3O8ZA

Crystal structure of spn1 (iws1) core domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
152
structure length
152
Chain Sequence
DPFTDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and biological importance of the spn1-spt6 interaction, and its regulatory role in nucleosome binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcription factor IWS1
total genus 60
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3o8zA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3o8zA02
3U88C 2R32A 4I6MC 3NMDA 5APSA 3F9KC 1NAFA 5AVWB 1HBWA 3B8EB 1CSBA 1J2JB 1HUCA 1MV8A 3L36A 3TNUB 5APVA 5AVZB 3V4WA 4EOTA 2C9NY 5AW4B 1GK4A 2VRSA 5AW5B 4C7NB 3HPGG 2WPQA 2WT7A 2YNYA 1H8AA 1GZLA 2KP8A 2N9BA 2WTYA 2R3CA 3HPHE 5AW3B 3A2AA 3UIAA 2Q7CA 1KQLA 4AQRD 4GKGA 3I5CA 2XPOA 1CZQA 3NFQA 5AVXB 2XU6A 5AW6B 2XV5A 5AVUB 1DH3A 1FOSF 5AVSB 1X8YA 4B86A 3KDPB 2E43A 2XZRA 4JYCA 2BASA 5CMZA 1MFZA 2WPSA 1T2KD 3M9HA 3HE4B 3O8ZA 2ZFCA 2QM8A 3OAKA 3IR9A 4LC1A 3MGNA 3M0AA 3VMYA 3VMXA 2WT7B 1H88A 2YO3A 1HWTC 2Z5IA 3NXSA 2B4JC 3M0DA 5AVYB 3L35A 4AUWA 2Q5UA 4AYCA 1S9KE 2XPPA 5AVQB 1FAVA 5AW2B 4KHXA 5APWA 5AW0B 2ZXEB 3NTNA 2Q3IA 5APYA 2XPNA 1G2CB 2IPPA 1OXZA 3M9BA 2Z5HA 3HE4A 2QM7A 1A02F 2N3AB 1CI6A 1S9KD 5AVTB 2R5BA 2C9LY 3SWFA 1HJBA 5APUA 1GU5A 1SP4A 2JJLA 3HE5B 1GTWA 1FOSE 3TYYA 3LIEA 3A5TA 1T2KC 5APTA 3A7OA 3LIDA 1EO0A 2P67A 2WPRA 1A02J 4HYTB 2P2UA 1GD2E 4XE5B 3TK1A 1GU4A 3V5BA 5AW1B 3VN0A 1YYCA 2W6AA 1H89A 1NWQA 2R5DA 5AW8B 1OWAA 2E42A 3TNUA 3A3YB 1IO4A 2WWWA 3L37A 5AVRB 4GT1A 3VYIA 1CI6B 2YO2A 3P8MC 1MUUA 4M3LA 5AVVB 5AW9B 3VMZA 4C7NA 5APXA 3P32A 2XPLA 1SLQA 4DZOA 1GK6A 2W27A 1JUNA 3HE5A 3HTKA 5APQA 3T97A 3V4QA 4C46A 1WJTA 3VTPC 2P7JA 1Z9EA 4I2LC 4JYBA 4RESB 1JNMA 3MD0A 2H7HA 3KQGA 3M91A 3M06A 5AW7B 3P7KA
chains in the Genus database with same CATH superfamily
2KIKA 2YKQA 4I6MC 2K1AA 3BRVB 5H2FH 4EOTA 4LQGA 4IL6X 2XDJA 2JP3A 1QVGO 1SQPD 2P1JA 3FXDA 1M7LA 1ZV8A 1VQ7P 1AA0A 3WUUA 2O1JA 4IL6H 4GKGA 3G3ZA 3L72G 4Y99C 1S4XA 1SQVJ 2K9YA 3U1CA 1PGQA 5AVUB 1FOSF 3BUOB 1AVYA 1MFTA 1OMIA 5CJ0A 1NTME 1L0LJ 2WPVB 4OC3A 2OYHB 4H44D 3VMXA 3CXHE 2E75C 2N1TD 1KYOE 1L0NG 4AYCA 1EC5A 2W6JH 1BSHA 1BGYJ 2LXBA 3V2PA 1YTZT 2FXOA 4TLFA 3WMM0 2LKMA 5APUA 3CCSP 3JCUH 1DD4A 3D7DA 4YXWH 2QEXP 2XKMA 1YYCA 1QGKB 4NGMA 1ZRTE 4U3FD 2R5DA 3VOPA 1LTBC 1NTZK 3A0BH 4N6JA 1L0NK 3H1IJ 2FYZA 3T97A 1SQVG 3MD0A 2H7HA 1GL2D 4PD4D 4K35A 1L0LK 4L76A 2OYOA 2B87B 3NMDA 4JZ0A 1CSBA 4JYWA 2IBZE 2QRXA 1EQ7A 3U59A 3RK3C 1LT1A 3CMEP 3RL0C 1FJPA 5M1BA 2KK7A 1IK9A 2Y0DA 2YNYA 4OC5A 1S3JA 2YKOA 1OVRA 1NTMG 5KLIB 5H2FE 1OIPA 3S9LA 2O01H 2MJZA 5E79E 4P4DA 2QIWA 3V2RA 1Z8LA 1EXJA 1AQTA 2ZYGA 4GPLB 1E5WA 1SS1A 5KAIH 2GUVA 3CC7P 3NXSA 2OGUA 1AVOA 3MP7B 1JY3N 1LWUA 2OYIA 1JY2N 2MKVA 3L73G 1L0LG 2HPCA 2WSCJ 5AVTB 4DJGA 2JBKA 2E75B 3T97B 2ZT9C 3H1LD 1USDA 2K88A 4XE5B 3MTUE 3KXDA 3H1LG 1EZVE 2IBZD 1ZRTD 2B9BA 5BVZA 1PIXA 1QLED 5CBNA 3P8MC 4C7NA 1KB9E 2OTLP 1SQPK 1GL2C 1ZMEC 3CCMP 2A06D 2SPZA 1SLQA 1FDMA 1GK6A 1YITP 5CCHD 4PV1D 1WJTA 2P7JA 2JEEA 1JCDA 1FZBA 4OMEA 2V7QH 1RF0A 3HUSA 4OC1A 1HBWA 3CL3D 3CXHD 3KYQA 5CCGD 4P4IA 1M1KQ 1SQVK 2KI7B 2YXRB 2WT7A 4H44C 3GMAA 2L5GB 3A2AA 5BU8B 2P58A 1DEBA 2BCCE 1IFNA 2FYUG 3KDPB 4JYCA 1MFZA 3VROA 2JWDA 1BE3G 1URQA 1BCCJ 4L74A 2A06G 1KMIZ 3M0DA 2GM4A 1T3JA 2QE7H 1NTKE 3H1JG 1KN7A 1FZCB 1S9KD 2WSEH 1BGYE 2XEFA 3O6QA 1SQBG 5KKZC 3HD7B 2C0XA 1SQPE 5APTA 2JBJA 3AE1C 3RBUA 1Q81Q 1GU4A 3EFGA 1JCCA 3HUSB 1KQSO 5KAFE 3A0BE 2E42A 4H0LC 2WWWA 1ZOYC 1L0LE 3CXHI 4M3LA 1OFCX 3SJFA 2Q6QA 1RF1C 1AQ5A 3BCCJ 1PP9D 1R8EA 3AEBC 2L91A 2ZT9D 3F9KC 2BCCD 4EIJA 3CWBE 4PV1C 1D7MA 1VQ9P 4L73A 3H1KJ 2VRSA 4Z1MH 4LLHA 1KD1Q 2IX7C 4U3FG 3FEDA 1FJKA 2ZYAA 1EDKA 2CK3H 1NU1G 1HGZA 2D2CD 4IOIH 1NTZE 4DT0A 1HF9A 2FYNC 2ZVOB 3CCJP 4WY4A 3BUXB 3CC4P 3D6YA 2IBZI 1S72P 4B86A 5KAFH 4YTPC 2Q1KA 1IFMA 3L73D 1NOHA 4A4BA 2POHA 3TDKA 1VQNP 2AEMA 1Y47A 3D71A 2WMMA 1VF5C 1A02F 2Y1MA 2DLAA 2JKVA 3RK3B 2KSEA 3ZNIA 2E76B 1EO0A 3G6EP 1GMJA 1JMBA 5CBOA 2KSJA 1W2EA 3CPWO 4P45A 4P44A 3EQ2A 1NKNA 4EI2A 2RKLA 4D6TG 1MZ9A 4RKUJ 1GDTA 3C1LA 3L37A 4GT1A 1PFIA 5APXA 2XPLA 1EXIA 1AFOA 1KILD 4IFMA 1NAYA 1Z9EA 1VDFA 3B71A 2OR4A 1SQQG 1OW6A 1FZFA 3GHGB 1XTGB 5APSA 3MIWA 2E76C 5APVA 1KB9I 1QX8A 1PGPA 1R5SA 2OARA 2FFDB 4UB8H 1SFCD 2WSSH 3RK2D 2PFXA 2KP8A 3CLQA 2Q7CA 1KQLA 1RE4A 4A7PA 4LGDE 1PPJE 3OB2B 1NTKK 3EWKA 1J1EB 3RGUA 5KLVK 2WPSA 2KNCB 1LNQA 2ZFCA 2OTJP 1RE3A 1N73B 4LC1A 2OYHC 3GW6A 3HD7C 1NTZG 2B4JC 4OGQB 3MHVA 3CD6P 3OJAB 3S1KA 2JR8A 2Z5HA 1Q7YQ 3CCEP 1SP4A 3VRRA 3TYYA 1K73Q 1S5LX 2YMYA 3MUDA 2NRGA 5L8RJ 3LW5H 1JEKA 2IBZG 1M56D 4HH2A 3F89A 3CX5D 3CCVP 1SQXJ 1ZN5A 2LR2A 1CI6B 1VQ6P 1NTMJ 4OGQC 4N78D 1IFIA 1VL2A 1FS0E 4I2LC 3M06A 1IFJA 1N7LA 3Q2YA 1P84E 5GTIE 2R32A 1YHQP 1SQBE 3RK2B 2KNCA 2NZ2A 2VKZG 1MKMA 4XA4A 4MCRA 1K05A 1FZCC 2HLOA 1S2EA 1CZQA 3FF3A 3CX5E 4Y99B 2FFDC 1DH3A 3PJSK 3M9QA 5GTHE 3CCQP 3BRTB 4NPFX 3FWNA 4NGNA 3M0AA 1RE3C 3AEAC 3R4YA 3RK2C 3PT1A 1SQXG 4WY4B 1DD3A 5AW0B 5KLVD 3G4SP 2XNDH 2E76D 3NTNA 1YQ3C 1OXZA 3E1IA 1T3UA 3PLNA 1WRGA 3VRPA 5BU5A 5TISH 3AE3C 2JJLA 2H43A 2WZ7A 4U3FJ 3C9IA 1ZXGA 2O1KA 1HGVA 1N73C 1NKZB 1SQBK 1ZP0C 3VP9A 3MUDC 3TNUA 3VYIA 3CCUP 2YO2A 3H1HE 3CCRP 1LP1B 1GL2B 1JUNA 5APQA 4YPCA 3RL0B 2BEZF 1LT9C 3K5BA 5CJ4A 1L0NE 3TGUG 2UWJE 1FBMA 4GDOA 2W90A 2H89C 3B4SA 3M0DC 3V4WA 4ZKPA 5B5EH 1OZHA 2JO1A 3B5NC 1VQOP 3ABVC 2FY8A 4NGRA 1URQB 3QH9A 5TJHA 1H0TB 3H25A 3GG2A 4P4BA 2XPOA 2PP6A 3NFQA 4YXDC 3L74D 4MCQA 1RE4C 1VQMP 1K9MQ 2FFDA 2NPSC 2GA1A 3CX5H 3VMYA 5CHXA 3TF5A 3HD7A 5GTHH 3AE6C 4NGSA 1JY3P 5APWA 2PVVA 2Q3EA 1M57D 2M8RA 2XEIA 2IYOA 2E5TA 1PGJA 2O3JA 2XEJA 3PTZA 2V7QJ 1GL2A 3W68A 3V6IA 2E75D 2M5AA 1LTIC 2IZ1A 3VN0A 2J59M 3VRNA 1JTHA 1EDJA 1FDIA 3H32A 1DE4C 1OWAA 2AEFA 1NU1J 4EDFA 2Y9YA 2IZ0A 1LT9A 1H0TA 4ZMDA 2PAJA 1S1CX 3KQGA 1NTZJ 3L71G 3M91A 1QVFO 4A4CA 2QJKC 4I7ZB 3ZDMA 1HJ0A 1NAFA 4ZNCA 2C9NY 4IFDK 3G9RA 5AW4B 4C7NB 4L75A 4O9BA 4W80A 1EZVG 3D6ZA 4N3YB 3HPHE 4PJ0E 1DX7A 1W2BO 2ZVNB 3H1LJ 2FBWC 3HE4B 2CPBA 2QJKB 3FEEA 1VQLP 4PD4H 1BDDA 2M5AB 1NYHA 4R4MA 5AVYB 4AUWA 1NO4A 1U57A 1NTKD 1PPJG 3RL0g 3VMAA 4UB6H 1NTKJ 1RH5B 1U7MA 1A02J 4BPUB 1J1EC 5ELYA 3D7HA 3GHGA 2FYUD 1RF0C 3HUSC 1H89A 3VP8A 2JWAA 3KPEA 5D29A 1QEXA 3GF3A 1UIIA 2RMZA 2FYUJ 3VGOA 4PD4E 2K9JB 3HTKA 4KJMA 2NPSB 1SFCC 1RF1B 1BE3D 4H44B 4TT3H 4P4FA 3AECC 1BCCG 1M1JB 2FYNB 1IC2A 5AVWB 3SJXA 1MV8A 4BRYB 5AVZB 1KYOI 2PRRA 3EFFK 1KFMA 1URQC 1X79B 3IWWA 1SQQJ 5K5GB 4W7YA 2AXTE 1N2DC 3BCCE 1JY3O 3KASA 4MN4C 5AVSB 2E43A 2XZRA 2FYUE 3BXMA 3Q5RA 1KYOD 3BVHA 2WSFJ 1K04A 4OWFA 4HJGH 1R5LA 1LTGC 3L35A 2YKPA 3WUTA 1IK7A 5AVQB 2FYUK 2FXPA 3CXHH 1T6AA 3BATA 2C6PA 1NH4A 3A0HE 1JY2P 2QM7A 1N7SD 1QL1A 2IFMA 2A45I 2R5BA 2C9LY 1KILE 1FC2C 1BGYD 3HTKB 1FOSE 4MCPA 1T2KC 3H1KG 1RF1A 1L4AA 3L71E 2WQYC 2RN0A 2D2CB 3V5BA 3H1KD 3H1JD 5HKZA 4BRYA 5CCHA 5AW9B 2UV8G 4PV1B 2BEQD 4JPZB 2P10A 3P8CD 4IFFA 2QJYC 3D7GA 3GF7A 3IFMA 3W67A 2ZJSE 1ZR2A 3CX5I 3PFVA 2KLUA 1ZLLA 1KB9H 2WPQA 3BHXA 2WTYA 1LT9B 1ZW0A 5F13A 3JC22 3L70G 3AE7C 3V2QA 3MZWB 5BY0A 1X8YA 5HKYA 3S4RA 2A45G 2BASA 4OVNF 5CMZA 2XEGA 2OOTA 3U1AA 4HKZH 2RH0A 3D70A 2A06E 2Z4EA 4DCKA 1L4AB 4I1LA 3H1IG 1KQGB 4R4LA 2Q5UA 1VQ4P 3Q3DA 2HFED 1HVVA 3S9OA 1KILB 2IFNA 4IL6E 4KHXA 5F09A 3D7FA 3IAOA 2GUSA 2WVRA 1PP9E 3HMJG 2HG5D 1YJWP 1LP1A 1GU5A 3I55P 4UB6E 3A5TA 5HKWA 2QA4P 2QG4A 1HH0A 3SFEC 1IFDA 3L75G 4K3AA 2ITAA 1JY2O 4NGTA 1X9VA 1L4AC 3A3YB 2W83C 1DEEG 1VQ5P 3P8CE 1Q90D 1LGHB 4DZOA 1KYOH 3V2NA 3VTPC 1VF5B 1KORA 3AE4C 1YTZI 3SFDC 3RBXA 4W9YA 2YXQB 1SQQK 4NGQA 3H1JE 2OQQA 3H1KE 3SWYA 4BPWB 1JM0A 1YBKA 2M3BA 3CWBJ 1LTTC 2YMKA 2NPSA 4GOFA 1QL2A 1G1IA 3TGUJ 2IYPA 3H1HD 2KB7P 2KZIA 2KZJA 3BCCD 3SSUA 3L75D 3H1HJ 3M9HA 4ASVA 3R2PA 2J5UA 2R3SA 3BUNB 3L75J 1RQVA 2Z5IA 3L70J 2DW3A 2B89A 1SQPJ 4U3FE 2ZXEB 2E5YA 2QVAA 2IPPA 1FDOA 3B5ND 1LTJC 2C6GA 1W5CE 1N7SB 4WBAA 2K37A 1IFPA 1GTWA 1KB9D 3CC2P 3L4FA 2P2UA 3L72J 5AW1B 1BCCE 5DJTB 1EZVD 4H0LB 1K8AQ 3FWLA 2Y0CA 3PLFB 3H1LE 1MUUA 4JBZA 4NGPA 2W27A 4C46A 3IN6A 1SQVE 1UIXA 2YIUC 2E74B 1JOCA 3JCUE 3RL0D 1NVOA 3TGUE 2O01N 3P7KA 4XFJA 1SVFA 2N9YB 3TNUB 3L70D 5AW5B 3H1JJ 4D6TD 1SQPG 1RY3A 4OC2A 3UIAA 4DOJA 1NHLA 1KQFB 5AVXB 2XU6A 2QSIA 3KHUA 4U7JA 3LW5J 2E74C 2KS1B 2YIUB 1OVVA 2FKWB 1HTLC 4NPDA 2I8DA 3OAKA 5KJ7C 3IR9A 1N7SA 1GW4A 1NJIQ 3CMAP 4RJTA 2AXTH 1DIPA 4BTFA 2XPNA 1G2CB 1BDCA 1PP9J 2N3AB 4KT0J 3SWFA 4QMAA 2K9JA 1T8ZA 3SJGA 3HD7D 3E7KA 1M1JA 1NU1D 1KILA 1Q2NA 2B87A 1NWQA 3BUWB 3A0HH 2I1KA 3C8VA 1PPJD 1RHZB 3N4XA 3GHGC 1X0TA 3VMZA 3FGAD 1LTSC 3H6PA 1NTKG 3L74J 2G8YA 2C6CA 5EFWB 1M8OB 1PL5A 1YVHA 3H1ID 5TISE 1JTHB 1VPCA 3L73J 2N1TA 1OVUA 5CCHC 3S9MA 3FX0A 3H32B 4JF7A 3WUVA 1CW5A 4W7ZA 5KJ7D 4JQ0D 1YJ9P 4BPXB 1EDIA 1GK4A 3ITKA 4OH8B 3OW2O 1FZGA 4OC4A 1CX8A 2A45H 1GZLA 4BWNA 4X3RA 3BUMB 1YJNP 4RO0A 1NTMD 1L0NJ 4HB1A 3BASA 3KZIH 1VQKP 2CBLA 3L74E 2Y0EA 3N7NA 3RBZA 1T2KD 4RR2B 2HR3A 1PGOA 2IDBA 1N7SC 3MGNA 5KLIC 5KJ7A 3B5NA 3QWOC 1H88A 1LTJB 3SJEA 4BXLA 1KFNA 4GODA 3FXEA 3L71J 5AXIA 2W8ZA 3Q5PA 1GW3A 3HE4A 3L71D 3AEDC 4WWIA 2C0WA 4Y28J 4C7RA 2M3EA 1KC8Q 1FZEA 5DJUB 3CWBG 1OW8A 3LIEA 3A7OA 2WPRA 3TK1A 1KILC 2J58A 2N1TB 3PHLA 4WB4A 1IO4A 1BE3J 1IJDB 4PJ0H 2D2CC 1URQD 1BGYG 3OA7A 2KLVA 3SWKA 4GIFA 4JYBA 4RESB 1JNMA 1SQXD 1PZQA 4H13C 2WSCH 3RK3E 1SQQE 1NU1K 1M90Q 3I56P 5KLVE 1S5LH 2AXCA 2KUBA 3OP0A 1FU1A 1RQUA 3L36A 1SQQD 1VF5D 2HYNA 2AEJA 1SQBJ 1AJYA 1JO5A 4H13B 1IZNB 2XNXA 1LTJA 5AW3B 1YQ4C 2CIJA 1L0LD 1USEA 3I5CA 2G3AA 1E79H 1BE3E 1FZCA 1FZAA 3TSIA 2BCCG 1P84I 2R44A 1HWTC 3USSA 1Y8AA 3L72E 1S9KE 4EYYQ 1NTMK 3BI1A 3Q1MA 3F5HA 4WY4D 4H0LD 1JB0J 2KS1A 1LTAC 2KOGA 4N78E 2ZAEB 4OGQD 1L2PA 3CCLP 2P67A 1JMMA 4HYTB 3L70E 1U7JA 2N1TC 3FECA 2W6AA 5KTBA 1KV4A 1SQBD 1LWUB 2OYIB 4GOEA 1G2CA 5B66H 2B88A 3L72D 1P84D 2K3RA 2I1JA 5KAIE 1SQVD 3PH0A 3V4QA 3II6A 1EDLA 2WSEJ 5AW7B 1PV3A 3AEEC 2H88C 1J2JB 2HODA 1HUCA 1WMKA 1PP9G 2OYHA 1G1JA 1FE6A 1Y9BA 1H8AA 2N9BA 3IF4A 5KLVJ 2W6BA 4OC0A 4AQRD 4D6TJ 2WITA 5AW6B 2XV5A 5B66E 4ZKUA 2E74D 5CCGC 5B5EE 3AEFC 1NU1E 1Q82Q 1SQXE 2QM8A 1Z56A 1N86A 2WT7B 1AV1A 2QJPB 4WY4C 2OTKE 1XTCC 5APYA 1WT6A 1BSNA 3AE2C 3JSVC 1TU3F 1HJBA 2FXMA 4NPEA 2PVWA 3B5NB 1J1DB 1SQXK 5KKZB 1GD2E 1ZR4A 2Q9IA 2QJYB 2ZYDA 3VRQA 3BI0A 2HODB 4H13D 5AVRB 5AVVB 2CPSA 3P32A 3PP5A 3O6QB 3HE5A 1NGMB 2ZT9B 2NPSD 4D6TE 2WSFH 3OB1B 2KXPB 1LWUC 2OYIC 3AEGC 3S9NA 3PRJA 3U88C 1FBVA 2O01J 3B8EB 5C39A 3WU2H 1S5LE 3HRNA 1SFCB 4MCSA 3TGUD 2LXCB 1N73A 3HPGG 2PGDA 2Y9ZA 1X22A 3L73E 2R3CA 1N8RQ 3GLMA 2JDIH 4I7ZC 3BCCG 3AE9C 5E79H 3H1IE 5CCGA 1BCCD 1L0ND 3O8ZA 2KYVA 2HPCB 1P84H 1EZVI 1OX3A 5GTIH 5J3XA 3AE5C 5KLVG 2YO3A 1OW7A 1YIJP 1KZUB 4PD4I 4P4JA 3WU2E 2H8PD 2XPPA 3CI9A 2V4HA 1FAVA 2M0BA 5AW2B 2Q3IA 1B47A 3L74G 3RK3D 3M9BA 4ASWA 4CPGA 1CI6A 2Y1NA 1NTZD 3HE5B 1J1DC 3E1RA 3LIDA 1Q86Q 3AE8C 3Q5SA 4P4EA 2QJPC 3L75E 3CWBD 1YI2P 1L4AD 5AW8B 1KTMA 1VQPP 1LJ2A 3KZIE 3H1HG 1SFCA 1M1JC 3G71P 2BCCJ 1VQ8P 2ZXXA 4WVZA 4UB8E
chains in the Genus database with same CATH topology
1VPCA 5CCHC 2N1TA 2YKQA 1XTGB 5APSA 4I6MC 3H32B 1IC2A 5AVWB 3BRVB 4JF7A 3MIWA 1MV8A 1CW5A 5APVA 5AVZB 4EOTA 4W7ZA 5KJ7D 2OARA 2FFDB 1KFMA 1URQC 1GK4A 1X79B 4OH8B 2XDJA 1SFCD 1FZGA 2P1JA 3RK2D 2A45H 1GZLA 2KP8A 1M7LA 1ZV8A 3CLQA 2O1JA 2Q7CA 1KQLA 1RE4A 4GKGA 3G3ZA 4W7YA 4LGDE 3BASA 4Y99C 1N2DC 3U1CA 5AVUB 1JY3O 1FOSF 5AVSB 1NTKK 2E43A 1J1EB 2XZRA 5CJ0A 3N7NA 5KLVK 2WPSA 1T2KD 2ZFCA 1RE3A 3BVHA 2OYHB 1N73B 4LC1A 3MGNA 1N7SC 2OYHC 3VMXA 5KJ7A 3B5NA 1H88A 3HD7C 1LTJB 2B4JC 1KFNA 1LTGC 2N1TD 3L35A 4AYCA 2YKPA 5AVQB 2FYUK 3OJAB 3BATA 1GW3A 3V2PA 1NH4A 1YTZT 2Z5HA 3HE4A 1JY2P 2QM7A 1N7SD 1QL1A 2IFMA 2A45I 2R5BA 3WMM0 2C9LY 2C0WA 2LKMA 5APUA 4C7RA 1SP4A 1FZEA 3HTKB 1FOSE 3TYYA 3LIEA 1T2KC 1RF1A 3A7OA 1L4AA 2YMYA 3MUDA 2WPRA 3TK1A 2XKMA 3V5BA 1YYCA 1KILC 2J58A 3LW5H 2N1TB 4HH2A 2R5DA 4WB4A 1IO4A 3VOPA 1LTBC 1NTZK 4N6JA 1ZN5A 5CCHA 1CI6B 1IJDB 5AW9B 1L0NK 4N78D 1IFIA 1URQD 2FYZA 3OA7A 2KLVA 3T97A 4GIFA 4I2LC 4JYBA 4RESB 1JNMA 3MD0A 2H7HA 1GL2D 2WSCH 1L0LK 3P8CD 3M06A 4IFFA 1NU1K 1IFJA 1N7LA 3IFMA 2R32A 3NMDA 1ZR2A 1CSBA 1FU1A 3L36A 1EQ7A 3RK2B 3U59A 3RK3C 1ZLLA 1FJPA 2HYNA 3RL0C 4XA4A 1JO5A 2WPQA 1IK9A 2YNYA 1FZCC 2WTYA 1LT9B 2XNXA 2HLOA 1LTJA 2YKOA 5AW3B 2O01H 3I5CA 1CZQA 2MJZA 3V2QA 4Y99B 2FFDC 1DH3A 1X8YA 3V2RA 3M9QA 2A45G 2BASA 5CMZA 3BRTB 1FZCA 3U1AA 1FZAA 1E5WA 3M0AA 3TSIA 1RE3C 2Z4EA 2GUVA 1HWTC 3NXSA 3RK2C 1L4AB 4I1LA 2Q5UA 1S9KE 2HFED 1HVVA 4WY4B 1KILB 1NTMK 2IFNA 4KHXA 5AW0B 1JY3N 3NTNA 1LWUA 4WY4D 1JY2N 2OYIA 1OXZA 3E1IA 1T3UA 1WRGA 2GUSA 2HPCA 2HG5D 5AVTB 1LTAC 5BU5A 1GU5A 2KOGA 2JJLA 4N78E 2H43A 3A5TA 2WZ7A 2P67A 1JMMA 3C9IA 4HYTB 1HH0A 4XE5B 2O1KA 1HGVA 1IFDA 1NKZB 1N73C 3MTUE 2N1TC 2W6AA 1JY2O 1SQBK 5KTBA 5BVZA 3VP9A 1LWUB 2OYIB 1G2CA 1X9VA 1L4AC 3TNUA 3A3YB 3VYIA 2YO2A 3P8MC 3P8CE 2I1JA 4C7NA 1SQPK 1GL2C 1SLQA 1LGHB 4DZOA 1FDMA 1GL2B 1GK6A 1JUNA 5APQA 3RL0B 3II6A 3V2NA 3V4QA 5CCHD 1WJTA 3VTPC 2P7JA 1LT9C 5CJ4A 2JEEA 1JCDA 1FZBA 5AW7B 3HUSA 1RF0A 1FBMA 1YTZI 1HBWA 3CL3D 1J2JB 2HODA 1HUCA 3M0DC 1SQQK 3V4WA 4ZKPA 3SWYA 5CCGD 3KYQA 3B5NC 1SQVK 2OYHA 2M3BA 1G1JA 1LTTC 1URQB 2WT7A 1H8AA 2NPSA 2N9BA 1QL2A 1G1IA 2L5GB 3A2AA 2W6BA 5BU8B 1DEBA 2KB7P 4AQRD 2XPOA 2PP6A 3NFQA 2WITA 5AW6B 2XV5A 1IFNA 4ZKUA 1RE4C 3KDPB 5CCGC 4JYCA 1MFZA 3M9HA 3R2PA 2FFDA 2NPSC 2QM8A 1Z56A 1N86A 5CHXA 3VMYA 1URQA 2WT7B 3HD7A 2Z5IA 1JY3P 3M0DA 2GM4A 1T3JA 4WY4C 5APWA 2ZXEB 1XTCC 5APYA 1WT6A 2IPPA 3B5ND 1LTJC 2M8RA 1FZCB 1S9KD 2WSEH 1HJBA 1N7SB 4WBAA 2FXMA 1GL2A 1GTWA 3B5NB 3HD7B 2C0XA 3L4FA 5APTA 1J1DB 1SQXK 2P2UA 1LTIC 1GD2E 1ZR4A 1GU4A 3EFGA 1JCCA 5AW1B 2J59M 3HUSB 1JTHA 3VN0A 2Q9IA 3H32A 1OWAA 2E42A 2HODB 2WWWA 5AVRB 5AVVB 4M3LA 1MUUA 2CPSA 3P32A 3PP5A 2W27A 3HE5A 4C46A 1RF1C 1AQ5A 1LT9A 2NPSD 1JOCA 2WSFH 3RL0D 2PAJA 3KQGA 1LWUC 2OYIC 3M91A 3P7KA 3U88C 3F9KC 1NAFA 1SVFA 3B8EB 4EIJA 3HRNA 3TNUB 2C9NY 4IFDK 1SFCB 5AW4B 4C7NB 2VRSA 4O9BA 5AW5B 1N73A 3HPGG 4LLHA 2IX7C 4W80A 1FJKA 2R3CA 4N3YB 1RY3A 3HPHE 1HGZA 3UIAA 4DOJA 1NHLA 4WY4A 1DX7A 5AVXB 2XU6A 4B86A 5CCGA 3HE4B 3O8ZA 1IFMA 1HTLC 2FKWB 2CPBA 2KYVA 2HPCB 3OAKA 5KJ7C 3IR9A 1N7SA 1GW4A 1NOHA 2POHA 2YO3A 1KZUB 5AVYB 4AUWA 1NO4A 2H8PD 2XPPA 3CI9A 1FAVA 5AW2B 2Q3IA 2XPNA 1G2CB 3RK3D 3M9BA 1A02F 2N3AB 1CI6A 3SWFA 1T8ZA 3HD7D 3HE5B 3RK3B 1J1DC 3LIDA 1EO0A 1M1JB 1A02J 1J1EC 2KSJA 1W2EA 3GHGA 1M1JA 1KILA 1RF0C 3EQ2A 3HUSC 1H89A 1NKNA 3VP8A 1NWQA 1L4AD 5AW8B 3KPEA 1MZ9A 2I1KA 1GDTA 3L37A 4GT1A 1SFCA 3N4XA 1M1JC 3GHGC 1PFIA 3VMZA 5APXA 2XPLA 1LTSC 3H6PA 1AFOA 3HTKA 1KILD 2NPSB 1SFCC 4IFMA 1Z9EA 1VDFA 1RF1B 1FZFA 3GHGB 1JTHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U88 C;  2R32 A;  4I6M C;  3NMD A;  5APS A;  3F9K C;  1NAF A;  5AVW B;  1HBW A;  3B8E B;  1CSB A;  1J2J B;  1HUC A;  1MV8 A;  3L36 A;  3TNU B;  5APV A;  5AVZ B;  3V4W A;  4EOT A;  2C9N Y;  5AW4 B;  1GK4 A;  2VRS A;  5AW5 B;  4C7N B;  3HPG G;  2WPQ A;  2WT7 A;  2YNY A;  1H8A A;  1GZL A;  2KP8 A;  2N9B A;  2WTY A;  2R3C A;  3HPH E;  5AW3 B;  3A2A A;  3UIA A;  2Q7C A;  1KQL A;  4AQR D;  4GKG A;  3I5C A;  2XPO A;  1CZQ A;  3NFQ A;  5AVX B;  2XU6 A;  5AW6 B;  2XV5 A;  5AVU B;  1DH3 A;  1FOS F;  5AVS B;  1X8Y A;  4B86 A;  3KDP B;  2E43 A;  2XZR A;  4JYC A;  2BAS A;  5CMZ A;  1MFZ A;  2WPS A;  1T2K D;  3M9H A;  3HE4 B;  3O8Z A;  2ZFC A;  2QM8 A;  3OAK A;  3IR9 A;  4LC1 A;  3MGN A;  3M0A A;  3VMY A;  3VMX A;  2WT7 B;  1H88 A;  2YO3 A;  1HWT C;  2Z5I A;  3NXS A;  2B4J C;  3M0D A;  5AVY B;  3L35 A;  4AUW A;  2Q5U A;  4AYC A;  1S9K E;  2XPP A;  5AVQ B;  1FAV A;  5AW2 B;  4KHX A;  5APW A;  5AW0 B;  2ZXE B;  3NTN A;  2Q3I A;  5APY A;  2XPN A;  1G2C B;  2IPP A;  1OXZ A;  3M9B A;  2Z5H A;  3HE4 A;  2QM7 A;  1A02 F;  2N3A B;  1CI6 A;  1S9K D;  5AVT B;  2R5B A;  2C9L Y;  3SWF A;  1HJB A;  5APU A;  1GU5 A;  1SP4 A;  2JJL A;  3HE5 B;  1GTW A;  1FOS E;  3TYY A;  3LIE A;  3A5T A;  1T2K C;  5APT A;  3A7O A;  3LID A;  1EO0 A;  2P67 A;  2WPR A;  1A02 J;  4HYT B;  2P2U A;  1GD2 E;  4XE5 B;  3TK1 A;  1GU4 A;  3V5B A;  5AW1 B;  3VN0 A;  1YYC A;  2W6A A;  1H89 A;  1NWQ A;  2R5D A;  5AW8 B;  1OWA A;  2E42 A;  3TNU A;  3A3Y B;  1IO4 A;  2WWW A;  3L37 A;  5AVR B;  4GT1 A;  3VYI A;  1CI6 B;  2YO2 A;  3P8M C;  1MUU A;  4M3L A;  5AVV B;  5AW9 B;  3VMZ A;  4C7N A;  5APX A;  3P32 A;  2XPL A;  1SLQ A;  4DZO A;  1GK6 A;  2W27 A;  1JUN A;  3HE5 A;  3HTK A;  5APQ A;  3T97 A;  3V4Q A;  4C46 A;  1WJT A;  3VTP C;  2P7J A;  1Z9E A;  4I2L C;  4JYB A;  4RES B;  1JNM A;  3MD0 A;  2H7H A;  3KQG A;  3M91 A;  3M06 A;  5AW7 B;  3P7K A; 
#chains in the Genus database with same CATH topology
 2KIK A;  2YKQ A;  4I6M C;  2K1A A;  3BRV B;  5H2F H;  4EOT A;  4LQG A;  4IL6 X;  2XDJ A;  2JP3 A;  1QVG O;  1SQP D;  2P1J A;  3FXD A;  1M7L A;  1ZV8 A;  1VQ7 P;  1AA0 A;  3WUU A;  2O1J A;  4IL6 H;  4GKG A;  3G3Z A;  3L72 G;  4Y99 C;  1S4X A;  1SQV J;  2K9Y A;  3U1C A;  1PGQ A;  5AVU B;  1FOS F;  3BUO B;  1AVY A;  1MFT A;  1OMI A;  5CJ0 A;  1NTM E;  1L0L J;  2WPV B;  4OC3 A;  2OYH B;  4H44 D;  3VMX A;  3CXH E;  2E75 C;  2N1T D;  1KYO E;  1L0N G;  4AYC A;  1EC5 A;  2W6J H;  1BSH A;  1BGY J;  2LXB A;  3V2P A;  1YTZ T;  2FXO A;  4TLF A;  3WMM 0;  2LKM A;  5APU A;  3CCS P;  3JCU H;  1DD4 A;  3D7D A;  4YXW H;  2QEX P;  2XKM A;  1YYC A;  1QGK B;  4NGM A;  1ZRT E;  4U3F D;  2R5D A;  3VOP A;  1LTB C;  1NTZ K;  3A0B H;  4N6J A;  1L0N K;  3H1I J;  2FYZ A;  3T97 A;  1SQV G;  3MD0 A;  2H7H A;  1GL2 D;  4PD4 D;  4K35 A;  1L0L K;  4L76 A;  2OYO A;  2B87 B;  3NMD A;  4JZ0 A;  1CSB A;  4JYW A;  2IBZ E;  2QRX A;  1EQ7 A;  3U59 A;  3RK3 C;  1LT1 A;  3CME P;  3RL0 C;  1FJP A;  5M1B A;  2KK7 A;  1IK9 A;  2Y0D A;  2YNY A;  4OC5 A;  1S3J A;  2YKO A;  1OVR A;  1NTM G;  5KLI B;  5H2F E;  1OIP A;  3S9L A;  2O01 H;  2MJZ A;  5E79 E;  4P4D A;  2QIW A;  3V2R A;  1Z8L A;  1EXJ A;  1AQT A;  2ZYG A;  4GPL B;  1E5W A;  1SS1 A;  5KAI H;  2GUV A;  3CC7 P;  3NXS A;  2OGU A;  1AVO A;  3MP7 B;  1JY3 N;  1LWU A;  2OYI A;  1JY2 N;  2MKV A;  3L73 G;  1L0L G;  2HPC A;  2WSC J;  5AVT B;  4DJG A;  2JBK A;  2E75 B;  3T97 B;  2ZT9 C;  3H1L D;  1USD A;  2K88 A;  4XE5 B;  3MTU E;  3KXD A;  3H1L G;  1EZV E;  2IBZ D;  1ZRT D;  2B9B A;  5BVZ A;  1PIX A;  1QLE D;  5CBN A;  3P8M C;  4C7N A;  1KB9 E;  2OTL P;  1SQP K;  1GL2 C;  1ZME C;  3CCM P;  2A06 D;  2SPZ A;  1SLQ A;  1FDM A;  1GK6 A;  1YIT P;  5CCH D;  4PV1 D;  1WJT A;  2P7J A;  2JEE A;  1JCD A;  1FZB A;  4OME A;  2V7Q H;  1RF0 A;  3HUS A;  4OC1 A;  1HBW A;  3CL3 D;  3CXH D;  3KYQ A;  5CCG D;  4P4I A;  1M1K Q;  1SQV K;  2KI7 B;  2YXR B;  2WT7 A;  4H44 C;  3GMA A;  2L5G B;  3A2A A;  5BU8 B;  2P58 A;  1DEB A;  2BCC E;  1IFN A;  2FYU G;  3KDP B;  4JYC A;  1MFZ A;  3VRO A;  2JWD A;  1BE3 G;  1URQ A;  1BCC J;  4L74 A;  2A06 G;  1KMI Z;  3M0D A;  2GM4 A;  1T3J A;  2QE7 H;  1NTK E;  3H1J G;  1KN7 A;  1FZC B;  1S9K D;  2WSE H;  1BGY E;  2XEF A;  3O6Q A;  1SQB G;  5KKZ C;  3HD7 B;  2C0X A;  1SQP E;  5APT A;  2JBJ A;  3AE1 C;  3RBU A;  1Q81 Q;  1GU4 A;  3EFG A;  1JCC A;  3HUS B;  1KQS O;  5KAF E;  3A0B E;  2E42 A;  4H0L C;  2WWW A;  1ZOY C;  1L0L E;  3CXH I;  4M3L A;  1OFC X;  3SJF A;  2Q6Q A;  1RF1 C;  1AQ5 A;  3BCC J;  1PP9 D;  1R8E A;  3AEB C;  2L91 A;  2ZT9 D;  3F9K C;  2BCC D;  4EIJ A;  3CWB E;  4PV1 C;  1D7M A;  1VQ9 P;  4L73 A;  3H1K J;  2VRS A;  4Z1M H;  4LLH A;  1KD1 Q;  2IX7 C;  4U3F G;  3FED A;  1FJK A;  2ZYA A;  1EDK A;  2CK3 H;  1NU1 G;  1HGZ A;  2D2C D;  4IOI H;  1NTZ E;  4DT0 A;  1HF9 A;  2FYN C;  2ZVO B;  3CCJ P;  4WY4 A;  3BUX B;  3CC4 P;  3D6Y A;  2IBZ I;  1S72 P;  4B86 A;  5KAF H;  4YTP C;  2Q1K A;  1IFM A;  3L73 D;  1NOH A;  4A4B A;  2POH A;  3TDK A;  1VQN P;  2AEM A;  1Y47 A;  3D71 A;  2WMM A;  1VF5 C;  1A02 F;  2Y1M A;  2DLA A;  2JKV A;  3RK3 B;  2KSE A;  3ZNI A;  2E76 B;  1EO0 A;  3G6E P;  1GMJ A;  1JMB A;  5CBO A;  2KSJ A;  1W2E A;  3CPW O;  4P45 A;  4P44 A;  3EQ2 A;  1NKN A;  4EI2 A;  2RKL A;  4D6T G;  1MZ9 A;  4RKU J;  1GDT A;  3C1L A;  3L37 A;  4GT1 A;  1PFI A;  5APX A;  2XPL A;  1EXI A;  1AFO A;  1KIL D;  4IFM A;  1NAY A;  1Z9E A;  1VDF A;  3B71 A;  2OR4 A;  1SQQ G;  1OW6 A;  1FZF A;  3GHG B;  1XTG B;  5APS A;  3MIW A;  2E76 C;  5APV A;  1KB9 I;  1QX8 A;  1PGP A;  1R5S A;  2OAR A;  2FFD B;  4UB8 H;  1SFC D;  2WSS H;  3RK2 D;  2PFX A;  2KP8 A;  3CLQ A;  2Q7C A;  1KQL A;  1RE4 A;  4A7P A;  4LGD E;  1PPJ E;  3OB2 B;  1NTK K;  3EWK A;  1J1E B;  3RGU A;  5KLV K;  2WPS A;  2KNC B;  1LNQ A;  2ZFC A;  2OTJ P;  1RE3 A;  1N73 B;  4LC1 A;  2OYH C;  3GW6 A;  3HD7 C;  1NTZ G;  2B4J C;  4OGQ B;  3MHV A;  3CD6 P;  3OJA B;  3S1K A;  2JR8 A;  2Z5H A;  1Q7Y Q;  3CCE P;  1SP4 A;  3VRR A;  3TYY A;  1K73 Q;  1S5L X;  2YMY A;  3MUD A;  2NRG A;  5L8R J;  3LW5 H;  1JEK A;  2IBZ G;  1M56 D;  4HH2 A;  3F89 A;  3CX5 D;  3CCV P;  1SQX J;  1ZN5 A;  2LR2 A;  1CI6 B;  1VQ6 P;  1NTM J;  4OGQ C;  4N78 D;  1IFI A;  1VL2 A;  1FS0 E;  4I2L C;  3M06 A;  1IFJ A;  1N7L A;  3Q2Y A;  1P84 E;  5GTI E;  2R32 A;  1YHQ P;  1SQB E;  3RK2 B;  2KNC A;  2NZ2 A;  2VKZ G;  1MKM A;  4XA4 A;  4MCR A;  1K05 A;  1FZC C;  2HLO A;  1S2E A;  1CZQ A;  3FF3 A;  3CX5 E;  4Y99 B;  2FFD C;  1DH3 A;  3PJS K;  3M9Q A;  5GTH E;  3CCQ P;  3BRT B;  4NPF X;  3FWN A;  4NGN A;  3M0A A;  1RE3 C;  3AEA C;  3R4Y A;  3RK2 C;  3PT1 A;  1SQX G;  4WY4 B;  1DD3 A;  5AW0 B;  5KLV D;  3G4S P;  2XND H;  2E76 D;  3NTN A;  1YQ3 C;  1OXZ A;  3E1I A;  1T3U A;  3PLN A;  1WRG A;  3VRP A;  5BU5 A;  5TIS H;  3AE3 C;  2JJL A;  2H43 A;  2WZ7 A;  4U3F J;  3C9I A;  1ZXG A;  2O1K A;  1HGV A;  1N73 C;  1NKZ B;  1SQB K;  1ZP0 C;  3VP9 A;  3MUD C;  3TNU A;  3VYI A;  3CCU P;  2YO2 A;  3H1H E;  3CCR P;  1LP1 B;  1GL2 B;  1JUN A;  5APQ A;  4YPC A;  3RL0 B;  2BEZ F;  1LT9 C;  3K5B A;  5CJ4 A;  1L0N E;  3TGU G;  2UWJ E;  1FBM A;  4GDO A;  2W90 A;  2H89 C;  3B4S A;  3M0D C;  3V4W A;  4ZKP A;  5B5E H;  1OZH A;  2JO1 A;  3B5N C;  1VQO P;  3ABV C;  2FY8 A;  4NGR A;  1URQ B;  3QH9 A;  5TJH A;  1H0T B;  3H25 A;  3GG2 A;  4P4B A;  2XPO A;  2PP6 A;  3NFQ A;  4YXD C;  3L74 D;  4MCQ A;  1RE4 C;  1VQM P;  1K9M Q;  2FFD A;  2NPS C;  2GA1 A;  3CX5 H;  3VMY A;  5CHX A;  3TF5 A;  3HD7 A;  5GTH H;  3AE6 C;  4NGS A;  1JY3 P;  5APW A;  2PVV A;  2Q3E A;  1M57 D;  2M8R A;  2XEI A;  2IYO A;  2E5T A;  1PGJ A;  2O3J A;  2XEJ A;  3PTZ A;  2V7Q J;  1GL2 A;  3W68 A;  3V6I A;  2E75 D;  2M5A A;  1LTI C;  2IZ1 A;  3VN0 A;  2J59 M;  3VRN A;  1JTH A;  1EDJ A;  1FDI A;  3H32 A;  1DE4 C;  1OWA A;  2AEF A;  1NU1 J;  4EDF A;  2Y9Y A;  2IZ0 A;  1LT9 A;  1H0T A;  4ZMD A;  2PAJ A;  1S1C X;  3KQG A;  1NTZ J;  3L71 G;  3M91 A;  1QVF O;  4A4C A;  2QJK C;  4I7Z B;  3ZDM A;  1HJ0 A;  1NAF A;  4ZNC A;  2C9N Y;  4IFD K;  3G9R A;  5AW4 B;  4C7N B;  4L75 A;  4O9B A;  4W80 A;  1EZV G;  3D6Z A;  4N3Y B;  3HPH E;  4PJ0 E;  1DX7 A;  1W2B O;  2ZVN B;  3H1L J;  2FBW C;  3HE4 B;  2CPB A;  2QJK B;  3FEE A;  1VQL P;  4PD4 H;  1BDD A;  2M5A B;  1NYH A;  4R4M A;  5AVY B;  4AUW A;  1NO4 A;  1U57 A;  1NTK D;  1PPJ G;  3RL0 g;  3VMA A;  4UB6 H;  1NTK J;  1RH5 B;  1U7M A;  1A02 J;  4BPU B;  1J1E C;  5ELY A;  3D7H A;  3GHG A;  2FYU D;  1RF0 C;  3HUS C;  1H89 A;  3VP8 A;  2JWA A;  3KPE A;  5D29 A;  1QEX A;  3GF3 A;  1UII A;  2RMZ A;  2FYU J;  3VGO A;  4PD4 E;  2K9J B;  3HTK A;  4KJM A;  2NPS B;  1SFC C;  1RF1 B;  1BE3 D;  4H44 B;  4TT3 H;  4P4F A;  3AEC C;  1BCC G;  1M1J B;  2FYN B;  1IC2 A;  5AVW B;  3SJX A;  1MV8 A;  4BRY B;  5AVZ B;  1KYO I;  2PRR A;  3EFF K;  1KFM A;  1URQ C;  1X79 B;  3IWW A;  1SQQ J;  5K5G B;  4W7Y A;  2AXT E;  1N2D C;  3BCC E;  1JY3 O;  3KAS A;  4MN4 C;  5AVS B;  2E43 A;  2XZR A;  2FYU E;  3BXM A;  3Q5R A;  1KYO D;  3BVH A;  2WSF J;  1K04 A;  4OWF A;  4HJG H;  1R5L A;  1LTG C;  3L35 A;  2YKP A;  3WUT A;  1IK7 A;  5AVQ B;  2FYU K;  2FXP A;  3CXH H;  1T6A A;  3BAT A;  2C6P A;  1NH4 A;  3A0H E;  1JY2 P;  2QM7 A;  1N7S D;  1QL1 A;  2IFM A;  2A45 I;  2R5B A;  2C9L Y;  1KIL E;  1FC2 C;  1BGY D;  3HTK B;  1FOS E;  4MCP A;  1T2K C;  3H1K G;  1RF1 A;  1L4A A;  3L71 E;  2WQY C;  2RN0 A;  2D2C B;  3V5B A;  3H1K D;  3H1J D;  5HKZ A;  4BRY A;  5CCH A;  5AW9 B;  2UV8 G;  4PV1 B;  2BEQ D;  4JPZ B;  2P10 A;  3P8C D;  4IFF A;  2QJY C;  3D7G A;  3GF7 A;  3IFM A;  3W67 A;  2ZJS E;  1ZR2 A;  3CX5 I;  3PFV A;  2KLU A;  1ZLL A;  1KB9 H;  2WPQ A;  3BHX A;  2WTY A;  1LT9 B;  1ZW0 A;  5F13 A;  3JC2 2;  3L70 G;  3AE7 C;  3V2Q A;  3MZW B;  5BY0 A;  1X8Y A;  5HKY A;  3S4R A;  2A45 G;  2BAS A;  4OVN F;  5CMZ A;  2XEG A;  2OOT A;  3U1A A;  4HKZ H;  2RH0 A;  3D70 A;  2A06 E;  2Z4E A;  4DCK A;  1L4A B;  4I1L A;  3H1I G;  1KQG B;  4R4L A;  2Q5U A;  1VQ4 P;  3Q3D A;  2HFE D;  1HVV A;  3S9O A;  1KIL B;  2IFN A;  4IL6 E;  4KHX A;  5F09 A;  3D7F A;  3IAO A;  2GUS A;  2WVR A;  1PP9 E;  3HMJ G;  2HG5 D;  1YJW P;  1LP1 A;  1GU5 A;  3I55 P;  4UB6 E;  3A5T A;  5HKW A;  2QA4 P;  2QG4 A;  1HH0 A;  3SFE C;  1IFD A;  3L75 G;  4K3A A;  2ITA A;  1JY2 O;  4NGT A;  1X9V A;  1L4A C;  3A3Y B;  2W83 C;  1DEE G;  1VQ5 P;  3P8C E;  1Q90 D;  1LGH B;  4DZO A;  1KYO H;  3V2N A;  3VTP C;  1VF5 B;  1KOR A;  3AE4 C;  1YTZ I;  3SFD C;  3RBX A;  4W9Y A;  2YXQ B;  1SQQ K;  4NGQ A;  3H1J E;  2OQQ A;  3H1K E;  3SWY A;  4BPW B;  1JM0 A;  1YBK A;  2M3B A;  3CWB J;  1LTT C;  2YMK A;  2NPS A;  4GOF A;  1QL2 A;  1G1I A;  3TGU J;  2IYP A;  3H1H D;  2KB7 P;  2KZI A;  2KZJ A;  3BCC D;  3SSU A;  3L75 D;  3H1H J;  3M9H A;  4ASV A;  3R2P A;  2J5U A;  2R3S A;  3BUN B;  3L75 J;  1RQV A;  2Z5I A;  3L70 J;  2DW3 A;  2B89 A;  1SQP J;  4U3F E;  2ZXE B;  2E5Y A;  2QVA A;  2IPP A;  1FDO A;  3B5N D;  1LTJ C;  2C6G A;  1W5C E;  1N7S B;  4WBA A;  2K37 A;  1IFP A;  1GTW A;  1KB9 D;  3CC2 P;  3L4F A;  2P2U A;  3L72 J;  5AW1 B;  1BCC E;  5DJT B;  1EZV D;  4H0L B;  1K8A Q;  3FWL A;  2Y0C A;  3PLF B;  3H1L E;  1MUU A;  4JBZ A;  4NGP A;  2W27 A;  4C46 A;  3IN6 A;  1SQV E;  1UIX A;  2YIU C;  2E74 B;  1JOC A;  3JCU E;  3RL0 D;  1NVO A;  3TGU E;  2O01 N;  3P7K A;  4XFJ A;  1SVF A;  2N9Y B;  3TNU B;  3L70 D;  5AW5 B;  3H1J J;  4D6T D;  1SQP G;  1RY3 A;  4OC2 A;  3UIA A;  4DOJ A;  1NHL A;  1KQF B;  5AVX B;  2XU6 A;  2QSI A;  3KHU A;  4U7J A;  3LW5 J;  2E74 C;  2KS1 B;  2YIU B;  1OVV A;  2FKW B;  1HTL C;  4NPD A;  2I8D A;  3OAK A;  5KJ7 C;  3IR9 A;  1N7S A;  1GW4 A;  1NJI Q;  3CMA P;  4RJT A;  2AXT H;  1DIP A;  4BTF A;  2XPN A;  1G2C B;  1BDC A;  1PP9 J;  2N3A B;  4KT0 J;  3SWF A;  4QMA A;  2K9J A;  1T8Z A;  3SJG A;  3HD7 D;  3E7K A;  1M1J A;  1NU1 D;  1KIL A;  1Q2N A;  2B87 A;  1NWQ A;  3BUW B;  3A0H H;  2I1K A;  3C8V A;  1PPJ D;  1RHZ B;  3N4X A;  3GHG C;  1X0T A;  3VMZ A;  3FGA D;  1LTS C;  3H6P A;  1NTK G;  3L74 J;  2G8Y A;  2C6C A;  5EFW B;  1M8O B;  1PL5 A;  1YVH A;  3H1I D;  5TIS E;  1JTH B;  1VPC A;  3L73 J;  2N1T A;  1OVU A;  5CCH C;  3S9M A;  3FX0 A;  3H32 B;  4JF7 A;  3WUV A;  1CW5 A;  4W7Z A;  5KJ7 D;  4JQ0 D;  1YJ9 P;  4BPX B;  1EDI A;  1GK4 A;  3ITK A;  4OH8 B;  3OW2 O;  1FZG A;  4OC4 A;  1CX8 A;  2A45 H;  1GZL A;  4BWN A;  4X3R A;  3BUM B;  1YJN P;  4RO0 A;  1NTM D;  1L0N J;  4HB1 A;  3BAS A;  3KZI H;  1VQK P;  2CBL A;  3L74 E;  2Y0E A;  3N7N A;  3RBZ A;  1T2K D;  4RR2 B;  2HR3 A;  1PGO A;  2IDB A;  1N7S C;  3MGN A;  5KLI C;  5KJ7 A;  3B5N A;  3QWO C;  1H88 A;  1LTJ B;  3SJE A;  4BXL A;  1KFN A;  4GOD A;  3FXE A;  3L71 J;  5AXI A;  2W8Z A;  3Q5P A;  1GW3 A;  3HE4 A;  3L71 D;  3AED C;  4WWI A;  2C0W A;  4Y28 J;  4C7R A;  2M3E A;  1KC8 Q;  1FZE A;  5DJU B;  3CWB G;  1OW8 A;  3LIE A;  3A7O A;  2WPR A;  3TK1 A;  1KIL C;  2J58 A;  2N1T B;  3PHL A;  4WB4 A;  1IO4 A;  1BE3 J;  1IJD B;  4PJ0 H;  2D2C C;  1URQ D;  1BGY G;  3OA7 A;  2KLV A;  3SWK A;  4GIF A;  4JYB A;  4RES B;  1JNM A;  1SQX D;  1PZQ A;  4H13 C;  2WSC H;  3RK3 E;  1SQQ E;  1NU1 K;  1M90 Q;  3I56 P;  5KLV E;  1S5L H;  2AXC A;  2KUB A;  3OP0 A;  1FU1 A;  1RQU A;  3L36 A;  1SQQ D;  1VF5 D;  2HYN A;  2AEJ A;  1SQB J;  1AJY A;  1JO5 A;  4H13 B;  1IZN B;  2XNX A;  1LTJ A;  5AW3 B;  1YQ4 C;  2CIJ A;  1L0L D;  1USE A;  3I5C A;  2G3A A;  1E79 H;  1BE3 E;  1FZC A;  1FZA A;  3TSI A;  2BCC G;  1P84 I;  2R44 A;  1HWT C;  3USS A;  1Y8A A;  3L72 E;  1S9K E;  4EYY Q;  1NTM K;  3BI1 A;  3Q1M A;  3F5H A;  4WY4 D;  4H0L D;  1JB0 J;  2KS1 A;  1LTA C;  2KOG A;  4N78 E;  2ZAE B;  4OGQ D;  1L2P A;  3CCL P;  2P67 A;  1JMM A;  4HYT B;  3L70 E;  1U7J A;  2N1T C;  3FEC A;  2W6A A;  5KTB A;  1KV4 A;  1SQB D;  1LWU B;  2OYI B;  4GOE A;  1G2C A;  5B66 H;  2B88 A;  3L72 D;  1P84 D;  2K3R A;  2I1J A;  5KAI E;  1SQV D;  3PH0 A;  3V4Q A;  3II6 A;  1EDL A;  2WSE J;  5AW7 B;  1PV3 A;  3AEE C;  2H88 C;  1J2J B;  2HOD A;  1HUC A;  1WMK A;  1PP9 G;  2OYH A;  1G1J A;  1FE6 A;  1Y9B A;  1H8A A;  2N9B A;  3IF4 A;  5KLV J;  2W6B A;  4OC0 A;  4AQR D;  4D6T J;  2WIT A;  5AW6 B;  2XV5 A;  5B66 E;  4ZKU A;  2E74 D;  5CCG C;  5B5E E;  3AEF C;  1NU1 E;  1Q82 Q;  1SQX E;  2QM8 A;  1Z56 A;  1N86 A;  2WT7 B;  1AV1 A;  2QJP B;  4WY4 C;  2OTK E;  1XTC C;  5APY A;  1WT6 A;  1BSN A;  3AE2 C;  3JSV C;  1TU3 F;  1HJB A;  2FXM A;  4NPE A;  2PVW A;  3B5N B;  1J1D B;  1SQX K;  5KKZ B;  1GD2 E;  1ZR4 A;  2Q9I A;  2QJY B;  2ZYD A;  3VRQ A;  3BI0 A;  2HOD B;  4H13 D;  5AVR B;  5AVV B;  2CPS A;  3P32 A;  3PP5 A;  3O6Q B;  3HE5 A;  1NGM B;  2ZT9 B;  2NPS D;  4D6T E;  2WSF H;  3OB1 B;  2KXP B;  1LWU C;  2OYI C;  3AEG C;  3S9N A;  3PRJ A;  3U88 C;  1FBV A;  2O01 J;  3B8E B;  5C39 A;  3WU2 H;  1S5L E;  3HRN A;  1SFC B;  4MCS A;  3TGU D;  2LXC B;  1N73 A;  3HPG G;  2PGD A;  2Y9Z A;  1X22 A;  3L73 E;  2R3C A;  1N8R Q;  3GLM A;  2JDI H;  4I7Z C;  3BCC G;  3AE9 C;  5E79 H;  3H1I E;  5CCG A;  1BCC D;  1L0N D;  3O8Z A;  2KYV A;  2HPC B;  1P84 H;  1EZV I;  1OX3 A;  5GTI H;  5J3X A;  3AE5 C;  5KLV G;  2YO3 A;  1OW7 A;  1YIJ P;  1KZU B;  4PD4 I;  4P4J A;  3WU2 E;  2H8P D;  2XPP A;  3CI9 A;  2V4H A;  1FAV A;  2M0B A;  5AW2 B;  2Q3I A;  1B47 A;  3L74 G;  3RK3 D;  3M9B A;  4ASW A;  4CPG A;  1CI6 A;  2Y1N A;  1NTZ D;  3HE5 B;  1J1D C;  3E1R A;  3LID A;  1Q86 Q;  3AE8 C;  3Q5S A;  4P4E A;  2QJP C;  3L75 E;  3CWB D;  1YI2 P;  1L4A D;  5AW8 B;  1KTM A;  1VQP P;  1LJ2 A;  3KZI E;  3H1H G;  1SFC A;  1M1J C;  3G71 P;  2BCC J;  1VQ8 P;  2ZXX A;  4WVZ A;  4UB8 E; 
#chains in the Genus database with same CATH homology
 1VPC A;  5CCH C;  2N1T A;  2YKQ A;  1XTG B;  5APS A;  4I6M C;  3H32 B;  1IC2 A;  5AVW B;  3BRV B;  4JF7 A;  3MIW A;  1MV8 A;  1CW5 A;  5APV A;  5AVZ B;  4EOT A;  4W7Z A;  5KJ7 D;  2OAR A;  2FFD B;  1KFM A;  1URQ C;  1GK4 A;  1X79 B;  4OH8 B;  2XDJ A;  1SFC D;  1FZG A;  2P1J A;  3RK2 D;  2A45 H;  1GZL A;  2KP8 A;  1M7L A;  1ZV8 A;  3CLQ A;  2O1J A;  2Q7C A;  1KQL A;  1RE4 A;  4GKG A;  3G3Z A;  4W7Y A;  4LGD E;  3BAS A;  4Y99 C;  1N2D C;  3U1C A;  5AVU B;  1JY3 O;  1FOS F;  5AVS B;  1NTK K;  2E43 A;  1J1E B;  2XZR A;  5CJ0 A;  3N7N A;  5KLV K;  2WPS A;  1T2K D;  2ZFC A;  1RE3 A;  3BVH A;  2OYH B;  1N73 B;  4LC1 A;  3MGN A;  1N7S C;  2OYH C;  3VMX A;  5KJ7 A;  3B5N A;  1H88 A;  3HD7 C;  1LTJ B;  2B4J C;  1KFN A;  1LTG C;  2N1T D;  3L35 A;  4AYC A;  2YKP A;  5AVQ B;  2FYU K;  3OJA B;  3BAT A;  1GW3 A;  3V2P A;  1NH4 A;  1YTZ T;  2Z5H A;  3HE4 A;  1JY2 P;  2QM7 A;  1N7S D;  1QL1 A;  2IFM A;  2A45 I;  2R5B A;  3WMM 0;  2C9L Y;  2C0W A;  2LKM A;  5APU A;  4C7R A;  1SP4 A;  1FZE A;  3HTK B;  1FOS E;  3TYY A;  3LIE A;  1T2K C;  1RF1 A;  3A7O A;  1L4A A;  2YMY A;  3MUD A;  2WPR A;  3TK1 A;  2XKM A;  3V5B A;  1YYC A;  1KIL C;  2J58 A;  3LW5 H;  2N1T B;  4HH2 A;  2R5D A;  4WB4 A;  1IO4 A;  3VOP A;  1LTB C;  1NTZ K;  4N6J A;  1ZN5 A;  5CCH A;  1CI6 B;  1IJD B;  5AW9 B;  1L0N K;  4N78 D;  1IFI A;  1URQ D;  2FYZ A;  3OA7 A;  2KLV A;  3T97 A;  4GIF A;  4I2L C;  4JYB A;  4RES B;  1JNM A;  3MD0 A;  2H7H A;  1GL2 D;  2WSC H;  1L0L K;  3P8C D;  3M06 A;  4IFF A;  1NU1 K;  1IFJ A;  1N7L A;  3IFM A;  2R32 A;  3NMD A;  1ZR2 A;  1CSB A;  1FU1 A;  3L36 A;  1EQ7 A;  3RK2 B;  3U59 A;  3RK3 C;  1ZLL A;  1FJP A;  2HYN A;  3RL0 C;  4XA4 A;  1JO5 A;  2WPQ A;  1IK9 A;  2YNY A;  1FZC C;  2WTY A;  1LT9 B;  2XNX A;  2HLO A;  1LTJ A;  2YKO A;  5AW3 B;  2O01 H;  3I5C A;  1CZQ A;  2MJZ A;  3V2Q A;  4Y99 B;  2FFD C;  1DH3 A;  1X8Y A;  3V2R A;  3M9Q A;  2A45 G;  2BAS A;  5CMZ A;  3BRT B;  1FZC A;  3U1A A;  1FZA A;  1E5W A;  3M0A A;  3TSI A;  1RE3 C;  2Z4E A;  2GUV A;  1HWT C;  3NXS A;  3RK2 C;  1L4A B;  4I1L A;  2Q5U A;  1S9K E;  2HFE D;  1HVV A;  4WY4 B;  1KIL B;  1NTM K;  2IFN A;  4KHX A;  5AW0 B;  1JY3 N;  3NTN A;  1LWU A;  4WY4 D;  1JY2 N;  2OYI A;  1OXZ A;  3E1I A;  1T3U A;  1WRG A;  2GUS A;  2HPC A;  2HG5 D;  5AVT B;  1LTA C;  5BU5 A;  1GU5 A;  2KOG A;  2JJL A;  4N78 E;  2H43 A;  3A5T A;  2WZ7 A;  2P67 A;  1JMM A;  3C9I A;  4HYT B;  1HH0 A;  4XE5 B;  2O1K A;  1HGV A;  1IFD A;  1NKZ B;  1N73 C;  3MTU E;  2N1T C;  2W6A A;  1JY2 O;  1SQB K;  5KTB A;  5BVZ A;  3VP9 A;  1LWU B;  2OYI B;  1G2C A;  1X9V A;  1L4A C;  3TNU A;  3A3Y B;  3VYI A;  2YO2 A;  3P8M C;  3P8C E;  2I1J A;  4C7N A;  1SQP K;  1GL2 C;  1SLQ A;  1LGH B;  4DZO A;  1FDM A;  1GL2 B;  1GK6 A;  1JUN A;  5APQ A;  3RL0 B;  3II6 A;  3V2N A;  3V4Q A;  5CCH D;  1WJT A;  3VTP C;  2P7J A;  1LT9 C;  5CJ4 A;  2JEE A;  1JCD A;  1FZB A;  5AW7 B;  3HUS A;  1RF0 A;  1FBM A;  1YTZ I;  1HBW A;  3CL3 D;  1J2J B;  2HOD A;  1HUC A;  3M0D C;  1SQQ K;  3V4W A;  4ZKP A;  3SWY A;  5CCG D;  3KYQ A;  3B5N C;  1SQV K;  2OYH A;  2M3B A;  1G1J A;  1LTT C;  1URQ B;  2WT7 A;  1H8A A;  2NPS A;  2N9B A;  1QL2 A;  1G1I A;  2L5G B;  3A2A A;  2W6B A;  5BU8 B;  1DEB A;  2KB7 P;  4AQR D;  2XPO A;  2PP6 A;  3NFQ A;  2WIT A;  5AW6 B;  2XV5 A;  1IFN A;  4ZKU A;  1RE4 C;  3KDP B;  5CCG C;  4JYC A;  1MFZ A;  3M9H A;  3R2P A;  2FFD A;  2NPS C;  2QM8 A;  1Z56 A;  1N86 A;  5CHX A;  3VMY A;  1URQ A;  2WT7 B;  3HD7 A;  2Z5I A;  1JY3 P;  3M0D A;  2GM4 A;  1T3J A;  4WY4 C;  5APW A;  2ZXE B;  1XTC C;  5APY A;  1WT6 A;  2IPP A;  3B5N D;  1LTJ C;  2M8R A;  1FZC B;  1S9K D;  2WSE H;  1HJB A;  1N7S B;  4WBA A;  2FXM A;  1GL2 A;  1GTW A;  3B5N B;  3HD7 B;  2C0X A;  3L4F A;  5APT A;  1J1D B;  1SQX K;  2P2U A;  1LTI C;  1GD2 E;  1ZR4 A;  1GU4 A;  3EFG A;  1JCC A;  5AW1 B;  2J59 M;  3HUS B;  1JTH A;  3VN0 A;  2Q9I A;  3H32 A;  1OWA A;  2E42 A;  2HOD B;  2WWW A;  5AVR B;  5AVV B;  4M3L A;  1MUU A;  2CPS A;  3P32 A;  3PP5 A;  2W27 A;  3HE5 A;  4C46 A;  1RF1 C;  1AQ5 A;  1LT9 A;  2NPS D;  1JOC A;  2WSF H;  3RL0 D;  2PAJ A;  3KQG A;  1LWU C;  2OYI C;  3M91 A;  3P7K A;  3U88 C;  3F9K C;  1NAF A;  1SVF A;  3B8E B;  4EIJ A;  3HRN A;  3TNU B;  2C9N Y;  4IFD K;  1SFC B;  5AW4 B;  4C7N B;  2VRS A;  4O9B A;  5AW5 B;  1N73 A;  3HPG G;  4LLH A;  2IX7 C;  4W80 A;  1FJK A;  2R3C A;  4N3Y B;  1RY3 A;  3HPH E;  1HGZ A;  3UIA A;  4DOJ A;  1NHL A;  4WY4 A;  1DX7 A;  5AVX B;  2XU6 A;  4B86 A;  5CCG A;  3HE4 B;  3O8Z A;  1IFM A;  1HTL C;  2FKW B;  2CPB A;  2KYV A;  2HPC B;  3OAK A;  5KJ7 C;  3IR9 A;  1N7S A;  1GW4 A;  1NOH A;  2POH A;  2YO3 A;  1KZU B;  5AVY B;  4AUW A;  1NO4 A;  2H8P D;  2XPP A;  3CI9 A;  1FAV A;  5AW2 B;  2Q3I A;  2XPN A;  1G2C B;  3RK3 D;  3M9B A;  1A02 F;  2N3A B;  1CI6 A;  3SWF A;  1T8Z A;  3HD7 D;  3HE5 B;  3RK3 B;  1J1D C;  3LID A;  1EO0 A;  1M1J B;  1A02 J;  1J1E C;  2KSJ A;  1W2E A;  3GHG A;  1M1J A;  1KIL A;  1RF0 C;  3EQ2 A;  3HUS C;  1H89 A;  1NKN A;  3VP8 A;  1NWQ A;  1L4A D;  5AW8 B;  3KPE A;  1MZ9 A;  2I1K A;  1GDT A;  3L37 A;  4GT1 A;  1SFC A;  3N4X A;  1M1J C;  3GHG C;  1PFI A;  3VMZ A;  5APX A;  2XPL A;  1LTS C;  3H6P A;  1AFO A;  3HTK A;  1KIL D;  2NPS B;  1SFC C;  4IFM A;  1Z9E A;  1VDF A;  1RF1 B;  1FZF A;  3GHG B;  1JTH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...