3VRQA

Crystal structure of the tyrosine kinase binding domain of cbl-c (pl mutant)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
310
structure length
278
Chain Sequence
QWEEARALGRAVRMLQRLEEQCPPSLRDLLPRTAQLLREVAHSRPGGPGGSGDFLLIYLANLEAKSRQVAALSRLRRQLAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRLSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural flexibility regulates phosphopeptide-binding activity of the tyrosine kinase binding domain of Cbl-c.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Signal transduction protein CBL-C
total genus 95
structure length 278
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02262 Cbl_N CBL proto-oncogene N-terminal domain 1
A PF02761 Cbl_N2 CBL proto-oncogene N-terminus, EF hand-like domain
A PF02762 Cbl_N3 CBL proto-oncogene N-terminus, SH2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3vrqA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 3vrqA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3vrqA03
1FYRA 1J7PA 4GL9E 1SPRA 3EVRA 1O4PA 1JBAA 1KFXL 4ZCUA 1CLBA 4K44A 1LA3A 4TZIA 1K9PA 1CJ1A 3IMJA 2KYFA 4GGFA 1KCYA 1SK6D 3VROA 5CPVA 4GUKA 1U5IA 1DJIA 3CZTX 2IS9A 1F4OA 5I6VA 1HQVA 3S8OA 2BE4A 2JPTA 2KSPA 1NYAA 4PE1A 1O4DA 1EG3A 1BR4B 1J55A 1K93D 1OSAA 2L98A 1CDNA 3MXCA 1V1GA 1Y1AA 2ZRTA 3ZNIA 2CTNA 1EJ3A 1RJVA 3JVTC 4YGDB 1CFCA 2ZNEA 3I5FC 4H1OA 1WDCB 1A1EA 1AYCA 4OVNF 2JYQA 1F4QA 3BXKA 1SY9A 1W7IB 1AD5A 2NCOA 3QRXA 1R1SA 3QWYA 3C1VA 4ETOA 4JQ0D 2K7OA 1YRTB 5DKNA 2H61C 2E30A 1O4HA 2ECDA 3RM1A 3VS2A 2LCPA 1ZACA 1UHNA 1TTXA 2L4IA 2LNWA 4USLA 3IQQA 4PHNA 4WWQA 1MR8A 1O47A 1R2UA 2M7LA 1QG1E 3DVEA 3IN8A 4DGXA 2JXCA 1BHHB 2KQ6A 4M2OA 2Y3AB 1K2HA 1GHUA 2JTZA 3CWGA 3BUXB 1ALWA 5KAZA 5AXIA 5BO4A 2WCEA 2CI9A 1B8LA 1EG4A 1CTRA 1O4BA 3NHNA 1MXLC 4PHMA 5CSFA 2LLTA 1F54A 1NCXA 1UHHA 2NZ0A 1O4FA 1FI5A 3KFJA 4N1GA 1XK4C 3NSKA 3VRRA 4AQJA 1LCKA 2EYVA 3HCMA 1JC2A 2L4KA 1D1ZA 2WCBA 1D4WA 1FMKA 1B4CA 2KHNA 1QS7A 2HPSA 1CMFA 2KDHA 1O4EA 3TUYB 2CT9A 1A1BA 2FCIA 1MF8B 4F5AA 4CFRA 1CB1A 3N8MA 4I5LB 3VS3A 2LHLA 2MLFC 4AOMA 5AERA 1DT7B 2JNXA 1C07A 2KYCA 3HIZB 2ZRSA 1X0NA 2WNDA 1S5GY 2L0PA 3EKJA 4MZLA 1JYQA 2SASA 2DM0A 1M39A 1SCVA 5EHRA 3FS7A 2JQ6A 4HRHA 3OHMB 3GK4X 2HUWA 2Q4UA 2KBMA 2SCPA 5DC9A 2VRGA 3ZWHA 3N84A 1SCMB 1NX1A 1UHKA 1BR1B 1AVSA 2L2EA 5KU1A 3DF0B 2AMIA 1TIZA 1K90D 5AEQA 1CDLA 2LAPA 2CNPA 2KNEA 2NCPA 4FQOA 4MRYA 3BYAA 1A1AA 1QLKA 2CIAA 2ZN8A 1XYDA 5G08A 2F3ZA 4PE0A 2WOSA 4YI9A 1MW4A 2LNXA 2K7BA 5D69A 1L2OC 5HLOA 1MXEA 1BF5A 1A08A 1L7ZA 4P9ZA 2CR4A 2LNKA 1GRIA 1NCYA 2PMYA 1KA7A 1J7QA 1OO4A 3VS5A 2MAZA 3CLNA 2PTKA 1E8AA 4XZ0A 1N2DA 1KFUS 5J3XA 2F33A 2M0RA 2NLNA 5I8NA 1XO5A 2AAOA 1DJWA 4OKHA 1CFDA 1M61A 1AOUF 2IZVA 4FBNA 1OPKA 4QJ3B 3DD4A 4D8KA 2EOBA 1O45A 5DC0B 4DGPA 5ER5A 3GK2A 3H4SE 1PSBA 1PULA 1SL7A 1UHIA 2JXLA 4CPVA 5CDWA 1K9UA 2A4JA 2OZOA 1TNQA 2LCTA 2H46E 2F2PA 4GPLB 5HLVA 1A81A 4OHDA 4ORBB 1D1OA 1A07A 1KFUL 3O6BA 1EXRA 1KK7Y 3O2PA 1S5GZ 1FF1A 1O42A 3O78A 3TDZA 3OB2B 2LANA 4NDDA 1TCEA 2D8NA 1ZUZA 1SCMC 1IJ5A 1A29A 1QASA 1O43A 5GJIA 4P9VA 1M31A 2JZIA 1BLKA 2LUXA 3HCKA 1UUSA 1N65A 3BUWB 3O4YA 1Z3KA 2F3YA 4WRIA 2P6BB 1CKKA 1K9KA 1QX7A 4MSPA 1NX3A 4NDBA 1H8BA 3S8LA 1QXPA 1NP8A 1NSHA 2KFFA 4MVFA 2RMXA 1O44A 2XP1A 1I3ZA 2GV5A 2OPOA 1LXFC 1OPLA 2IUGA 1KK8B 1YR5A 3GK1A 1R1PA 3TDIA 4FL2A 1PVBA 1QV0A 1LKLA 4ROJA 3D10A 2WORA 1G33A 1KFXS 2CCMA 1F2FA 3PALA 3DVJA 2FJUB 1O4IA 2AOAA 1QVIZ 2K7DA 1PRWA 1IGVA 1N0YA 1OMRA 3M7FA 1WRLA 4PALA 1SR6C 1O48A 3PM8A 3VS1A 2F2OA 3I5HC 1XFYO 2K0JA 3DVMA 4MN0A 2M97A 3I5HB 1FU5A 1HCSB 2ZNDA 5HYDA 1XFVO 3A8RA 5DKQA 2KFHA 2R2IA 2Q91A 3NXAA 4OR9B 4U1PA 3VRPA 1J7RA 2Y1NA 2BL0C 2PLDA 1SPYA 2RSYA 1QADA 1O4QA 1BMOA 5TNCA 1RFJA 5DF6A 5AANA 1G83A 1KQMC 2PSRA 4JE4A 1DJZA 5GQQC 2JNFA 5GJHA 2M8UA 4MEWA 3PATA 2LM5A 3JTDB 2OQ1A 1LVCD 2LMVA 3TS5B 2Y1MA 1QCFA 3EACA 3CR5X 3PSRA 3UYOA 1SL9A 5EEQA 2BCAA 1DGUA 1KWOB 1NX0A 1SHBA 1TNPA 3BKBA 1RROA 3I5GC 1CNPA 2JWWA 3S8NA 4MLWA 1BKMA 3JVTB 3OB1B 1AOTF 3S9KA 2MBXA 2BKHB 1WDCC 1TCFA 1CWEA 2LMUA 2VIFA 1ODBA 2M1KB 4JWQA 3IMDA 1GJYA 1JFKA 2F8PA 5CSIA 3HX4A 1WLMA 2BBUA 3AAJA 3QWXX 4WQ2A 1CWDL 4WQ3A 3LLEA 1XA5A 1RECA 3TDUA 1BFJA 2KI4B 2EYZA 1B8RA 1LUKA 4GFTA 2KI4C 1KK8C 1G4YR 4C0JA 2H8HA 3TKZA 1K9AA 3SG3A 3MXYA 5DC4A 1Y57A 1M27A 3GOFA 5I2OA 1AYBA 3SJSA 1NIWA 1QATA 3CTNA 1B7TZ 4PDZA 2L3TA 1ZMZA 2LMTA 1HCTB 2JT8A 1DGVA 1IKUA 1ZFPE 1SHDA 1OMVA 2JRFA 1J7OA 1A09A 3RLZA 4C0KA 3PJPA 4EY0A 1KQMB 3IQOA 1EL4A 4YGCB 2OS8C 1F71A 2KNOA 2WCFA 1Y1UA 1TRFA 2YSXA 1SRAA 3I5IC 4LUEA 1YURA 1SPSA 2I94A 1PALA 1JYRA 2HDVA 3OVEA 2EHBA 1OOJA 1OE9B 1SBJA 4BY4A 1AK8A 2EKXA 2ZFDA 4A4BA 2H5KA 1WY9A 4F0ZB 1BT6A 2LUCA 3SG6A 2E6WA 2IUHA 1A03A 3N7YA 2YU7A 3TUYC 2I2RE 3CR2A 3SG5A 1SMGA 3PLFB 1DJHA 1OQPA 4PCWA 2K8MB 4I5NB 4XJKA 1AB2A 2EC6C 2CBLA 4ZCVA 1S6IA 3SG7A 1MILA 1X02A 1D4TA 1BHHA 2MRKA 4YRUA 1QTXA 2WC8A 3I5GB 5EG3B 1A4PA 2QPTA 4YBHB 1R6PA 1O4JA 1K8UA 2EO6A 3I5FB 1S36A 2DOQA 1O46A 4K2RA 3CGAA 3NSLA 4MBEA 5IBWA 2I7AA 1JU5A 3VRNA 3US4A 1YUSA 1XFUO 2QMSA 1BLQA 2M9GA 2MRJA 2L4HA 1QX2A 2NXQA 4A4CA 4Q04A 1BG1A 2L50A 1YUUA 1BKLA 2MHHA 1CLLA 3KF9A 1FI6A 1CDPA 1BFIA 1ZFSA 4OHHA 1DJGA 3IN7A 5EHPA 2PVBA 1M63B 4CFQA 3VRZA 2LVVA 1JF2A 1HT9A 2PRUA 3EK4A 3EK8A 3VRYA 1CMGA 1NWDA 1UURA 1QJTA 2PNBA 1DJXA 4MZKA 1QIVA 1YX8A 2KAVA 1YTZC 3D0YB 4M2PA 5DKRA 1JWOA 1AHRA 1SL8A 3PFVA 1DJYA 3LCPC 3A4UB 3AKBA 2LLUA 1CFFA 2B1UA 2KGRA 2RORA 4L1BB 2L5XB 1FPWA 1KA6A 1B9AA 5I2QA 3VGOA 3OV1A 2L51A 2EGDA 4E93A 2RGIA 1B1GA 1CM4A 5ER4X 1AJ4A 2C9WA 2SRCA 3CD3A 4GAOA 3PSJA 2KGBC 4N5XA 1GGZA 2HMHA 1Q80A 3VS6A 4HRGA 2EC6B 1A1CA 2MC1A 1PVAA 2CXJA 3T04A 2K2AA 2AUCA 2LQWA 3MAZA 5CSJA 4GBAA 2M1UA 1S6JA 1XFWO 3KO0A 3WHTB 3WXAA 2DCRA 2K7AB 4K45A 5I2LA 3CS1A 4CLNA 1BODA 3D0YA 4HREE 1CLMA 2V53A 4MZJA 5PALA 1O41A 4OHIA 3NSOA 1LINA 2HQ8A 4XYNA 2GSBA 3TL0A 1H9OA 2QACA 1FW4A 2KAYA 3FIAA 5IBSA 1TNXA 4QSYA 2ABLA 1PK0D 1RPYA 3KHEA 2KFGA 2BKIB 3OX5A 5EELA 1O4OA 1NRVA 2JU0A 1YUTA 4DUQA 5CSNA 1TNWA 1MWNA 2TN4A 2Y4QA 3MSEB 1AP4A 4OHLA 1WQUA 3CBLA 2M49B 2LQNA 3BUNB 1IG5A 1C7WA 2HDXA 2BE6A 2LC5A 1K94A 2Y5IA 1LUNA 1NUBA 2G2BA 1AJ5A 2JC2A 3DVKA 5HKWA 2KAXA 5KSZA 4P5OE 4AQIA 1TCOB 2JTTA 3WNXB 1CSZA 4UPGA 2CI8A 2DLZA 2OS8B 2GGMA 1SKTA 2MA2A 2CS0A 2GE9A 3GQIB 3PSKA 2BBNA 4E68A 4MRXA 3SIAA 2LVJA 1BM2A 3WHUB 1RQQC 3SIBA 1KSMA 4YGAA 1TN4A 3PQZA 2K61A 3F45A 3FWBA 1J1EA 2KI6D 1K96A 3NSIA 1JWDA 1B7TY 4GGNA 2IUIA 1LUIA 1FBVA 3VS4A 2I18A 1F1WA 2L6KA 1VRKA 1JYUA 1XVJA 2LVIA 1SYMA 1JSAA 1IJRA 1LKJA 2FO0A 1KSWA 1UHJA 2K79B 3VS0A 1NX2A 3VRQA 1Y6WA 4M2QA 4JPZB 4DS7A 4GNKB 2COLB 2KBIA 4R1EA 1GGWA 2LLSA 3DF0A 4YI8A 1AYDA 1O4MA 1O4CA 2B3OA 1RK9A 5IBMA 1QV1A 2BECA 2G9BA 2OTGC 5F6TA 1BMBA 1CSYA 1S3PA 3C7IA 3GXXA 3JTDC 1NCZA 1KQVA 1M46A 2ISDA 5AFPA 5JOLA 3CR4X 4DIRA 2RVFA 4BTFA 2EYYA 2M29A 1QVIY 3IF7A 1WRKA 4CIDA 1MUXA 1PSRA 1U5IB 3UF4A 4JEGA 2C0IA 4XZ1A 3E3RA 1CDMA 5HKZA 3EAZA 4EIHA 3BUMB 4HSZA 1CFPA 2DLYA 1BJFA 4QJ5B 1Y1XA 1DF0B 3SG4A 4DCKA 4PE4A 1O4NA 1O4LA 2MRDA 1BU3A 2LP3A 2EU0A 2KQYA 3PN7C 2HCKA 1F70A 3AAKA 1B8CA 1UWOA 3PN7B 4FTGA 2FCEA 4ICBA 4ORAB 4L9MA 1DMOA 1SNLA 1ALVA 4NWGA 2PLEA 4GWFA 1SHAA 3K2MA 2EL8A 4ORCB 4FL3A 2JULA 5K89A 1DTLA 4N1FA 1IH0A 2AOBA 4D1EA 1RTP1 1IJ6A 1WLZA 2LV7A 1OZOA 5JJGA 1BOCA 1JFJA 4JGHA 2KOTA 1Y0VH 2MK2A 1NPQA 1F55A 1YRUB 1BLJA 3OP0A 3TZ1A 1BHFA 3K21A 1AUIB 4U8DA 2MQIA 2O60A 1DF0A 4DRWA 3PS5A 1OZSA 4C0LA 1SW8A 1SR6B 2HETA 1QX5B 1V1FA 2LE9B 1QLSA 2OTGB 1MQ1A 1IS0A 1LUMA 3VS7A 3WA4A 1LA0A 3I5IB 1C7VA 1TOPA 4F59A 5B8IB 2ZKMX 1XK4A 1FBZA 2M7NA 2BCBA 1YX7A 4I5KA 5AULA 2KI6C 5D7FA 3EVUA 5HKYA 4NWFA 1M45A 2BL0B 2H2KA 2AUGA 4NQGA 2M3WA 3ICBA 3SG2A 2PNAA 1S1EA 3OX6A 2O5GA 1GQMA 2MLEC 1IQ5A 1QIWA 3BUOB 1FU6A 2SHPA 3HHMB 3KPXA 3TS5C 2ZN9A 1OO3A 2K2FA 2JOJA 1IQ3A 1MHOA 4F5BA 2DVJA 1KWOC 1WRZA 2HQWA 1RWYA 3EKHA 4NDCA 1O4KA 1X6CA 2PASA 2JT0A 1YVHA 2GGZA 1KC2A 1KK7Z 1XA6A 3EK7A 4H34A 4U17A 4K11A 1FHSA 4IL1A 5FYXA 3BOWB 1NZLA 2BCXA 4BY5A 5BPJA 1H4BA 1JUOA 2JT3A 3LL8B 1K95A 4YGBB 2LVKA 1J1DA 1CM1A 1XFZO 1AYAA 1JF0A 1IWQA 1A75B 1YVLA 2BBMA 3FWCA 4TNCA 2FOTA 1R1QA 2ETZA 2C0TA 1SKJA 3AKAA 2FCDA 4PHJA 1LKKA 1LCJA 5KTYA 1O4AA 2CRHA 4LUDA 1NZVA 1O49A 4GGFC 2MJWB 4I5JA 4XJKB 1TZEE 4OHEA 1G8IA 1P13A 2K7CA 3LK0A 3M0WA 2LP2A 4P2YB 1S26D 1W7JB 2LHIA 1A2XA 1B47A 3LK1A 2HF5A 2C0OA 1KSOA 3BQ3A 1RJAA 4YGEB 1DVIA 5D0JA 1OMDA 4QJ4B 3BOWA 4PHKA 2PALA 2EO3A 1S6CA 3EVVA 4OCIA 1L2OB 1O4GA 4OV2A 2DX0A 1PICA 1EH2A 4M4ZA 1IRJA 1ZOTB 4PE7A 1X27A 4X6SA 1O4RA 2KK6A 3GXWA 1A75A 1XFXO 1F8HA 3CXLA 1UP5A 3KEVA 2H61A
chains in the Genus database with same CATH superfamily
3DY9A 3FEDA 1CLBA 4ZCUA 3R1VA 4TZIA 1K9PA 3QMEA 4GUKA 2C6PA 3FE8A 2IS9A 5I6VA 1HQVA 1NYAA 1BR4B 1OSAA 3ZNIA 3JVTC 4YGDB 2ZNEA 3I5FC 4OVNF 3BXKA 2NCOA 2E30A 3DXLA 1UHNA 2L4IA 2LNWA 1R2UA 4DGXA 4M2OA 4BPUB 1ALWA 5KAZA 1B8LA 1EG4A 1O4BA 4PHMA 5CSFA 2LLTA 1UHHA 1B4CA 1CMFA 2KDHA 4CFRA 4I5LB 2LHLA 2MLFC 3SS5A 1C07A 2KYCA 1X0NA 1JYQA 3LYVA 1M39A 1SCVA 2JQ6A 5DICA 5DC9A 3ZWHA 1NX1A 4KYNA 1DQEA 2LAPA 4MRYA 2KNEA 2CIAA 3BYAA 2LNXA 2F3ZA 2K7BA 1A08A 1GRIA 4P44A 1OO4A 2PTKA 3CLNA 2PVVA 2WCMA 2F33A 2NLNA 3BI0A 5I8NA 1XO5A 2AAOA 1DJWA 1AOUF 4FBNA 4QJ3B 4D8KA 3H4SE 1K9UA 2A4JA 3R1OA 2F2PA 4GPLB 1A81A 1A07A 1EXRA 4OC5A 3TDZA 1TCEA 2D8NA 3NFQA 1BLKA 3BUWB 4WRIA 2P6BB 3S8LA 1NP8A 3K1EA 3BHXA 1I3ZA 3SJXA 1R1PA 5FI6A 2XEFA 3TDIA 4FL2A 1QV0A 4ROJA 3D10A 2WORA 2FJUB 2K7DA 4PALA 3FEEA 1O48A 3I5HC 3DVMA 3I5HB 5DKQA 2VKZG 3NXAA 3D76A 2RSYA 5TNCA 4JE4A 3PATA 2OQ1A 4INXA 3UYOA 1SHBA 1CNPA 1AOTF 4P4FA 1DELA 1WDCC 1CWEA 1ODBA 2BBUA 4WQ3A 3D7DA 1XA5A 1BFJA 1B8RA 4C0JA 3TKZA 5DC4A 1M27A 2JT8A 2JRFA 3IQOA 2KNOA 1TRFA 3I5IC 1PALA 2HDVA 2ZFDA 4A4BA 4OC3A 3PLFB 1DJHA 4I5NB 2EC6C 2CBLA 5F09A 2XPLA 1MILA 1QTXA 2WC8A 1O4JA 1O46A 3L4AA 1BLQA 2MRJA 1QX2A 2NXQA 4A4CA 4Q04A 1BG1A 1BKLA 1BFIA 2PVBA 1HT9A 3EK4A 1NWDA 1QWVA 1QJTA 1DJXA 3IVTA 1YTZC 5DKRA 5F13A 5I94A 3PFVA 5I2QA 3VGOA 2EGDA 1AJ4A 3CD3A 4RR2B 4GAOA 3PSJA 3VS6A 2CXJA 2LQWA 1S6JA 3KO0A 1BODA 4OC1A 1W9ZA 2GSBA 1H9OA 5IBSA 2ABLA 1PK0D 1RPYA 3KHEA 1O4OA 1YUTA 1AP4A 3MSEB 4OHLA 5FI2A 2M49B 2HDXA 4LQGA 2BE6A 1K94A 4MCPA 2G2BA 1LUNA 2KAXA 1TCOB 3WNXB 2GE9A 3PSKA 2BNXA 3WHUB 1TN4A 3F45A 3FWBA 3NSIA 2IUIA 2LVIA 1SYMA 2FO0A 1KSWA 2K79B 3VS0A 1Y6WA 2KBIA 1O4MA 1GGWA 5IBMA 2B3OA 2OTGC 1BMBA 1KQVA 5AFPA 2EYYA 1QVIY 3BUMB 4HSZA 1BJFA 4QJ5B 3SG4A 3CYZA 2LP3A 3PN7C 1F70A 4ORAB 3CZ0A 4FL3A 4NGSA 1DTLA 1IH0A 1RTP1 4JGHA 3BXMA 3TZ1A 1BHFA 1AUIB 4U8DA 2MQIA 4DRWA 1OZSA 3UF4A 1QX5B 1LUMA 1MQ1A 3I5IB 2ZKMX 5D7FA 4NWFA 2H2KA 2M3WA 3ICBA 2P70A 2O5GA 1GQMA 1FU6A 4F5BA 1X6CA 1RWYA 1XA6A 4H34A 4K11A 3BOWB 1NZLA 2BCXA 4BY5A 3LL8B 1J1DA 1AYAA 2BBMA 3FWCA 5FI7A 1SKJA 4OMEA 4PHJA 1OOIX 1LKKA 1NZVA 1O49A 1P13A 2K7CA 3LK0A 3FF3A 1W7JB 1A2XA 2C0OA 1DVIA 4OCIA 1IRJA 1ZOTB 2QEOA 2PQLA 3GXWA 1XFXO 1J7PA 4GL9E 1SPRA 3EVRA 3B7AA 3B87A 3IMJA 4GGFA 3UO9A 1KCYA 5CPVA 1DJIA 2UV8G 1F4OA 3QWYA 2KSPA 1O4DA 3MXCA 1EG3A 1K93D 2L98A 2ZRTA 2CTNA 1WDCB 1F4QA 4JQ0D 3V2LA 2K7OA 2H61C 1O4HA 3RM1A 3VS2A 3FE9A 2M7LA 3DVEA 2JXCA 2XEIA 2KQ6A 3CWGA 4JZ0A 2WCEA 3NHNA 1CTRA 1OOHA 1O4FA 3R1PA 4N1GA 3NSKA 3HCMA 2L4KA 2WCBA 4P4BA 2CT9A 4F5AA 1MF8B 1CB1A 4NGNA 3VS3A 4AOMA 5AERA 3D73A 3EKJA 2SASA 4HRHA 2QEBA 3GK4X 2KBMA 3N84A 1SCMB 1UHKA 1BR1B 2L2EA 1TIZA 2NCPA 4FQOA 1A1AA 2ZN8A 2OOTA 5G08A 2WOSA 3HCKA 3F9KC 1MXEA 3L47A 2CR4A 2PMYA 2L2CA 3K2TA 1J7QA 2MAZA 1E8AA 5J3XA 1KFUS 1M61A 1ORGA 3DD4A 1OW4A 3EG5B 2EOBA 5ER5A 3GK2A 1PSBA 4CPVA 4OHDA 1C3YA 1KFUL 1KK7Y 1S5GZ 3BI1A 3OB2B 1SCMC 1IJ5A 1A29A 1QASA 4P9VA 3RZSA 1N65A 1CKKA 1K9KA 1NX3A 1H8BA 2KFFA 2RMXA 1OPLA 2IUGA 1KK8B 3GK1A 2CCMA 3DVJA 2AOAA 1PRWA 3VS1A 4MN0A 2M97A 1HCSB 2R2IA 1J7RA 2PLDA 1QADA 1RFJA 1G83A 5GQQC 4MEWA 2LMVA 1QCFA 2Y1MA 3EACA 3PSRA 1SL9A 2BCAA 1KWOB 1TNPA 1DC1A 3S8NA 4MLWA 1BKMA 3OB1B 2VIFA 2M1KB 4JWQA 3IMDA 3HX4A 4INWA 3AAJA 1CWDL 3LLEA 1RECA 2H8HA 2C6CA 1Y57A 1AYBA 1NIWA 3CTNA 2L3TA 1ZMZA 1SHDA 4EY0A 3KASA 1KQMB 4YGCB 2WCFA 3O4XA 2I94A 1JYRA 1OOJA 1SBJA 2H5KA 4F0ZB 1BT6A 1A03A 2I2RE 3CR2A 3SG5A 1AB2A 1OQPA 2K8MB 1X02A 2MRKA 3I5GB 2L5YA 2QPTA 4YBHB 1S36A 2DOQA 1JU5A 5IBWA 3US4A 2WCLA 3VRNA 1XFUO 2QMSA 2OR4A 2M9GA 2MHHA 1CLLA 1CDPA 1ZFSA 3IN7A 4P45A 4CFQA 3VRZA 2LVVA 1JWOA 3LCPC 3A4UB 2LLUA 2B1UA 4NGPA 2L5XB 1FPWA 4E93A 2C9WA 2SRCA 2KGBC 1Q80A 4HRGA 3T04A 5CSJA 4GBAA 2M1UA 2XPNA 3WXAA 3WHTB 3CS1A 4CLNA 1O41A 3IWWA 5GJHA 2BAPA 3TL0A 3BFAA 1P28A 1FW4A 4X3RA 3FIAA 3RBUA 5CSNA 2C6GA 1WQUA 1C7WA 2LC5A 2JC2A 5HKWA 4AQIA 2BBNA 4MRXA 3SIAA 1TUJA 1K96A 1B7TY 2I18A 2L6KA 1VRKA 3U88C 1JSAA 1LKJA 3BFBA 1UHJA 3VRQA 4M2QA 4JPZB 4GNKB 2COLB 4R1EA 3S8OA 4YI8A 2GTEA 2G9BA 1DEKA 1CSYA 1NCZA 3IF7A 1WRKA 1U5IB 2C0IA 4XZ1A 4DCKA 4NGTA 4PE4A 1O4NA 1O4LA 1BU3A 2EU0A 3B88A 3PN7B 1DMOA 4ICBA 4L9MA 1SNLA 4NWGA 3K2MA 4ORCB 5K89A 4N1FA 3S0AA 3Q8IA 1JFJA 3OGNA 1NPQA 2WCHA 1YRUB 1BLJA 3PS5A 1SR6B 2LE9B 3VS7A 1IS0A 3WA4A 1C7VA 1FBZA 1YX7A 4I5KA 3S0FA 2KI6C 2BL0B 1S1EA 3OX6A 3KPXA 2ZN9A 2K2FA 2JOJA 2WCKA 1WRZA 2HQWA 3EKHA 1Z9EA 1JUOA 4YGBB 1CM1A 4NGMA 2FOTA 2FCDA 5KTYA 4GGFC 4I5JA 4XJKB 4OHEA 3M0WA 4P2YB 1S26D 3D77A 4FQTA 5D3OA 3BOWA 4PHKA 2EO3A 1S6CA 2DX0A 3NGVA 3SJFA 3CDNA 4X6SA 1O4RA 1F8HA 3CXLA 3KEVA 1O4PA 1LA3A 2KYFA 1SK6D 3VROA 3CZTX 2JPTA 1EJ3A 1RJVA 1CFCA 4H1OA 1AYCA 1AD5A 3QRXA 1R1SA 1YRTB 5DKNA 2LCPA 1TTXA 4USLA 3IQQA 1O47A 1QG1E 1GHUA 2JTZA 3PJIA 5AXIA 1FI5A 4AQJA 2EYVA 1JC2A 1D1ZA 1D4WA 2CIJA 2KHNA 3DYEA 1A1BA 2FCIA 3N8MA 3HIZB 2JNXA 1WJTA 2L0PA 5EHRA 3FS7A 2HUWA 2SCPA 2VRGA 1AVSA 2AMIA 1K90D 5AEQA 2CNPA 4PE0A 4YI9A 5HLOA 5D69A 1BF5A 1L7ZA 2LNKA 3S9NA 1NCYA 4XZ0A 3D7FA 2IZVA 1OPKA 5DC0B 4DGPA 2XEJA 1PULA 3PM2A 1TNQA 2KLEA 5HLVA 2N3AB 1D1OA 3O6BA 3O78A 2LANA 4NDDA 2WC5A 1ZUZA 1O43A 1M31A 2JZIA 2LUXA 2XPOA 1UUSA 3O4YA 2KLDA 4MSPA 4NDBA 1NSHA 4MVFA 1O44A 2XP1A 2GV5A 1YR5A 1T14A 1PVBA 1G33A 1KFXS 3CZ2A 1O4IA 1QVIZ 1IGVA 3M7FA 1WRLA 1XFYO 2K0JA 1FU5A 2ZNDA 3A8RA 2KFHA 4U1PA 4OR9B 3VRPA 5DF6A 3D75A 1KQMC 2PSRA 1DJZA 2WC6A 2M8UA 2LM5A 3TS5B 3CR5X 3BFHA 5EEQA 4JKTA 2LRAA 3BKBA 2MBXA 2BKHB 2LMUA 1GJYA 1JFKA 5CSIA 1WLMA 4WQ2A 3TDUA 2KI4B 1LUKA 1KK8C 1G4YR 1K9AA 3SG3A 5I2OA 1B7TZ 2LMTA 1Z2CB 1HCTB 3B6XA 3RLZA 1Z8LA 4C0KA 3PJPA 3NHTA 2OS8C 1F71A 1Y1UA 1SRAA 4LUEA 3SJGA 3OVEA 3FECA 1OE9B 4BY4A 1AK8A 2QEHA 2LUCA 3SG6A 2E6WA 3N7YA 1OOFA 3TUYC 4XJKA 1D4TA 1BHHA 2B4JC 4MCSA 1A4PA 2EO6A 3I5FB 4K2RA 3CGAA 2I7AA 1YUSA 5ELYA 2L4HA 5EL2A 2L50A 3KF9A 3S9MA 4OHHA 1M63B 1JF2A 3EK8A 2PNBA 4MZKA 1YX8A 4M2PA 3DZTA 1AHRA 1SL8A 1CFFA 2KGRA 4L1BB 1B9AA 3OV1A 2L51A 2RGIA 1DE4C 1CM4A 5ER4X 2AUCA 3MAZA 2DCRA 4K45A 3D0YA 4HREE 1CLMA 5PALA 4NGRA 4OHIA 3NSOA 1LINA 2HQ8A 3S0GA 4PT1A 2BKIB 1GM0A 5EELA 2JU0A 3PT1A 2Y4QA 2LQNA 1IG5A 1AJ5A 5KSZA 5D29A 4P5OE 2CI8A 2JTTA 4UPGA 2GGMA 4OZDA 4E68A 1BM2A 1RQQC 3SIBA 1KSMA 4YGAA 2KGYA 2KI6D 1JWDA 4GGNA 1LUIA 1FBVA 3VS4A 1F1WA 1JYUA 2YGUA 1XVJA 4OC4A 1NX2A 1TWOA 1O4CA 1QV1A 5F6TA 1S3PA 3C7IA 3GXXA 4DIRA 4BTFA 3S0BA 4CIDA 1MUXA 1PSRA 3E3RA 1CDMA 4EIHA 1CFPA 2DLYA 1DF0B 2HCKA 3AAKA 1UWOA 4FTGA 3CABA 2PLEA 4GWFA 2EL8A 1WLZA 5JJGA 4IJ7A 2KOTA 1Y0VH 3K21A 2O60A 1V1FA 2HETA 1QLSA 1LA0A 3VB1A 2BCBA 3EVUA 2AUGA 3S9LA 4NQGA 3SG2A 2PNAA 3HHMB 1IQ5A 1QIWA 2WCJA 3BUOB 2SHPA 1OO3A 1IQ3A 1MHOA 2DVJA 4NDCA 1O4KA 2JT0A 2GGZA 1KC2A 1KK7Z 3EK7A 4U17A 4MCRA 2JT3A 1K95A 1IWQA 1YVLA 1R1QA 2C0TA 1TZEE 2MJWB 2LHIA 1B47A 3LK1A 2HF5A 1KSOA 1RJAA 4YGEB 4QJ4B 1O4GA 1L2OB 1PICA 1EH2A 4M4ZA 1X27A 1A75A 1FYRA 1JBAA 1KFXL 4K44A 1CJ1A 3O8ZA 1U5IA 4JYWA 2BE4A 4PE1A 1J55A 1CDNA 4JD9A 3S0DA 1V1GA 1Y1AA 1A1EA 1SSEB 2JYQA 1SY9A 1W7IB 3C1VA 4ETOA 2ECDA 2PYQA 3SJEA 1ZACA 4PHNA 4WWQA 1MR8A 3IN8A 1BHHB 2Y3AB 1K2HA 3BUXB 5BO4A 2CI9A 3D78A 1MXLC 1F54A 1NCXA 2QEVA 2NZ0A 3KFJA 1XK4C 1LCKA 3VRRA 3D7HA 1FMKA 1QS7A 2HPSA 4OC2A 1O4EA 3TUYB 4P4DA 1IIOA 3S0EA 1DT7B 2ZRSA 2WNDA 2PVWA 1S5GY 4MZLA 3SS4A 2JBKA 2DM0A 3OHMB 2Q4UA 2JBJA 5KU1A 3DF0B 1CDLA 1Z4HA 1QLKA 1XYDA 1MW4A 4P9ZA 1L2OC 4W9YA 1KA7A 3VS5A 1N2DA 2M0RA 4P4JA 4OKHA 1CFDA 3OAKA 1O45A 1UHIA 2JXLA 1SL7A 5CDWA 2OZOA 2LCTA 4ORBB 3O2PA 1FF1A 1O42A 5GJIA 1Z3KA 2F3YA 1QX7A 3N7HA 1QXPA 3R72A 2OPOA 1LXFC 2H8VA 3D7GA 3NHIA 1LKLA 1F2FA 3PALA 1N0YA 1OMRA 2P71A 1SR6C 3PM8A 2F2OA 4P4EA 5HYDA 1XFVO 2Q91A 2Y1NA 2BL0C 1SPYA 1O4QA 1BMOA 5AANA 2JNFA 3JTDB 1LVCD 1DGUA 1NX0A 1RROA 3I5GC 2JWWA 3JVTB 2XPPA 3S9KA 1TCFA 2FJYA 2F8PA 3QWXX 3HPGG 2EYZA 4GFTA 2KI4C 3MXYA 3GOFA 3SJSA 1QATA 4PDZA 1DGVA 1IKUA 1ZFPE 1OMVA 1J7OA 1A09A 1EL4A 2YSXA 1YURA 1SPSA 2EKXA 2EHBA 1WY9A 2IUHA 2YU7A 1SMGA 4PCWA 4ZCVA 1S6IA 3SG7A 4YRUA 5EG3B 1R6PA 1K8UA 3NSLA 4MBEA 1CX8A 1YUUA 1TUZA 1FI6A 1DJGA 5EHPA 2PRUA 1LS8A 3VRYA 1CMGA 1UURA 1QIVA 2KAVA 3D0YB 1DJYA 2QDIA 4NGQA 3AKBA 2RORA 1B1GA 4P4IA 4N5XA 1GGZA 2HMHA 2EC6B 1A1CA 2MC1A 1PVAA 2K2AA 1XFWO 2K7AB 5I2LA 2DLAA 4MZJA 2V53A 4XYNA 2QACA 2KAYA 1EO0A 1TNXA 4QSYA 2KFGA 3OX5A 1NRVA 4DUQA 1TNWA 1MWNA 2TN4A 3CBLA 3BUNB 2Y5IA 1NUBA 3CZ1A 3DVKA 1KA6A 1CSZA 2DLZA 2OS8B 1SKTA 2MA2A 2CS0A 3GQIB 2XEGA 3UNWA 2LVJA 5HL1A 3PQZA 2K61A 4MCQA 1J1EA 1OOGA 1IJRA 2KPHA 2LLSA 3DF0A 1AYDA 1RK9A 1C3ZA 2BECA 3L4LA 3JTDC 1M46A 2JPOA 2ISDA 5JOLA 3CR4X 2RVFA 2M29A 4JEGA 5HKZA 3EAZA 1Y1XA 2MRDA 4OC0A 2KQYA 3BJHA 1B8CA 2FCEA 1ALVA 1SHAA 2JULA 3HPHE 2AOBA 4D1EA 1IJ6A 2LV7A 1OZOA 1BOCA 3HMJG 2MK2A 3FE6A 3OBVA 1F55A 3OP0A 4F7FA 1DF0A 4DS7A 4C0LA 1SW8A 2OTGB 1TOPA 4F59A 5B8IB 1XK4A 2M7NA 5AULA 5HKYA 1M45A 2ERBA 2MLEC 3TS5C 3D74A 1KWOC 2PASA 1YVHA 1FHSA 4IL1A 1XFRA 5FYXA 5BPJA 1H4BA 2LVKA 2K60A 1XFZO 1JF0A 3SS3A 1A75B 4TNCA 3B86A 2ETZA 3AKAA 1LCJA 1O4AA 2CRHA 4LUDA 5BY0A 1G8IA 2LP2A 4BPWB 5D0JA 3BQ3A 1OMDA 2PALA 3EVVA 4OV2A 4PE7A 2KK6A 4BPXB 1UP5A 2H46E 2H61A
chains in the Genus database with same CATH topology
1FYRA 1J7PA 4GL9E 1SPRA 3EVRA 1O4PA 1JBAA 1KFXL 4ZCUA 1CLBA 4K44A 1LA3A 4TZIA 1K9PA 1CJ1A 3IMJA 2KYFA 4GGFA 1KCYA 1SK6D 3VROA 5CPVA 4GUKA 1U5IA 1DJIA 3CZTX 2IS9A 1F4OA 5I6VA 1HQVA 3S8OA 2BE4A 2JPTA 2KSPA 1NYAA 4PE1A 1O4DA 1EG3A 1BR4B 1J55A 1K93D 1OSAA 2L98A 1CDNA 3MXCA 1V1GA 1Y1AA 2ZRTA 3ZNIA 2CTNA 1EJ3A 1RJVA 3JVTC 4YGDB 1CFCA 2ZNEA 3I5FC 4H1OA 1WDCB 1A1EA 1AYCA 4OVNF 2JYQA 1F4QA 3BXKA 1SY9A 1W7IB 1AD5A 2NCOA 3QRXA 1R1SA 3QWYA 3C1VA 4ETOA 4JQ0D 2K7OA 1YRTB 5DKNA 2H61C 2E30A 1O4HA 2ECDA 3RM1A 3VS2A 2LCPA 1ZACA 1UHNA 1TTXA 2L4IA 2LNWA 4USLA 3IQQA 4PHNA 4WWQA 1MR8A 1O47A 1R2UA 2M7LA 1QG1E 3DVEA 3IN8A 4DGXA 2JXCA 1BHHB 2KQ6A 4M2OA 2Y3AB 1K2HA 1GHUA 2JTZA 3CWGA 3BUXB 1ALWA 5KAZA 5AXIA 5BO4A 2WCEA 2CI9A 1B8LA 1EG4A 1CTRA 1O4BA 3NHNA 1MXLC 4PHMA 5CSFA 2LLTA 1F54A 1NCXA 1UHHA 2NZ0A 1O4FA 1FI5A 3KFJA 4N1GA 1XK4C 3NSKA 3VRRA 4AQJA 1LCKA 2EYVA 3HCMA 1JC2A 2L4KA 1D1ZA 2WCBA 1D4WA 1FMKA 1B4CA 2KHNA 1QS7A 2HPSA 1CMFA 2KDHA 1O4EA 3TUYB 2CT9A 1A1BA 2FCIA 1MF8B 4F5AA 4CFRA 1CB1A 3N8MA 4I5LB 3VS3A 2LHLA 2MLFC 4AOMA 5AERA 1DT7B 2JNXA 1C07A 2KYCA 3HIZB 2ZRSA 1X0NA 2WNDA 1S5GY 2L0PA 3EKJA 4MZLA 1JYQA 2SASA 2DM0A 1M39A 1SCVA 5EHRA 3FS7A 2JQ6A 4HRHA 3OHMB 3GK4X 2HUWA 2Q4UA 2KBMA 2SCPA 5DC9A 2VRGA 3ZWHA 3N84A 1SCMB 1NX1A 1UHKA 1BR1B 1AVSA 2L2EA 5KU1A 3DF0B 2AMIA 1TIZA 1K90D 5AEQA 1CDLA 2LAPA 2CNPA 2KNEA 2NCPA 4FQOA 4MRYA 3BYAA 1A1AA 1QLKA 2CIAA 2ZN8A 1XYDA 5G08A 2F3ZA 4PE0A 2WOSA 4YI9A 1MW4A 2LNXA 2K7BA 5D69A 1L2OC 5HLOA 1MXEA 1BF5A 1A08A 1L7ZA 4P9ZA 2CR4A 2LNKA 1GRIA 1NCYA 2PMYA 1KA7A 1J7QA 1OO4A 3VS5A 2MAZA 3CLNA 2PTKA 1E8AA 4XZ0A 1N2DA 1KFUS 5J3XA 2F33A 2M0RA 2NLNA 5I8NA 1XO5A 2AAOA 1DJWA 4OKHA 1CFDA 1M61A 1AOUF 2IZVA 4FBNA 1OPKA 4QJ3B 3DD4A 4D8KA 2EOBA 1O45A 5DC0B 4DGPA 5ER5A 3GK2A 3H4SE 1PSBA 1PULA 1SL7A 1UHIA 2JXLA 4CPVA 5CDWA 1K9UA 2A4JA 2OZOA 1TNQA 2LCTA 2H46E 2F2PA 4GPLB 5HLVA 1A81A 4OHDA 4ORBB 1D1OA 1A07A 1KFUL 3O6BA 1EXRA 1KK7Y 3O2PA 1S5GZ 1FF1A 1O42A 3O78A 3TDZA 3OB2B 2LANA 4NDDA 1TCEA 2D8NA 1ZUZA 1SCMC 1IJ5A 1A29A 1QASA 1O43A 5GJIA 4P9VA 1M31A 2JZIA 1BLKA 2LUXA 3HCKA 1UUSA 1N65A 3BUWB 3O4YA 1Z3KA 2F3YA 4WRIA 2P6BB 1CKKA 1K9KA 1QX7A 4MSPA 1NX3A 4NDBA 1H8BA 3S8LA 1QXPA 1NP8A 1NSHA 2KFFA 4MVFA 2RMXA 1O44A 2XP1A 1I3ZA 2GV5A 2OPOA 1LXFC 1OPLA 2IUGA 1KK8B 1YR5A 3GK1A 1R1PA 3TDIA 4FL2A 1PVBA 1QV0A 1LKLA 4ROJA 3D10A 2WORA 1G33A 1KFXS 2CCMA 1F2FA 3PALA 3DVJA 2FJUB 1O4IA 2AOAA 1QVIZ 2K7DA 1PRWA 1IGVA 1N0YA 1OMRA 3M7FA 1WRLA 4PALA 1SR6C 1O48A 3PM8A 3VS1A 2F2OA 3I5HC 1XFYO 2K0JA 3DVMA 4MN0A 2M97A 3I5HB 1FU5A 1HCSB 2ZNDA 5HYDA 1XFVO 3A8RA 5DKQA 2KFHA 2R2IA 2Q91A 3NXAA 4OR9B 4U1PA 3VRPA 1J7RA 2Y1NA 2BL0C 2PLDA 1SPYA 2RSYA 1QADA 1O4QA 1BMOA 5TNCA 1RFJA 5DF6A 5AANA 1G83A 1KQMC 2PSRA 4JE4A 1DJZA 5GQQC 2JNFA 5GJHA 2M8UA 4MEWA 3PATA 2LM5A 3JTDB 2OQ1A 1LVCD 2LMVA 3TS5B 2Y1MA 1QCFA 3EACA 3CR5X 3PSRA 3UYOA 1SL9A 5EEQA 2BCAA 1DGUA 1KWOB 1NX0A 1SHBA 1TNPA 3BKBA 1RROA 3I5GC 1CNPA 2JWWA 3S8NA 4MLWA 1BKMA 3JVTB 3OB1B 1AOTF 3S9KA 2MBXA 2BKHB 1WDCC 1TCFA 1CWEA 2LMUA 2VIFA 1ODBA 2M1KB 4JWQA 3IMDA 1GJYA 1JFKA 2F8PA 5CSIA 3HX4A 1WLMA 2BBUA 3AAJA 3QWXX 4WQ2A 1CWDL 4WQ3A 3LLEA 1XA5A 1RECA 3TDUA 1BFJA 2KI4B 2EYZA 1B8RA 1LUKA 4GFTA 2KI4C 1KK8C 1G4YR 4C0JA 2H8HA 3TKZA 1K9AA 3SG3A 3MXYA 5DC4A 1Y57A 1M27A 3GOFA 5I2OA 1AYBA 3SJSA 1NIWA 1QATA 3CTNA 1B7TZ 4PDZA 2L3TA 1ZMZA 2LMTA 1HCTB 2JT8A 1DGVA 1IKUA 1ZFPE 1SHDA 1OMVA 2JRFA 1J7OA 1A09A 3RLZA 4C0KA 3PJPA 4EY0A 1KQMB 3IQOA 1EL4A 4YGCB 2OS8C 1F71A 2KNOA 2WCFA 1Y1UA 1TRFA 2YSXA 1SRAA 3I5IC 4LUEA 1YURA 1SPSA 2I94A 1PALA 1JYRA 2HDVA 3OVEA 2EHBA 1OOJA 1OE9B 1SBJA 4BY4A 1AK8A 2EKXA 2ZFDA 4A4BA 2H5KA 1WY9A 4F0ZB 1BT6A 2LUCA 3SG6A 2E6WA 2IUHA 1A03A 3N7YA 2YU7A 3TUYC 2I2RE 3CR2A 3SG5A 1SMGA 3PLFB 1DJHA 1OQPA 4PCWA 2K8MB 4I5NB 4XJKA 1AB2A 2EC6C 2CBLA 4ZCVA 1S6IA 3SG7A 1MILA 1X02A 1D4TA 1BHHA 2MRKA 4YRUA 1QTXA 2WC8A 3I5GB 5EG3B 1A4PA 2QPTA 4YBHB 1R6PA 1O4JA 1K8UA 2EO6A 3I5FB 1S36A 2DOQA 1O46A 4K2RA 3CGAA 3NSLA 4MBEA 5IBWA 2I7AA 1JU5A 3VRNA 3US4A 1YUSA 1XFUO 2QMSA 1BLQA 2M9GA 2MRJA 2L4HA 1QX2A 2NXQA 4A4CA 4Q04A 1BG1A 2L50A 1YUUA 1BKLA 2MHHA 1CLLA 3KF9A 1FI6A 1CDPA 1BFIA 1ZFSA 4OHHA 1DJGA 3IN7A 5EHPA 2PVBA 1M63B 4CFQA 3VRZA 2LVVA 1JF2A 1HT9A 2PRUA 3EK4A 3EK8A 3VRYA 1CMGA 1NWDA 1UURA 1QJTA 2PNBA 1DJXA 4MZKA 1QIVA 1YX8A 2KAVA 1YTZC 3D0YB 4M2PA 5DKRA 1JWOA 1AHRA 1SL8A 3PFVA 1DJYA 3LCPC 3A4UB 3AKBA 2LLUA 1CFFA 2B1UA 2KGRA 2RORA 4L1BB 2L5XB 1FPWA 1KA6A 1B9AA 5I2QA 3VGOA 3OV1A 2L51A 2EGDA 4E93A 2RGIA 1B1GA 1CM4A 5ER4X 1AJ4A 2C9WA 2SRCA 3CD3A 4GAOA 3PSJA 2KGBC 4N5XA 1GGZA 2HMHA 1Q80A 3VS6A 4HRGA 2EC6B 1A1CA 2MC1A 1PVAA 2CXJA 3T04A 2K2AA 2AUCA 2LQWA 3MAZA 5CSJA 4GBAA 2M1UA 1S6JA 1XFWO 3KO0A 3WHTB 3WXAA 2DCRA 2K7AB 4K45A 5I2LA 3CS1A 4CLNA 1BODA 3D0YA 4HREE 1CLMA 2V53A 4MZJA 5PALA 1O41A 4OHIA 3NSOA 1LINA 2HQ8A 4XYNA 2GSBA 3TL0A 1H9OA 2QACA 1FW4A 2KAYA 3FIAA 5IBSA 1TNXA 4QSYA 2ABLA 1PK0D 1RPYA 3KHEA 2KFGA 2BKIB 3OX5A 5EELA 1O4OA 1NRVA 2JU0A 1YUTA 4DUQA 5CSNA 1TNWA 1MWNA 2TN4A 2Y4QA 3MSEB 1AP4A 4OHLA 1WQUA 3CBLA 2M49B 2LQNA 3BUNB 1IG5A 1C7WA 2HDXA 2BE6A 2LC5A 1K94A 2Y5IA 1LUNA 1NUBA 2G2BA 1AJ5A 2JC2A 3DVKA 5HKWA 2KAXA 5KSZA 4P5OE 4AQIA 1TCOB 2JTTA 3WNXB 1CSZA 4UPGA 2CI8A 2DLZA 2OS8B 2GGMA 1SKTA 2MA2A 2CS0A 2GE9A 3GQIB 3PSKA 2BBNA 4E68A 4MRXA 3SIAA 2LVJA 1BM2A 3WHUB 1RQQC 3SIBA 1KSMA 4YGAA 1TN4A 3PQZA 2K61A 3F45A 3FWBA 1J1EA 2KI6D 1K96A 3NSIA 1JWDA 1B7TY 4GGNA 2IUIA 1LUIA 1FBVA 3VS4A 2I18A 1F1WA 2L6KA 1VRKA 1JYUA 1XVJA 2LVIA 1SYMA 1JSAA 1IJRA 1LKJA 2FO0A 1KSWA 1UHJA 2K79B 3VS0A 1NX2A 3VRQA 1Y6WA 4M2QA 4JPZB 4DS7A 4GNKB 2COLB 2KBIA 4R1EA 1GGWA 2LLSA 3DF0A 4YI8A 1AYDA 1O4MA 1O4CA 2B3OA 1RK9A 5IBMA 1QV1A 2BECA 2G9BA 2OTGC 5F6TA 1BMBA 1CSYA 1S3PA 3C7IA 3GXXA 3JTDC 1NCZA 1KQVA 1M46A 2ISDA 5AFPA 5JOLA 3CR4X 4DIRA 2RVFA 4BTFA 2EYYA 2M29A 1QVIY 3IF7A 1WRKA 4CIDA 1MUXA 1PSRA 1U5IB 3UF4A 4JEGA 2C0IA 4XZ1A 3E3RA 1CDMA 5HKZA 3EAZA 4EIHA 3BUMB 4HSZA 1CFPA 2DLYA 1BJFA 4QJ5B 1Y1XA 1DF0B 3SG4A 4DCKA 4PE4A 1O4NA 1O4LA 2MRDA 1BU3A 2LP3A 2EU0A 2KQYA 3PN7C 2HCKA 1F70A 3AAKA 1B8CA 1UWOA 3PN7B 4FTGA 2FCEA 4ICBA 4ORAB 4L9MA 1DMOA 1SNLA 1ALVA 4NWGA 2PLEA 4GWFA 1SHAA 3K2MA 2EL8A 4ORCB 4FL3A 2JULA 5K89A 1DTLA 4N1FA 1IH0A 2AOBA 4D1EA 1RTP1 1IJ6A 1WLZA 2LV7A 1OZOA 5JJGA 1BOCA 1JFJA 4JGHA 2KOTA 1Y0VH 2MK2A 1NPQA 1F55A 1YRUB 1BLJA 3OP0A 3TZ1A 1BHFA 3K21A 1AUIB 4U8DA 2MQIA 2O60A 1DF0A 4DRWA 3PS5A 1OZSA 4C0LA 1SW8A 1SR6B 2HETA 1QX5B 1V1FA 2LE9B 1QLSA 2OTGB 1MQ1A 1IS0A 1LUMA 3VS7A 3WA4A 1LA0A 3I5IB 1C7VA 1TOPA 4F59A 5B8IB 2ZKMX 1XK4A 1FBZA 2M7NA 2BCBA 1YX7A 4I5KA 5AULA 2KI6C 5D7FA 3EVUA 5HKYA 4NWFA 1M45A 2BL0B 2H2KA 2AUGA 4NQGA 2M3WA 3ICBA 3SG2A 2PNAA 1S1EA 3OX6A 2O5GA 1GQMA 2MLEC 1IQ5A 1QIWA 3BUOB 1FU6A 2SHPA 3HHMB 3KPXA 3TS5C 2ZN9A 1OO3A 2K2FA 2JOJA 1IQ3A 1MHOA 4F5BA 2DVJA 1KWOC 1WRZA 2HQWA 1RWYA 3EKHA 4NDCA 1O4KA 1X6CA 2PASA 2JT0A 1YVHA 2GGZA 1KC2A 1KK7Z 1XA6A 3EK7A 4H34A 4U17A 4K11A 1FHSA 4IL1A 5FYXA 3BOWB 1NZLA 2BCXA 4BY5A 5BPJA 1H4BA 1JUOA 2JT3A 3LL8B 1K95A 4YGBB 2LVKA 1J1DA 1CM1A 1XFZO 1AYAA 1JF0A 1IWQA 1A75B 1YVLA 2BBMA 3FWCA 4TNCA 2FOTA 1R1QA 2ETZA 2C0TA 1SKJA 3AKAA 2FCDA 4PHJA 1LKKA 1LCJA 5KTYA 1O4AA 2CRHA 4LUDA 1NZVA 1O49A 4GGFC 2MJWB 4I5JA 4XJKB 1TZEE 4OHEA 1G8IA 1P13A 2K7CA 3LK0A 3M0WA 2LP2A 4P2YB 1S26D 1W7JB 2LHIA 1A2XA 1B47A 3LK1A 2HF5A 2C0OA 1KSOA 3BQ3A 1RJAA 4YGEB 1DVIA 5D0JA 1OMDA 4QJ4B 3BOWA 4PHKA 2PALA 2EO3A 1S6CA 3EVVA 4OCIA 1L2OB 1O4GA 4OV2A 2DX0A 1PICA 1EH2A 4M4ZA 1IRJA 1ZOTB 4PE7A 1X27A 4X6SA 1O4RA 2KK6A 3GXWA 1A75A 1XFXO 1F8HA 3CXLA 1UP5A 3KEVA 2H61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYR A;  1J7P A;  4GL9 E;  1SPR A;  3EVR A;  1O4P A;  1JBA A;  1KFX L;  4ZCU A;  1CLB A;  4K44 A;  1LA3 A;  4TZI A;  1K9P A;  1CJ1 A;  3IMJ A;  2KYF A;  4GGF A;  1KCY A;  1SK6 D;  3VRO A;  5CPV A;  4GUK A;  1U5I A;  1DJI A;  3CZT X;  2IS9 A;  1F4O A;  5I6V A;  1HQV A;  3S8O A;  2BE4 A;  2JPT A;  2KSP A;  1NYA A;  4PE1 A;  1O4D A;  1EG3 A;  1BR4 B;  1J55 A;  1K93 D;  1OSA A;  2L98 A;  1CDN A;  3MXC A;  1V1G A;  1Y1A A;  2ZRT A;  3ZNI A;  2CTN A;  1EJ3 A;  1RJV A;  3JVT C;  4YGD B;  1CFC A;  2ZNE A;  3I5F C;  4H1O A;  1WDC B;  1A1E A;  1AYC A;  4OVN F;  2JYQ A;  1F4Q A;  3BXK A;  1SY9 A;  1W7I B;  1AD5 A;  2NCO A;  3QRX A;  1R1S A;  3QWY A;  3C1V A;  4ETO A;  4JQ0 D;  2K7O A;  1YRT B;  5DKN A;  2H61 C;  2E30 A;  1O4H A;  2ECD A;  3RM1 A;  3VS2 A;  2LCP A;  1ZAC A;  1UHN A;  1TTX A;  2L4I A;  2LNW A;  4USL A;  3IQQ A;  4PHN A;  4WWQ A;  1MR8 A;  1O47 A;  1R2U A;  2M7L A;  1QG1 E;  3DVE A;  3IN8 A;  4DGX A;  2JXC A;  1BHH B;  2KQ6 A;  4M2O A;  2Y3A B;  1K2H A;  1GHU A;  2JTZ A;  3CWG A;  3BUX B;  1ALW A;  5KAZ A;  5AXI A;  5BO4 A;  2WCE A;  2CI9 A;  1B8L A;  1EG4 A;  1CTR A;  1O4B A;  3NHN A;  1MXL C;  4PHM A;  5CSF A;  2LLT A;  1F54 A;  1NCX A;  1UHH A;  2NZ0 A;  1O4F A;  1FI5 A;  3KFJ A;  4N1G A;  1XK4 C;  3NSK A;  3VRR A;  4AQJ A;  1LCK A;  2EYV A;  3HCM A;  1JC2 A;  2L4K A;  1D1Z A;  2WCB A;  1D4W A;  1FMK A;  1B4C A;  2KHN A;  1QS7 A;  2HPS A;  1CMF A;  2KDH A;  1O4E A;  3TUY B;  2CT9 A;  1A1B A;  2FCI A;  1MF8 B;  4F5A A;  4CFR A;  1CB1 A;  3N8M A;  4I5L B;  3VS3 A;  2LHL A;  2MLF C;  4AOM A;  5AER A;  1DT7 B;  2JNX A;  1C07 A;  2KYC A;  3HIZ B;  2ZRS A;  1X0N A;  2WND A;  1S5G Y;  2L0P A;  3EKJ A;  4MZL A;  1JYQ A;  2SAS A;  2DM0 A;  1M39 A;  1SCV A;  5EHR A;  3FS7 A;  2JQ6 A;  4HRH A;  3OHM B;  3GK4 X;  2HUW A;  2Q4U A;  2KBM A;  2SCP A;  5DC9 A;  2VRG A;  3ZWH A;  3N84 A;  1SCM B;  1NX1 A;  1UHK A;  1BR1 B;  1AVS A;  2L2E A;  5KU1 A;  3DF0 B;  2AMI A;  1TIZ A;  1K90 D;  5AEQ A;  1CDL A;  2LAP A;  2CNP A;  2KNE A;  2NCP A;  4FQO A;  4MRY A;  3BYA A;  1A1A A;  1QLK A;  2CIA A;  2ZN8 A;  1XYD A;  5G08 A;  2F3Z A;  4PE0 A;  2WOS A;  4YI9 A;  1MW4 A;  2LNX A;  2K7B A;  5D69 A;  1L2O C;  5HLO A;  1MXE A;  1BF5 A;  1A08 A;  1L7Z A;  4P9Z A;  2CR4 A;  2LNK A;  1GRI A;  1NCY A;  2PMY A;  1KA7 A;  1J7Q A;  1OO4 A;  3VS5 A;  2MAZ A;  3CLN A;  2PTK A;  1E8A A;  4XZ0 A;  1N2D A;  1KFU S;  5J3X A;  2F33 A;  2M0R A;  2NLN A;  5I8N A;  1XO5 A;  2AAO A;  1DJW A;  4OKH A;  1CFD A;  1M61 A;  1AOU F;  2IZV A;  4FBN A;  1OPK A;  4QJ3 B;  3DD4 A;  4D8K A;  2EOB A;  1O45 A;  5DC0 B;  4DGP A;  5ER5 A;  3GK2 A;  3H4S E;  1PSB A;  1PUL A;  1SL7 A;  1UHI A;  2JXL A;  4CPV A;  5CDW A;  1K9U A;  2A4J A;  2OZO A;  1TNQ A;  2LCT A;  2H46 E;  2F2P A;  4GPL B;  5HLV A;  1A81 A;  4OHD A;  4ORB B;  1D1O A;  1A07 A;  1KFU L;  3O6B A;  1EXR A;  1KK7 Y;  3O2P A;  1S5G Z;  1FF1 A;  1O42 A;  3O78 A;  3TDZ A;  3OB2 B;  2LAN A;  4NDD A;  1TCE A;  2D8N A;  1ZUZ A;  1SCM C;  1IJ5 A;  1A29 A;  1QAS A;  1O43 A;  5GJI A;  4P9V A;  1M31 A;  2JZI A;  1BLK A;  2LUX A;  3HCK A;  1UUS A;  1N65 A;  3BUW B;  3O4Y A;  1Z3K A;  2F3Y A;  4WRI A;  2P6B B;  1CKK A;  1K9K A;  1QX7 A;  4MSP A;  1NX3 A;  4NDB A;  1H8B A;  3S8L A;  1QXP A;  1NP8 A;  1NSH A;  2KFF A;  4MVF A;  2RMX A;  1O44 A;  2XP1 A;  1I3Z A;  2GV5 A;  2OPO A;  1LXF C;  1OPL A;  2IUG A;  1KK8 B;  1YR5 A;  3GK1 A;  1R1P A;  3TDI A;  4FL2 A;  1PVB A;  1QV0 A;  1LKL A;  4ROJ A;  3D10 A;  2WOR A;  1G33 A;  1KFX S;  2CCM A;  1F2F A;  3PAL A;  3DVJ A;  2FJU B;  1O4I A;  2AOA A;  1QVI Z;  2K7D A;  1PRW A;  1IGV A;  1N0Y A;  1OMR A;  3M7F A;  1WRL A;  4PAL A;  1SR6 C;  1O48 A;  3PM8 A;  3VS1 A;  2F2O A;  3I5H C;  1XFY O;  2K0J A;  3DVM A;  4MN0 A;  2M97 A;  3I5H B;  1FU5 A;  1HCS B;  2ZND A;  5HYD A;  1XFV O;  3A8R A;  5DKQ A;  2KFH A;  2R2I A;  2Q91 A;  3NXA A;  4OR9 B;  4U1P A;  3VRP A;  1J7R A;  2Y1N A;  2BL0 C;  2PLD A;  1SPY A;  2RSY A;  1QAD A;  1O4Q A;  1BMO A;  5TNC A;  1RFJ A;  5DF6 A;  5AAN A;  1G83 A;  1KQM C;  2PSR A;  4JE4 A;  1DJZ A;  5GQQ C;  2JNF A;  5GJH A;  2M8U A;  4MEW A;  3PAT A;  2LM5 A;  3JTD B;  2OQ1 A;  1LVC D;  2LMV A;  3TS5 B;  2Y1M A;  1QCF A;  3EAC A;  3CR5 X;  3PSR A;  3UYO A;  1SL9 A;  5EEQ A;  2BCA A;  1DGU A;  1KWO B;  1NX0 A;  1SHB A;  1TNP A;  3BKB A;  1RRO A;  3I5G C;  1CNP A;  2JWW A;  3S8N A;  4MLW A;  1BKM A;  3JVT B;  3OB1 B;  1AOT F;  3S9K A;  2MBX A;  2BKH B;  1WDC C;  1TCF A;  1CWE A;  2LMU A;  2VIF A;  1ODB A;  2M1K B;  4JWQ A;  3IMD A;  1GJY A;  1JFK A;  2F8P A;  5CSI A;  3HX4 A;  1WLM A;  2BBU A;  3AAJ A;  3QWX X;  4WQ2 A;  1CWD L;  4WQ3 A;  3LLE A;  1XA5 A;  1REC A;  3TDU A;  1BFJ A;  2KI4 B;  2EYZ A;  1B8R A;  1LUK A;  4GFT A;  2KI4 C;  1KK8 C;  1G4Y R;  4C0J A;  2H8H A;  3TKZ A;  1K9A A;  3SG3 A;  3MXY A;  5DC4 A;  1Y57 A;  1M27 A;  3GOF A;  5I2O A;  1AYB A;  3SJS A;  1NIW A;  1QAT A;  3CTN A;  1B7T Z;  4PDZ A;  2L3T A;  1ZMZ A;  2LMT A;  1HCT B;  2JT8 A;  1DGV A;  1IKU A;  1ZFP E;  1SHD A;  1OMV A;  2JRF A;  1J7O A;  1A09 A;  3RLZ A;  4C0K A;  3PJP A;  4EY0 A;  1KQM B;  3IQO A;  1EL4 A;  4YGC B;  2OS8 C;  1F71 A;  2KNO A;  2WCF A;  1Y1U A;  1TRF A;  2YSX A;  1SRA A;  3I5I C;  4LUE A;  1YUR A;  1SPS A;  2I94 A;  1PAL A;  1JYR A;  2HDV A;  3OVE A;  2EHB A;  1OOJ A;  1OE9 B;  1SBJ A;  4BY4 A;  1AK8 A;  2EKX A;  2ZFD A;  4A4B A;  2H5K A;  1WY9 A;  4F0Z B;  1BT6 A;  2LUC A;  3SG6 A;  2E6W A;  2IUH A;  1A03 A;  3N7Y A;  2YU7 A;  3TUY C;  2I2R E;  3CR2 A;  3SG5 A;  1SMG A;  3PLF B;  1DJH A;  1OQP A;  4PCW A;  2K8M B;  4I5N B;  4XJK A;  1AB2 A;  2EC6 C;  2CBL A;  4ZCV A;  1S6I A;  3SG7 A;  1MIL A;  1X02 A;  1D4T A;  1BHH A;  2MRK A;  4YRU A;  1QTX A;  2WC8 A;  3I5G B;  5EG3 B;  1A4P A;  2QPT A;  4YBH B;  1R6P A;  1O4J A;  1K8U A;  2EO6 A;  3I5F B;  1S36 A;  2DOQ A;  1O46 A;  4K2R A;  3CGA A;  3NSL A;  4MBE A;  5IBW A;  2I7A A;  1JU5 A;  3VRN A;  3US4 A;  1YUS A;  1XFU O;  2QMS A;  1BLQ A;  2M9G A;  2MRJ A;  2L4H A;  1QX2 A;  2NXQ A;  4A4C A;  4Q04 A;  1BG1 A;  2L50 A;  1YUU A;  1BKL A;  2MHH A;  1CLL A;  3KF9 A;  1FI6 A;  1CDP A;  1BFI A;  1ZFS A;  4OHH A;  1DJG A;  3IN7 A;  5EHP A;  2PVB A;  1M63 B;  4CFQ A;  3VRZ A;  2LVV A;  1JF2 A;  1HT9 A;  2PRU A;  3EK4 A;  3EK8 A;  3VRY A;  1CMG A;  1NWD A;  1UUR A;  1QJT A;  2PNB A;  1DJX A;  4MZK A;  1QIV A;  1YX8 A;  2KAV A;  1YTZ C;  3D0Y B;  4M2P A;  5DKR A;  1JWO A;  1AHR A;  1SL8 A;  3PFV A;  1DJY A;  3LCP C;  3A4U B;  3AKB A;  2LLU A;  1CFF A;  2B1U A;  2KGR A;  2ROR A;  4L1B B;  2L5X B;  1FPW A;  1KA6 A;  1B9A A;  5I2Q A;  3VGO A;  3OV1 A;  2L51 A;  2EGD A;  4E93 A;  2RGI A;  1B1G A;  1CM4 A;  5ER4 X;  1AJ4 A;  2C9W A;  2SRC A;  3CD3 A;  4GAO A;  3PSJ A;  2KGB C;  4N5X A;  1GGZ A;  2HMH A;  1Q80 A;  3VS6 A;  4HRG A;  2EC6 B;  1A1C A;  2MC1 A;  1PVA A;  2CXJ A;  3T04 A;  2K2A A;  2AUC A;  2LQW A;  3MAZ A;  5CSJ A;  4GBA A;  2M1U A;  1S6J A;  1XFW O;  3KO0 A;  3WHT B;  3WXA A;  2DCR A;  2K7A B;  4K45 A;  5I2L A;  3CS1 A;  4CLN A;  1BOD A;  3D0Y A;  4HRE E;  1CLM A;  2V53 A;  4MZJ A;  5PAL A;  1O41 A;  4OHI A;  3NSO A;  1LIN A;  2HQ8 A;  4XYN A;  2GSB A;  3TL0 A;  1H9O A;  2QAC A;  1FW4 A;  2KAY A;  3FIA A;  5IBS A;  1TNX A;  4QSY A;  2ABL A;  1PK0 D;  1RPY A;  3KHE A;  2KFG A;  2BKI B;  3OX5 A;  5EEL A;  1O4O A;  1NRV A;  2JU0 A;  1YUT A;  4DUQ A;  5CSN A;  1TNW A;  1MWN A;  2TN4 A;  2Y4Q A;  3MSE B;  1AP4 A;  4OHL A;  1WQU A;  3CBL A;  2M49 B;  2LQN A;  3BUN B;  1IG5 A;  1C7W A;  2HDX A;  2BE6 A;  2LC5 A;  1K94 A;  2Y5I A;  1LUN A;  1NUB A;  2G2B A;  1AJ5 A;  2JC2 A;  3DVK A;  5HKW A;  2KAX A;  5KSZ A;  4P5O E;  4AQI A;  1TCO B;  2JTT A;  3WNX B;  1CSZ A;  4UPG A;  2CI8 A;  2DLZ A;  2OS8 B;  2GGM A;  1SKT A;  2MA2 A;  2CS0 A;  2GE9 A;  3GQI B;  3PSK A;  2BBN A;  4E68 A;  4MRX A;  3SIA A;  2LVJ A;  1BM2 A;  3WHU B;  1RQQ C;  3SIB A;  1KSM A;  4YGA A;  1TN4 A;  3PQZ A;  2K61 A;  3F45 A;  3FWB A;  1J1E A;  2KI6 D;  1K96 A;  3NSI A;  1JWD A;  1B7T Y;  4GGN A;  2IUI A;  1LUI A;  1FBV A;  3VS4 A;  2I18 A;  1F1W A;  2L6K A;  1VRK A;  1JYU A;  1XVJ A;  2LVI A;  1SYM A;  1JSA A;  1IJR A;  1LKJ A;  2FO0 A;  1KSW A;  1UHJ A;  2K79 B;  3VS0 A;  1NX2 A;  3VRQ A;  1Y6W A;  4M2Q A;  4JPZ B;  4DS7 A;  4GNK B;  2COL B;  2KBI A;  4R1E A;  1GGW A;  2LLS A;  3DF0 A;  4YI8 A;  1AYD A;  1O4M A;  1O4C A;  2B3O A;  1RK9 A;  5IBM A;  1QV1 A;  2BEC A;  2G9B A;  2OTG C;  5F6T A;  1BMB A;  1CSY A;  1S3P A;  3C7I A;  3GXX A;  3JTD C;  1NCZ A;  1KQV A;  1M46 A;  2ISD A;  5AFP A;  5JOL A;  3CR4 X;  4DIR A;  2RVF A;  4BTF A;  2EYY A;  2M29 A;  1QVI Y;  3IF7 A;  1WRK A;  4CID A;  1MUX A;  1PSR A;  1U5I B;  3UF4 A;  4JEG A;  2C0I A;  4XZ1 A;  3E3R A;  1CDM A;  5HKZ A;  3EAZ A;  4EIH A;  3BUM B;  4HSZ A;  1CFP A;  2DLY A;  1BJF A;  4QJ5 B;  1Y1X A;  1DF0 B;  3SG4 A;  4DCK A;  4PE4 A;  1O4N A;  1O4L A;  2MRD A;  1BU3 A;  2LP3 A;  2EU0 A;  2KQY A;  3PN7 C;  2HCK A;  1F70 A;  3AAK A;  1B8C A;  1UWO A;  3PN7 B;  4FTG A;  2FCE A;  4ICB A;  4ORA B;  4L9M A;  1DMO A;  1SNL A;  1ALV A;  4NWG A;  2PLE A;  4GWF A;  1SHA A;  3K2M A;  2EL8 A;  4ORC B;  4FL3 A;  2JUL A;  5K89 A;  1DTL A;  4N1F A;  1IH0 A;  2AOB A;  4D1E A;  1RTP 1;  1IJ6 A;  1WLZ A;  2LV7 A;  1OZO A;  5JJG A;  1BOC A;  1JFJ A;  4JGH A;  2KOT A;  1Y0V H;  2MK2 A;  1NPQ A;  1F55 A;  1YRU B;  1BLJ A;  3OP0 A;  3TZ1 A;  1BHF A;  3K21 A;  1AUI B;  4U8D A;  2MQI A;  2O60 A;  1DF0 A;  4DRW A;  3PS5 A;  1OZS A;  4C0L A;  1SW8 A;  1SR6 B;  2HET A;  1QX5 B;  1V1F A;  2LE9 B;  1QLS A;  2OTG B;  1MQ1 A;  1IS0 A;  1LUM A;  3VS7 A;  3WA4 A;  1LA0 A;  3I5I B;  1C7V A;  1TOP A;  4F59 A;  5B8I B;  2ZKM X;  1XK4 A;  1FBZ A;  2M7N A;  2BCB A;  1YX7 A;  4I5K A;  5AUL A;  2KI6 C;  5D7F A;  3EVU A;  5HKY A;  4NWF A;  1M45 A;  2BL0 B;  2H2K A;  2AUG A;  4NQG A;  2M3W A;  3ICB A;  3SG2 A;  2PNA A;  1S1E A;  3OX6 A;  2O5G A;  1GQM A;  2MLE C;  1IQ5 A;  1QIW A;  3BUO B;  1FU6 A;  2SHP A;  3HHM B;  3KPX A;  3TS5 C;  2ZN9 A;  1OO3 A;  2K2F A;  2JOJ A;  1IQ3 A;  1MHO A;  4F5B A;  2DVJ A;  1KWO C;  1WRZ A;  2HQW A;  1RWY A;  3EKH A;  4NDC A;  1O4K A;  1X6C A;  2PAS A;  2JT0 A;  1YVH A;  2GGZ A;  1KC2 A;  1KK7 Z;  1XA6 A;  3EK7 A;  4H34 A;  4U17 A;  4K11 A;  1FHS A;  4IL1 A;  5FYX A;  3BOW B;  1NZL A;  2BCX A;  4BY5 A;  5BPJ A;  1H4B A;  1JUO A;  2JT3 A;  3LL8 B;  1K95 A;  4YGB B;  2LVK A;  1J1D A;  1CM1 A;  1XFZ O;  1AYA A;  1JF0 A;  1IWQ A;  1A75 B;  1YVL A;  2BBM A;  3FWC A;  4TNC A;  2FOT A;  1R1Q A;  2ETZ A;  2C0T A;  1SKJ A;  3AKA A;  2FCD A;  4PHJ A;  1LKK A;  1LCJ A;  5KTY A;  1O4A A;  2CRH A;  4LUD A;  1NZV A;  1O49 A;  4GGF C;  2MJW B;  4I5J A;  4XJK B;  1TZE E;  4OHE A;  1G8I A;  1P13 A;  2K7C A;  3LK0 A;  3M0W A;  2LP2 A;  4P2Y B;  1S26 D;  1W7J B;  2LHI A;  1A2X A;  1B47 A;  3LK1 A;  2HF5 A;  2C0O A;  1KSO A;  3BQ3 A;  1RJA A;  4YGE B;  1DVI A;  5D0J A;  1OMD A;  4QJ4 B;  3BOW A;  4PHK A;  2PAL A;  2EO3 A;  1S6C A;  3EVV A;  4OCI A;  1L2O B;  1O4G A;  4OV2 A;  2DX0 A;  1PIC A;  1EH2 A;  4M4Z A;  1IRJ A;  1ZOT B;  4PE7 A;  1X27 A;  4X6S A;  1O4R A;  2KK6 A;  3GXW A;  1A75 A;  1XFX O;  1F8H A;  3CXL A;  1UP5 A;  3KEV A;  2H61 A; 
#chains in the Genus database with same CATH topology
 3DY9 A;  3FED A;  1CLB A;  4ZCU A;  3R1V A;  4TZI A;  1K9P A;  3QME A;  4GUK A;  2C6P A;  3FE8 A;  2IS9 A;  5I6V A;  1HQV A;  1NYA A;  1BR4 B;  1OSA A;  3ZNI A;  3JVT C;  4YGD B;  2ZNE A;  3I5F C;  4OVN F;  3BXK A;  2NCO A;  2E30 A;  3DXL A;  1UHN A;  2L4I A;  2LNW A;  1R2U A;  4DGX A;  4M2O A;  4BPU B;  1ALW A;  5KAZ A;  1B8L A;  1EG4 A;  1O4B A;  4PHM A;  5CSF A;  2LLT A;  1UHH A;  1B4C A;  1CMF A;  2KDH A;  4CFR A;  4I5L B;  2LHL A;  2MLF C;  3SS5 A;  1C07 A;  2KYC A;  1X0N A;  1JYQ A;  3LYV A;  1M39 A;  1SCV A;  2JQ6 A;  5DIC A;  5DC9 A;  3ZWH A;  1NX1 A;  4KYN A;  1DQE A;  2LAP A;  4MRY A;  2KNE A;  2CIA A;  3BYA A;  2LNX A;  2F3Z A;  2K7B A;  1A08 A;  1GRI A;  4P44 A;  1OO4 A;  2PTK A;  3CLN A;  2PVV A;  2WCM A;  2F33 A;  2NLN A;  3BI0 A;  5I8N A;  1XO5 A;  2AAO A;  1DJW A;  1AOU F;  4FBN A;  4QJ3 B;  4D8K A;  3H4S E;  1K9U A;  2A4J A;  3R1O A;  2F2P A;  4GPL B;  1A81 A;  1A07 A;  1EXR A;  4OC5 A;  3TDZ A;  1TCE A;  2D8N A;  3NFQ A;  1BLK A;  3BUW B;  4WRI A;  2P6B B;  3S8L A;  1NP8 A;  3K1E A;  3BHX A;  1I3Z A;  3SJX A;  1R1P A;  5FI6 A;  2XEF A;  3TDI A;  4FL2 A;  1QV0 A;  4ROJ A;  3D10 A;  2WOR A;  2FJU B;  2K7D A;  4PAL A;  3FEE A;  1O48 A;  3I5H C;  3DVM A;  3I5H B;  5DKQ A;  2VKZ G;  3NXA A;  3D76 A;  2RSY A;  5TNC A;  4JE4 A;  3PAT A;  2OQ1 A;  4INX A;  3UYO A;  1SHB A;  1CNP A;  1AOT F;  4P4F A;  1DEL A;  1WDC C;  1CWE A;  1ODB A;  2BBU A;  4WQ3 A;  3D7D A;  1XA5 A;  1BFJ A;  1B8R A;  4C0J A;  3TKZ A;  5DC4 A;  1M27 A;  2JT8 A;  2JRF A;  3IQO A;  2KNO A;  1TRF A;  3I5I C;  1PAL A;  2HDV A;  2ZFD A;  4A4B A;  4OC3 A;  3PLF B;  1DJH A;  4I5N B;  2EC6 C;  2CBL A;  5F09 A;  2XPL A;  1MIL A;  1QTX A;  2WC8 A;  1O4J A;  1O46 A;  3L4A A;  1BLQ A;  2MRJ A;  1QX2 A;  2NXQ A;  4A4C A;  4Q04 A;  1BG1 A;  1BKL A;  1BFI A;  2PVB A;  1HT9 A;  3EK4 A;  1NWD A;  1QWV A;  1QJT A;  1DJX A;  3IVT A;  1YTZ C;  5DKR A;  5F13 A;  5I94 A;  3PFV A;  5I2Q A;  3VGO A;  2EGD A;  1AJ4 A;  3CD3 A;  4RR2 B;  4GAO A;  3PSJ A;  3VS6 A;  2CXJ A;  2LQW A;  1S6J A;  3KO0 A;  1BOD A;  4OC1 A;  1W9Z A;  2GSB A;  1H9O A;  5IBS A;  2ABL A;  1PK0 D;  1RPY A;  3KHE A;  1O4O A;  1YUT A;  1AP4 A;  3MSE B;  4OHL A;  5FI2 A;  2M49 B;  2HDX A;  4LQG A;  2BE6 A;  1K94 A;  4MCP A;  2G2B A;  1LUN A;  2KAX A;  1TCO B;  3WNX B;  2GE9 A;  3PSK A;  2BNX A;  3WHU B;  1TN4 A;  3F45 A;  3FWB A;  3NSI A;  2IUI A;  2LVI A;  1SYM A;  2FO0 A;  1KSW A;  2K79 B;  3VS0 A;  1Y6W A;  2KBI A;  1O4M A;  1GGW A;  5IBM A;  2B3O A;  2OTG C;  1BMB A;  1KQV A;  5AFP A;  2EYY A;  1QVI Y;  3BUM B;  4HSZ A;  1BJF A;  4QJ5 B;  3SG4 A;  3CYZ A;  2LP3 A;  3PN7 C;  1F70 A;  4ORA B;  3CZ0 A;  4FL3 A;  4NGS A;  1DTL A;  1IH0 A;  1RTP 1;  4JGH A;  3BXM A;  3TZ1 A;  1BHF A;  1AUI B;  4U8D A;  2MQI A;  4DRW A;  1OZS A;  3UF4 A;  1QX5 B;  1LUM A;  1MQ1 A;  3I5I B;  2ZKM X;  5D7F A;  4NWF A;  2H2K A;  2M3W A;  3ICB A;  2P70 A;  2O5G A;  1GQM A;  1FU6 A;  4F5B A;  1X6C A;  1RWY A;  1XA6 A;  4H34 A;  4K11 A;  3BOW B;  1NZL A;  2BCX A;  4BY5 A;  3LL8 B;  1J1D A;  1AYA A;  2BBM A;  3FWC A;  5FI7 A;  1SKJ A;  4OME A;  4PHJ A;  1OOI X;  1LKK A;  1NZV A;  1O49 A;  1P13 A;  2K7C A;  3LK0 A;  3FF3 A;  1W7J B;  1A2X A;  2C0O A;  1DVI A;  4OCI A;  1IRJ A;  1ZOT B;  2QEO A;  2PQL A;  3GXW A;  1XFX O;  1J7P A;  4GL9 E;  1SPR A;  3EVR A;  3B7A A;  3B87 A;  3IMJ A;  4GGF A;  3UO9 A;  1KCY A;  5CPV A;  1DJI A;  2UV8 G;  1F4O A;  3QWY A;  2KSP A;  1O4D A;  3MXC A;  1EG3 A;  1K93 D;  2L98 A;  2ZRT A;  2CTN A;  1WDC B;  1F4Q A;  4JQ0 D;  3V2L A;  2K7O A;  2H61 C;  1O4H A;  3RM1 A;  3VS2 A;  3FE9 A;  2M7L A;  3DVE A;  2JXC A;  2XEI A;  2KQ6 A;  3CWG A;  4JZ0 A;  2WCE A;  3NHN A;  1CTR A;  1OOH A;  1O4F A;  3R1P A;  4N1G A;  3NSK A;  3HCM A;  2L4K A;  2WCB A;  4P4B A;  2CT9 A;  4F5A A;  1MF8 B;  1CB1 A;  4NGN A;  3VS3 A;  4AOM A;  5AER A;  3D73 A;  3EKJ A;  2SAS A;  4HRH A;  2QEB A;  3GK4 X;  2KBM A;  3N84 A;  1SCM B;  1UHK A;  1BR1 B;  2L2E A;  1TIZ A;  2NCP A;  4FQO A;  1A1A A;  2ZN8 A;  2OOT A;  5G08 A;  2WOS A;  3HCK A;  3F9K C;  1MXE A;  3L47 A;  2CR4 A;  2PMY A;  2L2C A;  3K2T A;  1J7Q A;  2MAZ A;  1E8A A;  5J3X A;  1KFU S;  1M61 A;  1ORG A;  3DD4 A;  1OW4 A;  3EG5 B;  2EOB A;  5ER5 A;  3GK2 A;  1PSB A;  4CPV A;  4OHD A;  1C3Y A;  1KFU L;  1KK7 Y;  1S5G Z;  3BI1 A;  3OB2 B;  1SCM C;  1IJ5 A;  1A29 A;  1QAS A;  4P9V A;  3RZS A;  1N65 A;  1CKK A;  1K9K A;  1NX3 A;  1H8B A;  2KFF A;  2RMX A;  1OPL A;  2IUG A;  1KK8 B;  3GK1 A;  2CCM A;  3DVJ A;  2AOA A;  1PRW A;  3VS1 A;  4MN0 A;  2M97 A;  1HCS B;  2R2I A;  1J7R A;  2PLD A;  1QAD A;  1RFJ A;  1G83 A;  5GQQ C;  4MEW A;  2LMV A;  1QCF A;  2Y1M A;  3EAC A;  3PSR A;  1SL9 A;  2BCA A;  1KWO B;  1TNP A;  1DC1 A;  3S8N A;  4MLW A;  1BKM A;  3OB1 B;  2VIF A;  2M1K B;  4JWQ A;  3IMD A;  3HX4 A;  4INW A;  3AAJ A;  1CWD L;  3LLE A;  1REC A;  2H8H A;  2C6C A;  1Y57 A;  1AYB A;  1NIW A;  3CTN A;  2L3T A;  1ZMZ A;  1SHD A;  4EY0 A;  3KAS A;  1KQM B;  4YGC B;  2WCF A;  3O4X A;  2I94 A;  1JYR A;  1OOJ A;  1SBJ A;  2H5K A;  4F0Z B;  1BT6 A;  1A03 A;  2I2R E;  3CR2 A;  3SG5 A;  1AB2 A;  1OQP A;  2K8M B;  1X02 A;  2MRK A;  3I5G B;  2L5Y A;  2QPT A;  4YBH B;  1S36 A;  2DOQ A;  1JU5 A;  5IBW A;  3US4 A;  2WCL A;  3VRN A;  1XFU O;  2QMS A;  2OR4 A;  2M9G A;  2MHH A;  1CLL A;  1CDP A;  1ZFS A;  3IN7 A;  4P45 A;  4CFQ A;  3VRZ A;  2LVV A;  1JWO A;  3LCP C;  3A4U B;  2LLU A;  2B1U A;  4NGP A;  2L5X B;  1FPW A;  4E93 A;  2C9W A;  2SRC A;  2KGB C;  1Q80 A;  4HRG A;  3T04 A;  5CSJ A;  4GBA A;  2M1U A;  2XPN A;  3WXA A;  3WHT B;  3CS1 A;  4CLN A;  1O41 A;  3IWW A;  5GJH A;  2BAP A;  3TL0 A;  3BFA A;  1P28 A;  1FW4 A;  4X3R A;  3FIA A;  3RBU A;  5CSN A;  2C6G A;  1WQU A;  1C7W A;  2LC5 A;  2JC2 A;  5HKW A;  4AQI A;  2BBN A;  4MRX A;  3SIA A;  1TUJ A;  1K96 A;  1B7T Y;  2I18 A;  2L6K A;  1VRK A;  3U88 C;  1JSA A;  1LKJ A;  3BFB A;  1UHJ A;  3VRQ A;  4M2Q A;  4JPZ B;  4GNK B;  2COL B;  4R1E A;  3S8O A;  4YI8 A;  2GTE A;  2G9B A;  1DEK A;  1CSY A;  1NCZ A;  3IF7 A;  1WRK A;  1U5I B;  2C0I A;  4XZ1 A;  4DCK A;  4NGT A;  4PE4 A;  1O4N A;  1O4L A;  1BU3 A;  2EU0 A;  3B88 A;  3PN7 B;  1DMO A;  4ICB A;  4L9M A;  1SNL A;  4NWG A;  3K2M A;  4ORC B;  5K89 A;  4N1F A;  3S0A A;  3Q8I A;  1JFJ A;  3OGN A;  1NPQ A;  2WCH A;  1YRU B;  1BLJ A;  3PS5 A;  1SR6 B;  2LE9 B;  3VS7 A;  1IS0 A;  3WA4 A;  1C7V A;  1FBZ A;  1YX7 A;  4I5K A;  3S0F A;  2KI6 C;  2BL0 B;  1S1E A;  3OX6 A;  3KPX A;  2ZN9 A;  2K2F A;  2JOJ A;  2WCK A;  1WRZ A;  2HQW A;  3EKH A;  1Z9E A;  1JUO A;  4YGB B;  1CM1 A;  4NGM A;  2FOT A;  2FCD A;  5KTY A;  4GGF C;  4I5J A;  4XJK B;  4OHE A;  3M0W A;  4P2Y B;  1S26 D;  3D77 A;  4FQT A;  5D3O A;  3BOW A;  4PHK A;  2EO3 A;  1S6C A;  2DX0 A;  3NGV A;  3SJF A;  3CDN A;  4X6S A;  1O4R A;  1F8H A;  3CXL A;  3KEV A;  1O4P A;  1LA3 A;  2KYF A;  1SK6 D;  3VRO A;  3CZT X;  2JPT A;  1EJ3 A;  1RJV A;  1CFC A;  4H1O A;  1AYC A;  1AD5 A;  3QRX A;  1R1S A;  1YRT B;  5DKN A;  2LCP A;  1TTX A;  4USL A;  3IQQ A;  1O47 A;  1QG1 E;  1GHU A;  2JTZ A;  3PJI A;  5AXI A;  1FI5 A;  4AQJ A;  2EYV A;  1JC2 A;  1D1Z A;  1D4W A;  2CIJ A;  2KHN A;  3DYE A;  1A1B A;  2FCI A;  3N8M A;  3HIZ B;  2JNX A;  1WJT A;  2L0P A;  5EHR A;  3FS7 A;  2HUW A;  2SCP A;  2VRG A;  1AVS A;  2AMI A;  1K90 D;  5AEQ A;  2CNP A;  4PE0 A;  4YI9 A;  5HLO A;  5D69 A;  1BF5 A;  1L7Z A;  2LNK A;  3S9N A;  1NCY A;  4XZ0 A;  3D7F A;  2IZV A;  1OPK A;  5DC0 B;  4DGP A;  2XEJ A;  1PUL A;  3PM2 A;  1TNQ A;  2KLE A;  5HLV A;  2N3A B;  1D1O A;  3O6B A;  3O78 A;  2LAN A;  4NDD A;  2WC5 A;  1ZUZ A;  1O43 A;  1M31 A;  2JZI A;  2LUX A;  2XPO A;  1UUS A;  3O4Y A;  2KLD A;  4MSP A;  4NDB A;  1NSH A;  4MVF A;  1O44 A;  2XP1 A;  2GV5 A;  1YR5 A;  1T14 A;  1PVB A;  1G33 A;  1KFX S;  3CZ2 A;  1O4I A;  1QVI Z;  1IGV A;  3M7F A;  1WRL A;  1XFY O;  2K0J A;  1FU5 A;  2ZND A;  3A8R A;  2KFH A;  4U1P A;  4OR9 B;  3VRP A;  5DF6 A;  3D75 A;  1KQM C;  2PSR A;  1DJZ A;  2WC6 A;  2M8U A;  2LM5 A;  3TS5 B;  3CR5 X;  3BFH A;  5EEQ A;  4JKT A;  2LRA A;  3BKB A;  2MBX A;  2BKH B;  2LMU A;  1GJY A;  1JFK A;  5CSI A;  1WLM A;  4WQ2 A;  3TDU A;  2KI4 B;  1LUK A;  1KK8 C;  1G4Y R;  1K9A A;  3SG3 A;  5I2O A;  1B7T Z;  2LMT A;  1Z2C B;  1HCT B;  3B6X A;  3RLZ A;  1Z8L A;  4C0K A;  3PJP A;  3NHT A;  2OS8 C;  1F71 A;  1Y1U A;  1SRA A;  4LUE A;  3SJG A;  3OVE A;  3FEC A;  1OE9 B;  4BY4 A;  1AK8 A;  2QEH A;  2LUC A;  3SG6 A;  2E6W A;  3N7Y A;  1OOF A;  3TUY C;  4XJK A;  1D4T A;  1BHH A;  2B4J C;  4MCS A;  1A4P A;  2EO6 A;  3I5F B;  4K2R A;  3CGA A;  2I7A A;  1YUS A;  5ELY A;  2L4H A;  5EL2 A;  2L50 A;  3KF9 A;  3S9M A;  4OHH A;  1M63 B;  1JF2 A;  3EK8 A;  2PNB A;  4MZK A;  1YX8 A;  4M2P A;  3DZT A;  1AHR A;  1SL8 A;  1CFF A;  2KGR A;  4L1B B;  1B9A A;  3OV1 A;  2L51 A;  2RGI A;  1DE4 C;  1CM4 A;  5ER4 X;  2AUC A;  3MAZ A;  2DCR A;  4K45 A;  3D0Y A;  4HRE E;  1CLM A;  5PAL A;  4NGR A;  4OHI A;  3NSO A;  1LIN A;  2HQ8 A;  3S0G A;  4PT1 A;  2BKI B;  1GM0 A;  5EEL A;  2JU0 A;  3PT1 A;  2Y4Q A;  2LQN A;  1IG5 A;  1AJ5 A;  5KSZ A;  5D29 A;  4P5O E;  2CI8 A;  2JTT A;  4UPG A;  2GGM A;  4OZD A;  4E68 A;  1BM2 A;  1RQQ C;  3SIB A;  1KSM A;  4YGA A;  2KGY A;  2KI6 D;  1JWD A;  4GGN A;  1LUI A;  1FBV A;  3VS4 A;  1F1W A;  1JYU A;  2YGU A;  1XVJ A;  4OC4 A;  1NX2 A;  1TWO A;  1O4C A;  1QV1 A;  5F6T A;  1S3P A;  3C7I A;  3GXX A;  4DIR A;  4BTF A;  3S0B A;  4CID A;  1MUX A;  1PSR A;  3E3R A;  1CDM A;  4EIH A;  1CFP A;  2DLY A;  1DF0 B;  2HCK A;  3AAK A;  1UWO A;  4FTG A;  3CAB A;  2PLE A;  4GWF A;  2EL8 A;  1WLZ A;  5JJG A;  4IJ7 A;  2KOT A;  1Y0V H;  3K21 A;  2O60 A;  1V1F A;  2HET A;  1QLS A;  1LA0 A;  3VB1 A;  2BCB A;  3EVU A;  2AUG A;  3S9L A;  4NQG A;  3SG2 A;  2PNA A;  3HHM B;  1IQ5 A;  1QIW A;  2WCJ A;  3BUO B;  2SHP A;  1OO3 A;  1IQ3 A;  1MHO A;  2DVJ A;  4NDC A;  1O4K A;  2JT0 A;  2GGZ A;  1KC2 A;  1KK7 Z;  3EK7 A;  4U17 A;  4MCR A;  2JT3 A;  1K95 A;  1IWQ A;  1YVL A;  1R1Q A;  2C0T A;  1TZE E;  2MJW B;  2LHI A;  1B47 A;  3LK1 A;  2HF5 A;  1KSO A;  1RJA A;  4YGE B;  4QJ4 B;  1O4G A;  1L2O B;  1PIC A;  1EH2 A;  4M4Z A;  1X27 A;  1A75 A;  1FYR A;  1JBA A;  1KFX L;  4K44 A;  1CJ1 A;  3O8Z A;  1U5I A;  4JYW A;  2BE4 A;  4PE1 A;  1J55 A;  1CDN A;  4JD9 A;  3S0D A;  1V1G A;  1Y1A A;  1A1E A;  1SSE B;  2JYQ A;  1SY9 A;  1W7I B;  3C1V A;  4ETO A;  2ECD A;  2PYQ A;  3SJE A;  1ZAC A;  4PHN A;  4WWQ A;  1MR8 A;  3IN8 A;  1BHH B;  2Y3A B;  1K2H A;  3BUX B;  5BO4 A;  2CI9 A;  3D78 A;  1MXL C;  1F54 A;  1NCX A;  2QEV A;  2NZ0 A;  3KFJ A;  1XK4 C;  1LCK A;  3VRR A;  3D7H A;  1FMK A;  1QS7 A;  2HPS A;  4OC2 A;  1O4E A;  3TUY B;  4P4D A;  1IIO A;  3S0E A;  1DT7 B;  2ZRS A;  2WND A;  2PVW A;  1S5G Y;  4MZL A;  3SS4 A;  2JBK A;  2DM0 A;  3OHM B;  2Q4U A;  2JBJ A;  5KU1 A;  3DF0 B;  1CDL A;  1Z4H A;  1QLK A;  1XYD A;  1MW4 A;  4P9Z A;  1L2O C;  4W9Y A;  1KA7 A;  3VS5 A;  1N2D A;  2M0R A;  4P4J A;  4OKH A;  1CFD A;  3OAK A;  1O45 A;  1UHI A;  2JXL A;  1SL7 A;  5CDW A;  2OZO A;  2LCT A;  4ORB B;  3O2P A;  1FF1 A;  1O42 A;  5GJI A;  1Z3K A;  2F3Y A;  1QX7 A;  3N7H A;  1QXP A;  3R72 A;  2OPO A;  1LXF C;  2H8V A;  3D7G A;  3NHI A;  1LKL A;  1F2F A;  3PAL A;  1N0Y A;  1OMR A;  2P71 A;  1SR6 C;  3PM8 A;  2F2O A;  4P4E A;  5HYD A;  1XFV O;  2Q91 A;  2Y1N A;  2BL0 C;  1SPY A;  1O4Q A;  1BMO A;  5AAN A;  2JNF A;  3JTD B;  1LVC D;  1DGU A;  1NX0 A;  1RRO A;  3I5G C;  2JWW A;  3JVT B;  2XPP A;  3S9K A;  1TCF A;  2FJY A;  2F8P A;  3QWX X;  3HPG G;  2EYZ A;  4GFT A;  2KI4 C;  3MXY A;  3GOF A;  3SJS A;  1QAT A;  4PDZ A;  1DGV A;  1IKU A;  1ZFP E;  1OMV A;  1J7O A;  1A09 A;  1EL4 A;  2YSX A;  1YUR A;  1SPS A;  2EKX A;  2EHB A;  1WY9 A;  2IUH A;  2YU7 A;  1SMG A;  4PCW A;  4ZCV A;  1S6I A;  3SG7 A;  4YRU A;  5EG3 B;  1R6P A;  1K8U A;  3NSL A;  4MBE A;  1CX8 A;  1YUU A;  1TUZ A;  1FI6 A;  1DJG A;  5EHP A;  2PRU A;  1LS8 A;  3VRY A;  1CMG A;  1UUR A;  1QIV A;  2KAV A;  3D0Y B;  1DJY A;  2QDI A;  4NGQ A;  3AKB A;  2ROR A;  1B1G A;  4P4I A;  4N5X A;  1GGZ A;  2HMH A;  2EC6 B;  1A1C A;  2MC1 A;  1PVA A;  2K2A A;  1XFW O;  2K7A B;  5I2L A;  2DLA A;  4MZJ A;  2V53 A;  4XYN A;  2QAC A;  2KAY A;  1EO0 A;  1TNX A;  4QSY A;  2KFG A;  3OX5 A;  1NRV A;  4DUQ A;  1TNW A;  1MWN A;  2TN4 A;  3CBL A;  3BUN B;  2Y5I A;  1NUB A;  3CZ1 A;  3DVK A;  1KA6 A;  1CSZ A;  2DLZ A;  2OS8 B;  1SKT A;  2MA2 A;  2CS0 A;  3GQI B;  2XEG A;  3UNW A;  2LVJ A;  5HL1 A;  3PQZ A;  2K61 A;  4MCQ A;  1J1E A;  1OOG A;  1IJR A;  2KPH A;  2LLS A;  3DF0 A;  1AYD A;  1RK9 A;  1C3Z A;  2BEC A;  3L4L A;  3JTD C;  1M46 A;  2JPO A;  2ISD A;  5JOL A;  3CR4 X;  2RVF A;  2M29 A;  4JEG A;  5HKZ A;  3EAZ A;  1Y1X A;  2MRD A;  4OC0 A;  2KQY A;  3BJH A;  1B8C A;  2FCE A;  1ALV A;  1SHA A;  2JUL A;  3HPH E;  2AOB A;  4D1E A;  1IJ6 A;  2LV7 A;  1OZO A;  1BOC A;  3HMJ G;  2MK2 A;  3FE6 A;  3OBV A;  1F55 A;  3OP0 A;  4F7F A;  1DF0 A;  4DS7 A;  4C0L A;  1SW8 A;  2OTG B;  1TOP A;  4F59 A;  5B8I B;  1XK4 A;  2M7N A;  5AUL A;  5HKY A;  1M45 A;  2ERB A;  2MLE C;  3TS5 C;  3D74 A;  1KWO C;  2PAS A;  1YVH A;  1FHS A;  4IL1 A;  1XFR A;  5FYX A;  5BPJ A;  1H4B A;  2LVK A;  2K60 A;  1XFZ O;  1JF0 A;  3SS3 A;  1A75 B;  4TNC A;  3B86 A;  2ETZ A;  3AKA A;  1LCJ A;  1O4A A;  2CRH A;  4LUD A;  5BY0 A;  1G8I A;  2LP2 A;  4BPW B;  5D0J A;  3BQ3 A;  1OMD A;  2PAL A;  3EVV A;  4OV2 A;  4PE7 A;  2KK6 A;  4BPX B;  1UP5 A;  2H46 E;  2H61 A; 
#chains in the Genus database with same CATH homology
 1FYR A;  1J7P A;  4GL9 E;  1SPR A;  3EVR A;  1O4P A;  1JBA A;  1KFX L;  4ZCU A;  1CLB A;  4K44 A;  1LA3 A;  4TZI A;  1K9P A;  1CJ1 A;  3IMJ A;  2KYF A;  4GGF A;  1KCY A;  1SK6 D;  3VRO A;  5CPV A;  4GUK A;  1U5I A;  1DJI A;  3CZT X;  2IS9 A;  1F4O A;  5I6V A;  1HQV A;  3S8O A;  2BE4 A;  2JPT A;  2KSP A;  1NYA A;  4PE1 A;  1O4D A;  1EG3 A;  1BR4 B;  1J55 A;  1K93 D;  1OSA A;  2L98 A;  1CDN A;  3MXC A;  1V1G A;  1Y1A A;  2ZRT A;  3ZNI A;  2CTN A;  1EJ3 A;  1RJV A;  3JVT C;  4YGD B;  1CFC A;  2ZNE A;  3I5F C;  4H1O A;  1WDC B;  1A1E A;  1AYC A;  4OVN F;  2JYQ A;  1F4Q A;  3BXK A;  1SY9 A;  1W7I B;  1AD5 A;  2NCO A;  3QRX A;  1R1S A;  3QWY A;  3C1V A;  4ETO A;  4JQ0 D;  2K7O A;  1YRT B;  5DKN A;  2H61 C;  2E30 A;  1O4H A;  2ECD A;  3RM1 A;  3VS2 A;  2LCP A;  1ZAC A;  1UHN A;  1TTX A;  2L4I A;  2LNW A;  4USL A;  3IQQ A;  4PHN A;  4WWQ A;  1MR8 A;  1O47 A;  1R2U A;  2M7L A;  1QG1 E;  3DVE A;  3IN8 A;  4DGX A;  2JXC A;  1BHH B;  2KQ6 A;  4M2O A;  2Y3A B;  1K2H A;  1GHU A;  2JTZ A;  3CWG A;  3BUX B;  1ALW A;  5KAZ A;  5AXI A;  5BO4 A;  2WCE A;  2CI9 A;  1B8L A;  1EG4 A;  1CTR A;  1O4B A;  3NHN A;  1MXL C;  4PHM A;  5CSF A;  2LLT A;  1F54 A;  1NCX A;  1UHH A;  2NZ0 A;  1O4F A;  1FI5 A;  3KFJ A;  4N1G A;  1XK4 C;  3NSK A;  3VRR A;  4AQJ A;  1LCK A;  2EYV A;  3HCM A;  1JC2 A;  2L4K A;  1D1Z A;  2WCB A;  1D4W A;  1FMK A;  1B4C A;  2KHN A;  1QS7 A;  2HPS A;  1CMF A;  2KDH A;  1O4E A;  3TUY B;  2CT9 A;  1A1B A;  2FCI A;  1MF8 B;  4F5A A;  4CFR A;  1CB1 A;  3N8M A;  4I5L B;  3VS3 A;  2LHL A;  2MLF C;  4AOM A;  5AER A;  1DT7 B;  2JNX A;  1C07 A;  2KYC A;  3HIZ B;  2ZRS A;  1X0N A;  2WND A;  1S5G Y;  2L0P A;  3EKJ A;  4MZL A;  1JYQ A;  2SAS A;  2DM0 A;  1M39 A;  1SCV A;  5EHR A;  3FS7 A;  2JQ6 A;  4HRH A;  3OHM B;  3GK4 X;  2HUW A;  2Q4U A;  2KBM A;  2SCP A;  5DC9 A;  2VRG A;  3ZWH A;  3N84 A;  1SCM B;  1NX1 A;  1UHK A;  1BR1 B;  1AVS A;  2L2E A;  5KU1 A;  3DF0 B;  2AMI A;  1TIZ A;  1K90 D;  5AEQ A;  1CDL A;  2LAP A;  2CNP A;  2KNE A;  2NCP A;  4FQO A;  4MRY A;  3BYA A;  1A1A A;  1QLK A;  2CIA A;  2ZN8 A;  1XYD A;  5G08 A;  2F3Z A;  4PE0 A;  2WOS A;  4YI9 A;  1MW4 A;  2LNX A;  2K7B A;  5D69 A;  1L2O C;  5HLO A;  1MXE A;  1BF5 A;  1A08 A;  1L7Z A;  4P9Z A;  2CR4 A;  2LNK A;  1GRI A;  1NCY A;  2PMY A;  1KA7 A;  1J7Q A;  1OO4 A;  3VS5 A;  2MAZ A;  3CLN A;  2PTK A;  1E8A A;  4XZ0 A;  1N2D A;  1KFU S;  5J3X A;  2F33 A;  2M0R A;  2NLN A;  5I8N A;  1XO5 A;  2AAO A;  1DJW A;  4OKH A;  1CFD A;  1M61 A;  1AOU F;  2IZV A;  4FBN A;  1OPK A;  4QJ3 B;  3DD4 A;  4D8K A;  2EOB A;  1O45 A;  5DC0 B;  4DGP A;  5ER5 A;  3GK2 A;  3H4S E;  1PSB A;  1PUL A;  1SL7 A;  1UHI A;  2JXL A;  4CPV A;  5CDW A;  1K9U A;  2A4J A;  2OZO A;  1TNQ A;  2LCT A;  2H46 E;  2F2P A;  4GPL B;  5HLV A;  1A81 A;  4OHD A;  4ORB B;  1D1O A;  1A07 A;  1KFU L;  3O6B A;  1EXR A;  1KK7 Y;  3O2P A;  1S5G Z;  1FF1 A;  1O42 A;  3O78 A;  3TDZ A;  3OB2 B;  2LAN A;  4NDD A;  1TCE A;  2D8N A;  1ZUZ A;  1SCM C;  1IJ5 A;  1A29 A;  1QAS A;  1O43 A;  5GJI A;  4P9V A;  1M31 A;  2JZI A;  1BLK A;  2LUX A;  3HCK A;  1UUS A;  1N65 A;  3BUW B;  3O4Y A;  1Z3K A;  2F3Y A;  4WRI A;  2P6B B;  1CKK A;  1K9K A;  1QX7 A;  4MSP A;  1NX3 A;  4NDB A;  1H8B A;  3S8L A;  1QXP A;  1NP8 A;  1NSH A;  2KFF A;  4MVF A;  2RMX A;  1O44 A;  2XP1 A;  1I3Z A;  2GV5 A;  2OPO A;  1LXF C;  1OPL A;  2IUG A;  1KK8 B;  1YR5 A;  3GK1 A;  1R1P A;  3TDI A;  4FL2 A;  1PVB A;  1QV0 A;  1LKL A;  4ROJ A;  3D10 A;  2WOR A;  1G33 A;  1KFX S;  2CCM A;  1F2F A;  3PAL A;  3DVJ A;  2FJU B;  1O4I A;  2AOA A;  1QVI Z;  2K7D A;  1PRW A;  1IGV A;  1N0Y A;  1OMR A;  3M7F A;  1WRL A;  4PAL A;  1SR6 C;  1O48 A;  3PM8 A;  3VS1 A;  2F2O A;  3I5H C;  1XFY O;  2K0J A;  3DVM A;  4MN0 A;  2M97 A;  3I5H B;  1FU5 A;  1HCS B;  2ZND A;  5HYD A;  1XFV O;  3A8R A;  5DKQ A;  2KFH A;  2R2I A;  2Q91 A;  3NXA A;  4OR9 B;  4U1P A;  3VRP A;  1J7R A;  2Y1N A;  2BL0 C;  2PLD A;  1SPY A;  2RSY A;  1QAD A;  1O4Q A;  1BMO A;  5TNC A;  1RFJ A;  5DF6 A;  5AAN A;  1G83 A;  1KQM C;  2PSR A;  4JE4 A;  1DJZ A;  5GQQ C;  2JNF A;  5GJH A;  2M8U A;  4MEW A;  3PAT A;  2LM5 A;  3JTD B;  2OQ1 A;  1LVC D;  2LMV A;  3TS5 B;  2Y1M A;  1QCF A;  3EAC A;  3CR5 X;  3PSR A;  3UYO A;  1SL9 A;  5EEQ A;  2BCA A;  1DGU A;  1KWO B;  1NX0 A;  1SHB A;  1TNP A;  3BKB A;  1RRO A;  3I5G C;  1CNP A;  2JWW A;  3S8N A;  4MLW A;  1BKM A;  3JVT B;  3OB1 B;  1AOT F;  3S9K A;  2MBX A;  2BKH B;  1WDC C;  1TCF A;  1CWE A;  2LMU A;  2VIF A;  1ODB A;  2M1K B;  4JWQ A;  3IMD A;  1GJY A;  1JFK A;  2F8P A;  5CSI A;  3HX4 A;  1WLM A;  2BBU A;  3AAJ A;  3QWX X;  4WQ2 A;  1CWD L;  4WQ3 A;  3LLE A;  1XA5 A;  1REC A;  3TDU A;  1BFJ A;  2KI4 B;  2EYZ A;  1B8R A;  1LUK A;  4GFT A;  2KI4 C;  1KK8 C;  1G4Y R;  4C0J A;  2H8H A;  3TKZ A;  1K9A A;  3SG3 A;  3MXY A;  5DC4 A;  1Y57 A;  1M27 A;  3GOF A;  5I2O A;  1AYB A;  3SJS A;  1NIW A;  1QAT A;  3CTN A;  1B7T Z;  4PDZ A;  2L3T A;  1ZMZ A;  2LMT A;  1HCT B;  2JT8 A;  1DGV A;  1IKU A;  1ZFP E;  1SHD A;  1OMV A;  2JRF A;  1J7O A;  1A09 A;  3RLZ A;  4C0K A;  3PJP A;  4EY0 A;  1KQM B;  3IQO A;  1EL4 A;  4YGC B;  2OS8 C;  1F71 A;  2KNO A;  2WCF A;  1Y1U A;  1TRF A;  2YSX A;  1SRA A;  3I5I C;  4LUE A;  1YUR A;  1SPS A;  2I94 A;  1PAL A;  1JYR A;  2HDV A;  3OVE A;  2EHB A;  1OOJ A;  1OE9 B;  1SBJ A;  4BY4 A;  1AK8 A;  2EKX A;  2ZFD A;  4A4B A;  2H5K A;  1WY9 A;  4F0Z B;  1BT6 A;  2LUC A;  3SG6 A;  2E6W A;  2IUH A;  1A03 A;  3N7Y A;  2YU7 A;  3TUY C;  2I2R E;  3CR2 A;  3SG5 A;  1SMG A;  3PLF B;  1DJH A;  1OQP A;  4PCW A;  2K8M B;  4I5N B;  4XJK A;  1AB2 A;  2EC6 C;  2CBL A;  4ZCV A;  1S6I A;  3SG7 A;  1MIL A;  1X02 A;  1D4T A;  1BHH A;  2MRK A;  4YRU A;  1QTX A;  2WC8 A;  3I5G B;  5EG3 B;  1A4P A;  2QPT A;  4YBH B;  1R6P A;  1O4J A;  1K8U A;  2EO6 A;  3I5F B;  1S36 A;  2DOQ A;  1O46 A;  4K2R A;  3CGA A;  3NSL A;  4MBE A;  5IBW A;  2I7A A;  1JU5 A;  3VRN A;  3US4 A;  1YUS A;  1XFU O;  2QMS A;  1BLQ A;  2M9G A;  2MRJ A;  2L4H A;  1QX2 A;  2NXQ A;  4A4C A;  4Q04 A;  1BG1 A;  2L50 A;  1YUU A;  1BKL A;  2MHH A;  1CLL A;  3KF9 A;  1FI6 A;  1CDP A;  1BFI A;  1ZFS A;  4OHH A;  1DJG A;  3IN7 A;  5EHP A;  2PVB A;  1M63 B;  4CFQ A;  3VRZ A;  2LVV A;  1JF2 A;  1HT9 A;  2PRU A;  3EK4 A;  3EK8 A;  3VRY A;  1CMG A;  1NWD A;  1UUR A;  1QJT A;  2PNB A;  1DJX A;  4MZK A;  1QIV A;  1YX8 A;  2KAV A;  1YTZ C;  3D0Y B;  4M2P A;  5DKR A;  1JWO A;  1AHR A;  1SL8 A;  3PFV A;  1DJY A;  3LCP C;  3A4U B;  3AKB A;  2LLU A;  1CFF A;  2B1U A;  2KGR A;  2ROR A;  4L1B B;  2L5X B;  1FPW A;  1KA6 A;  1B9A A;  5I2Q A;  3VGO A;  3OV1 A;  2L51 A;  2EGD A;  4E93 A;  2RGI A;  1B1G A;  1CM4 A;  5ER4 X;  1AJ4 A;  2C9W A;  2SRC A;  3CD3 A;  4GAO A;  3PSJ A;  2KGB C;  4N5X A;  1GGZ A;  2HMH A;  1Q80 A;  3VS6 A;  4HRG A;  2EC6 B;  1A1C A;  2MC1 A;  1PVA A;  2CXJ A;  3T04 A;  2K2A A;  2AUC A;  2LQW A;  3MAZ A;  5CSJ A;  4GBA A;  2M1U A;  1S6J A;  1XFW O;  3KO0 A;  3WHT B;  3WXA A;  2DCR A;  2K7A B;  4K45 A;  5I2L A;  3CS1 A;  4CLN A;  1BOD A;  3D0Y A;  4HRE E;  1CLM A;  2V53 A;  4MZJ A;  5PAL A;  1O41 A;  4OHI A;  3NSO A;  1LIN A;  2HQ8 A;  4XYN A;  2GSB A;  3TL0 A;  1H9O A;  2QAC A;  1FW4 A;  2KAY A;  3FIA A;  5IBS A;  1TNX A;  4QSY A;  2ABL A;  1PK0 D;  1RPY A;  3KHE A;  2KFG A;  2BKI B;  3OX5 A;  5EEL A;  1O4O A;  1NRV A;  2JU0 A;  1YUT A;  4DUQ A;  5CSN A;  1TNW A;  1MWN A;  2TN4 A;  2Y4Q A;  3MSE B;  1AP4 A;  4OHL A;  1WQU A;  3CBL A;  2M49 B;  2LQN A;  3BUN B;  1IG5 A;  1C7W A;  2HDX A;  2BE6 A;  2LC5 A;  1K94 A;  2Y5I A;  1LUN A;  1NUB A;  2G2B A;  1AJ5 A;  2JC2 A;  3DVK A;  5HKW A;  2KAX A;  5KSZ A;  4P5O E;  4AQI A;  1TCO B;  2JTT A;  3WNX B;  1CSZ A;  4UPG A;  2CI8 A;  2DLZ A;  2OS8 B;  2GGM A;  1SKT A;  2MA2 A;  2CS0 A;  2GE9 A;  3GQI B;  3PSK A;  2BBN A;  4E68 A;  4MRX A;  3SIA A;  2LVJ A;  1BM2 A;  3WHU B;  1RQQ C;  3SIB A;  1KSM A;  4YGA A;  1TN4 A;  3PQZ A;  2K61 A;  3F45 A;  3FWB A;  1J1E A;  2KI6 D;  1K96 A;  3NSI A;  1JWD A;  1B7T Y;  4GGN A;  2IUI A;  1LUI A;  1FBV A;  3VS4 A;  2I18 A;  1F1W A;  2L6K A;  1VRK A;  1JYU A;  1XVJ A;  2LVI A;  1SYM A;  1JSA A;  1IJR A;  1LKJ A;  2FO0 A;  1KSW A;  1UHJ A;  2K79 B;  3VS0 A;  1NX2 A;  3VRQ A;  1Y6W A;  4M2Q A;  4JPZ B;  4DS7 A;  4GNK B;  2COL B;  2KBI A;  4R1E A;  1GGW A;  2LLS A;  3DF0 A;  4YI8 A;  1AYD A;  1O4M A;  1O4C A;  2B3O A;  1RK9 A;  5IBM A;  1QV1 A;  2BEC A;  2G9B A;  2OTG C;  5F6T A;  1BMB A;  1CSY A;  1S3P A;  3C7I A;  3GXX A;  3JTD C;  1NCZ A;  1KQV A;  1M46 A;  2ISD A;  5AFP A;  5JOL A;  3CR4 X;  4DIR A;  2RVF A;  4BTF A;  2EYY A;  2M29 A;  1QVI Y;  3IF7 A;  1WRK A;  4CID A;  1MUX A;  1PSR A;  1U5I B;  3UF4 A;  4JEG A;  2C0I A;  4XZ1 A;  3E3R A;  1CDM A;  5HKZ A;  3EAZ A;  4EIH A;  3BUM B;  4HSZ A;  1CFP A;  2DLY A;  1BJF A;  4QJ5 B;  1Y1X A;  1DF0 B;  3SG4 A;  4DCK A;  4PE4 A;  1O4N A;  1O4L A;  2MRD A;  1BU3 A;  2LP3 A;  2EU0 A;  2KQY A;  3PN7 C;  2HCK A;  1F70 A;  3AAK A;  1B8C A;  1UWO A;  3PN7 B;  4FTG A;  2FCE A;  4ICB A;  4ORA B;  4L9M A;  1DMO A;  1SNL A;  1ALV A;  4NWG A;  2PLE A;  4GWF A;  1SHA A;  3K2M A;  2EL8 A;  4ORC B;  4FL3 A;  2JUL A;  5K89 A;  1DTL A;  4N1F A;  1IH0 A;  2AOB A;  4D1E A;  1RTP 1;  1IJ6 A;  1WLZ A;  2LV7 A;  1OZO A;  5JJG A;  1BOC A;  1JFJ A;  4JGH A;  2KOT A;  1Y0V H;  2MK2 A;  1NPQ A;  1F55 A;  1YRU B;  1BLJ A;  3OP0 A;  3TZ1 A;  1BHF A;  3K21 A;  1AUI B;  4U8D A;  2MQI A;  2O60 A;  1DF0 A;  4DRW A;  3PS5 A;  1OZS A;  4C0L A;  1SW8 A;  1SR6 B;  2HET A;  1QX5 B;  1V1F A;  2LE9 B;  1QLS A;  2OTG B;  1MQ1 A;  1IS0 A;  1LUM A;  3VS7 A;  3WA4 A;  1LA0 A;  3I5I B;  1C7V A;  1TOP A;  4F59 A;  5B8I B;  2ZKM X;  1XK4 A;  1FBZ A;  2M7N A;  2BCB A;  1YX7 A;  4I5K A;  5AUL A;  2KI6 C;  5D7F A;  3EVU A;  5HKY A;  4NWF A;  1M45 A;  2BL0 B;  2H2K A;  2AUG A;  4NQG A;  2M3W A;  3ICB A;  3SG2 A;  2PNA A;  1S1E A;  3OX6 A;  2O5G A;  1GQM A;  2MLE C;  1IQ5 A;  1QIW A;  3BUO B;  1FU6 A;  2SHP A;  3HHM B;  3KPX A;  3TS5 C;  2ZN9 A;  1OO3 A;  2K2F A;  2JOJ A;  1IQ3 A;  1MHO A;  4F5B A;  2DVJ A;  1KWO C;  1WRZ A;  2HQW A;  1RWY A;  3EKH A;  4NDC A;  1O4K A;  1X6C A;  2PAS A;  2JT0 A;  1YVH A;  2GGZ A;  1KC2 A;  1KK7 Z;  1XA6 A;  3EK7 A;  4H34 A;  4U17 A;  4K11 A;  1FHS A;  4IL1 A;  5FYX A;  3BOW B;  1NZL A;  2BCX A;  4BY5 A;  5BPJ A;  1H4B A;  1JUO A;  2JT3 A;  3LL8 B;  1K95 A;  4YGB B;  2LVK A;  1J1D A;  1CM1 A;  1XFZ O;  1AYA A;  1JF0 A;  1IWQ A;  1A75 B;  1YVL A;  2BBM A;  3FWC A;  4TNC A;  2FOT A;  1R1Q A;  2ETZ A;  2C0T A;  1SKJ A;  3AKA A;  2FCD A;  4PHJ A;  1LKK A;  1LCJ A;  5KTY A;  1O4A A;  2CRH A;  4LUD A;  1NZV A;  1O49 A;  4GGF C;  2MJW B;  4I5J A;  4XJK B;  1TZE E;  4OHE A;  1G8I A;  1P13 A;  2K7C A;  3LK0 A;  3M0W A;  2LP2 A;  4P2Y B;  1S26 D;  1W7J B;  2LHI A;  1A2X A;  1B47 A;  3LK1 A;  2HF5 A;  2C0O A;  1KSO A;  3BQ3 A;  1RJA A;  4YGE B;  1DVI A;  5D0J A;  1OMD A;  4QJ4 B;  3BOW A;  4PHK A;  2PAL A;  2EO3 A;  1S6C A;  3EVV A;  4OCI A;  1L2O B;  1O4G A;  4OV2 A;  2DX0 A;  1PIC A;  1EH2 A;  4M4Z A;  1IRJ A;  1ZOT B;  4PE7 A;  1X27 A;  4X6S A;  1O4R A;  2KK6 A;  3GXW A;  1A75 A;  1XFX O;  1F8H A;  3CXL A;  1UP5 A;  3KEV A;  2H61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...