4JZ0A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with ctt1055
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
692
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title A high affinity 18F-labeled phosphoramidate peptidomimetic inhibitor as a PSMA-targeted PET imaging agent for prostate cancer
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 257
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4jz0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4jz0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4jz0A02
4MCSA 4OKOA 2ZEFA 4R8FA 3NFZA 2Q43A 4C9UA 1VHEA 4P4JA 3WT4A 4PXEA 3K9TA 1PYTB 1Y9ZA 1TF9A 3CDXA 3IEHA 4G1PA 3KQXA 3NH5A 3VATA 1TF8A 4P4FA 3KR5A 3FX6A 4A39A 3B3TA 4NGMA 3KI9A 2GREA 2ZEOA 2PVVA 3LWUA 3PB6X 3RAMA 3GUXA 3D67A 4F9VA 4OIDA 4DYOA 1TKHA 3I74A 3DGVA 5DS0A 2C6GA 3MRUA 1LCPA 1AMPA 2EWBA 4MHPA 2RFHA 1CPSA 1Z2LA 2ZOFA 4FAIA 4Q7AA 1Z8LA 1VGYA 5LYLA 3D7HA 4OC0A 3CPAA 4OC3A 1F2OA 5D8NA 4DJLA 2XEFA 2NYQA 1VIXA 3BI1A 4P6YA 4A37A 4AXVA 2POKA 5LRJA 3IIBA 4UEZA 5LRGA 1YW4A 2Q51A 4R6TA 3FJUA 4EWTA 1ZLHA 4OC5A 5LYIA 2XEJA 2ZELA 2QJ8A 1HDUA 3H8EA 5JM6A 1CX8A 4MHNA 1RTQA 4R76A 4R7MA 1JQGA 4KNGE 3NA6A 2V8HA 3GLJA 4P4BA 3B3WA 4C8UA 4P4EA 4O23A 4BD9A 1CBXA 4F8ZA 4MCPA 3H8GA 1YLOA 2C6CA 1GYTA 3VTAA 1WVMA 1LAPA 4A38A 3SJEA 4NGRA 1BPMA 3EIFA 3KZWA 4IK2A 4MMOA 5K8NA 1ARLA 1FNOA 1LAMA 3IFEA 4C8AA 1BAVA 2PVWA 3LMSA 2BOAA 4C8PA 2ZOGA 3PB7X 1TXRA 1QQ9A 1UWYA 2EK8A 1VHOA 7CPAA 3KHXA 3NH8A 3FECA 8CPAA 3SI1A 5HVHA 5CBMA 5J1QA 3FVLA 1HDQA 4H2KA 2DEAA 2AFXA 4NGTA 2C6PA 3S9LA 3ICUA 3V38A 3WC5A 4EFDA 3BI0A 3NH4A 1CPXA 4PXDA 1F57A 1XF1A 2ZEMA 3D4UA 4GM5A 4C8CA 4OC2A 1R3NA 2WYRA 4JZ0A 2JBJA 1CP7A 3BHXA 1Z5RA 4MCRA 3PEIA 4ZY2A 4NJQA 4OC4A 2IMOA 4ZX9A 1Y0YA 4YU9A 4UIBA 2IJZA 1NSAA 3B7IA 4C9EA 4B6ZA 2PJ9A 2AFSA 2V8VA 2CF4A 3KGQA 3TX8A 3IC1A 2O53A 4NFRA 1XRYA 3KQZA 4CPAA 5HXDA 1YMEA 1DE4C 2GU2A 4WWVA 5IB9A 2FVGA 3PBEA 2G9DA 3DLJA 1ZLIA 3SJFA 3FEDA 1KWMA 2WZNA 3RBUA 5JGFA 2V77A 1BLLE 1IGBA 4K3NA 5THWA 2PJ0A 4C84A 4ZY0A 2HC9A 3QNVA 2BO9A 3SJXA 5LYDA 2ZEDA 2PJ8A 4PPZA 3VH9A 4ZYQA 3V7ZA 1LFWA 3PBBA 4MRIA 1F2PA 5I4MA 4CDJA 2I3CA 4UEFA 4PXCA 3PFOA 1CG2A 5LYFA 2JBKA 4NGQA 4MHZA 2PJ5A 4UIAA 3KHZA 3KASA 1ELMP 2AFZA 5JH9A 5HVFA 3WC6A 4FUUA 3H8FA 1ZG8A 3D7GA 1XFOA 3L2NA 2ANPA 3B3CA 4RUHA 4OIWA 3D68A 4EMEA 2AFWA 2PCUA 1OBRA 2PE3A 3WC7A 2CTBA 1IY7A 2IQ6A 2PJ7A 4P10A 5F09A 3SJGA 1XMBA 4C86A 1R43A 3WABA 2PJ4A 2NSMA 2PJCA 5K8PA 4F9UA 5ELYA 4MHYA 4P44A 4PQAA 2PRQA 4LQGA 3TC8A 2ZEHA 3CT9A 2AFOA 4UEEA 2PJ2A 1YW6A 4IHMA 4OC1A 4P45A 3D66A 4C8FA 4WJBA 3VARA 3HUVA 2RB7A 3B3SA 5HVGA 3PB8X 2AFUA 1V6CA 3K2KA 3B2YA 4C9RA 4IAVA 3IJ3A 2JEWA 5D29A 4MCQA 1AYEA 1Y0RA 1FT7A 4KSIA 2ZEEA 2PJAA 4W9YA 3B3VA 1ZG9A 1BPNA 2XEGA 3SI2A 4OP4A 3PRTA 1LOKA 1ELLP 4C85A 1Q7LA 2PIZA 3S9MA 3D7FA 1Y7EA 4ZI6A 1CP6A 4X8IA 2PJ1A 3PB4X 1YSJA 5K8MA 1ZG7A 3T8WA 2Q4ZA 1XJOA 3JRUA 3B35A 1PCAA 3I1UA 2OOTA 6CPAA 3FH4A 4PXBA 4FBEA 4Z65A 2XEIA 4FWUA 1TKJA 2EK9A 2J9AA 1LANA 2ZENA 3ISXA 1QMUA 3IO1A 3FMCA 4NJRA 2C1CA 2PJ3A 2AFMA 4ZY1A 4TNUA 4NGPA 1ARMA 3N5FA 4ONWA 4C8TA 2PJ6A 3FF3A 5CPAA 3FEEA 3CPXA 4C99A 4P4DA 1HEEA 1TKFA 2CIJA 3D7DA 4CDKA 4X3RA 3PFEA 4TWEA 1EE3P 2PJBA 1XBUA 4TJVA 4YWYA 4DUKA 4UF4A 2F8HA 3PB9X 3MN8A 5LRKA 2ZEGA 4ZX8A 4YN3A 4C9AA 4MXUA 3HLPA 3I6SA 2HB6A 2V8DA 3SI0A 4JYWA 2O4HA 3KL9A 4A94A 4NGSA 2ZEPA 4X2TA 5K8OA 3ISZA 2ABZA 3S9NA 2PIYA 2CTCA 2OR4A 1DTDA 2GLJA 2BCOA 4OMEA 2QYVA 4NGNA 2V8GA 1M4LA 3IWWA 2QVPA 2GLFA 4C9VA 4P4IA 3KR4A 3RZAA 3GB0A 4TJXA 3BXMA 2F7VA 2VL1A 1H8LA
chains in the Genus database with same CATH superfamily
5F48A 4MCSA 4OKOA 4XPDB 2ZEFA 3R9GA 2EVNA 1KUVA 1MJBA 4FD7A 4R8FA 4MFJA 3NFZA 5E96A 2Q43A 4R57A 3G8WA 4C9UA 2AJ6A 2PRBA 1VHEA 4P4JA 2DF5A 4M3SA 3WT4A 4PXEA 5EMIA 3K9TA 1PYTB 2HV2A 1J3LA 5AG5A 3GY9A 1Y9ZA 1TF9A 3CDXA 4YGOA 5KTCA 1ZYMA 3IEHA 5JYBA 4K30A 4G1PA 1Y9WA 1M4GA 3KQXA 3NH5A 4AVAA 3VATA 1TF8A 4P4FA 3KR5A 4KLVA 3FX6A 4A39A 4EVYA 3B3TA 4NGMA 1Q2CA 3KI9A 2GREA 2ZEOA 4UCPA 1M4DA 2PVVA 3LWUA 5H86A 3PB6X 3RAMA 2MP0A 5ISVA 4CRZB 3GUXA 4A30A 2P6FA 3D67A 4F9VA 3EFAA 4OIDA 4DYOA 1TKHA 2ZW7A 3I74A 2AE6A 5F49A 1XOVA 3DGVA 4LQ6A 2ZPAA 5DS0A 2C6GA 4U9ZA 2EZBA 1LCPA 2XPOA 1AMPA 2EWBA 2FS5A 3MRUA 4MHPA 2RFHA 4COGA 4CYPA 3LD2A 2FSRA 2HROA 1CPSA 2XPPA 1Z2LA 2ZOFA 1EO0A 3JVNA 4FAIA 3QAHA 1Z8LA 4H6ZA 4L8AA 4NSQA 4Q7AA 2R8VA 4NCZA 2J8RA 3VROA 1GHEA 1YLEA 1X10A 4KUAA 5KTAA 1QSMA 5BWAB 1VGYA 2VZZA 5LYLA 4KSAA 3D7HA 4OC0A 3CPAA 4OC3A 1F2OA 3P2FA 5C88A 2HUZA 5G22A 5D8NA 4CYNA 2XEFA 4NXYA 2NYQA 4DJLA 1VIXA 3BI1A 3HMJG 4P6YA 4RI1A 4A37A 4UFWA 4A32A 4COBA 3B8GA 3EO4A 4AXVA 1NBWA 2FIWA 2POKA 2B4DA 4CZ1A 4GXHA 5LRJA 2B4DB 3IIBA 1B47A 4UEZA 5LRGA 3ZNIA 1Z8TA 2D0PA 1YW4A 3PZJA 2Q51A 3BJ7A 3DSBA 1S7NA 4MI1A 4R6TA 4CAWA 2DIKA 5C82A 2BL1A 2OU2A 4NEXA 2B58A 1JWQA 1NXJA 3FJUA 2Z3PA 3PT1A 3V8IA 3R96A 4LX9A 1JDBC 4EWTA 3JUWA 1ZLHA 1MK4A 1C30B 4UCMA 1QSTA 4OC5A 5LYIA 1BOBA 4A33A 2XEJA 2VKZG 4M6HA 2ZELA 2GIVA 3PFVA 2QJ8A 3LODA 2C5QA 1HDUA 3H8EA 4C2XA 5JM6A 2HI6A 1CX8A 4CO9A 4KOVA 4IIXA 3BLNA 3GIUA 4XNHC 4MHNA 1RTQA 4U9YA 4UFXA 4R76A 2VBQA 1NE9A 2R1IA 4FD4A 4R7MA 1RO5A 3T9YA 1A2ZA 1JQGA 3C26A 5KTDA 4KNGE 1N71A 3NA6A 2V8HA 3GLJA 4Y49C 4P4BA 3B3WA 3TLZA 4C8UA 4P4EA 3U88C 4BTFA 4O23A 2BSWA 2ATRA 1YVKA 4BD9A 1CBXA 4F8ZA 1C3OB 4MCPA 1M6VB 2OB0A 1MJAA 4PK2A 4QB9A 3H8GA 3TLYA 2PR8A 2YNEA 3FB3A 5AGEA 1YLOA 4KUBA 2C6CA 1GYTA 2OZUA 1YGHA 4E8OA 1LAPA 4A38A 1WVMA 3C8OA 3SJEA 4NGRA 4A31A 1BPMA 4XPLA 4C2ZA 3EIFA 5A28A 3QAYA 3D8PA 3KZWA 2C27A 4F6AA 3S6HA 4IK2A 4MMOA 3BUMB 2G3TA 5K8NA 4JWPA 1ARLA 1FNOA 1LAMA 3W6XA 3IFEA 4KOWA 4C8AA 1BAVA 1KC7A 3NE7A 2PVWA 5AG6A 3LMSA 4L89A 1J4JA 1Q2DA 2BOAA 2RC4A 4C8PA 2ZOGA 2I79A 3PB7X 5DWNA 4B5PB 1QSOA 2FXFA 3TLGA 3T90A 1TXRA 3TLGB 1QQ9A 2R82A 1UWYA 2EK8A 2AUMA 1ZRSA 1VHOA 1MJ9A 3FYNA 2JDCA 7CPAA 2ZXVA 3WR7A 1ZL0A 3KHXA 3NH8A 3FECA 8CPAA 3SI1A 2ARHA 5CBMA 5HVHA 5J1QA 2Z0ZA 1HDQA 3FVLA 4H2KA 2IL4A 2DEAA 3QB8A 2AFXA 4NGTA 5EBVA 4CAXA 2C6PA 3S9LA 3ICUA 3F8KA 2VI7A 1IIDA 3V38A 3WC5A 3BI0A 3NH4A 1XEBA 4XPKA 4EFDA 1CPXA 1I12A 2N3AB 3D2PA 4PXDA 1F57A 2B4JC 1XF1A 1S7KA 2ZEMA 3D4UA 4GM5A 2Q4VA 1NSLA 1GGOA 4C8CA 4GPLB 4OC2A 2B4BA 3TO6A 1R3NA 4C68A 4CAVA 2GE3A 2WYRA 4RR2B 4JZ0A 2JBJA 4KZTA 3TCVA 2Q4YA 2WPWA 1CP7A 3BHXA 1Z5RA 3VRPA 1YK3A 4MCRA 3A9LA 3PP9A 3EZEA 5J3XA 2YNCA 1FBVA 3FBUA 3TOAA 3G3SA 5HH1A 3PEIA 3RYOA 5G1ZA 4ZY2A 1Z9EA 3K4IA 4NJQA 4OC4A 3IWGA 2JLMA 2IMOA 1VKCA 2PR1A 2VQYA 4ZX9A 5F5XA 3TLAA 3UY5A 1P0HA 5G20A 3BJ8A 4IIYA 1Y0YA 4YU9A 4B10A 2VZYA 2IJZA 4UIBA 1NSAA 4F0YA 3B7IA 4C9EA 4BPUB 4KVME 4B6ZA 3CZXA 2PJ9A 2Q44A 3JTKA 5J8CA 1CJWA 2KCWA 4ONUA 2AFSA 4HNYB 5J8FA 3VRRA 2CF4A 2V8VA 3KGQA 2FE7A 4JXQA 3TX8A 5H84A 5AG7A 3TO7A 2FL4A 4A95A 1I21A 2OLSA 3IC1A 2G3AA 2O53A 1XRYA 4NFRA 3KQZA 3T5MA 2YNCC 2QIRA 1AUGA 4CPAA 4CYQA 5HXDA 1YMEA 2OH1A 1DE4C 2Z11A 2GU2A 4WWVA 4MFQA 5IB9A 2FVGA 3VRQA 3PBEA 5CNPA 1SQHA 2G9DA 1VI4A 3CXPA 3DLJA 1ZLIA 4FD5A 3D2MA 3SJFA 5HMNA 3NOJA 3FEDA 4II9A 1Z9UA 3TE4A 3R9FA 2Q0YA 1KWMA 4CS0B 2WZNA 3N7ZA 3RBUA 5JGFA 5HKYA 1M4IA 4XNHB 4PK3A 2V77A 1BLLE 1Q5XA 1IGBA 4K3NA 1ON0A 2PJ0A 5THWA 4C84A 4ZY0A 2EUIA 4EYSA 2HC9A 5F13A 5BY0A 4KOYA 5HKWA 1CM0A 4JJXA 2PQ8A 2PCNA 3QNVA 3U1BA 2BO9A 3SJXA 4Y49B 5LYDA 4CYOA 4QBJA 2Q7BA 3TYXA 4AG7A 2ZEDA 4AG9A 2PJ8A 4IF5A 4KOTA 4J0NA 4X5KA 4PPZA 3VH9A 4MBUA 5HKZA 2R7HA 3F9KC 4ZYQA 3V7ZA 3FIXA 1LFWA 3PBBA 4H89A 1F2PA 4MRIA 5IB0A 1KEEB 4M6IA 5I4MA 3SXOA 3I3GA 1EZBA 4CDJA 5DWMA 2I3CA 2Y1NA 1YVOA 4UEFA 4PXCA 1VBGA 1X12A 5F47A 1OZPA 3IGRA 2CBLA 1FY7A 1CG2A 2Q7SA 1B6BA 1WK4A 3I9SA 3NE8A 3PFOA 1Z4EA 3TT2A 4F0XA 3EZAA 4INJA 3FRMA 5LYFA 2JBKA 4NGQA 3EZBA 4MHZA 4I49A 2PJ5A 2DPTA 4KSFA 3KHZA 3KASA 1ELMP 2AFZA 4MFKA 2WSAA 4UIAA 4Q36A 4UFVA 4B5OA 4B12A 3DNSA 4AB7A 4R87A 5JH9A 5HVFA 3WC6A 4FUUA 2NMTA 3H8FA 2ODFA 1ZG8A 2P0WA 4HNWB 3TTHA 4A2ZA 3D7GA 1XFOA 1V0CA 2ANPA 3L2NA 4GS4A 3B3CA 4RUHA 4OIWA 1VHSA 3EC4A 4CAFA 2GP4A 3D68A 3SR3A 4BMHA 4CGLA 2H5MA 4EMEA 2AFWA 2PCUA 1OBRA 2PE3A 3WC7A 2CTBA 1IYLA 1IY7A 1A9XB 2IQ6A 3ZJ0A 2PJ7A 4KOUA 2FT0A 3R1KA 2REEA 3IU2A 4P10A 4HNXB 5F09A 3SJGA 1XMBA 2OZGA 4KORA 4C86A 1R43A 3WABA 1JDEA 4MFZA 1YQEA 1DIKA 2PJ4A 1EZAA 2NSMA 3GYAA 1UFHA 1IYKA 4B14A 4BPXB 2XPLA 5A27A 1S7FA 5F9MA 4ORFA 5AG4A 2PJCA 5K8PA 4F9UA 4CGNA 2P6EA 5ELYA 4MHYA 4P44A 4CRYB 4PQAA 2GFQA 2PRQA 2FM4A 4LQGA 4AVBA 2DLAA 3TC8A 4PSWA 2ZEHA 3CT9A 2AFOA 4UEEA 5F1YA 2PJ2A 1YW6A 1WWZA 4IHMA 3TLBA 4OC1A 4P45A 2CNTA 3D66A 3EXNA 4KS9A 4C8FA 4WJBA 3VARA 3HUVA 5FVJA 3PLFB 2RB7A 3D3SA 3OAKA 3B3SA 5HVGA 4JD6A 2EZAA 3G23A 4H1HA 2R98A 3PB8X 4OLLA 2AFUA 2Q04A 3S6GA 1V6CA 3K2KA 3B2YA 4UWJA 4C9RA 4IAVA 1S5KA 2CY2A 3IJ3A 2B0AA 2JEWA 5D29A 4MCQA 2B5GA 1AYEA 2B5GB 2VXKA 2X0SA 1Y0RA 2P6GA 1IB1E 3NFQA 1FT7A 2JDDA 4KSIA 2ZEEA 3CXSA 3TLCA 4B11A 2PJAA 4W9YA 3P2HA 4HPSA 3B3VA 2D4PA 1ZG9A 1ZO0A 1BPNA 1IOIA 3ZZIA 1Q2YA 2J8MA 2XEGA 1Z8WA 4QVTA 2ZW4A 3SI2A 3FNCA 1XMTA 3PRTA 1LOKA 4OP4A 1ELLP 5IX3A 4C85A 4MI4A 1Q7LA 2PIZA 1YR0A 4C7IA 1XF8A 4MHDA 3S9MA 3D7FA 4E2AA 1YVHA 1IICA 3KKWA 2Y0MA 4MJ8A 1Y7EA 5JPHA 1Z4RA 4UWIA 3CXQA 4FD6A 4ZI6A 4E0AA 1Y9KA 1CP6A 4X8IA 1CS0B 2CNMA 2PJ1A 2UV8G 3DDDA 3PB4X 1YSJA 3R9EA 5K8MA 4XPDC 1ZG7A 3T8WA 2X7BA 2Q4ZA 2F5IA 1XJOA 2PSWA 3JRUA 3TFYA 1QSRA 1PU9A 4KLWA 4DNCA 3B35A 1TIQA 2YNDA 3EY5A 1CE8B 3VWDA 4YRHA 2FIAA 4KOXA 1KZFA 1I1DA 3BUXB 1PCAA 3I1UA 2OOTA 4M6GA 1XIXA 4CGOA 3SHPA 4CGMA 1T36B 4JVOA 4JXRA 3DR8A 2Z10A 2B3UA 4OAEA 1U6MA 6CPAA 2K5TA 2ZW5A 2Z3MA 3FH4A 4M85A 4E5SA 2DPSA 4PXBA 4FBEA 2YJTA 2BEIA 4ZBGA 3H4QA 4Z65A 2HWGA 1P4NA 2CXAA 2YGWA 3K9UA 3PGPA 4KVXA 2XEIA 5I0CA 4MFPA 3OB1B 2YJVA 4FWUA 5F46A 2EZCA 1TKJA 3HPHE 3HPGG 1KUXA 1QSNA 5IR2A 1Y7RA 2EK9A 2EO8A 3FXTA 4MFLA 2J9AA 2Z3LA 4UCNA 4M8DA 1BXRB 1LANA 2ZENA 3ISXA 3MGDA 2Z3OA 3RNZA 2QECA 1QMUA 3IO1A 2D4OA 3FMCA 3R95A 3O8ZA 4NJRA 2C1CA 2PJ3A 2AFMA 3OWCA 2XPNA 3GKRA 4TNUA 4ZGYB 1K4JA 4ZY1A 4NGPA 1ARMA 4RN7A 4R3KA 3N5FA 3GJZA 4ONWA 1YREA 4C8TA 3H5ZA 2O28A 3VWEA 2AUNA 2PJ6A 3FF3A 4Q38A 5CPAA 3FEEA 1XE4A 2D0OA 3CPXA 4C99A 4E94A 1YX0A 5AXIA 1S7LA 3RO0A 4HKFA 1L0CA 2REFA 4P4DA 1WJTA 1HEEA 1TKFA 3TOBA 3F5BA 2CIJA 3D7DA 4CDKA 4X3RA 3VGOA 5JVLA 3SXNA 3PFEA 4TWEA 1RXTA 4UA3A 1EE3P 4KVOE 4BPWB 3W91A 2PJBA 1XBUA 3OP0A 2Z3KA 4BINA 1Z8XA 4QUSA 2QMLA 4RS2A 3BUOB 4TJVA 4R3LA 5IV0A 5K99A 3BUNB 4MY3A 4PV6A 1R61A 1S3ZA 2G0BA 2J8NA 4YWYA 4DUKA 4UF4A 2DXQA 2F8HA 2B3VA 4AVCA 2E28A 2WUUA 5EC4A 1M44A 3T05A 4IUSA 3TLEA 3PB9X 2FCKA 2PDOA 4C2YA 1R57A 3MN8A 5LRKA 2ZEGA 4ZX8A 2ZW6A 4QC6A 4YN3A 1KBLA 2PC1A 4C9AA 4LUAA 4MXUA 3HLPA 3I6SA 5FD8A 3VTAA 4A4BA 2HB6A 2Y1MA 2V8DA 4JLYA 4OADA 3SI0A 4YFJA 3LACA 1IU8A 2CNSA 1B87A 3E0KA 4U5YA 4CGPA 4JYWA 3VRNA 3IU1A 3BUWB 4C7HA 2VEZA 3OB2B 2A4NA 2WPXA 2O4HA 1IOFA 3KL9A 4A94A 3W6SA 2BUEA 4NGSA 1M1DA 2GANA 4R9MA 2ZEPA 1S60A 4BBHA 4X2TA 5K8OA 3S6FA 3S6KA 2ABZA 3ISZA 3TO9A 3S9NA 5JQ4A 2PIYA 1BO4A 4B5PA 1KUYA 1NMTA 2JEVA 2CTCA 1LRZA 2OR4A 1DTDA 2GLJA 2Z3NA 2I00A 4A4CA 4UBRA 2BCOA 4OMEA 2OZHA 2HQYA 4NGNA 1PUAA 2QYVA 2V8GA 4PSXA 4B13A 1M4LA 3IWWA 2EBJA 2GLFA 2QVPA 3IWEA 4J3GA 4MY0A 4MJXA 4C9VA 4P4IA 3KR4A 4H6UA 4KOSA 4NF1A 3F0AA 5G21A 3RZAA 1VBHA 3KRVA 3GB0A 3T07A 3T0TA 4CAEA 4TJXA 3BXMA 5GCNA 3DR6A 2F7VA 2VL1A 1H8LA
chains in the Genus database with same CATH topology
4MCSA 4OKOA 2ZEFA 4R8FA 3NFZA 2Q43A 4C9UA 1VHEA 4P4JA 3WT4A 4PXEA 3K9TA 1PYTB 1Y9ZA 1TF9A 3CDXA 3IEHA 4G1PA 3KQXA 3NH5A 3VATA 1TF8A 4P4FA 3KR5A 3FX6A 4A39A 3B3TA 4NGMA 3KI9A 2GREA 2ZEOA 2PVVA 3LWUA 3PB6X 3RAMA 3GUXA 3D67A 4F9VA 4OIDA 4DYOA 1TKHA 3I74A 3DGVA 5DS0A 2C6GA 3MRUA 1LCPA 1AMPA 2EWBA 4MHPA 2RFHA 1CPSA 1Z2LA 2ZOFA 4FAIA 4Q7AA 1Z8LA 1VGYA 5LYLA 3D7HA 4OC0A 3CPAA 4OC3A 1F2OA 5D8NA 4DJLA 2XEFA 2NYQA 1VIXA 3BI1A 4P6YA 4A37A 4AXVA 2POKA 5LRJA 3IIBA 4UEZA 5LRGA 1YW4A 2Q51A 4R6TA 3FJUA 4EWTA 1ZLHA 4OC5A 5LYIA 2XEJA 2ZELA 2C5QA 2QJ8A 1HDUA 3H8EA 5JM6A 1CX8A 4MHNA 1RTQA 4R76A 4R7MA 1JQGA 4KNGE 3NA6A 2V8HA 3GLJA 4P4BA 3B3WA 4C8UA 4P4EA 4O23A 4BD9A 1CBXA 4F8ZA 4MCPA 3H8GA 1YLOA 2C6CA 1GYTA 3VTAA 1WVMA 1LAPA 4A38A 3SJEA 4NGRA 1BPMA 3EIFA 3KZWA 4IK2A 4MMOA 5K8NA 1ARLA 1FNOA 1LAMA 3IFEA 4C8AA 1BAVA 2PVWA 3LMSA 2BOAA 4C8PA 2ZOGA 3PB7X 1TXRA 1QQ9A 1UWYA 2EK8A 1VHOA 7CPAA 3KHXA 3NH8A 3FECA 8CPAA 3SI1A 5HVHA 5CBMA 5J1QA 3FVLA 1HDQA 4H2KA 2DEAA 2AFXA 4NGTA 2C6PA 3S9LA 3ICUA 3V38A 3WC5A 4EFDA 3BI0A 3NH4A 1CPXA 4PXDA 1F57A 1XF1A 2ZEMA 3D4UA 4GM5A 4C8CA 4OC2A 1R3NA 2WYRA 4JZ0A 2JBJA 1CP7A 3BHXA 1Z5RA 4MCRA 3PEIA 4ZY2A 4NJQA 4OC4A 2IMOA 4ZX9A 1Y0YA 4YU9A 4UIBA 2IJZA 1NSAA 3B7IA 4C9EA 4B6ZA 2PJ9A 2AFSA 2V8VA 2CF4A 3KGQA 3TX8A 3IC1A 2O53A 4NFRA 1XRYA 3KQZA 4CPAA 5HXDA 1YMEA 1DE4C 2GU2A 4WWVA 5IB9A 2FVGA 3PBEA 2G9DA 3DLJA 1ZLIA 3SJFA 3FEDA 1KWMA 2WZNA 3RBUA 5JGFA 2V77A 1BLLE 1IGBA 4K3NA 5THWA 2PJ0A 4C84A 4ZY0A 2HC9A 3QNVA 2BO9A 3SJXA 5LYDA 2ZEDA 2PJ8A 4PPZA 3VH9A 4ZYQA 3V7ZA 1LFWA 3PBBA 4MRIA 1F2PA 5I4MA 4CDJA 2I3CA 4UEFA 4PXCA 3PFOA 1CG2A 5LYFA 2JBKA 4NGQA 4MHZA 2PJ5A 4UIAA 3KHZA 3KASA 1ELMP 2AFZA 5JH9A 5HVFA 3WC6A 4FUUA 3H8FA 1ZG8A 3D7GA 1XFOA 3L2NA 2ANPA 3B3CA 4RUHA 4OIWA 2GP4A 3D68A 4EMEA 2AFWA 2PCUA 1OBRA 2PE3A 3WC7A 2CTBA 1IY7A 2IQ6A 2PJ7A 4P10A 5F09A 3SJGA 1XMBA 4C86A 1R43A 3WABA 2PJ4A 2NSMA 2PJCA 5K8PA 4F9UA 5ELYA 4MHYA 4P44A 4PQAA 2PRQA 4LQGA 3TC8A 2ZEHA 3CT9A 2AFOA 4UEEA 2PJ2A 1YW6A 4IHMA 4OC1A 4P45A 3D66A 4C8FA 4WJBA 3VARA 3HUVA 2RB7A 3B3SA 5HVGA 3PB8X 2AFUA 1V6CA 3K2KA 3B2YA 4C9RA 4IAVA 3IJ3A 2JEWA 5D29A 4MCQA 1AYEA 1Y0RA 1FT7A 4KSIA 2ZEEA 2PJAA 4W9YA 3B3VA 1ZG9A 1BPNA 2XEGA 3SI2A 4OP4A 3PRTA 1LOKA 1ELLP 4C85A 1Q7LA 2PIZA 3S9MA 3D7FA 1Y7EA 4ZI6A 1CP6A 4X8IA 2PJ1A 3PB4X 1YSJA 5K8MA 1ZG7A 3T8WA 2Q4ZA 1XJOA 3JRUA 3B35A 1PCAA 3I1UA 2OOTA 6CPAA 3FH4A 4PXBA 4FBEA 4Z65A 2XEIA 4FWUA 1TKJA 5IR2A 2EK9A 2J9AA 1LANA 2ZENA 3ISXA 1QMUA 3IO1A 3FMCA 4NJRA 2C1CA 2PJ3A 2AFMA 4ZY1A 4TNUA 4NGPA 1ARMA 3N5FA 4ONWA 4C8TA 2PJ6A 3FF3A 5CPAA 3FEEA 3CPXA 4C99A 4P4DA 1HEEA 1TKFA 2CIJA 3D7DA 4CDKA 4X3RA 3PFEA 4TWEA 1EE3P 2PJBA 1XBUA 4TJVA 4YWYA 4DUKA 4UF4A 2F8HA 3PB9X 3MN8A 5LRKA 2ZEGA 4ZX8A 4YN3A 4C9AA 4MXUA 3HLPA 3I6SA 2HB6A 2V8DA 3SI0A 4JYWA 2O4HA 3KL9A 4A94A 4NGSA 2ZEPA 4X2TA 5K8OA 3ISZA 2ABZA 3S9NA 2PIYA 2CTCA 2OR4A 1DTDA 2GLJA 2BCOA 4OMEA 2QYVA 4NGNA 2V8GA 1M4LA 3IWWA 2QVPA 2GLFA 4C9VA 4P4IA 3KR4A 3RZAA 3GB0A 4TJXA 3BXMA 2F7VA 2VL1A 1H8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCS A;  4OKO A;  2ZEF A;  4R8F A;  3NFZ A;  2Q43 A;  4C9U A;  1VHE A;  4P4J A;  3WT4 A;  4PXE A;  3K9T A;  1PYT B;  1Y9Z A;  1TF9 A;  3CDX A;  3IEH A;  4G1P A;  3KQX A;  3NH5 A;  3VAT A;  1TF8 A;  4P4F A;  3KR5 A;  3FX6 A;  4A39 A;  3B3T A;  4NGM A;  3KI9 A;  2GRE A;  2ZEO A;  2PVV A;  3LWU A;  3PB6 X;  3RAM A;  3GUX A;  3D67 A;  4F9V A;  4OID A;  4DYO A;  1TKH A;  3I74 A;  3DGV A;  5DS0 A;  2C6G A;  3MRU A;  1LCP A;  1AMP A;  2EWB A;  4MHP A;  2RFH A;  1CPS A;  1Z2L A;  2ZOF A;  4FAI A;  4Q7A A;  1Z8L A;  1VGY A;  5LYL A;  3D7H A;  4OC0 A;  3CPA A;  4OC3 A;  1F2O A;  5D8N A;  4DJL A;  2XEF A;  2NYQ A;  1VIX A;  3BI1 A;  4P6Y A;  4A37 A;  4AXV A;  2POK A;  5LRJ A;  3IIB A;  4UEZ A;  5LRG A;  1YW4 A;  2Q51 A;  4R6T A;  3FJU A;  4EWT A;  1ZLH A;  4OC5 A;  5LYI A;  2XEJ A;  2ZEL A;  2QJ8 A;  1HDU A;  3H8E A;  5JM6 A;  1CX8 A;  4MHN A;  1RTQ A;  4R76 A;  4R7M A;  1JQG A;  4KNG E;  3NA6 A;  2V8H A;  3GLJ A;  4P4B A;  3B3W A;  4C8U A;  4P4E A;  4O23 A;  4BD9 A;  1CBX A;  4F8Z A;  4MCP A;  3H8G A;  1YLO A;  2C6C A;  1GYT A;  3VTA A;  1WVM A;  1LAP A;  4A38 A;  3SJE A;  4NGR A;  1BPM A;  3EIF A;  3KZW A;  4IK2 A;  4MMO A;  5K8N A;  1ARL A;  1FNO A;  1LAM A;  3IFE A;  4C8A A;  1BAV A;  2PVW A;  3LMS A;  2BOA A;  4C8P A;  2ZOG A;  3PB7 X;  1TXR A;  1QQ9 A;  1UWY A;  2EK8 A;  1VHO A;  7CPA A;  3KHX A;  3NH8 A;  3FEC A;  8CPA A;  3SI1 A;  5HVH A;  5CBM A;  5J1Q A;  3FVL A;  1HDQ A;  4H2K A;  2DEA A;  2AFX A;  4NGT A;  2C6P A;  3S9L A;  3ICU A;  3V38 A;  3WC5 A;  4EFD A;  3BI0 A;  3NH4 A;  1CPX A;  4PXD A;  1F57 A;  1XF1 A;  2ZEM A;  3D4U A;  4GM5 A;  4C8C A;  4OC2 A;  1R3N A;  2WYR A;  4JZ0 A;  2JBJ A;  1CP7 A;  3BHX A;  1Z5R A;  4MCR A;  3PEI A;  4ZY2 A;  4NJQ A;  4OC4 A;  2IMO A;  4ZX9 A;  1Y0Y A;  4YU9 A;  4UIB A;  2IJZ A;  1NSA A;  3B7I A;  4C9E A;  4B6Z A;  2PJ9 A;  2AFS A;  2V8V A;  2CF4 A;  3KGQ A;  3TX8 A;  3IC1 A;  2O53 A;  4NFR A;  1XRY A;  3KQZ A;  4CPA A;  5HXD A;  1YME A;  1DE4 C;  2GU2 A;  4WWV A;  5IB9 A;  2FVG A;  3PBE A;  2G9D A;  3DLJ A;  1ZLI A;  3SJF A;  3FED A;  1KWM A;  2WZN A;  3RBU A;  5JGF A;  2V77 A;  1BLL E;  1IGB A;  4K3N A;  5THW A;  2PJ0 A;  4C84 A;  4ZY0 A;  2HC9 A;  3QNV A;  2BO9 A;  3SJX A;  5LYD A;  2ZED A;  2PJ8 A;  4PPZ A;  3VH9 A;  4ZYQ A;  3V7Z A;  1LFW A;  3PBB A;  4MRI A;  1F2P A;  5I4M A;  4CDJ A;  2I3C A;  4UEF A;  4PXC A;  3PFO A;  1CG2 A;  5LYF A;  2JBK A;  4NGQ A;  4MHZ A;  2PJ5 A;  4UIA A;  3KHZ A;  3KAS A;  1ELM P;  2AFZ A;  5JH9 A;  5HVF A;  3WC6 A;  4FUU A;  3H8F A;  1ZG8 A;  3D7G A;  1XFO A;  3L2N A;  2ANP A;  3B3C A;  4RUH A;  4OIW A;  3D68 A;  4EME A;  2AFW A;  2PCU A;  1OBR A;  2PE3 A;  3WC7 A;  2CTB A;  1IY7 A;  2IQ6 A;  2PJ7 A;  4P10 A;  5F09 A;  3SJG A;  1XMB A;  4C86 A;  1R43 A;  3WAB A;  2PJ4 A;  2NSM A;  2PJC A;  5K8P A;  4F9U A;  5ELY A;  4MHY A;  4P44 A;  4PQA A;  2PRQ A;  4LQG A;  3TC8 A;  2ZEH A;  3CT9 A;  2AFO A;  4UEE A;  2PJ2 A;  1YW6 A;  4IHM A;  4OC1 A;  4P45 A;  3D66 A;  4C8F A;  4WJB A;  3VAR A;  3HUV A;  2RB7 A;  3B3S A;  5HVG A;  3PB8 X;  2AFU A;  1V6C A;  3K2K A;  3B2Y A;  4C9R A;  4IAV A;  3IJ3 A;  2JEW A;  5D29 A;  4MCQ A;  1AYE A;  1Y0R A;  1FT7 A;  4KSI A;  2ZEE A;  2PJA A;  4W9Y A;  3B3V A;  1ZG9 A;  1BPN A;  2XEG A;  3SI2 A;  4OP4 A;  3PRT A;  1LOK A;  1ELL P;  4C85 A;  1Q7L A;  2PIZ A;  3S9M A;  3D7F A;  1Y7E A;  4ZI6 A;  1CP6 A;  4X8I A;  2PJ1 A;  3PB4 X;  1YSJ A;  5K8M A;  1ZG7 A;  3T8W A;  2Q4Z A;  1XJO A;  3JRU A;  3B35 A;  1PCA A;  3I1U A;  2OOT A;  6CPA A;  3FH4 A;  4PXB A;  4FBE A;  4Z65 A;  2XEI A;  4FWU A;  1TKJ A;  2EK9 A;  2J9A A;  1LAN A;  2ZEN A;  3ISX A;  1QMU A;  3IO1 A;  3FMC A;  4NJR A;  2C1C A;  2PJ3 A;  2AFM A;  4ZY1 A;  4TNU A;  4NGP A;  1ARM A;  3N5F A;  4ONW A;  4C8T A;  2PJ6 A;  3FF3 A;  5CPA A;  3FEE A;  3CPX A;  4C99 A;  4P4D A;  1HEE A;  1TKF A;  2CIJ A;  3D7D A;  4CDK A;  4X3R A;  3PFE A;  4TWE A;  1EE3 P;  2PJB A;  1XBU A;  4TJV A;  4YWY A;  4DUK A;  4UF4 A;  2F8H A;  3PB9 X;  3MN8 A;  5LRK A;  2ZEG A;  4ZX8 A;  4YN3 A;  4C9A A;  4MXU A;  3HLP A;  3I6S A;  2HB6 A;  2V8D A;  3SI0 A;  4JYW A;  2O4H A;  3KL9 A;  4A94 A;  4NGS A;  2ZEP A;  4X2T A;  5K8O A;  3ISZ A;  2ABZ A;  3S9N A;  2PIY A;  2CTC A;  2OR4 A;  1DTD A;  2GLJ A;  2BCO A;  4OME A;  2QYV A;  4NGN A;  2V8G A;  1M4L A;  3IWW A;  2QVP A;  2GLF A;  4C9V A;  4P4I A;  3KR4 A;  3RZA A;  3GB0 A;  4TJX A;  3BXM A;  2F7V A;  2VL1 A;  1H8L A; 
#chains in the Genus database with same CATH topology
 5F48 A;  4MCS A;  4OKO A;  4XPD B;  2ZEF A;  3R9G A;  2EVN A;  1KUV A;  1MJB A;  4FD7 A;  4R8F A;  4MFJ A;  3NFZ A;  5E96 A;  2Q43 A;  4R57 A;  3G8W A;  4C9U A;  2AJ6 A;  2PRB A;  1VHE A;  4P4J A;  2DF5 A;  4M3S A;  3WT4 A;  4PXE A;  5EMI A;  3K9T A;  1PYT B;  2HV2 A;  1J3L A;  5AG5 A;  3GY9 A;  1Y9Z A;  1TF9 A;  3CDX A;  4YGO A;  5KTC A;  1ZYM A;  3IEH A;  5JYB A;  4K30 A;  4G1P A;  1Y9W A;  1M4G A;  3KQX A;  3NH5 A;  4AVA A;  3VAT A;  1TF8 A;  4P4F A;  3KR5 A;  4KLV A;  3FX6 A;  4A39 A;  4EVY A;  3B3T A;  4NGM A;  1Q2C A;  3KI9 A;  2GRE A;  2ZEO A;  4UCP A;  1M4D A;  2PVV A;  3LWU A;  5H86 A;  3PB6 X;  3RAM A;  2MP0 A;  5ISV A;  4CRZ B;  3GUX A;  4A30 A;  2P6F A;  3D67 A;  4F9V A;  3EFA A;  4OID A;  4DYO A;  1TKH A;  2ZW7 A;  3I74 A;  2AE6 A;  5F49 A;  1XOV A;  3DGV A;  4LQ6 A;  2ZPA A;  5DS0 A;  2C6G A;  4U9Z A;  2EZB A;  1LCP A;  2XPO A;  1AMP A;  2EWB A;  2FS5 A;  3MRU A;  4MHP A;  2RFH A;  4COG A;  4CYP A;  3LD2 A;  2FSR A;  2HRO A;  1CPS A;  2XPP A;  1Z2L A;  2ZOF A;  1EO0 A;  3JVN A;  4FAI A;  3QAH A;  1Z8L A;  4H6Z A;  4L8A A;  4NSQ A;  4Q7A A;  2R8V A;  4NCZ A;  2J8R A;  3VRO A;  1GHE A;  1YLE A;  1X10 A;  4KUA A;  5KTA A;  1QSM A;  5BWA B;  1VGY A;  2VZZ A;  5LYL A;  4KSA A;  3D7H A;  4OC0 A;  3CPA A;  4OC3 A;  1F2O A;  3P2F A;  5C88 A;  2HUZ A;  5G22 A;  5D8N A;  4CYN A;  2XEF A;  4NXY A;  2NYQ A;  4DJL A;  1VIX A;  3BI1 A;  3HMJ G;  4P6Y A;  4RI1 A;  4A37 A;  4UFW A;  4A32 A;  4COB A;  3B8G A;  3EO4 A;  4AXV A;  1NBW A;  2FIW A;  2POK A;  2B4D A;  4CZ1 A;  4GXH A;  5LRJ A;  2B4D B;  3IIB A;  1B47 A;  4UEZ A;  5LRG A;  3ZNI A;  1Z8T A;  2D0P A;  1YW4 A;  3PZJ A;  2Q51 A;  3BJ7 A;  3DSB A;  1S7N A;  4MI1 A;  4R6T A;  4CAW A;  2DIK A;  5C82 A;  2BL1 A;  2OU2 A;  4NEX A;  2B58 A;  1JWQ A;  1NXJ A;  3FJU A;  2Z3P A;  3PT1 A;  3V8I A;  3R96 A;  4LX9 A;  1JDB C;  4EWT A;  3JUW A;  1ZLH A;  1MK4 A;  1C30 B;  4UCM A;  1QST A;  4OC5 A;  5LYI A;  1BOB A;  4A33 A;  2XEJ A;  2VKZ G;  4M6H A;  2ZEL A;  2GIV A;  3PFV A;  2QJ8 A;  3LOD A;  2C5Q A;  1HDU A;  3H8E A;  4C2X A;  5JM6 A;  2HI6 A;  1CX8 A;  4CO9 A;  4KOV A;  4IIX A;  3BLN A;  3GIU A;  4XNH C;  4MHN A;  1RTQ A;  4U9Y A;  4UFX A;  4R76 A;  2VBQ A;  1NE9 A;  2R1I A;  4FD4 A;  4R7M A;  1RO5 A;  3T9Y A;  1A2Z A;  1JQG A;  3C26 A;  5KTD A;  4KNG E;  1N71 A;  3NA6 A;  2V8H A;  3GLJ A;  4Y49 C;  4P4B A;  3B3W A;  3TLZ A;  4C8U A;  4P4E A;  3U88 C;  4BTF A;  4O23 A;  2BSW A;  2ATR A;  1YVK A;  4BD9 A;  1CBX A;  4F8Z A;  1C3O B;  4MCP A;  1M6V B;  2OB0 A;  1MJA A;  4PK2 A;  4QB9 A;  3H8G A;  3TLY A;  2PR8 A;  2YNE A;  3FB3 A;  5AGE A;  1YLO A;  4KUB A;  2C6C A;  1GYT A;  2OZU A;  1YGH A;  4E8O A;  1LAP A;  4A38 A;  1WVM A;  3C8O A;  3SJE A;  4NGR A;  4A31 A;  1BPM A;  4XPL A;  4C2Z A;  3EIF A;  5A28 A;  3QAY A;  3D8P A;  3KZW A;  2C27 A;  4F6A A;  3S6H A;  4IK2 A;  4MMO A;  3BUM B;  2G3T A;  5K8N A;  4JWP A;  1ARL A;  1FNO A;  1LAM A;  3W6X A;  3IFE A;  4KOW A;  4C8A A;  1BAV A;  1KC7 A;  3NE7 A;  2PVW A;  5AG6 A;  3LMS A;  4L89 A;  1J4J A;  1Q2D A;  2BOA A;  2RC4 A;  4C8P A;  2ZOG A;  2I79 A;  3PB7 X;  5DWN A;  4B5P B;  1QSO A;  2FXF A;  3TLG A;  3T90 A;  1TXR A;  3TLG B;  1QQ9 A;  2R82 A;  1UWY A;  2EK8 A;  2AUM A;  1ZRS A;  1VHO A;  1MJ9 A;  3FYN A;  2JDC A;  7CPA A;  2ZXV A;  3WR7 A;  1ZL0 A;  3KHX A;  3NH8 A;  3FEC A;  8CPA A;  3SI1 A;  2ARH A;  5CBM A;  5HVH A;  5J1Q A;  2Z0Z A;  1HDQ A;  3FVL A;  4H2K A;  2IL4 A;  2DEA A;  3QB8 A;  2AFX A;  4NGT A;  5EBV A;  4CAX A;  2C6P A;  3S9L A;  3ICU A;  3F8K A;  2VI7 A;  1IID A;  3V38 A;  3WC5 A;  3BI0 A;  3NH4 A;  1XEB A;  4XPK A;  4EFD A;  1CPX A;  1I12 A;  2N3A B;  3D2P A;  4PXD A;  1F57 A;  2B4J C;  1XF1 A;  1S7K A;  2ZEM A;  3D4U A;  4GM5 A;  2Q4V A;  1NSL A;  1GGO A;  4C8C A;  4GPL B;  4OC2 A;  2B4B A;  3TO6 A;  1R3N A;  4C68 A;  4CAV A;  2GE3 A;  2WYR A;  4RR2 B;  4JZ0 A;  2JBJ A;  4KZT A;  3TCV A;  2Q4Y A;  2WPW A;  1CP7 A;  3BHX A;  1Z5R A;  3VRP A;  1YK3 A;  4MCR A;  3A9L A;  3PP9 A;  3EZE A;  5J3X A;  2YNC A;  1FBV A;  3FBU A;  3TOA A;  3G3S A;  5HH1 A;  3PEI A;  3RYO A;  5G1Z A;  4ZY2 A;  1Z9E A;  3K4I A;  4NJQ A;  4OC4 A;  3IWG A;  2JLM A;  2IMO A;  1VKC A;  2PR1 A;  2VQY A;  4ZX9 A;  5F5X A;  3TLA A;  3UY5 A;  1P0H A;  5G20 A;  3BJ8 A;  4IIY A;  1Y0Y A;  4YU9 A;  4B10 A;  2VZY A;  2IJZ A;  4UIB A;  1NSA A;  4F0Y A;  3B7I A;  4C9E A;  4BPU B;  4KVM E;  4B6Z A;  3CZX A;  2PJ9 A;  2Q44 A;  3JTK A;  5J8C A;  1CJW A;  2KCW A;  4ONU A;  2AFS A;  4HNY B;  5J8F A;  3VRR A;  2CF4 A;  2V8V A;  3KGQ A;  2FE7 A;  4JXQ A;  3TX8 A;  5H84 A;  5AG7 A;  3TO7 A;  2FL4 A;  4A95 A;  1I21 A;  2OLS A;  3IC1 A;  2G3A A;  2O53 A;  1XRY A;  4NFR A;  3KQZ A;  3T5M A;  2YNC C;  2QIR A;  1AUG A;  4CPA A;  4CYQ A;  5HXD A;  1YME A;  2OH1 A;  1DE4 C;  2Z11 A;  2GU2 A;  4WWV A;  4MFQ A;  5IB9 A;  2FVG A;  3VRQ A;  3PBE A;  5CNP A;  1SQH A;  2G9D A;  1VI4 A;  3CXP A;  3DLJ A;  1ZLI A;  4FD5 A;  3D2M A;  3SJF A;  5HMN A;  3NOJ A;  3FED A;  4II9 A;  1Z9U A;  3TE4 A;  3R9F A;  2Q0Y A;  1KWM A;  4CS0 B;  2WZN A;  3N7Z A;  3RBU A;  5JGF A;  5HKY A;  1M4I A;  4XNH B;  4PK3 A;  2V77 A;  1BLL E;  1Q5X A;  1IGB A;  4K3N A;  1ON0 A;  2PJ0 A;  5THW A;  4C84 A;  4ZY0 A;  2EUI A;  4EYS A;  2HC9 A;  5F13 A;  5BY0 A;  4KOY A;  5HKW A;  1CM0 A;  4JJX A;  2PQ8 A;  2PCN A;  3QNV A;  3U1B A;  2BO9 A;  3SJX A;  4Y49 B;  5LYD A;  4CYO A;  4QBJ A;  2Q7B A;  3TYX A;  4AG7 A;  2ZED A;  4AG9 A;  2PJ8 A;  4IF5 A;  4KOT A;  4J0N A;  4X5K A;  4PPZ A;  3VH9 A;  4MBU A;  5HKZ A;  2R7H A;  3F9K C;  4ZYQ A;  3V7Z A;  3FIX A;  1LFW A;  3PBB A;  4H89 A;  1F2P A;  4MRI A;  5IB0 A;  1KEE B;  4M6I A;  5I4M A;  3SXO A;  3I3G A;  1EZB A;  4CDJ A;  5DWM A;  2I3C A;  2Y1N A;  1YVO A;  4UEF A;  4PXC A;  1VBG A;  1X12 A;  5F47 A;  1OZP A;  3IGR A;  2CBL A;  1FY7 A;  1CG2 A;  2Q7S A;  1B6B A;  1WK4 A;  3I9S A;  3NE8 A;  3PFO A;  1Z4E A;  3TT2 A;  4F0X A;  3EZA A;  4INJ A;  3FRM A;  5LYF A;  2JBK A;  4NGQ A;  3EZB A;  4MHZ A;  4I49 A;  2PJ5 A;  2DPT A;  4KSF A;  3KHZ A;  3KAS A;  1ELM P;  2AFZ A;  4MFK A;  2WSA A;  4UIA A;  4Q36 A;  4UFV A;  4B5O A;  4B12 A;  3DNS A;  4AB7 A;  4R87 A;  5JH9 A;  5HVF A;  3WC6 A;  4FUU A;  2NMT A;  3H8F A;  2ODF A;  1ZG8 A;  2P0W A;  4HNW B;  3TTH A;  4A2Z A;  3D7G A;  1XFO A;  1V0C A;  2ANP A;  3L2N A;  4GS4 A;  3B3C A;  4RUH A;  4OIW A;  1VHS A;  3EC4 A;  4CAF A;  2GP4 A;  3D68 A;  3SR3 A;  4BMH A;  4CGL A;  2H5M A;  4EME A;  2AFW A;  2PCU A;  1OBR A;  2PE3 A;  3WC7 A;  2CTB A;  1IYL A;  1IY7 A;  1A9X B;  2IQ6 A;  3ZJ0 A;  2PJ7 A;  4KOU A;  2FT0 A;  3R1K A;  2REE A;  3IU2 A;  4P10 A;  4HNX B;  5F09 A;  3SJG A;  1XMB A;  2OZG A;  4KOR A;  4C86 A;  1R43 A;  3WAB A;  1JDE A;  4MFZ A;  1YQE A;  1DIK A;  2PJ4 A;  1EZA A;  2NSM A;  3GYA A;  1UFH A;  1IYK A;  4B14 A;  4BPX B;  2XPL A;  5A27 A;  1S7F A;  5F9M A;  4ORF A;  5AG4 A;  2PJC A;  5K8P A;  4F9U A;  4CGN A;  2P6E A;  5ELY A;  4MHY A;  4P44 A;  4CRY B;  4PQA A;  2GFQ A;  2PRQ A;  2FM4 A;  4LQG A;  4AVB A;  2DLA A;  3TC8 A;  4PSW A;  2ZEH A;  3CT9 A;  2AFO A;  4UEE A;  5F1Y A;  2PJ2 A;  1YW6 A;  1WWZ A;  4IHM A;  3TLB A;  4OC1 A;  4P45 A;  2CNT A;  3D66 A;  3EXN A;  4KS9 A;  4C8F A;  4WJB A;  3VAR A;  3HUV A;  5FVJ A;  3PLF B;  2RB7 A;  3D3S A;  3OAK A;  3B3S A;  5HVG A;  4JD6 A;  2EZA A;  3G23 A;  4H1H A;  2R98 A;  3PB8 X;  4OLL A;  2AFU A;  2Q04 A;  3S6G A;  1V6C A;  3K2K A;  3B2Y A;  4UWJ A;  4C9R A;  4IAV A;  1S5K A;  2CY2 A;  3IJ3 A;  2B0A A;  2JEW A;  5D29 A;  4MCQ A;  2B5G A;  1AYE A;  2B5G B;  2VXK A;  2X0S A;  1Y0R A;  2P6G A;  1IB1 E;  3NFQ A;  1FT7 A;  2JDD A;  4KSI A;  2ZEE A;  3CXS A;  3TLC A;  4B11 A;  2PJA A;  4W9Y A;  3P2H A;  4HPS A;  3B3V A;  2D4P A;  1ZG9 A;  1ZO0 A;  1BPN A;  1IOI A;  3ZZI A;  1Q2Y A;  2J8M A;  2XEG A;  1Z8W A;  4QVT A;  2ZW4 A;  3SI2 A;  3FNC A;  1XMT A;  3PRT A;  1LOK A;  4OP4 A;  1ELL P;  5IX3 A;  4C85 A;  4MI4 A;  1Q7L A;  2PIZ A;  1YR0 A;  4C7I A;  1XF8 A;  4MHD A;  3S9M A;  3D7F A;  4E2A A;  1YVH A;  1IIC A;  3KKW A;  2Y0M A;  4MJ8 A;  1Y7E A;  5JPH A;  1Z4R A;  4UWI A;  3CXQ A;  4FD6 A;  4ZI6 A;  4E0A A;  1Y9K A;  1CP6 A;  4X8I A;  1CS0 B;  2CNM A;  2PJ1 A;  2UV8 G;  3DDD A;  3PB4 X;  1YSJ A;  3R9E A;  5K8M A;  4XPD C;  1ZG7 A;  3T8W A;  2X7B A;  2Q4Z A;  2F5I A;  1XJO A;  2PSW A;  3JRU A;  3TFY A;  1QSR A;  1PU9 A;  4KLW A;  4DNC A;  3B35 A;  1TIQ A;  2YND A;  3EY5 A;  1CE8 B;  3VWD A;  4YRH A;  2FIA A;  4KOX A;  1KZF A;  1I1D A;  3BUX B;  1PCA A;  3I1U A;  2OOT A;  4M6G A;  1XIX A;  4CGO A;  3SHP A;  4CGM A;  1T36 B;  4JVO A;  4JXR A;  3DR8 A;  2Z10 A;  2B3U A;  4OAE A;  1U6M A;  6CPA A;  2K5T A;  2ZW5 A;  2Z3M A;  3FH4 A;  4M85 A;  4E5S A;  2DPS A;  4PXB A;  4FBE A;  2YJT A;  2BEI A;  4ZBG A;  3H4Q A;  4Z65 A;  2HWG A;  1P4N A;  2CXA A;  2YGW A;  3K9U A;  3PGP A;  4KVX A;  2XEI A;  5I0C A;  4MFP A;  3OB1 B;  2YJV A;  4FWU A;  5F46 A;  2EZC A;  1TKJ A;  3HPH E;  3HPG G;  1KUX A;  1QSN A;  5IR2 A;  1Y7R A;  2EK9 A;  2EO8 A;  3FXT A;  4MFL A;  2J9A A;  2Z3L A;  4UCN A;  4M8D A;  1BXR B;  1LAN A;  2ZEN A;  3ISX A;  3MGD A;  2Z3O A;  3RNZ A;  2QEC A;  1QMU A;  3IO1 A;  2D4O A;  3FMC A;  3R95 A;  3O8Z A;  4NJR A;  2C1C A;  2PJ3 A;  2AFM A;  3OWC A;  2XPN A;  3GKR A;  4TNU A;  4ZGY B;  1K4J A;  4ZY1 A;  4NGP A;  1ARM A;  4RN7 A;  4R3K A;  3N5F A;  3GJZ A;  4ONW A;  1YRE A;  4C8T A;  3H5Z A;  2O28 A;  3VWE A;  2AUN A;  2PJ6 A;  3FF3 A;  4Q38 A;  5CPA A;  3FEE A;  1XE4 A;  2D0O A;  3CPX A;  4C99 A;  4E94 A;  1YX0 A;  5AXI A;  1S7L A;  3RO0 A;  4HKF A;  1L0C A;  2REF A;  4P4D A;  1WJT A;  1HEE A;  1TKF A;  3TOB A;  3F5B A;  2CIJ A;  3D7D A;  4CDK A;  4X3R A;  3VGO A;  5JVL A;  3SXN A;  3PFE A;  4TWE A;  1RXT A;  4UA3 A;  1EE3 P;  4KVO E;  4BPW B;  3W91 A;  2PJB A;  1XBU A;  3OP0 A;  2Z3K A;  4BIN A;  1Z8X A;  4QUS A;  2QML A;  4RS2 A;  3BUO B;  4TJV A;  4R3L A;  5IV0 A;  5K99 A;  3BUN B;  4MY3 A;  4PV6 A;  1R61 A;  1S3Z A;  2G0B A;  2J8N A;  4YWY A;  4DUK A;  4UF4 A;  2DXQ A;  2F8H A;  2B3V A;  4AVC A;  2E28 A;  2WUU A;  5EC4 A;  1M44 A;  3T05 A;  4IUS A;  3TLE A;  3PB9 X;  2FCK A;  2PDO A;  4C2Y A;  1R57 A;  3MN8 A;  5LRK A;  2ZEG A;  4ZX8 A;  2ZW6 A;  4QC6 A;  4YN3 A;  1KBL A;  2PC1 A;  4C9A A;  4LUA A;  4MXU A;  3HLP A;  3I6S A;  5FD8 A;  3VTA A;  4A4B A;  2HB6 A;  2Y1M A;  2V8D A;  4JLY A;  4OAD A;  3SI0 A;  4YFJ A;  3LAC A;  1IU8 A;  2CNS A;  1B87 A;  3E0K A;  4U5Y A;  4CGP A;  4JYW A;  3VRN A;  3IU1 A;  3BUW B;  4C7H A;  2VEZ A;  3OB2 B;  2A4N A;  2WPX A;  2O4H A;  1IOF A;  3KL9 A;  4A94 A;  3W6S A;  2BUE A;  4NGS A;  1M1D A;  2GAN A;  4R9M A;  2ZEP A;  1S60 A;  4BBH A;  4X2T A;  5K8O A;  3S6F A;  3S6K A;  2ABZ A;  3ISZ A;  3TO9 A;  3S9N A;  5JQ4 A;  2PIY A;  1BO4 A;  4B5P A;  1KUY A;  1NMT A;  2JEV A;  2CTC A;  1LRZ A;  2OR4 A;  1DTD A;  2GLJ A;  2Z3N A;  2I00 A;  4A4C A;  4UBR A;  2BCO A;  4OME A;  2OZH A;  2HQY A;  4NGN A;  1PUA A;  2QYV A;  2V8G A;  4PSX A;  4B13 A;  1M4L A;  3IWW A;  2EBJ A;  2GLF A;  2QVP A;  3IWE A;  4J3G A;  4MY0 A;  4MJX A;  4C9V A;  4P4I A;  3KR4 A;  4H6U A;  4KOS A;  4NF1 A;  3F0A A;  5G21 A;  3RZA A;  1VBH A;  3KRV A;  3GB0 A;  3T07 A;  3T0T A;  4CAE A;  4TJX A;  3BXM A;  5GCN A;  3DR6 A;  2F7V A;  2VL1 A;  1H8L A; 
#chains in the Genus database with same CATH homology
 4MCS A;  4OKO A;  2ZEF A;  4R8F A;  3NFZ A;  2Q43 A;  4C9U A;  1VHE A;  4P4J A;  3WT4 A;  4PXE A;  3K9T A;  1PYT B;  1Y9Z A;  1TF9 A;  3CDX A;  3IEH A;  4G1P A;  3KQX A;  3NH5 A;  3VAT A;  1TF8 A;  4P4F A;  3KR5 A;  3FX6 A;  4A39 A;  3B3T A;  4NGM A;  3KI9 A;  2GRE A;  2ZEO A;  2PVV A;  3LWU A;  3PB6 X;  3RAM A;  3GUX A;  3D67 A;  4F9V A;  4OID A;  4DYO A;  1TKH A;  3I74 A;  3DGV A;  5DS0 A;  2C6G A;  3MRU A;  1LCP A;  1AMP A;  2EWB A;  4MHP A;  2RFH A;  1CPS A;  1Z2L A;  2ZOF A;  4FAI A;  4Q7A A;  1Z8L A;  1VGY A;  5LYL A;  3D7H A;  4OC0 A;  3CPA A;  4OC3 A;  1F2O A;  5D8N A;  4DJL A;  2XEF A;  2NYQ A;  1VIX A;  3BI1 A;  4P6Y A;  4A37 A;  4AXV A;  2POK A;  5LRJ A;  3IIB A;  4UEZ A;  5LRG A;  1YW4 A;  2Q51 A;  4R6T A;  3FJU A;  4EWT A;  1ZLH A;  4OC5 A;  5LYI A;  2XEJ A;  2ZEL A;  2C5Q A;  2QJ8 A;  1HDU A;  3H8E A;  5JM6 A;  1CX8 A;  4MHN A;  1RTQ A;  4R76 A;  4R7M A;  1JQG A;  4KNG E;  3NA6 A;  2V8H A;  3GLJ A;  4P4B A;  3B3W A;  4C8U A;  4P4E A;  4O23 A;  4BD9 A;  1CBX A;  4F8Z A;  4MCP A;  3H8G A;  1YLO A;  2C6C A;  1GYT A;  3VTA A;  1WVM A;  1LAP A;  4A38 A;  3SJE A;  4NGR A;  1BPM A;  3EIF A;  3KZW A;  4IK2 A;  4MMO A;  5K8N A;  1ARL A;  1FNO A;  1LAM A;  3IFE A;  4C8A A;  1BAV A;  2PVW A;  3LMS A;  2BOA A;  4C8P A;  2ZOG A;  3PB7 X;  1TXR A;  1QQ9 A;  1UWY A;  2EK8 A;  1VHO A;  7CPA A;  3KHX A;  3NH8 A;  3FEC A;  8CPA A;  3SI1 A;  5HVH A;  5CBM A;  5J1Q A;  3FVL A;  1HDQ A;  4H2K A;  2DEA A;  2AFX A;  4NGT A;  2C6P A;  3S9L A;  3ICU A;  3V38 A;  3WC5 A;  4EFD A;  3BI0 A;  3NH4 A;  1CPX A;  4PXD A;  1F57 A;  1XF1 A;  2ZEM A;  3D4U A;  4GM5 A;  4C8C A;  4OC2 A;  1R3N A;  2WYR A;  4JZ0 A;  2JBJ A;  1CP7 A;  3BHX A;  1Z5R A;  4MCR A;  3PEI A;  4ZY2 A;  4NJQ A;  4OC4 A;  2IMO A;  4ZX9 A;  1Y0Y A;  4YU9 A;  4UIB A;  2IJZ A;  1NSA A;  3B7I A;  4C9E A;  4B6Z A;  2PJ9 A;  2AFS A;  2V8V A;  2CF4 A;  3KGQ A;  3TX8 A;  3IC1 A;  2O53 A;  4NFR A;  1XRY A;  3KQZ A;  4CPA A;  5HXD A;  1YME A;  1DE4 C;  2GU2 A;  4WWV A;  5IB9 A;  2FVG A;  3PBE A;  2G9D A;  3DLJ A;  1ZLI A;  3SJF A;  3FED A;  1KWM A;  2WZN A;  3RBU A;  5JGF A;  2V77 A;  1BLL E;  1IGB A;  4K3N A;  5THW A;  2PJ0 A;  4C84 A;  4ZY0 A;  2HC9 A;  3QNV A;  2BO9 A;  3SJX A;  5LYD A;  2ZED A;  2PJ8 A;  4PPZ A;  3VH9 A;  4ZYQ A;  3V7Z A;  1LFW A;  3PBB A;  4MRI A;  1F2P A;  5I4M A;  4CDJ A;  2I3C A;  4UEF A;  4PXC A;  3PFO A;  1CG2 A;  5LYF A;  2JBK A;  4NGQ A;  4MHZ A;  2PJ5 A;  4UIA A;  3KHZ A;  3KAS A;  1ELM P;  2AFZ A;  5JH9 A;  5HVF A;  3WC6 A;  4FUU A;  3H8F A;  1ZG8 A;  3D7G A;  1XFO A;  3L2N A;  2ANP A;  3B3C A;  4RUH A;  4OIW A;  2GP4 A;  3D68 A;  4EME A;  2AFW A;  2PCU A;  1OBR A;  2PE3 A;  3WC7 A;  2CTB A;  1IY7 A;  2IQ6 A;  2PJ7 A;  4P10 A;  5F09 A;  3SJG A;  1XMB A;  4C86 A;  1R43 A;  3WAB A;  2PJ4 A;  2NSM A;  2PJC A;  5K8P A;  4F9U A;  5ELY A;  4MHY A;  4P44 A;  4PQA A;  2PRQ A;  4LQG A;  3TC8 A;  2ZEH A;  3CT9 A;  2AFO A;  4UEE A;  2PJ2 A;  1YW6 A;  4IHM A;  4OC1 A;  4P45 A;  3D66 A;  4C8F A;  4WJB A;  3VAR A;  3HUV A;  2RB7 A;  3B3S A;  5HVG A;  3PB8 X;  2AFU A;  1V6C A;  3K2K A;  3B2Y A;  4C9R A;  4IAV A;  3IJ3 A;  2JEW A;  5D29 A;  4MCQ A;  1AYE A;  1Y0R A;  1FT7 A;  4KSI A;  2ZEE A;  2PJA A;  4W9Y A;  3B3V A;  1ZG9 A;  1BPN A;  2XEG A;  3SI2 A;  4OP4 A;  3PRT A;  1LOK A;  1ELL P;  4C85 A;  1Q7L A;  2PIZ A;  3S9M A;  3D7F A;  1Y7E A;  4ZI6 A;  1CP6 A;  4X8I A;  2PJ1 A;  3PB4 X;  1YSJ A;  5K8M A;  1ZG7 A;  3T8W A;  2Q4Z A;  1XJO A;  3JRU A;  3B35 A;  1PCA A;  3I1U A;  2OOT A;  6CPA A;  3FH4 A;  4PXB A;  4FBE A;  4Z65 A;  2XEI A;  4FWU A;  1TKJ A;  5IR2 A;  2EK9 A;  2J9A A;  1LAN A;  2ZEN A;  3ISX A;  1QMU A;  3IO1 A;  3FMC A;  4NJR A;  2C1C A;  2PJ3 A;  2AFM A;  4ZY1 A;  4TNU A;  4NGP A;  1ARM A;  3N5F A;  4ONW A;  4C8T A;  2PJ6 A;  3FF3 A;  5CPA A;  3FEE A;  3CPX A;  4C99 A;  4P4D A;  1HEE A;  1TKF A;  2CIJ A;  3D7D A;  4CDK A;  4X3R A;  3PFE A;  4TWE A;  1EE3 P;  2PJB A;  1XBU A;  4TJV A;  4YWY A;  4DUK A;  4UF4 A;  2F8H A;  3PB9 X;  3MN8 A;  5LRK A;  2ZEG A;  4ZX8 A;  4YN3 A;  4C9A A;  4MXU A;  3HLP A;  3I6S A;  2HB6 A;  2V8D A;  3SI0 A;  4JYW A;  2O4H A;  3KL9 A;  4A94 A;  4NGS A;  2ZEP A;  4X2T A;  5K8O A;  3ISZ A;  2ABZ A;  3S9N A;  2PIY A;  2CTC A;  2OR4 A;  1DTD A;  2GLJ A;  2BCO A;  4OME A;  2QYV A;  4NGN A;  2V8G A;  1M4L A;  3IWW A;  2QVP A;  2GLF A;  4C9V A;  4P4I A;  3KR4 A;  3RZA A;  3GB0 A;  4TJX A;  3BXM A;  2F7V A;  2VL1 A;  1H8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...