3VRQA

Crystal structure of the tyrosine kinase binding domain of cbl-c (pl mutant)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
310
structure length
278
Chain Sequence
QWEEARALGRAVRMLQRLEEQCPPSLRDLLPRTAQLLREVAHSRPGGPGGSGDFLLIYLANLEAKSRQVAALSRLRRQLAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRLSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal transduction protein CBL-C
publication title Structural flexibility regulates phosphopeptide-binding activity of the tyrosine kinase binding domain of Cbl-c.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 95
structure length 278
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02262 Cbl_N CBL proto-oncogene N-terminal domain 1
A PF02761 Cbl_N2 CBL proto-oncogene N-terminus, EF hand-like domain
A PF02762 Cbl_N3 CBL proto-oncogene N-terminus, SH2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3vrqA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 3vrqA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3vrqA03
2KQ6A 4GFTA 5D69A 4PHMA 1N0YA 1A75A 1ZACA 2BE6A 1DGVA 2F3YA 4YI9A 1O43A 2JOJA 1B1GA 2NLNA 2ZN8A 5DC9A 1F54A 3QRXA 1OQPA 2RMXA 3US4A 4NDBA 1KK7Y 1MR8A 1TTXA 2FCDA 2JU0A 2KFGA 3KFJA 3C1VA 1BHHB 1CFDA 2C0IA 2KGRA 1CDLA 1SCMC 2K7CA 5I2OA 2LVKA 3VGOA 1GHUA 2ECDA 1AJ5A 1QATA 2LNWA 1QJTA 4YGCB 4L1BB 1F4OA 3DF0B 5HLOA 1FU5A 4A4CA 1TOPA 1UHNA 3MAZA 4H34A 4U1PA 2BCAA 2JZIA 1O4AA 1AYCA 1QG1E 2BCXA 3DVMA 1BT6A 1XFWO 2KNOA 2KHNA 3IMJA 1SL8A 3DVEA 4P9ZA 3TKZA 3BUNB 2HDVA 2OPOA 3IN8A 2EO6A 4QJ5B 2LHLA 2K61A 5AERA 4MZJA 2BCBA 2PLDA 3QWYA 1BMOA 1OZSA 1WLMA 5TNCA 2ZNDA 2I18A 3MXYA 4PHJA 3VRYA 2M49B 2YU7A 2DM0A 1LCJA 3OHMB 1KK7Z 4ORCB 4ZCUA 3NHNA 1U5IB 2KAXA 2Q91A 2EYZA 2WNDA 2PVBA 3N7YA 2H61C 3CWGA 1NUBA 1O4GA 1TN4A 1G33A 1QX7A 1Y0VH 3PSKA 4ORBB 1IQ3A 4YGAA 2FJUB 4PALA 2IUIA 1O4PA 1QIVA 5AFPA 4K11A 1ALWA 3CTNA 3KHEA 3A4UB 1A1AA 1O44A 5DC4A 3I5HB 1A29A 2PTKA 3H4SE 4DS7A 1S5GY 2L4IA 2IUHA 1D1ZA 1GRIA 1EXRA 4JE4A 5CSIA 4LUEA 3VRNA 4F5AA 2KQYA 2LLTA 1AYAA 3EK7A 4I5JA 1AYDA 1BHHA 4XYNA 2WC8A 3CS1A 3K2MA 4OHIA 2KK6A 2CCMA 2E6WA 1LKKA 1KSMA 3DF0A 1A2XA 4P2YB 1BFIA 1CTRA 5BPJA 2FCIA 2FCEA 2LUXA 2EKXA 1M45A 1KSOA 2P6BB 2QPTA 1CJ1A 2Y5IA 1SMGA 1OPKA 2R2IA 1O4IA 3HCKA 1HCSB 1DJIA 3WXAA 1PRWA 3EKJA 3UF4A 1MXLC 1N65A 4GBAA 3D0YA 1DJHA 1DJZA 2KI4B 2LLSA 1CMFA 2F8PA 1JSAA 1A09A 2CIAA 2AAOA 1YR5A 3I5HC 1DMOA 1O4QA 2SHPA 5DC0B 4WWQA 3NSOA 2G2BA 3VS2A 1S3PA 1CWEA 5JJGA 4E68A 4BTFA 2DLYA 3LLEA 1A1EA 1DJXA 1SL9A 1FYRA 2DX0A 1KCYA 4NQGA 4C0LA 2EYYA 3BUMB 1BM2A 1O41A 5HLVA 2K7BA 2ZNEA 1YVLA 3TDIA 1TIZA 1DJGA 1KFXS 1X02A 2JPTA 1IJ6A 1KQMB 1U5IA 1OE9B 3PN7C 1CFPA 5CSFA 1A1BA 3BKBA 1O4NA 2I2RE 2BBNA 3NSKA 2MRJA 1Y1AA 1QLKA 2KI4C 4XJKB 1SPYA 4P5OE 1FW4A 1XK4A 1IJ5A 2JRFA 1OMDA 3TS5B 2CI8A 3CR2A 1TRFA 2IS9A 1A4PA 4DCKA 2YSXA 1IJRA 1C07A 1P13A 4GGFC 4PHKA 4DRWA 2AUGA 2K79B 1AB2A 1FMKA 2ZRTA 4WRIA 3IQOA 4N1FA 1BG1A 1QV1A 2ZRSA 2Y3AB 3EVUA 5CSJA 1B7TY 2K7OA 1O4HA 1KQMC 2JXLA 3EACA 4MZLA 1MUXA 3I5FB 2O60A 1O4FA 4FQOA 1K90D 2MJWB 2MRKA 1F4QA 3TDZA 1QIWA 3NSIA 2IUGA 1J1DA 3TS5C 1QVIY 1JBAA 1J1EA 3DVJA 1LA0A 3OX6A 2JULA 1A81A 1CLLA 1B8LA 4FL3A 5KSZA 1CSYA 4DUQA 3FIAA 1SYMA 4OHEA 4D8KA 3EK8A 3LK1A 2CNPA 2KBIA 1XFYO 1IRJA 1SR6B 1BF5A 4BY4A 3OP0A 3WHUB 5KAZA 1Q80A 1O4JA 2K7AB 2JYQA 5IBWA 2L51A 2JWWA 5G08A 4GGFA 2ISDA 1MHOA 3SJSA 1QX2A 2KFHA 4GWFA 5DKQA 4GNKB 1YRUB 1NYAA 2K0JA 1R6PA 2MRDA 5B8IB 2SASA 1FBZA 1RPYA 2AOBA 2JT3A 5GJIA 3I5FC 1CMGA 1H8BA 4FL2A 1RROA 1NZLA 1G83A 2CS0A 1K96A 1OOJA 4D1EA 1FBVA 1M61A 2HCKA 1K2HA 1BKMA 1CM4A 3OVEA 3S8NA 2KYCA 1BLJA 1ZFSA 2ZFDA 1LXFC 1B7TZ 1XFUO 3EKHA 2WORA 3N8MA 4E93A 2JTTA 2CXJA 2M1KB 2SCPA 1D4TA 3PSJA 1GQMA 1NIWA 1RJVA 2KYFA 2KI6D 2OZOA 1M39A 1EJ3A 1OZOA 1SR6C 2H2KA 3OB2B 2M29A 4LUDA 1FPWA 1NWDA 4AQJA 4F5BA 4MN0A 1QVIZ 1L2OB 1YX7A 2WCFA 4CPVA 1RECA 3RLZA 2KNEA 5D0JA 1TNPA 3LL8B 1B9AA 2WOSA 3GXXA 1QS7A 5GQQC 1BR4B 1J7OA 1OO4A 1A08A 1O4RA 1SRAA 1S36A 5HKZA 1NX0A 1HQVA 2L98A 1JWOA 1AVSA 2F2OA 5CSNA 1UURA 4M2OA 1PULA 5DKNA 5AXIA 2MBXA 4GPLB 3EAZA 2MK2A 1KFUL 3JTDB 1F71A 2L5XB 4WQ3A 3GQIB 3CR5X 2KAVA 1YTZC 2GGMA 4M2QA 2D8NA 1FHSA 1CB1A 2JXCA 2KI6C 2BBUA 1L2OC 1CDNA 4FBNA 5DF6A 1RQQC 3PJPA 3S9KA 1JF0A 1M31A 1YX8A 1KK8B 4GAOA 4YGBB 1V1GA 5AULA 1GGZA 1EH2A 1TNXA 2HUWA 2GGZA 2GE9A 1KFUS 1RTP1 4OKHA 3IQQA 4PCWA 4TNCA 1ZFPE 2L3TA 1SKTA 2LQNA 1ODBA 2TN4A 2NXQA 1K9AA 4YRUA 1LINA 1NCZA 5FYXA 3JTDC 2WCBA 1TNWA 1O4OA 2L4KA 3VRZA 2PRUA 1A1CA 1WRKA 2JNFA 2K2AA 3OX5A 1A07A 1PSBA 3CGAA 1X27A 2RSYA 1R1QA 1K9PA 2V53A 4ICBA 4MBEA 1SPRA 1R2UA 4OHHA 2QACA 4DIRA 1S6JA 2LMUA 2ZN9A 1F8HA 1O4CA 1O4KA 1SPSA 2BE4A 4F0ZB 1KK8C 1MWNA 1O4BA 3BYAA 4MEWA 3PALA 1W7JB 2JT8A 2H61A 3N84A 1J7RA 3ZNIA 4OHDA 1FU6A 2HF5A 1LUKA 2B3OA 1B47A 1K94A 4L9MA 4PHNA 3LK0A 1KFXL 2H46E 2M0RA 1CWDL 3BUWB 5AEQA 1FI5A 1QV0A 4ORAB 3ZWHA 2CBLA 5D7FA 5I6VA 5I8NA 1BODA 1O48A 1Y1UA 5CPVA 3SG4A 1XA6A 1NRVA 3CBLA 5CDWA 2E30A 4M2PA 1DF0B 1WQUA 2DVJA 2VIFA 1S5GZ 3BXKA 1BR1B 2M7NA 3EVVA 2ZKMX 1XFZO 2EHBA 3VS6A 1DGUA 1SCVA 4ZCVA 1BJFA 4F59A 2LVVA 1O47A 1J7PA 2LP3A 1GJYA 3KF9A 2XP1A 4OHLA 2LM5A 3GK4X 2K7DA 1UHKA 2Y1MA 4AOMA 1QCFA 3GK2A 1G8IA 3I5IB 5HKYA 1AP4A 1QX5B 1S6CA 1PICA 3M7FA 1ZOTB 1NCYA 1RWYA 1K95A 1NX1A 2O5GA 3AAKA 3BUOB 3AKBA 4I5LB 1JWDA 1OSAA 1ZUZA 2F33A 4OR9B 1BLQA 2GSBA 3GXWA 2A4JA 1BHFA 1QTXA 2CR4A 3SIBA 1YURA 2F2PA 1M27A 4QJ3B 2LLUA 1I3ZA 2LAPA 1RJAA 2BKHB 1NPQA 4NDDA 4FTGA 2EO3A 2LNXA 3JVTB 3TZ1A 2LNKA 4OCIA 1N2DA 2MLEC 3K21A 3KEVA 1BKLA 1KSWA 2ABLA 3I5IC 3LCPC 3OV1A 1PVAA 1O4MA 2C0OA 1YRTB 1SNLA 1Y1XA 2WCEA 1YVHA 2JC2A 3FWCA 1LKLA 1O42A 2KDHA 4R1EA 1WY9A 3I5GB 4MRXA 2COLB 1CM1A 5HYDA 1XFVO 1LVCD 2KSPA 1O4EA 3EK4A 4PE4A 1TCOB 3MXCA 1CLMA 1UP5A 1IH0A 4I5KA 3VS1A 1AUIB 2HPSA 1BLKA 1UUSA 2FO0A 1AYBA 4JPZB 3CXLA 2BL0B 4U8DA 1IGVA 3AKAA 3CLNA 4YBHB 1DF0A 1XA5A 1SHBA 1TZEE 2OS8B 4MZKA 3SIAA 3JVTC 4A4BA 4USLA 3BUXB 1FF1A 1NZVA 3S8OA 4CLNA 3C7IA 1WDCB 3MSEB 2AOAA 2HDXA 1SW8A 3PS5A 2HMHA 1KQVA 2RORA 2DOQA 5I2LA 4XJKA 1LUNA 1G4YR 4HRHA 3I5GC 1DVIA 4PE7A 5DKRA 2H5KA 1CKKA 3VS0A 1NX2A 2LMVA 4CFQA 1K9KA 1O49A 1OMRA 3O78A 2BECA 1XYDA 4C0JA 3QWXX 3GOFA 3D10A 2LV7A 3O4YA 1KC2A 4IL1A 2PASA 1ZMZA 2PMYA 1CLBA 2PLEA 2BL0C 1CNPA 3HX4A 3VRRA 4K2RA 3TDUA 2H8HA 3PM8A 2OS8C 1BFJA 1MF8B 1B8CA 4NWFA 4XZ1A 1DT7B 2Y1NA 1Y6WA 1WDCC 1DJYA 2M3WA 2OQ1A 3SG2A 1L7ZA 3CR4X 4MLWA 1JYUA 1PALA 1AOTF 2F3ZA 4U17A 1XFXO 1YUTA 2LHIA 3PSRA 5IBMA 2MAZA 3FS7A 4JEGA 4OV2A 3AAJA 2KBMA 2LMTA 1IS0A 4P9VA 2HETA 5EG3B 1JYRA 2L2EA 3F45A 1JF2A 1CFFA 1UHIA 3SG7A 1B8RA 2LVIA 3RM1A 4DGPA 1AD5A 1SL7A 3D0YB 5ER4X 1OPLA 1IWQA 1HT9A 1F2FA 1RFJA 1EG3A 4NWGA 4PE1A 2RVFA 2SRCA 2JNXA 3CZTX 2KFFA 4GL9E 1CDPA 2KOTA 4K45A 1JYQA 5EEQA 5HKWA 2CT9A 1QADA 1KA7A 4ETOA 3PQZA 3S8LA 1UHHA 2M1UA 3SG6A 3DD4A 3SG5A 1RK9A 4Q04A 1F1WA 2C0TA 4PE0A 4H1OA 3O2PA 3IN7A 3A8RA 1AHRA 2JT0A 2NCPA 1QASA 2LCPA 4I5NB 2HQWA 1KWOB 2KGBC 4MVFA 2EYVA 4HSZA 1HCTB 1IKUA 3E3RA 4QJ4B 1MQ1A 1BMBA 4TZIA 5IBSA 2EOBA 1PVBA 1F55A 1PK0D 2LQWA 1EL4A 3PFVA 5AANA 1NX3A 4C0KA 4YI8A 4N5XA 1R1PA 1SBJA 1H4BA 1IQ5A 3PLFB 5KTYA 2Q4UA 3VS3A 2PNAA 5K89A 1TNQA 3WHTB 2I94A 2JQ6A 2FOTA 2LVJA 4YGDB 3NXAA 1NP8A 2LP2A 1B4CA 1S6IA 1QXPA 2MHHA 3TUYB 1K9UA 2M7LA 1BU3A 1JFJA 1O4LA 2CRHA 3ICBA 4K44A 4NDCA 5PALA 1EG4A 2L50A 2L4HA 2KAYA 4GUKA 1KWOC 1KA6A 3IMDA 3OB1B 4XZ0A 4X6SA 3HHMB 3FWBA 3SG3A 2EU0A 2QMSA 1Z3KA 1H9OA 5EHRA 2EGDA 5F6TA 2NCOA 2PNBA 1C7VA 3VRPA 4HRGA 4MRYA 3T04A 2K2FA 2LANA 1JFKA 1XK4C 1WLZA 2CTNA 2NZ0A 3PN7B 3VROA 2IZVA 2OTGB 3DVKA 5JOLA 2DCRA 1WRLA 1W7IB 1YUSA 1J55A 3BOWB 3TL0A 4CFRA 3VS7A 1Y57A 3TUYC 4DGXA 4BY5A 1CDMA 1E8AA 1UHJA 1GGWA 4JWQA 4EY0A 5I2QA 2M8UA 3VS4A 2C9WA 3PATA 4QSYA 2MLFC 1UWOA 4HREE 2GV5A 1S26D 3VRQA 1SY9A 2EC6B 5KU1A 1FI6A 2JTZA 1R1SA 2AUCA 3KPXA 2I7AA 4GGNA 1MILA 1NSHA 1F70A 1A75B 3IF7A 5ER5A 1ALVA 3HIZB 1OO3A 4N1GA 4CIDA 1SHAA 1AJ4A 2BKIB 1K8UA 2LCTA 2OTGC 3UYOA 4JQ0D 4UPGA 1K93D 1NCXA 1MW4A 4PDZA 2ETZA 4M4ZA 1J7QA 2RGIA 1IG5A 1QLSA 2G9BA 4AQIA 3WA4A 2MQIA 1TCFA 5BO4A 2K8MB 1A03A 1JU5A 1MXEA 3GK1A 2BBMA 1S1EA 1WRZA 4OVNF 3BQ3A 1CFCA 2DLZA 2EC6C 4MSPA 5GJHA 3VS5A 1LA3A 1DTLA 2M9GA 1D1OA 2EL8A 5EHPA 2LC5A 4YGEB 1VRKA 2MA2A 4JGHA 3HCMA 1X0NA 1O45A 2HQ8A 1JC2A 2L6KA 1LCKA 1XVJA 2AMIA 1LKJA 4ROJA 1SK6D 4EIHA 1AOUF 3EVRA 2LE9B 1CSZA 2B1UA 3WNXB 2M97A 1BOCA 1LUIA 3KO0A 1LUMA 1X6CA 1YUUA 1JUOA 1SCMB 1V1FA 2L0PA 3O6BA 1AK8A 3BOWA 3NSLA 1SKJA 2CI9A 1C7WA 2PALA 1TCEA 1XO5A 1M63B 2LUCA 1SHDA 5EELA 1OMVA 1O46A 2Y4QA 1PSRA 2PSRA 2VRGA 1D4WA 5J3XA 1DJWA 3M0WA 3CD3A 4WQ2A 1M46A 2MC1A 1O4DA
chains in the Genus database with same CATH superfamily
5D69A 1ZACA 1A75A 1O43A 1B1GA 5DC9A 1F54A 3US4A 3KFJA 1BHHB 1CDLA 2LVKA 2LNWA 4L1BB 1DE4C 3B6XA 4U1PA 1O4AA 3DVMA 2OR4A 3S0GA 3DVEA 4P9ZA 3IN8A 2LHLA 2BCBA 4BPXB 2PLDA 2ZNDA 1KK7Z 3NFQA 2Q91A 2WNDA 3N7YA 1NUBA 1O4GA 1TN4A 3PSKA 1O4PA 4K11A 1ALWA 1A1AA 4JZ0A 2IUHA 2KQYA 2LLTA 4I5JA 3DXLA 2WC8A 3BI1A 4OHIA 4P2YB 2QPTA 2P71A 1SMGA 1HCSB 2G2BA 5JJGA 4BTFA 3LLEA 3D7DA 1BM2A 2K7BA 3TDIA 1O4JA 1A1BA 1CFPA 1IJ5A 1OMDA 2CI8A 3CR2A 1TRFA 4DRWA 3IQOA 4N1FA 3EG5B 2ZRSA 2Y3AB 3EVUA 1O4HA 2MRKA 1J1DA 1JBAA 1J1EA 1TUZA 3DVJA 1LA0A 1A81A 1CLLA 1CSYA 3FIAA 1SR6B 2JWWA 4GGFA 1MHOA 3SJSA 4GWFA 1NYAA 5B8IB 1FBZA 1RPYA 1CMGA 1H8BA 2PVWA 4FL2A 1RROA 2K60A 1K2HA 1BKMA 1CM4A 2ZFDA 1LXFC 2KYFA 2OZOA 1M39A 1EJ3A 1SR6C 1FPWA 4AQJA 1QVIZ 1L2OB 1B9AA 3GXXA 5GQQC 1BR4B 1J7OA 5D29A 1JWOA 3EAZA 1KFUL 4WQ3A 3GQIB 3CABA 1FHSA 2D8NA 2JXCA 1L2OC 1CDNA 3PJPA 3S9KA 1V1GA 1TNXA 3SJXA 2HUWA 1RTP1 1SKTA 1WRKA 2JNFA 1K9PA 3PT1A 4F0ZB 1O4BA 3NGVA 3BYAA 1W7JB 2H61A 3N84A 1J7RA 3OAKA 2HF5A 4L9MA 3LK0A 2WC6A 1CWDL 2QDIA 1QV0A 3ZWHA 2CBLA 2L5YA 1BR1B 2M7NA 1DGUA 2LVVA 1J7PA 2WCKA 2XP1A 2K7DA 1UHKA 1QCFA 5HKYA 1NCYA 1RWYA 3AAKA 3GXWA 1QTXA 3SIBA 1YURA 2F2PA 1M27A 2LLUA 2BKHB 4FTGA 3JVTB 1N2DA 1BKLA 3CZ0A 1KSWA 2ABLA 3LCPC 3OV1A 1PVAA 3B7AA 3UYOA 1Y1XA 2JC2A 2PYQA 4MRXA 5HYDA 1UP5A 1IH0A 3VS1A 3HMJG 2FO0A 2BL0B 4YBHB 2YGUA 3AKAA 3CLNA 1TZEE 2OS8B 4MZKA 3JVTC 3C7IA 1SW8A 2HMHA 1KQVA 3K1EA 1G4YR 4PE7A 1DVIA 4CFQA 3QWXX 2LV7A 2BL0C 1CNPA 3VRRA 2OS8C 1MF8B 1B8CA 1DT7B 2M3WA 4P4DA 1L7ZA 3CR4X 1PALA 2F3ZA 1XFXO 5IBMA 4OV2A 3AAJA 2LMTA 3F45A 1CFFA 1UHIA 4DGPA 1HT9A 1F2FA 1EG3A 2SRCA 4GL9E 2KFFA 1JYQA 5HKWA 2CT9A 1F1WA 2M1UA 4NGNA 3DD4A 3SG5A 4H1OA 3IN7A 2NCPA 1QASA 3B87A 2KGBC 1BMBA 4TZIA 2EOBA 1PVBA 3CZ1A 1NX3A 3SS5A 4C0KA 1IQ5A 2PNAA 3S0EA 1TNQA 3WHTB 2LP2A 1O4LA 1JFJA 1QXPA 2MHHA 2M7LA 1BU3A 2L50A 2KAYA 2XPOA 3IMDA 1H9OA 5EHRA 4HRGA 2K2FA 2LANA 2NZ0A 3DVKA 2DCRA 1WRLA 3VS7A 4BY5A 3D74A 2C9WA 4HREE 1S26D 3VRQA 2EC6B 1FI6A 2AUCA 3KPXA 2I7AA 1NSHA 5ER5A 2B4JC 3NHTA 1OO3A 1AJ4A 1K8UA 2LCTA 5FI6A 2ETZA 4P4JA 1MXEA 1S1EA 2EC6C 4YGEB 1VRKA 1X0NA 4INWA 2PQLA 2AMIA 4EIHA 3U88C 3EVRA 1CSZA 1Y57A 3KO0A 1YUUA 3O6BA 4BPUB 3BOWA 3NSLA 1XO5A 3SJFA 1OMVA 2Y4QA 2VRGA 5J3XA 2KQ6A 1N0YA 2ZN8A 1TTXA 2KFGA 3OGNA 1CFDA 2KGRA 2K7CA 3VGOA 1QATA 5HLOA 4P4BA 4OC1A 1TOPA 3MAZA 2JZIA 3BUNB 2HDVA 2OPOA 2EO6A 1OZSA 3MXYA 2DM0A 3NHNA 1U5IB 4MCSA 2H61C 3CWGA 1G33A 1QX7A 4ORBB 2FJUB 4PALA 2IUIA 5AFPA 3A4UB 5DICA 4DS7A 4LUEA 1GRIA 1CX8A 2JBJA 1AYDA 3K2MA 2KK6A 3DF0A 1BFIA 2FCIA 2FCEA 3HCKA 2P6BB 2R2IA 3UF4A 1MXLC 1DJHA 1DJZA 2KI4B 2LLSA 1O4QA 5DC0B 3SS4A 3S9MA 4WWQA 1CWEA 2DLYA 3Q8IA 2DX0A 2EYYA 1O41A 5HLVA 2JPTA 1OE9B 1O4NA 2I2RE 1QLKA 2KI4C 1SPYA 2XEIA 4MCRA 1A4PA 4DCKA 2K79B 1AB2A 1FMKA 5CSJA 1B7TY 2K7OA 2OOTA 3I5FB 4KYNA 4FQOA 2MJWB 1QIWA 3NSIA 2WCHA 3OX6A 4FL3A 5KSZA 3EK8A 1XFYO 3OP0A 3WHUB 2JYQA 5IBWA 2MRDA 2K0JA 3N7HA 3I5FC 3QMEA 1FBVA 2HCKA 3S8NA 1XFUO 4E93A 2JTTA 2CXJA 1D4TA 1GQMA 1NIWA 5F13A 2M29A 4CPVA 1YX7A 1RECA 2KNEA 5D0JA 3LL8B 4PT1A 1QS7A 4JD9A 3DY9A 1O4RA 3IVTA 1HQVA 1UURA 4M2OA 3CR5X 2KAVA 1YTZC 3FECA 1CB1A 1RQQC 3LYVA 4NGRA 1M31A 1YX8A 3S0FA 2XPNA 2GGZA 3IQQA 4PCWA 2NXQA 1K9AA 2WCBA 2RSYA 1A07A 1PSBA 1SPRA 4OHHA 1LS8A 2QACA 4DIRA 2LMUA 2ZN9A 1TWOA 3D73A 1T14A 4PHNA 1KFXL 2H46E 5AEQA 5D7FA 5I8NA 1O48A 1Y1UA 3CBLA 2E30A 3D78A 1DF0B 3BXKA 3S9NA 3VS6A 4ZCVA 2LP3A 3KF9A 2Y1MA 1G8IA 3VB1A 1S6CA 1K95A 1JWDA 4OR9B 2A4JA 1BHFA 3D7HA 2UV8G 1I3ZA 1RJAA 1NPQA 4NDDA 2LNXA 3K21A 1TUJA 2WCEA 1WY9A 2COLB 1CM1A 1XFVO 2KSPA 1O4EA 3MXCA 2WCMA 1BLKA 1UUSA 3CXLA 4U8DA 1IGVA 1SHBA 1NZVA 4A4BA 4USLA 4CLNA 3PJIA 1IIOA 4XJKA 1OOIX 4HRHA 4OC5A 2LMVA 1O49A 3O78A 2BECA 4NGSA 3D10A 1KC2A 2PASA 1ZMZA 2PLEA 3HX4A 4K2RA 3TDUA 1BFJA 1P28A 4XZ1A 3SG2A 4MLWA 1YUTA 3PSRA 4JEGA 2HETA 1JF2A 1OOGA 1B8RA 3RZSA 2C6GA 1OPLA 5ER4X 5F09A 4PE1A 4OC4A 1CDPA 2JBKA 4K45A 1QADA 3PQZA 1KA7A 4ETOA 3S8LA 3SG6A 2C0TA 1RK9A 3O2PA 1AHRA 2JT0A 2LCPA 3OBVA 2HQWA 4MVFA 1HCTB 2LQWA 4YI8A 1SBJA 2Q4UA 4P45A 4P4EA 1B4CA 2FOTA 2LVJA 1IS0A 3NXAA 1S6IA 2CRHA 1EG4A 3OB1B 3HHMB 3FWBA 3SG3A 1Z3KA 5F6TA 3T04A 3PN7B 1JFKA 2CTNA 4CFRA 1CDMA 1UHJA 3VS4A 1QWVA 2MLFC 4NGQA 4GGNA 1F70A 1A75B 4N1GA 1SHAA 2BKIB 4JQ0D 2KLDA 2RGIA 2G9BA 3WA4A 2MQIA 1TCFA 1JU5A 1CFCA 3BQ3A 5GJHA 1LA3A 1DTLA 5EHPA 2MA2A 1OW4A 2HQ8A 1LCKA 1LKJA 1AOUF 5HL1A 4INXA 3WNXB 2M97A 1LUMA 2L0PA 1SKJA 2CI9A 4X3RA 1M63B 1SHDA 5EELA 1PSRA 3M0WA 4WQ2A 1AP4A 3O4YA 1M46A 4GFTA 2F3YA 4NGMA 2JOJA 3QRXA 2RMXA 1KK7Y 1MR8A 2FCDA 2JU0A 1GHUA 3S0AA 4YGCB 3BFHA 1FU5A 1UHNA 3K2TA 3S0DA 1BT6A 2KNOA 2KHNA 3IMJA 3TKZA 2WCJA 2K61A 5AERA 4MZJA 3QWYA 5TNCA 3VRYA 3FEDA 1LCJA 4ORCB 3BFBA 4ZCUA 2KAXA 2KLEA 2EYZA 4YGAA 1QIVA 2BAPA 3KHEA 5DC4A 3BJHA 4F5AA 1EXRA 5CSIA 1DC1A 3VRNA 1BHHA 3EK7A 3CS1A 2CCMA 2E6WA 1LKKA 1KSMA 4NGPA 1CTRA 1M45A 1KSOA 1CJ1A 1OPKA 2Y5IA 3EKJA 1N65A 4GBAA 3SS3A 3D0YA 4H34A 2F8PA 2AAOA 3D7FA 3NSOA 3VS2A 1A1EA 1SSEB 1FYRA 2XEGA 1YVLA 1TIZA 3CZ2A 1DJGA 1X02A 1KQMB 4IJ7A 5CSFA 4XJKB 1XK4A 2IS9A 1P13A 4GGFC 2AUGA 2ZRTA 3PM2A 3O8ZA 1XFRA 1KQMC 4MZLA 1MUXA 2O60A 1O4FA 1K90D 2IUGA 1QVIY 4DUQA 4D8KA 3LK1A 2CNPA 1IRJA 4BY4A 1Q80A 2ISDA 1QX2A 2KFHA 1YRUB 1R6PA 2SASA 1NZLA 1G83A 2CS0A 4D1EA 1M61A 2KYCA 3N8MA 2M1KB 3PSJA 1OZOA 2H2KA 3OB2B 4F5BA 4F7FA 1NWDA 4MN0A 1OO4A 1SRAA 3R72A 2BNXA 1DELA 1NX0A 1AVSA 5CSNA 2MBXA 1F71A 4JKTA 4FBNA 2KI6C 5DF6A 1JF0A 4GAOA 5AULA 1GGZA 1EH2A 2GE9A 4TNCA 1ZFPE 2L3TA 3FE9A 2ERBA 2TN4A 5FI7A 4YRUA 1LINA 1NCZA 5FYXA 1TNWA 2L4KA 2PRUA 1X27A 3CGAA 1R1QA 4ICBA 2LRAA 4MBEA 1R2UA 1SPSA 3UNWA 4BPWB 1O4KA 4MEWA 3HPGG 3PALA 2JT8A 4OHDA 3ZNIA 1FU6A 4NGTA 1LUKA 2B3OA 1K94A 3DYEA 2M0RA 1FI5A 5I6VA 1BODA 3SG4A 1XA6A 1NRVA 1WQUA 1S5GZ 4F59A 3F9KC 1O47A 3NHIA 1GJYA 4OHLA 1QX5B 3M7FA 1ZOTB 2C6PA 4RR2B 2O5GA 3IWWA 2DLAA 2F33A 1BLQA 2GSBA 5D3OA 2CR4A 2QEVA 4QJ3B 2LAPA 2EO3A 2LNKA 2MLEC 2N3AB 3CDNA 1O4MA 1YRTB 1LKLA 1YVHA 4R1EA 1LVCD 1CLMA 1AUIB 3BFAA 2HPSA 4JPZB 3SIAA 1FF1A 1WDCB 2HDXA 5EL2A 2RORA 2DOQA 5I2LA 1LUNA 5DKRA 3VS0A 2H5KA 1CKKA 1NX2A 4P4IA 3SJEA 1XYDA 2PMYA 5I94A 2Y1NA 1WDCC 2OQ1A 1JYUA 1AOTF 5BY0A 2QEBA 3FS7A 2KBMA 2L2EA 4MCQA 2LVIA 3RM1A 3D0YB 1RFJA 2JNXA 2KOTA 3L4LA 3A8RA 1IKUA 2CIJA 3E3RA 3B86A 5IBSA 1OOHA 1F55A 1PK0D 2P70A 1EL4A 3PLFB 5KTYA 2XEJA 3VS3A 2I94A 1NP8A 4JE4A 4K44A 5PALA 2L4HA 2EU0A 2QMSA 2EGDA 1C7VA 3VRPA 4MRYA 3VROA 1XK4C 2IZVA 2GTEA 5JOLA 1W7IB 1J55A 3BOWB 3TL0A 4DGXA 4EY0A 2M8UA 4QSYA 1UWOA 2GV5A 1MILA 3IF7A 3HIZB 1NCXA 4PDZA 1J7QA 1QLSA 4AQIA 1A03A 1ORGA 3GK1A 4OMEA 4OVNF 2DLZA 3VS5A 3R1PA 2M9GA 2EL8A 4JGHA 3HCMA 1O45A 1JC2A 2L6KA 3L47A 1XVJA 3FF3A 4ROJA 1SK6D 4P44A 1Z9EA 2B1UA 1BOCA 1LUIA 1SCMB 1V1FA 1AK8A 1C7WA 2PALA 1TCEA 1OOFA 1O46A 2PSRA 1DJWA 2MC1A 4PHMA 2BE6A 1DGVA 4YI9A 2NLNA 1OQPA 4NDBA 1C3YA 3C1VA 2C0IA 1SCMC 3BXMA 5I2OA 4LQGA 1AJ5A 1QJTA 1DEKA 1F4OA 3DF0B 3KASA 4A4CA 3UO9A 2BCAA 1AYCA 1QG1E 2BCXA 2VKZG 3D7GA 1XFWO 1SL8A 4QJ5B 1BMOA 1WLMA 2I18A 4PHJA 2M49B 2YU7A 3OHMB 2PVBA 1Y0VH 1IQ3A 2XEFA 2KGYA 3CTNA 1O44A 4W9YA 3I5HB 1A29A 2PTKA 3H4SE 1S5GY 2L4IA 1D1ZA 1AYAA 4XYNA 1A2XA 5BPJA 2LUXA 2EKXA 1O4IA 1DJIA 3WXAA 1PRWA 1CMFA 1JSAA 1A09A 2CIAA 3R1OA 2SHPA 1YR5A 3I5HC 1DMOA 1S3PA 4E68A 3RBUA 1DJXA 1SL9A 1KCYA 4NQGA 4C0LA 3BUMB 2ZNEA 1KFXS 2EYVA 1IJ6A 1U5IA 3PN7C 3BKBA 2WC5A 2BBNA 3NSKA 2MRJA 1Y1AA 2XPPA 4P5OE 1FW4A 2JRFA 3TS5B 2YSXA 2QEHA 1IJRA 1C07A 4PHKA 4WRIA 1BG1A 1QV1A 2JXLA 3EACA 1F4QA 3TDZA 3TS5C 2JULA 1B8LA 4OHEA 1SYMA 2KBIA 1BF5A 5KAZA 2K7AB 2L51A 5G08A 5DKQA 4GNKB 2AOBA 2JT3A 5GJIA 1K96A 1W9ZA 1OOJA 3OVEA 1BLJA 1ZFSA 3EKHA 1B7TZ 2WORA 3SJGA 2SCPA 1RJVA 2KI6D 4LUDA 2WCFA 3RLZA 1TNPA 2WOSA 1A08A 1S36A 5HKZA 2L98A 1WJTA 2F2OA 3DZTA 1PULA 3B88A 5DKNA 5AXIA 4GPLB 2MK2A 3JTDB 2L5XB 2XPLA 2GGMA 4M2QA 2BBUA 4YGBB 1KK8B 2JPOA 4OZDA 3D77A 1KFUS 4OKHA 4OC0A 2LQNA 1ODBA 3JTDC 3V2LA 1O4OA 3VRZA 1A1CA 3OX5A 2K2AA 2V53A 1S6JA 1O4CA 1F8HA 2BE4A 1KK8C 1MWNA 1B47A 3BUWB 4ORAB 3FEEA 5CPVA 5CDWA 4M2PA 2DVJA 2VIFA 3EVVA 2ZKMX 1XFZO 2EHBA 1SCVA 1BJFA 2LM5A 3GK4X 4AOMA 3GK2A 3I5IB 5ELYA 1PICA 1NX1A 3BUOB 3AKBA 4I5LB 1OSAA 1ZUZA 3TZ1A 4OC2A 4OCIA 3KEVA 3I5IC 2C0OA 1SNLA 2WCLA 3FWCA 1O42A 2KDHA 3I5GB 3BI0A 4FQTA 3EK4A 4PE4A 3BHXA 1TCOB 4I5KA 1AYBA 1Z2CB 1DF0A 1XA5A 3BUXB 3S8OA 3MSEB 2AOAA 3PS5A 3I5GC 2QEOA 1K9KA 1OMRA 4C0JA 3GOFA 4IL1A 1CLBA 2H8HA 3PM8A 4NWFA 3D75A 1Y6WA 1DJYA 4MCPA 4U17A 2LHIA 2MAZA 4P9VA 5EG3B 1JYRA 1C3ZA 3S0BA 3SG7A 2PVVA 1AD5A 1SL7A 1IWQA 4NWGA 2RVFA 3CZTX 5EEQA 1UHHA 4Q04A 4PE0A 4P4FA 1DQEA 4I5NB 1KWOB 4HSZA 3L4AA 4QJ4B 1MQ1A 3PFVA 5AANA 4N5XA 1R1PA 1H4BA 5K89A 2JQ6A 4YGDB 2ECDA 3TUYB 1K9UA 3ICBA 4NDCA 3D76A 3CYZA 4GUKA 1KWOC 1KA6A 4XZ0A 4X6SA 2H8VA 2PNBA 2NCOA 2L2CA 4JYWA 2C6CA 1Z4HA 1WLZA 2OTGB 1EO0A 3R1VA 1YUSA 5FI2A 3TUYC 1E8AA 1GGWA 4JWQA 5I2QA 3PATA 1SY9A 5KU1A 2JTZA 1R1SA 1ALVA 2FJYA 4CIDA 2OTGC 4UPGA 1K93D 4OC3A 1MW4A 4M4ZA 1IG5A 5BO4A 2K8MB 2BBMA 1Z8LA 1WRZA 4MSPA 3S9LA 1D1OA 2LC5A 2KPHA 1GM0A 3FE8A 2LE9B 3O4XA 1X6CA 1JUOA 3HPHE 3FE6A 2LUCA 1D4WA 3CD3A 1O4DA
chains in the Genus database with same CATH topology
2KQ6A 4GFTA 5D69A 4PHMA 1N0YA 1A75A 1ZACA 2BE6A 1DGVA 2F3YA 4YI9A 1O43A 2JOJA 1B1GA 2NLNA 2ZN8A 5DC9A 1F54A 3QRXA 1OQPA 2RMXA 3US4A 4NDBA 1KK7Y 1MR8A 1TTXA 2FCDA 2JU0A 2KFGA 3KFJA 3C1VA 1BHHB 1CFDA 2C0IA 2KGRA 1CDLA 1SCMC 2K7CA 5I2OA 2LVKA 3VGOA 1GHUA 2ECDA 1AJ5A 1QATA 2LNWA 1QJTA 4YGCB 4L1BB 1F4OA 3DF0B 5HLOA 1FU5A 4A4CA 1TOPA 1UHNA 3MAZA 4H34A 4U1PA 2BCAA 2JZIA 1O4AA 1AYCA 1QG1E 2BCXA 3DVMA 1BT6A 1XFWO 2KNOA 2KHNA 3IMJA 1SL8A 3DVEA 4P9ZA 3TKZA 3BUNB 2HDVA 2OPOA 3IN8A 2EO6A 4QJ5B 2LHLA 2K61A 5AERA 4MZJA 2BCBA 2PLDA 3QWYA 1BMOA 1OZSA 1WLMA 5TNCA 2ZNDA 2I18A 3MXYA 4PHJA 3VRYA 2M49B 2YU7A 2DM0A 1LCJA 3OHMB 1KK7Z 4ORCB 4ZCUA 3NHNA 1U5IB 2KAXA 2Q91A 2EYZA 2WNDA 2PVBA 3N7YA 2H61C 3CWGA 1NUBA 1O4GA 1TN4A 1G33A 1QX7A 1Y0VH 3PSKA 4ORBB 1IQ3A 4YGAA 2FJUB 4PALA 2IUIA 1O4PA 1QIVA 5AFPA 4K11A 1ALWA 3CTNA 3KHEA 3A4UB 1A1AA 1O44A 5DC4A 3I5HB 1A29A 2PTKA 3H4SE 4DS7A 1S5GY 2L4IA 2IUHA 1D1ZA 1GRIA 1EXRA 4JE4A 5CSIA 4LUEA 3VRNA 4F5AA 2KQYA 2LLTA 1AYAA 3EK7A 4I5JA 1AYDA 1BHHA 4XYNA 2WC8A 3CS1A 3K2MA 4OHIA 2KK6A 2CCMA 2E6WA 1LKKA 1KSMA 3DF0A 1A2XA 4P2YB 1BFIA 1CTRA 5BPJA 2FCIA 2FCEA 2LUXA 2EKXA 1M45A 1KSOA 2P6BB 2QPTA 1CJ1A 2Y5IA 1SMGA 1OPKA 2R2IA 1O4IA 3HCKA 1HCSB 1DJIA 3WXAA 1PRWA 3EKJA 3UF4A 1MXLC 1N65A 4GBAA 3D0YA 1DJHA 1DJZA 2KI4B 2LLSA 1CMFA 2F8PA 1JSAA 1A09A 2CIAA 2AAOA 1YR5A 3I5HC 1DMOA 1O4QA 2SHPA 5DC0B 4WWQA 3NSOA 2G2BA 3VS2A 1S3PA 1CWEA 5JJGA 4E68A 4BTFA 2DLYA 3LLEA 1A1EA 1DJXA 1SL9A 1FYRA 2DX0A 1KCYA 4NQGA 4C0LA 2EYYA 3BUMB 1BM2A 1O41A 5HLVA 2K7BA 2ZNEA 1YVLA 3TDIA 1TIZA 1DJGA 1KFXS 1X02A 2JPTA 1IJ6A 1KQMB 1U5IA 1OE9B 3PN7C 1CFPA 5CSFA 1A1BA 3BKBA 1O4NA 2I2RE 2BBNA 3NSKA 2MRJA 1Y1AA 1QLKA 2KI4C 4XJKB 1SPYA 4P5OE 1FW4A 1XK4A 1IJ5A 2JRFA 1OMDA 3TS5B 2CI8A 3CR2A 1TRFA 2IS9A 1A4PA 4DCKA 2YSXA 1IJRA 1C07A 1P13A 4GGFC 4PHKA 4DRWA 2AUGA 2K79B 1AB2A 1FMKA 2ZRTA 4WRIA 3IQOA 4N1FA 1BG1A 1QV1A 2ZRSA 2Y3AB 3EVUA 5CSJA 1B7TY 2K7OA 1O4HA 1KQMC 2JXLA 3EACA 4MZLA 1MUXA 3I5FB 2O60A 1O4FA 4FQOA 1K90D 2MJWB 2MRKA 1F4QA 3TDZA 1QIWA 3NSIA 2IUGA 1J1DA 3TS5C 1QVIY 1JBAA 1J1EA 3DVJA 1LA0A 3OX6A 2JULA 1A81A 1CLLA 1B8LA 4FL3A 5KSZA 1CSYA 4DUQA 3FIAA 1SYMA 4OHEA 4D8KA 3EK8A 3LK1A 2CNPA 2KBIA 1XFYO 1IRJA 1SR6B 1BF5A 4BY4A 3OP0A 3WHUB 5KAZA 1Q80A 1O4JA 2K7AB 2JYQA 5IBWA 2L51A 2JWWA 5G08A 4GGFA 2ISDA 1MHOA 3SJSA 1QX2A 2KFHA 4GWFA 5DKQA 4GNKB 1YRUB 1NYAA 2K0JA 1R6PA 2MRDA 5B8IB 2SASA 1FBZA 1RPYA 2AOBA 2JT3A 5GJIA 3I5FC 1CMGA 1H8BA 4FL2A 1RROA 1NZLA 1G83A 2CS0A 1K96A 1OOJA 4D1EA 1FBVA 1M61A 2HCKA 1K2HA 1BKMA 1CM4A 3OVEA 3S8NA 2KYCA 1BLJA 1ZFSA 2ZFDA 1LXFC 1B7TZ 1XFUO 3EKHA 2WORA 3N8MA 4E93A 2JTTA 2CXJA 2M1KB 2SCPA 1D4TA 3PSJA 1GQMA 1NIWA 1RJVA 2KYFA 2KI6D 2OZOA 1M39A 1EJ3A 1OZOA 1SR6C 2H2KA 3OB2B 2M29A 4LUDA 1FPWA 1NWDA 4AQJA 4F5BA 4MN0A 1QVIZ 1L2OB 1YX7A 2WCFA 4CPVA 1RECA 3RLZA 2KNEA 5D0JA 1TNPA 3LL8B 1B9AA 2WOSA 3GXXA 1QS7A 5GQQC 1BR4B 1J7OA 1OO4A 1A08A 1O4RA 1SRAA 1S36A 5HKZA 1NX0A 1HQVA 2L98A 1JWOA 1AVSA 2F2OA 5CSNA 1UURA 4M2OA 1PULA 5DKNA 5AXIA 2MBXA 4GPLB 3EAZA 2MK2A 1KFUL 3JTDB 1F71A 2L5XB 4WQ3A 3GQIB 3CR5X 2KAVA 1YTZC 2GGMA 4M2QA 2D8NA 1FHSA 1CB1A 2JXCA 2KI6C 2BBUA 1L2OC 1CDNA 4FBNA 5DF6A 1RQQC 3PJPA 3S9KA 1JF0A 1M31A 1YX8A 1KK8B 4GAOA 4YGBB 1V1GA 5AULA 1GGZA 1EH2A 1TNXA 2HUWA 2GGZA 2GE9A 1KFUS 1RTP1 4OKHA 3IQQA 4PCWA 4TNCA 1ZFPE 2L3TA 1SKTA 2LQNA 1ODBA 2TN4A 2NXQA 1K9AA 4YRUA 1LINA 1NCZA 5FYXA 3JTDC 2WCBA 1TNWA 1O4OA 2L4KA 3VRZA 2PRUA 1A1CA 1WRKA 2JNFA 2K2AA 3OX5A 1A07A 1PSBA 3CGAA 1X27A 2RSYA 1R1QA 1K9PA 2V53A 4ICBA 4MBEA 1SPRA 1R2UA 4OHHA 2QACA 4DIRA 1S6JA 2LMUA 2ZN9A 1F8HA 1O4CA 1O4KA 1SPSA 2BE4A 4F0ZB 1KK8C 1MWNA 1O4BA 3BYAA 4MEWA 3PALA 1W7JB 2JT8A 2H61A 3N84A 1J7RA 3ZNIA 4OHDA 1FU6A 2HF5A 1LUKA 2B3OA 1B47A 1K94A 4L9MA 4PHNA 3LK0A 1KFXL 2H46E 2M0RA 1CWDL 3BUWB 5AEQA 1FI5A 1QV0A 4ORAB 3ZWHA 2CBLA 5D7FA 5I6VA 5I8NA 1BODA 1O48A 1Y1UA 5CPVA 3SG4A 1XA6A 1NRVA 3CBLA 5CDWA 2E30A 4M2PA 1DF0B 1WQUA 2DVJA 2VIFA 1S5GZ 3BXKA 1BR1B 2M7NA 3EVVA 2ZKMX 1XFZO 2EHBA 3VS6A 1DGUA 1SCVA 4ZCVA 1BJFA 4F59A 2LVVA 1O47A 1J7PA 2LP3A 1GJYA 3KF9A 2XP1A 4OHLA 2LM5A 3GK4X 2K7DA 1UHKA 2Y1MA 4AOMA 1QCFA 3GK2A 1G8IA 3I5IB 5HKYA 1AP4A 1QX5B 1S6CA 1PICA 3M7FA 1ZOTB 1NCYA 1RWYA 1K95A 1NX1A 2O5GA 3AAKA 3BUOB 3AKBA 4I5LB 1JWDA 1OSAA 1ZUZA 2F33A 4OR9B 1BLQA 2GSBA 3GXWA 2A4JA 1BHFA 1QTXA 2CR4A 3SIBA 1YURA 2F2PA 1M27A 4QJ3B 2LLUA 1I3ZA 2LAPA 1RJAA 2BKHB 1NPQA 4NDDA 4FTGA 2EO3A 2LNXA 3JVTB 3TZ1A 2LNKA 4OCIA 1N2DA 2MLEC 3K21A 3KEVA 1BKLA 1KSWA 2ABLA 3I5IC 3LCPC 3OV1A 1PVAA 1O4MA 2C0OA 1YRTB 1SNLA 1Y1XA 2WCEA 1YVHA 2JC2A 3FWCA 1LKLA 1O42A 2KDHA 4R1EA 1WY9A 3I5GB 4MRXA 2COLB 1CM1A 5HYDA 1XFVO 1LVCD 2KSPA 1O4EA 3EK4A 4PE4A 1TCOB 3MXCA 1CLMA 1UP5A 1IH0A 4I5KA 3VS1A 1AUIB 2HPSA 1BLKA 1UUSA 2FO0A 1AYBA 4JPZB 3CXLA 2BL0B 4U8DA 1IGVA 3AKAA 3CLNA 4YBHB 1DF0A 1XA5A 1SHBA 1TZEE 2OS8B 4MZKA 3SIAA 3JVTC 4A4BA 4USLA 3BUXB 1FF1A 1NZVA 3S8OA 4CLNA 3C7IA 1WDCB 3MSEB 2AOAA 2HDXA 1SW8A 3PS5A 2HMHA 1KQVA 2RORA 2DOQA 5I2LA 4XJKA 1LUNA 1G4YR 4HRHA 3I5GC 1DVIA 4PE7A 5DKRA 2H5KA 1CKKA 3VS0A 1NX2A 2LMVA 4CFQA 1K9KA 1O49A 1OMRA 3O78A 2BECA 1XYDA 4C0JA 3QWXX 3GOFA 3D10A 2LV7A 3O4YA 1KC2A 4IL1A 2PASA 1ZMZA 2PMYA 1CLBA 2PLEA 2BL0C 1CNPA 3HX4A 3VRRA 4K2RA 3TDUA 2H8HA 3PM8A 2OS8C 1BFJA 1MF8B 1B8CA 4NWFA 4XZ1A 1DT7B 2Y1NA 1Y6WA 1WDCC 1DJYA 2M3WA 2OQ1A 3SG2A 1L7ZA 3CR4X 4MLWA 1JYUA 1PALA 1AOTF 2F3ZA 4U17A 1XFXO 1YUTA 2LHIA 3PSRA 5IBMA 2MAZA 3FS7A 4JEGA 4OV2A 3AAJA 2KBMA 2LMTA 1IS0A 4P9VA 2HETA 5EG3B 1JYRA 2L2EA 3F45A 1JF2A 1CFFA 1UHIA 3SG7A 1B8RA 2LVIA 3RM1A 4DGPA 1AD5A 1SL7A 3D0YB 5ER4X 1OPLA 1IWQA 1HT9A 1F2FA 1RFJA 1EG3A 4NWGA 4PE1A 2RVFA 2SRCA 2JNXA 3CZTX 2KFFA 4GL9E 1CDPA 2KOTA 4K45A 1JYQA 5EEQA 5HKWA 2CT9A 1QADA 1KA7A 4ETOA 3PQZA 3S8LA 1UHHA 2M1UA 3SG6A 3DD4A 3SG5A 1RK9A 4Q04A 1F1WA 2C0TA 4PE0A 4H1OA 3O2PA 3IN7A 3A8RA 1AHRA 2JT0A 2NCPA 1QASA 2LCPA 4I5NB 2HQWA 1KWOB 2KGBC 4MVFA 2EYVA 4HSZA 1HCTB 1IKUA 3E3RA 4QJ4B 1MQ1A 1BMBA 4TZIA 5IBSA 2EOBA 1PVBA 1F55A 1PK0D 2LQWA 1EL4A 3PFVA 5AANA 1NX3A 4C0KA 4YI8A 4N5XA 1R1PA 1SBJA 1H4BA 1IQ5A 3PLFB 5KTYA 2Q4UA 3VS3A 2PNAA 5K89A 1TNQA 3WHTB 2I94A 2JQ6A 2FOTA 2LVJA 4YGDB 3NXAA 1NP8A 2LP2A 1B4CA 1S6IA 1QXPA 2MHHA 3TUYB 1K9UA 2M7LA 1BU3A 1JFJA 1O4LA 2CRHA 3ICBA 4K44A 4NDCA 5PALA 1EG4A 2L50A 2L4HA 2KAYA 4GUKA 1KWOC 1KA6A 3IMDA 3OB1B 4XZ0A 4X6SA 3HHMB 3FWBA 3SG3A 2EU0A 2QMSA 1Z3KA 1H9OA 5EHRA 2EGDA 5F6TA 2NCOA 2PNBA 1C7VA 3VRPA 4HRGA 4MRYA 3T04A 2K2FA 2LANA 1JFKA 1XK4C 1WLZA 2CTNA 2NZ0A 3PN7B 3VROA 2IZVA 2OTGB 3DVKA 5JOLA 2DCRA 1WRLA 1W7IB 1YUSA 1J55A 3BOWB 3TL0A 4CFRA 3VS7A 1Y57A 3TUYC 4DGXA 4BY5A 1CDMA 1E8AA 1UHJA 1GGWA 4JWQA 4EY0A 5I2QA 2M8UA 3VS4A 2C9WA 3PATA 4QSYA 2MLFC 1UWOA 4HREE 2GV5A 1S26D 3VRQA 1SY9A 2EC6B 5KU1A 1FI6A 2JTZA 1R1SA 2AUCA 3KPXA 2I7AA 4GGNA 1MILA 1NSHA 1F70A 1A75B 3IF7A 5ER5A 1ALVA 3HIZB 1OO3A 4N1GA 4CIDA 1SHAA 1AJ4A 2BKIB 1K8UA 2LCTA 2OTGC 3UYOA 4JQ0D 4UPGA 1K93D 1NCXA 1MW4A 4PDZA 2ETZA 4M4ZA 1J7QA 2RGIA 1IG5A 1QLSA 2G9BA 4AQIA 3WA4A 2MQIA 1TCFA 5BO4A 2K8MB 1A03A 1JU5A 1MXEA 3GK1A 2BBMA 1S1EA 1WRZA 4OVNF 3BQ3A 1CFCA 2DLZA 2EC6C 4MSPA 5GJHA 3VS5A 1LA3A 1DTLA 2M9GA 1D1OA 2EL8A 5EHPA 2LC5A 4YGEB 1VRKA 2MA2A 4JGHA 3HCMA 1X0NA 1O45A 2HQ8A 1JC2A 2L6KA 1LCKA 1XVJA 2AMIA 1LKJA 4ROJA 1SK6D 4EIHA 1AOUF 3EVRA 2LE9B 1CSZA 2B1UA 3WNXB 2M97A 1BOCA 1LUIA 3KO0A 1LUMA 1X6CA 1YUUA 1JUOA 1SCMB 1V1FA 2L0PA 3O6BA 1AK8A 3BOWA 3NSLA 1SKJA 2CI9A 1C7WA 2PALA 1TCEA 1XO5A 1M63B 2LUCA 1SHDA 5EELA 1OMVA 1O46A 2Y4QA 1PSRA 2PSRA 2VRGA 1D4WA 5J3XA 1DJWA 3M0WA 3CD3A 4WQ2A 1M46A 2MC1A 1O4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ6 A;  4GFT A;  5D69 A;  4PHM A;  1N0Y A;  1A75 A;  1ZAC A;  2BE6 A;  1DGV A;  2F3Y A;  4YI9 A;  1O43 A;  2JOJ A;  1B1G A;  2NLN A;  2ZN8 A;  5DC9 A;  1F54 A;  3QRX A;  1OQP A;  2RMX A;  3US4 A;  4NDB A;  1KK7 Y;  1MR8 A;  1TTX A;  2FCD A;  2JU0 A;  2KFG A;  3KFJ A;  3C1V A;  1BHH B;  1CFD A;  2C0I A;  2KGR A;  1CDL A;  1SCM C;  2K7C A;  5I2O A;  2LVK A;  3VGO A;  1GHU A;  2ECD A;  1AJ5 A;  1QAT A;  2LNW A;  1QJT A;  4YGC B;  4L1B B;  1F4O A;  3DF0 B;  5HLO A;  1FU5 A;  4A4C A;  1TOP A;  1UHN A;  3MAZ A;  4H34 A;  4U1P A;  2BCA A;  2JZI A;  1O4A A;  1AYC A;  1QG1 E;  2BCX A;  3DVM A;  1BT6 A;  1XFW O;  2KNO A;  2KHN A;  3IMJ A;  1SL8 A;  3DVE A;  4P9Z A;  3TKZ A;  3BUN B;  2HDV A;  2OPO A;  3IN8 A;  2EO6 A;  4QJ5 B;  2LHL A;  2K61 A;  5AER A;  4MZJ A;  2BCB A;  2PLD A;  3QWY A;  1BMO A;  1OZS A;  1WLM A;  5TNC A;  2ZND A;  2I18 A;  3MXY A;  4PHJ A;  3VRY A;  2M49 B;  2YU7 A;  2DM0 A;  1LCJ A;  3OHM B;  1KK7 Z;  4ORC B;  4ZCU A;  3NHN A;  1U5I B;  2KAX A;  2Q91 A;  2EYZ A;  2WND A;  2PVB A;  3N7Y A;  2H61 C;  3CWG A;  1NUB A;  1O4G A;  1TN4 A;  1G33 A;  1QX7 A;  1Y0V H;  3PSK A;  4ORB B;  1IQ3 A;  4YGA A;  2FJU B;  4PAL A;  2IUI A;  1O4P A;  1QIV A;  5AFP A;  4K11 A;  1ALW A;  3CTN A;  3KHE A;  3A4U B;  1A1A A;  1O44 A;  5DC4 A;  3I5H B;  1A29 A;  2PTK A;  3H4S E;  4DS7 A;  1S5G Y;  2L4I A;  2IUH A;  1D1Z A;  1GRI A;  1EXR A;  4JE4 A;  5CSI A;  4LUE A;  3VRN A;  4F5A A;  2KQY A;  2LLT A;  1AYA A;  3EK7 A;  4I5J A;  1AYD A;  1BHH A;  4XYN A;  2WC8 A;  3CS1 A;  3K2M A;  4OHI A;  2KK6 A;  2CCM A;  2E6W A;  1LKK A;  1KSM A;  3DF0 A;  1A2X A;  4P2Y B;  1BFI A;  1CTR A;  5BPJ A;  2FCI A;  2FCE A;  2LUX A;  2EKX A;  1M45 A;  1KSO A;  2P6B B;  2QPT A;  1CJ1 A;  2Y5I A;  1SMG A;  1OPK A;  2R2I A;  1O4I A;  3HCK A;  1HCS B;  1DJI A;  3WXA A;  1PRW A;  3EKJ A;  3UF4 A;  1MXL C;  1N65 A;  4GBA A;  3D0Y A;  1DJH A;  1DJZ A;  2KI4 B;  2LLS A;  1CMF A;  2F8P A;  1JSA A;  1A09 A;  2CIA A;  2AAO A;  1YR5 A;  3I5H C;  1DMO A;  1O4Q A;  2SHP A;  5DC0 B;  4WWQ A;  3NSO A;  2G2B A;  3VS2 A;  1S3P A;  1CWE A;  5JJG A;  4E68 A;  4BTF A;  2DLY A;  3LLE A;  1A1E A;  1DJX A;  1SL9 A;  1FYR A;  2DX0 A;  1KCY A;  4NQG A;  4C0L A;  2EYY A;  3BUM B;  1BM2 A;  1O41 A;  5HLV A;  2K7B A;  2ZNE A;  1YVL A;  3TDI A;  1TIZ A;  1DJG A;  1KFX S;  1X02 A;  2JPT A;  1IJ6 A;  1KQM B;  1U5I A;  1OE9 B;  3PN7 C;  1CFP A;  5CSF A;  1A1B A;  3BKB A;  1O4N A;  2I2R E;  2BBN A;  3NSK A;  2MRJ A;  1Y1A A;  1QLK A;  2KI4 C;  4XJK B;  1SPY A;  4P5O E;  1FW4 A;  1XK4 A;  1IJ5 A;  2JRF A;  1OMD A;  3TS5 B;  2CI8 A;  3CR2 A;  1TRF A;  2IS9 A;  1A4P A;  4DCK A;  2YSX A;  1IJR A;  1C07 A;  1P13 A;  4GGF C;  4PHK A;  4DRW A;  2AUG A;  2K79 B;  1AB2 A;  1FMK A;  2ZRT A;  4WRI A;  3IQO A;  4N1F A;  1BG1 A;  1QV1 A;  2ZRS A;  2Y3A B;  3EVU A;  5CSJ A;  1B7T Y;  2K7O A;  1O4H A;  1KQM C;  2JXL A;  3EAC A;  4MZL A;  1MUX A;  3I5F B;  2O60 A;  1O4F A;  4FQO A;  1K90 D;  2MJW B;  2MRK A;  1F4Q A;  3TDZ A;  1QIW A;  3NSI A;  2IUG A;  1J1D A;  3TS5 C;  1QVI Y;  1JBA A;  1J1E A;  3DVJ A;  1LA0 A;  3OX6 A;  2JUL A;  1A81 A;  1CLL A;  1B8L A;  4FL3 A;  5KSZ A;  1CSY A;  4DUQ A;  3FIA A;  1SYM A;  4OHE A;  4D8K A;  3EK8 A;  3LK1 A;  2CNP A;  2KBI A;  1XFY O;  1IRJ A;  1SR6 B;  1BF5 A;  4BY4 A;  3OP0 A;  3WHU B;  5KAZ A;  1Q80 A;  1O4J A;  2K7A B;  2JYQ A;  5IBW A;  2L51 A;  2JWW A;  5G08 A;  4GGF A;  2ISD A;  1MHO A;  3SJS A;  1QX2 A;  2KFH A;  4GWF A;  5DKQ A;  4GNK B;  1YRU B;  1NYA A;  2K0J A;  1R6P A;  2MRD A;  5B8I B;  2SAS A;  1FBZ A;  1RPY A;  2AOB A;  2JT3 A;  5GJI A;  3I5F C;  1CMG A;  1H8B A;  4FL2 A;  1RRO A;  1NZL A;  1G83 A;  2CS0 A;  1K96 A;  1OOJ A;  4D1E A;  1FBV A;  1M61 A;  2HCK A;  1K2H A;  1BKM A;  1CM4 A;  3OVE A;  3S8N A;  2KYC A;  1BLJ A;  1ZFS A;  2ZFD A;  1LXF C;  1B7T Z;  1XFU O;  3EKH A;  2WOR A;  3N8M A;  4E93 A;  2JTT A;  2CXJ A;  2M1K B;  2SCP A;  1D4T A;  3PSJ A;  1GQM A;  1NIW A;  1RJV A;  2KYF A;  2KI6 D;  2OZO A;  1M39 A;  1EJ3 A;  1OZO A;  1SR6 C;  2H2K A;  3OB2 B;  2M29 A;  4LUD A;  1FPW A;  1NWD A;  4AQJ A;  4F5B A;  4MN0 A;  1QVI Z;  1L2O B;  1YX7 A;  2WCF A;  4CPV A;  1REC A;  3RLZ A;  2KNE A;  5D0J A;  1TNP A;  3LL8 B;  1B9A A;  2WOS A;  3GXX A;  1QS7 A;  5GQQ C;  1BR4 B;  1J7O A;  1OO4 A;  1A08 A;  1O4R A;  1SRA A;  1S36 A;  5HKZ A;  1NX0 A;  1HQV A;  2L98 A;  1JWO A;  1AVS A;  2F2O A;  5CSN A;  1UUR A;  4M2O A;  1PUL A;  5DKN A;  5AXI A;  2MBX A;  4GPL B;  3EAZ A;  2MK2 A;  1KFU L;  3JTD B;  1F71 A;  2L5X B;  4WQ3 A;  3GQI B;  3CR5 X;  2KAV A;  1YTZ C;  2GGM A;  4M2Q A;  2D8N A;  1FHS A;  1CB1 A;  2JXC A;  2KI6 C;  2BBU A;  1L2O C;  1CDN A;  4FBN A;  5DF6 A;  1RQQ C;  3PJP A;  3S9K A;  1JF0 A;  1M31 A;  1YX8 A;  1KK8 B;  4GAO A;  4YGB B;  1V1G A;  5AUL A;  1GGZ A;  1EH2 A;  1TNX A;  2HUW A;  2GGZ A;  2GE9 A;  1KFU S;  1RTP 1;  4OKH A;  3IQQ A;  4PCW A;  4TNC A;  1ZFP E;  2L3T A;  1SKT A;  2LQN A;  1ODB A;  2TN4 A;  2NXQ A;  1K9A A;  4YRU A;  1LIN A;  1NCZ A;  5FYX A;  3JTD C;  2WCB A;  1TNW A;  1O4O A;  2L4K A;  3VRZ A;  2PRU A;  1A1C A;  1WRK A;  2JNF A;  2K2A A;  3OX5 A;  1A07 A;  1PSB A;  3CGA A;  1X27 A;  2RSY A;  1R1Q A;  1K9P A;  2V53 A;  4ICB A;  4MBE A;  1SPR A;  1R2U A;  4OHH A;  2QAC A;  4DIR A;  1S6J A;  2LMU A;  2ZN9 A;  1F8H A;  1O4C A;  1O4K A;  1SPS A;  2BE4 A;  4F0Z B;  1KK8 C;  1MWN A;  1O4B A;  3BYA A;  4MEW A;  3PAL A;  1W7J B;  2JT8 A;  2H61 A;  3N84 A;  1J7R A;  3ZNI A;  4OHD A;  1FU6 A;  2HF5 A;  1LUK A;  2B3O A;  1B47 A;  1K94 A;  4L9M A;  4PHN A;  3LK0 A;  1KFX L;  2H46 E;  2M0R A;  1CWD L;  3BUW B;  5AEQ A;  1FI5 A;  1QV0 A;  4ORA B;  3ZWH A;  2CBL A;  5D7F A;  5I6V A;  5I8N A;  1BOD A;  1O48 A;  1Y1U A;  5CPV A;  3SG4 A;  1XA6 A;  1NRV A;  3CBL A;  5CDW A;  2E30 A;  4M2P A;  1DF0 B;  1WQU A;  2DVJ A;  2VIF A;  1S5G Z;  3BXK A;  1BR1 B;  2M7N A;  3EVV A;  2ZKM X;  1XFZ O;  2EHB A;  3VS6 A;  1DGU A;  1SCV A;  4ZCV A;  1BJF A;  4F59 A;  2LVV A;  1O47 A;  1J7P A;  2LP3 A;  1GJY A;  3KF9 A;  2XP1 A;  4OHL A;  2LM5 A;  3GK4 X;  2K7D A;  1UHK A;  2Y1M A;  4AOM A;  1QCF A;  3GK2 A;  1G8I A;  3I5I B;  5HKY A;  1AP4 A;  1QX5 B;  1S6C A;  1PIC A;  3M7F A;  1ZOT B;  1NCY A;  1RWY A;  1K95 A;  1NX1 A;  2O5G A;  3AAK A;  3BUO B;  3AKB A;  4I5L B;  1JWD A;  1OSA A;  1ZUZ A;  2F33 A;  4OR9 B;  1BLQ A;  2GSB A;  3GXW A;  2A4J A;  1BHF A;  1QTX A;  2CR4 A;  3SIB A;  1YUR A;  2F2P A;  1M27 A;  4QJ3 B;  2LLU A;  1I3Z A;  2LAP A;  1RJA A;  2BKH B;  1NPQ A;  4NDD A;  4FTG A;  2EO3 A;  2LNX A;  3JVT B;  3TZ1 A;  2LNK A;  4OCI A;  1N2D A;  2MLE C;  3K21 A;  3KEV A;  1BKL A;  1KSW A;  2ABL A;  3I5I C;  3LCP C;  3OV1 A;  1PVA A;  1O4M A;  2C0O A;  1YRT B;  1SNL A;  1Y1X A;  2WCE A;  1YVH A;  2JC2 A;  3FWC A;  1LKL A;  1O42 A;  2KDH A;  4R1E A;  1WY9 A;  3I5G B;  4MRX A;  2COL B;  1CM1 A;  5HYD A;  1XFV O;  1LVC D;  2KSP A;  1O4E A;  3EK4 A;  4PE4 A;  1TCO B;  3MXC A;  1CLM A;  1UP5 A;  1IH0 A;  4I5K A;  3VS1 A;  1AUI B;  2HPS A;  1BLK A;  1UUS A;  2FO0 A;  1AYB A;  4JPZ B;  3CXL A;  2BL0 B;  4U8D A;  1IGV A;  3AKA A;  3CLN A;  4YBH B;  1DF0 A;  1XA5 A;  1SHB A;  1TZE E;  2OS8 B;  4MZK A;  3SIA A;  3JVT C;  4A4B A;  4USL A;  3BUX B;  1FF1 A;  1NZV A;  3S8O A;  4CLN A;  3C7I A;  1WDC B;  3MSE B;  2AOA A;  2HDX A;  1SW8 A;  3PS5 A;  2HMH A;  1KQV A;  2ROR A;  2DOQ A;  5I2L A;  4XJK A;  1LUN A;  1G4Y R;  4HRH A;  3I5G C;  1DVI A;  4PE7 A;  5DKR A;  2H5K A;  1CKK A;  3VS0 A;  1NX2 A;  2LMV A;  4CFQ A;  1K9K A;  1O49 A;  1OMR A;  3O78 A;  2BEC A;  1XYD A;  4C0J A;  3QWX X;  3GOF A;  3D10 A;  2LV7 A;  3O4Y A;  1KC2 A;  4IL1 A;  2PAS A;  1ZMZ A;  2PMY A;  1CLB A;  2PLE A;  2BL0 C;  1CNP A;  3HX4 A;  3VRR A;  4K2R A;  3TDU A;  2H8H A;  3PM8 A;  2OS8 C;  1BFJ A;  1MF8 B;  1B8C A;  4NWF A;  4XZ1 A;  1DT7 B;  2Y1N A;  1Y6W A;  1WDC C;  1DJY A;  2M3W A;  2OQ1 A;  3SG2 A;  1L7Z A;  3CR4 X;  4MLW A;  1JYU A;  1PAL A;  1AOT F;  2F3Z A;  4U17 A;  1XFX O;  1YUT A;  2LHI A;  3PSR A;  5IBM A;  2MAZ A;  3FS7 A;  4JEG A;  4OV2 A;  3AAJ A;  2KBM A;  2LMT A;  1IS0 A;  4P9V A;  2HET A;  5EG3 B;  1JYR A;  2L2E A;  3F45 A;  1JF2 A;  1CFF A;  1UHI A;  3SG7 A;  1B8R A;  2LVI A;  3RM1 A;  4DGP A;  1AD5 A;  1SL7 A;  3D0Y B;  5ER4 X;  1OPL A;  1IWQ A;  1HT9 A;  1F2F A;  1RFJ A;  1EG3 A;  4NWG A;  4PE1 A;  2RVF A;  2SRC A;  2JNX A;  3CZT X;  2KFF A;  4GL9 E;  1CDP A;  2KOT A;  4K45 A;  1JYQ A;  5EEQ A;  5HKW A;  2CT9 A;  1QAD A;  1KA7 A;  4ETO A;  3PQZ A;  3S8L A;  1UHH A;  2M1U A;  3SG6 A;  3DD4 A;  3SG5 A;  1RK9 A;  4Q04 A;  1F1W A;  2C0T A;  4PE0 A;  4H1O A;  3O2P A;  3IN7 A;  3A8R A;  1AHR A;  2JT0 A;  2NCP A;  1QAS A;  2LCP A;  4I5N B;  2HQW A;  1KWO B;  2KGB C;  4MVF A;  2EYV A;  4HSZ A;  1HCT B;  1IKU A;  3E3R A;  4QJ4 B;  1MQ1 A;  1BMB A;  4TZI A;  5IBS A;  2EOB A;  1PVB A;  1F55 A;  1PK0 D;  2LQW A;  1EL4 A;  3PFV A;  5AAN A;  1NX3 A;  4C0K A;  4YI8 A;  4N5X A;  1R1P A;  1SBJ A;  1H4B A;  1IQ5 A;  3PLF B;  5KTY A;  2Q4U A;  3VS3 A;  2PNA A;  5K89 A;  1TNQ A;  3WHT B;  2I94 A;  2JQ6 A;  2FOT A;  2LVJ A;  4YGD B;  3NXA A;  1NP8 A;  2LP2 A;  1B4C A;  1S6I A;  1QXP A;  2MHH A;  3TUY B;  1K9U A;  2M7L A;  1BU3 A;  1JFJ A;  1O4L A;  2CRH A;  3ICB A;  4K44 A;  4NDC A;  5PAL A;  1EG4 A;  2L50 A;  2L4H A;  2KAY A;  4GUK A;  1KWO C;  1KA6 A;  3IMD A;  3OB1 B;  4XZ0 A;  4X6S A;  3HHM B;  3FWB A;  3SG3 A;  2EU0 A;  2QMS A;  1Z3K A;  1H9O A;  5EHR A;  2EGD A;  5F6T A;  2NCO A;  2PNB A;  1C7V A;  3VRP A;  4HRG A;  4MRY A;  3T04 A;  2K2F A;  2LAN A;  1JFK A;  1XK4 C;  1WLZ A;  2CTN A;  2NZ0 A;  3PN7 B;  3VRO A;  2IZV A;  2OTG B;  3DVK A;  5JOL A;  2DCR A;  1WRL A;  1W7I B;  1YUS A;  1J55 A;  3BOW B;  3TL0 A;  4CFR A;  3VS7 A;  1Y57 A;  3TUY C;  4DGX A;  4BY5 A;  1CDM A;  1E8A A;  1UHJ A;  1GGW A;  4JWQ A;  4EY0 A;  5I2Q A;  2M8U A;  3VS4 A;  2C9W A;  3PAT A;  4QSY A;  2MLF C;  1UWO A;  4HRE E;  2GV5 A;  1S26 D;  3VRQ A;  1SY9 A;  2EC6 B;  5KU1 A;  1FI6 A;  2JTZ A;  1R1S A;  2AUC A;  3KPX A;  2I7A A;  4GGN A;  1MIL A;  1NSH A;  1F70 A;  1A75 B;  3IF7 A;  5ER5 A;  1ALV A;  3HIZ B;  1OO3 A;  4N1G A;  4CID A;  1SHA A;  1AJ4 A;  2BKI B;  1K8U A;  2LCT A;  2OTG C;  3UYO A;  4JQ0 D;  4UPG A;  1K93 D;  1NCX A;  1MW4 A;  4PDZ A;  2ETZ A;  4M4Z A;  1J7Q A;  2RGI A;  1IG5 A;  1QLS A;  2G9B A;  4AQI A;  3WA4 A;  2MQI A;  1TCF A;  5BO4 A;  2K8M B;  1A03 A;  1JU5 A;  1MXE A;  3GK1 A;  2BBM A;  1S1E A;  1WRZ A;  4OVN F;  3BQ3 A;  1CFC A;  2DLZ A;  2EC6 C;  4MSP A;  5GJH A;  3VS5 A;  1LA3 A;  1DTL A;  2M9G A;  1D1O A;  2EL8 A;  5EHP A;  2LC5 A;  4YGE B;  1VRK A;  2MA2 A;  4JGH A;  3HCM A;  1X0N A;  1O45 A;  2HQ8 A;  1JC2 A;  2L6K A;  1LCK A;  1XVJ A;  2AMI A;  1LKJ A;  4ROJ A;  1SK6 D;  4EIH A;  1AOU F;  3EVR A;  2LE9 B;  1CSZ A;  2B1U A;  3WNX B;  2M97 A;  1BOC A;  1LUI A;  3KO0 A;  1LUM A;  1X6C A;  1YUU A;  1JUO A;  1SCM B;  1V1F A;  2L0P A;  3O6B A;  1AK8 A;  3BOW A;  3NSL A;  1SKJ A;  2CI9 A;  1C7W A;  2PAL A;  1TCE A;  1XO5 A;  1M63 B;  2LUC A;  1SHD A;  5EEL A;  1OMV A;  1O46 A;  2Y4Q A;  1PSR A;  2PSR A;  2VRG A;  1D4W A;  5J3X A;  1DJW A;  3M0W A;  3CD3 A;  4WQ2 A;  1M46 A;  2MC1 A;  1O4D A; 
#chains in the Genus database with same CATH topology
 5D69 A;  1ZAC A;  1A75 A;  1O43 A;  1B1G A;  5DC9 A;  1F54 A;  3US4 A;  3KFJ A;  1BHH B;  1CDL A;  2LVK A;  2LNW A;  4L1B B;  1DE4 C;  3B6X A;  4U1P A;  1O4A A;  3DVM A;  2OR4 A;  3S0G A;  3DVE A;  4P9Z A;  3IN8 A;  2LHL A;  2BCB A;  4BPX B;  2PLD A;  2ZND A;  1KK7 Z;  3NFQ A;  2Q91 A;  2WND A;  3N7Y A;  1NUB A;  1O4G A;  1TN4 A;  3PSK A;  1O4P A;  4K11 A;  1ALW A;  1A1A A;  4JZ0 A;  2IUH A;  2KQY A;  2LLT A;  4I5J A;  3DXL A;  2WC8 A;  3BI1 A;  4OHI A;  4P2Y B;  2QPT A;  2P71 A;  1SMG A;  1HCS B;  2G2B A;  5JJG A;  4BTF A;  3LLE A;  3D7D A;  1BM2 A;  2K7B A;  3TDI A;  1O4J A;  1A1B A;  1CFP A;  1IJ5 A;  1OMD A;  2CI8 A;  3CR2 A;  1TRF A;  4DRW A;  3IQO A;  4N1F A;  3EG5 B;  2ZRS A;  2Y3A B;  3EVU A;  1O4H A;  2MRK A;  1J1D A;  1JBA A;  1J1E A;  1TUZ A;  3DVJ A;  1LA0 A;  1A81 A;  1CLL A;  1CSY A;  3FIA A;  1SR6 B;  2JWW A;  4GGF A;  1MHO A;  3SJS A;  4GWF A;  1NYA A;  5B8I B;  1FBZ A;  1RPY A;  1CMG A;  1H8B A;  2PVW A;  4FL2 A;  1RRO A;  2K60 A;  1K2H A;  1BKM A;  1CM4 A;  2ZFD A;  1LXF C;  2KYF A;  2OZO A;  1M39 A;  1EJ3 A;  1SR6 C;  1FPW A;  4AQJ A;  1QVI Z;  1L2O B;  1B9A A;  3GXX A;  5GQQ C;  1BR4 B;  1J7O A;  5D29 A;  1JWO A;  3EAZ A;  1KFU L;  4WQ3 A;  3GQI B;  3CAB A;  1FHS A;  2D8N A;  2JXC A;  1L2O C;  1CDN A;  3PJP A;  3S9K A;  1V1G A;  1TNX A;  3SJX A;  2HUW A;  1RTP 1;  1SKT A;  1WRK A;  2JNF A;  1K9P A;  3PT1 A;  4F0Z B;  1O4B A;  3NGV A;  3BYA A;  1W7J B;  2H61 A;  3N84 A;  1J7R A;  3OAK A;  2HF5 A;  4L9M A;  3LK0 A;  2WC6 A;  1CWD L;  2QDI A;  1QV0 A;  3ZWH A;  2CBL A;  2L5Y A;  1BR1 B;  2M7N A;  1DGU A;  2LVV A;  1J7P A;  2WCK A;  2XP1 A;  2K7D A;  1UHK A;  1QCF A;  5HKY A;  1NCY A;  1RWY A;  3AAK A;  3GXW A;  1QTX A;  3SIB A;  1YUR A;  2F2P A;  1M27 A;  2LLU A;  2BKH B;  4FTG A;  3JVT B;  1N2D A;  1BKL A;  3CZ0 A;  1KSW A;  2ABL A;  3LCP C;  3OV1 A;  1PVA A;  3B7A A;  3UYO A;  1Y1X A;  2JC2 A;  2PYQ A;  4MRX A;  5HYD A;  1UP5 A;  1IH0 A;  3VS1 A;  3HMJ G;  2FO0 A;  2BL0 B;  4YBH B;  2YGU A;  3AKA A;  3CLN A;  1TZE E;  2OS8 B;  4MZK A;  3JVT C;  3C7I A;  1SW8 A;  2HMH A;  1KQV A;  3K1E A;  1G4Y R;  4PE7 A;  1DVI A;  4CFQ A;  3QWX X;  2LV7 A;  2BL0 C;  1CNP A;  3VRR A;  2OS8 C;  1MF8 B;  1B8C A;  1DT7 B;  2M3W A;  4P4D A;  1L7Z A;  3CR4 X;  1PAL A;  2F3Z A;  1XFX O;  5IBM A;  4OV2 A;  3AAJ A;  2LMT A;  3F45 A;  1CFF A;  1UHI A;  4DGP A;  1HT9 A;  1F2F A;  1EG3 A;  2SRC A;  4GL9 E;  2KFF A;  1JYQ A;  5HKW A;  2CT9 A;  1F1W A;  2M1U A;  4NGN A;  3DD4 A;  3SG5 A;  4H1O A;  3IN7 A;  2NCP A;  1QAS A;  3B87 A;  2KGB C;  1BMB A;  4TZI A;  2EOB A;  1PVB A;  3CZ1 A;  1NX3 A;  3SS5 A;  4C0K A;  1IQ5 A;  2PNA A;  3S0E A;  1TNQ A;  3WHT B;  2LP2 A;  1O4L A;  1JFJ A;  1QXP A;  2MHH A;  2M7L A;  1BU3 A;  2L50 A;  2KAY A;  2XPO A;  3IMD A;  1H9O A;  5EHR A;  4HRG A;  2K2F A;  2LAN A;  2NZ0 A;  3DVK A;  2DCR A;  1WRL A;  3VS7 A;  4BY5 A;  3D74 A;  2C9W A;  4HRE E;  1S26 D;  3VRQ A;  2EC6 B;  1FI6 A;  2AUC A;  3KPX A;  2I7A A;  1NSH A;  5ER5 A;  2B4J C;  3NHT A;  1OO3 A;  1AJ4 A;  1K8U A;  2LCT A;  5FI6 A;  2ETZ A;  4P4J A;  1MXE A;  1S1E A;  2EC6 C;  4YGE B;  1VRK A;  1X0N A;  4INW A;  2PQL A;  2AMI A;  4EIH A;  3U88 C;  3EVR A;  1CSZ A;  1Y57 A;  3KO0 A;  1YUU A;  3O6B A;  4BPU B;  3BOW A;  3NSL A;  1XO5 A;  3SJF A;  1OMV A;  2Y4Q A;  2VRG A;  5J3X A;  2KQ6 A;  1N0Y A;  2ZN8 A;  1TTX A;  2KFG A;  3OGN A;  1CFD A;  2KGR A;  2K7C A;  3VGO A;  1QAT A;  5HLO A;  4P4B A;  4OC1 A;  1TOP A;  3MAZ A;  2JZI A;  3BUN B;  2HDV A;  2OPO A;  2EO6 A;  1OZS A;  3MXY A;  2DM0 A;  3NHN A;  1U5I B;  4MCS A;  2H61 C;  3CWG A;  1G33 A;  1QX7 A;  4ORB B;  2FJU B;  4PAL A;  2IUI A;  5AFP A;  3A4U B;  5DIC A;  4DS7 A;  4LUE A;  1GRI A;  1CX8 A;  2JBJ A;  1AYD A;  3K2M A;  2KK6 A;  3DF0 A;  1BFI A;  2FCI A;  2FCE A;  3HCK A;  2P6B B;  2R2I A;  3UF4 A;  1MXL C;  1DJH A;  1DJZ A;  2KI4 B;  2LLS A;  1O4Q A;  5DC0 B;  3SS4 A;  3S9M A;  4WWQ A;  1CWE A;  2DLY A;  3Q8I A;  2DX0 A;  2EYY A;  1O41 A;  5HLV A;  2JPT A;  1OE9 B;  1O4N A;  2I2R E;  1QLK A;  2KI4 C;  1SPY A;  2XEI A;  4MCR A;  1A4P A;  4DCK A;  2K79 B;  1AB2 A;  1FMK A;  5CSJ A;  1B7T Y;  2K7O A;  2OOT A;  3I5F B;  4KYN A;  4FQO A;  2MJW B;  1QIW A;  3NSI A;  2WCH A;  3OX6 A;  4FL3 A;  5KSZ A;  3EK8 A;  1XFY O;  3OP0 A;  3WHU B;  2JYQ A;  5IBW A;  2MRD A;  2K0J A;  3N7H A;  3I5F C;  3QME A;  1FBV A;  2HCK A;  3S8N A;  1XFU O;  4E93 A;  2JTT A;  2CXJ A;  1D4T A;  1GQM A;  1NIW A;  5F13 A;  2M29 A;  4CPV A;  1YX7 A;  1REC A;  2KNE A;  5D0J A;  3LL8 B;  4PT1 A;  1QS7 A;  4JD9 A;  3DY9 A;  1O4R A;  3IVT A;  1HQV A;  1UUR A;  4M2O A;  3CR5 X;  2KAV A;  1YTZ C;  3FEC A;  1CB1 A;  1RQQ C;  3LYV A;  4NGR A;  1M31 A;  1YX8 A;  3S0F A;  2XPN A;  2GGZ A;  3IQQ A;  4PCW A;  2NXQ A;  1K9A A;  2WCB A;  2RSY A;  1A07 A;  1PSB A;  1SPR A;  4OHH A;  1LS8 A;  2QAC A;  4DIR A;  2LMU A;  2ZN9 A;  1TWO A;  3D73 A;  1T14 A;  4PHN A;  1KFX L;  2H46 E;  5AEQ A;  5D7F A;  5I8N A;  1O48 A;  1Y1U A;  3CBL A;  2E30 A;  3D78 A;  1DF0 B;  3BXK A;  3S9N A;  3VS6 A;  4ZCV A;  2LP3 A;  3KF9 A;  2Y1M A;  1G8I A;  3VB1 A;  1S6C A;  1K95 A;  1JWD A;  4OR9 B;  2A4J A;  1BHF A;  3D7H A;  2UV8 G;  1I3Z A;  1RJA A;  1NPQ A;  4NDD A;  2LNX A;  3K21 A;  1TUJ A;  2WCE A;  1WY9 A;  2COL B;  1CM1 A;  1XFV O;  2KSP A;  1O4E A;  3MXC A;  2WCM A;  1BLK A;  1UUS A;  3CXL A;  4U8D A;  1IGV A;  1SHB A;  1NZV A;  4A4B A;  4USL A;  4CLN A;  3PJI A;  1IIO A;  4XJK A;  1OOI X;  4HRH A;  4OC5 A;  2LMV A;  1O49 A;  3O78 A;  2BEC A;  4NGS A;  3D10 A;  1KC2 A;  2PAS A;  1ZMZ A;  2PLE A;  3HX4 A;  4K2R A;  3TDU A;  1BFJ A;  1P28 A;  4XZ1 A;  3SG2 A;  4MLW A;  1YUT A;  3PSR A;  4JEG A;  2HET A;  1JF2 A;  1OOG A;  1B8R A;  3RZS A;  2C6G A;  1OPL A;  5ER4 X;  5F09 A;  4PE1 A;  4OC4 A;  1CDP A;  2JBK A;  4K45 A;  1QAD A;  3PQZ A;  1KA7 A;  4ETO A;  3S8L A;  3SG6 A;  2C0T A;  1RK9 A;  3O2P A;  1AHR A;  2JT0 A;  2LCP A;  3OBV A;  2HQW A;  4MVF A;  1HCT B;  2LQW A;  4YI8 A;  1SBJ A;  2Q4U A;  4P45 A;  4P4E A;  1B4C A;  2FOT A;  2LVJ A;  1IS0 A;  3NXA A;  1S6I A;  2CRH A;  1EG4 A;  3OB1 B;  3HHM B;  3FWB A;  3SG3 A;  1Z3K A;  5F6T A;  3T04 A;  3PN7 B;  1JFK A;  2CTN A;  4CFR A;  1CDM A;  1UHJ A;  3VS4 A;  1QWV A;  2MLF C;  4NGQ A;  4GGN A;  1F70 A;  1A75 B;  4N1G A;  1SHA A;  2BKI B;  4JQ0 D;  2KLD A;  2RGI A;  2G9B A;  3WA4 A;  2MQI A;  1TCF A;  1JU5 A;  1CFC A;  3BQ3 A;  5GJH A;  1LA3 A;  1DTL A;  5EHP A;  2MA2 A;  1OW4 A;  2HQ8 A;  1LCK A;  1LKJ A;  1AOU F;  5HL1 A;  4INX A;  3WNX B;  2M97 A;  1LUM A;  2L0P A;  1SKJ A;  2CI9 A;  4X3R A;  1M63 B;  1SHD A;  5EEL A;  1PSR A;  3M0W A;  4WQ2 A;  1AP4 A;  3O4Y A;  1M46 A;  4GFT A;  2F3Y A;  4NGM A;  2JOJ A;  3QRX A;  2RMX A;  1KK7 Y;  1MR8 A;  2FCD A;  2JU0 A;  1GHU A;  3S0A A;  4YGC B;  3BFH A;  1FU5 A;  1UHN A;  3K2T A;  3S0D A;  1BT6 A;  2KNO A;  2KHN A;  3IMJ A;  3TKZ A;  2WCJ A;  2K61 A;  5AER A;  4MZJ A;  3QWY A;  5TNC A;  3VRY A;  3FED A;  1LCJ A;  4ORC B;  3BFB A;  4ZCU A;  2KAX A;  2KLE A;  2EYZ A;  4YGA A;  1QIV A;  2BAP A;  3KHE A;  5DC4 A;  3BJH A;  4F5A A;  1EXR A;  5CSI A;  1DC1 A;  3VRN A;  1BHH A;  3EK7 A;  3CS1 A;  2CCM A;  2E6W A;  1LKK A;  1KSM A;  4NGP A;  1CTR A;  1M45 A;  1KSO A;  1CJ1 A;  1OPK A;  2Y5I A;  3EKJ A;  1N65 A;  4GBA A;  3SS3 A;  3D0Y A;  4H34 A;  2F8P A;  2AAO A;  3D7F A;  3NSO A;  3VS2 A;  1A1E A;  1SSE B;  1FYR A;  2XEG A;  1YVL A;  1TIZ A;  3CZ2 A;  1DJG A;  1X02 A;  1KQM B;  4IJ7 A;  5CSF A;  4XJK B;  1XK4 A;  2IS9 A;  1P13 A;  4GGF C;  2AUG A;  2ZRT A;  3PM2 A;  3O8Z A;  1XFR A;  1KQM C;  4MZL A;  1MUX A;  2O60 A;  1O4F A;  1K90 D;  2IUG A;  1QVI Y;  4DUQ A;  4D8K A;  3LK1 A;  2CNP A;  1IRJ A;  4BY4 A;  1Q80 A;  2ISD A;  1QX2 A;  2KFH A;  1YRU B;  1R6P A;  2SAS A;  1NZL A;  1G83 A;  2CS0 A;  4D1E A;  1M61 A;  2KYC A;  3N8M A;  2M1K B;  3PSJ A;  1OZO A;  2H2K A;  3OB2 B;  4F5B A;  4F7F A;  1NWD A;  4MN0 A;  1OO4 A;  1SRA A;  3R72 A;  2BNX A;  1DEL A;  1NX0 A;  1AVS A;  5CSN A;  2MBX A;  1F71 A;  4JKT A;  4FBN A;  2KI6 C;  5DF6 A;  1JF0 A;  4GAO A;  5AUL A;  1GGZ A;  1EH2 A;  2GE9 A;  4TNC A;  1ZFP E;  2L3T A;  3FE9 A;  2ERB A;  2TN4 A;  5FI7 A;  4YRU A;  1LIN A;  1NCZ A;  5FYX A;  1TNW A;  2L4K A;  2PRU A;  1X27 A;  3CGA A;  1R1Q A;  4ICB A;  2LRA A;  4MBE A;  1R2U A;  1SPS A;  3UNW A;  4BPW B;  1O4K A;  4MEW A;  3HPG G;  3PAL A;  2JT8 A;  4OHD A;  3ZNI A;  1FU6 A;  4NGT A;  1LUK A;  2B3O A;  1K94 A;  3DYE A;  2M0R A;  1FI5 A;  5I6V A;  1BOD A;  3SG4 A;  1XA6 A;  1NRV A;  1WQU A;  1S5G Z;  4F59 A;  3F9K C;  1O47 A;  3NHI A;  1GJY A;  4OHL A;  1QX5 B;  3M7F A;  1ZOT B;  2C6P A;  4RR2 B;  2O5G A;  3IWW A;  2DLA A;  2F33 A;  1BLQ A;  2GSB A;  5D3O A;  2CR4 A;  2QEV A;  4QJ3 B;  2LAP A;  2EO3 A;  2LNK A;  2MLE C;  2N3A B;  3CDN A;  1O4M A;  1YRT B;  1LKL A;  1YVH A;  4R1E A;  1LVC D;  1CLM A;  1AUI B;  3BFA A;  2HPS A;  4JPZ B;  3SIA A;  1FF1 A;  1WDC B;  2HDX A;  5EL2 A;  2ROR A;  2DOQ A;  5I2L A;  1LUN A;  5DKR A;  3VS0 A;  2H5K A;  1CKK A;  1NX2 A;  4P4I A;  3SJE A;  1XYD A;  2PMY A;  5I94 A;  2Y1N A;  1WDC C;  2OQ1 A;  1JYU A;  1AOT F;  5BY0 A;  2QEB A;  3FS7 A;  2KBM A;  2L2E A;  4MCQ A;  2LVI A;  3RM1 A;  3D0Y B;  1RFJ A;  2JNX A;  2KOT A;  3L4L A;  3A8R A;  1IKU A;  2CIJ A;  3E3R A;  3B86 A;  5IBS A;  1OOH A;  1F55 A;  1PK0 D;  2P70 A;  1EL4 A;  3PLF B;  5KTY A;  2XEJ A;  3VS3 A;  2I94 A;  1NP8 A;  4JE4 A;  4K44 A;  5PAL A;  2L4H A;  2EU0 A;  2QMS A;  2EGD A;  1C7V A;  3VRP A;  4MRY A;  3VRO A;  1XK4 C;  2IZV A;  2GTE A;  5JOL A;  1W7I B;  1J55 A;  3BOW B;  3TL0 A;  4DGX A;  4EY0 A;  2M8U A;  4QSY A;  1UWO A;  2GV5 A;  1MIL A;  3IF7 A;  3HIZ B;  1NCX A;  4PDZ A;  1J7Q A;  1QLS A;  4AQI A;  1A03 A;  1ORG A;  3GK1 A;  4OME A;  4OVN F;  2DLZ A;  3VS5 A;  3R1P A;  2M9G A;  2EL8 A;  4JGH A;  3HCM A;  1O45 A;  1JC2 A;  2L6K A;  3L47 A;  1XVJ A;  3FF3 A;  4ROJ A;  1SK6 D;  4P44 A;  1Z9E A;  2B1U A;  1BOC A;  1LUI A;  1SCM B;  1V1F A;  1AK8 A;  1C7W A;  2PAL A;  1TCE A;  1OOF A;  1O46 A;  2PSR A;  1DJW A;  2MC1 A;  4PHM A;  2BE6 A;  1DGV A;  4YI9 A;  2NLN A;  1OQP A;  4NDB A;  1C3Y A;  3C1V A;  2C0I A;  1SCM C;  3BXM A;  5I2O A;  4LQG A;  1AJ5 A;  1QJT A;  1DEK A;  1F4O A;  3DF0 B;  3KAS A;  4A4C A;  3UO9 A;  2BCA A;  1AYC A;  1QG1 E;  2BCX A;  2VKZ G;  3D7G A;  1XFW O;  1SL8 A;  4QJ5 B;  1BMO A;  1WLM A;  2I18 A;  4PHJ A;  2M49 B;  2YU7 A;  3OHM B;  2PVB A;  1Y0V H;  1IQ3 A;  2XEF A;  2KGY A;  3CTN A;  1O44 A;  4W9Y A;  3I5H B;  1A29 A;  2PTK A;  3H4S E;  1S5G Y;  2L4I A;  1D1Z A;  1AYA A;  4XYN A;  1A2X A;  5BPJ A;  2LUX A;  2EKX A;  1O4I A;  1DJI A;  3WXA A;  1PRW A;  1CMF A;  1JSA A;  1A09 A;  2CIA A;  3R1O A;  2SHP A;  1YR5 A;  3I5H C;  1DMO A;  1S3P A;  4E68 A;  3RBU A;  1DJX A;  1SL9 A;  1KCY A;  4NQG A;  4C0L A;  3BUM B;  2ZNE A;  1KFX S;  2EYV A;  1IJ6 A;  1U5I A;  3PN7 C;  3BKB A;  2WC5 A;  2BBN A;  3NSK A;  2MRJ A;  1Y1A A;  2XPP A;  4P5O E;  1FW4 A;  2JRF A;  3TS5 B;  2YSX A;  2QEH A;  1IJR A;  1C07 A;  4PHK A;  4WRI A;  1BG1 A;  1QV1 A;  2JXL A;  3EAC A;  1F4Q A;  3TDZ A;  3TS5 C;  2JUL A;  1B8L A;  4OHE A;  1SYM A;  2KBI A;  1BF5 A;  5KAZ A;  2K7A B;  2L51 A;  5G08 A;  5DKQ A;  4GNK B;  2AOB A;  2JT3 A;  5GJI A;  1K96 A;  1W9Z A;  1OOJ A;  3OVE A;  1BLJ A;  1ZFS A;  3EKH A;  1B7T Z;  2WOR A;  3SJG A;  2SCP A;  1RJV A;  2KI6 D;  4LUD A;  2WCF A;  3RLZ A;  1TNP A;  2WOS A;  1A08 A;  1S36 A;  5HKZ A;  2L98 A;  1WJT A;  2F2O A;  3DZT A;  1PUL A;  3B88 A;  5DKN A;  5AXI A;  4GPL B;  2MK2 A;  3JTD B;  2L5X B;  2XPL A;  2GGM A;  4M2Q A;  2BBU A;  4YGB B;  1KK8 B;  2JPO A;  4OZD A;  3D77 A;  1KFU S;  4OKH A;  4OC0 A;  2LQN A;  1ODB A;  3JTD C;  3V2L A;  1O4O A;  3VRZ A;  1A1C A;  3OX5 A;  2K2A A;  2V53 A;  1S6J A;  1O4C A;  1F8H A;  2BE4 A;  1KK8 C;  1MWN A;  1B47 A;  3BUW B;  4ORA B;  3FEE A;  5CPV A;  5CDW A;  4M2P A;  2DVJ A;  2VIF A;  3EVV A;  2ZKM X;  1XFZ O;  2EHB A;  1SCV A;  1BJF A;  2LM5 A;  3GK4 X;  4AOM A;  3GK2 A;  3I5I B;  5ELY A;  1PIC A;  1NX1 A;  3BUO B;  3AKB A;  4I5L B;  1OSA A;  1ZUZ A;  3TZ1 A;  4OC2 A;  4OCI A;  3KEV A;  3I5I C;  2C0O A;  1SNL A;  2WCL A;  3FWC A;  1O42 A;  2KDH A;  3I5G B;  3BI0 A;  4FQT A;  3EK4 A;  4PE4 A;  3BHX A;  1TCO B;  4I5K A;  1AYB A;  1Z2C B;  1DF0 A;  1XA5 A;  3BUX B;  3S8O A;  3MSE B;  2AOA A;  3PS5 A;  3I5G C;  2QEO A;  1K9K A;  1OMR A;  4C0J A;  3GOF A;  4IL1 A;  1CLB A;  2H8H A;  3PM8 A;  4NWF A;  3D75 A;  1Y6W A;  1DJY A;  4MCP A;  4U17 A;  2LHI A;  2MAZ A;  4P9V A;  5EG3 B;  1JYR A;  1C3Z A;  3S0B A;  3SG7 A;  2PVV A;  1AD5 A;  1SL7 A;  1IWQ A;  4NWG A;  2RVF A;  3CZT X;  5EEQ A;  1UHH A;  4Q04 A;  4PE0 A;  4P4F A;  1DQE A;  4I5N B;  1KWO B;  4HSZ A;  3L4A A;  4QJ4 B;  1MQ1 A;  3PFV A;  5AAN A;  4N5X A;  1R1P A;  1H4B A;  5K89 A;  2JQ6 A;  4YGD B;  2ECD A;  3TUY B;  1K9U A;  3ICB A;  4NDC A;  3D76 A;  3CYZ A;  4GUK A;  1KWO C;  1KA6 A;  4XZ0 A;  4X6S A;  2H8V A;  2PNB A;  2NCO A;  2L2C A;  4JYW A;  2C6C A;  1Z4H A;  1WLZ A;  2OTG B;  1EO0 A;  3R1V A;  1YUS A;  5FI2 A;  3TUY C;  1E8A A;  1GGW A;  4JWQ A;  5I2Q A;  3PAT A;  1SY9 A;  5KU1 A;  2JTZ A;  1R1S A;  1ALV A;  2FJY A;  4CID A;  2OTG C;  4UPG A;  1K93 D;  4OC3 A;  1MW4 A;  4M4Z A;  1IG5 A;  5BO4 A;  2K8M B;  2BBM A;  1Z8L A;  1WRZ A;  4MSP A;  3S9L A;  1D1O A;  2LC5 A;  2KPH A;  1GM0 A;  3FE8 A;  2LE9 B;  3O4X A;  1X6C A;  1JUO A;  3HPH E;  3FE6 A;  2LUC A;  1D4W A;  3CD3 A;  1O4D A; 
#chains in the Genus database with same CATH homology
 2KQ6 A;  4GFT A;  5D69 A;  4PHM A;  1N0Y A;  1A75 A;  1ZAC A;  2BE6 A;  1DGV A;  2F3Y A;  4YI9 A;  1O43 A;  2JOJ A;  1B1G A;  2NLN A;  2ZN8 A;  5DC9 A;  1F54 A;  3QRX A;  1OQP A;  2RMX A;  3US4 A;  4NDB A;  1KK7 Y;  1MR8 A;  1TTX A;  2FCD A;  2JU0 A;  2KFG A;  3KFJ A;  3C1V A;  1BHH B;  1CFD A;  2C0I A;  2KGR A;  1CDL A;  1SCM C;  2K7C A;  5I2O A;  2LVK A;  3VGO A;  1GHU A;  2ECD A;  1AJ5 A;  1QAT A;  2LNW A;  1QJT A;  4YGC B;  4L1B B;  1F4O A;  3DF0 B;  5HLO A;  1FU5 A;  4A4C A;  1TOP A;  1UHN A;  3MAZ A;  4H34 A;  4U1P A;  2BCA A;  2JZI A;  1O4A A;  1AYC A;  1QG1 E;  2BCX A;  3DVM A;  1BT6 A;  1XFW O;  2KNO A;  2KHN A;  3IMJ A;  1SL8 A;  3DVE A;  4P9Z A;  3TKZ A;  3BUN B;  2HDV A;  2OPO A;  3IN8 A;  2EO6 A;  4QJ5 B;  2LHL A;  2K61 A;  5AER A;  4MZJ A;  2BCB A;  2PLD A;  3QWY A;  1BMO A;  1OZS A;  1WLM A;  5TNC A;  2ZND A;  2I18 A;  3MXY A;  4PHJ A;  3VRY A;  2M49 B;  2YU7 A;  2DM0 A;  1LCJ A;  3OHM B;  1KK7 Z;  4ORC B;  4ZCU A;  3NHN A;  1U5I B;  2KAX A;  2Q91 A;  2EYZ A;  2WND A;  2PVB A;  3N7Y A;  2H61 C;  3CWG A;  1NUB A;  1O4G A;  1TN4 A;  1G33 A;  1QX7 A;  1Y0V H;  3PSK A;  4ORB B;  1IQ3 A;  4YGA A;  2FJU B;  4PAL A;  2IUI A;  1O4P A;  1QIV A;  5AFP A;  4K11 A;  1ALW A;  3CTN A;  3KHE A;  3A4U B;  1A1A A;  1O44 A;  5DC4 A;  3I5H B;  1A29 A;  2PTK A;  3H4S E;  4DS7 A;  1S5G Y;  2L4I A;  2IUH A;  1D1Z A;  1GRI A;  1EXR A;  4JE4 A;  5CSI A;  4LUE A;  3VRN A;  4F5A A;  2KQY A;  2LLT A;  1AYA A;  3EK7 A;  4I5J A;  1AYD A;  1BHH A;  4XYN A;  2WC8 A;  3CS1 A;  3K2M A;  4OHI A;  2KK6 A;  2CCM A;  2E6W A;  1LKK A;  1KSM A;  3DF0 A;  1A2X A;  4P2Y B;  1BFI A;  1CTR A;  5BPJ A;  2FCI A;  2FCE A;  2LUX A;  2EKX A;  1M45 A;  1KSO A;  2P6B B;  2QPT A;  1CJ1 A;  2Y5I A;  1SMG A;  1OPK A;  2R2I A;  1O4I A;  3HCK A;  1HCS B;  1DJI A;  3WXA A;  1PRW A;  3EKJ A;  3UF4 A;  1MXL C;  1N65 A;  4GBA A;  3D0Y A;  1DJH A;  1DJZ A;  2KI4 B;  2LLS A;  1CMF A;  2F8P A;  1JSA A;  1A09 A;  2CIA A;  2AAO A;  1YR5 A;  3I5H C;  1DMO A;  1O4Q A;  2SHP A;  5DC0 B;  4WWQ A;  3NSO A;  2G2B A;  3VS2 A;  1S3P A;  1CWE A;  5JJG A;  4E68 A;  4BTF A;  2DLY A;  3LLE A;  1A1E A;  1DJX A;  1SL9 A;  1FYR A;  2DX0 A;  1KCY A;  4NQG A;  4C0L A;  2EYY A;  3BUM B;  1BM2 A;  1O41 A;  5HLV A;  2K7B A;  2ZNE A;  1YVL A;  3TDI A;  1TIZ A;  1DJG A;  1KFX S;  1X02 A;  2JPT A;  1IJ6 A;  1KQM B;  1U5I A;  1OE9 B;  3PN7 C;  1CFP A;  5CSF A;  1A1B A;  3BKB A;  1O4N A;  2I2R E;  2BBN A;  3NSK A;  2MRJ A;  1Y1A A;  1QLK A;  2KI4 C;  4XJK B;  1SPY A;  4P5O E;  1FW4 A;  1XK4 A;  1IJ5 A;  2JRF A;  1OMD A;  3TS5 B;  2CI8 A;  3CR2 A;  1TRF A;  2IS9 A;  1A4P A;  4DCK A;  2YSX A;  1IJR A;  1C07 A;  1P13 A;  4GGF C;  4PHK A;  4DRW A;  2AUG A;  2K79 B;  1AB2 A;  1FMK A;  2ZRT A;  4WRI A;  3IQO A;  4N1F A;  1BG1 A;  1QV1 A;  2ZRS A;  2Y3A B;  3EVU A;  5CSJ A;  1B7T Y;  2K7O A;  1O4H A;  1KQM C;  2JXL A;  3EAC A;  4MZL A;  1MUX A;  3I5F B;  2O60 A;  1O4F A;  4FQO A;  1K90 D;  2MJW B;  2MRK A;  1F4Q A;  3TDZ A;  1QIW A;  3NSI A;  2IUG A;  1J1D A;  3TS5 C;  1QVI Y;  1JBA A;  1J1E A;  3DVJ A;  1LA0 A;  3OX6 A;  2JUL A;  1A81 A;  1CLL A;  1B8L A;  4FL3 A;  5KSZ A;  1CSY A;  4DUQ A;  3FIA A;  1SYM A;  4OHE A;  4D8K A;  3EK8 A;  3LK1 A;  2CNP A;  2KBI A;  1XFY O;  1IRJ A;  1SR6 B;  1BF5 A;  4BY4 A;  3OP0 A;  3WHU B;  5KAZ A;  1Q80 A;  1O4J A;  2K7A B;  2JYQ A;  5IBW A;  2L51 A;  2JWW A;  5G08 A;  4GGF A;  2ISD A;  1MHO A;  3SJS A;  1QX2 A;  2KFH A;  4GWF A;  5DKQ A;  4GNK B;  1YRU B;  1NYA A;  2K0J A;  1R6P A;  2MRD A;  5B8I B;  2SAS A;  1FBZ A;  1RPY A;  2AOB A;  2JT3 A;  5GJI A;  3I5F C;  1CMG A;  1H8B A;  4FL2 A;  1RRO A;  1NZL A;  1G83 A;  2CS0 A;  1K96 A;  1OOJ A;  4D1E A;  1FBV A;  1M61 A;  2HCK A;  1K2H A;  1BKM A;  1CM4 A;  3OVE A;  3S8N A;  2KYC A;  1BLJ A;  1ZFS A;  2ZFD A;  1LXF C;  1B7T Z;  1XFU O;  3EKH A;  2WOR A;  3N8M A;  4E93 A;  2JTT A;  2CXJ A;  2M1K B;  2SCP A;  1D4T A;  3PSJ A;  1GQM A;  1NIW A;  1RJV A;  2KYF A;  2KI6 D;  2OZO A;  1M39 A;  1EJ3 A;  1OZO A;  1SR6 C;  2H2K A;  3OB2 B;  2M29 A;  4LUD A;  1FPW A;  1NWD A;  4AQJ A;  4F5B A;  4MN0 A;  1QVI Z;  1L2O B;  1YX7 A;  2WCF A;  4CPV A;  1REC A;  3RLZ A;  2KNE A;  5D0J A;  1TNP A;  3LL8 B;  1B9A A;  2WOS A;  3GXX A;  1QS7 A;  5GQQ C;  1BR4 B;  1J7O A;  1OO4 A;  1A08 A;  1O4R A;  1SRA A;  1S36 A;  5HKZ A;  1NX0 A;  1HQV A;  2L98 A;  1JWO A;  1AVS A;  2F2O A;  5CSN A;  1UUR A;  4M2O A;  1PUL A;  5DKN A;  5AXI A;  2MBX A;  4GPL B;  3EAZ A;  2MK2 A;  1KFU L;  3JTD B;  1F71 A;  2L5X B;  4WQ3 A;  3GQI B;  3CR5 X;  2KAV A;  1YTZ C;  2GGM A;  4M2Q A;  2D8N A;  1FHS A;  1CB1 A;  2JXC A;  2KI6 C;  2BBU A;  1L2O C;  1CDN A;  4FBN A;  5DF6 A;  1RQQ C;  3PJP A;  3S9K A;  1JF0 A;  1M31 A;  1YX8 A;  1KK8 B;  4GAO A;  4YGB B;  1V1G A;  5AUL A;  1GGZ A;  1EH2 A;  1TNX A;  2HUW A;  2GGZ A;  2GE9 A;  1KFU S;  1RTP 1;  4OKH A;  3IQQ A;  4PCW A;  4TNC A;  1ZFP E;  2L3T A;  1SKT A;  2LQN A;  1ODB A;  2TN4 A;  2NXQ A;  1K9A A;  4YRU A;  1LIN A;  1NCZ A;  5FYX A;  3JTD C;  2WCB A;  1TNW A;  1O4O A;  2L4K A;  3VRZ A;  2PRU A;  1A1C A;  1WRK A;  2JNF A;  2K2A A;  3OX5 A;  1A07 A;  1PSB A;  3CGA A;  1X27 A;  2RSY A;  1R1Q A;  1K9P A;  2V53 A;  4ICB A;  4MBE A;  1SPR A;  1R2U A;  4OHH A;  2QAC A;  4DIR A;  1S6J A;  2LMU A;  2ZN9 A;  1F8H A;  1O4C A;  1O4K A;  1SPS A;  2BE4 A;  4F0Z B;  1KK8 C;  1MWN A;  1O4B A;  3BYA A;  4MEW A;  3PAL A;  1W7J B;  2JT8 A;  2H61 A;  3N84 A;  1J7R A;  3ZNI A;  4OHD A;  1FU6 A;  2HF5 A;  1LUK A;  2B3O A;  1B47 A;  1K94 A;  4L9M A;  4PHN A;  3LK0 A;  1KFX L;  2H46 E;  2M0R A;  1CWD L;  3BUW B;  5AEQ A;  1FI5 A;  1QV0 A;  4ORA B;  3ZWH A;  2CBL A;  5D7F A;  5I6V A;  5I8N A;  1BOD A;  1O48 A;  1Y1U A;  5CPV A;  3SG4 A;  1XA6 A;  1NRV A;  3CBL A;  5CDW A;  2E30 A;  4M2P A;  1DF0 B;  1WQU A;  2DVJ A;  2VIF A;  1S5G Z;  3BXK A;  1BR1 B;  2M7N A;  3EVV A;  2ZKM X;  1XFZ O;  2EHB A;  3VS6 A;  1DGU A;  1SCV A;  4ZCV A;  1BJF A;  4F59 A;  2LVV A;  1O47 A;  1J7P A;  2LP3 A;  1GJY A;  3KF9 A;  2XP1 A;  4OHL A;  2LM5 A;  3GK4 X;  2K7D A;  1UHK A;  2Y1M A;  4AOM A;  1QCF A;  3GK2 A;  1G8I A;  3I5I B;  5HKY A;  1AP4 A;  1QX5 B;  1S6C A;  1PIC A;  3M7F A;  1ZOT B;  1NCY A;  1RWY A;  1K95 A;  1NX1 A;  2O5G A;  3AAK A;  3BUO B;  3AKB A;  4I5L B;  1JWD A;  1OSA A;  1ZUZ A;  2F33 A;  4OR9 B;  1BLQ A;  2GSB A;  3GXW A;  2A4J A;  1BHF A;  1QTX A;  2CR4 A;  3SIB A;  1YUR A;  2F2P A;  1M27 A;  4QJ3 B;  2LLU A;  1I3Z A;  2LAP A;  1RJA A;  2BKH B;  1NPQ A;  4NDD A;  4FTG A;  2EO3 A;  2LNX A;  3JVT B;  3TZ1 A;  2LNK A;  4OCI A;  1N2D A;  2MLE C;  3K21 A;  3KEV A;  1BKL A;  1KSW A;  2ABL A;  3I5I C;  3LCP C;  3OV1 A;  1PVA A;  1O4M A;  2C0O A;  1YRT B;  1SNL A;  1Y1X A;  2WCE A;  1YVH A;  2JC2 A;  3FWC A;  1LKL A;  1O42 A;  2KDH A;  4R1E A;  1WY9 A;  3I5G B;  4MRX A;  2COL B;  1CM1 A;  5HYD A;  1XFV O;  1LVC D;  2KSP A;  1O4E A;  3EK4 A;  4PE4 A;  1TCO B;  3MXC A;  1CLM A;  1UP5 A;  1IH0 A;  4I5K A;  3VS1 A;  1AUI B;  2HPS A;  1BLK A;  1UUS A;  2FO0 A;  1AYB A;  4JPZ B;  3CXL A;  2BL0 B;  4U8D A;  1IGV A;  3AKA A;  3CLN A;  4YBH B;  1DF0 A;  1XA5 A;  1SHB A;  1TZE E;  2OS8 B;  4MZK A;  3SIA A;  3JVT C;  4A4B A;  4USL A;  3BUX B;  1FF1 A;  1NZV A;  3S8O A;  4CLN A;  3C7I A;  1WDC B;  3MSE B;  2AOA A;  2HDX A;  1SW8 A;  3PS5 A;  2HMH A;  1KQV A;  2ROR A;  2DOQ A;  5I2L A;  4XJK A;  1LUN A;  1G4Y R;  4HRH A;  3I5G C;  1DVI A;  4PE7 A;  5DKR A;  2H5K A;  1CKK A;  3VS0 A;  1NX2 A;  2LMV A;  4CFQ A;  1K9K A;  1O49 A;  1OMR A;  3O78 A;  2BEC A;  1XYD A;  4C0J A;  3QWX X;  3GOF A;  3D10 A;  2LV7 A;  3O4Y A;  1KC2 A;  4IL1 A;  2PAS A;  1ZMZ A;  2PMY A;  1CLB A;  2PLE A;  2BL0 C;  1CNP A;  3HX4 A;  3VRR A;  4K2R A;  3TDU A;  2H8H A;  3PM8 A;  2OS8 C;  1BFJ A;  1MF8 B;  1B8C A;  4NWF A;  4XZ1 A;  1DT7 B;  2Y1N A;  1Y6W A;  1WDC C;  1DJY A;  2M3W A;  2OQ1 A;  3SG2 A;  1L7Z A;  3CR4 X;  4MLW A;  1JYU A;  1PAL A;  1AOT F;  2F3Z A;  4U17 A;  1XFX O;  1YUT A;  2LHI A;  3PSR A;  5IBM A;  2MAZ A;  3FS7 A;  4JEG A;  4OV2 A;  3AAJ A;  2KBM A;  2LMT A;  1IS0 A;  4P9V A;  2HET A;  5EG3 B;  1JYR A;  2L2E A;  3F45 A;  1JF2 A;  1CFF A;  1UHI A;  3SG7 A;  1B8R A;  2LVI A;  3RM1 A;  4DGP A;  1AD5 A;  1SL7 A;  3D0Y B;  5ER4 X;  1OPL A;  1IWQ A;  1HT9 A;  1F2F A;  1RFJ A;  1EG3 A;  4NWG A;  4PE1 A;  2RVF A;  2SRC A;  2JNX A;  3CZT X;  2KFF A;  4GL9 E;  1CDP A;  2KOT A;  4K45 A;  1JYQ A;  5EEQ A;  5HKW A;  2CT9 A;  1QAD A;  1KA7 A;  4ETO A;  3PQZ A;  3S8L A;  1UHH A;  2M1U A;  3SG6 A;  3DD4 A;  3SG5 A;  1RK9 A;  4Q04 A;  1F1W A;  2C0T A;  4PE0 A;  4H1O A;  3O2P A;  3IN7 A;  3A8R A;  1AHR A;  2JT0 A;  2NCP A;  1QAS A;  2LCP A;  4I5N B;  2HQW A;  1KWO B;  2KGB C;  4MVF A;  2EYV A;  4HSZ A;  1HCT B;  1IKU A;  3E3R A;  4QJ4 B;  1MQ1 A;  1BMB A;  4TZI A;  5IBS A;  2EOB A;  1PVB A;  1F55 A;  1PK0 D;  2LQW A;  1EL4 A;  3PFV A;  5AAN A;  1NX3 A;  4C0K A;  4YI8 A;  4N5X A;  1R1P A;  1SBJ A;  1H4B A;  1IQ5 A;  3PLF B;  5KTY A;  2Q4U A;  3VS3 A;  2PNA A;  5K89 A;  1TNQ A;  3WHT B;  2I94 A;  2JQ6 A;  2FOT A;  2LVJ A;  4YGD B;  3NXA A;  1NP8 A;  2LP2 A;  1B4C A;  1S6I A;  1QXP A;  2MHH A;  3TUY B;  1K9U A;  2M7L A;  1BU3 A;  1JFJ A;  1O4L A;  2CRH A;  3ICB A;  4K44 A;  4NDC A;  5PAL A;  1EG4 A;  2L50 A;  2L4H A;  2KAY A;  4GUK A;  1KWO C;  1KA6 A;  3IMD A;  3OB1 B;  4XZ0 A;  4X6S A;  3HHM B;  3FWB A;  3SG3 A;  2EU0 A;  2QMS A;  1Z3K A;  1H9O A;  5EHR A;  2EGD A;  5F6T A;  2NCO A;  2PNB A;  1C7V A;  3VRP A;  4HRG A;  4MRY A;  3T04 A;  2K2F A;  2LAN A;  1JFK A;  1XK4 C;  1WLZ A;  2CTN A;  2NZ0 A;  3PN7 B;  3VRO A;  2IZV A;  2OTG B;  3DVK A;  5JOL A;  2DCR A;  1WRL A;  1W7I B;  1YUS A;  1J55 A;  3BOW B;  3TL0 A;  4CFR A;  3VS7 A;  1Y57 A;  3TUY C;  4DGX A;  4BY5 A;  1CDM A;  1E8A A;  1UHJ A;  1GGW A;  4JWQ A;  4EY0 A;  5I2Q A;  2M8U A;  3VS4 A;  2C9W A;  3PAT A;  4QSY A;  2MLF C;  1UWO A;  4HRE E;  2GV5 A;  1S26 D;  3VRQ A;  1SY9 A;  2EC6 B;  5KU1 A;  1FI6 A;  2JTZ A;  1R1S A;  2AUC A;  3KPX A;  2I7A A;  4GGN A;  1MIL A;  1NSH A;  1F70 A;  1A75 B;  3IF7 A;  5ER5 A;  1ALV A;  3HIZ B;  1OO3 A;  4N1G A;  4CID A;  1SHA A;  1AJ4 A;  2BKI B;  1K8U A;  2LCT A;  2OTG C;  3UYO A;  4JQ0 D;  4UPG A;  1K93 D;  1NCX A;  1MW4 A;  4PDZ A;  2ETZ A;  4M4Z A;  1J7Q A;  2RGI A;  1IG5 A;  1QLS A;  2G9B A;  4AQI A;  3WA4 A;  2MQI A;  1TCF A;  5BO4 A;  2K8M B;  1A03 A;  1JU5 A;  1MXE A;  3GK1 A;  2BBM A;  1S1E A;  1WRZ A;  4OVN F;  3BQ3 A;  1CFC A;  2DLZ A;  2EC6 C;  4MSP A;  5GJH A;  3VS5 A;  1LA3 A;  1DTL A;  2M9G A;  1D1O A;  2EL8 A;  5EHP A;  2LC5 A;  4YGE B;  1VRK A;  2MA2 A;  4JGH A;  3HCM A;  1X0N A;  1O45 A;  2HQ8 A;  1JC2 A;  2L6K A;  1LCK A;  1XVJ A;  2AMI A;  1LKJ A;  4ROJ A;  1SK6 D;  4EIH A;  1AOU F;  3EVR A;  2LE9 B;  1CSZ A;  2B1U A;  3WNX B;  2M97 A;  1BOC A;  1LUI A;  3KO0 A;  1LUM A;  1X6C A;  1YUU A;  1JUO A;  1SCM B;  1V1F A;  2L0P A;  3O6B A;  1AK8 A;  3BOW A;  3NSL A;  1SKJ A;  2CI9 A;  1C7W A;  2PAL A;  1TCE A;  1XO5 A;  1M63 B;  2LUC A;  1SHD A;  5EEL A;  1OMV A;  1O46 A;  2Y4Q A;  1PSR A;  2PSR A;  2VRG A;  1D4W A;  5J3X A;  1DJW A;  3M0W A;  3CD3 A;  4WQ2 A;  1M46 A;  2MC1 A;  1O4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...