4JZ0A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with ctt1055
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title A high affinity 18F-labeled phosphoramidate peptidomimetic inhibitor as a PSMA-targeted PET imaging agent for prostate cancer
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 257
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4jz0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4jz0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4jz0A02
3IWWA 4X8IA 2C6CA 3NH4A 4ZY0A 3ICUA 2POKA 2JBKA 3KL9A 4AXVA 3I74A 2XEFA 3D7HA 2IMOA 5JH9A 4TJXA 8CPAA 3NA6A 3GB0A 3RAMA 1CPSA 2NSMA 2ZEDA 3WC5A 3IC1A 4ZX9A 3FECA 4TJVA 1LANA 4OC2A 1TKJA 1TKHA 1ELMP 3B3TA 4O23A 4R7MA 2AFUA 2F7VA 2GLFA 2PJ0A 2QVPA 1YSJA 4EFDA 4ZX8A 1XFOA 3PRTA 2QYVA 4ZYQA 4A39A 3FVLA 5HXDA 3CDXA 2QJ8A 4Z65A 3ISZA 2AFSA 3BI1A 3IO1A 4MXUA 2GLJA 2JEWA 4ZI6A 2C6PA 1PYTB 2XEGA 4G1PA 3KQXA 1CX8A 4B6ZA 3SI0A 1VGYA 1VIXA 2CF4A 1LAMA 1ZG7A 2I3CA 3H8GA 2PCUA 3DLJA 2XEIA 4W9YA 2GREA 2VL1A 3LMSA 1CP7A 3KHXA 2AFZA 3B3CA 3KASA 4OC3A 2XEJA 4Q7AA 1BAVA 4PXDA 5HVHA 3GLJA 2ZEPA 3TX8A 4OC5A 1ZG9A 4FBEA 3SJFA 1RTQA 2PJ6A 5HVFA 5D8NA 3KHZA 3FEDA 4C8AA 4NGPA 1R43A 1HDQA 2ZEFA 4C9EA 2PVWA 3QNVA 3PB7X 4TWEA 3ISXA 4ZY1A 4C9AA 3FX6A 3HLPA 2F8HA 1CP6A 3PBEA 1VHEA 3KGQA 4C8PA 4MCRA 1GYTA 4NGMA 2AFOA 3B2YA 3JRUA 1F57A 3WC6A 2ZEGA 2ABZA 1Y9ZA 2J9AA 4MRIA 2V77A 3KR5A 4X2TA 3KZWA 2EK8A 1PCAA 4DJLA 3K9TA 3EIFA 4NGNA 4YU9A 4C9UA 2V8VA 3NFZA 1ELLP 3S9MA 1OBRA 4KSIA 1ZG8A 2PJ5A 2RFHA 4A38A 1XJOA 4H2KA 3BXMA 5CPAA 4IK2A 3I1UA 2V8DA 3CT9A 3RBUA 2BCOA 3B3WA 1IGBA 4OIDA 5K8OA 2WYRA 2PJCA 4NJRA 5LYIA 4CDJA 4IAVA 3SI2A 5CBMA 2PE3A 1Y0YA 2ZEMA 2ZELA 1WVMA 2PVVA 3IJ3A 4R76A 3D7DA 4A94A 2DEAA 1XF1A 3B3VA 2HC9A 3K2KA 4NGRA 1BLLE 5LYFA 2PJ7A 4YN3A 3CPAA 2OOTA 2ANPA 1HEEA 2CTBA 1Y7EA 4P4JA 2ZEOA 1Y0RA 5JM6A 4UIBA 4KNGE 4C86A 2Q51A 3KQZA 5K8NA 1F2PA 4UEEA 3PFOA 2FVGA 4OMEA 3S9NA 3D68A 4C85A 3KR4A 1M4LA 3PFEA 5K8MA 2EWBA 1XBUA 2C6GA 4LQGA 1BPMA 4BD9A 2CIJA 4P45A 1BPNA 3DGVA 4PQAA 4PXEA 4UF4A 5LRJA 4P4FA 4R8FA 2O4HA 2AFXA 1Q7LA 4P4IA 3MRUA 2ZEEA 1LCPA 5IB9A 5HVGA 1DTDA 4RUHA 5I4MA 2ZENA 4WJBA 3SJGA 1XMBA 2Q4ZA 4OIWA 3LWUA 1VHOA 3D67A 3D7GA 1R3NA 1AMPA 4C8FA 4P4EA 1YW4A 4PXCA 4ZY2A 1V6CA 2BOAA 1LOKA 4C8UA 1Z5RA 3VATA 2Q43A 2PJ9A 1KWMA 2PJ2A 4K3NA 4C84A 4CDKA 3IIBA 2PJBA 1CBXA 4C8TA 3PB6X 5LRKA 3WC7A 4NGTA 4NFRA 4NGSA 3B7IA 1NSAA 3KI9A 1TF8A 2IJZA 2PRQA 4R6TA 4MCSA 3FJUA 4P6YA 4OP4A 3V38A 2AFWA 1Z8LA 4P4BA 3BI0A 4FWUA 3NH5A 4P44A 2BO9A 4YWYA 1FNOA 1F2OA 3H8FA 4EMEA 1YMEA 5THWA 3BHXA 4NJQA 3VTAA 5ELYA 1LAPA 3VH9A 3WABA 1H8LA 2ZOFA 2G9DA 3VARA 1ZLHA 3SJXA 2O53A 3FMCA 4C99A 4FAIA 1CG2A 5JGFA 1UWYA 2PIYA 3IEHA 4DUKA 4JZ0A 4UEFA 3B35A 2CTCA 3TC8A 7CPAA 4C9VA 1XRYA 2PJAA 4PPZA 1FT7A 2NYQA 5J1QA 5LRGA 1YLOA 5D29A 2RB7A 2HB6A 1Z2LA 1IY7A 3PB8X 4F9UA 3SJEA 4NGQA 4FUUA 3D66A 1QQ9A 5LYDA 3PEIA 4OC4A 3PB9X 4DYOA 2PJ4A 3WT4A 3D4UA 3I6SA 3RZAA 4C9RA 4MHNA 3PBBA 3MN8A 2C1CA 4P4DA 2AFMA 3FF3A 1TKFA 2PIZA 1ARMA 2JBJA 3B3SA 4GM5A 1HDUA 3L2NA 3FEEA 4MMOA 6CPAA 4CPAA 4TNUA 2EK9A 4MHZA 1TF9A 2ZOGA 4EWTA 4MCQA 4P10A 3PB4X 4MHYA 2PJ8A 4MCPA 2IQ6A 1YW6A 2PJ1A 4JYWA 1ZLIA 2ZEHA 3H8EA 2V8GA 2PJ3A 3CPXA 1EE3P 2V8HA 4A37A 1DE4C 1JQGA 4WWVA 1AYEA 4UIAA 1QMUA 3IFEA 4OC0A 1CPXA 3V7ZA 2OR4A 3GUXA 4OKOA 1ARLA 4UEZA 4ONWA 4X3RA 3N5FA 5LYLA 3T8WA 3HUVA 1TXRA 2WZNA 2GU2A 1LFWA 4PXBA 3SI1A 4F9VA 3FH4A 4MHPA 4C8CA 3NH8A 5F09A 4F8ZA 4IHMA 3D7FA 5K8PA 4OC1A 3S9LA 5DS0A
chains in the Genus database with same CATH superfamily
1VBHA 3IWWA 3A9LA 4PK2A 5KTAA 4X8IA 2C6CA 2CNMA 3NH4A 4QB9A 3R9EA 1YLEA 4ZY0A 4E5SA 4L8AA 2K5TA 4GPLB 3ICUA 2POKA 3D3SA 5HKWA 4UA3A 2B3VA 2JBKA 5IB0A 5F1YA 3KL9A 2JDCA 4MFLA 3B8GA 5AG5A 3FYNA 5DWNA 5AXIA 1Z8XA 2OZGA 4RR2B 3R9FA 4AXVA 3I74A 2XEFA 2YNCC 3QAYA 3D7HA 1GHEA 2IMOA 4JXQA 5EC4A 3W6SA 8CPAA 3NA6A 3BUMB 4EVYA 5JH9A 4TJXA 5CNPA 2R8VA 3R1KA 4M3SA 2XPPA 4KOXA 5J8FA 3GB0A 4KVME 3RAMA 3TLCA 3I9SA 3JTKA 1CPSA 2NSMA 2ZEDA 4B5PB 1M6VB 3WC5A 1BXRB 2PCNA 3IC1A 2AUMA 4ZX9A 3FECA 4TJVA 2Z3KA 2ZW4A 1LANA 4PV6A 3TLZA 4OC2A 1I12A 1TKJA 1TKHA 4FD6A 4AG7A 1ELMP 3B3TA 1EO0A 4O23A 1YQEA 4QUSA 5JYBA 4R7MA 3OAKA 2DLAA 2AFUA 2F7VA 2GLFA 2PJ0A 2JDDA 2FSRA 1ZL0A 2DF5A 3T90A 2FM4A 1QSMA 2Y1MA 2QVPA 4UWIA 4CAVA 1YSJA 3TLAA 2Z3PA 1M4DA 2CXAA 3F8KA 4KUBA 3EFAA 2PSWA 3IU1A 1XFOA 4KSAA 4XNHB 3PRTA 2QYVA 4ZX8A 1S5KA 3VWEA 2FS5A 4ZYQA 3TLBA 4A39A 3FVLA 4J3GA 5HXDA 2FE7A 3CDXA 4C2XA 2EO8A 3OWCA 2QJ8A 1X10A 4Z65A 4CYOA 2B3UA 3ISZA 2AFSA 3BI1A 3IO1A 2VBQA 1Z8WA 4MXUA 2GP4A 1KBLA 2BEIA 2GLJA 2JEWA 3RO0A 4ZI6A 4YRHA 2C6PA 1PYTB 2XEGA 3D2PA 4G1PA 4MBUA 4A33A 4XPLA 3KQXA 1CX8A 1IYKA 2Y1NA 3DR8A 3EC4A 1VGYA 3SI0A 4B6ZA 4YGOA 5DWMA 1VIXA 2CNTA 2PDOA 1Y9KA 5A27A 2CF4A 3BLNA 4U5YA 1QSOA 5I0CA 4CGOA 1LAMA 1ZG7A 3RNZA 2B0AA 1TIQA 2B4BA 2BUEA 2I3CA 3F0AA 3H8GA 4B5PA 4M8DA 3TO9A 2PCUA 3DLJA 4KOUA 2XEIA 2DPSA 4W9YA 3T0TA 2GREA 2VL1A 4HNWB 3LMSA 4Y49B 1CP7A 3KHXA 4ONUA 2DPTA 2AFZA 2MP0A 3C8OA 3OP0A 5HKZA 3B3CA 3BJ8A 3KASA 2XEJA 4OC3A 4Q7AA 4OLLA 5AGEA 1WK4A 3U88C 2GIVA 4B10A 3VRNA 3CXPA 5H86A 1BAVA 3BUNB 2WPWA 4MFKA 4PXDA 5HVHA 3GLJA 2D0OA 2ZEPA 2VXKA 4OC5A 1ZG9A 3TX8A 4A30A 4FBEA 3G23A 4M6HA 4F0XA 4BPXB 3SJFA 4IUSA 1A9XB 1Q2DA 1RTQA 5F5XA 2PJ6A 2Q7SA 5HVFA 1SQHA 5D8NA 4CAFA 3KHZA 3FB3A 3V8IA 3FEDA 3R95A 4C8AA 5A28A 2O28A 4HKFA 4C7HA 4NGPA 1R43A 1HDQA 2FIAA 2ZEFA 2YNEA 3TT2A 4C9EA 5J3XA 2PVWA 1LRZA 4BPWB 4NXYA 1C3OB 2R1IA 3QNVA 3PB7X 5K99A 4TWEA 2J8RA 3ISXA 4ZY1A 4R9MA 1R57A 4C9AA 3FX6A 1XE4A 3HLPA 2Q7BA 4H6UA 2F8HA 2I79A 1JDEA 1CP6A 3PBEA 1VHEA 3KGQA 4F0YA 4C8PA 4JXRA 4MCRA 1GYTA 2PQ8A 5HMNA 4NGMA 2AFOA 3B2YA 3JRUA 4M6IA 1B6BA 2Q4VA 3U1BA 3PLFB 3R96A 1F57A 3WC6A 2P0WA 2ZEGA 2ABZA 1YVOA 2J9AA 4MRIA 1Y9ZA 4E94A 5JPHA 2Q0YA 4QVTA 2V77A 3KR5A 4Q38A 4A32A 2XPNA 4X2TA 2D4OA 3KZWA 4MY3A 2OLSA 2EK8A 3OB2B 1FY7A 1PCAA 4DJLA 5IX3A 3K9TA 4B5OA 3EIFA 4NGNA 4YU9A 3TO7A 4C9UA 3FXTA 2XPLA 2V8VA 1FBVA 3NFZA 4AB7A 2CBLA 1ELLP 4OADA 3S9MA 3O8ZA 4M85A 2YNCA 1OBRA 4KZTA 1YK3A 4KSIA 1ZG8A 3E0KA 2PJ5A 2RFHA 4A38A 1XJOA 3VROA 4H2KA 4LQ6A 2VI7A 4LUAA 1ZRSA 3BXMA 5CPAA 3WABA 3TOBA 1RXTA 5G1ZA 1Q2CA 4IK2A 5AG7A 3I1UA 3TOAA 1Z9UA 2Z11A 2V8DA 3SXNA 3CT9A 1S7FA 4B13A 3RBUA 1YVKA 1PUAA 2BCOA 3PZJA 5EBVA 3B3WA 1IGBA 4OIDA 5KTDA 2EZBA 4CO9A 4K30A 5K8OA 1PU9A 2Z3MA 3D8PA 4KOVA 2WYRA 2PJCA 3GJZA 4NJRA 5LYIA 2X0SA 4IAVA 1NSLA 4CDJA 3SI2A 5CBMA 2PE3A 4ZBGA 3ZZIA 4J0NA 4JD6A 4CYQA 5FVJA 2D0PA 1Y0YA 2OH1A 2ZEMA 3BUXB 2ZELA 1WVMA 5G22A 5FD8A 2PVVA 3P2FA 4IF5A 4IIXA 3IJ3A 1KUXA 4R76A 3D7DA 2EVNA 3W91A 4A94A 2VEZA 4M6GA 3ZJ0A 2DEAA 1M1DA 2JEVA 3B3VA 2HC9A 4X5KA 4XPKA 1XF1A 1ZYMA 3K2KA 4OAEA 1IIDA 1DIKA 3F9KC 4NSQA 4R3LA 4NGRA 1BLLE 3H5ZA 2PR1A 3S6FA 2PRBA 5LYFA 2PJ7A 3EY5A 2HROA 3CPAA 3LACA 3DR6A 4CAWA 2OOTA 1NXJA 4YN3A 2ANPA 5F47A 1HEEA 2R98A 2CTBA 4RS2A 1QSTA 4E2AA 5C82A 4CRYB 4HNXB 4EYSA 1Y7EA 3DSBA 4P4JA 3GKRA 3S6KA 1Z4EA 4JVOA 2AJ6A 2Z3OA 3EZAA 2G3AA 2HWGA 4DNCA 4KOSA 1YGHA 2ZPAA 4COBA 4BMHA 2ATRA 4MJ8A 2ZEOA 1Z8TA 1Y0RA 5JM6A 2KCWA 4UIBA 2C5QA 1KZFA 2FL4A 5J8CA 4KNGE 4C86A 2REEA 1MJBA 2Q51A 4KVOE 3KQZA 3MGDA 5K8NA 2Z3NA 3IGRA 1J3LA 5HKYA 1F2PA 2X7BA 5AG4A 2Y0MA 4UEEA 2ODFA 2FT0A 3PFOA 4MFJA 4RN7A 3GIUA 2FVGA 4OMEA 3S9NA 3D68A 1MJAA 2GANA 4C85A 1U6MA 5C88A 3KR4A 1KC7A 1M4LA 4PK3A 3PFEA 2ZW6A 2Z3LA 1BO4A 4PSXA 5K8MA 1N71A 2EWBA 1XBUA 2C6GA 4LQGA 1BPMA 1JDBC 4BD9A 5G21A 2CIJA 2Z0ZA 3QAHA 4P45A 1BPNA 3QB8A 5KTCA 3OB1B 3DGVA 4PQAA 2ZW7A 4PXEA 2YJTA 4UF4A 3NFQA 4NF1A 5LRJA 2QIRA 4P4FA 3SR3A 1IICA 4FD4A 4R8FA 1M4IA 1Y9WA 3H4QA 1KUVA 1XF8A 2AFXA 1Q7LA 2O4HA 3VRPA 3I3GA 4P4IA 2PR8A 2ZEEA 1LCPA 3D2MA 3LD2A 3MRUA 4HPSA 5AG6A 1DTDA 4RUHA 5BWAB 2HQYA 4KUAA 5HVGA 5I4MA 2FCKA 2ZENA 2QECA 4WJBA 3SJGA 2ARHA 1XMBA 2EZCA 2Q4ZA 4OIWA 3LWUA 1VHOA 3GY9A 3T5MA 3D67A 3D7GA 3VGOA 1QSNA 1R3NA 1UFHA 1AMPA 4C8FA 4P4EA 4B11A 1YW4A 4PXCA 2YJVA 4ZY2A 1V6CA 2BOAA 1S7NA 1LOKA 4UBRA 3ZNIA 5G20A 1VBGA 4C8UA 5EMIA 1Z9EA 1Z5RA 4R3KA 4MFQA 3VATA 2Q43A 3DNSA 3C26A 2PJ9A 2G3TA 1KWMA 2PJ2A 2VZYA 4K3NA 1C30B 4C84A 4CDKA 4CGNA 5BY0A 2ZXVA 1B87A 3IIBA 2PJBA 1CBXA 2Q4YA 1CE8B 4C8TA 3IWEA 3PB6X 4XPDC 1CJWA 5LRKA 3WC7A 4CAEA 4NGTA 2YNDA 4KS9A 3TTHA 4NFRA 4NGSA 4KOYA 1Y7RA 3T05A 5F46A 1P4NA 3TLEA 3K9UA 4UFVA 2VKZG 4HNYB 4ORFA 2OU2A 3B7IA 1IOFA 1T36B 1NSAA 2VZZA 3KI9A 4B14A 3TE4A 3RYOA 4C2ZA 1TF8A 2IJZA 2PRQA 2HUZA 4R6TA 4MCSA 4E0AA 2OZHA 4JJXA 4INJA 3T9YA 3W6XA 3FJUA 4A4BA 3T07A 4R87A 4KLVA 3IU2A 1XMTA 4P6YA 4ZGYB 3PP9A 4OP4A 3V38A 2AFWA 4NCZA 1Z8LA 4P4BA 3DDDA 2P6GA 4MFPA 3BI0A 1X12A 1MJ9A 4I49A 4A95A 1IOIA 4Y49C 2BSWA 3TO6A 5ISVA 1XEBA 4FWUA 3G3SA 3UY5A 3NH5A 4P44A 2BO9A 4YWYA 1FNOA 3S6GA 1F2OA 3H8FA 4U9ZA 4EMEA 1YMEA 4E8OA 5THWA 4Q36A 1GGOA 1VHSA 3BHXA 4H1HA 2C27A 4NJQA 3VTAA 5ELYA 1LAPA 3VH9A 2H5MA 2Z10A 4FD7A 1ON0A 2Q04A 4PSWA 1H8LA 2ZOFA 4UCPA 1J4JA 2G9DA 3P2HA 3VARA 1VKCA 4II9A 4CZ1A 3TLYA 2B4JC 1ZLHA 4C2YA 3SJXA 3LODA 1AUGA 2O53A 1K4JA 3FMCA 1VI4A 4C99A 1S7KA 2AE6A 3EXNA 3HPHE 2B5GB 2WUUA 4MFZA 1CG2A 4FAIA 5JGFA 1UWYA 2PIYA 4L89A 2DIKA 3IEHA 1Z4RA 3CXSA 1S7LA 4QC6A 4DUKA 3G8WA 4JZ0A 4MJXA 1WJTA 1XIXA 5F13A 3VRRA 4NEXA 4C68A 3TLGB 3TFYA 4UEFA 4A4CA 3B35A 4MY0A 2CTCA 1Q5XA 2IL4A 3TC8A 7CPAA 4IIYA 2ZW5A 4AVBA 4C7IA 2E28A 4C9VA 4CGLA 4UFWA 1ZO0A 5F48A 1XRYA 2PJAA 4FD5A 4U9YA 4PPZA 1FT7A 3JVNA 4UWJA 2N3AB 2NYQA 2HV2A 2JLMA 5J1QA 4A31A 2P6FA 2R7HA 5LRGA 2WPXA 4H6ZA 4JWPA 1YLOA 5D29A 2RB7A 3VWDA 2AUNA 2HB6A 1Z2LA 4CYNA 1IY7A 3PB8X 4F9UA 3SJEA 4NGQA 1IYLA 2P6EA 4FUUA 3VRQA 2VQYA 3FIXA 1YVHA 3D66A 1QQ9A 4UCMA 5H84A 5LYDA 4KLWA 2A4NA 3PEIA 4OC4A 3PB9X 4JLYA 4DYOA 2PJ4A 3HMJG 3WT4A 4XPDB 4AVCA 4BBHA 4A2ZA 2EZAA 3D4UA 2YGWA 3R9GA 3HPGG 3I6SA 3BUWB 1IB1E 2NMTA 3RZAA 4C9RA 1OZPA 4MHNA 4COGA 1B47A 1MK4A 1NE9A 1XOVA 2C1CA 3CXQA 3MN8A 1A2ZA 3PBBA 4P4DA 4KOWA 4CRZB 1M4GA 2J8MA 1EZBA 2EUIA 2AFMA 2UV8G 3N7ZA 1TKFA 3FF3A 2G0BA 3FBUA 4CYPA 3PT1A 2WSAA 2CY2A 2B5GA 2PIZA 5HH1A 1ARMA 2JBJA 3PFVA 3B3SA 1KUYA 4GM5A 1HDUA 3L2NA 4KORA 3BUOB 3FEEA 4MMOA 4GS4A 4R57A 6CPAA 4CPAA 3TLGA 4EFDA 1KEEB 2B58A 4TNUA 1Q2YA 2EK9A 4MHZA 1WWZA 1TF9A 2ZOGA 1I21A 3EO4A 3KRVA 5IV0A 3FNCA 5JVLA 4KVXA 4EWTA 4MCQA 4P10A 1QSRA 1YX0A 2FXFA 3S6HA 3PB4X 4MHYA 2J8NA 4BINA 1EZAA 2PJ8A 3K4IA 2FIWA 4MCPA 2IQ6A 2OZUA 1YW6A 4CGMA 2PJ1A 1CS0B 2B4DB 1L0CA 2GE3A 4JYWA 1R61A 1ZLIA 3TYXA 1IU8A 5E96A 5IR2A 2ZEHA 3H8EA 2V8GA 1M44A 1BOBA 1P0HA 4MHDA 3BJ7A 3F5BA 2PC1A 2I00A 4UCNA 5GCNA 2PJ3A 4QBJA 2BL1A 1CM0A 5F49A 2HI6A 3CPXA 4BTFA 5JQ4A 1EE3P 4BPUB 1NBWA 2V8HA 4XNHC 3GYAA 4A37A 1DE4C 1JQGA 1YREA 4WWVA 4UFXA 3NOJA 4B12A 3JUWA 1AYEA 3NE8A 1JWQA 2QMLA 3CZXA 1QMUA 3IFEA 2F5IA 4UIAA 4OC0A 1RO5A 1CPXA 1S60A 3TCVA 2Q44A 2R82A 4H89A 4KSFA 3NE7A 3V7ZA 2OR4A 4CGPA 4MI1A 3SXOA 4CAXA 3GUXA 3IWGA 4OKOA 2GFQA 1ARLA 4F6AA 5IB9A 2RC4A 1I1DA 4UEZA 4ONWA 4X3RA 3N5FA 3FRMA 4CS0B 3T8WA 5LYLA 3EZEA 5F9MA 3HUVA 4LX9A 1TXRA 2WZNA 3SHPA 1YR0A 2GU2A 4GXHA 2XPOA 4RI1A 3WR7A 1LFWA 4PXBA 2REFA 2EBJA 3SI1A 4F9VA 1NMTA 3FH4A 3EZBA 2OB0A 4AVAA 3KKWA 1S3ZA 4MHPA 3PGPA 4MI4A 4KOTA 1V0CA 2D4PA 4YFJA 4C8CA 3NH8A 2B4DA 5F09A 4F8ZA 4IHMA 3D7FA 2DXQA 5K8PA 2CNSA 4AG9A 4OC1A 3S9LA 5DS0A
chains in the Genus database with same CATH topology
3IWWA 4X8IA 2C6CA 3NH4A 4ZY0A 3ICUA 2POKA 2JBKA 3KL9A 4AXVA 3I74A 2XEFA 3D7HA 2IMOA 5JH9A 4TJXA 8CPAA 3NA6A 3GB0A 3RAMA 1CPSA 2NSMA 2ZEDA 3WC5A 3IC1A 4ZX9A 3FECA 4TJVA 1LANA 4OC2A 1TKJA 1TKHA 1ELMP 3B3TA 4O23A 4R7MA 2AFUA 2F7VA 2GLFA 2PJ0A 2QVPA 1YSJA 4EFDA 4ZX8A 1XFOA 3PRTA 2QYVA 4ZYQA 4A39A 3FVLA 5HXDA 3CDXA 2QJ8A 4Z65A 3ISZA 2AFSA 3BI1A 3IO1A 4MXUA 2GP4A 2GLJA 2JEWA 4ZI6A 2C6PA 1PYTB 2XEGA 4G1PA 3KQXA 1CX8A 4B6ZA 3SI0A 1VGYA 1VIXA 2CF4A 1LAMA 1ZG7A 2I3CA 3H8GA 2PCUA 3DLJA 2XEIA 4W9YA 2GREA 2VL1A 3LMSA 1CP7A 3KHXA 2AFZA 3B3CA 3KASA 4OC3A 2XEJA 4Q7AA 1BAVA 4PXDA 5HVHA 3GLJA 2ZEPA 3TX8A 4OC5A 1ZG9A 4FBEA 3SJFA 1RTQA 2PJ6A 5HVFA 5D8NA 3KHZA 3FEDA 4C8AA 4NGPA 1R43A 1HDQA 2ZEFA 4C9EA 2PVWA 3QNVA 3PB7X 4TWEA 3ISXA 4ZY1A 4C9AA 3FX6A 3HLPA 2F8HA 1CP6A 3PBEA 1VHEA 3KGQA 4C8PA 4MCRA 1GYTA 4NGMA 2AFOA 3B2YA 3JRUA 1F57A 3WC6A 2ZEGA 2ABZA 1Y9ZA 2J9AA 4MRIA 2V77A 3KR5A 4X2TA 3KZWA 2EK8A 1PCAA 4DJLA 3K9TA 3EIFA 4NGNA 4YU9A 4C9UA 2V8VA 3NFZA 1ELLP 3S9MA 1OBRA 4KSIA 1ZG8A 2PJ5A 2RFHA 4A38A 1XJOA 4H2KA 3BXMA 5CPAA 4IK2A 3I1UA 2V8DA 3CT9A 3RBUA 2BCOA 3B3WA 1IGBA 4OIDA 5K8OA 2WYRA 2PJCA 4NJRA 5LYIA 4CDJA 4IAVA 3SI2A 5CBMA 2PE3A 1Y0YA 2ZEMA 2ZELA 1WVMA 2PVVA 3IJ3A 4R76A 3D7DA 4A94A 2DEAA 1XF1A 3B3VA 2HC9A 3K2KA 4NGRA 1BLLE 5LYFA 2PJ7A 4YN3A 3CPAA 2OOTA 2ANPA 1HEEA 2CTBA 1Y7EA 4P4JA 2ZEOA 1Y0RA 5JM6A 4UIBA 2C5QA 4KNGE 4C86A 2Q51A 3KQZA 5K8NA 1F2PA 4UEEA 3PFOA 2FVGA 4OMEA 3S9NA 3D68A 4C85A 3KR4A 1M4LA 3PFEA 5K8MA 2EWBA 1XBUA 2C6GA 4LQGA 1BPMA 4BD9A 2CIJA 4P45A 1BPNA 3DGVA 4PQAA 4PXEA 4UF4A 5LRJA 4P4FA 4R8FA 2O4HA 2AFXA 1Q7LA 4P4IA 3MRUA 2ZEEA 1LCPA 5IB9A 5HVGA 1DTDA 4RUHA 5I4MA 2ZENA 4WJBA 3SJGA 1XMBA 2Q4ZA 4OIWA 3LWUA 1VHOA 3D67A 3D7GA 1R3NA 1AMPA 4C8FA 4P4EA 1YW4A 4PXCA 4ZY2A 1V6CA 2BOAA 1LOKA 4C8UA 1Z5RA 3VATA 2Q43A 2PJ9A 1KWMA 2PJ2A 4K3NA 4C84A 4CDKA 3IIBA 2PJBA 1CBXA 4C8TA 3PB6X 5LRKA 3WC7A 4NGTA 4NFRA 4NGSA 3B7IA 1NSAA 3KI9A 1TF8A 2IJZA 2PRQA 4R6TA 4MCSA 3FJUA 4P6YA 4OP4A 3V38A 2AFWA 1Z8LA 4P4BA 3BI0A 4FWUA 3NH5A 4P44A 2BO9A 4YWYA 1FNOA 1F2OA 3H8FA 4EMEA 1YMEA 5THWA 3BHXA 4NJQA 3VTAA 5ELYA 1LAPA 3VH9A 3WABA 1H8LA 2ZOFA 2G9DA 3VARA 1ZLHA 3SJXA 2O53A 3FMCA 4C99A 4FAIA 1CG2A 5JGFA 1UWYA 2PIYA 3IEHA 4DUKA 4JZ0A 4UEFA 3B35A 2CTCA 3TC8A 7CPAA 4C9VA 1XRYA 2PJAA 4PPZA 1FT7A 2NYQA 5J1QA 5LRGA 1YLOA 5D29A 2RB7A 2HB6A 1Z2LA 1IY7A 3PB8X 4F9UA 3SJEA 4NGQA 4FUUA 3D66A 1QQ9A 5LYDA 3PEIA 4OC4A 3PB9X 4DYOA 2PJ4A 3WT4A 3D4UA 3I6SA 3RZAA 4C9RA 4MHNA 3PBBA 3MN8A 2C1CA 4P4DA 2AFMA 3FF3A 1TKFA 2PIZA 1ARMA 2JBJA 3B3SA 4GM5A 1HDUA 3L2NA 3FEEA 4MMOA 6CPAA 4CPAA 4TNUA 2EK9A 4MHZA 1TF9A 2ZOGA 4EWTA 4MCQA 4P10A 3PB4X 4MHYA 2PJ8A 4MCPA 2IQ6A 1YW6A 2PJ1A 4JYWA 1ZLIA 5IR2A 2ZEHA 3H8EA 2V8GA 2PJ3A 3CPXA 1EE3P 2V8HA 4A37A 1DE4C 1JQGA 4WWVA 1AYEA 4UIAA 1QMUA 3IFEA 4OC0A 1CPXA 3V7ZA 2OR4A 3GUXA 4OKOA 1ARLA 4UEZA 4ONWA 4X3RA 3N5FA 5LYLA 3T8WA 3HUVA 1TXRA 2WZNA 2GU2A 1LFWA 4PXBA 3SI1A 4F9VA 3FH4A 4MHPA 4C8CA 3NH8A 5F09A 4F8ZA 4IHMA 3D7FA 5K8PA 4OC1A 3S9LA 5DS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWW A;  4X8I A;  2C6C A;  3NH4 A;  4ZY0 A;  3ICU A;  2POK A;  2JBK A;  3KL9 A;  4AXV A;  3I74 A;  2XEF A;  3D7H A;  2IMO A;  5JH9 A;  4TJX A;  8CPA A;  3NA6 A;  3GB0 A;  3RAM A;  1CPS A;  2NSM A;  2ZED A;  3WC5 A;  3IC1 A;  4ZX9 A;  3FEC A;  4TJV A;  1LAN A;  4OC2 A;  1TKJ A;  1TKH A;  1ELM P;  3B3T A;  4O23 A;  4R7M A;  2AFU A;  2F7V A;  2GLF A;  2PJ0 A;  2QVP A;  1YSJ A;  4EFD A;  4ZX8 A;  1XFO A;  3PRT A;  2QYV A;  4ZYQ A;  4A39 A;  3FVL A;  5HXD A;  3CDX A;  2QJ8 A;  4Z65 A;  3ISZ A;  2AFS A;  3BI1 A;  3IO1 A;  4MXU A;  2GLJ A;  2JEW A;  4ZI6 A;  2C6P A;  1PYT B;  2XEG A;  4G1P A;  3KQX A;  1CX8 A;  4B6Z A;  3SI0 A;  1VGY A;  1VIX A;  2CF4 A;  1LAM A;  1ZG7 A;  2I3C A;  3H8G A;  2PCU A;  3DLJ A;  2XEI A;  4W9Y A;  2GRE A;  2VL1 A;  3LMS A;  1CP7 A;  3KHX A;  2AFZ A;  3B3C A;  3KAS A;  4OC3 A;  2XEJ A;  4Q7A A;  1BAV A;  4PXD A;  5HVH A;  3GLJ A;  2ZEP A;  3TX8 A;  4OC5 A;  1ZG9 A;  4FBE A;  3SJF A;  1RTQ A;  2PJ6 A;  5HVF A;  5D8N A;  3KHZ A;  3FED A;  4C8A A;  4NGP A;  1R43 A;  1HDQ A;  2ZEF A;  4C9E A;  2PVW A;  3QNV A;  3PB7 X;  4TWE A;  3ISX A;  4ZY1 A;  4C9A A;  3FX6 A;  3HLP A;  2F8H A;  1CP6 A;  3PBE A;  1VHE A;  3KGQ A;  4C8P A;  4MCR A;  1GYT A;  4NGM A;  2AFO A;  3B2Y A;  3JRU A;  1F57 A;  3WC6 A;  2ZEG A;  2ABZ A;  1Y9Z A;  2J9A A;  4MRI A;  2V77 A;  3KR5 A;  4X2T A;  3KZW A;  2EK8 A;  1PCA A;  4DJL A;  3K9T A;  3EIF A;  4NGN A;  4YU9 A;  4C9U A;  2V8V A;  3NFZ A;  1ELL P;  3S9M A;  1OBR A;  4KSI A;  1ZG8 A;  2PJ5 A;  2RFH A;  4A38 A;  1XJO A;  4H2K A;  3BXM A;  5CPA A;  4IK2 A;  3I1U A;  2V8D A;  3CT9 A;  3RBU A;  2BCO A;  3B3W A;  1IGB A;  4OID A;  5K8O A;  2WYR A;  2PJC A;  4NJR A;  5LYI A;  4CDJ A;  4IAV A;  3SI2 A;  5CBM A;  2PE3 A;  1Y0Y A;  2ZEM A;  2ZEL A;  1WVM A;  2PVV A;  3IJ3 A;  4R76 A;  3D7D A;  4A94 A;  2DEA A;  1XF1 A;  3B3V A;  2HC9 A;  3K2K A;  4NGR A;  1BLL E;  5LYF A;  2PJ7 A;  4YN3 A;  3CPA A;  2OOT A;  2ANP A;  1HEE A;  2CTB A;  1Y7E A;  4P4J A;  2ZEO A;  1Y0R A;  5JM6 A;  4UIB A;  4KNG E;  4C86 A;  2Q51 A;  3KQZ A;  5K8N A;  1F2P A;  4UEE A;  3PFO A;  2FVG A;  4OME A;  3S9N A;  3D68 A;  4C85 A;  3KR4 A;  1M4L A;  3PFE A;  5K8M A;  2EWB A;  1XBU A;  2C6G A;  4LQG A;  1BPM A;  4BD9 A;  2CIJ A;  4P45 A;  1BPN A;  3DGV A;  4PQA A;  4PXE A;  4UF4 A;  5LRJ A;  4P4F A;  4R8F A;  2O4H A;  2AFX A;  1Q7L A;  4P4I A;  3MRU A;  2ZEE A;  1LCP A;  5IB9 A;  5HVG A;  1DTD A;  4RUH A;  5I4M A;  2ZEN A;  4WJB A;  3SJG A;  1XMB A;  2Q4Z A;  4OIW A;  3LWU A;  1VHO A;  3D67 A;  3D7G A;  1R3N A;  1AMP A;  4C8F A;  4P4E A;  1YW4 A;  4PXC A;  4ZY2 A;  1V6C A;  2BOA A;  1LOK A;  4C8U A;  1Z5R A;  3VAT A;  2Q43 A;  2PJ9 A;  1KWM A;  2PJ2 A;  4K3N A;  4C84 A;  4CDK A;  3IIB A;  2PJB A;  1CBX A;  4C8T A;  3PB6 X;  5LRK A;  3WC7 A;  4NGT A;  4NFR A;  4NGS A;  3B7I A;  1NSA A;  3KI9 A;  1TF8 A;  2IJZ A;  2PRQ A;  4R6T A;  4MCS A;  3FJU A;  4P6Y A;  4OP4 A;  3V38 A;  2AFW A;  1Z8L A;  4P4B A;  3BI0 A;  4FWU A;  3NH5 A;  4P44 A;  2BO9 A;  4YWY A;  1FNO A;  1F2O A;  3H8F A;  4EME A;  1YME A;  5THW A;  3BHX A;  4NJQ A;  3VTA A;  5ELY A;  1LAP A;  3VH9 A;  3WAB A;  1H8L A;  2ZOF A;  2G9D A;  3VAR A;  1ZLH A;  3SJX A;  2O53 A;  3FMC A;  4C99 A;  4FAI A;  1CG2 A;  5JGF A;  1UWY A;  2PIY A;  3IEH A;  4DUK A;  4JZ0 A;  4UEF A;  3B35 A;  2CTC A;  3TC8 A;  7CPA A;  4C9V A;  1XRY A;  2PJA A;  4PPZ A;  1FT7 A;  2NYQ A;  5J1Q A;  5LRG A;  1YLO A;  5D29 A;  2RB7 A;  2HB6 A;  1Z2L A;  1IY7 A;  3PB8 X;  4F9U A;  3SJE A;  4NGQ A;  4FUU A;  3D66 A;  1QQ9 A;  5LYD A;  3PEI A;  4OC4 A;  3PB9 X;  4DYO A;  2PJ4 A;  3WT4 A;  3D4U A;  3I6S A;  3RZA A;  4C9R A;  4MHN A;  3PBB A;  3MN8 A;  2C1C A;  4P4D A;  2AFM A;  3FF3 A;  1TKF A;  2PIZ A;  1ARM A;  2JBJ A;  3B3S A;  4GM5 A;  1HDU A;  3L2N A;  3FEE A;  4MMO A;  6CPA A;  4CPA A;  4TNU A;  2EK9 A;  4MHZ A;  1TF9 A;  2ZOG A;  4EWT A;  4MCQ A;  4P10 A;  3PB4 X;  4MHY A;  2PJ8 A;  4MCP A;  2IQ6 A;  1YW6 A;  2PJ1 A;  4JYW A;  1ZLI A;  2ZEH A;  3H8E A;  2V8G A;  2PJ3 A;  3CPX A;  1EE3 P;  2V8H A;  4A37 A;  1DE4 C;  1JQG A;  4WWV A;  1AYE A;  4UIA A;  1QMU A;  3IFE A;  4OC0 A;  1CPX A;  3V7Z A;  2OR4 A;  3GUX A;  4OKO A;  1ARL A;  4UEZ A;  4ONW A;  4X3R A;  3N5F A;  5LYL A;  3T8W A;  3HUV A;  1TXR A;  2WZN A;  2GU2 A;  1LFW A;  4PXB A;  3SI1 A;  4F9V A;  3FH4 A;  4MHP A;  4C8C A;  3NH8 A;  5F09 A;  4F8Z A;  4IHM A;  3D7F A;  5K8P A;  4OC1 A;  3S9L A;  5DS0 A; 
#chains in the Genus database with same CATH topology
 1VBH A;  3IWW A;  3A9L A;  4PK2 A;  5KTA A;  4X8I A;  2C6C A;  2CNM A;  3NH4 A;  4QB9 A;  3R9E A;  1YLE A;  4ZY0 A;  4E5S A;  4L8A A;  2K5T A;  4GPL B;  3ICU A;  2POK A;  3D3S A;  5HKW A;  4UA3 A;  2B3V A;  2JBK A;  5IB0 A;  5F1Y A;  3KL9 A;  2JDC A;  4MFL A;  3B8G A;  5AG5 A;  3FYN A;  5DWN A;  5AXI A;  1Z8X A;  2OZG A;  4RR2 B;  3R9F A;  4AXV A;  3I74 A;  2XEF A;  2YNC C;  3QAY A;  3D7H A;  1GHE A;  2IMO A;  4JXQ A;  5EC4 A;  3W6S A;  8CPA A;  3NA6 A;  3BUM B;  4EVY A;  5JH9 A;  4TJX A;  5CNP A;  2R8V A;  3R1K A;  4M3S A;  2XPP A;  4KOX A;  5J8F A;  3GB0 A;  4KVM E;  3RAM A;  3TLC A;  3I9S A;  3JTK A;  1CPS A;  2NSM A;  2ZED A;  4B5P B;  1M6V B;  3WC5 A;  1BXR B;  2PCN A;  3IC1 A;  2AUM A;  4ZX9 A;  3FEC A;  4TJV A;  2Z3K A;  2ZW4 A;  1LAN A;  4PV6 A;  3TLZ A;  4OC2 A;  1I12 A;  1TKJ A;  1TKH A;  4FD6 A;  4AG7 A;  1ELM P;  3B3T A;  1EO0 A;  4O23 A;  1YQE A;  4QUS A;  5JYB A;  4R7M A;  3OAK A;  2DLA A;  2AFU A;  2F7V A;  2GLF A;  2PJ0 A;  2JDD A;  2FSR A;  1ZL0 A;  2DF5 A;  3T90 A;  2FM4 A;  1QSM A;  2Y1M A;  2QVP A;  4UWI A;  4CAV A;  1YSJ A;  3TLA A;  2Z3P A;  1M4D A;  2CXA A;  3F8K A;  4KUB A;  3EFA A;  2PSW A;  3IU1 A;  1XFO A;  4KSA A;  4XNH B;  3PRT A;  2QYV A;  4ZX8 A;  1S5K A;  3VWE A;  2FS5 A;  4ZYQ A;  3TLB A;  4A39 A;  3FVL A;  4J3G A;  5HXD A;  2FE7 A;  3CDX A;  4C2X A;  2EO8 A;  3OWC A;  2QJ8 A;  1X10 A;  4Z65 A;  4CYO A;  2B3U A;  3ISZ A;  2AFS A;  3BI1 A;  3IO1 A;  2VBQ A;  1Z8W A;  4MXU A;  2GP4 A;  1KBL A;  2BEI A;  2GLJ A;  2JEW A;  3RO0 A;  4ZI6 A;  4YRH A;  2C6P A;  1PYT B;  2XEG A;  3D2P A;  4G1P A;  4MBU A;  4A33 A;  4XPL A;  3KQX A;  1CX8 A;  1IYK A;  2Y1N A;  3DR8 A;  3EC4 A;  1VGY A;  3SI0 A;  4B6Z A;  4YGO A;  5DWM A;  1VIX A;  2CNT A;  2PDO A;  1Y9K A;  5A27 A;  2CF4 A;  3BLN A;  4U5Y A;  1QSO A;  5I0C A;  4CGO A;  1LAM A;  1ZG7 A;  3RNZ A;  2B0A A;  1TIQ A;  2B4B A;  2BUE A;  2I3C A;  3F0A A;  3H8G A;  4B5P A;  4M8D A;  3TO9 A;  2PCU A;  3DLJ A;  4KOU A;  2XEI A;  2DPS A;  4W9Y A;  3T0T A;  2GRE A;  2VL1 A;  4HNW B;  3LMS A;  4Y49 B;  1CP7 A;  3KHX A;  4ONU A;  2DPT A;  2AFZ A;  2MP0 A;  3C8O A;  3OP0 A;  5HKZ A;  3B3C A;  3BJ8 A;  3KAS A;  2XEJ A;  4OC3 A;  4Q7A A;  4OLL A;  5AGE A;  1WK4 A;  3U88 C;  2GIV A;  4B10 A;  3VRN A;  3CXP A;  5H86 A;  1BAV A;  3BUN B;  2WPW A;  4MFK A;  4PXD A;  5HVH A;  3GLJ A;  2D0O A;  2ZEP A;  2VXK A;  4OC5 A;  1ZG9 A;  3TX8 A;  4A30 A;  4FBE A;  3G23 A;  4M6H A;  4F0X A;  4BPX B;  3SJF A;  4IUS A;  1A9X B;  1Q2D A;  1RTQ A;  5F5X A;  2PJ6 A;  2Q7S A;  5HVF A;  1SQH A;  5D8N A;  4CAF A;  3KHZ A;  3FB3 A;  3V8I A;  3FED A;  3R95 A;  4C8A A;  5A28 A;  2O28 A;  4HKF A;  4C7H A;  4NGP A;  1R43 A;  1HDQ A;  2FIA A;  2ZEF A;  2YNE A;  3TT2 A;  4C9E A;  5J3X A;  2PVW A;  1LRZ A;  4BPW B;  4NXY A;  1C3O B;  2R1I A;  3QNV A;  3PB7 X;  5K99 A;  4TWE A;  2J8R A;  3ISX A;  4ZY1 A;  4R9M A;  1R57 A;  4C9A A;  3FX6 A;  1XE4 A;  3HLP A;  2Q7B A;  4H6U A;  2F8H A;  2I79 A;  1JDE A;  1CP6 A;  3PBE A;  1VHE A;  3KGQ A;  4F0Y A;  4C8P A;  4JXR A;  4MCR A;  1GYT A;  2PQ8 A;  5HMN A;  4NGM A;  2AFO A;  3B2Y A;  3JRU A;  4M6I A;  1B6B A;  2Q4V A;  3U1B A;  3PLF B;  3R96 A;  1F57 A;  3WC6 A;  2P0W A;  2ZEG A;  2ABZ A;  1YVO A;  2J9A A;  4MRI A;  1Y9Z A;  4E94 A;  5JPH A;  2Q0Y A;  4QVT A;  2V77 A;  3KR5 A;  4Q38 A;  4A32 A;  2XPN A;  4X2T A;  2D4O A;  3KZW A;  4MY3 A;  2OLS A;  2EK8 A;  3OB2 B;  1FY7 A;  1PCA A;  4DJL A;  5IX3 A;  3K9T A;  4B5O A;  3EIF A;  4NGN A;  4YU9 A;  3TO7 A;  4C9U A;  3FXT A;  2XPL A;  2V8V A;  1FBV A;  3NFZ A;  4AB7 A;  2CBL A;  1ELL P;  4OAD A;  3S9M A;  3O8Z A;  4M85 A;  2YNC A;  1OBR A;  4KZT A;  1YK3 A;  4KSI A;  1ZG8 A;  3E0K A;  2PJ5 A;  2RFH A;  4A38 A;  1XJO A;  3VRO A;  4H2K A;  4LQ6 A;  2VI7 A;  4LUA A;  1ZRS A;  3BXM A;  5CPA A;  3WAB A;  3TOB A;  1RXT A;  5G1Z A;  1Q2C A;  4IK2 A;  5AG7 A;  3I1U A;  3TOA A;  1Z9U A;  2Z11 A;  2V8D A;  3SXN A;  3CT9 A;  1S7F A;  4B13 A;  3RBU A;  1YVK A;  1PUA A;  2BCO A;  3PZJ A;  5EBV A;  3B3W A;  1IGB A;  4OID A;  5KTD A;  2EZB A;  4CO9 A;  4K30 A;  5K8O A;  1PU9 A;  2Z3M A;  3D8P A;  4KOV A;  2WYR A;  2PJC A;  3GJZ A;  4NJR A;  5LYI A;  2X0S A;  4IAV A;  1NSL A;  4CDJ A;  3SI2 A;  5CBM A;  2PE3 A;  4ZBG A;  3ZZI A;  4J0N A;  4JD6 A;  4CYQ A;  5FVJ A;  2D0P A;  1Y0Y A;  2OH1 A;  2ZEM A;  3BUX B;  2ZEL A;  1WVM A;  5G22 A;  5FD8 A;  2PVV A;  3P2F A;  4IF5 A;  4IIX A;  3IJ3 A;  1KUX A;  4R76 A;  3D7D A;  2EVN A;  3W91 A;  4A94 A;  2VEZ A;  4M6G A;  3ZJ0 A;  2DEA A;  1M1D A;  2JEV A;  3B3V A;  2HC9 A;  4X5K A;  4XPK A;  1XF1 A;  1ZYM A;  3K2K A;  4OAE A;  1IID A;  1DIK A;  3F9K C;  4NSQ A;  4R3L A;  4NGR A;  1BLL E;  3H5Z A;  2PR1 A;  3S6F A;  2PRB A;  5LYF A;  2PJ7 A;  3EY5 A;  2HRO A;  3CPA A;  3LAC A;  3DR6 A;  4CAW A;  2OOT A;  1NXJ A;  4YN3 A;  2ANP A;  5F47 A;  1HEE A;  2R98 A;  2CTB A;  4RS2 A;  1QST A;  4E2A A;  5C82 A;  4CRY B;  4HNX B;  4EYS A;  1Y7E A;  3DSB A;  4P4J A;  3GKR A;  3S6K A;  1Z4E A;  4JVO A;  2AJ6 A;  2Z3O A;  3EZA A;  2G3A A;  2HWG A;  4DNC A;  4KOS A;  1YGH A;  2ZPA A;  4COB A;  4BMH A;  2ATR A;  4MJ8 A;  2ZEO A;  1Z8T A;  1Y0R A;  5JM6 A;  2KCW A;  4UIB A;  2C5Q A;  1KZF A;  2FL4 A;  5J8C A;  4KNG E;  4C86 A;  2REE A;  1MJB A;  2Q51 A;  4KVO E;  3KQZ A;  3MGD A;  5K8N A;  2Z3N A;  3IGR A;  1J3L A;  5HKY A;  1F2P A;  2X7B A;  5AG4 A;  2Y0M A;  4UEE A;  2ODF A;  2FT0 A;  3PFO A;  4MFJ A;  4RN7 A;  3GIU A;  2FVG A;  4OME A;  3S9N A;  3D68 A;  1MJA A;  2GAN A;  4C85 A;  1U6M A;  5C88 A;  3KR4 A;  1KC7 A;  1M4L A;  4PK3 A;  3PFE A;  2ZW6 A;  2Z3L A;  1BO4 A;  4PSX A;  5K8M A;  1N71 A;  2EWB A;  1XBU A;  2C6G A;  4LQG A;  1BPM A;  1JDB C;  4BD9 A;  5G21 A;  2CIJ A;  2Z0Z A;  3QAH A;  4P45 A;  1BPN A;  3QB8 A;  5KTC A;  3OB1 B;  3DGV A;  4PQA A;  2ZW7 A;  4PXE A;  2YJT A;  4UF4 A;  3NFQ A;  4NF1 A;  5LRJ A;  2QIR A;  4P4F A;  3SR3 A;  1IIC A;  4FD4 A;  4R8F A;  1M4I A;  1Y9W A;  3H4Q A;  1KUV A;  1XF8 A;  2AFX A;  1Q7L A;  2O4H A;  3VRP A;  3I3G A;  4P4I A;  2PR8 A;  2ZEE A;  1LCP A;  3D2M A;  3LD2 A;  3MRU A;  4HPS A;  5AG6 A;  1DTD A;  4RUH A;  5BWA B;  2HQY A;  4KUA A;  5HVG A;  5I4M A;  2FCK A;  2ZEN A;  2QEC A;  4WJB A;  3SJG A;  2ARH A;  1XMB A;  2EZC A;  2Q4Z A;  4OIW A;  3LWU A;  1VHO A;  3GY9 A;  3T5M A;  3D67 A;  3D7G A;  3VGO A;  1QSN A;  1R3N A;  1UFH A;  1AMP A;  4C8F A;  4P4E A;  4B11 A;  1YW4 A;  4PXC A;  2YJV A;  4ZY2 A;  1V6C A;  2BOA A;  1S7N A;  1LOK A;  4UBR A;  3ZNI A;  5G20 A;  1VBG A;  4C8U A;  5EMI A;  1Z9E A;  1Z5R A;  4R3K A;  4MFQ A;  3VAT A;  2Q43 A;  3DNS A;  3C26 A;  2PJ9 A;  2G3T A;  1KWM A;  2PJ2 A;  2VZY A;  4K3N A;  1C30 B;  4C84 A;  4CDK A;  4CGN A;  5BY0 A;  2ZXV A;  1B87 A;  3IIB A;  2PJB A;  1CBX A;  2Q4Y A;  1CE8 B;  4C8T A;  3IWE A;  3PB6 X;  4XPD C;  1CJW A;  5LRK A;  3WC7 A;  4CAE A;  4NGT A;  2YND A;  4KS9 A;  3TTH A;  4NFR A;  4NGS A;  4KOY A;  1Y7R A;  3T05 A;  5F46 A;  1P4N A;  3TLE A;  3K9U A;  4UFV A;  2VKZ G;  4HNY B;  4ORF A;  2OU2 A;  3B7I A;  1IOF A;  1T36 B;  1NSA A;  2VZZ A;  3KI9 A;  4B14 A;  3TE4 A;  3RYO A;  4C2Z A;  1TF8 A;  2IJZ A;  2PRQ A;  2HUZ A;  4R6T A;  4MCS A;  4E0A A;  2OZH A;  4JJX A;  4INJ A;  3T9Y A;  3W6X A;  3FJU A;  4A4B A;  3T07 A;  4R87 A;  4KLV A;  3IU2 A;  1XMT A;  4P6Y A;  4ZGY B;  3PP9 A;  4OP4 A;  3V38 A;  2AFW A;  4NCZ A;  1Z8L A;  4P4B A;  3DDD A;  2P6G A;  4MFP A;  3BI0 A;  1X12 A;  1MJ9 A;  4I49 A;  4A95 A;  1IOI A;  4Y49 C;  2BSW A;  3TO6 A;  5ISV A;  1XEB A;  4FWU A;  3G3S A;  3UY5 A;  3NH5 A;  4P44 A;  2BO9 A;  4YWY A;  1FNO A;  3S6G A;  1F2O A;  3H8F A;  4U9Z A;  4EME A;  1YME A;  4E8O A;  5THW A;  4Q36 A;  1GGO A;  1VHS A;  3BHX A;  4H1H A;  2C27 A;  4NJQ A;  3VTA A;  5ELY A;  1LAP A;  3VH9 A;  2H5M A;  2Z10 A;  4FD7 A;  1ON0 A;  2Q04 A;  4PSW A;  1H8L A;  2ZOF A;  4UCP A;  1J4J A;  2G9D A;  3P2H A;  3VAR A;  1VKC A;  4II9 A;  4CZ1 A;  3TLY A;  2B4J C;  1ZLH A;  4C2Y A;  3SJX A;  3LOD A;  1AUG A;  2O53 A;  1K4J A;  3FMC A;  1VI4 A;  4C99 A;  1S7K A;  2AE6 A;  3EXN A;  3HPH E;  2B5G B;  2WUU A;  4MFZ A;  1CG2 A;  4FAI A;  5JGF A;  1UWY A;  2PIY A;  4L89 A;  2DIK A;  3IEH A;  1Z4R A;  3CXS A;  1S7L A;  4QC6 A;  4DUK A;  3G8W A;  4JZ0 A;  4MJX A;  1WJT A;  1XIX A;  5F13 A;  3VRR A;  4NEX A;  4C68 A;  3TLG B;  3TFY A;  4UEF A;  4A4C A;  3B35 A;  4MY0 A;  2CTC A;  1Q5X A;  2IL4 A;  3TC8 A;  7CPA A;  4IIY A;  2ZW5 A;  4AVB A;  4C7I A;  2E28 A;  4C9V A;  4CGL A;  4UFW A;  1ZO0 A;  5F48 A;  1XRY A;  2PJA A;  4FD5 A;  4U9Y A;  4PPZ A;  1FT7 A;  3JVN A;  4UWJ A;  2N3A B;  2NYQ A;  2HV2 A;  2JLM A;  5J1Q A;  4A31 A;  2P6F A;  2R7H A;  5LRG A;  2WPX A;  4H6Z A;  4JWP A;  1YLO A;  5D29 A;  2RB7 A;  3VWD A;  2AUN A;  2HB6 A;  1Z2L A;  4CYN A;  1IY7 A;  3PB8 X;  4F9U A;  3SJE A;  4NGQ A;  1IYL A;  2P6E A;  4FUU A;  3VRQ A;  2VQY A;  3FIX A;  1YVH A;  3D66 A;  1QQ9 A;  4UCM A;  5H84 A;  5LYD A;  4KLW A;  2A4N A;  3PEI A;  4OC4 A;  3PB9 X;  4JLY A;  4DYO A;  2PJ4 A;  3HMJ G;  3WT4 A;  4XPD B;  4AVC A;  4BBH A;  4A2Z A;  2EZA A;  3D4U A;  2YGW A;  3R9G A;  3HPG G;  3I6S A;  3BUW B;  1IB1 E;  2NMT A;  3RZA A;  4C9R A;  1OZP A;  4MHN A;  4COG A;  1B47 A;  1MK4 A;  1NE9 A;  1XOV A;  2C1C A;  3CXQ A;  3MN8 A;  1A2Z A;  3PBB A;  4P4D A;  4KOW A;  4CRZ B;  1M4G A;  2J8M A;  1EZB A;  2EUI A;  2AFM A;  2UV8 G;  3N7Z A;  1TKF A;  3FF3 A;  2G0B A;  3FBU A;  4CYP A;  3PT1 A;  2WSA A;  2CY2 A;  2B5G A;  2PIZ A;  5HH1 A;  1ARM A;  2JBJ A;  3PFV A;  3B3S A;  1KUY A;  4GM5 A;  1HDU A;  3L2N A;  4KOR A;  3BUO B;  3FEE A;  4MMO A;  4GS4 A;  4R57 A;  6CPA A;  4CPA A;  3TLG A;  4EFD A;  1KEE B;  2B58 A;  4TNU A;  1Q2Y A;  2EK9 A;  4MHZ A;  1WWZ A;  1TF9 A;  2ZOG A;  1I21 A;  3EO4 A;  3KRV A;  5IV0 A;  3FNC A;  5JVL A;  4KVX A;  4EWT A;  4MCQ A;  4P10 A;  1QSR A;  1YX0 A;  2FXF A;  3S6H A;  3PB4 X;  4MHY A;  2J8N A;  4BIN A;  1EZA A;  2PJ8 A;  3K4I A;  2FIW A;  4MCP A;  2IQ6 A;  2OZU A;  1YW6 A;  4CGM A;  2PJ1 A;  1CS0 B;  2B4D B;  1L0C A;  2GE3 A;  4JYW A;  1R61 A;  1ZLI A;  3TYX A;  1IU8 A;  5E96 A;  5IR2 A;  2ZEH A;  3H8E A;  2V8G A;  1M44 A;  1BOB A;  1P0H A;  4MHD A;  3BJ7 A;  3F5B A;  2PC1 A;  2I00 A;  4UCN A;  5GCN A;  2PJ3 A;  4QBJ A;  2BL1 A;  1CM0 A;  5F49 A;  2HI6 A;  3CPX A;  4BTF A;  5JQ4 A;  1EE3 P;  4BPU B;  1NBW A;  2V8H A;  4XNH C;  3GYA A;  4A37 A;  1DE4 C;  1JQG A;  1YRE A;  4WWV A;  4UFX A;  3NOJ A;  4B12 A;  3JUW A;  1AYE A;  3NE8 A;  1JWQ A;  2QML A;  3CZX A;  1QMU A;  3IFE A;  2F5I A;  4UIA A;  4OC0 A;  1RO5 A;  1CPX A;  1S60 A;  3TCV A;  2Q44 A;  2R82 A;  4H89 A;  4KSF A;  3NE7 A;  3V7Z A;  2OR4 A;  4CGP A;  4MI1 A;  3SXO A;  4CAX A;  3GUX A;  3IWG A;  4OKO A;  2GFQ A;  1ARL A;  4F6A A;  5IB9 A;  2RC4 A;  1I1D A;  4UEZ A;  4ONW A;  4X3R A;  3N5F A;  3FRM A;  4CS0 B;  3T8W A;  5LYL A;  3EZE A;  5F9M A;  3HUV A;  4LX9 A;  1TXR A;  2WZN A;  3SHP A;  1YR0 A;  2GU2 A;  4GXH A;  2XPO A;  4RI1 A;  3WR7 A;  1LFW A;  4PXB A;  2REF A;  2EBJ A;  3SI1 A;  4F9V A;  1NMT A;  3FH4 A;  3EZB A;  2OB0 A;  4AVA A;  3KKW A;  1S3Z A;  4MHP A;  3PGP A;  4MI4 A;  4KOT A;  1V0C A;  2D4P A;  4YFJ A;  4C8C A;  3NH8 A;  2B4D A;  5F09 A;  4F8Z A;  4IHM A;  3D7F A;  2DXQ A;  5K8P A;  2CNS A;  4AG9 A;  4OC1 A;  3S9L A;  5DS0 A; 
#chains in the Genus database with same CATH homology
 3IWW A;  4X8I A;  2C6C A;  3NH4 A;  4ZY0 A;  3ICU A;  2POK A;  2JBK A;  3KL9 A;  4AXV A;  3I74 A;  2XEF A;  3D7H A;  2IMO A;  5JH9 A;  4TJX A;  8CPA A;  3NA6 A;  3GB0 A;  3RAM A;  1CPS A;  2NSM A;  2ZED A;  3WC5 A;  3IC1 A;  4ZX9 A;  3FEC A;  4TJV A;  1LAN A;  4OC2 A;  1TKJ A;  1TKH A;  1ELM P;  3B3T A;  4O23 A;  4R7M A;  2AFU A;  2F7V A;  2GLF A;  2PJ0 A;  2QVP A;  1YSJ A;  4EFD A;  4ZX8 A;  1XFO A;  3PRT A;  2QYV A;  4ZYQ A;  4A39 A;  3FVL A;  5HXD A;  3CDX A;  2QJ8 A;  4Z65 A;  3ISZ A;  2AFS A;  3BI1 A;  3IO1 A;  4MXU A;  2GP4 A;  2GLJ A;  2JEW A;  4ZI6 A;  2C6P A;  1PYT B;  2XEG A;  4G1P A;  3KQX A;  1CX8 A;  4B6Z A;  3SI0 A;  1VGY A;  1VIX A;  2CF4 A;  1LAM A;  1ZG7 A;  2I3C A;  3H8G A;  2PCU A;  3DLJ A;  2XEI A;  4W9Y A;  2GRE A;  2VL1 A;  3LMS A;  1CP7 A;  3KHX A;  2AFZ A;  3B3C A;  3KAS A;  4OC3 A;  2XEJ A;  4Q7A A;  1BAV A;  4PXD A;  5HVH A;  3GLJ A;  2ZEP A;  3TX8 A;  4OC5 A;  1ZG9 A;  4FBE A;  3SJF A;  1RTQ A;  2PJ6 A;  5HVF A;  5D8N A;  3KHZ A;  3FED A;  4C8A A;  4NGP A;  1R43 A;  1HDQ A;  2ZEF A;  4C9E A;  2PVW A;  3QNV A;  3PB7 X;  4TWE A;  3ISX A;  4ZY1 A;  4C9A A;  3FX6 A;  3HLP A;  2F8H A;  1CP6 A;  3PBE A;  1VHE A;  3KGQ A;  4C8P A;  4MCR A;  1GYT A;  4NGM A;  2AFO A;  3B2Y A;  3JRU A;  1F57 A;  3WC6 A;  2ZEG A;  2ABZ A;  1Y9Z A;  2J9A A;  4MRI A;  2V77 A;  3KR5 A;  4X2T A;  3KZW A;  2EK8 A;  1PCA A;  4DJL A;  3K9T A;  3EIF A;  4NGN A;  4YU9 A;  4C9U A;  2V8V A;  3NFZ A;  1ELL P;  3S9M A;  1OBR A;  4KSI A;  1ZG8 A;  2PJ5 A;  2RFH A;  4A38 A;  1XJO A;  4H2K A;  3BXM A;  5CPA A;  4IK2 A;  3I1U A;  2V8D A;  3CT9 A;  3RBU A;  2BCO A;  3B3W A;  1IGB A;  4OID A;  5K8O A;  2WYR A;  2PJC A;  4NJR A;  5LYI A;  4CDJ A;  4IAV A;  3SI2 A;  5CBM A;  2PE3 A;  1Y0Y A;  2ZEM A;  2ZEL A;  1WVM A;  2PVV A;  3IJ3 A;  4R76 A;  3D7D A;  4A94 A;  2DEA A;  1XF1 A;  3B3V A;  2HC9 A;  3K2K A;  4NGR A;  1BLL E;  5LYF A;  2PJ7 A;  4YN3 A;  3CPA A;  2OOT A;  2ANP A;  1HEE A;  2CTB A;  1Y7E A;  4P4J A;  2ZEO A;  1Y0R A;  5JM6 A;  4UIB A;  2C5Q A;  4KNG E;  4C86 A;  2Q51 A;  3KQZ A;  5K8N A;  1F2P A;  4UEE A;  3PFO A;  2FVG A;  4OME A;  3S9N A;  3D68 A;  4C85 A;  3KR4 A;  1M4L A;  3PFE A;  5K8M A;  2EWB A;  1XBU A;  2C6G A;  4LQG A;  1BPM A;  4BD9 A;  2CIJ A;  4P45 A;  1BPN A;  3DGV A;  4PQA A;  4PXE A;  4UF4 A;  5LRJ A;  4P4F A;  4R8F A;  2O4H A;  2AFX A;  1Q7L A;  4P4I A;  3MRU A;  2ZEE A;  1LCP A;  5IB9 A;  5HVG A;  1DTD A;  4RUH A;  5I4M A;  2ZEN A;  4WJB A;  3SJG A;  1XMB A;  2Q4Z A;  4OIW A;  3LWU A;  1VHO A;  3D67 A;  3D7G A;  1R3N A;  1AMP A;  4C8F A;  4P4E A;  1YW4 A;  4PXC A;  4ZY2 A;  1V6C A;  2BOA A;  1LOK A;  4C8U A;  1Z5R A;  3VAT A;  2Q43 A;  2PJ9 A;  1KWM A;  2PJ2 A;  4K3N A;  4C84 A;  4CDK A;  3IIB A;  2PJB A;  1CBX A;  4C8T A;  3PB6 X;  5LRK A;  3WC7 A;  4NGT A;  4NFR A;  4NGS A;  3B7I A;  1NSA A;  3KI9 A;  1TF8 A;  2IJZ A;  2PRQ A;  4R6T A;  4MCS A;  3FJU A;  4P6Y A;  4OP4 A;  3V38 A;  2AFW A;  1Z8L A;  4P4B A;  3BI0 A;  4FWU A;  3NH5 A;  4P44 A;  2BO9 A;  4YWY A;  1FNO A;  1F2O A;  3H8F A;  4EME A;  1YME A;  5THW A;  3BHX A;  4NJQ A;  3VTA A;  5ELY A;  1LAP A;  3VH9 A;  3WAB A;  1H8L A;  2ZOF A;  2G9D A;  3VAR A;  1ZLH A;  3SJX A;  2O53 A;  3FMC A;  4C99 A;  4FAI A;  1CG2 A;  5JGF A;  1UWY A;  2PIY A;  3IEH A;  4DUK A;  4JZ0 A;  4UEF A;  3B35 A;  2CTC A;  3TC8 A;  7CPA A;  4C9V A;  1XRY A;  2PJA A;  4PPZ A;  1FT7 A;  2NYQ A;  5J1Q A;  5LRG A;  1YLO A;  5D29 A;  2RB7 A;  2HB6 A;  1Z2L A;  1IY7 A;  3PB8 X;  4F9U A;  3SJE A;  4NGQ A;  4FUU A;  3D66 A;  1QQ9 A;  5LYD A;  3PEI A;  4OC4 A;  3PB9 X;  4DYO A;  2PJ4 A;  3WT4 A;  3D4U A;  3I6S A;  3RZA A;  4C9R A;  4MHN A;  3PBB A;  3MN8 A;  2C1C A;  4P4D A;  2AFM A;  3FF3 A;  1TKF A;  2PIZ A;  1ARM A;  2JBJ A;  3B3S A;  4GM5 A;  1HDU A;  3L2N A;  3FEE A;  4MMO A;  6CPA A;  4CPA A;  4TNU A;  2EK9 A;  4MHZ A;  1TF9 A;  2ZOG A;  4EWT A;  4MCQ A;  4P10 A;  3PB4 X;  4MHY A;  2PJ8 A;  4MCP A;  2IQ6 A;  1YW6 A;  2PJ1 A;  4JYW A;  1ZLI A;  5IR2 A;  2ZEH A;  3H8E A;  2V8G A;  2PJ3 A;  3CPX A;  1EE3 P;  2V8H A;  4A37 A;  1DE4 C;  1JQG A;  4WWV A;  1AYE A;  4UIA A;  1QMU A;  3IFE A;  4OC0 A;  1CPX A;  3V7Z A;  2OR4 A;  3GUX A;  4OKO A;  1ARL A;  4UEZ A;  4ONW A;  4X3R A;  3N5F A;  5LYL A;  3T8W A;  3HUV A;  1TXR A;  2WZN A;  2GU2 A;  1LFW A;  4PXB A;  3SI1 A;  4F9V A;  3FH4 A;  4MHP A;  4C8C A;  3NH8 A;  5F09 A;  4F8Z A;  4IHM A;  3D7F A;  5K8P A;  4OC1 A;  3S9L A;  5DS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...