3F9KC

Two domain fragment of hiv-2 integrase in complex with ledgf ibd
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
SMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel co-crystal structure affords the design of gain-of-function lentiviral integrase mutants in the presence of modified PSIP1/LEDGF/p75
pubmed doi rcsb
source organism Human immunodeficiency virus type 2
molecule tags Viral protein, recombination
molecule keywords Integrase
total genus 33
structure length 94
sequence length 94
chains with identical sequence G, K, O, S, W, a, e, i, m, q, u
ec nomenclature
pdb deposition date 2008-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3f9kC00
1Z9EA 2XPNA 1WJTA 1EO0A 2XPPA 3HPHE 3HPGG 3NFQA 2N3AB 2XPLA 3OAKA 2B4JC 3U88C 3F9KC 3O8ZA 2XPOA
chains in the Genus database with same CATH superfamily
1FBVA 5F13A 3HMJG 3PFVA 4MCPA 4A4CA 3D7FA 3S9LA 3BUXB 4P4JA 4P44A 3VGOA 1Z9EA 2XEJA 4P45A 3BI1A 4W9YA 3BHXA 3NFQA 2XPLA 2VKZG 3OB1B 4OC5A 4NGRA 4BPWB 3OB2B 4P4BA 5HKYA 3BUWB 1WJTA 3SJEA 5BY0A 2OR4A 4OC0A 3FECA 3FEEA 2CBLA 3S9MA 3VROA 3HPGG 3BUOB 1Z8LA 4GPLB 3VRRA 4P4IA 4OC1A 4A4BA 2XEGA 3D7DA 3VRNA 4NGTA 3ZNIA 4NGMA 3U88C 3BUNB 4MCRA 1EO0A 5HKZA 2C6GA 2CIJA 3SJGA 3OAKA 2C6CA 4RR2B 2B4JC 5D29A 2Y1NA 5HKWA 2XEIA 3PLFB 3HPHE 2UV8G 3D7HA 3D7GA 3IWWA 4P4EA 2JBJA 3BUMB 4P4DA 3RBUA 1CX8A 2JBKA 4OMEA 4OC2A 2C6PA 3F9KC 4P4FA 2XPNA 4JZ0A 4OC3A 2XPPA 4NGNA 4BPXB 3SJFA 4X3RA 3SJXA 2PVVA 4OC4A 4MCQA 5J3XA 3BI0A 5ELYA 4LQGA 3FF3A 3FEDA 2OOTA 2DLAA 2PVWA 4JYWA 4NGSA 5AXIA 3S9NA 2Y1MA 3VRQA 4BTFA 3OP0A 3O8ZA 2XPOA 2XEFA 4NGPA 3PT1A 4MCSA 4BPUB 3BXMA 1YVHA 5F09A 1B47A 2N3AB 1DE4C 3VRPA 3KASA 4NGQA
chains in the Genus database with same CATH topology
1Z9EA 2XPNA 1WJTA 1EO0A 2XPPA 3HPHE 3HPGG 3NFQA 2N3AB 2XPLA 3OAKA 2B4JC 3U88C 3F9KC 3O8ZA 2XPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9E A;  2XPN A;  1WJT A;  1EO0 A;  2XPP A;  3HPH E;  3HPG G;  3NFQ A;  2N3A B;  2XPL A;  3OAK A;  2B4J C;  3U88 C;  3F9K C;  3O8Z A;  2XPO A; 
#chains in the Genus database with same CATH topology
 1FBV A;  5F13 A;  3HMJ G;  3PFV A;  4MCP A;  4A4C A;  3D7F A;  3S9L A;  3BUX B;  4P4J A;  4P44 A;  3VGO A;  1Z9E A;  2XEJ A;  4P45 A;  3BI1 A;  4W9Y A;  3BHX A;  3NFQ A;  2XPL A;  2VKZ G;  3OB1 B;  4OC5 A;  4NGR A;  4BPW B;  3OB2 B;  4P4B A;  5HKY A;  3BUW B;  1WJT A;  3SJE A;  5BY0 A;  2OR4 A;  4OC0 A;  3FEC A;  3FEE A;  2CBL A;  3S9M A;  3VRO A;  3HPG G;  3BUO B;  1Z8L A;  4GPL B;  3VRR A;  4P4I A;  4OC1 A;  4A4B A;  2XEG A;  3D7D A;  3VRN A;  4NGT A;  3ZNI A;  4NGM A;  3U88 C;  3BUN B;  4MCR A;  1EO0 A;  5HKZ A;  2C6G A;  2CIJ A;  3SJG A;  3OAK A;  2C6C A;  4RR2 B;  2B4J C;  5D29 A;  2Y1N A;  5HKW A;  2XEI A;  3PLF B;  3HPH E;  2UV8 G;  3D7H A;  3D7G A;  3IWW A;  4P4E A;  2JBJ A;  3BUM B;  4P4D A;  3RBU A;  1CX8 A;  2JBK A;  4OME A;  4OC2 A;  2C6P A;  3F9K C;  4P4F A;  2XPN A;  4JZ0 A;  4OC3 A;  2XPP A;  4NGN A;  4BPX B;  3SJF A;  4X3R A;  3SJX A;  2PVV A;  4OC4 A;  4MCQ A;  5J3X A;  3BI0 A;  5ELY A;  4LQG A;  3FF3 A;  3FED A;  2OOT A;  2DLA A;  2PVW A;  4JYW A;  4NGS A;  5AXI A;  3S9N A;  2Y1M A;  3VRQ A;  4BTF A;  3OP0 A;  3O8Z A;  2XPO A;  2XEF A;  4NGP A;  3PT1 A;  4MCS A;  4BPU B;  3BXM A;  1YVH A;  5F09 A;  1B47 A;  2N3A B;  1DE4 C;  3VRP A;  3KAS A;  4NGQ A; 
#chains in the Genus database with same CATH homology
 1Z9E A;  2XPN A;  1WJT A;  1EO0 A;  2XPP A;  3HPH E;  3HPG G;  3NFQ A;  2N3A B;  2XPL A;  3OAK A;  2B4J C;  3U88 C;  3F9K C;  3O8Z A;  2XPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...