4JZ0A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with ctt1055
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A high affinity 18F-labeled phosphoramidate peptidomimetic inhibitor as a PSMA-targeted PET imaging agent for prostate cancer
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 257
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4jz0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4jz0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4jz0A02
2ZEGA 4G1PA 3TC8A 4KNGE 4R8FA 1TXRA 2XEIA 4MHPA 3NH8A 1QQ9A 3PFEA 3B3SA 4C8AA 4OIWA 1CPXA 3DGVA 4ZX8A 2Q4ZA 1XF1A 7CPAA 4MHZA 4C99A 4NGMA 5J1QA 1AYEA 5K8NA 4NJQA 1XJOA 1TF8A 1VGYA 3D7DA 1VHEA 1NSAA 1VIXA 1TF9A 1TKFA 4O23A 3RAMA 2AFUA 3PRTA 4B6ZA 2PIZA 3ISZA 4IHMA 3IO1A 3BHXA 3IIBA 3IFEA 3HUVA 2GU2A 3H8FA 3D66A 3PB9X 4ZY1A 3FF3A 4NGRA 4MHNA 3RBUA 1PYTB 3TX8A 3D7FA 2AFSA 1Y0YA 4P45A 4P4FA 4KSIA 1YMEA 2ZEFA 4R7MA 3PEIA 4P4BA 3KL9A 4EFDA 3S9MA 3FVLA 2CF4A 3FEDA 2PJ6A 4X8IA 2IJZA 4MRIA 1UWYA 1R43A 3PBEA 1Z2LA 1BPMA 3NH5A 3MRUA 2I3CA 3WC5A 1Y9ZA 1Y0RA 1YW4A 3KGQA 5I4MA 1CP6A 2PJ7A 4Z65A 3B35A 4YN3A 1FT7A 3KHXA 4NGPA 3WC7A 3LMSA 3IEHA 3S9LA 3JRUA 1ELMP 4P44A 5LYDA 1Q7LA 4MCPA 2BO9A 4OP4A 1DTDA 1IY7A 4OC1A 3ISXA 4EMEA 2PJ0A 3SJGA 2EWBA 2RFHA 2PJ9A 4OC0A 4R6TA 4EWTA 4A94A 2F8HA 3SI1A 4OC2A 4PXEA 4P4DA 1LANA 3NFZA 4ZX9A 3ICUA 2CTBA 2VL1A 1CP7A 1Z8LA 3BXMA 4NJRA 3SJEA 3VARA 3D67A 3D4UA 4FAIA 2PJ5A 4R76A 5CPAA 5HVFA 1F57A 3KQZA 4WWVA 4JYWA 1PCAA 4ZY0A 4C86A 1GYTA 4ONWA 5D8NA 4NFRA 5K8OA 3FEEA 2ZELA 1TKHA 4P4IA 4TJVA 2PCUA 4IK2A 1HDUA 2PJ1A 1HEEA 1Z5RA 4GM5A 2V77A 2WYRA 3L2NA 4C9EA 3MN8A 1BLLE 1WVMA 2FVGA 3SI2A 1CBXA 2PJCA 5LRJA 4PXCA 3N5FA 4PPZA 4DUKA 4CDKA 3SI0A 1IGBA 2BCOA 3H8EA 4MCSA 2XEFA 2ZENA 3LWUA 1BAVA 1ELLP 5JGFA 3FJUA 2AFXA 3DLJA 1DE4C 3BI1A 2QJ8A 4LQGA 2POKA 3GB0A 2EK9A 1V6CA 3IJ3A 4DYOA 3V7ZA 3PB6X 2ZEHA 2O53A 2ZEPA 4MXUA 4A38A 4NGTA 1LAPA 5ELYA 2HC9A 1LAMA 4AXVA 2V8GA 1ARMA 2PJ3A 2CTCA 3B3VA 3FX6A 4YWYA 1VHOA 4X2TA 1YSJA 1ZLIA 4C9RA 1KWMA 1XMBA 4PXBA 2PE3A 2V8VA 2AFZA 3VH9A 3RZAA 1CX8A 3WT4A 3CPAA 4NGQA 2IMOA 3K2KA 5CBMA 3PFOA 2CIJA 4C8TA 3K9TA 3NH4A 1R3NA 3B2YA 4P10A 4OKOA 4C9AA 2NSMA 2EK8A 3D68A 4P6YA 3VATA 1Y7EA 4TJXA 1LCPA 2C6PA 1EE3P 4X3RA 5JH9A 2QVPA 1YLOA 3KR5A 4IAVA 4RUHA 4C9VA 3IC1A 3KI9A 1ZG8A 4C9UA 3PB8X 4C8UA 3QNVA 4UEFA 4A39A 3B3WA 3KZWA 5K8MA 3B3CA 1QMUA 3FECA 2JEWA 2Q51A 2ZEEA 3BI0A 4CPAA 3HLPA 2AFMA 1XBUA 1JQGA 4MHYA 3SJXA 3CT9A 4Q7AA 2PJBA 2JBKA 3GUXA 2C6GA 3EIFA 3WC6A 2IQ6A 3FMCA 1ZG9A 5HVGA 4K3NA 1HDQA 2C1CA 2HB6A 5THWA 2ABZA 4WJBA 2RB7A 1ARLA 2GLFA 5LYFA 3D7GA 2G9DA 1YW6A 3PB4X 4P4JA 1H8LA 1ZG7A 3I1UA 4PXDA 2ZOFA 8CPAA 4OMEA 1XFOA 4BD9A 3SJFA 4UF4A 3T8WA 3GLJA 2OR4A 3V38A 1FNOA 4MMOA 4H2KA 4ZI6A 2PIYA 3CDXA 3B7IA 1CG2A 1CPSA 1BPNA 2NYQA 2GREA 1RTQA 4UEEA 1LFWA 3H8GA 4FUUA 3KHZA 2AFWA 4C84A 4C8CA 2C6CA 4NGNA 4TNUA 5F09A 2F7VA 4ZYQA 2Q43A 6CPAA 4MCRA 1F2OA 1TKJA 3I6SA 2PJ2A 2PRQA 2ZEDA 5LRGA 5IB9A 2WZNA 4A37A 5LRKA 2ZEOA 1LOKA 4JZ0A 3CPXA 3D7HA 4MCQA 3VTAA 5DS0A 4OIDA 2PVVA 4C8PA 2ZOGA 5HXDA 3WABA 4PQAA 4YU9A 1OBRA 4P4EA 1XRYA 2DEAA 3KQXA 4TWEA 1M4LA 2PJ4A 5JM6A 3IWWA 3KR4A 2ZEMA 4ZY2A 4F9UA 2XEJA 2V8HA 3B3TA 2PJ8A 4UEZA 4NGSA 4FBEA 5HVHA 3PB7X 4C85A 1F2PA 2V8DA 3FH4A 2GLJA 4OC5A 2PJAA 5LYIA 2QYVA 3S9NA 1AMPA 4UIAA 2BOAA 3NA6A 2ANPA 4C8FA 4FWUA 2J9AA 4DJLA 2AFOA 5K8PA 2PVWA 3KASA 5LYLA 4CDJA 4F9VA 4F8ZA 2JBJA 5D29A 4OC3A 2O4HA 2XEGA 4UIBA 4W9YA 3PBBA 1ZLHA 2OOTA 3I74A 4OC4A
chains in the Genus database with same CATH superfamily
2PRBA 2ZEGA 4G1PA 4MFLA 3TLGA 3EZBA 4R87A 3TC8A 4B5OA 2DXQA 1RO5A 3RNZA 3S6FA 4M6IA 4KOWA 4B5PB 4KNGE 2Q4YA 4MFKA 5ISVA 5EC4A 1B87A 4R8FA 4RS2A 3EXNA 5JYBA 1TXRA 2XEIA 1VKCA 4F0YA 4CRYB 2FSRA 2XPPA 3FXTA 3NH8A 4LQ6A 4MI4A 1S60A 4MHPA 1QQ9A 2BUEA 3PFEA 4C7IA 5HMNA 3B3SA 4C8AA 3NFQA 4OIWA 1CPXA 1R57A 3DGVA 1DIKA 3TOAA 2EZCA 4A95A 4ZX8A 2FCKA 1QSMA 2Q4ZA 7CPAA 2Y0MA 4MHZA 1XF1A 4C99A 4NGMA 1YREA 5J1QA 1AYEA 1NE9A 2EVNA 2G3TA 5K8NA 2N3AB 3OB2B 4NJQA 1XJOA 1TF8A 1VGYA 3VWDA 3D7DA 1VHEA 1NSAA 3BUMB 3FNCA 4OLLA 3ZZIA 2C27A 4M8DA 4MFPA 4CYNA 1VIXA 2FM4A 1QSRA 1TF9A 1TKFA 1NXJA 4IF5A 4O23A 2AFUA 3PRTA 3RAMA 3IWGA 2AUNA 4B6ZA 4QB9A 2ARHA 2PIZA 2E28A 2WPWA 3B8GA 3ISZA 1YK3A 4IHMA 3IO1A 2IL4A 3BHXA 1IOFA 1EZAA 3R1KA 1AUGA 4GXHA 3IIBA 3IFEA 3R96A 3HUVA 3K9UA 1LRZA 2GU2A 3KKWA 3S6GA 3BUOB 3H8FA 3D66A 4JXRA 2Z3NA 4PK2A 3F9KC 2VZZA 5BY0A 1VHSA 4NSQA 3PB9X 4NF1A 4ZY1A 2VXKA 2JEVA 2OH1A 3FF3A 4NGRA 2R8VA 2YGWA 4LX9A 1YX0A 5DWMA 4MHNA 2OZHA 1KEEB 3RBUA 4MFQA 3P2HA 1PYTB 4B12A 3TX8A 5J3XA 3EFAA 3R9GA 4Y49B 4KVXA 3D7FA 3F0AA 4ONUA 4UBRA 3R95A 4MFJA 4A2ZA 2AFSA 1Y0YA 4UWJA 4P45A 4P4FA 1ZO0A 2ODFA 4U9YA 2CBLA 4KSIA 5FVJA 4IIYA 2VI7A 2EBJA 4H89A 4CAEA 3LODA 4QVTA 1YMEA 2ZEFA 4R7MA 3PEIA 2XPOA 5HH1A 5AG5A 4P4BA 4BINA 1J3LA 3KL9A 3G23A 3E0KA 4FD6A 4EFDA 3S9MA 3FVLA 3LD2A 1IYKA 3KRVA 4BPXB 3FEDA 2CF4A 2PJ6A 4X8IA 2IJZA 3PGPA 4MRIA 3TLCA 2YNEA 5KTAA 4PSXA 1UWYA 1XOVA 1CM0A 4J0NA 4CAWA 1R43A 3PBEA 1XIXA 1QSOA 1Z2LA 2FIWA 4UA3A 2B3VA 5H84A 1BPMA 3TLBA 3SXOA 1WWZA 2Z3LA 3JVNA 3NH5A 4MJ8A 4F0XA 4CZ1A 3T90A 3MRUA 2I3CA 3WC5A 1Y9ZA 1Y0RA 1YW4A 3KGQA 3GY9A 5I4MA 1CJWA 2EZAA 1CP6A 2VZYA 2PJ7A 4Z65A 3B35A 4YN3A 1FT7A 3O8ZA 3OAKA 3KHXA 2KCWA 4NGPA 2VQYA 3WC7A 3LMSA 4HNWB 3IEHA 3NOJA 3S9LA 4B11A 1KC7A 3JRUA 4KVOE 1XEBA 2JLMA 4C2XA 1ELMP 4P44A 2EUIA 5LYDA 2OLSA 2ZW7A 4ZBGA 1Q7LA 3PZJA 1YLEA 4MCPA 2BO9A 4MY3A 4OP4A 1S5KA 2YJVA 1DTDA 2Z3OA 5A28A 4H1HA 3H5ZA 4KSFA 5C82A 1IY7A 4OADA 5IB0A 4OC1A 2QECA 3VROA 3D2PA 3FRMA 3ISXA 4BMHA 4EMEA 3PLFB 1EO0A 2PJ0A 3SJGA 2EWBA 2RFHA 2PJ9A 4OC0A 3NE7A 4R6TA 4HNYB 2ZW6A 5AGEA 4A94A 4EWTA 2F8HA 5AG4A 4UCPA 3I3GA 4KS9A 3SI1A 4OC2A 4PXEA 4P4DA 1LANA 2CNMA 4K30A 3NFZA 1XF8A 4MHDA 5EBVA 5EMIA 4ZX9A 3V8IA 1XE4A 3SXNA 4B10A 3ICUA 3G8WA 2CTBA 2VL1A 3T07A 2ATRA 1CP7A 1Z8LA 3BXMA 3JUWA 4FD5A 4JWPA 3VRNA 4KVME 4NJRA 3SJEA 3VARA 3D67A 3D4UA 3TOBA 4FAIA 2PJ5A 3D3SA 4R76A 5CPAA 2A4NA 2AUMA 5HVFA 1I12A 2ZW4A 1Z4EA 3D2MA 1F57A 4INJA 3KQZA 3TLEA 4WWVA 4JYWA 1IB1E 1WK4A 1FBVA 1PCAA 4XPDC 2FS5A 3TO6A 4CRZB 4ZY0A 3QB8A 1GYTA 1X10A 4QUSA 3RYOA 2Q0YA 4MY0A 4ONWA 4C86A 5D8NA 3FB3A 3BLNA 4NFRA 4A31A 4A4CA 2WUUA 1S7NA 3C8OA 2GP4A 5JQ4A 5K8OA 2HI6A 5HKZA 3FEEA 2DPTA 5HKWA 4FD7A 1VBGA 2YNDA 2ZELA 1TKHA 4CYOA 3FIXA 4P4IA 2PQ8A 4CAVA 3OP0A 4TJVA 5JVLA 4BTFA 2PCUA 4IK2A 1HDUA 2PJ1A 2B3UA 1HEEA 2G3AA 1Z5RA 4M85A 5G22A 4GM5A 4JXQA 3I9SA 1S3ZA 2V77A 2WYRA 3L2NA 4KOYA 4C9EA 3MN8A 1BLLE 4CGPA 1PU9A 3CZXA 1WVMA 2OZGA 3CXPA 2PR1A 2FVGA 3K4IA 2WPXA 4MJXA 3SI2A 4E2AA 5AG6A 3W91A 4CYQA 3QAHA 1CBXA 4H6ZA 5AXIA 1BOBA 2PJCA 5LRJA 4PXCA 1OZPA 3N5FA 2FT0A 1SQHA 4PPZA 2R1IA 4DUKA 3VRRA 4UCNA 4AG9A 2BL1A 4CDKA 3SI0A 1IGBA 5K99A 4XNHC 2BCOA 3H8EA 4PV6A 4MCSA 1B6BA 2XEFA 2OU2A 2CNSA 4AVBA 2ZENA 1BAVA 1ELLP 3LWUA 5JGFA 3FJUA 1C30B 4E5SA 2AFXA 3DLJA 1QSNA 1DE4C 2Y1MA 3BI1A 2QJ8A 2DPSA 4LQGA 5FD8A 2G0BA 2POKA 3GB0A 1XMTA 3ZJ0A 2EK9A 5DWNA 1V6CA 1ZRSA 2Y1NA 3PP9A 3IGRA 5JPHA 3F8KA 5E96A 3IJ3A 5F48A 3U1BA 3VWEA 1X12A 4DYOA 3V7ZA 3PB6X 2GIVA 2ZEHA 2O53A 2RC4A 2ZEPA 3S6KA 4MXUA 1WJTA 2OZUA 4BPUB 4A38A 1A2ZA 4NGTA 3ZNIA 2R82A 1LAPA 4KUAA 1P0HA 5ELYA 4AVCA 4A32A 3TE4A 1M6VB 2HC9A 1LAMA 4KSAA 4AXVA 2V8GA 2O28A 1ARMA 2PJ3A 3IU2A 5A27A 1BXRB 2PDOA 2MP0A 2CTCA 3B3VA 2AE6A 3IWEA 2XPLA 3FX6A 4AVAA 5J8CA 4YWYA 1VHOA 1KUXA 1KUVA 4AB7A 3FYNA 5F1YA 3T0TA 3P2FA 4X2TA 4M6HA 1YSJA 1ZLIA 4C9RA 1KWMA 4JJXA 4C68A 1XMBA 3TLAA 2X7BA 2ZXVA 3EY5A 4KOTA 4PXBA 4L8AA 2PE3A 2V8VA 2AFZA 3VH9A 3RZAA 1CX8A 1RXTA 5CNPA 3WT4A 1JWQA 3CPAA 4NGQA 2IMOA 4IIXA 3PFVA 1Z9EA 3K2KA 5CBMA 3VRPA 3PFOA 4PSWA 1Z4RA 2CIJA 4C8TA 3K9TA 3NH4A 1R3NA 3B2YA 1T36B 4P10A 2Z11A 4OKOA 2C5QA 4C9AA 4M3SA 2B0AA 2NSMA 2EK8A 3D68A 4P6YA 3VATA 5BWAB 1Y7EA 4GPLB 4TJXA 5I0CA 2D0PA 1LCPA 2EO8A 1Y9KA 3GIUA 4X5KA 2C6PA 1EE3P 4LUAA 3TO9A 1M1DA 4X3RA 5JH9A 2FE7A 2CNTA 2HQYA 1V0CA 2QVPA 2GANA 4B13A 1YLOA 4KOUA 2P6EA 3KR5A 4IAVA 5F47A 1IICA 2PSWA 2DIKA 2Q44A 4RUHA 1JDBC 4C9VA 3IC1A 2CXAA 3TYXA 3KI9A 1ZG8A 2YNCA 5AG7A 2J8RA 4HKFA 1CS0B 5F13A 5F49A 4E0AA 4JVOA 4C9UA 1QSTA 1P4NA 2P0WA 3PB8X 4MFZA 2XPNA 3BUNB 2K5TA 4C8UA 3QNVA 4HNXB 2Z3MA 4UEFA 4A39A 3EZEA 4NEXA 5C88A 3B3WA 1VBHA 3KZWA 5K8MA 3TCVA 1Z9UA 1N71A 3B3CA 1Q2DA 1MK4A 4CO9A 1QMUA 3TLYA 3FECA 2JEWA 2Q51A 1VI4A 1MJ9A 3SR3A 1EZBA 1Y9WA 2ZEEA 1NSLA 3BI0A 1A9XB 2J8MA 4KLWA 1Z8XA 2REFA 2NMTA 4MBUA 5G21A 4CPAA 4CAFA 3GYAA 3BUWB 4CS0B 3HLPA 4U9ZA 1Y7RA 2AFMA 2REEA 4JD6A 1XBUA 2QMLA 3W6SA 1JQGA 4MHYA 3SJXA 3CT9A 3MGDA 4PK3A 4XPKA 4DNCA 4M6GA 2Q7SA 2VEZA 4KOXA 4Q7AA 2PJBA 5H86A 3EC4A 1ZYMA 2JBKA 1YGHA 1TIQA 3DDDA 2Q7BA 1NBWA 2F5IA 3GUXA 2C6GA 3EIFA 1YVOA 2X0SA 3WC6A 5F5XA 2IQ6A 3FMCA 1ZG9A 4ZGYB 5HVGA 4K3NA 4CGOA 2YNCC 1HDQA 3GJZA 2R98A 2FIAA 4OAEA 2C1CA 2HB6A 5THWA 2ABZA 4WJBA 3S6HA 2RB7A 1ARLA 2GLFA 2I00A 3H4QA 2BSWA 5LYFA 3D7GA 2G9DA 1YW6A 3DR8A 3PB4X 4P4JA 2B4DA 1H8LA 1ZG7A 1IIDA 1KZFA 1ON0A 1PUAA 3I1UA 4KORA 4PXDA 3T9YA 2ZOFA 1R61A 2D0OA 3EZAA 4C2YA 1B47A 4OMEA 4XNHB 8CPAA 4II9A 1XFOA 3N7ZA 1L0CA 4BD9A 3RO0A 3SJFA 2PR8A 4UF4A 4KUBA 5IX3A 4NXYA 3TTHA 1BO4A 3TLZA 2FL4A 2P6GA 3DSBA 3T8WA 3GLJA 2OR4A 3V38A 1FNOA 1JDEA 4MMOA 3T05A 2B4JC 4H2KA 4KOVA 2H5MA 2BEIA 4C2ZA 4BPWB 3R9FA 3TT2A 4ZI6A 2PIYA 4UFVA 2Z3KA 3CDXA 2ZPAA 3B7IA 3IU1A 2P6FA 1CG2A 1CPSA 2QIRA 3F5BA 4KOSA 2Q04A 4R9MA 1BPNA 2NYQA 1Z8WA 3BUXB 2GREA 3UY5A 2YJTA 1RTQA 4UEEA 3TLGB 4H6UA 1LFWA 3H8GA 3TFYA 4UWIA 4FUUA 4B5PA 2B5GA 2R7HA 3KHZA 2AFWA 4XPLA 1C3OB 3VGOA 2OB0A 5J8FA 1YVHA 3CXSA 4YFJA 3U88C 4C84A 3A9LA 4C8CA 2C6CA 4NGNA 4KZTA 4TNUA 4Q36A 5F09A 2F7VA 2VBQA 1MJBA 2JDDA 4Y49C 2FXFA 4IUSA 4CGLA 1J4JA 3BJ7A 4ZYQA 1ZL0A 2D4OA 2EZBA 3HPGG 2Q43A 3TO7A 6CPAA 4MCRA 1F2OA 2B4BA 3G3SA 3T5MA 1TKJA 3I6SA 2Z10A 3OWCA 1IOIA 2Z0ZA 5F9MA 2J8NA 3DNSA 4E8OA 1M4GA 4UCMA 5G1ZA 5GCNA 2PJ2A 2PRQA 2HUZA 4COGA 2ZEDA 5LRGA 4R3LA 4KLVA 2WZNA 4A37A 5IB9A 5LRKA 4RR2B 4E94A 1M4IA 2Q4VA 2ZEOA 3HPHE 2AJ6A 3GKRA 2I79A 3FBUA 1LOKA 4JZ0A 3CPXA 4C7HA 3D7HA 3WR7A 4MCQA 2JDCA 5KTCA 1KUYA 2HV2A 4QC6A 3W6XA 1S7KA 4B14A 1S7FA 2GFQA 3VTAA 4RI1A 1M4DA 5DS0A 4OIDA 2PVVA 4C8PA 1Q5XA 2ZOGA 5HXDA 5IV0A 4RN7A 3WABA 4PQAA 4YU9A 1OBRA 4P4EA 1NMTA 1CE8B 1M44A 2DLAA 1XRYA 3SHPA 1GHEA 4MI1A 3DR6A 1YVKA 4UFWA 4EYSA 1YQEA 2UV8G 2DEAA 3KQXA 4TWEA 5IR2A 3CXQA 1M4LA 2PJ4A 4CGNA 5JM6A 3PT1A 4CAXA 3JTKA 4GS4A 2HROA 2HWGA 3IWWA 3KR4A 4UFXA 4FD4A 1S7LA 2DF5A 2ZEMA 5KTDA 4YRHA 4COBA 4ZY2A 4NCZA 4F9UA 2XEJA 1I21A 2V8HA 3B3TA 4ORFA 4A33A 2PJ8A 4UEZA 5G20A 4NGSA 4FBEA 1Z8TA 4L89A 4XPDB 5HVHA 3PB7X 4HPSA 1FY7A 1U6MA 2B5GB 4C85A 4U5YA 1F2PA 2V8DA 3FH4A 3LACA 2GLJA 3C26A 1IU8A 4OC5A 2PJAA 4EVYA 1K4JA 5LYIA 5F46A 3HMJG 2QYVA 4CGMA 1MJAA 3S9NA 1AMPA 4Q38A 5HKYA 4A30A 2PC1A 4JLYA 4AG7A 2B4DB 2CY2A 4UIAA 2BOAA 2GE3A 3BJ8A 3NA6A 3R9EA 2ANPA 4C8FA 3EO4A 1YR0A 4QBJA 4F6AA 4FWUA 1UFHA 2J9AA 2ZW5A 4DJLA 2AFOA 2VKZG 3NE8A 4A4BA 1I1DA 2PCNA 5K8PA 2PVWA 3KASA 5LYLA 4CDJA 4F9VA 4J3GA 4F8ZA 4R3KA 2JBJA 3QAYA 1GGOA 5D29A 2Z3PA 4BBHA 4OC3A 1Q2CA 1KBLA 4R57A 2B58A 2WSAA 2O4HA 4I49A 2XEGA 4UIBA 4W9YA 3PBBA 1ZLHA 2OOTA 2D4PA 3I74A 4OC4A 4CYPA 3OB1B 3VRQA 1Q2YA 3D8PA 1IYLA 4YGOA
chains in the Genus database with same CATH topology
2ZEGA 4G1PA 3TC8A 4KNGE 4R8FA 1TXRA 2XEIA 4MHPA 3NH8A 1QQ9A 3PFEA 3B3SA 4C8AA 4OIWA 1CPXA 3DGVA 4ZX8A 2Q4ZA 1XF1A 7CPAA 4MHZA 4C99A 4NGMA 5J1QA 1AYEA 5K8NA 4NJQA 1XJOA 1TF8A 1VGYA 3D7DA 1VHEA 1NSAA 1VIXA 1TF9A 1TKFA 4O23A 3RAMA 2AFUA 3PRTA 4B6ZA 2PIZA 3ISZA 4IHMA 3IO1A 3BHXA 3IIBA 3IFEA 3HUVA 2GU2A 3H8FA 3D66A 3PB9X 4ZY1A 3FF3A 4NGRA 4MHNA 3RBUA 1PYTB 3TX8A 3D7FA 2AFSA 1Y0YA 4P45A 4P4FA 4KSIA 1YMEA 2ZEFA 4R7MA 3PEIA 2C5QA 4P4BA 3KL9A 4EFDA 3S9MA 3FVLA 2CF4A 3FEDA 2PJ6A 4X8IA 2IJZA 4MRIA 1UWYA 1R43A 3PBEA 1Z2LA 1BPMA 3NH5A 3MRUA 2I3CA 3WC5A 1Y9ZA 1Y0RA 1YW4A 3KGQA 5I4MA 1CP6A 2PJ7A 4Z65A 3B35A 4YN3A 1FT7A 3KHXA 4NGPA 3WC7A 3LMSA 3IEHA 3S9LA 3JRUA 1ELMP 4P44A 5LYDA 1Q7LA 4MCPA 2BO9A 4OP4A 1DTDA 1IY7A 4OC1A 3ISXA 4EMEA 2PJ0A 3SJGA 2EWBA 2RFHA 2PJ9A 4OC0A 4R6TA 4EWTA 4A94A 2F8HA 3SI1A 4OC2A 4PXEA 4P4DA 1LANA 3NFZA 4ZX9A 3ICUA 2CTBA 2VL1A 1CP7A 1Z8LA 3BXMA 4NJRA 3SJEA 3VARA 3D67A 3D4UA 4FAIA 2PJ5A 4R76A 5CPAA 5HVFA 1F57A 3KQZA 4WWVA 4JYWA 1PCAA 4ZY0A 4C86A 1GYTA 4ONWA 5D8NA 4NFRA 2GP4A 5K8OA 3FEEA 2ZELA 1TKHA 4P4IA 4TJVA 2PCUA 4IK2A 1HDUA 2PJ1A 1HEEA 1Z5RA 4GM5A 2V77A 2WYRA 3L2NA 4C9EA 3MN8A 1BLLE 1WVMA 2FVGA 3SI2A 1CBXA 2PJCA 5LRJA 4PXCA 3N5FA 4PPZA 4DUKA 4CDKA 3SI0A 1IGBA 2BCOA 3H8EA 4MCSA 2XEFA 2ZENA 3LWUA 1BAVA 1ELLP 5JGFA 3FJUA 2AFXA 3DLJA 1DE4C 3BI1A 2QJ8A 4LQGA 2POKA 3GB0A 2EK9A 1V6CA 3IJ3A 4DYOA 3V7ZA 3PB6X 2ZEHA 2O53A 2ZEPA 4MXUA 4A38A 4NGTA 1LAPA 5ELYA 2HC9A 1LAMA 4AXVA 2V8GA 1ARMA 2PJ3A 2CTCA 3B3VA 3FX6A 4YWYA 1VHOA 4X2TA 1YSJA 1ZLIA 4C9RA 1KWMA 1XMBA 4PXBA 2PE3A 2V8VA 2AFZA 3VH9A 3RZAA 1CX8A 3WT4A 3CPAA 4NGQA 2IMOA 3K2KA 5CBMA 3PFOA 2CIJA 4C8TA 3K9TA 3NH4A 1R3NA 3B2YA 4P10A 4OKOA 4C9AA 2NSMA 2EK8A 3D68A 4P6YA 3VATA 1Y7EA 4TJXA 1LCPA 2C6PA 1EE3P 4X3RA 5JH9A 2QVPA 1YLOA 3KR5A 4IAVA 4RUHA 4C9VA 3IC1A 3KI9A 1ZG8A 4C9UA 3PB8X 4C8UA 3QNVA 4UEFA 4A39A 3B3WA 3KZWA 5K8MA 3B3CA 1QMUA 3FECA 2JEWA 2Q51A 2ZEEA 3BI0A 4CPAA 3HLPA 2AFMA 1XBUA 1JQGA 4MHYA 3SJXA 3CT9A 4Q7AA 2PJBA 2JBKA 3GUXA 2C6GA 3EIFA 3WC6A 2IQ6A 3FMCA 1ZG9A 5HVGA 4K3NA 1HDQA 2C1CA 2HB6A 5THWA 2ABZA 4WJBA 2RB7A 1ARLA 2GLFA 5LYFA 3D7GA 2G9DA 1YW6A 3PB4X 4P4JA 1H8LA 1ZG7A 3I1UA 4PXDA 2ZOFA 8CPAA 4OMEA 1XFOA 4BD9A 3SJFA 4UF4A 3T8WA 3GLJA 2OR4A 3V38A 1FNOA 4MMOA 4H2KA 4ZI6A 2PIYA 3CDXA 3B7IA 1CG2A 1CPSA 1BPNA 2NYQA 2GREA 1RTQA 4UEEA 1LFWA 3H8GA 4FUUA 3KHZA 2AFWA 4C84A 4C8CA 2C6CA 4NGNA 4TNUA 5F09A 2F7VA 4ZYQA 2Q43A 6CPAA 4MCRA 1F2OA 1TKJA 3I6SA 2PJ2A 2PRQA 2ZEDA 5LRGA 5IB9A 2WZNA 4A37A 5LRKA 2ZEOA 1LOKA 4JZ0A 3CPXA 3D7HA 4MCQA 3VTAA 5DS0A 4OIDA 2PVVA 4C8PA 2ZOGA 5HXDA 3WABA 4PQAA 4YU9A 1OBRA 4P4EA 1XRYA 2DEAA 3KQXA 4TWEA 5IR2A 1M4LA 2PJ4A 5JM6A 3IWWA 3KR4A 2ZEMA 4ZY2A 4F9UA 2XEJA 2V8HA 3B3TA 2PJ8A 4UEZA 4NGSA 4FBEA 5HVHA 3PB7X 4C85A 1F2PA 2V8DA 3FH4A 2GLJA 4OC5A 2PJAA 5LYIA 2QYVA 3S9NA 1AMPA 4UIAA 2BOAA 3NA6A 2ANPA 4C8FA 4FWUA 2J9AA 4DJLA 2AFOA 5K8PA 2PVWA 3KASA 5LYLA 4CDJA 4F9VA 4F8ZA 2JBJA 5D29A 4OC3A 2O4HA 2XEGA 4UIBA 4W9YA 3PBBA 1ZLHA 2OOTA 3I74A 4OC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEG A;  4G1P A;  3TC8 A;  4KNG E;  4R8F A;  1TXR A;  2XEI A;  4MHP A;  3NH8 A;  1QQ9 A;  3PFE A;  3B3S A;  4C8A A;  4OIW A;  1CPX A;  3DGV A;  4ZX8 A;  2Q4Z A;  1XF1 A;  7CPA A;  4MHZ A;  4C99 A;  4NGM A;  5J1Q A;  1AYE A;  5K8N A;  4NJQ A;  1XJO A;  1TF8 A;  1VGY A;  3D7D A;  1VHE A;  1NSA A;  1VIX A;  1TF9 A;  1TKF A;  4O23 A;  3RAM A;  2AFU A;  3PRT A;  4B6Z A;  2PIZ A;  3ISZ A;  4IHM A;  3IO1 A;  3BHX A;  3IIB A;  3IFE A;  3HUV A;  2GU2 A;  3H8F A;  3D66 A;  3PB9 X;  4ZY1 A;  3FF3 A;  4NGR A;  4MHN A;  3RBU A;  1PYT B;  3TX8 A;  3D7F A;  2AFS A;  1Y0Y A;  4P45 A;  4P4F A;  4KSI A;  1YME A;  2ZEF A;  4R7M A;  3PEI A;  4P4B A;  3KL9 A;  4EFD A;  3S9M A;  3FVL A;  2CF4 A;  3FED A;  2PJ6 A;  4X8I A;  2IJZ A;  4MRI A;  1UWY A;  1R43 A;  3PBE A;  1Z2L A;  1BPM A;  3NH5 A;  3MRU A;  2I3C A;  3WC5 A;  1Y9Z A;  1Y0R A;  1YW4 A;  3KGQ A;  5I4M A;  1CP6 A;  2PJ7 A;  4Z65 A;  3B35 A;  4YN3 A;  1FT7 A;  3KHX A;  4NGP A;  3WC7 A;  3LMS A;  3IEH A;  3S9L A;  3JRU A;  1ELM P;  4P44 A;  5LYD A;  1Q7L A;  4MCP A;  2BO9 A;  4OP4 A;  1DTD A;  1IY7 A;  4OC1 A;  3ISX A;  4EME A;  2PJ0 A;  3SJG A;  2EWB A;  2RFH A;  2PJ9 A;  4OC0 A;  4R6T A;  4EWT A;  4A94 A;  2F8H A;  3SI1 A;  4OC2 A;  4PXE A;  4P4D A;  1LAN A;  3NFZ A;  4ZX9 A;  3ICU A;  2CTB A;  2VL1 A;  1CP7 A;  1Z8L A;  3BXM A;  4NJR A;  3SJE A;  3VAR A;  3D67 A;  3D4U A;  4FAI A;  2PJ5 A;  4R76 A;  5CPA A;  5HVF A;  1F57 A;  3KQZ A;  4WWV A;  4JYW A;  1PCA A;  4ZY0 A;  4C86 A;  1GYT A;  4ONW A;  5D8N A;  4NFR A;  5K8O A;  3FEE A;  2ZEL A;  1TKH A;  4P4I A;  4TJV A;  2PCU A;  4IK2 A;  1HDU A;  2PJ1 A;  1HEE A;  1Z5R A;  4GM5 A;  2V77 A;  2WYR A;  3L2N A;  4C9E A;  3MN8 A;  1BLL E;  1WVM A;  2FVG A;  3SI2 A;  1CBX A;  2PJC A;  5LRJ A;  4PXC A;  3N5F A;  4PPZ A;  4DUK A;  4CDK A;  3SI0 A;  1IGB A;  2BCO A;  3H8E A;  4MCS A;  2XEF A;  2ZEN A;  3LWU A;  1BAV A;  1ELL P;  5JGF A;  3FJU A;  2AFX A;  3DLJ A;  1DE4 C;  3BI1 A;  2QJ8 A;  4LQG A;  2POK A;  3GB0 A;  2EK9 A;  1V6C A;  3IJ3 A;  4DYO A;  3V7Z A;  3PB6 X;  2ZEH A;  2O53 A;  2ZEP A;  4MXU A;  4A38 A;  4NGT A;  1LAP A;  5ELY A;  2HC9 A;  1LAM A;  4AXV A;  2V8G A;  1ARM A;  2PJ3 A;  2CTC A;  3B3V A;  3FX6 A;  4YWY A;  1VHO A;  4X2T A;  1YSJ A;  1ZLI A;  4C9R A;  1KWM A;  1XMB A;  4PXB A;  2PE3 A;  2V8V A;  2AFZ A;  3VH9 A;  3RZA A;  1CX8 A;  3WT4 A;  3CPA A;  4NGQ A;  2IMO A;  3K2K A;  5CBM A;  3PFO A;  2CIJ A;  4C8T A;  3K9T A;  3NH4 A;  1R3N A;  3B2Y A;  4P10 A;  4OKO A;  4C9A A;  2NSM A;  2EK8 A;  3D68 A;  4P6Y A;  3VAT A;  1Y7E A;  4TJX A;  1LCP A;  2C6P A;  1EE3 P;  4X3R A;  5JH9 A;  2QVP A;  1YLO A;  3KR5 A;  4IAV A;  4RUH A;  4C9V A;  3IC1 A;  3KI9 A;  1ZG8 A;  4C9U A;  3PB8 X;  4C8U A;  3QNV A;  4UEF A;  4A39 A;  3B3W A;  3KZW A;  5K8M A;  3B3C A;  1QMU A;  3FEC A;  2JEW A;  2Q51 A;  2ZEE A;  3BI0 A;  4CPA A;  3HLP A;  2AFM A;  1XBU A;  1JQG A;  4MHY A;  3SJX A;  3CT9 A;  4Q7A A;  2PJB A;  2JBK A;  3GUX A;  2C6G A;  3EIF A;  3WC6 A;  2IQ6 A;  3FMC A;  1ZG9 A;  5HVG A;  4K3N A;  1HDQ A;  2C1C A;  2HB6 A;  5THW A;  2ABZ A;  4WJB A;  2RB7 A;  1ARL A;  2GLF A;  5LYF A;  3D7G A;  2G9D A;  1YW6 A;  3PB4 X;  4P4J A;  1H8L A;  1ZG7 A;  3I1U A;  4PXD A;  2ZOF A;  8CPA A;  4OME A;  1XFO A;  4BD9 A;  3SJF A;  4UF4 A;  3T8W A;  3GLJ A;  2OR4 A;  3V38 A;  1FNO A;  4MMO A;  4H2K A;  4ZI6 A;  2PIY A;  3CDX A;  3B7I A;  1CG2 A;  1CPS A;  1BPN A;  2NYQ A;  2GRE A;  1RTQ A;  4UEE A;  1LFW A;  3H8G A;  4FUU A;  3KHZ A;  2AFW A;  4C84 A;  4C8C A;  2C6C A;  4NGN A;  4TNU A;  5F09 A;  2F7V A;  4ZYQ A;  2Q43 A;  6CPA A;  4MCR A;  1F2O A;  1TKJ A;  3I6S A;  2PJ2 A;  2PRQ A;  2ZED A;  5LRG A;  5IB9 A;  2WZN A;  4A37 A;  5LRK A;  2ZEO A;  1LOK A;  4JZ0 A;  3CPX A;  3D7H A;  4MCQ A;  3VTA A;  5DS0 A;  4OID A;  2PVV A;  4C8P A;  2ZOG A;  5HXD A;  3WAB A;  4PQA A;  4YU9 A;  1OBR A;  4P4E A;  1XRY A;  2DEA A;  3KQX A;  4TWE A;  1M4L A;  2PJ4 A;  5JM6 A;  3IWW A;  3KR4 A;  2ZEM A;  4ZY2 A;  4F9U A;  2XEJ A;  2V8H A;  3B3T A;  2PJ8 A;  4UEZ A;  4NGS A;  4FBE A;  5HVH A;  3PB7 X;  4C85 A;  1F2P A;  2V8D A;  3FH4 A;  2GLJ A;  4OC5 A;  2PJA A;  5LYI A;  2QYV A;  3S9N A;  1AMP A;  4UIA A;  2BOA A;  3NA6 A;  2ANP A;  4C8F A;  4FWU A;  2J9A A;  4DJL A;  2AFO A;  5K8P A;  2PVW A;  3KAS A;  5LYL A;  4CDJ A;  4F9V A;  4F8Z A;  2JBJ A;  5D29 A;  4OC3 A;  2O4H A;  2XEG A;  4UIB A;  4W9Y A;  3PBB A;  1ZLH A;  2OOT A;  3I74 A;  4OC4 A; 
#chains in the Genus database with same CATH topology
 2PRB A;  2ZEG A;  4G1P A;  4MFL A;  3TLG A;  3EZB A;  4R87 A;  3TC8 A;  4B5O A;  2DXQ A;  1RO5 A;  3RNZ A;  3S6F A;  4M6I A;  4KOW A;  4B5P B;  4KNG E;  2Q4Y A;  4MFK A;  5ISV A;  5EC4 A;  1B87 A;  4R8F A;  4RS2 A;  3EXN A;  5JYB A;  1TXR A;  2XEI A;  1VKC A;  4F0Y A;  4CRY B;  2FSR A;  2XPP A;  3FXT A;  3NH8 A;  4LQ6 A;  4MI4 A;  1S60 A;  4MHP A;  1QQ9 A;  2BUE A;  3PFE A;  4C7I A;  5HMN A;  3B3S A;  4C8A A;  3NFQ A;  4OIW A;  1CPX A;  1R57 A;  3DGV A;  1DIK A;  3TOA A;  2EZC A;  4A95 A;  4ZX8 A;  2FCK A;  1QSM A;  2Q4Z A;  7CPA A;  2Y0M A;  4MHZ A;  1XF1 A;  4C99 A;  4NGM A;  1YRE A;  5J1Q A;  1AYE A;  1NE9 A;  2EVN A;  2G3T A;  5K8N A;  2N3A B;  3OB2 B;  4NJQ A;  1XJO A;  1TF8 A;  1VGY A;  3VWD A;  3D7D A;  1VHE A;  1NSA A;  3BUM B;  3FNC A;  4OLL A;  3ZZI A;  2C27 A;  4M8D A;  4MFP A;  4CYN A;  1VIX A;  2FM4 A;  1QSR A;  1TF9 A;  1TKF A;  1NXJ A;  4IF5 A;  4O23 A;  2AFU A;  3PRT A;  3RAM A;  3IWG A;  2AUN A;  4B6Z A;  4QB9 A;  2ARH A;  2PIZ A;  2E28 A;  2WPW A;  3B8G A;  3ISZ A;  1YK3 A;  4IHM A;  3IO1 A;  2IL4 A;  3BHX A;  1IOF A;  1EZA A;  3R1K A;  1AUG A;  4GXH A;  3IIB A;  3IFE A;  3R96 A;  3HUV A;  3K9U A;  1LRZ A;  2GU2 A;  3KKW A;  3S6G A;  3BUO B;  3H8F A;  3D66 A;  4JXR A;  2Z3N A;  4PK2 A;  3F9K C;  2VZZ A;  5BY0 A;  1VHS A;  4NSQ A;  3PB9 X;  4NF1 A;  4ZY1 A;  2VXK A;  2JEV A;  2OH1 A;  3FF3 A;  4NGR A;  2R8V A;  2YGW A;  4LX9 A;  1YX0 A;  5DWM A;  4MHN A;  2OZH A;  1KEE B;  3RBU A;  4MFQ A;  3P2H A;  1PYT B;  4B12 A;  3TX8 A;  5J3X A;  3EFA A;  3R9G A;  4Y49 B;  4KVX A;  3D7F A;  3F0A A;  4ONU A;  4UBR A;  3R95 A;  4MFJ A;  4A2Z A;  2AFS A;  1Y0Y A;  4UWJ A;  4P45 A;  4P4F A;  1ZO0 A;  2ODF A;  4U9Y A;  2CBL A;  4KSI A;  5FVJ A;  4IIY A;  2VI7 A;  2EBJ A;  4H89 A;  4CAE A;  3LOD A;  4QVT A;  1YME A;  2ZEF A;  4R7M A;  3PEI A;  2XPO A;  5HH1 A;  5AG5 A;  4P4B A;  4BIN A;  1J3L A;  3KL9 A;  3G23 A;  3E0K A;  4FD6 A;  4EFD A;  3S9M A;  3FVL A;  3LD2 A;  1IYK A;  3KRV A;  4BPX B;  3FED A;  2CF4 A;  2PJ6 A;  4X8I A;  2IJZ A;  3PGP A;  4MRI A;  3TLC A;  2YNE A;  5KTA A;  4PSX A;  1UWY A;  1XOV A;  1CM0 A;  4J0N A;  4CAW A;  1R43 A;  3PBE A;  1XIX A;  1QSO A;  1Z2L A;  2FIW A;  4UA3 A;  2B3V A;  5H84 A;  1BPM A;  3TLB A;  3SXO A;  1WWZ A;  2Z3L A;  3JVN A;  3NH5 A;  4MJ8 A;  4F0X A;  4CZ1 A;  3T90 A;  3MRU A;  2I3C A;  3WC5 A;  1Y9Z A;  1Y0R A;  1YW4 A;  3KGQ A;  3GY9 A;  5I4M A;  1CJW A;  2EZA A;  1CP6 A;  2VZY A;  2PJ7 A;  4Z65 A;  3B35 A;  4YN3 A;  1FT7 A;  3O8Z A;  3OAK A;  3KHX A;  2KCW A;  4NGP A;  2VQY A;  3WC7 A;  3LMS A;  4HNW B;  3IEH A;  3NOJ A;  3S9L A;  4B11 A;  1KC7 A;  3JRU A;  4KVO E;  1XEB A;  2JLM A;  4C2X A;  1ELM P;  4P44 A;  2EUI A;  5LYD A;  2OLS A;  2ZW7 A;  4ZBG A;  1Q7L A;  3PZJ A;  1YLE A;  4MCP A;  2BO9 A;  4MY3 A;  4OP4 A;  1S5K A;  2YJV A;  1DTD A;  2Z3O A;  5A28 A;  4H1H A;  3H5Z A;  4KSF A;  5C82 A;  1IY7 A;  4OAD A;  5IB0 A;  4OC1 A;  2QEC A;  3VRO A;  3D2P A;  3FRM A;  3ISX A;  4BMH A;  4EME A;  3PLF B;  1EO0 A;  2PJ0 A;  3SJG A;  2EWB A;  2RFH A;  2PJ9 A;  4OC0 A;  3NE7 A;  4R6T A;  4HNY B;  2ZW6 A;  5AGE A;  4A94 A;  4EWT A;  2F8H A;  5AG4 A;  4UCP A;  3I3G A;  4KS9 A;  3SI1 A;  4OC2 A;  4PXE A;  4P4D A;  1LAN A;  2CNM A;  4K30 A;  3NFZ A;  1XF8 A;  4MHD A;  5EBV A;  5EMI A;  4ZX9 A;  3V8I A;  1XE4 A;  3SXN A;  4B10 A;  3ICU A;  3G8W A;  2CTB A;  2VL1 A;  3T07 A;  2ATR A;  1CP7 A;  1Z8L A;  3BXM A;  3JUW A;  4FD5 A;  4JWP A;  3VRN A;  4KVM E;  4NJR A;  3SJE A;  3VAR A;  3D67 A;  3D4U A;  3TOB A;  4FAI A;  2PJ5 A;  3D3S A;  4R76 A;  5CPA A;  2A4N A;  2AUM A;  5HVF A;  1I12 A;  2ZW4 A;  1Z4E A;  3D2M A;  1F57 A;  4INJ A;  3KQZ A;  3TLE A;  4WWV A;  4JYW A;  1IB1 E;  1WK4 A;  1FBV A;  1PCA A;  4XPD C;  2FS5 A;  3TO6 A;  4CRZ B;  4ZY0 A;  3QB8 A;  1GYT A;  1X10 A;  4QUS A;  3RYO A;  2Q0Y A;  4MY0 A;  4ONW A;  4C86 A;  5D8N A;  3FB3 A;  3BLN A;  4NFR A;  4A31 A;  4A4C A;  2WUU A;  1S7N A;  3C8O A;  2GP4 A;  5JQ4 A;  5K8O A;  2HI6 A;  5HKZ A;  3FEE A;  2DPT A;  5HKW A;  4FD7 A;  1VBG A;  2YND A;  2ZEL A;  1TKH A;  4CYO A;  3FIX A;  4P4I A;  2PQ8 A;  4CAV A;  3OP0 A;  4TJV A;  5JVL A;  4BTF A;  2PCU A;  4IK2 A;  1HDU A;  2PJ1 A;  2B3U A;  1HEE A;  2G3A A;  1Z5R A;  4M85 A;  5G22 A;  4GM5 A;  4JXQ A;  3I9S A;  1S3Z A;  2V77 A;  2WYR A;  3L2N A;  4KOY A;  4C9E A;  3MN8 A;  1BLL E;  4CGP A;  1PU9 A;  3CZX A;  1WVM A;  2OZG A;  3CXP A;  2PR1 A;  2FVG A;  3K4I A;  2WPX A;  4MJX A;  3SI2 A;  4E2A A;  5AG6 A;  3W91 A;  4CYQ A;  3QAH A;  1CBX A;  4H6Z A;  5AXI A;  1BOB A;  2PJC A;  5LRJ A;  4PXC A;  1OZP A;  3N5F A;  2FT0 A;  1SQH A;  4PPZ A;  2R1I A;  4DUK A;  3VRR A;  4UCN A;  4AG9 A;  2BL1 A;  4CDK A;  3SI0 A;  1IGB A;  5K99 A;  4XNH C;  2BCO A;  3H8E A;  4PV6 A;  4MCS A;  1B6B A;  2XEF A;  2OU2 A;  2CNS A;  4AVB A;  2ZEN A;  1BAV A;  1ELL P;  3LWU A;  5JGF A;  3FJU A;  1C30 B;  4E5S A;  2AFX A;  3DLJ A;  1QSN A;  1DE4 C;  2Y1M A;  3BI1 A;  2QJ8 A;  2DPS A;  4LQG A;  5FD8 A;  2G0B A;  2POK A;  3GB0 A;  1XMT A;  3ZJ0 A;  2EK9 A;  5DWN A;  1V6C A;  1ZRS A;  2Y1N A;  3PP9 A;  3IGR A;  5JPH A;  3F8K A;  5E96 A;  3IJ3 A;  5F48 A;  3U1B A;  3VWE A;  1X12 A;  4DYO A;  3V7Z A;  3PB6 X;  2GIV A;  2ZEH A;  2O53 A;  2RC4 A;  2ZEP A;  3S6K A;  4MXU A;  1WJT A;  2OZU A;  4BPU B;  4A38 A;  1A2Z A;  4NGT A;  3ZNI A;  2R82 A;  1LAP A;  4KUA A;  1P0H A;  5ELY A;  4AVC A;  4A32 A;  3TE4 A;  1M6V B;  2HC9 A;  1LAM A;  4KSA A;  4AXV A;  2V8G A;  2O28 A;  1ARM A;  2PJ3 A;  3IU2 A;  5A27 A;  1BXR B;  2PDO A;  2MP0 A;  2CTC A;  3B3V A;  2AE6 A;  3IWE A;  2XPL A;  3FX6 A;  4AVA A;  5J8C A;  4YWY A;  1VHO A;  1KUX A;  1KUV A;  4AB7 A;  3FYN A;  5F1Y A;  3T0T A;  3P2F A;  4X2T A;  4M6H A;  1YSJ A;  1ZLI A;  4C9R A;  1KWM A;  4JJX A;  4C68 A;  1XMB A;  3TLA A;  2X7B A;  2ZXV A;  3EY5 A;  4KOT A;  4PXB A;  4L8A A;  2PE3 A;  2V8V A;  2AFZ A;  3VH9 A;  3RZA A;  1CX8 A;  1RXT A;  5CNP A;  3WT4 A;  1JWQ A;  3CPA A;  4NGQ A;  2IMO A;  4IIX A;  3PFV A;  1Z9E A;  3K2K A;  5CBM A;  3VRP A;  3PFO A;  4PSW A;  1Z4R A;  2CIJ A;  4C8T A;  3K9T A;  3NH4 A;  1R3N A;  3B2Y A;  1T36 B;  4P10 A;  2Z11 A;  4OKO A;  2C5Q A;  4C9A A;  4M3S A;  2B0A A;  2NSM A;  2EK8 A;  3D68 A;  4P6Y A;  3VAT A;  5BWA B;  1Y7E A;  4GPL B;  4TJX A;  5I0C A;  2D0P A;  1LCP A;  2EO8 A;  1Y9K A;  3GIU A;  4X5K A;  2C6P A;  1EE3 P;  4LUA A;  3TO9 A;  1M1D A;  4X3R A;  5JH9 A;  2FE7 A;  2CNT A;  2HQY A;  1V0C A;  2QVP A;  2GAN A;  4B13 A;  1YLO A;  4KOU A;  2P6E A;  3KR5 A;  4IAV A;  5F47 A;  1IIC A;  2PSW A;  2DIK A;  2Q44 A;  4RUH A;  1JDB C;  4C9V A;  3IC1 A;  2CXA A;  3TYX A;  3KI9 A;  1ZG8 A;  2YNC A;  5AG7 A;  2J8R A;  4HKF A;  1CS0 B;  5F13 A;  5F49 A;  4E0A A;  4JVO A;  4C9U A;  1QST A;  1P4N A;  2P0W A;  3PB8 X;  4MFZ A;  2XPN A;  3BUN B;  2K5T A;  4C8U A;  3QNV A;  4HNX B;  2Z3M A;  4UEF A;  4A39 A;  3EZE A;  4NEX A;  5C88 A;  3B3W A;  1VBH A;  3KZW A;  5K8M A;  3TCV A;  1Z9U A;  1N71 A;  3B3C A;  1Q2D A;  1MK4 A;  4CO9 A;  1QMU A;  3TLY A;  3FEC A;  2JEW A;  2Q51 A;  1VI4 A;  1MJ9 A;  3SR3 A;  1EZB A;  1Y9W A;  2ZEE A;  1NSL A;  3BI0 A;  1A9X B;  2J8M A;  4KLW A;  1Z8X A;  2REF A;  2NMT A;  4MBU A;  5G21 A;  4CPA A;  4CAF A;  3GYA A;  3BUW B;  4CS0 B;  3HLP A;  4U9Z A;  1Y7R A;  2AFM A;  2REE A;  4JD6 A;  1XBU A;  2QML A;  3W6S A;  1JQG A;  4MHY A;  3SJX A;  3CT9 A;  3MGD A;  4PK3 A;  4XPK A;  4DNC A;  4M6G A;  2Q7S A;  2VEZ A;  4KOX A;  4Q7A A;  2PJB A;  5H86 A;  3EC4 A;  1ZYM A;  2JBK A;  1YGH A;  1TIQ A;  3DDD A;  2Q7B A;  1NBW A;  2F5I A;  3GUX A;  2C6G A;  3EIF A;  1YVO A;  2X0S A;  3WC6 A;  5F5X A;  2IQ6 A;  3FMC A;  1ZG9 A;  4ZGY B;  5HVG A;  4K3N A;  4CGO A;  2YNC C;  1HDQ A;  3GJZ A;  2R98 A;  2FIA A;  4OAE A;  2C1C A;  2HB6 A;  5THW A;  2ABZ A;  4WJB A;  3S6H A;  2RB7 A;  1ARL A;  2GLF A;  2I00 A;  3H4Q A;  2BSW A;  5LYF A;  3D7G A;  2G9D A;  1YW6 A;  3DR8 A;  3PB4 X;  4P4J A;  2B4D A;  1H8L A;  1ZG7 A;  1IID A;  1KZF A;  1ON0 A;  1PUA A;  3I1U A;  4KOR A;  4PXD A;  3T9Y A;  2ZOF A;  1R61 A;  2D0O A;  3EZA A;  4C2Y A;  1B47 A;  4OME A;  4XNH B;  8CPA A;  4II9 A;  1XFO A;  3N7Z A;  1L0C A;  4BD9 A;  3RO0 A;  3SJF A;  2PR8 A;  4UF4 A;  4KUB A;  5IX3 A;  4NXY A;  3TTH A;  1BO4 A;  3TLZ A;  2FL4 A;  2P6G A;  3DSB A;  3T8W A;  3GLJ A;  2OR4 A;  3V38 A;  1FNO A;  1JDE A;  4MMO A;  3T05 A;  2B4J C;  4H2K A;  4KOV A;  2H5M A;  2BEI A;  4C2Z A;  4BPW B;  3R9F A;  3TT2 A;  4ZI6 A;  2PIY A;  4UFV A;  2Z3K A;  3CDX A;  2ZPA A;  3B7I A;  3IU1 A;  2P6F A;  1CG2 A;  1CPS A;  2QIR A;  3F5B A;  4KOS A;  2Q04 A;  4R9M A;  1BPN A;  2NYQ A;  1Z8W A;  3BUX B;  2GRE A;  3UY5 A;  2YJT A;  1RTQ A;  4UEE A;  3TLG B;  4H6U A;  1LFW A;  3H8G A;  3TFY A;  4UWI A;  4FUU A;  4B5P A;  2B5G A;  2R7H A;  3KHZ A;  2AFW A;  4XPL A;  1C3O B;  3VGO A;  2OB0 A;  5J8F A;  1YVH A;  3CXS A;  4YFJ A;  3U88 C;  4C84 A;  3A9L A;  4C8C A;  2C6C A;  4NGN A;  4KZT A;  4TNU A;  4Q36 A;  5F09 A;  2F7V A;  2VBQ A;  1MJB A;  2JDD A;  4Y49 C;  2FXF A;  4IUS A;  4CGL A;  1J4J A;  3BJ7 A;  4ZYQ A;  1ZL0 A;  2D4O A;  2EZB A;  3HPG G;  2Q43 A;  3TO7 A;  6CPA A;  4MCR A;  1F2O A;  2B4B A;  3G3S A;  3T5M A;  1TKJ A;  3I6S A;  2Z10 A;  3OWC A;  1IOI A;  2Z0Z A;  5F9M A;  2J8N A;  3DNS A;  4E8O A;  1M4G A;  4UCM A;  5G1Z A;  5GCN A;  2PJ2 A;  2PRQ A;  2HUZ A;  4COG A;  2ZED A;  5LRG A;  4R3L A;  4KLV A;  2WZN A;  4A37 A;  5IB9 A;  5LRK A;  4RR2 B;  4E94 A;  1M4I A;  2Q4V A;  2ZEO A;  3HPH E;  2AJ6 A;  3GKR A;  2I79 A;  3FBU A;  1LOK A;  4JZ0 A;  3CPX A;  4C7H A;  3D7H A;  3WR7 A;  4MCQ A;  2JDC A;  5KTC A;  1KUY A;  2HV2 A;  4QC6 A;  3W6X A;  1S7K A;  4B14 A;  1S7F A;  2GFQ A;  3VTA A;  4RI1 A;  1M4D A;  5DS0 A;  4OID A;  2PVV A;  4C8P A;  1Q5X A;  2ZOG A;  5HXD A;  5IV0 A;  4RN7 A;  3WAB A;  4PQA A;  4YU9 A;  1OBR A;  4P4E A;  1NMT A;  1CE8 B;  1M44 A;  2DLA A;  1XRY A;  3SHP A;  1GHE A;  4MI1 A;  3DR6 A;  1YVK A;  4UFW A;  4EYS A;  1YQE A;  2UV8 G;  2DEA A;  3KQX A;  4TWE A;  5IR2 A;  3CXQ A;  1M4L A;  2PJ4 A;  4CGN A;  5JM6 A;  3PT1 A;  4CAX A;  3JTK A;  4GS4 A;  2HRO A;  2HWG A;  3IWW A;  3KR4 A;  4UFX A;  4FD4 A;  1S7L A;  2DF5 A;  2ZEM A;  5KTD A;  4YRH A;  4COB A;  4ZY2 A;  4NCZ A;  4F9U A;  2XEJ A;  1I21 A;  2V8H A;  3B3T A;  4ORF A;  4A33 A;  2PJ8 A;  4UEZ A;  5G20 A;  4NGS A;  4FBE A;  1Z8T A;  4L89 A;  4XPD B;  5HVH A;  3PB7 X;  4HPS A;  1FY7 A;  1U6M A;  2B5G B;  4C85 A;  4U5Y A;  1F2P A;  2V8D A;  3FH4 A;  3LAC A;  2GLJ A;  3C26 A;  1IU8 A;  4OC5 A;  2PJA A;  4EVY A;  1K4J A;  5LYI A;  5F46 A;  3HMJ G;  2QYV A;  4CGM A;  1MJA A;  3S9N A;  1AMP A;  4Q38 A;  5HKY A;  4A30 A;  2PC1 A;  4JLY A;  4AG7 A;  2B4D B;  2CY2 A;  4UIA A;  2BOA A;  2GE3 A;  3BJ8 A;  3NA6 A;  3R9E A;  2ANP A;  4C8F A;  3EO4 A;  1YR0 A;  4QBJ A;  4F6A A;  4FWU A;  1UFH A;  2J9A A;  2ZW5 A;  4DJL A;  2AFO A;  2VKZ G;  3NE8 A;  4A4B A;  1I1D A;  2PCN A;  5K8P A;  2PVW A;  3KAS A;  5LYL A;  4CDJ A;  4F9V A;  4J3G A;  4F8Z A;  4R3K A;  2JBJ A;  3QAY A;  1GGO A;  5D29 A;  2Z3P A;  4BBH A;  4OC3 A;  1Q2C A;  1KBL A;  4R57 A;  2B58 A;  2WSA A;  2O4H A;  4I49 A;  2XEG A;  4UIB A;  4W9Y A;  3PBB A;  1ZLH A;  2OOT A;  2D4P A;  3I74 A;  4OC4 A;  4CYP A;  3OB1 B;  3VRQ A;  1Q2Y A;  3D8P A;  1IYL A;  4YGO A; 
#chains in the Genus database with same CATH homology
 2ZEG A;  4G1P A;  3TC8 A;  4KNG E;  4R8F A;  1TXR A;  2XEI A;  4MHP A;  3NH8 A;  1QQ9 A;  3PFE A;  3B3S A;  4C8A A;  4OIW A;  1CPX A;  3DGV A;  4ZX8 A;  2Q4Z A;  1XF1 A;  7CPA A;  4MHZ A;  4C99 A;  4NGM A;  5J1Q A;  1AYE A;  5K8N A;  4NJQ A;  1XJO A;  1TF8 A;  1VGY A;  3D7D A;  1VHE A;  1NSA A;  1VIX A;  1TF9 A;  1TKF A;  4O23 A;  3RAM A;  2AFU A;  3PRT A;  4B6Z A;  2PIZ A;  3ISZ A;  4IHM A;  3IO1 A;  3BHX A;  3IIB A;  3IFE A;  3HUV A;  2GU2 A;  3H8F A;  3D66 A;  3PB9 X;  4ZY1 A;  3FF3 A;  4NGR A;  4MHN A;  3RBU A;  1PYT B;  3TX8 A;  3D7F A;  2AFS A;  1Y0Y A;  4P45 A;  4P4F A;  4KSI A;  1YME A;  2ZEF A;  4R7M A;  3PEI A;  2C5Q A;  4P4B A;  3KL9 A;  4EFD A;  3S9M A;  3FVL A;  2CF4 A;  3FED A;  2PJ6 A;  4X8I A;  2IJZ A;  4MRI A;  1UWY A;  1R43 A;  3PBE A;  1Z2L A;  1BPM A;  3NH5 A;  3MRU A;  2I3C A;  3WC5 A;  1Y9Z A;  1Y0R A;  1YW4 A;  3KGQ A;  5I4M A;  1CP6 A;  2PJ7 A;  4Z65 A;  3B35 A;  4YN3 A;  1FT7 A;  3KHX A;  4NGP A;  3WC7 A;  3LMS A;  3IEH A;  3S9L A;  3JRU A;  1ELM P;  4P44 A;  5LYD A;  1Q7L A;  4MCP A;  2BO9 A;  4OP4 A;  1DTD A;  1IY7 A;  4OC1 A;  3ISX A;  4EME A;  2PJ0 A;  3SJG A;  2EWB A;  2RFH A;  2PJ9 A;  4OC0 A;  4R6T A;  4EWT A;  4A94 A;  2F8H A;  3SI1 A;  4OC2 A;  4PXE A;  4P4D A;  1LAN A;  3NFZ A;  4ZX9 A;  3ICU A;  2CTB A;  2VL1 A;  1CP7 A;  1Z8L A;  3BXM A;  4NJR A;  3SJE A;  3VAR A;  3D67 A;  3D4U A;  4FAI A;  2PJ5 A;  4R76 A;  5CPA A;  5HVF A;  1F57 A;  3KQZ A;  4WWV A;  4JYW A;  1PCA A;  4ZY0 A;  4C86 A;  1GYT A;  4ONW A;  5D8N A;  4NFR A;  2GP4 A;  5K8O A;  3FEE A;  2ZEL A;  1TKH A;  4P4I A;  4TJV A;  2PCU A;  4IK2 A;  1HDU A;  2PJ1 A;  1HEE A;  1Z5R A;  4GM5 A;  2V77 A;  2WYR A;  3L2N A;  4C9E A;  3MN8 A;  1BLL E;  1WVM A;  2FVG A;  3SI2 A;  1CBX A;  2PJC A;  5LRJ A;  4PXC A;  3N5F A;  4PPZ A;  4DUK A;  4CDK A;  3SI0 A;  1IGB A;  2BCO A;  3H8E A;  4MCS A;  2XEF A;  2ZEN A;  3LWU A;  1BAV A;  1ELL P;  5JGF A;  3FJU A;  2AFX A;  3DLJ A;  1DE4 C;  3BI1 A;  2QJ8 A;  4LQG A;  2POK A;  3GB0 A;  2EK9 A;  1V6C A;  3IJ3 A;  4DYO A;  3V7Z A;  3PB6 X;  2ZEH A;  2O53 A;  2ZEP A;  4MXU A;  4A38 A;  4NGT A;  1LAP A;  5ELY A;  2HC9 A;  1LAM A;  4AXV A;  2V8G A;  1ARM A;  2PJ3 A;  2CTC A;  3B3V A;  3FX6 A;  4YWY A;  1VHO A;  4X2T A;  1YSJ A;  1ZLI A;  4C9R A;  1KWM A;  1XMB A;  4PXB A;  2PE3 A;  2V8V A;  2AFZ A;  3VH9 A;  3RZA A;  1CX8 A;  3WT4 A;  3CPA A;  4NGQ A;  2IMO A;  3K2K A;  5CBM A;  3PFO A;  2CIJ A;  4C8T A;  3K9T A;  3NH4 A;  1R3N A;  3B2Y A;  4P10 A;  4OKO A;  4C9A A;  2NSM A;  2EK8 A;  3D68 A;  4P6Y A;  3VAT A;  1Y7E A;  4TJX A;  1LCP A;  2C6P A;  1EE3 P;  4X3R A;  5JH9 A;  2QVP A;  1YLO A;  3KR5 A;  4IAV A;  4RUH A;  4C9V A;  3IC1 A;  3KI9 A;  1ZG8 A;  4C9U A;  3PB8 X;  4C8U A;  3QNV A;  4UEF A;  4A39 A;  3B3W A;  3KZW A;  5K8M A;  3B3C A;  1QMU A;  3FEC A;  2JEW A;  2Q51 A;  2ZEE A;  3BI0 A;  4CPA A;  3HLP A;  2AFM A;  1XBU A;  1JQG A;  4MHY A;  3SJX A;  3CT9 A;  4Q7A A;  2PJB A;  2JBK A;  3GUX A;  2C6G A;  3EIF A;  3WC6 A;  2IQ6 A;  3FMC A;  1ZG9 A;  5HVG A;  4K3N A;  1HDQ A;  2C1C A;  2HB6 A;  5THW A;  2ABZ A;  4WJB A;  2RB7 A;  1ARL A;  2GLF A;  5LYF A;  3D7G A;  2G9D A;  1YW6 A;  3PB4 X;  4P4J A;  1H8L A;  1ZG7 A;  3I1U A;  4PXD A;  2ZOF A;  8CPA A;  4OME A;  1XFO A;  4BD9 A;  3SJF A;  4UF4 A;  3T8W A;  3GLJ A;  2OR4 A;  3V38 A;  1FNO A;  4MMO A;  4H2K A;  4ZI6 A;  2PIY A;  3CDX A;  3B7I A;  1CG2 A;  1CPS A;  1BPN A;  2NYQ A;  2GRE A;  1RTQ A;  4UEE A;  1LFW A;  3H8G A;  4FUU A;  3KHZ A;  2AFW A;  4C84 A;  4C8C A;  2C6C A;  4NGN A;  4TNU A;  5F09 A;  2F7V A;  4ZYQ A;  2Q43 A;  6CPA A;  4MCR A;  1F2O A;  1TKJ A;  3I6S A;  2PJ2 A;  2PRQ A;  2ZED A;  5LRG A;  5IB9 A;  2WZN A;  4A37 A;  5LRK A;  2ZEO A;  1LOK A;  4JZ0 A;  3CPX A;  3D7H A;  4MCQ A;  3VTA A;  5DS0 A;  4OID A;  2PVV A;  4C8P A;  2ZOG A;  5HXD A;  3WAB A;  4PQA A;  4YU9 A;  1OBR A;  4P4E A;  1XRY A;  2DEA A;  3KQX A;  4TWE A;  5IR2 A;  1M4L A;  2PJ4 A;  5JM6 A;  3IWW A;  3KR4 A;  2ZEM A;  4ZY2 A;  4F9U A;  2XEJ A;  2V8H A;  3B3T A;  2PJ8 A;  4UEZ A;  4NGS A;  4FBE A;  5HVH A;  3PB7 X;  4C85 A;  1F2P A;  2V8D A;  3FH4 A;  2GLJ A;  4OC5 A;  2PJA A;  5LYI A;  2QYV A;  3S9N A;  1AMP A;  4UIA A;  2BOA A;  3NA6 A;  2ANP A;  4C8F A;  4FWU A;  2J9A A;  4DJL A;  2AFO A;  5K8P A;  2PVW A;  3KAS A;  5LYL A;  4CDJ A;  4F9V A;  4F8Z A;  2JBJ A;  5D29 A;  4OC3 A;  2O4H A;  2XEG A;  4UIB A;  4W9Y A;  3PBB A;  1ZLH A;  2OOT A;  3I74 A;  4OC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...