3F9KC

Two domain fragment of hiv-2 integrase in complex with ledgf ibd
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
SMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrase
publication title A novel co-crystal structure affords the design of gain-of-function lentiviral integrase mutants in the presence of modified PSIP1/LEDGF/p75
pubmed doi rcsb
source organism Human immunodeficiency virus type 2
molecule tags Viral protein, recombination
total genus 33
structure length 94
sequence length 94
chains with identical sequence G, K, O, S, W, a, e, i, m, q, u
ec nomenclature
pdb deposition date 2008-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3f9kC00
3HPGG 2N3AB 1Z9EA 2B4JC 2XPLA 2XPNA 3NFQA 2XPPA 2XPOA 3O8ZA 3HPHE 3OAKA 3U88C 1EO0A 1WJTA 3F9KC
chains in the Genus database with same CATH superfamily
5F13A 3RBUA 3BI1A 4NGNA 2XEGA 5F09A 4P4FA 1YVHA 2XEIA 3HPGG 5D29A 4BPWB 4BTFA 1Z9EA 4NGPA 2JBKA 4JYWA 1WJTA 4BPXB 3ZNIA 2DLAA 4BPUB 1FBVA 2XPNA 3BUMB 4NGTA 1DE4C 4A4BA 3D7FA 3VRRA 2C6GA 2OOTA 4MCRA 4P4BA 4JZ0A 5ELYA 2Y1NA 2CIJA 3PLFB 3FEEA 2C6CA 2VKZG 3IWWA 4P4JA 3BUWB 3VGOA 4P45A 3OP0A 3S9MA 1B47A 4OC1A 2PVWA 3U88C 4OC5A 3D7HA 3SJEA 4GPLB 5J3XA 4OC4A 3VROA 1CX8A 3D7DA 5AXIA 3SJFA 4MCQA 3BUXB 2B4JC 2XPPA 4MCPA 3BXMA 3SJXA 3FEDA 3HPHE 3VRQA 4P4IA 1EO0A 3HMJG 4W9YA 3VRPA 4OC2A 3BI0A 2JBJA 3BUNB 3NFQA 4OMEA 4P44A 3OAKA 4RR2B 4NGQA 2N3AB 3FECA 5BY0A 3D7GA 4NGMA 3S9LA 2XPOA 3O8ZA 4NGSA 3VRNA 2PVVA 3KASA 2UV8G 2Y1MA 3BHXA 1Z8LA 2XPLA 2CBLA 3OB1B 2XEFA 4A4CA 4X3RA 5HKYA 3S9NA 3PT1A 4LQGA 4OC3A 4P4EA 3FF3A 4OC0A 2XEJA 4P4DA 2C6PA 3SJGA 2OR4A 5HKWA 5HKZA 3BUOB 3OB2B 4NGRA 3PFVA 4MCSA 3F9KC
chains in the Genus database with same CATH topology
3HPGG 2N3AB 1Z9EA 2B4JC 2XPLA 2XPNA 3NFQA 2XPPA 2XPOA 3O8ZA 3HPHE 3OAKA 3U88C 1EO0A 1WJTA 3F9KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPG G;  2N3A B;  1Z9E A;  2B4J C;  2XPL A;  2XPN A;  3NFQ A;  2XPP A;  2XPO A;  3O8Z A;  3HPH E;  3OAK A;  3U88 C;  1EO0 A;  1WJT A;  3F9K C; 
#chains in the Genus database with same CATH topology
 5F13 A;  3RBU A;  3BI1 A;  4NGN A;  2XEG A;  5F09 A;  4P4F A;  1YVH A;  2XEI A;  3HPG G;  5D29 A;  4BPW B;  4BTF A;  1Z9E A;  4NGP A;  2JBK A;  4JYW A;  1WJT A;  4BPX B;  3ZNI A;  2DLA A;  4BPU B;  1FBV A;  2XPN A;  3BUM B;  4NGT A;  1DE4 C;  4A4B A;  3D7F A;  3VRR A;  2C6G A;  2OOT A;  4MCR A;  4P4B A;  4JZ0 A;  5ELY A;  2Y1N A;  2CIJ A;  3PLF B;  3FEE A;  2C6C A;  2VKZ G;  3IWW A;  4P4J A;  3BUW B;  3VGO A;  4P45 A;  3OP0 A;  3S9M A;  1B47 A;  4OC1 A;  2PVW A;  3U88 C;  4OC5 A;  3D7H A;  3SJE A;  4GPL B;  5J3X A;  4OC4 A;  3VRO A;  1CX8 A;  3D7D A;  5AXI A;  3SJF A;  4MCQ A;  3BUX B;  2B4J C;  2XPP A;  4MCP A;  3BXM A;  3SJX A;  3FED A;  3HPH E;  3VRQ A;  4P4I A;  1EO0 A;  3HMJ G;  4W9Y A;  3VRP A;  4OC2 A;  3BI0 A;  2JBJ A;  3BUN B;  3NFQ A;  4OME A;  4P44 A;  3OAK A;  4RR2 B;  4NGQ A;  2N3A B;  3FEC A;  5BY0 A;  3D7G A;  4NGM A;  3S9L A;  2XPO A;  3O8Z A;  4NGS A;  3VRN A;  2PVV A;  3KAS A;  2UV8 G;  2Y1M A;  3BHX A;  1Z8L A;  2XPL A;  2CBL A;  3OB1 B;  2XEF A;  4A4C A;  4X3R A;  5HKY A;  3S9N A;  3PT1 A;  4LQG A;  4OC3 A;  4P4E A;  3FF3 A;  4OC0 A;  2XEJ A;  4P4D A;  2C6P A;  3SJG A;  2OR4 A;  5HKW A;  5HKZ A;  3BUO B;  3OB2 B;  4NGR A;  3PFV A;  4MCS A;  3F9K C; 
#chains in the Genus database with same CATH homology
 3HPG G;  2N3A B;  1Z9E A;  2B4J C;  2XPL A;  2XPN A;  3NFQ A;  2XPP A;  2XPO A;  3O8Z A;  3HPH E;  3OAK A;  3U88 C;  1EO0 A;  1WJT A;  3F9K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...