3F9KC

Two domain fragment of hiv-2 integrase in complex with ledgf ibd
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
b'SMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVLEVLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrase
publication title A novel co-crystal structure affords the design of gain-of-function lentiviral integrase mutants in the presence of modified PSIP1/LEDGF/p75
pubmed doi rcsb
source organism Human immunodeficiency virus type 2
molecule tags Viral protein, recombination
total genus 33
structure length 94
sequence length 94
chains with identical sequence G, K, O, S, W, a, e, i, m, q, u
ec nomenclature
pdb deposition date 2008-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3f9kC00
2XPPA 3HPGG 2B4JC 3U88C 2XPLA 1Z9EA 3NFQA 3OAKA 3HPHE 2XPNA 3F9KC 1WJTA 1EO0A 3O8ZA 2N3AB 2XPOA
chains in the Genus database with same CATH superfamily
3S9NA 4OC4A 3FF3A 1YVHA 3BUOB 4P4FA 4MCPA 2PVVA 2JBJA 4P4EA 3O8ZA 5ELYA 4NGQA 4P44A 4BTFA 4A4BA 1B47A 3FEEA 3BUMB 2XPOA 2Y1MA 4MCQA 5J3XA 1Z9EA 3OAKA 5F13A 3SJGA 2XEGA 2XPPA 5D29A 3U88C 2C6CA 1DE4C 1Z8LA 3D7HA 3IWWA 3HPGG 2B4JC 3VGOA 4BPXB 4OC0A 4OC1A 3BI0A 3SJXA 1CX8A 4NGRA 5AXIA 2UV8G 5HKWA 5HKZA 4RR2B 3VRPA 1FBVA 3BUNB 2VKZG 2OOTA 2N3AB 2CBLA 3VROA 3D7GA 3OB2B 3FEDA 4W9YA 3VRRA 5HKYA 3RBUA 3BXMA 4LQGA 2PVWA 3HMJG 3FECA 4OMEA 4JYWA 4P4IA 1EO0A 4P4DA 3BUXB 3D7DA 2DLAA 4NGNA 4X3RA 3S9MA 4OC3A 2XEIA 2XPNA 1WJTA 3KASA 4P4BA 4BPWB 4A4CA 3OB1B 3BI1A 3NFQA 3ZNIA 3F9KC 2JBKA 3VRNA 3OP0A 4P45A 2C6GA 3PFVA 4MCRA 2XEJA 4NGTA 3PLFB 4OC5A 4NGPA 4NGMA 4OC2A 2Y1NA 4JZ0A 3BHXA 2XPLA 5F09A 3SJFA 4GPLB 4BPUB 5BY0A 2CIJA 3S9LA 4MCSA 3PT1A 2XEFA 3SJEA 3HPHE 3D7FA 2C6PA 4P4JA 3BUWB 4NGSA 3VRQA 2OR4A
chains in the Genus database with same CATH topology
2XPPA 3HPGG 2B4JC 3U88C 2XPLA 1Z9EA 3NFQA 3OAKA 3HPHE 2XPNA 3F9KC 1WJTA 1EO0A 3O8ZA 2N3AB 2XPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPP A;  3HPG G;  2B4J C;  3U88 C;  2XPL A;  1Z9E A;  3NFQ A;  3OAK A;  3HPH E;  2XPN A;  3F9K C;  1WJT A;  1EO0 A;  3O8Z A;  2N3A B;  2XPO A; 
#chains in the Genus database with same CATH topology
 3S9N A;  4OC4 A;  3FF3 A;  1YVH A;  3BUO B;  4P4F A;  4MCP A;  2PVV A;  2JBJ A;  4P4E A;  3O8Z A;  5ELY A;  4NGQ A;  4P44 A;  4BTF A;  4A4B A;  1B47 A;  3FEE A;  3BUM B;  2XPO A;  2Y1M A;  4MCQ A;  5J3X A;  1Z9E A;  3OAK A;  5F13 A;  3SJG A;  2XEG A;  2XPP A;  5D29 A;  3U88 C;  2C6C A;  1DE4 C;  1Z8L A;  3D7H A;  3IWW A;  3HPG G;  2B4J C;  3VGO A;  4BPX B;  4OC0 A;  4OC1 A;  3BI0 A;  3SJX A;  1CX8 A;  4NGR A;  5AXI A;  2UV8 G;  5HKW A;  5HKZ A;  4RR2 B;  3VRP A;  1FBV A;  3BUN B;  2VKZ G;  2OOT A;  2N3A B;  2CBL A;  3VRO A;  3D7G A;  3OB2 B;  3FED A;  4W9Y A;  3VRR A;  5HKY A;  3RBU A;  3BXM A;  4LQG A;  2PVW A;  3HMJ G;  3FEC A;  4OME A;  4JYW A;  4P4I A;  1EO0 A;  4P4D A;  3BUX B;  3D7D A;  2DLA A;  4NGN A;  4X3R A;  3S9M A;  4OC3 A;  2XEI A;  2XPN A;  1WJT A;  3KAS A;  4P4B A;  4BPW B;  4A4C A;  3OB1 B;  3BI1 A;  3NFQ A;  3ZNI A;  3F9K C;  2JBK A;  3VRN A;  3OP0 A;  4P45 A;  2C6G A;  3PFV A;  4MCR A;  2XEJ A;  4NGT A;  3PLF B;  4OC5 A;  4NGP A;  4NGM A;  4OC2 A;  2Y1N A;  4JZ0 A;  3BHX A;  2XPL A;  5F09 A;  3SJF A;  4GPL B;  4BPU B;  5BY0 A;  2CIJ A;  3S9L A;  4MCS A;  3PT1 A;  2XEF A;  3SJE A;  3HPH E;  3D7F A;  2C6P A;  4P4J A;  3BUW B;  4NGS A;  3VRQ A;  2OR4 A; 
#chains in the Genus database with same CATH homology
 2XPP A;  3HPG G;  2B4J C;  3U88 C;  2XPL A;  1Z9E A;  3NFQ A;  3OAK A;  3HPH E;  2XPN A;  3F9K C;  1WJT A;  1EO0 A;  3O8Z A;  2N3A B;  2XPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...