 3HE4B 1LT9C 3L37A 3H6PA 1LTBC 3HE5B 3H32A 2N9BA 2XPPA 2WZ7A 3R2PA 1MFZA 5KJ7A 3NFQA 1ZR4A 1W2EA 5AVVB 1WJTA 4KHXA 2Q3IA 3OAKA 3UIAA 1CSBA 1GK4A 3B5NB 2W6AA 2XPOA 1FZCA 2R32A 2WSEH 1NWQA 4O9BA 5APUA 1GL2C 5AW0B 1X79B 1RF1B 2KB7P 2WPSA 2L5GB 2OYIC 1LT9B 1EO0A 1VDFA 1N73A 2A45I 3P32A 1JTHA 5BU8B 3V2NA 1NO4A 1G1JA 3LIDA 3M9QA 2N3AB 2XNXA 1GTWA 1M1JA 5CHXA 4WBAA 2IX7C 1HJBA 2YKOA 5KTBA 4EOTA 1OWAA 3GHGA 4C7NB 1IFJA 1X9VA 1Z56A 5AVUB 5AW6B 1LTTC 3HE4A 3CLQA 1NH4A 1ZLLA 3IFMA 3KDPB 4W7YA 5AVZB 2GUVA 2KP8A 2P7JA 1MZ9A 1URQC 3V2PA 1JOCA 1N7LA 3HPGG 2P1JA 2ZFCA 2Q9IA 3KQGA 1GL2B 1NTMK 3RL0C 1JO5A 1KILD 1DX7A 1SFCA 3KYQA 5CJ0A 3RK3B 5AVRB 4N6JA 1T8ZA 3G3ZA 3MD0A 2NPSA 3BVHA 1SLQA 3MUDA 2HG5D 1E5WA 2N1TA 2C9LY 3U1AA 1GU4A 2KYVA 3HD7C 2IPPA 2YO3A 1J1DB 3M0DC 4C7RA 2FYUK 1G2CB 4N3YB 3U59A 2JEEA 1GZLA 1SQPK 3MIWA 1T2KD 1GW3A 1LTAC 4XA4A 1FZFA 1T3UA 2I1JA 2OYHC 3OA7A 3EFGA 1AQ5A 2R5DA 1MUUA 3WMM0 2CPSA 1KFNA 1QL1A 3V4QA 1JMMA 1IFNA 1NTKK 1GD2E 1DEBA 1N7SA 1HGZA 3NXSA 5AVQB 4WY4B 3TNUA 1N2DC 1J1EB 5APWA 1RF1C 1YYCA 2FYZA 3V5BA 3P8CE 4LGDE 1NTZK 2FFDB 4ZKUA 4N78E 2OYIA 2CPBA 1ZV8A 4WY4D 2WT7B 3M0AA 1RY3A 5BU5A 5CCGD 1CI6B 3PP5A 4GT1A 5AW1B 5AW5B 2KSJA 2OYHB 2FKWB 1J2JB 3CL3D 3LIEA 3N4XA 5BVZA 5CJ4A 1NKZB 1S9KD 1L4AB 4JF7A 3VN0A 1FZEA 1H89A 3E1IA 3NTNA 1X8YA 4HH2A 1LTJA 3V4WA 1G2CA 3BRTB 1LWUC 5AW9B 3HUSC 3VMXA 4AQRD 4GIFA 4M3LA 1JCDA 1URQA 2YKPA 1LGHB 1L4AD 4AUWA 3IR9A 3RK3C 1SQBK 3A3YB 2HODA 1IJDB 4Y99C 5AW8B 2Q7CA 1HBWA 1HH0A 1SP4A 2W27A 1FBMA 1SFCD 4DOJA 1T2KC 3O8ZA 1J1DC 1FOSE 1KILB 1RF0C 5CCHD 3HD7A 5AVYB 5KLVK 1FU1A 3M0DA 2WPRA 3M06A 3NMDA 2N1TD 3HE5A 1DH3A 5AW2B 2P2UA 2H43A 1NU1K 1LWUB 3HUSB 2HPCB 2MJZA 3HTKB 2XV5A 5APSA 2C0XA 2O1KA 4IFMA 3V2RA 4DZOA 3A7OA 3T97A 2I1KA 1GU5A 5AVXB 3LW5H 1Z9EA 1EQ7A 2A45G 2P67A 1FZCC 3RK2B 4Y99B 1RE3C 3B5NA 4WY4C 1J1EC 5AW3B 3VYIA 1RE4C 3M9HA 2IFNA 1OXZA 5CCGC 1SQQK 2FFDC 1RF1A 4WB4A 2E43A 1N73C 3H32B 2O01H 5APXA 1CZQA 1N7SD 3RK2D 1LT9A 3A2AA 2YMYA 2KOGA 2YKQA 4RESB 2OARA 2W6BA 2WWWA 5APVA 2QM8A 4I6MC 1L0LK 1FDMA 3GHGC 3U1CA 1ZN5A 1IFIA 4C7NA 1L4AC 1LTGC 1KFMA 5KJ7D 1FZAA 1FZCB 1MV8A 3L4FA 1JNMA 2J58A 2KLVA 1QL2A 2XDJA 1GK6A 5APYA 1FOSF 1SFCC 2IFMA 1GL2A 2HLOA 1FZGA 1HVVA 1LTSC 1N73B 4LC1A 5APTA 1JTHB 1YTZI 2VRSA 3VTPC 4IFFA 5CCHC 1L0NK 5AW4B 1M1JB 1GDTA 1SQXK 2Z4EA 2XZRA 1IFMA 3L36A 1JY2P 3GHGB 4LLHA 2R3CA 3L35A 1KILC 1G1IA 1H88A 1KZUB 2GM4A 3M9BA 1RF0A 2XKMA 5AVTB 1IFDA 1NHLA 2Z5HA 4I2LC 2XPLA 2WTYA 2PAJA 3HPHE 1JY2N 3VOPA 4JYCA 3VMZA 3TSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPR A;  3M06 A;  3NMD A;  3HE5 A;  1DH3 A;  5AW2 B;  1H8A A;  2P2U A;  3TK1 A;  2IPP A;  4C46 A;  2YO3 A;  5CMZ A;  1JUN A;  2R5B A;  2XV5 A;  5APS A;  5AW7 B;  1G2C B;  2XPN A;  4DZO A;  1GZL A;  3A7O A;  1HWT C;  3P8M C;  3T97 A;  3HE4 B;  2ZXE B;  1T2K D;  1GU5 A;  3L37 A;  5AVX B;  3MGN A;  2Q5U A;  5AVS B;  3HE5 B;  1Z9E A;  2N9B A;  2P67 A;  1A02 F;  2XPP A;  2C9N Y;  3F9K C;  2R5D A;  2YO2 A;  1MFZ A;  1MUU A;  2YNY A;  3NFQ A;  5AW3 B;  1HUC A;  5AVW B;  3VYI A;  3M9H A;  3V4Q A;  2XU6 A;  5AVV B;  1OXZ A;  2WPQ A;  5APQ A;  1GD2 E;  1WJT A;  4KHX A;  2Q3I A;  2WT7 A;  1S9K E;  3TNU A;  3NXS A;  5AVQ B;  2E43 A;  3OAK A;  5APX A;  1CZQ A;  3I5C A;  3UIA A;  3A2A A;  1CSB A;  1GK4 A;  3TYY A;  3B8E B;  1CI6 A;  5APW A;  1YYC A;  2W6A A;  3V5B A;  2XPO A;  4RES B;  2R32 A;  1NWQ A;  2WWW A;  5APV A;  2QM8 A;  4I6M C;  4JYB A;  5APU A;  4AYC A;  5AW0 B;  2WT7 B;  3TNU B;  3M0A A;  2WPS A;  4C7N A;  1EO0 A;  1A02 J;  1CI6 B;  4GT1 A;  5AW1 B;  3P32 A;  5AW5 B;  2Z5I A;  3LID A;  1J2J B;  1MV8 A;  2N3A B;  1GTW A;  3LIE A;  1JNM A;  1S9K D;  3VN0 A;  2H7H A;  1H89 A;  1HJB A;  1GK6 A;  5APY A;  3NTN A;  3A5T A;  1FOS F;  1X8Y A;  4EOT A;  1NAF A;  1OWA A;  3V4W A;  4C7N B;  4LC1 A;  5APT A;  5AW9 B;  3VMX A;  4AQR D;  5AVU B;  4M3L A;  5AW6 B;  2VRS A;  3VTP C;  3HE4 A;  5AW4 B;  3KDP B;  5AVZ B;  2KP8 A;  1IO4 A;  2E42 A;  2P7J A;  4AUW A;  4XE5 B;  3IR9 A;  4GKG A;  2XZR A;  3VMY A;  2QM7 A;  1GU4 A;  3L36 A;  3U88 C;  3HPG G;  2ZFC A;  3KQG A;  3A3Y B;  2BAS A;  2R3C A;  5AW8 B;  3L35 A;  2Q7C A;  1H88 A;  1HBW A;  2B4J C;  5AVR B;  1KQL A;  1SP4 A;  2W27 A;  3P7K A;  3M9B A;  1FAV A;  1T2K C;  3HTK A;  3MD0 A;  3O8Z A;  3M91 A;  5AVT B;  2JJL A;  1FOS E;  2Z5H A;  1SLQ A;  4I2L C;  2XPL A;  2WTY A;  2C9L Y;  3SWF A;  3HPH E;  5AVY B;  4HYT B;  3M0D A;  4JYC A;  4B86 A;  3VMZ A; 
#chains in the Genus database with same CATH topology
 2B9B A;  5KKZ C;  4RKU J;  3GG2 A;  1S4X A;  2R5B A;  4NGS A;  1N7S C;  3AE8 C;  2WVR A;  3AE4 C;  3P8M C;  3RBX A;  2POH A;  3L75 G;  1NTK E;  3CCR P;  5B66 H;  3F9K C;  4R4M A;  2YO2 A;  3L75 J;  2WSF J;  2H8P D;  2YNY A;  1EXI A;  3S9M A;  3TGU E;  1AJY A;  1S2E A;  1S3J A;  3C8V A;  1S9K E;  4W9Y A;  2IYO A;  2Y0C A;  2NZ2 A;  1KD1 Q;  2LXC B;  4WVZ A;  3KZI E;  1OIP A;  4JYB A;  4AYC A;  3W68 A;  1EZV I;  2YXQ B;  1GMJ A;  4NGT A;  1A02 J;  3Q5P A;  2J59 M;  2Z5I A;  1T3J A;  2WSC H;  2O1J A;  2ZVN B;  2PP6 A;  3TDK A;  4CPG A;  1NAF A;  2JBJ A;  2PVV A;  4L76 A;  4ZNC A;  4IL6 H;  3VMY A;  2QM7 A;  4D6T D;  1VQ9 P;  1FE6 A;  4MCR A;  1LTI C;  1S1C X;  3HTK A;  3BCC E;  4RR2 B;  4HYT B;  2NPS C;  2UV8 G;  4B86 A;  3B5N C;  1H8A A;  3H1I D;  3HMJ G;  4I1L A;  1N86 A;  3RL0 D;  1BGY D;  3S9L A;  4U3F E;  2M3B A;  1HWT C;  1XTG B;  4UB6 E;  1LT9 C;  4H44 D;  3H32 A;  2OTL P;  3I56 P;  2WZ7 A;  5K5G B;  1PL5 A;  4OC5 A;  1MFZ A;  2KIK A;  3AEG C;  3BUM B;  2CK3 H;  5AVV B;  1KV4 A;  1AQT A;  2KNC A;  1Y47 A;  1OW6 A;  3OAK A;  4DJG A;  1GK4 A;  2KUB A;  2W6A A;  1FZC A;  2R32 A;  2JO1 A;  1GL2 C;  2NRG A;  1X79 B;  2W6J H;  1AV1 A;  2KB7 P;  1EO0 A;  3H1J D;  1VDF A;  2Q3E A;  1VQ8 P;  2A45 I;  3P32 A;  4L73 A;  1G1J A;  3AE3 C;  4BPU B;  1M1J A;  5CHX A;  3WUT A;  1SQX E;  2BCC E;  1DIP A;  5KTB A;  1YIJ P;  1KC8 Q;  4C7N B;  1PP9 E;  1BSN A;  1H0T A;  2BEQ D;  1ZLL A;  3IFM A;  4PV1 C;  3KDP B;  4W7Y A;  5AVZ B;  2P7J A;  1OX3 A;  1FDI A;  1URQ C;  3V2P A;  3AEE C;  3CC4 P;  2JP3 A;  2QIW A;  2E74 C;  3WUV A;  1NU1 G;  3S1K A;  3IWW A;  2K1A A;  3BVH A;  2IBZ D;  1NTM G;  1NU1 J;  2HG5 D;  3U1A A;  3MZW B;  1NTM J;  2JR8 A;  3B71 A;  3L74 G;  2K88 A;  3PLN A;  2KYV A;  1M8O B;  3HD7 C;  2IPP A;  1TU3 F;  3M0D C;  3L74 J;  2YIU B;  3GLM A;  1JEK A;  4N3Y B;  1EZV G;  1GZL A;  3MIW A;  1LTA C;  2SPZ A;  4KJM A;  1T3U A;  1SQQ J;  3OA7 A;  1AQ5 A;  2R5D A;  1BCC G;  1KFN A;  1IFN A;  1U7J A;  1BCC J;  2FXP A;  4WY4 B;  3D6Y A;  3LW5 J;  3L71 J;  1N2D C;  2AXT H;  5APW A;  2E76 C;  3P8C E;  1NTK G;  4JYW A;  1ZRT E;  3L72 G;  1VQK P;  4JQ0 D;  4N78 E;  3QH9 A;  1LP1 B;  3L72 J;  4NPE A;  1E79 H;  3L70 D;  1CI6 B;  1J2J B;  3KHU A;  4LQG A;  3LIE A;  2WMM A;  3V4W A;  3MHV A;  5F13 A;  1G2C A;  3HUS C;  4GIF A;  3CWB D;  3PFV A;  2XND H;  3FGA D;  1T6A A;  2QJP B;  3RK3 C;  1SQB K;  2ITA A;  3O6Q A;  1EDK A;  3A3Y B;  2JBK A;  1PPJ D;  5BY0 A;  4HB1 A;  1T2K C;  5KAF E;  2AEM A;  1FOS E;  4GOD A;  1Q82 Q;  1KYO H;  3E1R A;  1FU1 A;  4YXW H;  2ZT9 D;  1NTZ E;  5AW2 B;  1NU1 K;  3CCS P;  1LWU B;  2XV5 A;  2C0X A;  4DZO A;  3A7O A;  3L73 G;  2I1K A;  1P84 E;  3PT1 A;  1KYO I;  1OVR A;  2A45 G;  1R8E A;  1SQV J;  3L73 J;  4YPC A;  4Y99 B;  1RE3 C;  4H13 D;  2A06 D;  3VYI A;  2IFN A;  1D7M A;  1U57 A;  2Y1N A;  1SQQ K;  1PGQ A;  4WB4 A;  3CCV P;  1K73 Q;  4U3F G;  2YXR B;  2YMY A;  2HR3 A;  1YIT P;  2YKQ A;  3PLF B;  2R44 A;  5J3X A;  1MKM A;  2W6B A;  4I6M C;  1FDM A;  5TIS E;  1ZN5 A;  4RO0 A;  4C7N A;  3VRQ A;  2M5A A;  1LTG C;  1ZOY C;  1KIL E;  1ZP0 C;  3WU2 E;  1Q2N A;  3L4F A;  4DCK A;  4RJT A;  1L0L D;  3PJS K;  5APY A;  1FOS F;  3CXH E;  2XEI A;  4OC1 A;  2IFM A;  1Q7Y Q;  1DE4 C;  1N73 B;  3GMA A;  5APT A;  4PD4 E;  2FYN C;  2QJK B;  3GW6 A;  2G8Y A;  4LLH A;  1SQX G;  2BCC G;  4UB8 E;  1KZU B;  2GM4 A;  1PP9 G;  5AVT B;  1NHL A;  3A0H H;  2B87 B;  1QLE D;  1YTZ T;  3HD7 D;  1M7L A;  2NPS B;  2HFE D;  1YI2 P;  2ZT9 B;  4OC0 A;  3VRO A;  1AFO A;  3MGN A;  4WY4 A;  5AVS B;  2M0B A;  1A02 F;  1RE4 A;  2C9N Y;  1IC2 A;  2RN0 A;  4ASV A;  3L75 D;  5EFW B;  3CXH I;  1HUC A;  3H1K D;  2XU6 A;  3FEE A;  4OH8 B;  1SQV K;  2WPQ A;  1XTC C;  1VQ5 P;  1LP1 A;  3OJA B;  3JSV C;  2E76 D;  2LKM A;  4HKZ H;  1CI6 A;  1VQ6 P;  4ZKP A;  1CW5 A;  1UII A;  3H1H D;  1OW8 A;  3CCU P;  3H1L D;  1KB9 E;  4OC2 A;  1HGV A;  1VPC A;  3A5T A;  1SQB E;  3CX5 E;  1DD3 A;  1IO4 A;  3RK3 D;  2E42 A;  4GKG A;  4BRY B;  3PRJ A;  4BXL A;  2E5T A;  3SWY A;  1LTJ B;  2ZXX A;  2BAS A;  2IDB A;  1URQ B;  2B4J C;  1KQL A;  4GPL B;  1LWU A;  1VF5 C;  1NU1 E;  3VP9 A;  3BRV B;  2ZVO B;  2JJL A;  3V2Q A;  1SQP G;  3D7D A;  2HOD B;  1K05 A;  3ABV C;  2KSE A;  1HTL C;  3L74 E;  3MUD C;  1SQP J;  1JUN A;  5B66 E;  2G3A A;  3BUO B;  1S5L H;  3AE1 C;  2YMK A;  1ZXG A;  1EZV E;  3HD7 B;  1SQQ E;  1LTB C;  3HE5 B;  2XPP A;  2E5Y A;  3R4Y A;  3NFQ A;  1M56 D;  1ZR4 A;  1NTZ G;  3VRN A;  3V6I A;  1BCC E;  2QJY B;  4P4J A;  3L71 E;  1NTZ J;  3CX5 I;  2FBW C;  5L8R J;  2WSE H;  4OC4 A;  1YJW P;  3L72 E;  2E76 B;  1BE3 D;  2L5G B;  2OYI C;  1N73 A;  1EXJ A;  5CBO A;  5BU8 B;  1IK7 A;  3LID A;  4JZ0 A;  2OYO A;  3AE7 C;  3B4S A;  3CME P;  4IL6 E;  1OWA A;  1X9V A;  1R5S A;  1W2B O;  1LTT C;  3RGU A;  3HE4 A;  4OGQ C;  3A0B H;  1QVF O;  2GUV A;  2KP8 A;  1BDD A;  1MZ9 A;  3KAS A;  3CCQ P;  1JOC A;  3KQG A;  2B87 A;  5KLV G;  1KQG B;  3KYQ A;  3RK3 B;  5KLV J;  4N6J A;  3G3Z A;  2OGU A;  1M1K Q;  2NPS A;  2C9L Y;  2OQQ A;  1USE A;  1NTM D;  1Q86 Q;  2YO3 A;  5AXI A;  5HKY A;  4OC3 A;  1G2C B;  3JCU H;  3W67 A;  1SQP K;  3BUW B;  3CCM P;  3CCJ P;  1QEX A;  2E75 D;  4XA4 A;  1SQV E;  3L73 E;  1K8A Q;  2AEF A;  3SFD C;  1OVV A;  3O6Q B;  1MUU A;  3CPW O;  2CPS A;  1QL1 A;  3V4Q A;  1JMM A;  3KZI H;  1HGZ A;  5AVQ B;  1QVG O;  3G6E P;  1RF1 C;  2K37 A;  4LGD E;  1NTZ K;  4Z1M H;  5D29 A;  2CPB A;  1NTK D;  4WY4 D;  2RMZ A;  1QGK B;  4Y28 J;  1IZN B;  4PJ0 H;  1RY3 A;  3PP5 A;  5AW5 B;  3TGU D;  2BEZ F;  2OYH B;  2H88 C;  3CL3 D;  4JBZ A;  5BVZ A;  5CJ4 A;  3K5B A;  1S9K D;  4BRY A;  2OTJ P;  1FZE A;  1L0N J;  2K9Y A;  1LTJ A;  2FYU E;  5AW9 B;  1URQ A;  1EDL A;  2JWA A;  2ZYG A;  3IR9 A;  1Z8L A;  1NVO A;  2K9J B;  2FYN B;  2HOD A;  3BHX A;  5H2F H;  2M3E A;  3IF4 A;  5GTH H;  1RQU A;  1VF5 D;  1RHZ B;  3SSU A;  1SFC D;  1SQB G;  4P4B A;  3AEB C;  1J1D C;  2IBZ I;  2M5A B;  1SQB J;  5CBN A;  1RF0 C;  3HD7 A;  5AVY B;  5KLV K;  3M0D A;  3M06 A;  3HE5 A;  1DH3 A;  1OW7 A;  5KLI B;  4OME A;  3V2R A;  2VKZ G;  2QEX P;  3ZDM A;  1GU5 A;  1M57 D;  3CMA P;  5AVX B;  2C6G A;  2JDI H;  3OW2 O;  1FZC C;  1LJ2 A;  1R5L A;  3BCC D;  4NPD A;  2AXT E;  4EI2 A;  2E75 B;  1OXZ A;  4BTF A;  5CCG C;  2FFD C;  2E43 A;  5DJT B;  2O01 H;  1N7S D;  3AEA C;  3BUX B;  3A2A A;  2KOG A;  4RES B;  1SQQ G;  4U3F D;  5DJU B;  4D6T G;  2GA1 A;  1IFI A;  1L4A C;  4D6T J;  3L71 G;  1MV8 A;  3AE2 C;  2Q6Q A;  4H0L C;  2J58 A;  1QL2 A;  2XDJ A;  1FZG A;  4GOE A;  1LTS C;  2Q1K A;  4LC1 A;  3H1I G;  1JTH B;  4NGN A;  1YVH A;  1YTZ I;  2VRS A;  5CCH C;  1L0N K;  2W8Z A;  4P45 A;  5AW4 B;  2WSC J;  3H1I J;  1NYH A;  1BGY G;  1L2P A;  2KI7 B;  3L36 A;  2Y0D A;  1JY2 P;  1BGY J;  3GHG B;  1KYO E;  2R3C A;  4GOF A;  4ASW A;  1KIL C;  1G1I A;  1H88 A;  4TLF A;  2KS1 B;  2FXO A;  1SQX D;  2BCC D;  2ZYA A;  3JC2 2;  2RH0 A;  4I2L C;  2WTY A;  4JYC A;  1PP9 D;  1SQP E;  1VF5 B;  1SFC B;  3MP7 B;  3TK1 A;  5TJH A;  5C39 A;  1JY3 P;  1IFP A;  1PZQ A;  1K04 A;  2HYN A;  3C9I A;  3BI1 A;  3RK2 C;  2C6C A;  1PGP A;  2ZXE B;  1RE3 A;  2Q5U A;  2Y0E A;  3FWN A;  3H1J G;  2NPS D;  4IL6 X;  2KK7 A;  1WRG A;  2C0W A;  2V7Q H;  3H1J J;  2IYP A;  1FJP A;  3B5N D;  3N7N A;  1WMK A;  5APQ A;  3RBZ A;  5KJ7 C;  1X0T A;  3Q5R A;  3HRN A;  3CCE P;  1U7M A;  3TYY A;  5KKZ B;  1SQV G;  3FWL A;  2OYH A;  3ZNI A;  2WIT A;  1N7S B;  1JY2 O;  1PFI A;  1DD4 A;  3SJE A;  2IBZ G;  2OYI B;  4YTP C;  2H7H A;  3II6 A;  4W7Z A;  1YQ3 C;  2K9J A;  1GL2 D;  3P8C D;  1ZRT D;  4N78 D;  5E79 E;  5KAF H;  5GTI H;  3BAT A;  1JY3 O;  1NOH A;  1SVF A;  5KLV E;  3CI9 A;  2GUS A;  3AEF C;  2FYU G;  3M91 A;  5M1B A;  3SWF A;  2FYU J;  4PV1 D;  1JCC A;  2W83 C;  1P84 H;  1URQ D;  2N1T C;  4C46 A;  1UIX A;  5CMZ A;  3EWK A;  2WSF H;  1FDO A;  4I7Z C;  3BAS A;  2E74 D;  2XPN A;  4R4L A;  3D71 A;  1VQ7 P;  3HE4 B;  1PGJ A;  3L37 A;  1RQV A;  2O01 J;  2PGD A;  1W2E A;  4OVN F;  1NTZ D;  3ITK A;  1OVU A;  3UIA A;  3B5N B;  2XPO A;  1NWQ A;  3CWB J;  1P84 D;  1MFT A;  1RF1 B;  1LT9 B;  1JTH A;  1NO4 A;  3E7K A;  4PD4 H;  3M9Q A;  2XNX A;  5KAI H;  1L0N E;  2IX7 C;  1HJB A;  2YKO A;  4EOT A;  3GHG A;  1KQS O;  1FS0 E;  3AE6 C;  1IFJ A;  2KS1 A;  4UB8 H;  3Q3D A;  2P1J A;  2ZFC A;  4A4B A;  1GL2 B;  2LR2 A;  2AEJ A;  3RL0 C;  1KIL D;  1Q81 Q;  1DX7 A;  1SFC A;  5CJ0 A;  3SJG A;  5AVR B;  1VQP P;  2D2C C;  3BXM A;  1T8Z A;  2A06 G;  3MD0 A;  4H44 C;  3CXH D;  1SLQ A;  3MUD A;  1E5W A;  3S9O A;  1GU4 A;  4PD4 D;  3CD6 P;  1J1D B;  4C7R A;  4K3A A;  2FYU K;  1CX8 A;  4PV1 B;  1T2K D;  1GW3 A;  4JPZ B;  1FZF A;  4MCQ A;  2I1J A;  2E74 B;  3BI0 A;  3WMM 0;  3Q2Y A;  1GD2 E;  3SWK A;  4A7P A;  1DEB A;  1N7S A;  1JB0 J;  2H89 C;  4KT0 J;  1W5C E;  5B5E H;  3V5B A;  2FFD B;  4TT3 H;  1KB9 H;  2MKV A;  2IZ1 A;  2OYI A;  1ZV8 A;  2WT7 B;  3M0A A;  2PFX A;  4D6T E;  3PTZ A;  4GT1 A;  5AW1 B;  1BDC A;  4MN4 C;  1NKZ B;  3A0B E;  1L4A B;  4JF7 A;  3VN0 A;  2P10 A;  3BRT B;  1LWU C;  4H0L B;  3VMX A;  1JM0 A;  1JCD A;  3H1I E;  1BGY E;  1PIX A;  2IZ0 A;  4Y99 C;  5AW8 B;  1HBW A;  1KB9 D;  1HH0 A;  1SP4 A;  1FBM A;  1X22 A;  3H1K G;  1KIL B;  1SQB D;  3H1K J;  3JCU E;  3NMD A;  2N1T D;  3CX5 D;  2P2U A;  3SJF A;  2H43 A;  3I55 P;  3HUS B;  2HPC B;  1B47 A;  2MJZ A;  5APS A;  4IFM A;  1VQN P;  4NGM A;  2JKV A;  1K9M Q;  1BSH A;  3USS A;  3LW5 H;  1Z9E A;  2P67 A;  2C6P A;  3RK2 B;  3H1H G;  1NU1 D;  3H1J E;  3B5N A;  1AVO A;  3H1L G;  2CIJ A;  3PH0 A;  1J1E C;  5AW3 B;  3H1H J;  3H1L J;  1RF1 A;  3L74 D;  1N73 C;  1CZQ A;  1LT9 A;  1VL2 A;  1YBK A;  4PJ0 E;  2QJK C;  4WWI A;  2B89 A;  2WWW A;  3CC7 P;  1EZV D;  1L0L K;  1M90 Q;  1SQQ D;  1VQO P;  3D7G A;  1YQ4 C;  1BCC D;  2B88 A;  1JNM A;  2KLV A;  4NGQ A;  3L71 D;  2IBZ E;  1GK6 A;  1GL2 A;  1HVV A;  5H2F E;  4IFF A;  5GTH E;  3L72 D;  1GDT A;  1FBV A;  2ZT9 C;  2Z4E A;  2XZR A;  1IFM A;  3TF5 A;  1KOR A;  1L0N G;  3L35 A;  2D2C D;  3M9B A;  4P4D A;  1RF0 A;  2WSS H;  1JY2 N;  4H13 C;  3VMZ A;  3Q5S A;  1NKN A;  2DLA A;  2KXP B;  3D70 A;  3EQ2 A;  3OB1 B;  2A45 H;  1IK9 A;  2M8R A;  4W80 A;  5AW7 B;  1YHQ P;  3G9R A;  2N1T B;  1GW4 A;  3AE9 C;  3GF3 A;  1YJN P;  3IN6 A;  1BE3 G;  4I7Z B;  5ELY A;  3C1L A;  3L70 E;  1BE3 J;  5CCG A;  3KPE A;  1JY3 N;  5AVW B;  2FFD A;  4UB6 H;  1FJK A;  4NGR A;  1DEE G;  2L91 A;  2WT7 A;  3VP8 A;  3CC2 P;  1ZR2 A;  3I5C A;  3B8E B;  3CWB E;  4EDF A;  1LTJ C;  1L4A A;  1SQV D;  3L73 D;  3TNU B;  2J5U A;  4IFD K;  4A4C A;  1PPJ E;  2AXC A;  1S5L X;  2O3J A;  2I8D A;  2WSE J;  1WT6 A;  3PHL A;  3RBU A;  4P4F A;  1M1J C;  2QRX A;  5CCH A;  1HJ0 A;  1KN7 A;  4XE5 B;  3F5H A;  3U88 C;  1KIL A;  1NAY A;  4EIJ A;  3Q1M A;  3MTU E;  3P7K A;  1FAV A;  3HUS A;  2HPC A;  2QJY C;  3RL0 B;  2A06 E;  3BUN B;  5F09 A;  4OGQ D;  2D2C B;  2FYU D;  3FED A;  2PRR A;  1AVY A;  4H44 B;  3G71 P;  3RL0 g;  1Y9B A;  2Y9Z A;  1EC5 A;  2FXM A;  1OFC X;  1FZB A;  3H6P A;  2QE7 H;  2N9B A;  1PV3 A;  1NTK J;  5HKW A;  4ZMD A;  3FF3 A;  4BPX B;  2P58 A;  3R2P A;  3TGU G;  5KJ7 A;  4NGP A;  3WUU A;  3FXE A;  3TGU J;  3SFE C;  1WJT A;  3T97 B;  4KHX A;  2Q3I A;  2JWD A;  3OB2 B;  1L0L E;  1YJ9 P;  2RKL A;  4XFJ A;  1CSB A;  3QWO C;  3G4S P;  1OMI A;  4O9B A;  5APU A;  4QMA A;  5AW0 B;  2WPS A;  2KZI A;  3V2N A;  1HF9 A;  2N3A B;  1GTW A;  4WBA A;  2ZJS E;  3GF7 A;  5GTI E;  4EYY Q;  1Z56 A;  5AVU B;  3FX0 A;  5AW6 B;  1N8R Q;  3CLQ A;  1NH4 A;  1NGM B;  1N7L A;  3HPG G;  2Q9I A;  1NTM K;  4NPF X;  1JO5 A;  1Y8A A;  2ZYD A;  4MCS A;  2OR4 A;  3BCC G;  3L75 E;  2OOT A;  3H1K E;  3AE5 C;  1OZH A;  3BCC J;  2N1T A;  1KTM A;  2DW3 A;  1RH5 B;  2WQY C;  3SJX A;  4U7J A;  4OGQ B;  1EDJ A;  3U59 A;  3A0H E;  2JEE A;  4U3F J;  1KYO D;  3S4R A;  2FY8 A;  2CBL A;  1EDI A;  2PVW A;  2QA4 P;  2OYH C;  3EFG A;  1KMI Z;  1QX8 A;  3H1H E;  3KXD A;  3H1L E;  1NTK K;  1SQP D;  3TNU A;  3NXS A;  1J1E B;  4P4E A;  1YYC A;  4P4I A;  2FYZ A;  2QSI A;  3FEC A;  4ZKU A;  3L70 G;  3RK3 E;  5KAI E;  1P84 I;  2QVA A;  3L70 J;  3AEC C;  4L75 A;  5BU5 A;  5CCG D;  1LNQ A;  2Y1M A;  2KSJ A;  2FKW B;  5TIS H;  3N4X A;  2XEF A;  1JMB A;  5E79 H;  1H89 A;  3E1I A;  3NTN A;  1X8Y A;  1SQX J;  3CWB G;  4HH2 A;  2BCC J;  3WU2 H;  4AQR D;  1S72 P;  4M3L A;  1PP9 J;  5KLI C;  2YKP A;  1LGH B;  1L4A D;  1PPJ G;  4AUW A;  3CXH H;  2KLU A;  1IJD B;  3S9N A;  4H0L D;  2Q7C A;  3D7H A;  2W90 A;  2W27 A;  3CCL P;  4DOJ A;  2E75 C;  1LT1 A;  3O8Z A;  2LXB A;  2YIU C;  5CCH D;  2QG4 A;  1ZW0 A;  2WPR A;  4BWN A;  4PD4 I;  2XEG A;  3HTK B;  4H13 B;  4OWF A;  1KQF B;  2O1K A;  2XEJ A;  4MCP A;  1SS1 A;  3T97 A;  5KLV D;  1USD A;  4X3R A;  1EQ7 A;  1BE3 E;  2K3R A;  3H25 A;  1NJI Q;  4K35 A;  4WY4 C;  1S5L E;  1RE4 C;  3M9H A;  5B5E E;  2V4H A;  3F89 A;  3H32 B;  5APX A;  3RK2 D;  2KZJ A;  3VRP A;  2OAR A;  2V7Q J;  3VMA A;  5APV A;  2QM8 A;  2KNC B;  3GHG C;  2Y9Y A;  3U1C A;  3OP0 A;  5KJ7 D;  1KFM A;  1FZA A;  1FC2 C;  1L0L G;  1VQM P;  3D7F A;  1FZC B;  2ZAE B;  4BPW B;  3D6Z A;  1VQ4 P;  1L0L J;  4P44 A;  3AED C;  2R3S A;  1SFC C;  4GDO A;  2HLO A;  2QJP C;  1NTM E;  1Q90 D;  4IOI H;  3VRR A;  3VTP C;  1PGO A;  3IAO A;  2N9Y B;  1M1J B;  4YXD C;  1SQX K;  1VQL P;  5HKZ A;  2O01 N;  3CX5 H;  4DT0 A;  1H0T B;  1ZME C;  3EFF K;  1KB9 I;  1L0N D;  4L74 A;  2UWJ E;  2XKM A;  1AA0 A;  2OTK E;  1IFD A;  4HJG H;  2WPV B;  2Z5H A;  3FXD A;  2XPL A;  3VGO A;  2PAJ A;  3HPH E;  3VOP A;  3TSI A; 
#chains in the Genus database with same CATH homology
 1NKN A;  1SFC B;  1YTZ T;  3HD7 D;  3EQ2 A;  3TK1 A;  2R5B A;  2A45 H;  1IK9 A;  1M7L A;  2M8R A;  4W80 A;  2NPS B;  1JY3 P;  5AW7 B;  1N7S C;  2HYN A;  3C9I A;  3RK2 C;  2HFE D;  2N1T B;  3P8M C;  1GW4 A;  2POH A;  2ZXE B;  1RE3 A;  1AFO A;  3MGN A;  4WY4 A;  2Q5U A;  5AVS B;  1A02 F;  1RE4 A;  2C9N Y;  1IC2 A;  3F9K C;  2YO2 A;  5CCG A;  2NPS D;  3KPE A;  2H8P D;  2YNY A;  1WRG A;  2C0W A;  1JY3 N;  1HUC A;  5AVW B;  2FFD A;  1FJP A;  3B5N D;  2XU6 A;  1FJK A;  4OH8 B;  3N7N A;  5KJ7 C;  1SQV K;  2WPQ A;  1XTC C;  5APQ A;  2WT7 A;  1S9K E;  3VP8 A;  3OJA B;  3HRN A;  1ZR2 A;  3I5C A;  2LKM A;  3TYY A;  3B8E B;  1CI6 A;  2OYH A;  2WIT A;  4JYB A;  4AYC A;  1LTJ C;  1L4A A;  1N7S B;  3TNU B;  4ZKP A;  4IFD K;  1CW5 A;  1A02 J;  1JY2 O;  1PFI A;  2J59 M;  2Z5I A;  1T3J A;  2WSC H;  1WT6 A;  2O1J A;  2OYI B;  2PP6 A;  1HGV A;  1VPC A;  2H7H A;  3A5T A;  1M1J C;  3II6 A;  4W7Z A;  1NAF A;  5CCH A;  1GL2 D;  3P8C D;  4N78 D;  1IO4 A;  3RK3 D;  2E42 A;  4XE5 B;  4GKG A;  3VMY A;  2QM7 A;  3BAT A;  1JY3 O;  3U88 C;  1KIL A;  3SWY A;  1LTJ B;  1NOH A;  1SVF A;  4EIJ A;  2BAS A;  3CI9 A;  1LTI C;  3MTU E;  1URQ B;  2B4J C;  1KQL A;  1LWU A;  2GUS A;  3P7K A;  1FAV A;  3HUS A;  2HPC A;  3HTK A;  3M91 A;  3RL0 B;  3VP9 A;  3BRV B;  2JJL A;  3V2Q A;  3SWF A;  4HYT B;  2NPS C;  2HOD B;  4B86 A;  1JCC A;  1HTL C;  1URQ D;  3B5N C;  1H8A A;  2N1T C;  4C46 A;  5CMZ A;  1JUN A;  2WSF H;  4I1L A;  1N86 A;  3RL0 D;  3BAS A;  2FXM A;  2M3B A;  2XPN A;  1FZB A;  1HWT C;  3HD7 B;  1XTG B;  3HE4 B;  1LT9 C;  3L37 A;  3H6P A;  1LTB C;  3HE5 B;  3H32 A;  2N9B A;  2XPP A;  2WZ7 A;  3R2P A;  1MFZ A;  5KJ7 A;  3NFQ A;  1ZR4 A;  1W2E A;  5AVV B;  1WJT A;  4KHX A;  2Q3I A;  3OAK A;  3UIA A;  1CSB A;  1GK4 A;  3B5N B;  2W6A A;  2XPO A;  1FZC A;  2R32 A;  2WSE H;  1NWQ A;  4O9B A;  5APU A;  1GL2 C;  5AW0 B;  1X79 B;  1RF1 B;  2KB7 P;  2WPS A;  2L5G B;  2OYI C;  1LT9 B;  1EO0 A;  1VDF A;  1N73 A;  2A45 I;  3P32 A;  1JTH A;  5BU8 B;  3V2N A;  1NO4 A;  1G1J A;  3LID A;  3M9Q A;  2N3A B;  2XNX A;  1GTW A;  1M1J A;  5CHX A;  4WBA A;  2IX7 C;  1HJB A;  2YKO A;  5KTB A;  4EOT A;  1OWA A;  3GHG A;  4C7N B;  1IFJ A;  1X9V A;  1Z56 A;  5AVU B;  5AW6 B;  1LTT C;  3HE4 A;  3CLQ A;  1NH4 A;  1ZLL A;  3IFM A;  3KDP B;  4W7Y A;  5AVZ B;  2GUV A;  2KP8 A;  2P7J A;  1MZ9 A;  1URQ C;  3V2P A;  1JOC A;  1N7L A;  3HPG G;  2P1J A;  2ZFC A;  2Q9I A;  3KQG A;  1GL2 B;  1NTM K;  3RL0 C;  1JO5 A;  1KIL D;  1DX7 A;  1SFC A;  3KYQ A;  5CJ0 A;  3RK3 B;  5AVR B;  4N6J A;  1T8Z A;  3G3Z A;  3MD0 A;  2NPS A;  3BVH A;  1SLQ A;  3MUD A;  2HG5 D;  1E5W A;  2N1T A;  2C9L Y;  3U1A A;  1GU4 A;  2KYV A;  3HD7 C;  2IPP A;  2YO3 A;  1J1D B;  3M0D C;  4C7R A;  2FYU K;  1G2C B;  4N3Y B;  3U59 A;  2JEE A;  1GZL A;  1SQP K;  3MIW A;  1T2K D;  1GW3 A;  1LTA C;  4XA4 A;  1FZF A;  1T3U A;  2I1J A;  2OYH C;  3OA7 A;  3EFG A;  1AQ5 A;  2R5D A;  1MUU A;  3WMM 0;  2CPS A;  1KFN A;  1QL1 A;  3V4Q A;  1JMM A;  1IFN A;  1NTK K;  1GD2 E;  1DEB A;  1N7S A;  1HGZ A;  3NXS A;  5AVQ B;  4WY4 B;  3TNU A;  1N2D C;  1J1E B;  5APW A;  1RF1 C;  1YYC A;  2FYZ A;  3V5B A;  3P8C E;  4LGD E;  1NTZ K;  2FFD B;  4ZKU A;  4N78 E;  2OYI A;  2CPB A;  1ZV8 A;  4WY4 D;  2WT7 B;  3M0A A;  1RY3 A;  5BU5 A;  5CCG D;  1CI6 B;  3PP5 A;  4GT1 A;  5AW1 B;  5AW5 B;  2KSJ A;  2OYH B;  2FKW B;  1J2J B;  3CL3 D;  3LIE A;  3N4X A;  5BVZ A;  5CJ4 A;  1NKZ B;  1S9K D;  1L4A B;  4JF7 A;  3VN0 A;  1FZE A;  1H89 A;  3E1I A;  3NTN A;  1X8Y A;  4HH2 A;  1LTJ A;  3V4W A;  1G2C A;  3BRT B;  1LWU C;  5AW9 B;  3HUS C;  3VMX A;  4AQR D;  4GIF A;  4M3L A;  1JCD A;  1URQ A;  2YKP A;  1LGH B;  1L4A D;  4AUW A;  3IR9 A;  3RK3 C;  1SQB K;  3A3Y B;  2HOD A;  1IJD B;  4Y99 C;  5AW8 B;  2Q7C A;  1HBW A;  1HH0 A;  1SP4 A;  2W27 A;  1FBM A;  1SFC D;  4DOJ A;  1T2K C;  3O8Z A;  1J1D C;  1FOS E;  1KIL B;  1RF0 C;  5CCH D;  3HD7 A;  5AVY B;  5KLV K;  1FU1 A;  3M0D A;  2WPR A;  3M06 A;  3NMD A;  2N1T D;  3HE5 A;  1DH3 A;  5AW2 B;  2P2U A;  2H43 A;  1NU1 K;  1LWU B;  3HUS B;  2HPC B;  2MJZ A;  3HTK B;  2XV5 A;  5APS A;  2C0X A;  2O1K A;  4IFM A;  3V2R A;  4DZO A;  3A7O A;  3T97 A;  2I1K A;  1GU5 A;  5AVX B;  3LW5 H;  1Z9E A;  1EQ7 A;  2A45 G;  2P67 A;  1FZC C;  3RK2 B;  4Y99 B;  1RE3 C;  3B5N A;  4WY4 C;  1J1E C;  5AW3 B;  3VYI A;  1RE4 C;  3M9H A;  2IFN A;  1OXZ A;  5CCG C;  1SQQ K;  2FFD C;  1RF1 A;  4WB4 A;  2E43 A;  1N73 C;  3H32 B;  2O01 H;  5APX A;  1CZQ A;  1N7S D;  3RK2 D;  1LT9 A;  3A2A A;  2YMY A;  2KOG A;  2YKQ A;  4RES B;  2OAR A;  2W6B A;  2WWW A;  5APV A;  2QM8 A;  4I6M C;  1L0L K;  1FDM A;  3GHG C;  3U1C A;  1ZN5 A;  1IFI A;  4C7N A;  1L4A C;  1LTG C;  1KFM A;  5KJ7 D;  1FZA A;  1FZC B;  1MV8 A;  3L4F A;  1JNM A;  2J58 A;  2KLV A;  1QL2 A;  2XDJ A;  1GK6 A;  5APY A;  1FOS F;  1SFC C;  2IFM A;  1GL2 A;  2HLO A;  1FZG A;  1HVV A;  1LTS C;  1N73 B;  4LC1 A;  5APT A;  1JTH B;  1YTZ I;  2VRS A;  3VTP C;  4IFF A;  5CCH C;  1L0N K;  5AW4 B;  1M1J B;  1GDT A;  1SQX K;  2Z4E A;  2XZR A;  1IFM A;  3L36 A;  1JY2 P;  3GHG B;  4LLH A;  2R3C A;  3L35 A;  1KIL C;  1G1I A;  1H88 A;  1KZU B;  2GM4 A;  3M9B A;  1RF0 A;  2XKM A;  5AVT B;  1IFD A;  1NHL A;  2Z5H A;  4I2L C;  2XPL A;  2WTY A;  2PAJ A;  3HPH E;  1JY2 N;  3VOP A;  4JYC A;  3VMZ A;  3TSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...