4JZ0A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with ctt1055
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title A high affinity 18F-labeled phosphoramidate peptidomimetic inhibitor as a PSMA-targeted PET imaging agent for prostate cancer
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 257
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4jz0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4jz0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4jz0A02
2AFOA 3IWWA 4TWEA 2PJ7A 4DUKA 4OC2A 2ZOFA 3IJ3A 2Q51A 4ONWA 1HDQA 3D7GA 1H8LA 3V38A 1TKJA 2PJAA 4MHZA 4NGQA 2GU2A 3CDXA 2GLFA 5DS0A 3I1UA 3S9NA 4NGRA 1Q7LA 1XF1A 1LOKA 3CPXA 4OC5A 5F09A 2BO9A 1QQ9A 3VARA 2C6CA 1VHOA 4CDJA 1Y9ZA 2CTBA 4P45A 4C9UA 1ZG8A 2V8DA 4X8IA 3S9LA 3BHXA 3MN8A 3PEIA 2PJ9A 1ARLA 1WVMA 4MXUA 5LRGA 4C8CA 3KASA 1LFWA 1XJOA 4FAIA 1PCAA 1GYTA 3IO1A 4UEZA 1ELLP 1Y7EA 4UEEA 1BAVA 2WZNA 4OC3A 4OIWA 2JBJA 4WWVA 4C8AA 1YW6A 2NSMA 3L2NA 1XBUA 4MCRA 5THWA 4A37A 1CPSA 1RTQA 2EWBA 4NGTA 1F2OA 2ZEFA 2XEJA 3D4UA 2I3CA 3LMSA 4DYOA 3KQZA 4C9VA 1XFOA 4PPZA 2RB7A 2Q43A 2BOAA 2ZEOA 1TF8A 3FX6A 1ARMA 2V77A 4A38A 3PBBA 4NGNA 4P4JA 4IAVA 4AXVA 4UIAA 4Q7AA 4F9VA 2FVGA 2AFXA 1LAMA 3PB8X 3KR5A 1YSJA 2PJ2A 1R43A 4TJVA 1PYTB 5ELYA 3SJFA 1HDUA 4C9EA 4OMEA 4RUHA 4NGMA 2F7VA 4OC1A 3IIBA 3MRUA 3NH8A 2PJ8A 2HC9A 3JRUA 1LAPA 3H8FA 2G9DA 1DE4C 4CPAA 4FUUA 5K8OA 3IEHA 1Y0RA 4MCQA 2ABZA 2HB6A 3B3WA 3NFZA 4YU9A 3B3TA 4EWTA 1KWMA 2ZEPA 3DLJA 2ZOGA 1VHEA 3PB4X 2PJ1A 4PXDA 1UWYA 1Z2LA 4C84A 2AFUA 1IGBA 2ZEEA 1VIXA 5IB9A 2IMOA 3FH4A 1JQGA 3B3CA 4P4FA 4NGSA 3KL9A 4K3NA 3WC6A 3S9MA 4C85A 2AFZA 3VH9A 5HVFA 5J1QA 3ICUA 1CG2A 8CPAA 4ZX8A 3KI9A 4TJXA 2J9AA 1EE3P 1XRYA 2PVWA 2PVVA 2QJ8A 3VTAA 2EK9A 3FEEA 3WABA 3D7FA 2QYVA 4PXBA 4LQGA 3FJUA 4P6YA 3KR4A 3BI0A 3D68A 3NH4A 1TF9A 2PRQA 1ELMP 2C1CA 4H2KA 3RZAA 3SI0A 3KQXA 3GUXA 2PE3A 5LYIA 1BLLE 4P10A 3ISXA 3HUVA 2ZELA 1NSAA 1BPMA 2PJCA 1CPXA 3SI1A 4TNUA 2EK8A 2F8HA 4C9AA 4C86A 2JEWA 4ZX9A 3D7DA 2CTCA 4ZYQA 1OBRA 4P4BA 4MRIA 2ANPA 3H8GA 4YWYA 3FMCA 4UIBA 4YN3A 3B35A 2AFSA 3PB9X 5LRKA 4EMEA 3PFEA 2ZEGA 3QNVA 3FVLA 4B6ZA 4ZY2A 1ZLHA 2ZENA 3PB6X 3CT9A 3FEDA 3NA6A 4P4EA 1F2PA 4ZI6A 5JH9A 4MMOA 3RAMA 1QMUA 4C8PA 2GREA 3D7HA 4P4IA 4FWUA 3HLPA 2OOTA 2PIYA 3D67A 4WJBA 5K8NA 4NJQA 4W9YA 2POKA 1CP6A 4ZY0A 1ZLIA 2BCOA 4BD9A 2O53A 4PXEA 3WT4A 4MHNA 4OC0A 4P4DA 1M4LA 5LYDA 3BI1A 3K2KA 3RBUA 2IQ6A 3VATA 3V7ZA 2ZEDA 4OKOA 3KZWA 4PXCA 1Z5RA 3IC1A 4C9RA 4Z65A 3SJGA 1Z8LA 3SJXA 2RFHA 4FBEA 3KHZA 4X2TA 3CPAA 4G1PA 3GB0A 2QVPA 7CPAA 3H8EA 4O23A 2C6PA 1CBXA 1FNOA 1XMBA 4R7MA 2PIZA 4C8TA 1FT7A 3PRTA 3LWUA 1TKHA 2OR4A 4KSIA 3FF3A 4ZY1A 4A94A 4CDKA 1AMPA 2VL1A 1ZG7A 4MHPA 5K8MA 2V8HA 1CX8A 3NH5A 3DGVA 1VGYA 1DTDA 4MHYA 3PFOA 3K9TA 2GLJA 4IK2A 3KGQA 4R8FA 3PBEA 2AFMA 4X3RA 5HVGA 3IFEA 4IHMA 2IJZA 3TC8A 2PJ6A 1TKFA 4P44A 3WC5A 4UF4A 6CPAA 2AFWA 5JM6A 2O4HA 3WC7A 4OC4A 4F8ZA 2V8GA 5LYLA 4C99A 1LANA 3D66A 4PQAA 4R76A 5K8PA 2C6GA 2XEFA 2JBKA 2XEGA 1CP7A 5JGFA 1ZG9A 1YMEA 1IY7A 1BPNA 3I6SA 5LYFA 3PB7X 4UEFA 5LRJA 3SJEA 1Y0YA 1V6CA 1LCPA 5CPAA 3TX8A 2CIJA 2PJ3A 3N5FA 1HEEA 2ZEHA 1TXRA 3B3VA 4C8FA 4F9UA 3SI2A 2NYQA 2Q4ZA 3B3SA 3KHXA 1F57A 2WYRA 5HVHA 1R3NA 4A39A 4NFRA 3EIFA 2PJ4A 4C8UA 3FECA 5D29A 4NJRA 4OP4A 4R6TA 4OIDA 4MCSA 3BXMA 2PJ5A 3GLJA 5CBMA 5D8NA 5HXDA 2CF4A 1YLOA 2DEAA 2V8VA 2ZEMA 3ISZA 2PJBA 1AYEA 3I74A 2PJ0A 1YW4A 2PCUA 2XEIA 4NGPA 3B7IA 4JYWA 4GM5A 4KNGE 5I4MA 4MCPA 4DJLA 3T8WA 4EFDA 4JZ0A 3B2YA
chains in the Genus database with same CATH superfamily
5F9MA 4UFXA 2AFOA 3IWWA 3TLBA 5CNPA 1NMTA 5G20A 1FY7A 2AUNA 4TWEA 4CGMA 2PJ7A 2QMLA 4RI1A 3EXNA 1JWQA 3TOBA 4CGLA 4DUKA 3TCVA 4OC2A 2ZOFA 2FCKA 2WPWA 3IJ3A 3PP9A 4A4BA 1Y9KA 1EZBA 4B13A 2Q51A 4ONWA 1HDQA 3D7GA 1XOVA 1H8LA 3V38A 4CYQA 1TKJA 2PJAA 3W6XA 4GPLB 2OZGA 2YGWA 1MJ9A 2OZUA 3JVNA 4J0NA 3RYOA 2B4DB 2GP4A 4COBA 4MHZA 4NGQA 2GU2A 3TO9A 5A28A 2WSAA 2GLFA 3CDXA 3I1UA 3QB8A 3S9NA 4K30A 4NGRA 4NXYA 5DS0A 2FT0A 3ZZIA 3I3GA 4B5PA 1Q7LA 2HQYA 2EVNA 3R95A 2EO8A 1XF1A 2OH1A 4L8AA 4KUBA 5I0CA 1BXRB 2YJVA 4GXHA 5J1QA 4E0AA 1LOKA 3CPXA 3R9FA 4OC5A 3TO6A 5F48A 5F09A 2B4DA 2BO9A 4RR2B 1QQ9A 3VARA 2MP0A 2XPPA 2C6CA 5HKZA 4KOUA 1VHOA 1KUVA 4CDJA 3TE4A 4C2XA 3PLFB 1J4JA 2Z10A 1S7FA 2CTBA 1Y9ZA 1CJWA 3T0TA 4P45A 1Z4EA 4C9UA 1GHEA 3SHPA 1ZG8A 4E2AA 2V8DA 4PSXA 4X8IA 1Z9EA 3S9LA 2Q0YA 3BHXA 2YNCA 3G3SA 5FVJA 2ZXVA 2ZPAA 3MN8A 4ZBGA 3PEIA 4UWJA 2BUEA 2PJ9A 5H84A 1ARLA 2H5MA 2GIVA 3V8IA 1WVMA 4M8DA 2FE7A 4F6AA 4MXUA 2YJTA 4E5SA 3VRRA 5LRGA 4C8CA 3HPHE 3KASA 2CBLA 4Y49C 3ZJ0A 1LFWA 1MK4A 3TO7A 1JDBC 2Z3MA 2VKZG 4KSAA 1XJOA 3GYAA 4MBUA 4KVOE 4FAIA 1A9XB 4DNCA 3U1BA 1J3LA 1PCAA 3P2HA 2G3AA 1Z8XA 4MI4A 1GYTA 3IO1A 2FM4A 4UEZA 2VXKA 1KEEB 1MJBA 4U5YA 3BUNB 3TOAA 3EZEA 1ELLP 1Y7EA 4UEEA 1BAVA 2WZNA 5F47A 4OC3A 4I49A 4IUSA 3R1KA 2REEA 4OIWA 2JBJA 4QC6A 4L89A 3EO4A 2B4BA 4WWVA 2VBQA 4C8AA 3PT1A 1YW6A 2NSMA 3L2NA 3DR8A 1ZRSA 1XBUA 4MCRA 5THWA 1ZYMA 4A37A 1CPSA 1RTQA 4CAEA 4COGA 5BWAB 2EWBA 1ON0A 4NGTA 2PC1A 2PR1A 4KOTA 5EBVA 1F2OA 2ZEFA 3BUMB 1CS0B 2XEJA 3NFQA 3D4UA 2I3CA 4JJXA 3LMSA 4KVXA 3KQZA 4DYOA 2B4JC 1XFOA 3CXPA 4PPZA 4CAWA 4C9VA 4ORFA 1EO0A 2CNTA 4KVME 4IIYA 4KOWA 2JLMA 2RB7A 3EY5A 2Q43A 3VWEA 1DIKA 2ZW6A 2Q04A 1S7KA 2BOAA 2ZEOA 4H6ZA 2UV8G 1B87A 1TF8A 2ATRA 2OZHA 3FX6A 1ARMA 4NCZA 4C7IA 1C3OB 4U9YA 2V77A 4A38A 3PBBA 4NGNA 1GGOA 3CXSA 4BBHA 4P4JA 1KUXA 5J8CA 1S7NA 1QSMA 4IAVA 1YR0A 4MFQA 4AXVA 2Y0MA 3P2FA 4UIAA 1IYLA 1U6MA 4Q7AA 2Z0ZA 4F9VA 2FVGA 2AFXA 1YREA 3H5ZA 3FB3A 1LAMA 4AG7A 2BL1A 1A2ZA 5JQ4A 3PB8X 2R82A 3F9KC 3KR5A 1YSJA 1ZO0A 2R7HA 3KKWA 4XNHC 4A31A 3E0KA 2PJ2A 5JYBA 1R43A 2DPSA 2GE3A 1PYTB 2HWGA 3VGOA 4TJVA 3T05A 4CO9A 5ELYA 1B47A 3NOJA 4B5OA 2HV2A 3SJFA 1M44A 1HDUA 1P4NA 2ODFA 5IV0A 4C9EA 2R1IA 5F5XA 3FRMA 1S60A 2XPLA 4OMEA 1NE9A 2PQ8A 3CXQA 3D3SA 4RUHA 1XE4A 4M6HA 4AG9A 4NGMA 2F7VA 4OC1A 2XPNA 3IIBA 3MRUA 3NH8A 3VRNA 4NSQA 2PJ8A 2HC9A 3JRUA 2Q4VA 1LAPA 3SXNA 4MY0A 3H8FA 2G9DA 1DE4C 4XPKA 2ZW7A 1YX0A 2JDDA 5H86A 2NMTA 4EVYA 1VHSA 4FUUA 4CPAA 3IEHA 5K8OA 1Y0RA 2B5GA 4MCQA 2ABZA 3D2MA 2FIWA 3BJ8A 1OZPA 2HB6A 3B3WA 3NFZA 4YU9A 5AG5A 3B3TA 4A2ZA 4EWTA 1JDEA 1KWMA 4M6GA 2ZEPA 4MFPA 1Z8WA 3DNSA 3DLJA 2ZOGA 3UY5A 1VHEA 3TLAA 3PB4X 2PCNA 2B3VA 1IB1E 2PJ1A 4PXDA 4U9ZA 1UWYA 1Z2LA 2BSWA 5KTDA 3LD2A 4C84A 2X7BA 2AFUA 1IGBA 4HNYB 2ZEEA 2REFA 3R9EA 2X0SA 2XPOA 3LACA 5C82A 1XMTA 3OWCA 2EZAA 1VIXA 3IWGA 3VRQA 1RO5A 2IMOA 3R9GA 5IB9A 3FBUA 1SQHA 4JD6A 3FH4A 4KOYA 1JQGA 4C7HA 3B3CA 4P4FA 3NE7A 4NGSA 4XNHB 3KL9A 1Z8TA 4K3NA 2QIRA 3JTKA 3S9MA 2JDCA 3OP0A 3QAYA 3WC6A 4C85A 3U88C 2AFZA 4X5KA 4JXRA 1M4DA 5HVFA 1CG2A 3VH9A 4UFWA 8CPAA 4ZX8A 5HMNA 3ICUA 3TLZA 1S3ZA 3KI9A 4TJXA 2J9AA 4RS2A 4UCPA 5EC4A 1EE3P 1Z9UA 2HROA 2WPXA 1I1DA 4YFJA 1XRYA 1PU9A 2PVWA 2PVVA 2KCWA 5F46A 3DR6A 3TYXA 2JEVA 2QJ8A 3VTAA 2EK9A 5K99A 3IGRA 4QB9A 4A30A 3FEEA 4XPDC 2VZZA 3D7FA 3WABA 2FS5A 2QYVA 1Y7RA 3B8GA 3JUWA 4PXBA 4LQGA 3TLGB 3FXTA 2QECA 5KTCA 1X12A 3EFAA 1MJAA 4BMHA 3FJUA 4MY3A 4P6YA 3KR4A 3BLNA 3BI0A 3S6KA 5J3XA 4ZGYB 3D68A 5IX3A 3NH4A 5G21A 1TF9A 4UFVA 3BUOB 4KSFA 1WK4A 2PRQA 3R96A 1LRZA 1ELMP 2C1CA 4H2KA 4BPUB 3RZAA 1R57A 3KQXA 3SI0A 3GUXA 5JPHA 2PE3A 5LYIA 1BLLE 3T9YA 4CYNA 4P10A 3ISXA 1PUAA 2OB0A 3HUVA 4PK3A 2ZELA 1NSAA 2K5TA 1BPMA 4C68A 2PJCA 1I12A 1CPXA 1FBVA 3F5BA 3SI1A 4TNUA 2EK8A 4LUAA 2I00A 2F8HA 4C9AA 2PRBA 4MJ8A 4C86A 2JEWA 4UBRA 4ZX9A 3D7DA 2CTCA 2CNMA 4M85A 4MHDA 3W91A 1BOBA 4CYOA 4ZYQA 1OBRA 2AJ6A 2OU2A 4P4BA 1T36B 5JVLA 4R9MA 2R98A 4MRIA 1XF8A 1YVKA 4AVAA 2ANPA 3H8GA 4YWYA 3TFYA 3FMCA 4UIBA 4YN3A 3B35A 3H4QA 2AFSA 3KRVA 4R3LA 3PB9X 5LRKA 3S6HA 4EMEA 4MJXA 5AG6A 3PFEA 4ONUA 2ZEGA 3QNVA 3FVLA 3PZJA 3VROA 4ZY2A 1ZLHA 4B6ZA 3O8ZA 2ZENA 3PB6X 4UCNA 4FD7A 4KS9A 3CT9A 1IICA 4Y49B 3FEDA 3PGPA 3W6SA 3NA6A 4P4EA 1F2PA 1KBLA 3BUWB 2Z3NA 4E8OA 4MMOA 4ZI6A 3RAMA 5JH9A 1QMUA 3RNZA 5IB0A 5EMIA 4C8PA 4CGNA 2GREA 3D7HA 4P4IA 1YGHA 4FWUA 3HLPA 4KOVA 1IOFA 2G3TA 4UA3A 2OOTA 2PIYA 4F0XA 3D67A 1IIDA 4WJBA 2Q4YA 3MGDA 3A9LA 4B11A 3VRPA 4MFZA 5K8NA 1X10A 1QSTA 4NJQA 1WJTA 4W9YA 2POKA 4JWPA 1CP6A 2FIAA 5HH1A 4R57A 4ZY0A 1Q2DA 1ZLIA 2BCOA 4CRYB 4II9A 1VI4A 1VKCA 4BD9A 2O53A 2Z11A 3K4IA 4PXEA 3WT4A 4MHNA 4OC0A 4R87A 4P4DA 1M4LA 2CY2A 2PR8A 5LYDA 2PSWA 3BI1A 3K2KA 3RBUA 1XEBA 2IQ6A 3EC4A 3VATA 2E28A 4CZ1A 2I79A 1S5KA 1K4JA 2ZEDA 4FD6A 3KZWA 4M3SA 4OKOA 4PXCA 3V7ZA 1Z5RA 4CGOA 3IC1A 4C9RA 4Z65A 3FNCA 4KZTA 1M1DA 4H6UA 2B0AA 2P6FA 3SJGA 1Z8LA 3T5MA 3SJXA 3IWEA 2AUMA 4CAXA 2RFHA 2ZW4A 2YNCC 4FBEA 3WR7A 4UWIA 1QSNA 4KOXA 3KHZA 4X2TA 3C26A 3CPAA 3GB0A 4G1PA 4HPSA 4A32A 3S6GA 2WUUA 4HNWB 2FSRA 5A27A 2P6EA 2Y1MA 3F0AA 5AG4A 2QVPA 7CPAA 3TLEA 4NEXA 2F5IA 2DPTA 4BPXB 4KUAA 3H8EA 4O23A 2HI6A 4A33A 5F13A 2C6PA 3OB2B 1CBXA 1FNOA 2Q7SA 4A4CA 1XMBA 2HUZA 4R7MA 2PIZA 3VWDA 2N3AB 4Q38A 1EZAA 4C8TA 1FT7A 4KORA 3PRTA 2D4OA 3SXOA 1KZFA 2BEIA 3D2PA 3LWUA 1TKHA 4R3KA 4B5PB 4QBJA 5E96A 5AXIA 2O28A 4J3GA 1YQEA 1TIQA 2OR4A 2DF5A 4BPWB 4KSIA 4BTFA 1N71A 3S6FA 2IL4A 3GIUA 4OAEA 3FF3A 4FD4A 1NXJA 4ZY1A 4A94A 3N7ZA 2Z3LA 4CDKA 2PDOA 5ISVA 1AMPA 2D0PA 2VL1A 1ZG7A 4MHPA 5FD8A 5K8MA 1Z4RA 2V8HA 1CX8A 1XIXA 2Y1NA 2VI7A 3NH5A 3DGVA 4PSWA 3K9UA 5F49A 4CAFA 3EZAA 1VGYA 1DTDA 4JLYA 4MHYA 2ARHA 3PFOA 3K9TA 2GLJA 2R8VA 4IK2A 4YRHA 3KGQA 3I9SA 4KOSA 4R8FA 2Z3PA 3PBEA 3BUXB 2AFMA 2FXFA 3B2YA 3IU1A 1S7LA 1YVOA 4X3RA 2ZW5A 4QVTA 4MI1A 5HVGA 5DWNA 3IFEA 3OB1B 2P0WA 3TTHA 4IHMA 2FL4A 2J8MA 2IJZA 5HKYA 1QSRA 3TC8A 2PJ6A 1TKFA 4P44A 1M4IA 3GKRA 3WC5A 3TLYA 3T90A 4UF4A 6CPAA 5BY0A 2AFWA 1UFHA 5JM6A 2O4HA 4PV6A 4XPLA 3WC7A 2EZCA 4OC4A 4A95A 4F8ZA 2V8GA 3TLGA 5LYLA 1ZL0A 4OLLA 1IYKA 4C99A 4HKFA 4AVCA 1L0CA 1LANA 3D66A 4CRZB 4KLVA 1KC7A 4PQAA 1IU8A 4MFLA 1Q5XA 4R76A 1BO4A 5K8PA 5IR2A 2C6GA 3IU2A 2XEFA 4M6IA 4OADA 4RN7A 2JBKA 2XEGA 1CP7A 5KTAA 4CAVA 2C5QA 3F8KA 3FIXA 5JGFA 3D8PA 3ZNIA 1ZG9A 4IF5A 2A4NA 1YMEA 2YNEA 5AGEA 1IY7A 1IOIA 4Q36A 1VBHA 5J8FA 1BPNA 3HPGG 1VBGA 3G8WA 3I6SA 4AB7A 1RXTA 1R61A 1M4GA 1I21A 2VQYA 4LX9A 5LYFA 1CM0A 1NSLA 2B58A 2RC4A 4B10A 4LQ6A 2D0OA 4H1HA 3PB7X 4EYSA 4UEFA 1M6VB 5LRJA 3SJEA 2Z3OA 4GS4A 3TT2A 1Y0YA 1YVHA 3CZXA 1V6CA 1LCPA 5CPAA 4XPDB 2CIJA 2PJ3A 3FYNA 3TX8A 4JVOA 3N5FA 1HEEA 2ZEHA 2P6GA 5AG7A 1TXRA 3B3VA 1NBWA 2G0BA 4MFJA 4C2ZA 4C8FA 3LODA 2OLSA 4FD5A 4F9UA 5DWMA 2NYQA 2Q4ZA 3SI2A 2EZBA 3NE8A 3SR3A 1P0HA 3B3SA 1YK3A 2Z3KA 3KHXA 4B14A 2Q44A 2VEZA 1F57A 2WYRA 5HVHA 4AVBA 1R3NA 4A39A 3BJ7A 1QSOA 3QAHA 4NFRA 2CNSA 2Q7BA 4C2YA 3PFVA 3EIFA 1YLEA 3DSBA 4CYPA 2VZYA 2PJ4A 1Y9WA 2CXAA 1Q2CA 4C8UA 3FECA 5D29A 4NJRA 4OP4A 4R6TA 3HMJG 2J8RA 2GANA 4OIDA 2EUIA 4NF1A 4MCSA 3BXMA 1B6BA 2C27A 2PJ5A 2B3UA 3GLJA 4MFKA 4HNXB 4KLWA 4YGOA 4BINA 4CGPA 5D8NA 5CBMA 5HXDA 2CF4A 1YLOA 3GY9A 3RO0A 4CS0B 2DEAA 1V0CA 2V8VA 4JXQA 2GFQA 2ZEMA 3OAKA 5HKWA 2D4PA 3ISZA 5G1ZA 4B12A 2PJBA 4F0YA 5C88A 1AUGA 1AYEA 3I74A 4QUSA 2PJ0A 1CE8B 1YW4A 2PCUA 4IIXA 2EBJA 4H89A 5GCNA 4PK2A 3GJZA 1C30B 4INJA 2DLAA 3EZBA 2XEIA 4NGPA 2DIKA 2J8NA 3B7IA 4UCMA 3C8OA 4JYWA 4E94A 4GM5A 1KUYA 1Q2YA 2DXQA 1WWZA 3DDDA 5I4MA 4KNGE 4MCPA 2AE6A 2YNDA 4DJLA 5F1YA 5G22A 3T8WA 4EFDA 3TLCA 4JZ0A 2B5GB 3G23A 3T07A
chains in the Genus database with same CATH topology
2AFOA 3IWWA 4TWEA 2PJ7A 4DUKA 4OC2A 2ZOFA 3IJ3A 2Q51A 4ONWA 1HDQA 3D7GA 1H8LA 3V38A 1TKJA 2PJAA 2GP4A 4MHZA 4NGQA 2GU2A 3CDXA 2GLFA 5DS0A 3I1UA 3S9NA 4NGRA 1Q7LA 1XF1A 1LOKA 3CPXA 4OC5A 5F09A 2BO9A 1QQ9A 3VARA 2C6CA 1VHOA 4CDJA 1Y9ZA 2CTBA 4P45A 4C9UA 1ZG8A 2V8DA 4X8IA 3S9LA 3BHXA 3MN8A 3PEIA 2PJ9A 1ARLA 1WVMA 4MXUA 5LRGA 4C8CA 3KASA 1LFWA 1XJOA 4FAIA 1PCAA 1GYTA 3IO1A 4UEZA 1ELLP 1Y7EA 4UEEA 1BAVA 2WZNA 4OC3A 4OIWA 2JBJA 4WWVA 4C8AA 1YW6A 2NSMA 3L2NA 1XBUA 4MCRA 5THWA 4A37A 1CPSA 1RTQA 2EWBA 4NGTA 1F2OA 2ZEFA 2XEJA 3D4UA 2I3CA 3LMSA 4DYOA 3KQZA 4C9VA 1XFOA 4PPZA 2RB7A 2Q43A 2BOAA 2ZEOA 1TF8A 3FX6A 1ARMA 2V77A 4A38A 3PBBA 4NGNA 4P4JA 4IAVA 4AXVA 4UIAA 4Q7AA 4F9VA 2FVGA 2AFXA 1LAMA 3PB8X 3KR5A 1YSJA 2PJ2A 1R43A 4TJVA 1PYTB 5ELYA 3SJFA 1HDUA 4C9EA 4OMEA 4RUHA 4NGMA 2F7VA 4OC1A 3IIBA 3MRUA 3NH8A 2PJ8A 2HC9A 3JRUA 1LAPA 3H8FA 2G9DA 1DE4C 4CPAA 4FUUA 5K8OA 3IEHA 1Y0RA 4MCQA 2ABZA 2HB6A 3B3WA 3NFZA 4YU9A 3B3TA 4EWTA 1KWMA 2ZEPA 3DLJA 2ZOGA 1VHEA 3PB4X 2PJ1A 4PXDA 1UWYA 1Z2LA 4C84A 2AFUA 1IGBA 2ZEEA 1VIXA 5IB9A 2IMOA 3FH4A 1JQGA 3B3CA 4P4FA 4NGSA 3KL9A 4K3NA 3WC6A 3S9MA 4C85A 2AFZA 3VH9A 5HVFA 5J1QA 3ICUA 1CG2A 8CPAA 4ZX8A 3KI9A 4TJXA 2J9AA 1EE3P 1XRYA 2PVWA 2PVVA 2QJ8A 3VTAA 2EK9A 3FEEA 3WABA 3D7FA 2QYVA 4PXBA 4LQGA 3FJUA 4P6YA 3KR4A 3BI0A 3D68A 3NH4A 1TF9A 2PRQA 1ELMP 2C1CA 4H2KA 3RZAA 3SI0A 3KQXA 3GUXA 2PE3A 5LYIA 1BLLE 4P10A 3ISXA 3HUVA 2ZELA 1NSAA 1BPMA 2PJCA 1CPXA 3SI1A 4TNUA 2EK8A 2F8HA 4C9AA 4C86A 2JEWA 4ZX9A 3D7DA 2CTCA 4ZYQA 1OBRA 4P4BA 4MRIA 2ANPA 3H8GA 4YWYA 3FMCA 4UIBA 4YN3A 3B35A 2AFSA 3PB9X 5LRKA 4EMEA 3PFEA 2ZEGA 3QNVA 3FVLA 4B6ZA 4ZY2A 1ZLHA 2ZENA 3PB6X 3CT9A 3FEDA 3NA6A 4P4EA 1F2PA 4ZI6A 5JH9A 4MMOA 3RAMA 1QMUA 4C8PA 2GREA 3D7HA 4P4IA 4FWUA 3HLPA 2OOTA 2PIYA 3D67A 4WJBA 5K8NA 4NJQA 4W9YA 2POKA 1CP6A 4ZY0A 1ZLIA 2BCOA 4BD9A 2O53A 4PXEA 3WT4A 4MHNA 4OC0A 4P4DA 1M4LA 5LYDA 3BI1A 3K2KA 3RBUA 2IQ6A 3VATA 3V7ZA 2ZEDA 4OKOA 3KZWA 4PXCA 1Z5RA 3IC1A 4C9RA 4Z65A 3SJGA 1Z8LA 3SJXA 2RFHA 4FBEA 3KHZA 4X2TA 3CPAA 4G1PA 3GB0A 2QVPA 7CPAA 3H8EA 4O23A 2C6PA 1CBXA 1FNOA 1XMBA 4R7MA 2PIZA 4C8TA 1FT7A 3PRTA 3LWUA 1TKHA 2OR4A 4KSIA 3FF3A 4ZY1A 4A94A 4CDKA 1AMPA 2VL1A 1ZG7A 4MHPA 5K8MA 2V8HA 1CX8A 3NH5A 3DGVA 1VGYA 1DTDA 4MHYA 3PFOA 3K9TA 2GLJA 4IK2A 3KGQA 4R8FA 3PBEA 2AFMA 4X3RA 5HVGA 3IFEA 4IHMA 2IJZA 3TC8A 2PJ6A 1TKFA 4P44A 3WC5A 4UF4A 6CPAA 2AFWA 5JM6A 2O4HA 3WC7A 4OC4A 4F8ZA 2V8GA 5LYLA 4C99A 1LANA 3D66A 4PQAA 4R76A 5K8PA 5IR2A 2C6GA 2XEFA 2C5QA 2JBKA 2XEGA 1CP7A 5JGFA 1ZG9A 1YMEA 1IY7A 1BPNA 3I6SA 5LYFA 3PB7X 4UEFA 5LRJA 3SJEA 1Y0YA 1V6CA 1LCPA 5CPAA 3TX8A 2CIJA 2PJ3A 3N5FA 1HEEA 2ZEHA 1TXRA 3B3VA 4C8FA 4F9UA 3SI2A 2NYQA 2Q4ZA 3B3SA 3KHXA 1F57A 2WYRA 5HVHA 1R3NA 4A39A 4NFRA 3EIFA 2PJ4A 4C8UA 3FECA 5D29A 4NJRA 4OP4A 4R6TA 4OIDA 4MCSA 3BXMA 2PJ5A 3GLJA 5CBMA 5D8NA 5HXDA 2CF4A 1YLOA 2DEAA 2V8VA 2ZEMA 3ISZA 2PJBA 1AYEA 3I74A 2PJ0A 1YW4A 2PCUA 2XEIA 4NGPA 3B7IA 4JYWA 4GM5A 4KNGE 5I4MA 4MCPA 4DJLA 3T8WA 4EFDA 4JZ0A 3B2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFO A;  3IWW A;  4TWE A;  2PJ7 A;  4DUK A;  4OC2 A;  2ZOF A;  3IJ3 A;  2Q51 A;  4ONW A;  1HDQ A;  3D7G A;  1H8L A;  3V38 A;  1TKJ A;  2PJA A;  4MHZ A;  4NGQ A;  2GU2 A;  3CDX A;  2GLF A;  5DS0 A;  3I1U A;  3S9N A;  4NGR A;  1Q7L A;  1XF1 A;  1LOK A;  3CPX A;  4OC5 A;  5F09 A;  2BO9 A;  1QQ9 A;  3VAR A;  2C6C A;  1VHO A;  4CDJ A;  1Y9Z A;  2CTB A;  4P45 A;  4C9U A;  1ZG8 A;  2V8D A;  4X8I A;  3S9L A;  3BHX A;  3MN8 A;  3PEI A;  2PJ9 A;  1ARL A;  1WVM A;  4MXU A;  5LRG A;  4C8C A;  3KAS A;  1LFW A;  1XJO A;  4FAI A;  1PCA A;  1GYT A;  3IO1 A;  4UEZ A;  1ELL P;  1Y7E A;  4UEE A;  1BAV A;  2WZN A;  4OC3 A;  4OIW A;  2JBJ A;  4WWV A;  4C8A A;  1YW6 A;  2NSM A;  3L2N A;  1XBU A;  4MCR A;  5THW A;  4A37 A;  1CPS A;  1RTQ A;  2EWB A;  4NGT A;  1F2O A;  2ZEF A;  2XEJ A;  3D4U A;  2I3C A;  3LMS A;  4DYO A;  3KQZ A;  4C9V A;  1XFO A;  4PPZ A;  2RB7 A;  2Q43 A;  2BOA A;  2ZEO A;  1TF8 A;  3FX6 A;  1ARM A;  2V77 A;  4A38 A;  3PBB A;  4NGN A;  4P4J A;  4IAV A;  4AXV A;  4UIA A;  4Q7A A;  4F9V A;  2FVG A;  2AFX A;  1LAM A;  3PB8 X;  3KR5 A;  1YSJ A;  2PJ2 A;  1R43 A;  4TJV A;  1PYT B;  5ELY A;  3SJF A;  1HDU A;  4C9E A;  4OME A;  4RUH A;  4NGM A;  2F7V A;  4OC1 A;  3IIB A;  3MRU A;  3NH8 A;  2PJ8 A;  2HC9 A;  3JRU A;  1LAP A;  3H8F A;  2G9D A;  1DE4 C;  4CPA A;  4FUU A;  5K8O A;  3IEH A;  1Y0R A;  4MCQ A;  2ABZ A;  2HB6 A;  3B3W A;  3NFZ A;  4YU9 A;  3B3T A;  4EWT A;  1KWM A;  2ZEP A;  3DLJ A;  2ZOG A;  1VHE A;  3PB4 X;  2PJ1 A;  4PXD A;  1UWY A;  1Z2L A;  4C84 A;  2AFU A;  1IGB A;  2ZEE A;  1VIX A;  5IB9 A;  2IMO A;  3FH4 A;  1JQG A;  3B3C A;  4P4F A;  4NGS A;  3KL9 A;  4K3N A;  3WC6 A;  3S9M A;  4C85 A;  2AFZ A;  3VH9 A;  5HVF A;  5J1Q A;  3ICU A;  1CG2 A;  8CPA A;  4ZX8 A;  3KI9 A;  4TJX A;  2J9A A;  1EE3 P;  1XRY A;  2PVW A;  2PVV A;  2QJ8 A;  3VTA A;  2EK9 A;  3FEE A;  3WAB A;  3D7F A;  2QYV A;  4PXB A;  4LQG A;  3FJU A;  4P6Y A;  3KR4 A;  3BI0 A;  3D68 A;  3NH4 A;  1TF9 A;  2PRQ A;  1ELM P;  2C1C A;  4H2K A;  3RZA A;  3SI0 A;  3KQX A;  3GUX A;  2PE3 A;  5LYI A;  1BLL E;  4P10 A;  3ISX A;  3HUV A;  2ZEL A;  1NSA A;  1BPM A;  2PJC A;  1CPX A;  3SI1 A;  4TNU A;  2EK8 A;  2F8H A;  4C9A A;  4C86 A;  2JEW A;  4ZX9 A;  3D7D A;  2CTC A;  4ZYQ A;  1OBR A;  4P4B A;  4MRI A;  2ANP A;  3H8G A;  4YWY A;  3FMC A;  4UIB A;  4YN3 A;  3B35 A;  2AFS A;  3PB9 X;  5LRK A;  4EME A;  3PFE A;  2ZEG A;  3QNV A;  3FVL A;  4B6Z A;  4ZY2 A;  1ZLH A;  2ZEN A;  3PB6 X;  3CT9 A;  3FED A;  3NA6 A;  4P4E A;  1F2P A;  4ZI6 A;  5JH9 A;  4MMO A;  3RAM A;  1QMU A;  4C8P A;  2GRE A;  3D7H A;  4P4I A;  4FWU A;  3HLP A;  2OOT A;  2PIY A;  3D67 A;  4WJB A;  5K8N A;  4NJQ A;  4W9Y A;  2POK A;  1CP6 A;  4ZY0 A;  1ZLI A;  2BCO A;  4BD9 A;  2O53 A;  4PXE A;  3WT4 A;  4MHN A;  4OC0 A;  4P4D A;  1M4L A;  5LYD A;  3BI1 A;  3K2K A;  3RBU A;  2IQ6 A;  3VAT A;  3V7Z A;  2ZED A;  4OKO A;  3KZW A;  4PXC A;  1Z5R A;  3IC1 A;  4C9R A;  4Z65 A;  3SJG A;  1Z8L A;  3SJX A;  2RFH A;  4FBE A;  3KHZ A;  4X2T A;  3CPA A;  4G1P A;  3GB0 A;  2QVP A;  7CPA A;  3H8E A;  4O23 A;  2C6P A;  1CBX A;  1FNO A;  1XMB A;  4R7M A;  2PIZ A;  4C8T A;  1FT7 A;  3PRT A;  3LWU A;  1TKH A;  2OR4 A;  4KSI A;  3FF3 A;  4ZY1 A;  4A94 A;  4CDK A;  1AMP A;  2VL1 A;  1ZG7 A;  4MHP A;  5K8M A;  2V8H A;  1CX8 A;  3NH5 A;  3DGV A;  1VGY A;  1DTD A;  4MHY A;  3PFO A;  3K9T A;  2GLJ A;  4IK2 A;  3KGQ A;  4R8F A;  3PBE A;  2AFM A;  4X3R A;  5HVG A;  3IFE A;  4IHM A;  2IJZ A;  3TC8 A;  2PJ6 A;  1TKF A;  4P44 A;  3WC5 A;  4UF4 A;  6CPA A;  2AFW A;  5JM6 A;  2O4H A;  3WC7 A;  4OC4 A;  4F8Z A;  2V8G A;  5LYL A;  4C99 A;  1LAN A;  3D66 A;  4PQA A;  4R76 A;  5K8P A;  2C6G A;  2XEF A;  2JBK A;  2XEG A;  1CP7 A;  5JGF A;  1ZG9 A;  1YME A;  1IY7 A;  1BPN A;  3I6S A;  5LYF A;  3PB7 X;  4UEF A;  5LRJ A;  3SJE A;  1Y0Y A;  1V6C A;  1LCP A;  5CPA A;  3TX8 A;  2CIJ A;  2PJ3 A;  3N5F A;  1HEE A;  2ZEH A;  1TXR A;  3B3V A;  4C8F A;  4F9U A;  3SI2 A;  2NYQ A;  2Q4Z A;  3B3S A;  3KHX A;  1F57 A;  2WYR A;  5HVH A;  1R3N A;  4A39 A;  4NFR A;  3EIF A;  2PJ4 A;  4C8U A;  3FEC A;  5D29 A;  4NJR A;  4OP4 A;  4R6T A;  4OID A;  4MCS A;  3BXM A;  2PJ5 A;  3GLJ A;  5CBM A;  5D8N A;  5HXD A;  2CF4 A;  1YLO A;  2DEA A;  2V8V A;  2ZEM A;  3ISZ A;  2PJB A;  1AYE A;  3I74 A;  2PJ0 A;  1YW4 A;  2PCU A;  2XEI A;  4NGP A;  3B7I A;  4JYW A;  4GM5 A;  4KNG E;  5I4M A;  4MCP A;  4DJL A;  3T8W A;  4EFD A;  4JZ0 A;  3B2Y A; 
#chains in the Genus database with same CATH topology
 5F9M A;  4UFX A;  2AFO A;  3IWW A;  3TLB A;  5CNP A;  1NMT A;  5G20 A;  1FY7 A;  2AUN A;  4TWE A;  4CGM A;  2PJ7 A;  2QML A;  4RI1 A;  3EXN A;  1JWQ A;  3TOB A;  4CGL A;  4DUK A;  3TCV A;  4OC2 A;  2ZOF A;  2FCK A;  2WPW A;  3IJ3 A;  3PP9 A;  4A4B A;  1Y9K A;  1EZB A;  4B13 A;  2Q51 A;  4ONW A;  1HDQ A;  3D7G A;  1XOV A;  1H8L A;  3V38 A;  4CYQ A;  1TKJ A;  2PJA A;  3W6X A;  4GPL B;  2OZG A;  2YGW A;  1MJ9 A;  2OZU A;  3JVN A;  4J0N A;  3RYO A;  2B4D B;  2GP4 A;  4COB A;  4MHZ A;  4NGQ A;  2GU2 A;  3TO9 A;  5A28 A;  2WSA A;  2GLF A;  3CDX A;  3I1U A;  3QB8 A;  3S9N A;  4K30 A;  4NGR A;  4NXY A;  5DS0 A;  2FT0 A;  3ZZI A;  3I3G A;  4B5P A;  1Q7L A;  2HQY A;  2EVN A;  3R95 A;  2EO8 A;  1XF1 A;  2OH1 A;  4L8A A;  4KUB A;  5I0C A;  1BXR B;  2YJV A;  4GXH A;  5J1Q A;  4E0A A;  1LOK A;  3CPX A;  3R9F A;  4OC5 A;  3TO6 A;  5F48 A;  5F09 A;  2B4D A;  2BO9 A;  4RR2 B;  1QQ9 A;  3VAR A;  2MP0 A;  2XPP A;  2C6C A;  5HKZ A;  4KOU A;  1VHO A;  1KUV A;  4CDJ A;  3TE4 A;  4C2X A;  3PLF B;  1J4J A;  2Z10 A;  1S7F A;  2CTB A;  1Y9Z A;  1CJW A;  3T0T A;  4P45 A;  1Z4E A;  4C9U A;  1GHE A;  3SHP A;  1ZG8 A;  4E2A A;  2V8D A;  4PSX A;  4X8I A;  1Z9E A;  3S9L A;  2Q0Y A;  3BHX A;  2YNC A;  3G3S A;  5FVJ A;  2ZXV A;  2ZPA A;  3MN8 A;  4ZBG A;  3PEI A;  4UWJ A;  2BUE A;  2PJ9 A;  5H84 A;  1ARL A;  2H5M A;  2GIV A;  3V8I A;  1WVM A;  4M8D A;  2FE7 A;  4F6A A;  4MXU A;  2YJT A;  4E5S A;  3VRR A;  5LRG A;  4C8C A;  3HPH E;  3KAS A;  2CBL A;  4Y49 C;  3ZJ0 A;  1LFW A;  1MK4 A;  3TO7 A;  1JDB C;  2Z3M A;  2VKZ G;  4KSA A;  1XJO A;  3GYA A;  4MBU A;  4KVO E;  4FAI A;  1A9X B;  4DNC A;  3U1B A;  1J3L A;  1PCA A;  3P2H A;  2G3A A;  1Z8X A;  4MI4 A;  1GYT A;  3IO1 A;  2FM4 A;  4UEZ A;  2VXK A;  1KEE B;  1MJB A;  4U5Y A;  3BUN B;  3TOA A;  3EZE A;  1ELL P;  1Y7E A;  4UEE A;  1BAV A;  2WZN A;  5F47 A;  4OC3 A;  4I49 A;  4IUS A;  3R1K A;  2REE A;  4OIW A;  2JBJ A;  4QC6 A;  4L89 A;  3EO4 A;  2B4B A;  4WWV A;  2VBQ A;  4C8A A;  3PT1 A;  1YW6 A;  2NSM A;  3L2N A;  3DR8 A;  1ZRS A;  1XBU A;  4MCR A;  5THW A;  1ZYM A;  4A37 A;  1CPS A;  1RTQ A;  4CAE A;  4COG A;  5BWA B;  2EWB A;  1ON0 A;  4NGT A;  2PC1 A;  2PR1 A;  4KOT A;  5EBV A;  1F2O A;  2ZEF A;  3BUM B;  1CS0 B;  2XEJ A;  3NFQ A;  3D4U A;  2I3C A;  4JJX A;  3LMS A;  4KVX A;  3KQZ A;  4DYO A;  2B4J C;  1XFO A;  3CXP A;  4PPZ A;  4CAW A;  4C9V A;  4ORF A;  1EO0 A;  2CNT A;  4KVM E;  4IIY A;  4KOW A;  2JLM A;  2RB7 A;  3EY5 A;  2Q43 A;  3VWE A;  1DIK A;  2ZW6 A;  2Q04 A;  1S7K A;  2BOA A;  2ZEO A;  4H6Z A;  2UV8 G;  1B87 A;  1TF8 A;  2ATR A;  2OZH A;  3FX6 A;  1ARM A;  4NCZ A;  4C7I A;  1C3O B;  4U9Y A;  2V77 A;  4A38 A;  3PBB A;  4NGN A;  1GGO A;  3CXS A;  4BBH A;  4P4J A;  1KUX A;  5J8C A;  1S7N A;  1QSM A;  4IAV A;  1YR0 A;  4MFQ A;  4AXV A;  2Y0M A;  3P2F A;  4UIA A;  1IYL A;  1U6M A;  4Q7A A;  2Z0Z A;  4F9V A;  2FVG A;  2AFX A;  1YRE A;  3H5Z A;  3FB3 A;  1LAM A;  4AG7 A;  2BL1 A;  1A2Z A;  5JQ4 A;  3PB8 X;  2R82 A;  3F9K C;  3KR5 A;  1YSJ A;  1ZO0 A;  2R7H A;  3KKW A;  4XNH C;  4A31 A;  3E0K A;  2PJ2 A;  5JYB A;  1R43 A;  2DPS A;  2GE3 A;  1PYT B;  2HWG A;  3VGO A;  4TJV A;  3T05 A;  4CO9 A;  5ELY A;  1B47 A;  3NOJ A;  4B5O A;  2HV2 A;  3SJF A;  1M44 A;  1HDU A;  1P4N A;  2ODF A;  5IV0 A;  4C9E A;  2R1I A;  5F5X A;  3FRM A;  1S60 A;  2XPL A;  4OME A;  1NE9 A;  2PQ8 A;  3CXQ A;  3D3S A;  4RUH A;  1XE4 A;  4M6H A;  4AG9 A;  4NGM A;  2F7V A;  4OC1 A;  2XPN A;  3IIB A;  3MRU A;  3NH8 A;  3VRN A;  4NSQ A;  2PJ8 A;  2HC9 A;  3JRU A;  2Q4V A;  1LAP A;  3SXN A;  4MY0 A;  3H8F A;  2G9D A;  1DE4 C;  4XPK A;  2ZW7 A;  1YX0 A;  2JDD A;  5H86 A;  2NMT A;  4EVY A;  1VHS A;  4FUU A;  4CPA A;  3IEH A;  5K8O A;  1Y0R A;  2B5G A;  4MCQ A;  2ABZ A;  3D2M A;  2FIW A;  3BJ8 A;  1OZP A;  2HB6 A;  3B3W A;  3NFZ A;  4YU9 A;  5AG5 A;  3B3T A;  4A2Z A;  4EWT A;  1JDE A;  1KWM A;  4M6G A;  2ZEP A;  4MFP A;  1Z8W A;  3DNS A;  3DLJ A;  2ZOG A;  3UY5 A;  1VHE A;  3TLA A;  3PB4 X;  2PCN A;  2B3V A;  1IB1 E;  2PJ1 A;  4PXD A;  4U9Z A;  1UWY A;  1Z2L A;  2BSW A;  5KTD A;  3LD2 A;  4C84 A;  2X7B A;  2AFU A;  1IGB A;  4HNY B;  2ZEE A;  2REF A;  3R9E A;  2X0S A;  2XPO A;  3LAC A;  5C82 A;  1XMT A;  3OWC A;  2EZA A;  1VIX A;  3IWG A;  3VRQ A;  1RO5 A;  2IMO A;  3R9G A;  5IB9 A;  3FBU A;  1SQH A;  4JD6 A;  3FH4 A;  4KOY A;  1JQG A;  4C7H A;  3B3C A;  4P4F A;  3NE7 A;  4NGS A;  4XNH B;  3KL9 A;  1Z8T A;  4K3N A;  2QIR A;  3JTK A;  3S9M A;  2JDC A;  3OP0 A;  3QAY A;  3WC6 A;  4C85 A;  3U88 C;  2AFZ A;  4X5K A;  4JXR A;  1M4D A;  5HVF A;  1CG2 A;  3VH9 A;  4UFW A;  8CPA A;  4ZX8 A;  5HMN A;  3ICU A;  3TLZ A;  1S3Z A;  3KI9 A;  4TJX A;  2J9A A;  4RS2 A;  4UCP A;  5EC4 A;  1EE3 P;  1Z9U A;  2HRO A;  2WPX A;  1I1D A;  4YFJ A;  1XRY A;  1PU9 A;  2PVW A;  2PVV A;  2KCW A;  5F46 A;  3DR6 A;  3TYX A;  2JEV A;  2QJ8 A;  3VTA A;  2EK9 A;  5K99 A;  3IGR A;  4QB9 A;  4A30 A;  3FEE A;  4XPD C;  2VZZ A;  3D7F A;  3WAB A;  2FS5 A;  2QYV A;  1Y7R A;  3B8G A;  3JUW A;  4PXB A;  4LQG A;  3TLG B;  3FXT A;  2QEC A;  5KTC A;  1X12 A;  3EFA A;  1MJA A;  4BMH A;  3FJU A;  4MY3 A;  4P6Y A;  3KR4 A;  3BLN A;  3BI0 A;  3S6K A;  5J3X A;  4ZGY B;  3D68 A;  5IX3 A;  3NH4 A;  5G21 A;  1TF9 A;  4UFV A;  3BUO B;  4KSF A;  1WK4 A;  2PRQ A;  3R96 A;  1LRZ A;  1ELM P;  2C1C A;  4H2K A;  4BPU B;  3RZA A;  1R57 A;  3KQX A;  3SI0 A;  3GUX A;  5JPH A;  2PE3 A;  5LYI A;  1BLL E;  3T9Y A;  4CYN A;  4P10 A;  3ISX A;  1PUA A;  2OB0 A;  3HUV A;  4PK3 A;  2ZEL A;  1NSA A;  2K5T A;  1BPM A;  4C68 A;  2PJC A;  1I12 A;  1CPX A;  1FBV A;  3F5B A;  3SI1 A;  4TNU A;  2EK8 A;  4LUA A;  2I00 A;  2F8H A;  4C9A A;  2PRB A;  4MJ8 A;  4C86 A;  2JEW A;  4UBR A;  4ZX9 A;  3D7D A;  2CTC A;  2CNM A;  4M85 A;  4MHD A;  3W91 A;  1BOB A;  4CYO A;  4ZYQ A;  1OBR A;  2AJ6 A;  2OU2 A;  4P4B A;  1T36 B;  5JVL A;  4R9M A;  2R98 A;  4MRI A;  1XF8 A;  1YVK A;  4AVA A;  2ANP A;  3H8G A;  4YWY A;  3TFY A;  3FMC A;  4UIB A;  4YN3 A;  3B35 A;  3H4Q A;  2AFS A;  3KRV A;  4R3L A;  3PB9 X;  5LRK A;  3S6H A;  4EME A;  4MJX A;  5AG6 A;  3PFE A;  4ONU A;  2ZEG A;  3QNV A;  3FVL A;  3PZJ A;  3VRO A;  4ZY2 A;  1ZLH A;  4B6Z A;  3O8Z A;  2ZEN A;  3PB6 X;  4UCN A;  4FD7 A;  4KS9 A;  3CT9 A;  1IIC A;  4Y49 B;  3FED A;  3PGP A;  3W6S A;  3NA6 A;  4P4E A;  1F2P A;  1KBL A;  3BUW B;  2Z3N A;  4E8O A;  4MMO A;  4ZI6 A;  3RAM A;  5JH9 A;  1QMU A;  3RNZ A;  5IB0 A;  5EMI A;  4C8P A;  4CGN A;  2GRE A;  3D7H A;  4P4I A;  1YGH A;  4FWU A;  3HLP A;  4KOV A;  1IOF A;  2G3T A;  4UA3 A;  2OOT A;  2PIY A;  4F0X A;  3D67 A;  1IID A;  4WJB A;  2Q4Y A;  3MGD A;  3A9L A;  4B11 A;  3VRP A;  4MFZ A;  5K8N A;  1X10 A;  1QST A;  4NJQ A;  1WJT A;  4W9Y A;  2POK A;  4JWP A;  1CP6 A;  2FIA A;  5HH1 A;  4R57 A;  4ZY0 A;  1Q2D A;  1ZLI A;  2BCO A;  4CRY B;  4II9 A;  1VI4 A;  1VKC A;  4BD9 A;  2O53 A;  2Z11 A;  3K4I A;  4PXE A;  3WT4 A;  4MHN A;  4OC0 A;  4R87 A;  4P4D A;  1M4L A;  2CY2 A;  2PR8 A;  5LYD A;  2PSW A;  3BI1 A;  3K2K A;  3RBU A;  1XEB A;  2IQ6 A;  3EC4 A;  3VAT A;  2E28 A;  4CZ1 A;  2I79 A;  1S5K A;  1K4J A;  2ZED A;  4FD6 A;  3KZW A;  4M3S A;  4OKO A;  4PXC A;  3V7Z A;  1Z5R A;  4CGO A;  3IC1 A;  4C9R A;  4Z65 A;  3FNC A;  4KZT A;  1M1D A;  4H6U A;  2B0A A;  2P6F A;  3SJG A;  1Z8L A;  3T5M A;  3SJX A;  3IWE A;  2AUM A;  4CAX A;  2RFH A;  2ZW4 A;  2YNC C;  4FBE A;  3WR7 A;  4UWI A;  1QSN A;  4KOX A;  3KHZ A;  4X2T A;  3C26 A;  3CPA A;  3GB0 A;  4G1P A;  4HPS A;  4A32 A;  3S6G A;  2WUU A;  4HNW B;  2FSR A;  5A27 A;  2P6E A;  2Y1M A;  3F0A A;  5AG4 A;  2QVP A;  7CPA A;  3TLE A;  4NEX A;  2F5I A;  2DPT A;  4BPX B;  4KUA A;  3H8E A;  4O23 A;  2HI6 A;  4A33 A;  5F13 A;  2C6P A;  3OB2 B;  1CBX A;  1FNO A;  2Q7S A;  4A4C A;  1XMB A;  2HUZ A;  4R7M A;  2PIZ A;  3VWD A;  2N3A B;  4Q38 A;  1EZA A;  4C8T A;  1FT7 A;  4KOR A;  3PRT A;  2D4O A;  3SXO A;  1KZF A;  2BEI A;  3D2P A;  3LWU A;  1TKH A;  4R3K A;  4B5P B;  4QBJ A;  5E96 A;  5AXI A;  2O28 A;  4J3G A;  1YQE A;  1TIQ A;  2OR4 A;  2DF5 A;  4BPW B;  4KSI A;  4BTF A;  1N71 A;  3S6F A;  2IL4 A;  3GIU A;  4OAE A;  3FF3 A;  4FD4 A;  1NXJ A;  4ZY1 A;  4A94 A;  3N7Z A;  2Z3L A;  4CDK A;  2PDO A;  5ISV A;  1AMP A;  2D0P A;  2VL1 A;  1ZG7 A;  4MHP A;  5FD8 A;  5K8M A;  1Z4R A;  2V8H A;  1CX8 A;  1XIX A;  2Y1N A;  2VI7 A;  3NH5 A;  3DGV A;  4PSW A;  3K9U A;  5F49 A;  4CAF A;  3EZA A;  1VGY A;  1DTD A;  4JLY A;  4MHY A;  2ARH A;  3PFO A;  3K9T A;  2GLJ A;  2R8V A;  4IK2 A;  4YRH A;  3KGQ A;  3I9S A;  4KOS A;  4R8F A;  2Z3P A;  3PBE A;  3BUX B;  2AFM A;  2FXF A;  3B2Y A;  3IU1 A;  1S7L A;  1YVO A;  4X3R A;  2ZW5 A;  4QVT A;  4MI1 A;  5HVG A;  5DWN A;  3IFE A;  3OB1 B;  2P0W A;  3TTH A;  4IHM A;  2FL4 A;  2J8M A;  2IJZ A;  5HKY A;  1QSR A;  3TC8 A;  2PJ6 A;  1TKF A;  4P44 A;  1M4I A;  3GKR A;  3WC5 A;  3TLY A;  3T90 A;  4UF4 A;  6CPA A;  5BY0 A;  2AFW A;  1UFH A;  5JM6 A;  2O4H A;  4PV6 A;  4XPL A;  3WC7 A;  2EZC A;  4OC4 A;  4A95 A;  4F8Z A;  2V8G A;  3TLG A;  5LYL A;  1ZL0 A;  4OLL A;  1IYK A;  4C99 A;  4HKF A;  4AVC A;  1L0C A;  1LAN A;  3D66 A;  4CRZ B;  4KLV A;  1KC7 A;  4PQA A;  1IU8 A;  4MFL A;  1Q5X A;  4R76 A;  1BO4 A;  5K8P A;  5IR2 A;  2C6G A;  3IU2 A;  2XEF A;  4M6I A;  4OAD A;  4RN7 A;  2JBK A;  2XEG A;  1CP7 A;  5KTA A;  4CAV A;  2C5Q A;  3F8K A;  3FIX A;  5JGF A;  3D8P A;  3ZNI A;  1ZG9 A;  4IF5 A;  2A4N A;  1YME A;  2YNE A;  5AGE A;  1IY7 A;  1IOI A;  4Q36 A;  1VBH A;  5J8F A;  1BPN A;  3HPG G;  1VBG A;  3G8W A;  3I6S A;  4AB7 A;  1RXT A;  1R61 A;  1M4G A;  1I21 A;  2VQY A;  4LX9 A;  5LYF A;  1CM0 A;  1NSL A;  2B58 A;  2RC4 A;  4B10 A;  4LQ6 A;  2D0O A;  4H1H A;  3PB7 X;  4EYS A;  4UEF A;  1M6V B;  5LRJ A;  3SJE A;  2Z3O A;  4GS4 A;  3TT2 A;  1Y0Y A;  1YVH A;  3CZX A;  1V6C A;  1LCP A;  5CPA A;  4XPD B;  2CIJ A;  2PJ3 A;  3FYN A;  3TX8 A;  4JVO A;  3N5F A;  1HEE A;  2ZEH A;  2P6G A;  5AG7 A;  1TXR A;  3B3V A;  1NBW A;  2G0B A;  4MFJ A;  4C2Z A;  4C8F A;  3LOD A;  2OLS A;  4FD5 A;  4F9U A;  5DWM A;  2NYQ A;  2Q4Z A;  3SI2 A;  2EZB A;  3NE8 A;  3SR3 A;  1P0H A;  3B3S A;  1YK3 A;  2Z3K A;  3KHX A;  4B14 A;  2Q44 A;  2VEZ A;  1F57 A;  2WYR A;  5HVH A;  4AVB A;  1R3N A;  4A39 A;  3BJ7 A;  1QSO A;  3QAH A;  4NFR A;  2CNS A;  2Q7B A;  4C2Y A;  3PFV A;  3EIF A;  1YLE A;  3DSB A;  4CYP A;  2VZY A;  2PJ4 A;  1Y9W A;  2CXA A;  1Q2C A;  4C8U A;  3FEC A;  5D29 A;  4NJR A;  4OP4 A;  4R6T A;  3HMJ G;  2J8R A;  2GAN A;  4OID A;  2EUI A;  4NF1 A;  4MCS A;  3BXM A;  1B6B A;  2C27 A;  2PJ5 A;  2B3U A;  3GLJ A;  4MFK A;  4HNX B;  4KLW A;  4YGO A;  4BIN A;  4CGP A;  5D8N A;  5CBM A;  5HXD A;  2CF4 A;  1YLO A;  3GY9 A;  3RO0 A;  4CS0 B;  2DEA A;  1V0C A;  2V8V A;  4JXQ A;  2GFQ A;  2ZEM A;  3OAK A;  5HKW A;  2D4P A;  3ISZ A;  5G1Z A;  4B12 A;  2PJB A;  4F0Y A;  5C88 A;  1AUG A;  1AYE A;  3I74 A;  4QUS A;  2PJ0 A;  1CE8 B;  1YW4 A;  2PCU A;  4IIX A;  2EBJ A;  4H89 A;  5GCN A;  4PK2 A;  3GJZ A;  1C30 B;  4INJ A;  2DLA A;  3EZB A;  2XEI A;  4NGP A;  2DIK A;  2J8N A;  3B7I A;  4UCM A;  3C8O A;  4JYW A;  4E94 A;  4GM5 A;  1KUY A;  1Q2Y A;  2DXQ A;  1WWZ A;  3DDD A;  5I4M A;  4KNG E;  4MCP A;  2AE6 A;  2YND A;  4DJL A;  5F1Y A;  5G22 A;  3T8W A;  4EFD A;  3TLC A;  4JZ0 A;  2B5G B;  3G23 A;  3T07 A; 
#chains in the Genus database with same CATH homology
 2AFO A;  3IWW A;  4TWE A;  2PJ7 A;  4DUK A;  4OC2 A;  2ZOF A;  3IJ3 A;  2Q51 A;  4ONW A;  1HDQ A;  3D7G A;  1H8L A;  3V38 A;  1TKJ A;  2PJA A;  2GP4 A;  4MHZ A;  4NGQ A;  2GU2 A;  3CDX A;  2GLF A;  5DS0 A;  3I1U A;  3S9N A;  4NGR A;  1Q7L A;  1XF1 A;  1LOK A;  3CPX A;  4OC5 A;  5F09 A;  2BO9 A;  1QQ9 A;  3VAR A;  2C6C A;  1VHO A;  4CDJ A;  1Y9Z A;  2CTB A;  4P45 A;  4C9U A;  1ZG8 A;  2V8D A;  4X8I A;  3S9L A;  3BHX A;  3MN8 A;  3PEI A;  2PJ9 A;  1ARL A;  1WVM A;  4MXU A;  5LRG A;  4C8C A;  3KAS A;  1LFW A;  1XJO A;  4FAI A;  1PCA A;  1GYT A;  3IO1 A;  4UEZ A;  1ELL P;  1Y7E A;  4UEE A;  1BAV A;  2WZN A;  4OC3 A;  4OIW A;  2JBJ A;  4WWV A;  4C8A A;  1YW6 A;  2NSM A;  3L2N A;  1XBU A;  4MCR A;  5THW A;  4A37 A;  1CPS A;  1RTQ A;  2EWB A;  4NGT A;  1F2O A;  2ZEF A;  2XEJ A;  3D4U A;  2I3C A;  3LMS A;  4DYO A;  3KQZ A;  4C9V A;  1XFO A;  4PPZ A;  2RB7 A;  2Q43 A;  2BOA A;  2ZEO A;  1TF8 A;  3FX6 A;  1ARM A;  2V77 A;  4A38 A;  3PBB A;  4NGN A;  4P4J A;  4IAV A;  4AXV A;  4UIA A;  4Q7A A;  4F9V A;  2FVG A;  2AFX A;  1LAM A;  3PB8 X;  3KR5 A;  1YSJ A;  2PJ2 A;  1R43 A;  4TJV A;  1PYT B;  5ELY A;  3SJF A;  1HDU A;  4C9E A;  4OME A;  4RUH A;  4NGM A;  2F7V A;  4OC1 A;  3IIB A;  3MRU A;  3NH8 A;  2PJ8 A;  2HC9 A;  3JRU A;  1LAP A;  3H8F A;  2G9D A;  1DE4 C;  4CPA A;  4FUU A;  5K8O A;  3IEH A;  1Y0R A;  4MCQ A;  2ABZ A;  2HB6 A;  3B3W A;  3NFZ A;  4YU9 A;  3B3T A;  4EWT A;  1KWM A;  2ZEP A;  3DLJ A;  2ZOG A;  1VHE A;  3PB4 X;  2PJ1 A;  4PXD A;  1UWY A;  1Z2L A;  4C84 A;  2AFU A;  1IGB A;  2ZEE A;  1VIX A;  5IB9 A;  2IMO A;  3FH4 A;  1JQG A;  3B3C A;  4P4F A;  4NGS A;  3KL9 A;  4K3N A;  3WC6 A;  3S9M A;  4C85 A;  2AFZ A;  3VH9 A;  5HVF A;  5J1Q A;  3ICU A;  1CG2 A;  8CPA A;  4ZX8 A;  3KI9 A;  4TJX A;  2J9A A;  1EE3 P;  1XRY A;  2PVW A;  2PVV A;  2QJ8 A;  3VTA A;  2EK9 A;  3FEE A;  3WAB A;  3D7F A;  2QYV A;  4PXB A;  4LQG A;  3FJU A;  4P6Y A;  3KR4 A;  3BI0 A;  3D68 A;  3NH4 A;  1TF9 A;  2PRQ A;  1ELM P;  2C1C A;  4H2K A;  3RZA A;  3SI0 A;  3KQX A;  3GUX A;  2PE3 A;  5LYI A;  1BLL E;  4P10 A;  3ISX A;  3HUV A;  2ZEL A;  1NSA A;  1BPM A;  2PJC A;  1CPX A;  3SI1 A;  4TNU A;  2EK8 A;  2F8H A;  4C9A A;  4C86 A;  2JEW A;  4ZX9 A;  3D7D A;  2CTC A;  4ZYQ A;  1OBR A;  4P4B A;  4MRI A;  2ANP A;  3H8G A;  4YWY A;  3FMC A;  4UIB A;  4YN3 A;  3B35 A;  2AFS A;  3PB9 X;  5LRK A;  4EME A;  3PFE A;  2ZEG A;  3QNV A;  3FVL A;  4B6Z A;  4ZY2 A;  1ZLH A;  2ZEN A;  3PB6 X;  3CT9 A;  3FED A;  3NA6 A;  4P4E A;  1F2P A;  4ZI6 A;  5JH9 A;  4MMO A;  3RAM A;  1QMU A;  4C8P A;  2GRE A;  3D7H A;  4P4I A;  4FWU A;  3HLP A;  2OOT A;  2PIY A;  3D67 A;  4WJB A;  5K8N A;  4NJQ A;  4W9Y A;  2POK A;  1CP6 A;  4ZY0 A;  1ZLI A;  2BCO A;  4BD9 A;  2O53 A;  4PXE A;  3WT4 A;  4MHN A;  4OC0 A;  4P4D A;  1M4L A;  5LYD A;  3BI1 A;  3K2K A;  3RBU A;  2IQ6 A;  3VAT A;  3V7Z A;  2ZED A;  4OKO A;  3KZW A;  4PXC A;  1Z5R A;  3IC1 A;  4C9R A;  4Z65 A;  3SJG A;  1Z8L A;  3SJX A;  2RFH A;  4FBE A;  3KHZ A;  4X2T A;  3CPA A;  4G1P A;  3GB0 A;  2QVP A;  7CPA A;  3H8E A;  4O23 A;  2C6P A;  1CBX A;  1FNO A;  1XMB A;  4R7M A;  2PIZ A;  4C8T A;  1FT7 A;  3PRT A;  3LWU A;  1TKH A;  2OR4 A;  4KSI A;  3FF3 A;  4ZY1 A;  4A94 A;  4CDK A;  1AMP A;  2VL1 A;  1ZG7 A;  4MHP A;  5K8M A;  2V8H A;  1CX8 A;  3NH5 A;  3DGV A;  1VGY A;  1DTD A;  4MHY A;  3PFO A;  3K9T A;  2GLJ A;  4IK2 A;  3KGQ A;  4R8F A;  3PBE A;  2AFM A;  4X3R A;  5HVG A;  3IFE A;  4IHM A;  2IJZ A;  3TC8 A;  2PJ6 A;  1TKF A;  4P44 A;  3WC5 A;  4UF4 A;  6CPA A;  2AFW A;  5JM6 A;  2O4H A;  3WC7 A;  4OC4 A;  4F8Z A;  2V8G A;  5LYL A;  4C99 A;  1LAN A;  3D66 A;  4PQA A;  4R76 A;  5K8P A;  5IR2 A;  2C6G A;  2XEF A;  2C5Q A;  2JBK A;  2XEG A;  1CP7 A;  5JGF A;  1ZG9 A;  1YME A;  1IY7 A;  1BPN A;  3I6S A;  5LYF A;  3PB7 X;  4UEF A;  5LRJ A;  3SJE A;  1Y0Y A;  1V6C A;  1LCP A;  5CPA A;  3TX8 A;  2CIJ A;  2PJ3 A;  3N5F A;  1HEE A;  2ZEH A;  1TXR A;  3B3V A;  4C8F A;  4F9U A;  3SI2 A;  2NYQ A;  2Q4Z A;  3B3S A;  3KHX A;  1F57 A;  2WYR A;  5HVH A;  1R3N A;  4A39 A;  4NFR A;  3EIF A;  2PJ4 A;  4C8U A;  3FEC A;  5D29 A;  4NJR A;  4OP4 A;  4R6T A;  4OID A;  4MCS A;  3BXM A;  2PJ5 A;  3GLJ A;  5CBM A;  5D8N A;  5HXD A;  2CF4 A;  1YLO A;  2DEA A;  2V8V A;  2ZEM A;  3ISZ A;  2PJB A;  1AYE A;  3I74 A;  2PJ0 A;  1YW4 A;  2PCU A;  2XEI A;  4NGP A;  3B7I A;  4JYW A;  4GM5 A;  4KNG E;  5I4M A;  4MCP A;  4DJL A;  3T8W A;  4EFD A;  4JZ0 A;  3B2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...