4JZ0A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with ctt1055
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title A high affinity 18F-labeled phosphoramidate peptidomimetic inhibitor as a PSMA-targeted PET imaging agent for prostate cancer
rcsb
source organism Homo sapiens
total genus 257
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4jz0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4jz0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4jz0A02
3TC8A 2HC9A 3RZAA 2V8HA 1UWYA 3D67A 5JH9A 2JEWA 2ZEMA 2NSMA 4ZY1A 3WT4A 3KR5A 1YW4A 4DJLA 1R3NA 3B7IA 1PCAA 3H8EA 2F8HA 4MRIA 4X3RA 2BO9A 4A37A 4X2TA 4WWVA 1LANA 4C84A 3CPAA 2ZEDA 4O23A 1FT7A 1CBXA 4ZY2A 1BPNA 2AFMA 2C1CA 4P4FA 1ELMP 1IGBA 3WC6A 1CG2A 3PB6X 3S9MA 3B3SA 2G9DA 3V38A 3VH9A 3SJXA 5JGFA 2I3CA 2JBKA 2V8GA 3PBBA 3PRTA 4C9UA 3IC1A 1F2OA 1Z5RA 4PXCA 1LFWA 5J1QA 4EWTA 4BD9A 4C99A 1BPMA 3WABA 3DGVA 4C8CA 1H8LA 1TF8A 4MXUA 2C6CA 2AFSA 3S9LA 1NSAA 3L2NA 1DTDA 4MMOA 3ICUA 2ZEFA 5I4MA 3CPXA 1V6CA 5K8MA 2PJ0A 4FWUA 2XEJA 4C8PA 3FVLA 1QMUA 4LQGA 2PJ2A 3KHZA 1CP6A 2PJ4A 2RB7A 4PXEA 4RUHA 4P4DA 2RFHA 2POKA 2ZEPA 2NYQA 2C6PA 3T8WA 2Q43A 5CBMA 4CDKA 4P4IA 2Q51A 4MHZA 5K8OA 4NGRA 1CPSA 5THWA 4R76A 1TXRA 1XF1A 1EE3P 4UEFA 4P10A 5DS0A 3PEIA 1YSJA 4F8ZA 2HB6A 4A38A 3PB9X 4IAVA 2GREA 3D7GA 1VHOA 3TX8A 3ISZA 2JBJA 3S9NA 4NJQA 2CTBA 4AXVA 1LAMA 2J9AA 2PIYA 3KGQA 2PJCA 4NGQA 1AMPA 4C9EA 5D29A 4R8FA 2O4HA 3WC5A 2PJBA 5HVHA 2AFUA 3B2YA 3CT9A 4UEZA 4UIAA 3NA6A 2V8VA 1HEEA 3D4UA 2EK9A 2V77A 5LRKA 4C85A 4JYWA 3GB0A 4ZI6A 4CPAA 5LYLA 3K9TA 3IIBA 3KL9A 4NGNA 5K8NA 4B6ZA 5LYIA 4KSIA 2PCUA 3D68A 1ZLIA 2PJ5A 3IJ3A 4K3NA 2QVPA 1RTQA 4PXDA 4ZY0A 2ZEGA 4YWYA 2OOTA 1JQGA 3V7ZA 4P44A 1Y0RA 4ONWA 3PBEA 1TKFA 2IMOA 2BCOA 3DLJA 4YN3A 1CP7A 4C8AA 3KQXA 2IJZA 4YU9A 4MCPA 3VTAA 4EMEA 4R7MA 1R43A 4MCSA 2WZNA 4OC2A 3KR4A 3PB4X 4TWEA 4TJVA 3GLJA 2FVGA 3H8FA 3LMSA 3QNVA 2PJ1A 1HDQA 4H2KA 4F9UA 4ZX8A 4OIWA 4NGTA 3HLPA 1GYTA 1F2PA 1ZG8A 4OC3A 2PVWA 3IEHA 3MN8A 4IHMA 2O53A 2PE3A 1TF9A 3FJUA 4Z65A 2XEFA 2VL1A 2GU2A 4KNGE 1XJOA 3HUVA 2PVVA 4OC4A 5F09A 3FMCA 5HVFA 2BOAA 3KHXA 1HDUA 5CPAA 1XRYA 2PJAA 3RBUA 3SI2A 1FNOA 1TKHA 3WC7A 4FUUA 1BAVA 2WYRA 4OMEA 7CPAA 3SI0A 2PJ6A 3B3CA 3VARA 4TJXA 3KASA 4OKOA 2CF4A 2CTCA 3BI1A 1XMBA 6CPAA 4G1PA 3IWWA 3NH5A 1ZG9A 1Y7EA 3ISXA 4PQAA 1LOKA 4ZYQA 4IK2A 3N5FA 3NH8A 1TKJA 2PIZA 1QQ9A 3CDXA 1ZLHA 4P4EA 4MHPA 4NJRA 4MHNA 4F9VA 4W9YA 4MCRA 4JZ0A 1LCPA 1WVMA 4UIBA 4MCQA 4A39A 4OC5A 4ZX9A 5HVGA 3FEDA 2IQ6A 3LWUA 4P45A 4A94A 1Y0YA 3SJFA 3I1UA 4WJBA 3SJEA 4PPZA 4P4BA 1YW6A 2PRQA 2AFXA 3D66A 3IO1A 5LRGA 3IFEA 4NGPA 3SJGA 4GM5A 2F7VA 2OR4A 3B3TA 1LAPA 4C86A 4OP4A 3PFOA 3PB7X 2ZENA 5D8NA 4DYOA 4NGSA 4EFDA 4FBEA 3SI1A 1IY7A 3PFEA 3BHXA 4Q7AA 3BXMA 2AFOA 2XEIA 2ZEEA 1ELLP 5K8PA 4UF4A 1Z2LA 4X8IA 2V8DA 2ZEOA 5JM6A 1M4LA 2ABZA 3FH4A 3VATA 3NFZA 5LYDA 1CPXA 1PYTB 2EK8A 4UEEA 2PJ7A 1VIXA 4OC0A 5IB9A 3RAMA 3EIFA 3I6SA 2ZOGA 2ANPA 4OC1A 3B35A 1ZG7A 2AFWA 2EWBA 5ELYA 2GLFA 4OIDA 4C9VA 3I74A 2CIJA 4CDJA 4P4JA 4NGMA 2GLJA 5LRJA 3KI9A 3K2KA 4TNUA 3GUXA 2AFZA 3D7FA 1Z8LA 3FEEA 3B3WA 3D7HA 1ARLA 4C8FA 3NH4A 4C8UA 4C9RA 3FECA 1F57A 3BI0A 1VGYA 2DEAA 1XFOA 4P6YA 1VHEA 2ZELA 3JRUA 4FAIA 2PJ3A 4R6TA 3B3VA 2PJ8A 1XBUA 3MRUA 4MHYA 1Q7LA 3KZWA 1OBRA 3FF3A 1DE4C 1YMEA 2Q4ZA 5LYFA 3FX6A 3D7DA 4NFRA 1AYEA 1YLOA 2ZOFA 8CPAA 2PJ9A 4C9AA 2QJ8A 2QYVA 3PB8X 2XEGA 4C8TA 1ARMA 5HXDA 1CX8A 1KWMA 3KQZA 2C6GA 4DUKA 4PXBA 2ZEHA 3H8GA 1Y9ZA 1BLLE
chains in the Genus database with same CATH superfamily
3TC8A 2HC9A 4Y49B 5KTCA 3LACA 3T9YA 3R1KA 3RZAA 2FSRA 5F1YA 2V8HA 4J3GA 1UWYA 1I1DA 3D67A 4KNGE 5E96A 2GP4A 1Z4RA 5JH9A 1VBHA 1IIDA 4CAXA 2JEWA 3P2FA 2ZEMA 2NSMA 3I9SA 4ZY1A 3WT4A 4CGMA 1JDBC 3KR5A 4PK2A 3TT2A 1YW4A 4DJLA 2Q7SA 2VBQA 1R3NA 3B7IA 1CE8B 1PCAA 3H8EA 2EZAA 2F8HA 3DDDA 3JVNA 4MRIA 4X3RA 2BO9A 2JEVA 2FT0A 3HPGG 2ZW7A 4PK3A 4WWVA 1LANA 4X2TA 4A37A 3CPAA 1Y9KA 2ZEDA 4C84A 4O23A 1FT7A 3SR3A 1CBXA 1S7LA 4XPKA 4UFVA 2X0SA 4R57A 5FVJA 4ZY2A 3GKRA 1IOFA 3TOAA 4Q38A 1BPNA 2AFMA 3R95A 3HPHE 2C1CA 2HUZA 3EXNA 4P4FA 1ELMP 4CYOA 4KLVA 1IGBA 2ATRA 3IU2A 2XPPA 3WC6A 1CG2A 5F13A 3PB6X 3ZJ0A 3S9MA 3B3SA 2DIKA 2G9DA 2HI6A 3V38A 1OZPA 4CGOA 3DR6A 3SJXA 3VH9A 1YQEA 5JGFA 1QSRA 2JBKA 2G3TA 2I3CA 4Y49C 2V8GA 4PV6A 1Q2DA 3PBBA 3PRTA 4C9UA 3IC1A 3O8ZA 1F2OA 1Z5RA 2BUEA 4PXCA 1LFWA 3NOJA 5J1QA 4EWTA 1XE4A 4BD9A 2YGWA 4C99A 4F0YA 4E94A 2OU2A 3TLAA 1BPMA 1KBLA 3WABA 2C27A 3QB8A 1FBVA 2X7BA 3DGVA 1PUAA 4UCMA 3VROA 2B4DA 3SHPA 4C8CA 2CXAA 3TLGB 4KUBA 1H8LA 1KUXA 4C7IA 1TF8A 4MXUA 2C6CA 2P6EA 2AFSA 1NE9A 4MFQA 3TLYA 1YREA 4A4CA 1NBWA 3S9LA 3R9GA 1KEEB 4HPSA 1NSAA 4M6IA 3L2NA 4KVME 2D0OA 1DTDA 1S7KA 4DNCA 2P6GA 3K9UA 4MMOA 3ICUA 2ZEFA 5I4MA 3FRMA 3CPXA 1V6CA 5K8MA 4A33A 1RO5A 2PJ0A 1Z9EA 2Y1MA 4B10A 3DNSA 2BEIA 4FWUA 5G22A 4KSFA 4IUSA 2XEJA 1FY7A 4C8PA 3MGDA 3FVLA 3OAKA 1QMUA 2ZW5A 4LQGA 4RS2A 2PJ2A 3KHZA 4RI1A 1CP6A 2PJ4A 2RB7A 4GS4A 3FXTA 4PXEA 4RUHA 4CO9A 3JUWA 4P4DA 2RFHA 2POKA 2ZEPA 4A95A 4MFKA 4RR2B 3NE7A 2K5TA 2NYQA 2C6PA 5J3XA 1VKCA 3E0KA 3PP9A 3T8WA 2Q43A 5CBMA 4LQ6A 2GIVA 1YX0A 3WR7A 4CRZB 4CDKA 3UY5A 3K4IA 2GFQA 1KZFA 4XPDB 1J3LA 2OH1A 4P4IA 3N7ZA 4MFPA 5H84A 1Q5XA 3VRPA 2B5GB 2Q51A 2Q4YA 4FD6A 4MHZA 4NGRA 5K8OA 3KKWA 1CPSA 5THWA 4HNYB 4R76A 1TXRA 1YVOA 1Z9UA 1EE3P 4UEFA 5C82A 1XF1A 4P10A 4UA3A 3U88C 5DS0A 4F6AA 3PEIA 3R96A 4M3SA 1YSJA 2ODFA 4HNXB 1YR0A 1MJBA 4E2AA 4MJXA 4KSAA 4F8ZA 4FD4A 2HB6A 4NCZA 3F5BA 4A38A 3TTHA 2WSAA 1Q2YA 3PB9X 4IAVA 1IU8A 1P0HA 3D7GA 1Y7RA 2GREA 3FNCA 1M6VB 1S5KA 1VHOA 3TX8A 3PT1A 3ISZA 4H6ZA 2Q04A 2JBJA 1VBGA 4L89A 4JXQA 3S9NA 2XPOA 1YVKA 4HNWB 4R3KA 4INJA 1IYLA 2Q44A 4KLWA 4NJQA 3S6KA 3TO9A 4CAFA 2CTBA 1R61A 4AXVA 4KUAA 2YNDA 1LAMA 2J9AA 2PIYA 2Q0YA 3KGQA 2OB0A 2FL4A 2PJCA 4NGQA 1BOBA 1U6MA 4KOWA 5CNPA 1AMPA 5GCNA 4AVBA 2C5QA 2HWGA 1CM0A 4IIXA 5D29A 4R8FA 5F48A 3V8IA 4YFJA 4Q36A 4C9EA 5AGEA 4A30A 2Z10A 2JDDA 2O4HA 4XPLA 3IWGA 3D2MA 4CYQA 3WC5A 2PJBA 5HVHA 2AFUA 1CJWA 3B2YA 3CT9A 2P0WA 3NA6A 2V8VA 4UEZA 4UIAA 4B5PA 3VWEA 5JQ4A 1HEEA 3D4UA 1M1DA 4YRHA 3IWEA 4H1HA 2EK9A 1NSLA 1B47A 2V77A 3W6SA 2EZBA 2VXKA 5H86A 5LRKA 3TLZA 4U9YA 4C85A 4MJ8A 2B4JC 4JYWA 3GB0A 4CRYB 4ZI6A 4CPAA 5LYLA 3K9TA 3IIBA 3LODA 3B8GA 3KL9A 4NGNA 5K8NA 4B6ZA 5LYIA 2Y1NA 4KSIA 2PCUA 4R3LA 3D68A 3TO7A 2AUNA 1ZLIA 2PJ5A 3FIXA 3IJ3A 2REFA 3IGRA 4A2ZA 4FD7A 4K3NA 1RXTA 1RTQA 2QVPA 4KOYA 4PXDA 1IICA 4KVXA 4A31A 2ZEGA 4YWYA 2OOTA 1TIQA 1PU9A 2FCKA 2R8VA 5G1ZA 3CXQA 3RNZA 2HV2A 4QVTA 3R9FA 3G8WA 4FAIA 1JQGA 2BSWA 2XPNA 3V7ZA 4P44A 2E28A 3BJ8A 2YNEA 3T05A 1S60A 1A2ZA 1Y0RA 3PBEA 4ONWA 4C68A 1ZL0A 1TKFA 2IMOA 3QAYA 4C2YA 2BCOA 1WJTA 4QC6A 5BY0A 1IYKA 3DLJA 4YN3A 1EO0A 4H6UA 1CP7A 4C8AA 3ZZIA 3KQXA 5JYBA 3DSBA 2IJZA 3P2HA 4KZTA 4UWJA 4YU9A 4MCPA 4B13A 5AG4A 5F9MA 3T0TA 1Z8WA 3R9EA 3VTAA 4EMEA 5BWAB 3TYXA 4R7MA 1A9XB 4C2XA 1YK3A 1M44A 2NMTA 1R43A 4MCSA 1QSNA 2WZNA 4YGOA 5EBVA 4OC2A 4UFWA 1X10A 1MJ9A 1QSOA 2EBJA 2O28A 3KR4A 3PB4X 4M85A 4ZGYB 2KCWA 4TWEA 1VHSA 2ZXVA 3PGPA 4TJVA 4KS9A 4COBA 3GLJA 2FVGA 3OB2B 2VQYA 3H8FA 3LMSA 3QNVA 3FYNA 1ZYMA 5F47A 2PJ1A 1HDQA 1MK4A 4H2KA 1C3OB 4F9UA 2EUIA 4ZX8A 2WUUA 5HKYA 4OIWA 4NGTA 4BPUB 3EC4A 3H4QA 3HLPA 3TFYA 3F9KC 4B12A 4IIYA 1GYTA 2PRBA 1F2PA 1I12A 4CGNA 1ZG8A 4CGLA 1ZRSA 4J0NA 3EY5A 4OC3A 5IR2A 2CBLA 4CAVA 2PVWA 3W6XA 4AVAA 5IV0A 3FBUA 3GJZA 5IX3A 3IEHA 3MN8A 4IHMA 4NF1A 5JPHA 3D2PA 2O53A 5K99A 4EVYA 4JLYA 1Z4EA 2PE3A 1TF9A 2PCNA 2B0AA 2YJTA 2MP0A 1XEBA 2IL4A 3FJUA 2XEFA 3BUOB 2Z3MA 4NSQA 4Z65A 4OADA 4PSWA 2CNSA 2GU2A 2VL1A 3G23A 1XJOA 5ISVA 3HUVA 4L8AA 2PVVA 4GPLB 4OC4A 5F09A 3BUXB 3FMCA 4UWIA 1S7NA 2REEA 4UCNA 5HVFA 3W91A 1K4JA 3CXPA 2G0BA 3D8PA 2BOAA 3KHXA 1HDUA 2B5GA 5CPAA 1XRYA 2PJAA 3RBUA 5JVLA 2R1IA 1UFHA 3SI2A 1FNOA 2G3AA 1TKHA 3WC7A 4FUUA 1BAVA 5A27A 4QBJA 4IF5A 3PFVA 3F8KA 1LRZA 2WYRA 4OMEA 5F49A 4F0XA 2FS5A 7CPAA 2OLSA 4LUAA 2PJ6A 3B3CA 3SI0A 3VARA 4TJXA 3KASA 4NXYA 4OKOA 2J8NA 4OAEA 2CF4A 2CTCA 5HMNA 3BLNA 2OZUA 3BI1A 1XMBA 2P6FA 1N71A 2B3VA 3S6GA 4CZ1A 1B6BA 6CPAA 2Q7BA 1T36B 4G1PA 5AXIA 5IB0A 3OP0A 4JVOA 1BXRB 3NFQA 1SQHA 1V0CA 2RC4A 3IWWA 2ZW4A 2PR8A 5FD8A 3NH5A 3C8OA 1ZG9A 4E5SA 4X5KA 3TE4A 1Y7EA 2VEZA 3ISXA 2DLAA 1LOKA 4PQAA 2H5MA 4FD5A 3TLBA 1Z8XA 1YVHA 4ZYQA 3T07A 4IK2A 3CZXA 1Z8TA 4KVOE 3N5FA 3NH8A 3SXNA 3PZJA 5J8FA 4COGA 4XPDC 1P4NA 1TKJA 2PIZA 1QQ9A 3CDXA 3JTKA 3VRNA 1ZLHA 3OB1B 4MHDA 3BUWB 5F5XA 3TO6A 4P4EA 4MHPA 1JWQA 4NJRA 3KRVA 4MHNA 4F9VA 3TLEA 4MY0A 4W9YA 2AUMA 4MCRA 4AVCA 4JZ0A 1BO4A 1LCPA 1WVMA 5J8CA 4KOVA 4MCQA 4UIBA 4A39A 4CS0B 4OC5A 4ZX9A 5HVGA 3FEDA 2GANA 4CYNA 2IQ6A 3LWUA 4OLLA 4P45A 4R87A 4A94A 1Y0YA 4CDJA 3SJFA 3S6FA 2PSWA 3I1UA 4WJBA 3SJEA 4PPZA 4P4BA 2EO8A 4BPXB 3FB3A 2WPXA 1JDEA 4MI1A 2FIAA 4HKFA 3D3SA 2YNCC 1YW6A 2PRQA 2AFXA 3D66A 3IO1A 3LD2A 2OZGA 5EC4A 4ZBGA 5LRGA 3IFEA 1M4DA 2Z3OA 3VGOA 4B5OA 4II9A 1EZAA 4NGPA 4LX9A 3SJGA 2Z0ZA 4B5PB 4GM5A 5KTDA 4AB7A 3QAHA 3VWDA 2F7VA 4U9ZA 2OR4A 3DR8A 3B3TA 3NE8A 4AG9A 1LAPA 1DIKA 1XMTA 4OP4A 4C86A 5DWNA 3PFOA 1X12A 1KUYA 1B87A 4QB9A 4CGPA 3PB7X 2ZENA 2CNMA 1NXJA 3OWCA 5D8NA 1L0CA 4DYOA 4ONUA 4NGSA 2B4BA 2I00A 5EMIA 5I0CA 5G20A 5KTAA 2YJVA 1R57A 4I49A 4EFDA 2PDOA 4FBEA 4B14A 2AE6A 4KOTA 4BBHA 3SI1A 1IY7A 3PFEA 2I79A 2J8MA 4JJXA 4JWPA 3BHXA 3TLGA 1Q2CA 3S6HA 3T90A 4A4BA 4Q7AA 3BXMA 4BMHA 2VKZG 2XEIA 2AFOA 2ZEEA 1IB1E 1ELLP 1ON0A 2R98A 3GIUA 4UF4A 4CYPA 5K8PA 1Z2LA 3T5MA 3CXSA 4X8IA 2V8DA 1M4IA 2ZEOA 1VI4A 5JM6A 1M4LA 2ABZA 2D4OA 2R82A 3FH4A 3VATA 2GE3A 3NFZA 4UFXA 3H5ZA 3C26A 1CPXA 1PYTB 5LYDA 3BUMB 2EVNA 2EK8A 4B11A 4UEEA 2PJ7A 3HMJG 2QMLA 5HKWA 3BUNB 3GYAA 4BTFA 2B4DB 2F5IA 4A32A 4BINA 1VIXA 4M8DA 4OC0A 5AG5A 5IB9A 3RAMA 1XIXA 3EIFA 4KOUA 3VRQA 2Q4VA 1J4JA 4E0AA 1C30B 5A28A 4NEXA 4MFJA 2ZOGA 3I6SA 1EZBA 5HH1A 1WWZA 3VRRA 2ANPA 4OC1A 4M6GA 4CAWA 4JD6A 3B35A 1ZG7A 4UCPA 2OZHA 2PR1A 2AFWA 2EWBA 2PQ8A 3U1BA 5ELYA 3EZBA 1CS0B 2GLFA 2VZYA 4PSXA 4XNHB 4OIDA 1S7FA 2B3UA 4C9VA 3I74A 2CIJA 3TLCA 1S3ZA 2PC1A 4RN7A 5AG7A 2HROA 4UBRA 2CNTA 3EZAA 1IOIA 2D4PA 5C88A 4P4JA 4NGMA 2QIRA 2GLJA 4R9MA 5LRJA 2HQYA 3KI9A 1ZO0A 2FE7A 2FXFA 3K2KA 3G3SA 4EYSA 2VI7A 4H89A 4TNUA 4AG7A 5F46A 2N3AB 3GUXA 3PLFB 2AFZA 4GXHA 3D7FA 1I21A 1Z8LA 4K30A 3FEEA 3B3WA 1QSMA 1YLEA 2Z3PA 2ARHA 2CY2A 3D7HA 2B58A 1ARLA 4BPWB 1GGOA 4C8FA 1GHEA 3NH4A 4C8UA 1KC7A 3RYOA 4KOSA 2EZCA 4C9RA 3FECA 2ZW6A 2DPSA 2Y0MA 1F57A 3BI0A 1NMTA 2R7HA 1VGYA 2DEAA 1MJAA 1XFOA 4P6YA 4CAEA 1VHEA 1M4GA 5G21A 2ZELA 1WK4A 1Y9WA 3A9LA 3JRUA 4MY3A 5DWMA 3TOBA 1QSTA 2DF5A 1AUGA 1KUVA 2PJ3A 2XPLA 2Z11A 2Z3KA 3EFAA 3IU1A 4MBUA 3B3VA 4R6TA 2PJ8A 1XBUA 2J8RA 1YGHA 3TCVA 3MRUA 2FM4A 2YNCA 1Q7LA 3KZWA 4MHYA 4MI4A 2FIWA 2A4NA 2BL1A 4XNHC 3ZNIA 1OBRA 2DXQA 3FF3A 3I3GA 1DE4C 1YMEA 2JLMA 2Q4ZA 2ZPAA 4QUSA 3SXOA 5LYFA 2AJ6A 4M6HA 3FX6A 3F0AA 3D7DA 4KORA 4NFRA 1AYEA 1YLOA 2ZOFA 8CPAA 4ORFA 2PJ9A 4U5YA 4C9AA 4E8OA 2QJ8A 5HKZA 2Z3NA 2JDCA 2QECA 2QYVA 2VZZA 3BJ7A 3PB8X 4MFLA 2XEGA 4ZY0A 2D0PA 4C8TA 5AG6A 2UV8G 1ARMA 2WPWA 1XOVA 4JXRA 4MFZA 2Z3LA 4C7HA 5HXDA 4KOXA 1CX8A 1KWMA 3KQZA 2C6GA 1XF8A 3EO4A 3EZEA 4C2ZA 4DUKA 4PXBA 2DPTA 2ZEHA 3H8GA 3RO0A 1Y9ZA 1BLLE 3GY9A
chains in the Genus database with same CATH topology
3TC8A 2HC9A 3RZAA 2V8HA 1UWYA 3D67A 2GP4A 5JH9A 2JEWA 2ZEMA 2NSMA 4ZY1A 3WT4A 3KR5A 1YW4A 4DJLA 1R3NA 3B7IA 1PCAA 3H8EA 2F8HA 4MRIA 4X3RA 2BO9A 4A37A 4X2TA 4WWVA 1LANA 4C84A 3CPAA 2ZEDA 4O23A 1FT7A 1CBXA 4ZY2A 1BPNA 2AFMA 2C1CA 4P4FA 1ELMP 1IGBA 3WC6A 1CG2A 3PB6X 3S9MA 3B3SA 2G9DA 3V38A 3VH9A 3SJXA 5JGFA 2I3CA 2JBKA 2V8GA 3PBBA 3PRTA 4C9UA 3IC1A 1F2OA 1Z5RA 4PXCA 1LFWA 5J1QA 4EWTA 4BD9A 4C99A 1BPMA 3WABA 3DGVA 4C8CA 1H8LA 1TF8A 4MXUA 2C6CA 2AFSA 3S9LA 1NSAA 3L2NA 1DTDA 4MMOA 3ICUA 2ZEFA 5I4MA 3CPXA 1V6CA 5K8MA 2PJ0A 4FWUA 2XEJA 4C8PA 3FVLA 1QMUA 4LQGA 2PJ2A 3KHZA 1CP6A 2PJ4A 2RB7A 4PXEA 4RUHA 4P4DA 2RFHA 2POKA 2ZEPA 2NYQA 2C6PA 3T8WA 2Q43A 5CBMA 4CDKA 4P4IA 2Q51A 4MHZA 5K8OA 4NGRA 1CPSA 5THWA 4R76A 1TXRA 1XF1A 1EE3P 4UEFA 4P10A 5DS0A 3PEIA 1YSJA 4F8ZA 2HB6A 4A38A 3PB9X 4IAVA 2GREA 3D7GA 1VHOA 3TX8A 3ISZA 2JBJA 5IR2A 3S9NA 4NJQA 2CTBA 4AXVA 1LAMA 2J9AA 2PIYA 3KGQA 2PJCA 4NGQA 1AMPA 2C5QA 4C9EA 5D29A 4R8FA 2O4HA 3WC5A 2PJBA 5HVHA 2AFUA 3B2YA 3CT9A 4UEZA 4UIAA 3NA6A 2V8VA 1HEEA 3D4UA 2EK9A 2V77A 5LRKA 4C85A 4JYWA 3GB0A 4ZI6A 4CPAA 5LYLA 3K9TA 3IIBA 3KL9A 4NGNA 5K8NA 4B6ZA 5LYIA 4KSIA 2PCUA 3D68A 1ZLIA 2PJ5A 3IJ3A 4K3NA 2QVPA 1RTQA 4PXDA 4ZY0A 2ZEGA 4YWYA 2OOTA 1JQGA 3V7ZA 4P44A 1Y0RA 4ONWA 3PBEA 1TKFA 2IMOA 2BCOA 3DLJA 4YN3A 1CP7A 4C8AA 3KQXA 2IJZA 4YU9A 4MCPA 3VTAA 4EMEA 4R7MA 1R43A 4MCSA 2WZNA 4OC2A 3KR4A 3PB4X 4TWEA 4TJVA 3GLJA 2FVGA 3H8FA 3LMSA 3QNVA 2PJ1A 1HDQA 4H2KA 4F9UA 4ZX8A 4OIWA 4NGTA 3HLPA 1GYTA 1F2PA 1ZG8A 4OC3A 2PVWA 3IEHA 3MN8A 4IHMA 2O53A 2PE3A 1TF9A 3FJUA 4Z65A 2XEFA 2VL1A 2GU2A 4KNGE 1XJOA 3HUVA 2PVVA 4OC4A 5F09A 3FMCA 5HVFA 2BOAA 3KHXA 1HDUA 5CPAA 1XRYA 2PJAA 3RBUA 3SI2A 1FNOA 1TKHA 3WC7A 4FUUA 1BAVA 2WYRA 4OMEA 7CPAA 3SI0A 2PJ6A 3B3CA 3VARA 4TJXA 3KASA 4OKOA 2CF4A 2CTCA 3BI1A 1XMBA 6CPAA 4G1PA 3IWWA 3NH5A 1ZG9A 1Y7EA 3ISXA 4PQAA 1LOKA 4ZYQA 4IK2A 3N5FA 3NH8A 1TKJA 2PIZA 1QQ9A 3CDXA 1ZLHA 4P4EA 4MHPA 4NJRA 4MHNA 4F9VA 4W9YA 4MCRA 4JZ0A 1LCPA 1WVMA 4UIBA 4MCQA 4A39A 4OC5A 4ZX9A 5HVGA 3FEDA 2IQ6A 3LWUA 4P45A 4A94A 1Y0YA 3SJFA 3I1UA 4WJBA 3SJEA 4PPZA 4P4BA 1YW6A 2PRQA 2AFXA 3D66A 3IO1A 5LRGA 3IFEA 4NGPA 3SJGA 4GM5A 2F7VA 2OR4A 3B3TA 1LAPA 4C86A 4OP4A 3PFOA 3PB7X 2ZENA 5D8NA 4DYOA 4NGSA 4EFDA 4FBEA 3SI1A 1IY7A 3PFEA 3BHXA 4Q7AA 3BXMA 2AFOA 2XEIA 2ZEEA 1ELLP 5K8PA 4UF4A 1Z2LA 4X8IA 2V8DA 2ZEOA 5JM6A 1M4LA 2ABZA 3FH4A 3VATA 3NFZA 5LYDA 1CPXA 1PYTB 2EK8A 4UEEA 2PJ7A 1VIXA 4OC0A 5IB9A 3RAMA 3EIFA 3I6SA 2ZOGA 2ANPA 4OC1A 3B35A 1ZG7A 2AFWA 2EWBA 5ELYA 2GLFA 4OIDA 4C9VA 3I74A 2CIJA 4CDJA 4P4JA 4NGMA 2GLJA 5LRJA 3KI9A 3K2KA 4TNUA 3GUXA 2AFZA 3D7FA 1Z8LA 3FEEA 3B3WA 3D7HA 1ARLA 4C8FA 3NH4A 4C8UA 4C9RA 3FECA 1F57A 3BI0A 1VGYA 2DEAA 1XFOA 4P6YA 1VHEA 2ZELA 3JRUA 4FAIA 2PJ3A 4R6TA 3B3VA 2PJ8A 1XBUA 3MRUA 4MHYA 1Q7LA 3KZWA 1OBRA 3FF3A 1DE4C 1YMEA 2Q4ZA 5LYFA 3FX6A 3D7DA 4NFRA 1AYEA 1YLOA 2ZOFA 8CPAA 2PJ9A 4C9AA 2QJ8A 2QYVA 3PB8X 2XEGA 4C8TA 1ARMA 5HXDA 1CX8A 1KWMA 3KQZA 2C6GA 4DUKA 4PXBA 2ZEHA 3H8GA 1Y9ZA 1BLLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TC8 A;  2HC9 A;  3RZA A;  2V8H A;  1UWY A;  3D67 A;  5JH9 A;  2JEW A;  2ZEM A;  2NSM A;  4ZY1 A;  3WT4 A;  3KR5 A;  1YW4 A;  4DJL A;  1R3N A;  3B7I A;  1PCA A;  3H8E A;  2F8H A;  4MRI A;  4X3R A;  2BO9 A;  4A37 A;  4X2T A;  4WWV A;  1LAN A;  4C84 A;  3CPA A;  2ZED A;  4O23 A;  1FT7 A;  1CBX A;  4ZY2 A;  1BPN A;  2AFM A;  2C1C A;  4P4F A;  1ELM P;  1IGB A;  3WC6 A;  1CG2 A;  3PB6 X;  3S9M A;  3B3S A;  2G9D A;  3V38 A;  3VH9 A;  3SJX A;  5JGF A;  2I3C A;  2JBK A;  2V8G A;  3PBB A;  3PRT A;  4C9U A;  3IC1 A;  1F2O A;  1Z5R A;  4PXC A;  1LFW A;  5J1Q A;  4EWT A;  4BD9 A;  4C99 A;  1BPM A;  3WAB A;  3DGV A;  4C8C A;  1H8L A;  1TF8 A;  4MXU A;  2C6C A;  2AFS A;  3S9L A;  1NSA A;  3L2N A;  1DTD A;  4MMO A;  3ICU A;  2ZEF A;  5I4M A;  3CPX A;  1V6C A;  5K8M A;  2PJ0 A;  4FWU A;  2XEJ A;  4C8P A;  3FVL A;  1QMU A;  4LQG A;  2PJ2 A;  3KHZ A;  1CP6 A;  2PJ4 A;  2RB7 A;  4PXE A;  4RUH A;  4P4D A;  2RFH A;  2POK A;  2ZEP A;  2NYQ A;  2C6P A;  3T8W A;  2Q43 A;  5CBM A;  4CDK A;  4P4I A;  2Q51 A;  4MHZ A;  5K8O A;  4NGR A;  1CPS A;  5THW A;  4R76 A;  1TXR A;  1XF1 A;  1EE3 P;  4UEF A;  4P10 A;  5DS0 A;  3PEI A;  1YSJ A;  4F8Z A;  2HB6 A;  4A38 A;  3PB9 X;  4IAV A;  2GRE A;  3D7G A;  1VHO A;  3TX8 A;  3ISZ A;  2JBJ A;  3S9N A;  4NJQ A;  2CTB A;  4AXV A;  1LAM A;  2J9A A;  2PIY A;  3KGQ A;  2PJC A;  4NGQ A;  1AMP A;  4C9E A;  5D29 A;  4R8F A;  2O4H A;  3WC5 A;  2PJB A;  5HVH A;  2AFU A;  3B2Y A;  3CT9 A;  4UEZ A;  4UIA A;  3NA6 A;  2V8V A;  1HEE A;  3D4U A;  2EK9 A;  2V77 A;  5LRK A;  4C85 A;  4JYW A;  3GB0 A;  4ZI6 A;  4CPA A;  5LYL A;  3K9T A;  3IIB A;  3KL9 A;  4NGN A;  5K8N A;  4B6Z A;  5LYI A;  4KSI A;  2PCU A;  3D68 A;  1ZLI A;  2PJ5 A;  3IJ3 A;  4K3N A;  2QVP A;  1RTQ A;  4PXD A;  4ZY0 A;  2ZEG A;  4YWY A;  2OOT A;  1JQG A;  3V7Z A;  4P44 A;  1Y0R A;  4ONW A;  3PBE A;  1TKF A;  2IMO A;  2BCO A;  3DLJ A;  4YN3 A;  1CP7 A;  4C8A A;  3KQX A;  2IJZ A;  4YU9 A;  4MCP A;  3VTA A;  4EME A;  4R7M A;  1R43 A;  4MCS A;  2WZN A;  4OC2 A;  3KR4 A;  3PB4 X;  4TWE A;  4TJV A;  3GLJ A;  2FVG A;  3H8F A;  3LMS A;  3QNV A;  2PJ1 A;  1HDQ A;  4H2K A;  4F9U A;  4ZX8 A;  4OIW A;  4NGT A;  3HLP A;  1GYT A;  1F2P A;  1ZG8 A;  4OC3 A;  2PVW A;  3IEH A;  3MN8 A;  4IHM A;  2O53 A;  2PE3 A;  1TF9 A;  3FJU A;  4Z65 A;  2XEF A;  2VL1 A;  2GU2 A;  4KNG E;  1XJO A;  3HUV A;  2PVV A;  4OC4 A;  5F09 A;  3FMC A;  5HVF A;  2BOA A;  3KHX A;  1HDU A;  5CPA A;  1XRY A;  2PJA A;  3RBU A;  3SI2 A;  1FNO A;  1TKH A;  3WC7 A;  4FUU A;  1BAV A;  2WYR A;  4OME A;  7CPA A;  3SI0 A;  2PJ6 A;  3B3C A;  3VAR A;  4TJX A;  3KAS A;  4OKO A;  2CF4 A;  2CTC A;  3BI1 A;  1XMB A;  6CPA A;  4G1P A;  3IWW A;  3NH5 A;  1ZG9 A;  1Y7E A;  3ISX A;  4PQA A;  1LOK A;  4ZYQ A;  4IK2 A;  3N5F A;  3NH8 A;  1TKJ A;  2PIZ A;  1QQ9 A;  3CDX A;  1ZLH A;  4P4E A;  4MHP A;  4NJR A;  4MHN A;  4F9V A;  4W9Y A;  4MCR A;  4JZ0 A;  1LCP A;  1WVM A;  4UIB A;  4MCQ A;  4A39 A;  4OC5 A;  4ZX9 A;  5HVG A;  3FED A;  2IQ6 A;  3LWU A;  4P45 A;  4A94 A;  1Y0Y A;  3SJF A;  3I1U A;  4WJB A;  3SJE A;  4PPZ A;  4P4B A;  1YW6 A;  2PRQ A;  2AFX A;  3D66 A;  3IO1 A;  5LRG A;  3IFE A;  4NGP A;  3SJG A;  4GM5 A;  2F7V A;  2OR4 A;  3B3T A;  1LAP A;  4C86 A;  4OP4 A;  3PFO A;  3PB7 X;  2ZEN A;  5D8N A;  4DYO A;  4NGS A;  4EFD A;  4FBE A;  3SI1 A;  1IY7 A;  3PFE A;  3BHX A;  4Q7A A;  3BXM A;  2AFO A;  2XEI A;  2ZEE A;  1ELL P;  5K8P A;  4UF4 A;  1Z2L A;  4X8I A;  2V8D A;  2ZEO A;  5JM6 A;  1M4L A;  2ABZ A;  3FH4 A;  3VAT A;  3NFZ A;  5LYD A;  1CPX A;  1PYT B;  2EK8 A;  4UEE A;  2PJ7 A;  1VIX A;  4OC0 A;  5IB9 A;  3RAM A;  3EIF A;  3I6S A;  2ZOG A;  2ANP A;  4OC1 A;  3B35 A;  1ZG7 A;  2AFW A;  2EWB A;  5ELY A;  2GLF A;  4OID A;  4C9V A;  3I74 A;  2CIJ A;  4CDJ A;  4P4J A;  4NGM A;  2GLJ A;  5LRJ A;  3KI9 A;  3K2K A;  4TNU A;  3GUX A;  2AFZ A;  3D7F A;  1Z8L A;  3FEE A;  3B3W A;  3D7H A;  1ARL A;  4C8F A;  3NH4 A;  4C8U A;  4C9R A;  3FEC A;  1F57 A;  3BI0 A;  1VGY A;  2DEA A;  1XFO A;  4P6Y A;  1VHE A;  2ZEL A;  3JRU A;  4FAI A;  2PJ3 A;  4R6T A;  3B3V A;  2PJ8 A;  1XBU A;  3MRU A;  4MHY A;  1Q7L A;  3KZW A;  1OBR A;  3FF3 A;  1DE4 C;  1YME A;  2Q4Z A;  5LYF A;  3FX6 A;  3D7D A;  4NFR A;  1AYE A;  1YLO A;  2ZOF A;  8CPA A;  2PJ9 A;  4C9A A;  2QJ8 A;  2QYV A;  3PB8 X;  2XEG A;  4C8T A;  1ARM A;  5HXD A;  1CX8 A;  1KWM A;  3KQZ A;  2C6G A;  4DUK A;  4PXB A;  2ZEH A;  3H8G A;  1Y9Z A;  1BLL E; 
#chains in the Genus database with same CATH topology
 3TC8 A;  2HC9 A;  4Y49 B;  5KTC A;  3LAC A;  3T9Y A;  3R1K A;  3RZA A;  2FSR A;  5F1Y A;  2V8H A;  4J3G A;  1UWY A;  1I1D A;  3D67 A;  4KNG E;  5E96 A;  2GP4 A;  1Z4R A;  5JH9 A;  1VBH A;  1IID A;  4CAX A;  2JEW A;  3P2F A;  2ZEM A;  2NSM A;  3I9S A;  4ZY1 A;  3WT4 A;  4CGM A;  1JDB C;  3KR5 A;  4PK2 A;  3TT2 A;  1YW4 A;  4DJL A;  2Q7S A;  2VBQ A;  1R3N A;  3B7I A;  1CE8 B;  1PCA A;  3H8E A;  2EZA A;  2F8H A;  3DDD A;  3JVN A;  4MRI A;  4X3R A;  2BO9 A;  2JEV A;  2FT0 A;  3HPG G;  2ZW7 A;  4PK3 A;  4WWV A;  1LAN A;  4X2T A;  4A37 A;  3CPA A;  1Y9K A;  2ZED A;  4C84 A;  4O23 A;  1FT7 A;  3SR3 A;  1CBX A;  1S7L A;  4XPK A;  4UFV A;  2X0S A;  4R57 A;  5FVJ A;  4ZY2 A;  3GKR A;  1IOF A;  3TOA A;  4Q38 A;  1BPN A;  2AFM A;  3R95 A;  3HPH E;  2C1C A;  2HUZ A;  3EXN A;  4P4F A;  1ELM P;  4CYO A;  4KLV A;  1IGB A;  2ATR A;  3IU2 A;  2XPP A;  3WC6 A;  1CG2 A;  5F13 A;  3PB6 X;  3ZJ0 A;  3S9M A;  3B3S A;  2DIK A;  2G9D A;  2HI6 A;  3V38 A;  1OZP A;  4CGO A;  3DR6 A;  3SJX A;  3VH9 A;  1YQE A;  5JGF A;  1QSR A;  2JBK A;  2G3T A;  2I3C A;  4Y49 C;  2V8G A;  4PV6 A;  1Q2D A;  3PBB A;  3PRT A;  4C9U A;  3IC1 A;  3O8Z A;  1F2O A;  1Z5R A;  2BUE A;  4PXC A;  1LFW A;  3NOJ A;  5J1Q A;  4EWT A;  1XE4 A;  4BD9 A;  2YGW A;  4C99 A;  4F0Y A;  4E94 A;  2OU2 A;  3TLA A;  1BPM A;  1KBL A;  3WAB A;  2C27 A;  3QB8 A;  1FBV A;  2X7B A;  3DGV A;  1PUA A;  4UCM A;  3VRO A;  2B4D A;  3SHP A;  4C8C A;  2CXA A;  3TLG B;  4KUB A;  1H8L A;  1KUX A;  4C7I A;  1TF8 A;  4MXU A;  2C6C A;  2P6E A;  2AFS A;  1NE9 A;  4MFQ A;  3TLY A;  1YRE A;  4A4C A;  1NBW A;  3S9L A;  3R9G A;  1KEE B;  4HPS A;  1NSA A;  4M6I A;  3L2N A;  4KVM E;  2D0O A;  1DTD A;  1S7K A;  4DNC A;  2P6G A;  3K9U A;  4MMO A;  3ICU A;  2ZEF A;  5I4M A;  3FRM A;  3CPX A;  1V6C A;  5K8M A;  4A33 A;  1RO5 A;  2PJ0 A;  1Z9E A;  2Y1M A;  4B10 A;  3DNS A;  2BEI A;  4FWU A;  5G22 A;  4KSF A;  4IUS A;  2XEJ A;  1FY7 A;  4C8P A;  3MGD A;  3FVL A;  3OAK A;  1QMU A;  2ZW5 A;  4LQG A;  4RS2 A;  2PJ2 A;  3KHZ A;  4RI1 A;  1CP6 A;  2PJ4 A;  2RB7 A;  4GS4 A;  3FXT A;  4PXE A;  4RUH A;  4CO9 A;  3JUW A;  4P4D A;  2RFH A;  2POK A;  2ZEP A;  4A95 A;  4MFK A;  4RR2 B;  3NE7 A;  2K5T A;  2NYQ A;  2C6P A;  5J3X A;  1VKC A;  3E0K A;  3PP9 A;  3T8W A;  2Q43 A;  5CBM A;  4LQ6 A;  2GIV A;  1YX0 A;  3WR7 A;  4CRZ B;  4CDK A;  3UY5 A;  3K4I A;  2GFQ A;  1KZF A;  4XPD B;  1J3L A;  2OH1 A;  4P4I A;  3N7Z A;  4MFP A;  5H84 A;  1Q5X A;  3VRP A;  2B5G B;  2Q51 A;  2Q4Y A;  4FD6 A;  4MHZ A;  4NGR A;  5K8O A;  3KKW A;  1CPS A;  5THW A;  4HNY B;  4R76 A;  1TXR A;  1YVO A;  1Z9U A;  1EE3 P;  4UEF A;  5C82 A;  1XF1 A;  4P10 A;  4UA3 A;  3U88 C;  5DS0 A;  4F6A A;  3PEI A;  3R96 A;  4M3S A;  1YSJ A;  2ODF A;  4HNX B;  1YR0 A;  1MJB A;  4E2A A;  4MJX A;  4KSA A;  4F8Z A;  4FD4 A;  2HB6 A;  4NCZ A;  3F5B A;  4A38 A;  3TTH A;  2WSA A;  1Q2Y A;  3PB9 X;  4IAV A;  1IU8 A;  1P0H A;  3D7G A;  1Y7R A;  2GRE A;  3FNC A;  1M6V B;  1S5K A;  1VHO A;  3TX8 A;  3PT1 A;  3ISZ A;  4H6Z A;  2Q04 A;  2JBJ A;  1VBG A;  4L89 A;  4JXQ A;  3S9N A;  2XPO A;  1YVK A;  4HNW B;  4R3K A;  4INJ A;  1IYL A;  2Q44 A;  4KLW A;  4NJQ A;  3S6K A;  3TO9 A;  4CAF A;  2CTB A;  1R61 A;  4AXV A;  4KUA A;  2YND A;  1LAM A;  2J9A A;  2PIY A;  2Q0Y A;  3KGQ A;  2OB0 A;  2FL4 A;  2PJC A;  4NGQ A;  1BOB A;  1U6M A;  4KOW A;  5CNP A;  1AMP A;  5GCN A;  4AVB A;  2C5Q A;  2HWG A;  1CM0 A;  4IIX A;  5D29 A;  4R8F A;  5F48 A;  3V8I A;  4YFJ A;  4Q36 A;  4C9E A;  5AGE A;  4A30 A;  2Z10 A;  2JDD A;  2O4H A;  4XPL A;  3IWG A;  3D2M A;  4CYQ A;  3WC5 A;  2PJB A;  5HVH A;  2AFU A;  1CJW A;  3B2Y A;  3CT9 A;  2P0W A;  3NA6 A;  2V8V A;  4UEZ A;  4UIA A;  4B5P A;  3VWE A;  5JQ4 A;  1HEE A;  3D4U A;  1M1D A;  4YRH A;  3IWE A;  4H1H A;  2EK9 A;  1NSL A;  1B47 A;  2V77 A;  3W6S A;  2EZB A;  2VXK A;  5H86 A;  5LRK A;  3TLZ A;  4U9Y A;  4C85 A;  4MJ8 A;  2B4J C;  4JYW A;  3GB0 A;  4CRY B;  4ZI6 A;  4CPA A;  5LYL A;  3K9T A;  3IIB A;  3LOD A;  3B8G A;  3KL9 A;  4NGN A;  5K8N A;  4B6Z A;  5LYI A;  2Y1N A;  4KSI A;  2PCU A;  4R3L A;  3D68 A;  3TO7 A;  2AUN A;  1ZLI A;  2PJ5 A;  3FIX A;  3IJ3 A;  2REF A;  3IGR A;  4A2Z A;  4FD7 A;  4K3N A;  1RXT A;  1RTQ A;  2QVP A;  4KOY A;  4PXD A;  1IIC A;  4KVX A;  4A31 A;  2ZEG A;  4YWY A;  2OOT A;  1TIQ A;  1PU9 A;  2FCK A;  2R8V A;  5G1Z A;  3CXQ A;  3RNZ A;  2HV2 A;  4QVT A;  3R9F A;  3G8W A;  4FAI A;  1JQG A;  2BSW A;  2XPN A;  3V7Z A;  4P44 A;  2E28 A;  3BJ8 A;  2YNE A;  3T05 A;  1S60 A;  1A2Z A;  1Y0R A;  3PBE A;  4ONW A;  4C68 A;  1ZL0 A;  1TKF A;  2IMO A;  3QAY A;  4C2Y A;  2BCO A;  1WJT A;  4QC6 A;  5BY0 A;  1IYK A;  3DLJ A;  4YN3 A;  1EO0 A;  4H6U A;  1CP7 A;  4C8A A;  3ZZI A;  3KQX A;  5JYB A;  3DSB A;  2IJZ A;  3P2H A;  4KZT A;  4UWJ A;  4YU9 A;  4MCP A;  4B13 A;  5AG4 A;  5F9M A;  3T0T A;  1Z8W A;  3R9E A;  3VTA A;  4EME A;  5BWA B;  3TYX A;  4R7M A;  1A9X B;  4C2X A;  1YK3 A;  1M44 A;  2NMT A;  1R43 A;  4MCS A;  1QSN A;  2WZN A;  4YGO A;  5EBV A;  4OC2 A;  4UFW A;  1X10 A;  1MJ9 A;  1QSO A;  2EBJ A;  2O28 A;  3KR4 A;  3PB4 X;  4M85 A;  4ZGY B;  2KCW A;  4TWE A;  1VHS A;  2ZXV A;  3PGP A;  4TJV A;  4KS9 A;  4COB A;  3GLJ A;  2FVG A;  3OB2 B;  2VQY A;  3H8F A;  3LMS A;  3QNV A;  3FYN A;  1ZYM A;  5F47 A;  2PJ1 A;  1HDQ A;  1MK4 A;  4H2K A;  1C3O B;  4F9U A;  2EUI A;  4ZX8 A;  2WUU A;  5HKY A;  4OIW A;  4NGT A;  4BPU B;  3EC4 A;  3H4Q A;  3HLP A;  3TFY A;  3F9K C;  4B12 A;  4IIY A;  1GYT A;  2PRB A;  1F2P A;  1I12 A;  4CGN A;  1ZG8 A;  4CGL A;  1ZRS A;  4J0N A;  3EY5 A;  4OC3 A;  5IR2 A;  2CBL A;  4CAV A;  2PVW A;  3W6X A;  4AVA A;  5IV0 A;  3FBU A;  3GJZ A;  5IX3 A;  3IEH A;  3MN8 A;  4IHM A;  4NF1 A;  5JPH A;  3D2P A;  2O53 A;  5K99 A;  4EVY A;  4JLY A;  1Z4E A;  2PE3 A;  1TF9 A;  2PCN A;  2B0A A;  2YJT A;  2MP0 A;  1XEB A;  2IL4 A;  3FJU A;  2XEF A;  3BUO B;  2Z3M A;  4NSQ A;  4Z65 A;  4OAD A;  4PSW A;  2CNS A;  2GU2 A;  2VL1 A;  3G23 A;  1XJO A;  5ISV A;  3HUV A;  4L8A A;  2PVV A;  4GPL B;  4OC4 A;  5F09 A;  3BUX B;  3FMC A;  4UWI A;  1S7N A;  2REE A;  4UCN A;  5HVF A;  3W91 A;  1K4J A;  3CXP A;  2G0B A;  3D8P A;  2BOA A;  3KHX A;  1HDU A;  2B5G A;  5CPA A;  1XRY A;  2PJA A;  3RBU A;  5JVL A;  2R1I A;  1UFH A;  3SI2 A;  1FNO A;  2G3A A;  1TKH A;  3WC7 A;  4FUU A;  1BAV A;  5A27 A;  4QBJ A;  4IF5 A;  3PFV A;  3F8K A;  1LRZ A;  2WYR A;  4OME A;  5F49 A;  4F0X A;  2FS5 A;  7CPA A;  2OLS A;  4LUA A;  2PJ6 A;  3B3C A;  3SI0 A;  3VAR A;  4TJX A;  3KAS A;  4NXY A;  4OKO A;  2J8N A;  4OAE A;  2CF4 A;  2CTC A;  5HMN A;  3BLN A;  2OZU A;  3BI1 A;  1XMB A;  2P6F A;  1N71 A;  2B3V A;  3S6G A;  4CZ1 A;  1B6B A;  6CPA A;  2Q7B A;  1T36 B;  4G1P A;  5AXI A;  5IB0 A;  3OP0 A;  4JVO A;  1BXR B;  3NFQ A;  1SQH A;  1V0C A;  2RC4 A;  3IWW A;  2ZW4 A;  2PR8 A;  5FD8 A;  3NH5 A;  3C8O A;  1ZG9 A;  4E5S A;  4X5K A;  3TE4 A;  1Y7E A;  2VEZ A;  3ISX A;  2DLA A;  1LOK A;  4PQA A;  2H5M A;  4FD5 A;  3TLB A;  1Z8X A;  1YVH A;  4ZYQ A;  3T07 A;  4IK2 A;  3CZX A;  1Z8T A;  4KVO E;  3N5F A;  3NH8 A;  3SXN A;  3PZJ A;  5J8F A;  4COG A;  4XPD C;  1P4N A;  1TKJ A;  2PIZ A;  1QQ9 A;  3CDX A;  3JTK A;  3VRN A;  1ZLH A;  3OB1 B;  4MHD A;  3BUW B;  5F5X A;  3TO6 A;  4P4E A;  4MHP A;  1JWQ A;  4NJR A;  3KRV A;  4MHN A;  4F9V A;  3TLE A;  4MY0 A;  4W9Y A;  2AUM A;  4MCR A;  4AVC A;  4JZ0 A;  1BO4 A;  1LCP A;  1WVM A;  5J8C A;  4KOV A;  4MCQ A;  4UIB A;  4A39 A;  4CS0 B;  4OC5 A;  4ZX9 A;  5HVG A;  3FED A;  2GAN A;  4CYN A;  2IQ6 A;  3LWU A;  4OLL A;  4P45 A;  4R87 A;  4A94 A;  1Y0Y A;  4CDJ A;  3SJF A;  3S6F A;  2PSW A;  3I1U A;  4WJB A;  3SJE A;  4PPZ A;  4P4B A;  2EO8 A;  4BPX B;  3FB3 A;  2WPX A;  1JDE A;  4MI1 A;  2FIA A;  4HKF A;  3D3S A;  2YNC C;  1YW6 A;  2PRQ A;  2AFX A;  3D66 A;  3IO1 A;  3LD2 A;  2OZG A;  5EC4 A;  4ZBG A;  5LRG A;  3IFE A;  1M4D A;  2Z3O A;  3VGO A;  4B5O A;  4II9 A;  1EZA A;  4NGP A;  4LX9 A;  3SJG A;  2Z0Z A;  4B5P B;  4GM5 A;  5KTD A;  4AB7 A;  3QAH A;  3VWD A;  2F7V A;  4U9Z A;  2OR4 A;  3DR8 A;  3B3T A;  3NE8 A;  4AG9 A;  1LAP A;  1DIK A;  1XMT A;  4OP4 A;  4C86 A;  5DWN A;  3PFO A;  1X12 A;  1KUY A;  1B87 A;  4QB9 A;  4CGP A;  3PB7 X;  2ZEN A;  2CNM A;  1NXJ A;  3OWC A;  5D8N A;  1L0C A;  4DYO A;  4ONU A;  4NGS A;  2B4B A;  2I00 A;  5EMI A;  5I0C A;  5G20 A;  5KTA A;  2YJV A;  1R57 A;  4I49 A;  4EFD A;  2PDO A;  4FBE A;  4B14 A;  2AE6 A;  4KOT A;  4BBH A;  3SI1 A;  1IY7 A;  3PFE A;  2I79 A;  2J8M A;  4JJX A;  4JWP A;  3BHX A;  3TLG A;  1Q2C A;  3S6H A;  3T90 A;  4A4B A;  4Q7A A;  3BXM A;  4BMH A;  2VKZ G;  2XEI A;  2AFO A;  2ZEE A;  1IB1 E;  1ELL P;  1ON0 A;  2R98 A;  3GIU A;  4UF4 A;  4CYP A;  5K8P A;  1Z2L A;  3T5M A;  3CXS A;  4X8I A;  2V8D A;  1M4I A;  2ZEO A;  1VI4 A;  5JM6 A;  1M4L A;  2ABZ A;  2D4O A;  2R82 A;  3FH4 A;  3VAT A;  2GE3 A;  3NFZ A;  4UFX A;  3H5Z A;  3C26 A;  1CPX A;  1PYT B;  5LYD A;  3BUM B;  2EVN A;  2EK8 A;  4B11 A;  4UEE A;  2PJ7 A;  3HMJ G;  2QML A;  5HKW A;  3BUN B;  3GYA A;  4BTF A;  2B4D B;  2F5I A;  4A32 A;  4BIN A;  1VIX A;  4M8D A;  4OC0 A;  5AG5 A;  5IB9 A;  3RAM A;  1XIX A;  3EIF A;  4KOU A;  3VRQ A;  2Q4V A;  1J4J A;  4E0A A;  1C30 B;  5A28 A;  4NEX A;  4MFJ A;  2ZOG A;  3I6S A;  1EZB A;  5HH1 A;  1WWZ A;  3VRR A;  2ANP A;  4OC1 A;  4M6G A;  4CAW A;  4JD6 A;  3B35 A;  1ZG7 A;  4UCP A;  2OZH A;  2PR1 A;  2AFW A;  2EWB A;  2PQ8 A;  3U1B A;  5ELY A;  3EZB A;  1CS0 B;  2GLF A;  2VZY A;  4PSX A;  4XNH B;  4OID A;  1S7F A;  2B3U A;  4C9V A;  3I74 A;  2CIJ A;  3TLC A;  1S3Z A;  2PC1 A;  4RN7 A;  5AG7 A;  2HRO A;  4UBR A;  2CNT A;  3EZA A;  1IOI A;  2D4P A;  5C88 A;  4P4J A;  4NGM A;  2QIR A;  2GLJ A;  4R9M A;  5LRJ A;  2HQY A;  3KI9 A;  1ZO0 A;  2FE7 A;  2FXF A;  3K2K A;  3G3S A;  4EYS A;  2VI7 A;  4H89 A;  4TNU A;  4AG7 A;  5F46 A;  2N3A B;  3GUX A;  3PLF B;  2AFZ A;  4GXH A;  3D7F A;  1I21 A;  1Z8L A;  4K30 A;  3FEE A;  3B3W A;  1QSM A;  1YLE A;  2Z3P A;  2ARH A;  2CY2 A;  3D7H A;  2B58 A;  1ARL A;  4BPW B;  1GGO A;  4C8F A;  1GHE A;  3NH4 A;  4C8U A;  1KC7 A;  3RYO A;  4KOS A;  2EZC A;  4C9R A;  3FEC A;  2ZW6 A;  2DPS A;  2Y0M A;  1F57 A;  3BI0 A;  1NMT A;  2R7H A;  1VGY A;  2DEA A;  1MJA A;  1XFO A;  4P6Y A;  4CAE A;  1VHE A;  1M4G A;  5G21 A;  2ZEL A;  1WK4 A;  1Y9W A;  3A9L A;  3JRU A;  4MY3 A;  5DWM A;  3TOB A;  1QST A;  2DF5 A;  1AUG A;  1KUV A;  2PJ3 A;  2XPL A;  2Z11 A;  2Z3K A;  3EFA A;  3IU1 A;  4MBU A;  3B3V A;  4R6T A;  2PJ8 A;  1XBU A;  2J8R A;  1YGH A;  3TCV A;  3MRU A;  2FM4 A;  2YNC A;  1Q7L A;  3KZW A;  4MHY A;  4MI4 A;  2FIW A;  2A4N A;  2BL1 A;  4XNH C;  3ZNI A;  1OBR A;  2DXQ A;  3FF3 A;  3I3G A;  1DE4 C;  1YME A;  2JLM A;  2Q4Z A;  2ZPA A;  4QUS A;  3SXO A;  5LYF A;  2AJ6 A;  4M6H A;  3FX6 A;  3F0A A;  3D7D A;  4KOR A;  4NFR A;  1AYE A;  1YLO A;  2ZOF A;  8CPA A;  4ORF A;  2PJ9 A;  4U5Y A;  4C9A A;  4E8O A;  2QJ8 A;  5HKZ A;  2Z3N A;  2JDC A;  2QEC A;  2QYV A;  2VZZ A;  3BJ7 A;  3PB8 X;  4MFL A;  2XEG A;  4ZY0 A;  2D0P A;  4C8T A;  5AG6 A;  2UV8 G;  1ARM A;  2WPW A;  1XOV A;  4JXR A;  4MFZ A;  2Z3L A;  4C7H A;  5HXD A;  4KOX A;  1CX8 A;  1KWM A;  3KQZ A;  2C6G A;  1XF8 A;  3EO4 A;  3EZE A;  4C2Z A;  4DUK A;  4PXB A;  2DPT A;  2ZEH A;  3H8G A;  3RO0 A;  1Y9Z A;  1BLL E;  3GY9 A; 
#chains in the Genus database with same CATH homology
 3TC8 A;  2HC9 A;  3RZA A;  2V8H A;  1UWY A;  3D67 A;  2GP4 A;  5JH9 A;  2JEW A;  2ZEM A;  2NSM A;  4ZY1 A;  3WT4 A;  3KR5 A;  1YW4 A;  4DJL A;  1R3N A;  3B7I A;  1PCA A;  3H8E A;  2F8H A;  4MRI A;  4X3R A;  2BO9 A;  4A37 A;  4X2T A;  4WWV A;  1LAN A;  4C84 A;  3CPA A;  2ZED A;  4O23 A;  1FT7 A;  1CBX A;  4ZY2 A;  1BPN A;  2AFM A;  2C1C A;  4P4F A;  1ELM P;  1IGB A;  3WC6 A;  1CG2 A;  3PB6 X;  3S9M A;  3B3S A;  2G9D A;  3V38 A;  3VH9 A;  3SJX A;  5JGF A;  2I3C A;  2JBK A;  2V8G A;  3PBB A;  3PRT A;  4C9U A;  3IC1 A;  1F2O A;  1Z5R A;  4PXC A;  1LFW A;  5J1Q A;  4EWT A;  4BD9 A;  4C99 A;  1BPM A;  3WAB A;  3DGV A;  4C8C A;  1H8L A;  1TF8 A;  4MXU A;  2C6C A;  2AFS A;  3S9L A;  1NSA A;  3L2N A;  1DTD A;  4MMO A;  3ICU A;  2ZEF A;  5I4M A;  3CPX A;  1V6C A;  5K8M A;  2PJ0 A;  4FWU A;  2XEJ A;  4C8P A;  3FVL A;  1QMU A;  4LQG A;  2PJ2 A;  3KHZ A;  1CP6 A;  2PJ4 A;  2RB7 A;  4PXE A;  4RUH A;  4P4D A;  2RFH A;  2POK A;  2ZEP A;  2NYQ A;  2C6P A;  3T8W A;  2Q43 A;  5CBM A;  4CDK A;  4P4I A;  2Q51 A;  4MHZ A;  5K8O A;  4NGR A;  1CPS A;  5THW A;  4R76 A;  1TXR A;  1XF1 A;  1EE3 P;  4UEF A;  4P10 A;  5DS0 A;  3PEI A;  1YSJ A;  4F8Z A;  2HB6 A;  4A38 A;  3PB9 X;  4IAV A;  2GRE A;  3D7G A;  1VHO A;  3TX8 A;  3ISZ A;  2JBJ A;  5IR2 A;  3S9N A;  4NJQ A;  2CTB A;  4AXV A;  1LAM A;  2J9A A;  2PIY A;  3KGQ A;  2PJC A;  4NGQ A;  1AMP A;  2C5Q A;  4C9E A;  5D29 A;  4R8F A;  2O4H A;  3WC5 A;  2PJB A;  5HVH A;  2AFU A;  3B2Y A;  3CT9 A;  4UEZ A;  4UIA A;  3NA6 A;  2V8V A;  1HEE A;  3D4U A;  2EK9 A;  2V77 A;  5LRK A;  4C85 A;  4JYW A;  3GB0 A;  4ZI6 A;  4CPA A;  5LYL A;  3K9T A;  3IIB A;  3KL9 A;  4NGN A;  5K8N A;  4B6Z A;  5LYI A;  4KSI A;  2PCU A;  3D68 A;  1ZLI A;  2PJ5 A;  3IJ3 A;  4K3N A;  2QVP A;  1RTQ A;  4PXD A;  4ZY0 A;  2ZEG A;  4YWY A;  2OOT A;  1JQG A;  3V7Z A;  4P44 A;  1Y0R A;  4ONW A;  3PBE A;  1TKF A;  2IMO A;  2BCO A;  3DLJ A;  4YN3 A;  1CP7 A;  4C8A A;  3KQX A;  2IJZ A;  4YU9 A;  4MCP A;  3VTA A;  4EME A;  4R7M A;  1R43 A;  4MCS A;  2WZN A;  4OC2 A;  3KR4 A;  3PB4 X;  4TWE A;  4TJV A;  3GLJ A;  2FVG A;  3H8F A;  3LMS A;  3QNV A;  2PJ1 A;  1HDQ A;  4H2K A;  4F9U A;  4ZX8 A;  4OIW A;  4NGT A;  3HLP A;  1GYT A;  1F2P A;  1ZG8 A;  4OC3 A;  2PVW A;  3IEH A;  3MN8 A;  4IHM A;  2O53 A;  2PE3 A;  1TF9 A;  3FJU A;  4Z65 A;  2XEF A;  2VL1 A;  2GU2 A;  4KNG E;  1XJO A;  3HUV A;  2PVV A;  4OC4 A;  5F09 A;  3FMC A;  5HVF A;  2BOA A;  3KHX A;  1HDU A;  5CPA A;  1XRY A;  2PJA A;  3RBU A;  3SI2 A;  1FNO A;  1TKH A;  3WC7 A;  4FUU A;  1BAV A;  2WYR A;  4OME A;  7CPA A;  3SI0 A;  2PJ6 A;  3B3C A;  3VAR A;  4TJX A;  3KAS A;  4OKO A;  2CF4 A;  2CTC A;  3BI1 A;  1XMB A;  6CPA A;  4G1P A;  3IWW A;  3NH5 A;  1ZG9 A;  1Y7E A;  3ISX A;  4PQA A;  1LOK A;  4ZYQ A;  4IK2 A;  3N5F A;  3NH8 A;  1TKJ A;  2PIZ A;  1QQ9 A;  3CDX A;  1ZLH A;  4P4E A;  4MHP A;  4NJR A;  4MHN A;  4F9V A;  4W9Y A;  4MCR A;  4JZ0 A;  1LCP A;  1WVM A;  4UIB A;  4MCQ A;  4A39 A;  4OC5 A;  4ZX9 A;  5HVG A;  3FED A;  2IQ6 A;  3LWU A;  4P45 A;  4A94 A;  1Y0Y A;  3SJF A;  3I1U A;  4WJB A;  3SJE A;  4PPZ A;  4P4B A;  1YW6 A;  2PRQ A;  2AFX A;  3D66 A;  3IO1 A;  5LRG A;  3IFE A;  4NGP A;  3SJG A;  4GM5 A;  2F7V A;  2OR4 A;  3B3T A;  1LAP A;  4C86 A;  4OP4 A;  3PFO A;  3PB7 X;  2ZEN A;  5D8N A;  4DYO A;  4NGS A;  4EFD A;  4FBE A;  3SI1 A;  1IY7 A;  3PFE A;  3BHX A;  4Q7A A;  3BXM A;  2AFO A;  2XEI A;  2ZEE A;  1ELL P;  5K8P A;  4UF4 A;  1Z2L A;  4X8I A;  2V8D A;  2ZEO A;  5JM6 A;  1M4L A;  2ABZ A;  3FH4 A;  3VAT A;  3NFZ A;  5LYD A;  1CPX A;  1PYT B;  2EK8 A;  4UEE A;  2PJ7 A;  1VIX A;  4OC0 A;  5IB9 A;  3RAM A;  3EIF A;  3I6S A;  2ZOG A;  2ANP A;  4OC1 A;  3B35 A;  1ZG7 A;  2AFW A;  2EWB A;  5ELY A;  2GLF A;  4OID A;  4C9V A;  3I74 A;  2CIJ A;  4CDJ A;  4P4J A;  4NGM A;  2GLJ A;  5LRJ A;  3KI9 A;  3K2K A;  4TNU A;  3GUX A;  2AFZ A;  3D7F A;  1Z8L A;  3FEE A;  3B3W A;  3D7H A;  1ARL A;  4C8F A;  3NH4 A;  4C8U A;  4C9R A;  3FEC A;  1F57 A;  3BI0 A;  1VGY A;  2DEA A;  1XFO A;  4P6Y A;  1VHE A;  2ZEL A;  3JRU A;  4FAI A;  2PJ3 A;  4R6T A;  3B3V A;  2PJ8 A;  1XBU A;  3MRU A;  4MHY A;  1Q7L A;  3KZW A;  1OBR A;  3FF3 A;  1DE4 C;  1YME A;  2Q4Z A;  5LYF A;  3FX6 A;  3D7D A;  4NFR A;  1AYE A;  1YLO A;  2ZOF A;  8CPA A;  2PJ9 A;  4C9A A;  2QJ8 A;  2QYV A;  3PB8 X;  2XEG A;  4C8T A;  1ARM A;  5HXD A;  1CX8 A;  1KWM A;  3KQZ A;  2C6G A;  4DUK A;  4PXB A;  2ZEH A;  3H8G A;  1Y9Z A;  1BLL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...