3VRQA

Crystal structure of the tyrosine kinase binding domain of cbl-c (pl mutant)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
310
structure length
278
Chain Sequence
QWEEARALGRAVRMLQRLEEQCPPSLRDLLPRTAQLLREVAHSRPGGPGGSGDFLLIYLANLEAKSRQVAALSRLRRQLAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRLSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural flexibility regulates phosphopeptide-binding activity of the tyrosine kinase binding domain of Cbl-c.
pubmed doi rcsb
molecule keywords Signal transduction protein CBL-C
molecule tags Protein binding
source organism Homo sapiens
total genus 95
structure length 278
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02262 Cbl_N CBL proto-oncogene N-terminal domain 1
A PF02761 Cbl_N2 CBL proto-oncogene N-terminus, EF hand-like domain
A PF02762 Cbl_N3 CBL proto-oncogene N-terminus, SH2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3vrqA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 3vrqA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3vrqA03
1YR5A 2JT8A 2KAYA 2ETZA 1HT9A 4U1PA 1XK4A 1OMRA 1KSOA 4N1FA 2MBXA 1BOCA 2WOSA 1DJWA 4WWQA 2BECA 3F45A 3LCPC 1NYAA 2VRGA 5I2QA 1LUIA 4ORBB 3GK1A 3BUMB 1SPYA 2BBMA 1OO3A 4D8KA 4M2PA 2LMVA 4I5JA 1Z3KA 2MJWB 2JPTA 1M31A 4HRHA 1S36A 1XA5A 2KQYA 3EVVA 4AOMA 3CS1A 2FCDA 5HLVA 3TDZA 5EHRA 5CDWA 3VRYA 1QV0A 1YURA 1BFIA 2KI4C 2CT9A 3BYAA 2M49B 3M0WA 2LANA 3OHMB 4PHMA 2K0JA 2AOAA 1EXRA 1UP5A 1FF1A 1JC2A 3I5GB 4UPGA 4YI9A 5AFPA 5HLOA 2D8NA 1QS7A 1QLKA 3NSIA 1LUMA 3HCKA 3FIAA 2FO0A 1ALWA 1S5GY 2AAOA 1JYUA 4YGEB 1O42A 1K8UA 1P13A 3EACA 3BQ3A 1UUSA 2COLB 1O4BA 2AOBA 3WA4A 3LL8B 2E30A 1QX7A 2K2AA 2ABLA 1D4TA 3JVTB 1O41A 1XFWO 1O4HA 1QADA 2KDHA 4CFRA 4GUKA 3PSJA 1YTZC 1L2OC 3CTNA 3VGOA 1QCFA 1A1CA 2DLZA 1OSAA 1O4GA 2NCPA 4JGHA 5HKZA 2VIFA 4I5LB 1A81A 2KI6C 2GGMA 1KCYA 4P2YB 4BY5A 2HMHA 4H34A 1KA6A 4MZJA 1CMFA 1SHDA 3GK4X 2HETA 2E6WA 2ZNEA 3BXKA 4XJKA 1K9PA 3NSLA 1J7PA 1LUKA 2IUIA 4K44A 4YGCB 4ZCUA 2M29A 2RSYA 3IN7A 2CXJA 1XA6A 4I5KA 2RVFA 5AXIA 4YGBB 2F2OA 2JXLA 4D1EA 1X0NA 2L2EA 1AUIB 2LHIA 2ZFDA 1X02A 3AAJA 1WDCC 4CPVA 1FPWA 2H8HA 1Y57A 2KFFA 2EYYA 3TDUA 1O4NA 4OHEA 5FYXA 4OVNF 3SIAA 3I5FC 4GAOA 5GQQC 1Y1UA 2BE4A 2EKXA 1O4FA 2BCAA 1O4AA 1KFUS 1AHRA 1GHUA 2PVBA 4MLWA 2C0IA 2F3YA 5AANA 1TCEA 4P5OE 2KGRA 3OVEA 2KAXA 3US4A 2Q91A 2HDVA 3I5HB 1C7VA 3C1VA 1NX2A 1SKTA 2Y4QA 3M7FA 3RLZA 1WLZA 3MXYA 3HCMA 1JF2A 1NRVA 3TDIA 4LUEA 4WQ3A 4NDCA 1CDNA 3SIBA 1G83A 2EHBA 1O45A 2HDXA 2PTKA 3RM1A 2JU0A 2Y1NA 3VS3A 1S5GZ 4NQGA 1BHHB 1BMOA 1J55A 3TKZA 1S3PA 5AEQA 2LMTA 4EIHA 4F5AA 1XFYO 1CFPA 3CD3A 3CWGA 2ZRSA 3OX6A 2EC6B 4BTFA 2DCRA 2G2BA 2Y3AB 2CIAA 4ROJA 1QV1A 2CNPA 3PFVA 3OV1A 3KHEA 2WNDA 2OTGB 3SG4A 4BY4A 1SKJA 1VRKA 1V1FA 4ORCB 5D7FA 1IH0A 2C0OA 1IWQA 2YU7A 1O48A 1CLLA 1WRLA 3TL0A 4GBAA 1O4RA 3DVEA 3I5GC 1EJ3A 2M97A 1HQVA 1MHOA 1CFDA 2ZRTA 5PALA 1PVBA 1BJFA 3IMDA 2JT0A 2KBIA 1L7ZA 1XVJA 4Q04A 5DKQA 1M45A 1O47A 1JYQA 1BODA 2JYQA 3LK1A 2NCOA 2ISDA 4DS7A 5EEQA 1QIVA 4NWFA 2EYVA 5BPJA 4USLA 1B9AA 1B7TY 1CJ1A 4I5NB 2F2PA 2JOJA 2JNXA 1SR6B 1IKUA 1O43A 2JWWA 3JVTC 1O4LA 1MXLC 1ALVA 1TNPA 1YX7A 4OCIA 5CSIA 5IBWA 1DMOA 1OZSA 3JTDB 4PE7A 1IQ3A 1K9AA 1BU3A 1QJTA 1ZFPE 1J1DA 1CM1A 3EKHA 3GK2A 2NXQA 2CS0A 1BT6A 1RQQC 1QTXA 4JEGA 4LUDA 2JQ6A 3E3RA 2HUWA 3VS6A 3D10A 1F70A 4FL3A 4C0LA 4OHIA 1NZVA 4QSYA 1FU6A 1OPLA 1H4BA 1F2FA 1DF0A 4TNCA 2ZN8A 4E68A 3QRXA 3UYOA 4IL1A 1TOPA 1O44A 1C07A 2LNWA 1TNQA 1SCVA 2RGIA 1FBZA 2JRFA 3I5IB 1M27A 1Y0VH 4NWGA 3S8NA 1B8RA 2M3WA 3OX5A 1A03A 3MSEB 1AOTF 2DX0A 1K93D 2KSPA 1D1ZA 1O4DA 1GQMA 1S6JA 3EK7A 2H46E 5CPVA 1KFXS 1X6CA 4JPZB 3WHUB 2BKIB 3PLFB 1SHAA 2WCEA 3VRNA 2MC1A 3EK8A 1CWDL 1M63B 5I8NA 1IJ5A 2M9GA 3D0YA 4YGDB 1A08A 2NLNA 1BR4B 1IJRA 4DCKA 3IQQA 1MXEA 1CB1A 1R1PA 4MRYA 2L4KA 1CDMA 1O4KA 2CI9A 3CBLA 1OMVA 1WRZA 1YX8A 5I6VA 1TCOB 1XFUO 2TN4A 1NPQA 2LVIA 2H61A 1SW8A 3IQOA 1KSWA 2K61A 4E93A 3I5HC 1LXFC 3WHTB 1OQPA 1SYMA 2OPOA 1UURA 1V1GA 2LV7A 4L9MA 4MZLA 3BOWA 3FS7A 4PHKA 2M7NA 3SG6A 3MXCA 4M2QA 1O4QA 2LM5A 4JE4A 1S26D 1SPSA 4K45A 2AUCA 1DJGA 2EU0A 2YSXA 5JJGA 3AAKA 1AK8A 1JSAA 2MQIA 3VS1A 1GRIA 1CKKA 1YVHA 3AKBA 4PALA 5AERA 1K9KA 4GWFA 1PK0D 3EK4A 2WCBA 4YI8A 1S6CA 2LP3A 1TNWA 3QWXX 1ZUZA 1B7TZ 3IF7A 3K2MA 2EC6C 5EG3B 1A1EA 1B4CA 1UWOA 1E8AA 5DC9A 2OS8B 2OTGC 1CSZA 1OOJA 1YVLA 2RORA 4ORAB 1RECA 1J7RA 1O4EA 4HSZA 1LVCD 4F5BA 4C0KA 3ZWHA 2MRJA 1PSBA 1FHSA 4M4ZA 1UHNA 4GPLB 4OR9B 1FMKA 2LCTA 3DF0A 1H9OA 2BL0B 5K89A 1Y1AA 3EVRA 5KU1A 2C0TA 2PMYA 3EVUA 3KF9A 1CDLA 2PRUA 5BO4A 5GJHA 2MLEC 2JULA 3UF4A 3IMJA 2K7OA 4QJ4B 1SR6C 1DTLA 4ZCVA 2PNAA 5AULA 2JXCA 4YBHB 1JFJA 1XFZO 2MLFC 1FU5A 4HREE 3JTDC 1RFJA 2I94A 1SHBA 2AUGA 3VS4A 3S8OA 2KK6A 1D4WA 1KQMB 2KOTA 2LLTA 1WQUA 1KC2A 3T04A 1RWYA 2K7AB 3KFJA 1JWOA 2NZ0A 1JF0A 1A75B 1F4OA 2AMIA 2HPSA 2P6BB 4N5XA 4ETOA 1B1GA 4XZ0A 1MWNA 1S1EA 2O5GA 1AVSA 3BUXB 1SCMB 1O4OA 3S9KA 2Y1MA 2BCXA 4MRXA 1SNLA 2HF5A 3VRQA 5DKNA 2M1UA 3I5IC 1LCKA 1PALA 1PRWA 2QACA 1QLSA 2HCKA 4OHLA 5EELA 1RROA 2DM0A 3VS5A 1TIZA 2I18A 4XJKB 2QMSA 1LKJA 1KK7Y 2KYFA 2JTTA 2F8PA 4PDZA 5CSJA 1AJ5A 4EY0A 2LVVA 5DF6A 3VRRA 2KI6D 4PCWA 1JFKA 1O4PA 2V53A 3O2PA 3PQZA 1DJXA 1WLMA 1O4JA 2BE6A 1TZEE 1B8CA 1Y1XA 1AP4A 2L4HA 3PN7B 3VS2A 3HX4A 1O4CA 1HCSB 3HIZB 1K90D 1WRKA 2O60A 1SPRA 2DLYA 1B47A 1KK8B 2LLSA 4GGFC 4P9ZA 4JQ0D 1NWDA 2GE9A 4FQOA 2ZNDA 1LA0A 4PE0A 2ECDA 1RTP1 2CCMA 1Y6WA 1NCXA 2FJUB 1DVIA 1IG5A 2KBMA 1F55A 4C0JA 1DJIA 1SMGA 3A8RA 4OV2A 4OKHA 1U5IA 2BBNA 2KFHA 5DC0B 1R1QA 2MRKA 1UHIA 1XK4C 1NSHA 1WY9A 3TZ1A 2IUHA 4X6SA 5DKRA 1Q80A 1RK9A 2KAVA 1FW4A 1G4YR 4K11A 5B8IB 1NUBA 2IS9A 3EKJA 3SG2A 4DUQA 1AYBA 1TCFA 1O4IA 2L3TA 3C7IA 1UHHA 1AJ4A 2GSBA 1BG1A 4F59A 3BUNB 4AQJA 3GQIB 5DC4A 2L50A 1G33A 2EO3A 2FCIA 1I3ZA 2DVJA 2OS8C 2L0PA 2K79B 1DJHA 1XO5A 2LC5A 4XYNA 1A2XA 2KQ6A 2PLDA 1KSMA 4PE4A 4YGAA 2PLEA 4HRGA 2LMUA 4CIDA 3OP0A 1A09A 3ICBA 1NX0A 1SK6D 3OB2B 3GXXA 1ZFSA 2KNEA 1M61A 2BL0C 2SASA 3LLEA 2LCPA 4CFQA 3HHMB 3N84A 3K21A 3KO0A 4L1BB 2JT3A 4PE1A 1QG1E 2QPTA 5KAZA 5JOLA 1O4MA 1ZOTB 2M8UA 3CGAA 3CLNA 1RPYA 4JWQA 4FBNA 1FBVA 2PSRA 5I2OA 2L4IA 1OO4A 3DVKA 4OHDA 3FWBA 2FCEA 2KFGA 1SBJA 4DIRA 2RMXA 1KK7Z 2LLUA 1JU5A 3PJPA 1BMBA 1KQMC 1TN4A 2G9BA 1KFUL 2LAPA 1SY9A 3VS7A 1TNXA 1R1SA 2CI8A 2LNXA 1NIWA 1G8IA 4U17A 3PATA 2DOQA 1IGVA 2LUXA 5CSNA 1SCMC 4AQIA 4PHNA 1NX1A 2L51A 1MUXA 2MK2A 2WORA 4TZIA 2PASA 2MHHA 5D69A 2M1KB 1J7OA 1DGVA 3TS5B 1O46A 3BKBA 3VRZA 1NCYA 3BUWB 4F0ZB 4DGXA 1O49A 1DF0B 4M2OA 2EOBA 4GL9E 1BR1B 2L5XB 1ODBA 5ER5A 1OPKA 2MAZA 3PSKA 1EH2A 1A1BA 1CM4A 1ZACA 3FWCA 3PALA 2I2RE 2BBUA 3PN7C 2GV5A 1QX5B 1X27A 4FL2A 1ZMZA 1KK8C 3D0YB 4ICBA 5F6TA 2H5KA 1FYRA 3N8MA 3TUYB 1MILA 1LKLA 3S8LA 4GGNA 1DJYA 3CR4X 3VS0A 2MRDA 4NDBA 1B8LA 2JC2A 2LNKA 5HKWA 2JZIA 1PSRA 1SL8A 3O78A 1LUNA 1SL9A 2Q4UA 3AKAA 3NHNA 3CZTX 5HKYA 1RJAA 3O6BA 1FI5A 3QWYA 1GGWA 1R6PA 3SG3A 2M7LA 2LE9B 5J3XA 2OQ1A 3BOWB 1MR8A 1CFCA 4A4BA 1CNPA 1W7JB 1KWOB 3SG7A 2B3OA 1A75A 1TRFA 4A4CA 1TTXA 2A4JA 4PHJA 1C7WA 1HCTB 3EAZA 1DT7B 5D0JA 4DGPA 2JTZA 3LK0A 1QVIY 1JBAA 5HYDA 1BHFA 1YRTB 1BKLA 3NXAA 5IBMA 2EO6A 2KYCA 4K2RA 3OB1B 3PSRA 4GFTA 1F54A 1BLKA 1BLQA 1IQ5A 1BLJA 1N65A 1LA3A 2K7DA 1LINA 2IUGA 3N7YA 1R2UA 2EYZA 1S6IA 2GGZA 2L98A 4MVFA 3DVJA 2XP1A 1AB2A 1M39A 1YUSA 1AOUF 1EG3A 4NDDA 1UHJA 4MBEA 1EL4A 1YRUB 2LVJA 1PULA 1KFXL 1BHHA 2IZVA 2KNOA 4U8DA 1JWDA 2SRCA 4OHHA 5IBSA 2BCBA 3DF0B 3MAZA 1AYAA 2WC8A 1MW4A 1QXPA 1NP8A 2F3ZA 3GXWA 1XYDA 3PM8A 1J1EA 2R2IA 2B1UA 1K2HA 2CRHA 1K94A 3VRPA 4WRIA 1QASA 4MN0A 2K7BA 3VROA 2OZOA 1K95A 1XFVO 2KI4B 4FTGA 4MEWA 4N1GA 1OMDA 5ER4X 2LQNA 1K9UA 1AD5A 4MSPA 5CSFA 1DGUA 1N0YA 1YUTA 2F33A 5I2LA 2K8MB 1MF8B 2LUCA 4MZKA 1BKMA 4CLNA 1IRJA 1A1AA 1BFJA 3TS5C 1EG4A 1LCJA 1AYDA 1XFXO 1OZOA 3WNXB 2L6KA 4QJ5B 3KPXA 2LHLA 3NSOA 4GNKB 5EHPA 3SJSA 1QATA 2ZN9A 1SRAA 1PVAA 3GOFA 5KSZA 1QX2A 1N2DA 1JUOA 3NSKA 3SG5A 1BF5A 1YUUA 2JNFA 3WXAA 2Y5IA 1CFFA 4XZ1A 2CTNA 5G08A 3DD4A 1F71A 1H8BA 1IJ6A 1NZLA 3PS5A 2BKHB 1K96A 1L2OB 3DVMA 1GJYA 4QJ3B 1D1OA 1J7QA 2EGDA 1CLBA 2LVKA 2CR4A 3CXLA 3TUYC 1QVIZ 3H4SE 1F8HA 2KHNA 4H1OA 5GJIA 1W7IB 2PNBA 1GGZA 1RJVA 2ZKMX 1KA7A 1F4QA 2WCFA 3KEVA 2H61C 2K7CA 1KQVA 1MQ1A 1A29A 1DJZA 1QIWA 2CBLA 2FOTA 3O4YA 2SHPA 1A4PA 1UHKA 3A4UB 4R1EA 1LKKA 1CSYA 3CR5X 1A07A 2HQ8A 1CLMA 1CWEA 1KWOC 2LQWA 2I7AA 1WDCB 2HQWA 2H2KA 2KGBC 2PALA 2K2FA 4WQ2A 5KTYA 1JYRA 2EL8A 1U5IB 1F1WA 3IN8A 1M46A 3CR2A 1BM2A 1NCZA 1PICA 1AYCA 2LP2A 3I5FB 4GGFA 1CDPA 2SCPA 4P9VA 2M0RA 4DRWA 4YRUA 3ZNIA 2MA2A 1FI6A 1CMGA 1CTRA 2C9WA 1OE9B 1SL7A 5TNCA 1NX3A 3BUOB 1IS0A
chains in the Genus database with same CATH superfamily
2KAYA 4U1PA 4WWQA 3F45A 4ORBB 3GK1A 1SPYA 2BBMA 4D8KA 4M2PA 3N7HA 4MCPA 1XA5A 3EVVA 5CDWA 1YURA 1BFIA 4PHMA 1EXRA 1UP5A 3I5GB 2D8NA 3FIAA 1O4BA 2AOBA 4CFRA 4GUKA 1T14A 3CTNA 2DLZA 1QCFA 2GGMA 4P2YB 4BY5A 1SHDA 1K9PA 3NSLA 4ZCUA 3IN7A 1XA6A 4YGBB 2L2EA 1AUIB 2ZFDA 2QEBA 3OAKA 2H8HA 3TDUA 2N3AB 1O4NA 3SIAA 4GAOA 5GQQC 1Y1UA 1O4FA 1O4AA 4FQTA 2PVBA 3FE8A 3OVEA 3I5HB 1NRVA 3KASA 1CDNA 1O45A 5D29A 3RM1A 2Y1NA 1S5GZ 4NQGA 1BMOA 1J55A 2KLDA 1XFYO 1CFPA 3CD3A 3OX6A 4ROJA 1QV1A 3SG4A 4ORCB 1IWQA 2XPPA 1L7ZA 1BODA 2ISDA 2EYVA 1CJ1A 4I5NB 2JOJA 2P71A 1O43A 2JWWA 3JVTC 1O4LA 4OCIA 1OZSA 1ZFPE 3D10A 4FL3A 4C0LA 1NZVA 4E68A 3QRXA 1O44A 1C07A 1TNQA 2JRFA 5FI7A 1CX8A 2M3WA 1GQMA 5CPVA 4JPZB 2WCEA 3EK8A 1OOIX 2M9GA 4YGDB 1BR4B 4P44A 2L4KA 2XEGA 2CI9A 1YX8A 2QEOA 1NPQA 2LVIA 3V2LA 1SW8A 2DLAA 3WHTB 1OQPA 1Z3KA 1UURA 4MZLA 4JE4A 1TWOA 1SPSA 1DJGA 5JJGA 3OBVA 1JSAA 1CKKA 1K9KA 1PK0D 1C3YA 4YI8A 1TNWA 1B7TZ 3IF7A 2EC6C 2RORA 5DICA 1J7RA 2MRJA 4M4ZA 1FMKA 5K89A 3EVRA 3L47A 2PRUA 2JULA 2K7OA 1DTLA 5AULA 1SHBA 2KOTA 4P4EA 3KFJA 1F4OA 4XZ0A 4MRXA 1SNLA 2HF5A 3B88A 2M1UA 4OHLA 1RROA 2DM0A 1LKJA 2JTTA 4PDZA 4EY0A 2KI6D 4PCWA 3O2PA 1DJXA 1WLMA 2L4HA 4RR2B 3HIZB 1K90D 1B47A 4FQOA 2ZNDA 4PE0A 2KLEA 1RTP1 2FJUB 2KBMA 4P4BA 3A8RA 1U5IA 2BBNA 2KFHA 1R1QA 2MRKA 4X6SA 1NSHA 1WY9A 1RK9A 2KAVA 3NHIA 2IS9A 3EKJA 3SG2A 4DUQA 2GSBA 2PLDA 2PLEA 3L4AA 1SK6D 3K21A 2JT3A 2QPTA 1O4MA 3CGAA 3CLNA 1RPYA 4JWQA 2PSRA 2L4IA 4OHDA 4DIRA 2LAPA 3VS7A 1NIWA 1G8IA 1IGVA 5CSNA 2PASA 2MHHA 2M1KB 1O46A 3VRZA 2H8VA 3BUWB 4DGXA 1DF0B 2EOBA 1BR1B 1ODBA 5ER5A 1EH2A 3PALA 2GV5A 4FL2A 1ZMZA 1FYRA 1LKLA 3S8LA 4GGNA 1DJYA 3VS0A 1EO0A 5HKWA 1LUNA 1PSRA 3O78A 3VB1A 3AKAA 3O6BA 1R6PA 3SG3A 3BFHA 3BOWB 1MR8A 1KWOB 4A4CA 1TTXA 4LQGA 4OC5A 1HCTB 3EAZA 2JTZA 3LK0A 1BHFA 1F54A 4JD9A 1BLJA 2K7DA 1S6IA 4MVFA 1YUSA 1UHJA 2LVJA 2IZVA 2KNOA 1AYAA 1WJTA 2F3ZA 2CRHA 1K94A 2K7BA 2OZOA 1XFVO 1OMDA 1AD5A 5I2LA 1N0YA 1YUTA 2LUCA 2C6CA 4GNKB 4W9YA 5KSZA 1BF5A 1YUUA 4BPXB 1NZLA 1F71A 1K96A 4QJ3B 5EHRA 1GJYA 1J7QA 1CLBA 2LVKA 1GGZA 1RJVA 1MQ1A 1A29A 3O4YA 1UHKA 4R1EA 1CSYA 1CLMA 1CWEA 2I7AA 2PALA 2HQWA 4WQ2A 1JYRA 1M46A 3CR2A 4DRWA 4YRUA 1CMGA 1LS8A 2WCKA 1NX3A 3RZSA 2JT8A 1HT9A 1XK4A 4N1FA 2WOSA 1DJWA 2VRGA 1IIOA 3BUMB 3SJGA 2LMVA 4MCQA 4I5JA 1S36A 4AOMA 2FCDA 3TDZA 2KI4C 2M49B 3M0WA 2LANA 2AOAA 3HMJG 4UPGA 4YI9A 5HLOA 3HCKA 1LUMA 3RBUA 1ALWA 1K8UA 3BQ3A 3WA4A 1P28A 2E30A 1QX7A 1QADA 1XFWO 2KDHA 2JBKA 2XEFA 3VGOA 5HKZA 4I5LB 1A81A 2KI6C 3D74A 4H34A 4MZJA 3GK4X 5EL2A 2M29A 2CXJA 4I5KA 2RVFA 5AXIA 4D1EA 1X0NA 4CPVA 4P4IA 3CABA 1GHUA 4MLWA 1TCEA 2KAXA 3US4A 2Q91A 3C1VA 1WLZA 3HCMA 1JF2A 3TDIA 4WQ3A 3SIBA 3D76A 2XPOA 3VS3A 3B87A 3TKZA 4EIHA 3CWGA 4BTFA 2CIAA 3OV1A 2OTGB 1IH0A 2YU7A 1CLLA 1O4RA 1EJ3A 3IMDA 1MHOA 1OOFA 2ZRTA 1PVBA 2JT0A 2KBIA 5DKQA 4Q04A 3LK1A 4NWFA 4USLA 2F2PA 1IKUA 1MXLC 5CSIA 3SJEA 1YX7A 1DMOA 4PE7A 2CS0A 1BT6A 3R72A 1RQQC 4JEGA 4LUDA 3VS6A 1F2FA 1DF0A 4P4DA 1SCVA 2RGIA 1M27A 3I5IB 2DX0A 1K93D 4JYWA 2H46E 1SHAA 3VRNA 1TUZA 2MC1A 5I8NA 1IJRA 2NLNA 4DCKA 3IQQA 4MRYA 3S0AA 1O4KA 1TCOB 4E93A 2K61A 2BAPA 4L9MA 3BOWA 3FS7A 1C3ZA 4M2QA 2EU0A 3SS5A 1AK8A 3VS1A 2MQIA 5AERA 4GWFA 1Z4HA 2JPOA 1B4CA 1UWOA 1CSZA 1YVLA 1LVCD 3ZWHA 1PSBA 1FHSA 1W9ZA 1H9OA 1Y1AA 2PMYA 3EVUA 5BO4A 3UF4A 4QJ4B 1SR6C 4ZCVA 2PNAA 2JXCA 4YBHB 1XFZO 2MLFC 3JTDC 1RFJA 3S8OA 1D4WA 1KQMB 1B1GA 1MWNA 5BY0A 4OC1A 1SCMB 3S9KA 3R1PA 3BI1A 3LYVA 4MCSA 5DKNA 2QACA 2HCKA 2KYFA 5CSJA 1O4PA 1B8CA 2QEVA 3PN7B 3HX4A 2XEIA 1O4CA 3FE6A 1WRKA 2O60A 1KK8B 2LLSA 4JQ0D 2GE9A 2ECDA 2CCMA 1Y6WA 1NCXA 3S9MA 1DVIA 4C0JA 1DJIA 1SMGA 4OKHA 5DC0B 2PYQA 1UHIA 1Z2CB 2BNXA 1AYBA 1O4IA 3C7IA 1UHHA 3BUNB 1G33A 2EO3A 2FCIA 4MCRA 1I3ZA 2OS8C 2L0PA 2K79B 4XYNA 1KSMA 4PE4A 1A09A 2YGUA 4NGNA 2KNEA 2BL0C 2SASA 3LLEA 2LCPA 3N84A 4L1BB 5KAZA 4PE1A 1QG1E 1ZOTB 4FBNA 5I2OA 2FCEA 2LRAA 1JU5A 1TN4A 1R1SA 2LNXA 4U17A 3PATA 4PHNA 2JBJA 1J7OA 1DGVA 4INXA 1O49A 2MAZA 2B4JC 1A1BA 1QX5B 4ICBA 3N8MA 3TUYB 2MRDA 4NDBA 1B8LA 2JZIA 1SL9A 2Q4UA 3CZTX 2M7LA 2LE9B 1A75A 5D0JA 3SJFA 5IBMA 1JBAA 1BKLA 4K2RA 1N65A 1LINA 2XP1A 2GGZA 1M39A 1EG3A 4MBEA 4OHHA 2FJYA 1JWDA 5IBSA 3BFBA 3DF0B 3GXWA 2B1UA 3PJIA 4FTGA 4N1GA 4MEWA 2LQNA 5CSFA 2F33A 2K8MB 1MF8B 1BKMA 1BFJA 3TS5C 1EG4A 1OZOA 3BFAA 3B7AA 4NGPA 2QEHA 1PVAA 3GOFA 1N2DA 4XZ1A 1H8BA 3PS5A 3BJHA 3DVMA 3CXLA 2EGDA 2KHNA 5GJIA 2PNBA 1F4QA 3KEVA 1DJZA 2XEJA 2HQ8A 2H2KA 2EL8A 1F1WA 3IN8A 1NCZA 1PICA 1AYCA 2XPNA 4GGFA 2K60A 3ZNIA 2MA2A 1FI6A 1SL7A 5TNCA 3NGVA 3BUOB 1IS0A 1YR5A 2ETZA 3BHXA 3D7DA 1BOCA 5I2QA 1OO3A 4INWA 2JPTA 2KQYA 2XPLA 3CS1A 5HLVA 3BYAA 3CYZA 3OHMB 2K0JA 5ELYA 5AFPA 3NSIA 2FO0A 3F9KC 1JYUA 1O42A 2K2AA 3JVTB 1O41A 1O4HA 4NGSA 4PT1A 3HPGG 1YTZC 1L2OC 1A1CA 2NCPA 2VIFA 3FF3A 1KCYA 2HMHA 1CMFA 2HETA 2E6WA 3BXKA 1LUKA 4K44A 4YGCB 2RSYA 2F2OA 1X02A 3AAJA 1WDCC 3I5FC 2EKXA 3FEEA 2BCAA 1KFUS 1AHRA 2F3YA 5AANA 4P5OE 2KGRA 2HDVA 1C7VA 1SKTA 3M7FA 3RLZA 3L4LA 3MXYA 4LUEA 4NDCA 2L2CA 1G83A 1DC1A 2PTKA 3S9LA 2ZRSA 2EC6B 1OW4A 2Y3AB 2CNPA 4BY4A 1SKJA 1VRKA 1O48A 3TL0A 3I5GC 1HQVA 1BJFA 1XVJA 1JYQA 5EEQA 1QIVA 5BPJA 3Q8IA 1ALVA 1TNPA 1K9AA 1J1DA 1CM1A 3GK2A 2NXQA 3E3RA 2HUWA 3UNWA 1F70A 4OHIA 1FU6A 4TNCA 2ZN8A 3UYOA 2LNWA 1FBZA 5FI2A 1B8RA 1AOTF 2IUIA 2KSPA 1D1ZA 1S6JA 3WHUB 2BKIB 1CWDL 1M63B 4OC2A 3DY9A 1CB1A 1CDMA 3CBLA 1OMVA 1WRZA 3FEDA 2H61A 3IQOA 1KSWA 3I5HC 1LXFC 1SYMA 2OPOA 1V1GA 1XFRA 2LV7A 2M7NA 3SG6A 3MXCA 1S26D 2YSXA 1DE4C 3AKBA 2WCBA 1S6CA 3B6XA 1ZUZA 1A1EA 3D7FA 1OOJA 4ORAB 1RECA 1O4EA 4P45A 4F5BA 4OR9B 3DF0A 1CDLA 2MLEC 3IMJA 3S0BA 3D73A 3HPHE 4HREE 2LLTA 1KC2A 1RWYA 2K7AB 1JWOA 1A75B 2AMIA 4N5XA 1TUJA 2WCHA 2KPHA 3D78A 2Y1MA 2WCMA 1LCKA 4XJKB 4IJ7A 1KK7Y 2F8PA 5DF6A 1JFKA 1O4JA 1Y1XA 3VS2A 1HCSB 4P9ZA 2DLYA 1Z8LA 1NWDA 1LA0A 3D77A 4JZ0A 3SS4A 1XK4C 5DKRA 1Q80A 4K11A 1NUBA 3IVTA 2OOTA 1AJ4A 1BG1A 4F59A 4AQJA 5DC4A 2L50A 2DVJA 1XO5A 2LC5A 2KGYA 1A2XA 4YGAA 3OP0A 1NX0A 1ZFSA 3HHMB 3IWWA 1FBVA 1OO4A 2LLUA 3PJPA 1BMBA 2G9BA 1KFUL 1SY9A 1TNXA 4P4JA 2PVWA 2CI8A 2LUXA 4AQIA 1NX1A 2L51A 3K1EA 1DEKA 4TZIA 5D69A 3CZ1A 3BKBA 2C6GA 1NCYA 4F0ZB 4M2OA 4GL9E 2L5XB 1OPKA 1OOGA 3FWCA 1X27A 3D0YB 2PQLA 5F6TA 2H5KA 3FECA 3CR4X 3CDNA 2JC2A 1SL8A 5HKYA 1RJAA 1FI5A 5J3XA 4X3RA 1W7JB 2B3OA 2A4JA 4PHJA 3K2TA 1C7WA 4OC4A 1DT7B 4DGPA 3D75A 5D3OA 1QVIY 1YRTB 1BLQA 1IQ5A 1LA3A 3N7YA 1R2UA 3DVJA 1AOUF 4NDDA 2WC6A 1PULA 2SRCA 4U8DA 2WC8A 1MW4A 1NP8A 1XYDA 1K2HA 2QDIA 3VRPA 2CIJA 1QASA 5ER4X 2KI4B 1K9UA 4MSPA 1DGUA 4MZKA 1A1AA 1IRJA 1LCJA 2ERBA 1XFXO 3WNXB 4QJ5B 3KPXA 3NSOA 5EHPA 3SJSA 2ZN9A 1SRAA 1QX2A 2PVVA 1JUOA 3NSKA 3SG5A 2Y5IA 1CFFA 3DYEA 1IJ6A 1D1OA 3CZ0A 2CR4A 1F8HA 1W7IB 3PM2A 2SHPA 1QIWA 1A4PA 3A4UB 3DZTA 3CR5X 1KWOC 2LQWA 5KTYA 2KGBC 2K2FA 2L5YA 3S0FA 1BM2A 2LP2A 1CDPA 1CTRA 2C9WA 1OMRA 1KSOA 2MBXA 2BECA 3LCPC 4BPWB 1NYAA 1LUIA 3CZ2A 4P4FA 2MJWB 1M31A 4HRHA 3VRYA 1QV0A 2CT9A 3SS3A 1FF1A 1JC2A 1QS7A 1QLKA 1S5GY 2AAOA 1P13A 4YGEB 3EACA 2WCJA 1UUSA 2COLB 3LL8B 2ABLA 1D4TA 5HL1A 3PSJA 5FI6A 1OSAA 1O4GA 4JGHA 1KA6A 2ZNEA 4XJKA 1J7PA 2JXLA 2LHIA 1FPWA 1Y57A 2KFFA 2EYYA 4OHEA 5FYXA 4OVNF 2BE4A 5F13A 2C0IA 1NX2A 2Y4QA 3BXMA 2EHBA 3U88C 2HDXA 2JU0A 1BHHB 1S3PA 5AEQA 2LMTA 4F5AA 5F09A 2DCRA 2G2BA 5DC9A 3PFVA 3S9NA 3KHEA 2WNDA 4OC0A 5D7FA 1V1FA 1SSEB 2C0OA 1WRLA 4GBAA 3DVEA 2M97A 1CFDA 5PALA 4BPUB 3QMEA 1M45A 1O47A 2JYQA 2NCOA 4DS7A 1B9AA 1B7TY 2JNXA 1SR6B 5IBWA 3JTDB 1IQ3A 1BU3A 1QJTA 3EKHA 1QTXA 2JQ6A 4QSYA 1OPLA 1H4BA 4IL1A 1TOPA 1QWVA 1Y0VH 4NWGA 4OMEA 3S8NA 3OX5A 1A03A 1DQEA 3MSEB 1O4DA 3EK7A 1KFXS 1X6CA 3PLFB 1IJ5A 3D0YA 1A08A 1R1PA 1MXEA 5I6VA 1XFUO 2TN4A 4F7FA 3R1OA 4PHKA 4JKTA 3B86A 1O4QA 2LM5A 3DXLA 4K45A 2AUCA 3AAKA 1GRIA 1YVHA 4PALA 3EK4A 2LP3A 3QWXX 3K2MA 5EG3B 1E8AA 3S0EA 2OS8B 2OTGC 2P70A 4HSZA 4C0KA 3O8ZA 1UHNA 4GPLB 2LCTA 2BL0B 5KU1A 2C0TA 3KF9A 5GJHA 1JFJA 1FU5A 2I94A 2AUGA 3VS4A 2KK6A 2GTEA 1WQUA 3T04A 2NZ0A 1JF0A 2P6BB 4ETOA 2HPSA 3FE9A 1S1EA 2O5GA 1AVSA 3UO9A 3BUXB 1O4OA 2BCXA 3VRQA 3I5IC 4OC3A 2WCLA 1PALA 1PRWA 3VS5A 1QLSA 5EELA 1TIZA 2I18A 2QMSA 1AJ5A 2LVVA 3VRRA 3PQZA 2V53A 3BI0A 2BE6A 1TZEE 1AP4A 1SPRA 4GGFC 1IG5A 1F55A 4OV2A 3TZ1A 2IUHA 1FW4A 1G4YR 5B8IB 3NHTA 2L3TA 1TCFA 3GQIB 1DJHA 3D7GA 2KQ6A 4HRGA 2LMUA 4CIDA 3ICBA 3OB2B 3GXXA 1M61A 4CFQA 2VKZG 3KO0A 3EG5B 5JOLA 2M8UA 2C6PA 2UV8G 3DVKA 3S0DA 3FWBA 2KFGA 1SBJA 2RMXA 1KK7Z 1KQMC 4NGMA 2DOQA 1SCMC 4NGTA 1MUXA 2MK2A 2WORA 3TS5B 3R1VA 3PSKA 1Z9EA 1CM4A 1ZACA 2BBUA 2I2RE 3PN7C 1ORGA 2WC5A 1KK8C 1MILA 3PT1A 2LNKA 4KYNA 3QWYA 3NHNA 1GGWA 2OQ1A 4OZDA 1CFCA 1CNPA 4A4BA 3SG7A 1TRFA 3NFQA 5HYDA 3NXAA 2EO6A 2KYCA 3OB1B 3PSRA 4GFTA 1BLKA 3OGNA 2IUGA 2EYZA 2L98A 1AB2A 4NGRA 3D7HA 1EL4A 1YRUB 1BHHA 1KFXL 5I94A 2BCBA 3MAZA 1QXPA 3PM8A 1J1EA 2R2IA 1GM0A 4WRIA 4MN0A 3SJXA 3VROA 1K95A 1DELA 4CLNA 3S0GA 1AYDA 2L6KA 2LHLA 1QATA 1OOHA 2JNFA 3WXAA 2CTNA 5G08A 3DD4A 1L2OB 2BKHB 4NGQA 3TUYC 1QVIZ 3H4SE 4H1OA 2ZKMX 1KA7A 2WCFA 2OR4A 2H61C 2K7CA 1KQVA 2CBLA 2FOTA 1LKKA 1A07A 1WDCB 3O4XA 1U5IB 3I5FB 2SCPA 4P9VA 2M0RA 1OE9B
chains in the Genus database with same CATH topology
1YR5A 2JT8A 2KAYA 2ETZA 1HT9A 4U1PA 1XK4A 1OMRA 1KSOA 4N1FA 2MBXA 1BOCA 2WOSA 1DJWA 4WWQA 2BECA 3F45A 3LCPC 1NYAA 2VRGA 5I2QA 1LUIA 4ORBB 3GK1A 3BUMB 1SPYA 2BBMA 1OO3A 4D8KA 4M2PA 2LMVA 4I5JA 1Z3KA 2MJWB 2JPTA 1M31A 4HRHA 1S36A 1XA5A 2KQYA 3EVVA 4AOMA 3CS1A 2FCDA 5HLVA 3TDZA 5EHRA 5CDWA 3VRYA 1QV0A 1YURA 1BFIA 2KI4C 2CT9A 3BYAA 2M49B 3M0WA 2LANA 3OHMB 4PHMA 2K0JA 2AOAA 1EXRA 1UP5A 1FF1A 1JC2A 3I5GB 4UPGA 4YI9A 5AFPA 5HLOA 2D8NA 1QS7A 1QLKA 3NSIA 1LUMA 3HCKA 3FIAA 2FO0A 1ALWA 1S5GY 2AAOA 1JYUA 4YGEB 1O42A 1K8UA 1P13A 3EACA 3BQ3A 1UUSA 2COLB 1O4BA 2AOBA 3WA4A 3LL8B 2E30A 1QX7A 2K2AA 2ABLA 1D4TA 3JVTB 1O41A 1XFWO 1O4HA 1QADA 2KDHA 4CFRA 4GUKA 3PSJA 1YTZC 1L2OC 3CTNA 3VGOA 1QCFA 1A1CA 2DLZA 1OSAA 1O4GA 2NCPA 4JGHA 5HKZA 2VIFA 4I5LB 1A81A 2KI6C 2GGMA 1KCYA 4P2YB 4BY5A 2HMHA 4H34A 1KA6A 4MZJA 1CMFA 1SHDA 3GK4X 2HETA 2E6WA 2ZNEA 3BXKA 4XJKA 1K9PA 3NSLA 1J7PA 1LUKA 2IUIA 4K44A 4YGCB 4ZCUA 2M29A 2RSYA 3IN7A 2CXJA 1XA6A 4I5KA 2RVFA 5AXIA 4YGBB 2F2OA 2JXLA 4D1EA 1X0NA 2L2EA 1AUIB 2LHIA 2ZFDA 1X02A 3AAJA 1WDCC 4CPVA 1FPWA 2H8HA 1Y57A 2KFFA 2EYYA 3TDUA 1O4NA 4OHEA 5FYXA 4OVNF 3SIAA 3I5FC 4GAOA 5GQQC 1Y1UA 2BE4A 2EKXA 1O4FA 2BCAA 1O4AA 1KFUS 1AHRA 1GHUA 2PVBA 4MLWA 2C0IA 2F3YA 5AANA 1TCEA 4P5OE 2KGRA 3OVEA 2KAXA 3US4A 2Q91A 2HDVA 3I5HB 1C7VA 3C1VA 1NX2A 1SKTA 2Y4QA 3M7FA 3RLZA 1WLZA 3MXYA 3HCMA 1JF2A 1NRVA 3TDIA 4LUEA 4WQ3A 4NDCA 1CDNA 3SIBA 1G83A 2EHBA 1O45A 2HDXA 2PTKA 3RM1A 2JU0A 2Y1NA 3VS3A 1S5GZ 4NQGA 1BHHB 1BMOA 1J55A 3TKZA 1S3PA 5AEQA 2LMTA 4EIHA 4F5AA 1XFYO 1CFPA 3CD3A 3CWGA 2ZRSA 3OX6A 2EC6B 4BTFA 2DCRA 2G2BA 2Y3AB 2CIAA 4ROJA 1QV1A 2CNPA 3PFVA 3OV1A 3KHEA 2WNDA 2OTGB 3SG4A 4BY4A 1SKJA 1VRKA 1V1FA 4ORCB 5D7FA 1IH0A 2C0OA 1IWQA 2YU7A 1O48A 1CLLA 1WRLA 3TL0A 4GBAA 1O4RA 3DVEA 3I5GC 1EJ3A 2M97A 1HQVA 1MHOA 1CFDA 2ZRTA 5PALA 1PVBA 1BJFA 3IMDA 2JT0A 2KBIA 1L7ZA 1XVJA 4Q04A 5DKQA 1M45A 1O47A 1JYQA 1BODA 2JYQA 3LK1A 2NCOA 2ISDA 4DS7A 5EEQA 1QIVA 4NWFA 2EYVA 5BPJA 4USLA 1B9AA 1B7TY 1CJ1A 4I5NB 2F2PA 2JOJA 2JNXA 1SR6B 1IKUA 1O43A 2JWWA 3JVTC 1O4LA 1MXLC 1ALVA 1TNPA 1YX7A 4OCIA 5CSIA 5IBWA 1DMOA 1OZSA 3JTDB 4PE7A 1IQ3A 1K9AA 1BU3A 1QJTA 1ZFPE 1J1DA 1CM1A 3EKHA 3GK2A 2NXQA 2CS0A 1BT6A 1RQQC 1QTXA 4JEGA 4LUDA 2JQ6A 3E3RA 2HUWA 3VS6A 3D10A 1F70A 4FL3A 4C0LA 4OHIA 1NZVA 4QSYA 1FU6A 1OPLA 1H4BA 1F2FA 1DF0A 4TNCA 2ZN8A 4E68A 3QRXA 3UYOA 4IL1A 1TOPA 1O44A 1C07A 2LNWA 1TNQA 1SCVA 2RGIA 1FBZA 2JRFA 3I5IB 1M27A 1Y0VH 4NWGA 3S8NA 1B8RA 2M3WA 3OX5A 1A03A 3MSEB 1AOTF 2DX0A 1K93D 2KSPA 1D1ZA 1O4DA 1GQMA 1S6JA 3EK7A 2H46E 5CPVA 1KFXS 1X6CA 4JPZB 3WHUB 2BKIB 3PLFB 1SHAA 2WCEA 3VRNA 2MC1A 3EK8A 1CWDL 1M63B 5I8NA 1IJ5A 2M9GA 3D0YA 4YGDB 1A08A 2NLNA 1BR4B 1IJRA 4DCKA 3IQQA 1MXEA 1CB1A 1R1PA 4MRYA 2L4KA 1CDMA 1O4KA 2CI9A 3CBLA 1OMVA 1WRZA 1YX8A 5I6VA 1TCOB 1XFUO 2TN4A 1NPQA 2LVIA 2H61A 1SW8A 3IQOA 1KSWA 2K61A 4E93A 3I5HC 1LXFC 3WHTB 1OQPA 1SYMA 2OPOA 1UURA 1V1GA 2LV7A 4L9MA 4MZLA 3BOWA 3FS7A 4PHKA 2M7NA 3SG6A 3MXCA 4M2QA 1O4QA 2LM5A 4JE4A 1S26D 1SPSA 4K45A 2AUCA 1DJGA 2EU0A 2YSXA 5JJGA 3AAKA 1AK8A 1JSAA 2MQIA 3VS1A 1GRIA 1CKKA 1YVHA 3AKBA 4PALA 5AERA 1K9KA 4GWFA 1PK0D 3EK4A 2WCBA 4YI8A 1S6CA 2LP3A 1TNWA 3QWXX 1ZUZA 1B7TZ 3IF7A 3K2MA 2EC6C 5EG3B 1A1EA 1B4CA 1UWOA 1E8AA 5DC9A 2OS8B 2OTGC 1CSZA 1OOJA 1YVLA 2RORA 4ORAB 1RECA 1J7RA 1O4EA 4HSZA 1LVCD 4F5BA 4C0KA 3ZWHA 2MRJA 1PSBA 1FHSA 4M4ZA 1UHNA 4GPLB 4OR9B 1FMKA 2LCTA 3DF0A 1H9OA 2BL0B 5K89A 1Y1AA 3EVRA 5KU1A 2C0TA 2PMYA 3EVUA 3KF9A 1CDLA 2PRUA 5BO4A 5GJHA 2MLEC 2JULA 3UF4A 3IMJA 2K7OA 4QJ4B 1SR6C 1DTLA 4ZCVA 2PNAA 5AULA 2JXCA 4YBHB 1JFJA 1XFZO 2MLFC 1FU5A 4HREE 3JTDC 1RFJA 2I94A 1SHBA 2AUGA 3VS4A 3S8OA 2KK6A 1D4WA 1KQMB 2KOTA 2LLTA 1WQUA 1KC2A 3T04A 1RWYA 2K7AB 3KFJA 1JWOA 2NZ0A 1JF0A 1A75B 1F4OA 2AMIA 2HPSA 2P6BB 4N5XA 4ETOA 1B1GA 4XZ0A 1MWNA 1S1EA 2O5GA 1AVSA 3BUXB 1SCMB 1O4OA 3S9KA 2Y1MA 2BCXA 4MRXA 1SNLA 2HF5A 3VRQA 5DKNA 2M1UA 3I5IC 1LCKA 1PALA 1PRWA 2QACA 1QLSA 2HCKA 4OHLA 5EELA 1RROA 2DM0A 3VS5A 1TIZA 2I18A 4XJKB 2QMSA 1LKJA 1KK7Y 2KYFA 2JTTA 2F8PA 4PDZA 5CSJA 1AJ5A 4EY0A 2LVVA 5DF6A 3VRRA 2KI6D 4PCWA 1JFKA 1O4PA 2V53A 3O2PA 3PQZA 1DJXA 1WLMA 1O4JA 2BE6A 1TZEE 1B8CA 1Y1XA 1AP4A 2L4HA 3PN7B 3VS2A 3HX4A 1O4CA 1HCSB 3HIZB 1K90D 1WRKA 2O60A 1SPRA 2DLYA 1B47A 1KK8B 2LLSA 4GGFC 4P9ZA 4JQ0D 1NWDA 2GE9A 4FQOA 2ZNDA 1LA0A 4PE0A 2ECDA 1RTP1 2CCMA 1Y6WA 1NCXA 2FJUB 1DVIA 1IG5A 2KBMA 1F55A 4C0JA 1DJIA 1SMGA 3A8RA 4OV2A 4OKHA 1U5IA 2BBNA 2KFHA 5DC0B 1R1QA 2MRKA 1UHIA 1XK4C 1NSHA 1WY9A 3TZ1A 2IUHA 4X6SA 5DKRA 1Q80A 1RK9A 2KAVA 1FW4A 1G4YR 4K11A 5B8IB 1NUBA 2IS9A 3EKJA 3SG2A 4DUQA 1AYBA 1TCFA 1O4IA 2L3TA 3C7IA 1UHHA 1AJ4A 2GSBA 1BG1A 4F59A 3BUNB 4AQJA 3GQIB 5DC4A 2L50A 1G33A 2EO3A 2FCIA 1I3ZA 2DVJA 2OS8C 2L0PA 2K79B 1DJHA 1XO5A 2LC5A 4XYNA 1A2XA 2KQ6A 2PLDA 1KSMA 4PE4A 4YGAA 2PLEA 4HRGA 2LMUA 4CIDA 3OP0A 1A09A 3ICBA 1NX0A 1SK6D 3OB2B 3GXXA 1ZFSA 2KNEA 1M61A 2BL0C 2SASA 3LLEA 2LCPA 4CFQA 3HHMB 3N84A 3K21A 3KO0A 4L1BB 2JT3A 4PE1A 1QG1E 2QPTA 5KAZA 5JOLA 1O4MA 1ZOTB 2M8UA 3CGAA 3CLNA 1RPYA 4JWQA 4FBNA 1FBVA 2PSRA 5I2OA 2L4IA 1OO4A 3DVKA 4OHDA 3FWBA 2FCEA 2KFGA 1SBJA 4DIRA 2RMXA 1KK7Z 2LLUA 1JU5A 3PJPA 1BMBA 1KQMC 1TN4A 2G9BA 1KFUL 2LAPA 1SY9A 3VS7A 1TNXA 1R1SA 2CI8A 2LNXA 1NIWA 1G8IA 4U17A 3PATA 2DOQA 1IGVA 2LUXA 5CSNA 1SCMC 4AQIA 4PHNA 1NX1A 2L51A 1MUXA 2MK2A 2WORA 4TZIA 2PASA 2MHHA 5D69A 2M1KB 1J7OA 1DGVA 3TS5B 1O46A 3BKBA 3VRZA 1NCYA 3BUWB 4F0ZB 4DGXA 1O49A 1DF0B 4M2OA 2EOBA 4GL9E 1BR1B 2L5XB 1ODBA 5ER5A 1OPKA 2MAZA 3PSKA 1EH2A 1A1BA 1CM4A 1ZACA 3FWCA 3PALA 2I2RE 2BBUA 3PN7C 2GV5A 1QX5B 1X27A 4FL2A 1ZMZA 1KK8C 3D0YB 4ICBA 5F6TA 2H5KA 1FYRA 3N8MA 3TUYB 1MILA 1LKLA 3S8LA 4GGNA 1DJYA 3CR4X 3VS0A 2MRDA 4NDBA 1B8LA 2JC2A 2LNKA 5HKWA 2JZIA 1PSRA 1SL8A 3O78A 1LUNA 1SL9A 2Q4UA 3AKAA 3NHNA 3CZTX 5HKYA 1RJAA 3O6BA 1FI5A 3QWYA 1GGWA 1R6PA 3SG3A 2M7LA 2LE9B 5J3XA 2OQ1A 3BOWB 1MR8A 1CFCA 4A4BA 1CNPA 1W7JB 1KWOB 3SG7A 2B3OA 1A75A 1TRFA 4A4CA 1TTXA 2A4JA 4PHJA 1C7WA 1HCTB 3EAZA 1DT7B 5D0JA 4DGPA 2JTZA 3LK0A 1QVIY 1JBAA 5HYDA 1BHFA 1YRTB 1BKLA 3NXAA 5IBMA 2EO6A 2KYCA 4K2RA 3OB1B 3PSRA 4GFTA 1F54A 1BLKA 1BLQA 1IQ5A 1BLJA 1N65A 1LA3A 2K7DA 1LINA 2IUGA 3N7YA 1R2UA 2EYZA 1S6IA 2GGZA 2L98A 4MVFA 3DVJA 2XP1A 1AB2A 1M39A 1YUSA 1AOUF 1EG3A 4NDDA 1UHJA 4MBEA 1EL4A 1YRUB 2LVJA 1PULA 1KFXL 1BHHA 2IZVA 2KNOA 4U8DA 1JWDA 2SRCA 4OHHA 5IBSA 2BCBA 3DF0B 3MAZA 1AYAA 2WC8A 1MW4A 1QXPA 1NP8A 2F3ZA 3GXWA 1XYDA 3PM8A 1J1EA 2R2IA 2B1UA 1K2HA 2CRHA 1K94A 3VRPA 4WRIA 1QASA 4MN0A 2K7BA 3VROA 2OZOA 1K95A 1XFVO 2KI4B 4FTGA 4MEWA 4N1GA 1OMDA 5ER4X 2LQNA 1K9UA 1AD5A 4MSPA 5CSFA 1DGUA 1N0YA 1YUTA 2F33A 5I2LA 2K8MB 1MF8B 2LUCA 4MZKA 1BKMA 4CLNA 1IRJA 1A1AA 1BFJA 3TS5C 1EG4A 1LCJA 1AYDA 1XFXO 1OZOA 3WNXB 2L6KA 4QJ5B 3KPXA 2LHLA 3NSOA 4GNKB 5EHPA 3SJSA 1QATA 2ZN9A 1SRAA 1PVAA 3GOFA 5KSZA 1QX2A 1N2DA 1JUOA 3NSKA 3SG5A 1BF5A 1YUUA 2JNFA 3WXAA 2Y5IA 1CFFA 4XZ1A 2CTNA 5G08A 3DD4A 1F71A 1H8BA 1IJ6A 1NZLA 3PS5A 2BKHB 1K96A 1L2OB 3DVMA 1GJYA 4QJ3B 1D1OA 1J7QA 2EGDA 1CLBA 2LVKA 2CR4A 3CXLA 3TUYC 1QVIZ 3H4SE 1F8HA 2KHNA 4H1OA 5GJIA 1W7IB 2PNBA 1GGZA 1RJVA 2ZKMX 1KA7A 1F4QA 2WCFA 3KEVA 2H61C 2K7CA 1KQVA 1MQ1A 1A29A 1DJZA 1QIWA 2CBLA 2FOTA 3O4YA 2SHPA 1A4PA 1UHKA 3A4UB 4R1EA 1LKKA 1CSYA 3CR5X 1A07A 2HQ8A 1CLMA 1CWEA 1KWOC 2LQWA 2I7AA 1WDCB 2HQWA 2H2KA 2KGBC 2PALA 2K2FA 4WQ2A 5KTYA 1JYRA 2EL8A 1U5IB 1F1WA 3IN8A 1M46A 3CR2A 1BM2A 1NCZA 1PICA 1AYCA 2LP2A 3I5FB 4GGFA 1CDPA 2SCPA 4P9VA 2M0RA 4DRWA 4YRUA 3ZNIA 2MA2A 1FI6A 1CMGA 1CTRA 2C9WA 1OE9B 1SL7A 5TNCA 1NX3A 3BUOB 1IS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YR5 A;  2JT8 A;  2KAY A;  2ETZ A;  1HT9 A;  4U1P A;  1XK4 A;  1OMR A;  1KSO A;  4N1F A;  2MBX A;  1BOC A;  2WOS A;  1DJW A;  4WWQ A;  2BEC A;  3F45 A;  3LCP C;  1NYA A;  2VRG A;  5I2Q A;  1LUI A;  4ORB B;  3GK1 A;  3BUM B;  1SPY A;  2BBM A;  1OO3 A;  4D8K A;  4M2P A;  2LMV A;  4I5J A;  1Z3K A;  2MJW B;  2JPT A;  1M31 A;  4HRH A;  1S36 A;  1XA5 A;  2KQY A;  3EVV A;  4AOM A;  3CS1 A;  2FCD A;  5HLV A;  3TDZ A;  5EHR A;  5CDW A;  3VRY A;  1QV0 A;  1YUR A;  1BFI A;  2KI4 C;  2CT9 A;  3BYA A;  2M49 B;  3M0W A;  2LAN A;  3OHM B;  4PHM A;  2K0J A;  2AOA A;  1EXR A;  1UP5 A;  1FF1 A;  1JC2 A;  3I5G B;  4UPG A;  4YI9 A;  5AFP A;  5HLO A;  2D8N A;  1QS7 A;  1QLK A;  3NSI A;  1LUM A;  3HCK A;  3FIA A;  2FO0 A;  1ALW A;  1S5G Y;  2AAO A;  1JYU A;  4YGE B;  1O42 A;  1K8U A;  1P13 A;  3EAC A;  3BQ3 A;  1UUS A;  2COL B;  1O4B A;  2AOB A;  3WA4 A;  3LL8 B;  2E30 A;  1QX7 A;  2K2A A;  2ABL A;  1D4T A;  3JVT B;  1O41 A;  1XFW O;  1O4H A;  1QAD A;  2KDH A;  4CFR A;  4GUK A;  3PSJ A;  1YTZ C;  1L2O C;  3CTN A;  3VGO A;  1QCF A;  1A1C A;  2DLZ A;  1OSA A;  1O4G A;  2NCP A;  4JGH A;  5HKZ A;  2VIF A;  4I5L B;  1A81 A;  2KI6 C;  2GGM A;  1KCY A;  4P2Y B;  4BY5 A;  2HMH A;  4H34 A;  1KA6 A;  4MZJ A;  1CMF A;  1SHD A;  3GK4 X;  2HET A;  2E6W A;  2ZNE A;  3BXK A;  4XJK A;  1K9P A;  3NSL A;  1J7P A;  1LUK A;  2IUI A;  4K44 A;  4YGC B;  4ZCU A;  2M29 A;  2RSY A;  3IN7 A;  2CXJ A;  1XA6 A;  4I5K A;  2RVF A;  5AXI A;  4YGB B;  2F2O A;  2JXL A;  4D1E A;  1X0N A;  2L2E A;  1AUI B;  2LHI A;  2ZFD A;  1X02 A;  3AAJ A;  1WDC C;  4CPV A;  1FPW A;  2H8H A;  1Y57 A;  2KFF A;  2EYY A;  3TDU A;  1O4N A;  4OHE A;  5FYX A;  4OVN F;  3SIA A;  3I5F C;  4GAO A;  5GQQ C;  1Y1U A;  2BE4 A;  2EKX A;  1O4F A;  2BCA A;  1O4A A;  1KFU S;  1AHR A;  1GHU A;  2PVB A;  4MLW A;  2C0I A;  2F3Y A;  5AAN A;  1TCE A;  4P5O E;  2KGR A;  3OVE A;  2KAX A;  3US4 A;  2Q91 A;  2HDV A;  3I5H B;  1C7V A;  3C1V A;  1NX2 A;  1SKT A;  2Y4Q A;  3M7F A;  3RLZ A;  1WLZ A;  3MXY A;  3HCM A;  1JF2 A;  1NRV A;  3TDI A;  4LUE A;  4WQ3 A;  4NDC A;  1CDN A;  3SIB A;  1G83 A;  2EHB A;  1O45 A;  2HDX A;  2PTK A;  3RM1 A;  2JU0 A;  2Y1N A;  3VS3 A;  1S5G Z;  4NQG A;  1BHH B;  1BMO A;  1J55 A;  3TKZ A;  1S3P A;  5AEQ A;  2LMT A;  4EIH A;  4F5A A;  1XFY O;  1CFP A;  3CD3 A;  3CWG A;  2ZRS A;  3OX6 A;  2EC6 B;  4BTF A;  2DCR A;  2G2B A;  2Y3A B;  2CIA A;  4ROJ A;  1QV1 A;  2CNP A;  3PFV A;  3OV1 A;  3KHE A;  2WND A;  2OTG B;  3SG4 A;  4BY4 A;  1SKJ A;  1VRK A;  1V1F A;  4ORC B;  5D7F A;  1IH0 A;  2C0O A;  1IWQ A;  2YU7 A;  1O48 A;  1CLL A;  1WRL A;  3TL0 A;  4GBA A;  1O4R A;  3DVE A;  3I5G C;  1EJ3 A;  2M97 A;  1HQV A;  1MHO A;  1CFD A;  2ZRT A;  5PAL A;  1PVB A;  1BJF A;  3IMD A;  2JT0 A;  2KBI A;  1L7Z A;  1XVJ A;  4Q04 A;  5DKQ A;  1M45 A;  1O47 A;  1JYQ A;  1BOD A;  2JYQ A;  3LK1 A;  2NCO A;  2ISD A;  4DS7 A;  5EEQ A;  1QIV A;  4NWF A;  2EYV A;  5BPJ A;  4USL A;  1B9A A;  1B7T Y;  1CJ1 A;  4I5N B;  2F2P A;  2JOJ A;  2JNX A;  1SR6 B;  1IKU A;  1O43 A;  2JWW A;  3JVT C;  1O4L A;  1MXL C;  1ALV A;  1TNP A;  1YX7 A;  4OCI A;  5CSI A;  5IBW A;  1DMO A;  1OZS A;  3JTD B;  4PE7 A;  1IQ3 A;  1K9A A;  1BU3 A;  1QJT A;  1ZFP E;  1J1D A;  1CM1 A;  3EKH A;  3GK2 A;  2NXQ A;  2CS0 A;  1BT6 A;  1RQQ C;  1QTX A;  4JEG A;  4LUD A;  2JQ6 A;  3E3R A;  2HUW A;  3VS6 A;  3D10 A;  1F70 A;  4FL3 A;  4C0L A;  4OHI A;  1NZV A;  4QSY A;  1FU6 A;  1OPL A;  1H4B A;  1F2F A;  1DF0 A;  4TNC A;  2ZN8 A;  4E68 A;  3QRX A;  3UYO A;  4IL1 A;  1TOP A;  1O44 A;  1C07 A;  2LNW A;  1TNQ A;  1SCV A;  2RGI A;  1FBZ A;  2JRF A;  3I5I B;  1M27 A;  1Y0V H;  4NWG A;  3S8N A;  1B8R A;  2M3W A;  3OX5 A;  1A03 A;  3MSE B;  1AOT F;  2DX0 A;  1K93 D;  2KSP A;  1D1Z A;  1O4D A;  1GQM A;  1S6J A;  3EK7 A;  2H46 E;  5CPV A;  1KFX S;  1X6C A;  4JPZ B;  3WHU B;  2BKI B;  3PLF B;  1SHA A;  2WCE A;  3VRN A;  2MC1 A;  3EK8 A;  1CWD L;  1M63 B;  5I8N A;  1IJ5 A;  2M9G A;  3D0Y A;  4YGD B;  1A08 A;  2NLN A;  1BR4 B;  1IJR A;  4DCK A;  3IQQ A;  1MXE A;  1CB1 A;  1R1P A;  4MRY A;  2L4K A;  1CDM A;  1O4K A;  2CI9 A;  3CBL A;  1OMV A;  1WRZ A;  1YX8 A;  5I6V A;  1TCO B;  1XFU O;  2TN4 A;  1NPQ A;  2LVI A;  2H61 A;  1SW8 A;  3IQO A;  1KSW A;  2K61 A;  4E93 A;  3I5H C;  1LXF C;  3WHT B;  1OQP A;  1SYM A;  2OPO A;  1UUR A;  1V1G A;  2LV7 A;  4L9M A;  4MZL A;  3BOW A;  3FS7 A;  4PHK A;  2M7N A;  3SG6 A;  3MXC A;  4M2Q A;  1O4Q A;  2LM5 A;  4JE4 A;  1S26 D;  1SPS A;  4K45 A;  2AUC A;  1DJG A;  2EU0 A;  2YSX A;  5JJG A;  3AAK A;  1AK8 A;  1JSA A;  2MQI A;  3VS1 A;  1GRI A;  1CKK A;  1YVH A;  3AKB A;  4PAL A;  5AER A;  1K9K A;  4GWF A;  1PK0 D;  3EK4 A;  2WCB A;  4YI8 A;  1S6C A;  2LP3 A;  1TNW A;  3QWX X;  1ZUZ A;  1B7T Z;  3IF7 A;  3K2M A;  2EC6 C;  5EG3 B;  1A1E A;  1B4C A;  1UWO A;  1E8A A;  5DC9 A;  2OS8 B;  2OTG C;  1CSZ A;  1OOJ A;  1YVL A;  2ROR A;  4ORA B;  1REC A;  1J7R A;  1O4E A;  4HSZ A;  1LVC D;  4F5B A;  4C0K A;  3ZWH A;  2MRJ A;  1PSB A;  1FHS A;  4M4Z A;  1UHN A;  4GPL B;  4OR9 B;  1FMK A;  2LCT A;  3DF0 A;  1H9O A;  2BL0 B;  5K89 A;  1Y1A A;  3EVR A;  5KU1 A;  2C0T A;  2PMY A;  3EVU A;  3KF9 A;  1CDL A;  2PRU A;  5BO4 A;  5GJH A;  2MLE C;  2JUL A;  3UF4 A;  3IMJ A;  2K7O A;  4QJ4 B;  1SR6 C;  1DTL A;  4ZCV A;  2PNA A;  5AUL A;  2JXC A;  4YBH B;  1JFJ A;  1XFZ O;  2MLF C;  1FU5 A;  4HRE E;  3JTD C;  1RFJ A;  2I94 A;  1SHB A;  2AUG A;  3VS4 A;  3S8O A;  2KK6 A;  1D4W A;  1KQM B;  2KOT A;  2LLT A;  1WQU A;  1KC2 A;  3T04 A;  1RWY A;  2K7A B;  3KFJ A;  1JWO A;  2NZ0 A;  1JF0 A;  1A75 B;  1F4O A;  2AMI A;  2HPS A;  2P6B B;  4N5X A;  4ETO A;  1B1G A;  4XZ0 A;  1MWN A;  1S1E A;  2O5G A;  1AVS A;  3BUX B;  1SCM B;  1O4O A;  3S9K A;  2Y1M A;  2BCX A;  4MRX A;  1SNL A;  2HF5 A;  3VRQ A;  5DKN A;  2M1U A;  3I5I C;  1LCK A;  1PAL A;  1PRW A;  2QAC A;  1QLS A;  2HCK A;  4OHL A;  5EEL A;  1RRO A;  2DM0 A;  3VS5 A;  1TIZ A;  2I18 A;  4XJK B;  2QMS A;  1LKJ A;  1KK7 Y;  2KYF A;  2JTT A;  2F8P A;  4PDZ A;  5CSJ A;  1AJ5 A;  4EY0 A;  2LVV A;  5DF6 A;  3VRR A;  2KI6 D;  4PCW A;  1JFK A;  1O4P A;  2V53 A;  3O2P A;  3PQZ A;  1DJX A;  1WLM A;  1O4J A;  2BE6 A;  1TZE E;  1B8C A;  1Y1X A;  1AP4 A;  2L4H A;  3PN7 B;  3VS2 A;  3HX4 A;  1O4C A;  1HCS B;  3HIZ B;  1K90 D;  1WRK A;  2O60 A;  1SPR A;  2DLY A;  1B47 A;  1KK8 B;  2LLS A;  4GGF C;  4P9Z A;  4JQ0 D;  1NWD A;  2GE9 A;  4FQO A;  2ZND A;  1LA0 A;  4PE0 A;  2ECD A;  1RTP 1;  2CCM A;  1Y6W A;  1NCX A;  2FJU B;  1DVI A;  1IG5 A;  2KBM A;  1F55 A;  4C0J A;  1DJI A;  1SMG A;  3A8R A;  4OV2 A;  4OKH A;  1U5I A;  2BBN A;  2KFH A;  5DC0 B;  1R1Q A;  2MRK A;  1UHI A;  1XK4 C;  1NSH A;  1WY9 A;  3TZ1 A;  2IUH A;  4X6S A;  5DKR A;  1Q80 A;  1RK9 A;  2KAV A;  1FW4 A;  1G4Y R;  4K11 A;  5B8I B;  1NUB A;  2IS9 A;  3EKJ A;  3SG2 A;  4DUQ A;  1AYB A;  1TCF A;  1O4I A;  2L3T A;  3C7I A;  1UHH A;  1AJ4 A;  2GSB A;  1BG1 A;  4F59 A;  3BUN B;  4AQJ A;  3GQI B;  5DC4 A;  2L50 A;  1G33 A;  2EO3 A;  2FCI A;  1I3Z A;  2DVJ A;  2OS8 C;  2L0P A;  2K79 B;  1DJH A;  1XO5 A;  2LC5 A;  4XYN A;  1A2X A;  2KQ6 A;  2PLD A;  1KSM A;  4PE4 A;  4YGA A;  2PLE A;  4HRG A;  2LMU A;  4CID A;  3OP0 A;  1A09 A;  3ICB A;  1NX0 A;  1SK6 D;  3OB2 B;  3GXX A;  1ZFS A;  2KNE A;  1M61 A;  2BL0 C;  2SAS A;  3LLE A;  2LCP A;  4CFQ A;  3HHM B;  3N84 A;  3K21 A;  3KO0 A;  4L1B B;  2JT3 A;  4PE1 A;  1QG1 E;  2QPT A;  5KAZ A;  5JOL A;  1O4M A;  1ZOT B;  2M8U A;  3CGA A;  3CLN A;  1RPY A;  4JWQ A;  4FBN A;  1FBV A;  2PSR A;  5I2O A;  2L4I A;  1OO4 A;  3DVK A;  4OHD A;  3FWB A;  2FCE A;  2KFG A;  1SBJ A;  4DIR A;  2RMX A;  1KK7 Z;  2LLU A;  1JU5 A;  3PJP A;  1BMB A;  1KQM C;  1TN4 A;  2G9B A;  1KFU L;  2LAP A;  1SY9 A;  3VS7 A;  1TNX A;  1R1S A;  2CI8 A;  2LNX A;  1NIW A;  1G8I A;  4U17 A;  3PAT A;  2DOQ A;  1IGV A;  2LUX A;  5CSN A;  1SCM C;  4AQI A;  4PHN A;  1NX1 A;  2L51 A;  1MUX A;  2MK2 A;  2WOR A;  4TZI A;  2PAS A;  2MHH A;  5D69 A;  2M1K B;  1J7O A;  1DGV A;  3TS5 B;  1O46 A;  3BKB A;  3VRZ A;  1NCY A;  3BUW B;  4F0Z B;  4DGX A;  1O49 A;  1DF0 B;  4M2O A;  2EOB A;  4GL9 E;  1BR1 B;  2L5X B;  1ODB A;  5ER5 A;  1OPK A;  2MAZ A;  3PSK A;  1EH2 A;  1A1B A;  1CM4 A;  1ZAC A;  3FWC A;  3PAL A;  2I2R E;  2BBU A;  3PN7 C;  2GV5 A;  1QX5 B;  1X27 A;  4FL2 A;  1ZMZ A;  1KK8 C;  3D0Y B;  4ICB A;  5F6T A;  2H5K A;  1FYR A;  3N8M A;  3TUY B;  1MIL A;  1LKL A;  3S8L A;  4GGN A;  1DJY A;  3CR4 X;  3VS0 A;  2MRD A;  4NDB A;  1B8L A;  2JC2 A;  2LNK A;  5HKW A;  2JZI A;  1PSR A;  1SL8 A;  3O78 A;  1LUN A;  1SL9 A;  2Q4U A;  3AKA A;  3NHN A;  3CZT X;  5HKY A;  1RJA A;  3O6B A;  1FI5 A;  3QWY A;  1GGW A;  1R6P A;  3SG3 A;  2M7L A;  2LE9 B;  5J3X A;  2OQ1 A;  3BOW B;  1MR8 A;  1CFC A;  4A4B A;  1CNP A;  1W7J B;  1KWO B;  3SG7 A;  2B3O A;  1A75 A;  1TRF A;  4A4C A;  1TTX A;  2A4J A;  4PHJ A;  1C7W A;  1HCT B;  3EAZ A;  1DT7 B;  5D0J A;  4DGP A;  2JTZ A;  3LK0 A;  1QVI Y;  1JBA A;  5HYD A;  1BHF A;  1YRT B;  1BKL A;  3NXA A;  5IBM A;  2EO6 A;  2KYC A;  4K2R A;  3OB1 B;  3PSR A;  4GFT A;  1F54 A;  1BLK A;  1BLQ A;  1IQ5 A;  1BLJ A;  1N65 A;  1LA3 A;  2K7D A;  1LIN A;  2IUG A;  3N7Y A;  1R2U A;  2EYZ A;  1S6I A;  2GGZ A;  2L98 A;  4MVF A;  3DVJ A;  2XP1 A;  1AB2 A;  1M39 A;  1YUS A;  1AOU F;  1EG3 A;  4NDD A;  1UHJ A;  4MBE A;  1EL4 A;  1YRU B;  2LVJ A;  1PUL A;  1KFX L;  1BHH A;  2IZV A;  2KNO A;  4U8D A;  1JWD A;  2SRC A;  4OHH A;  5IBS A;  2BCB A;  3DF0 B;  3MAZ A;  1AYA A;  2WC8 A;  1MW4 A;  1QXP A;  1NP8 A;  2F3Z A;  3GXW A;  1XYD A;  3PM8 A;  1J1E A;  2R2I A;  2B1U A;  1K2H A;  2CRH A;  1K94 A;  3VRP A;  4WRI A;  1QAS A;  4MN0 A;  2K7B A;  3VRO A;  2OZO A;  1K95 A;  1XFV O;  2KI4 B;  4FTG A;  4MEW A;  4N1G A;  1OMD A;  5ER4 X;  2LQN A;  1K9U A;  1AD5 A;  4MSP A;  5CSF A;  1DGU A;  1N0Y A;  1YUT A;  2F33 A;  5I2L A;  2K8M B;  1MF8 B;  2LUC A;  4MZK A;  1BKM A;  4CLN A;  1IRJ A;  1A1A A;  1BFJ A;  3TS5 C;  1EG4 A;  1LCJ A;  1AYD A;  1XFX O;  1OZO A;  3WNX B;  2L6K A;  4QJ5 B;  3KPX A;  2LHL A;  3NSO A;  4GNK B;  5EHP A;  3SJS A;  1QAT A;  2ZN9 A;  1SRA A;  1PVA A;  3GOF A;  5KSZ A;  1QX2 A;  1N2D A;  1JUO A;  3NSK A;  3SG5 A;  1BF5 A;  1YUU A;  2JNF A;  3WXA A;  2Y5I A;  1CFF A;  4XZ1 A;  2CTN A;  5G08 A;  3DD4 A;  1F71 A;  1H8B A;  1IJ6 A;  1NZL A;  3PS5 A;  2BKH B;  1K96 A;  1L2O B;  3DVM A;  1GJY A;  4QJ3 B;  1D1O A;  1J7Q A;  2EGD A;  1CLB A;  2LVK A;  2CR4 A;  3CXL A;  3TUY C;  1QVI Z;  3H4S E;  1F8H A;  2KHN A;  4H1O A;  5GJI A;  1W7I B;  2PNB A;  1GGZ A;  1RJV A;  2ZKM X;  1KA7 A;  1F4Q A;  2WCF A;  3KEV A;  2H61 C;  2K7C A;  1KQV A;  1MQ1 A;  1A29 A;  1DJZ A;  1QIW A;  2CBL A;  2FOT A;  3O4Y A;  2SHP A;  1A4P A;  1UHK A;  3A4U B;  4R1E A;  1LKK A;  1CSY A;  3CR5 X;  1A07 A;  2HQ8 A;  1CLM A;  1CWE A;  1KWO C;  2LQW A;  2I7A A;  1WDC B;  2HQW A;  2H2K A;  2KGB C;  2PAL A;  2K2F A;  4WQ2 A;  5KTY A;  1JYR A;  2EL8 A;  1U5I B;  1F1W A;  3IN8 A;  1M46 A;  3CR2 A;  1BM2 A;  1NCZ A;  1PIC A;  1AYC A;  2LP2 A;  3I5F B;  4GGF A;  1CDP A;  2SCP A;  4P9V A;  2M0R A;  4DRW A;  4YRU A;  3ZNI A;  2MA2 A;  1FI6 A;  1CMG A;  1CTR A;  2C9W A;  1OE9 B;  1SL7 A;  5TNC A;  1NX3 A;  3BUO B;  1IS0 A; 
#chains in the Genus database with same CATH topology
 2KAY A;  4U1P A;  4WWQ A;  3F45 A;  4ORB B;  3GK1 A;  1SPY A;  2BBM A;  4D8K A;  4M2P A;  3N7H A;  4MCP A;  1XA5 A;  3EVV A;  5CDW A;  1YUR A;  1BFI A;  4PHM A;  1EXR A;  1UP5 A;  3I5G B;  2D8N A;  3FIA A;  1O4B A;  2AOB A;  4CFR A;  4GUK A;  1T14 A;  3CTN A;  2DLZ A;  1QCF A;  2GGM A;  4P2Y B;  4BY5 A;  1SHD A;  1K9P A;  3NSL A;  4ZCU A;  3IN7 A;  1XA6 A;  4YGB B;  2L2E A;  1AUI B;  2ZFD A;  2QEB A;  3OAK A;  2H8H A;  3TDU A;  2N3A B;  1O4N A;  3SIA A;  4GAO A;  5GQQ C;  1Y1U A;  1O4F A;  1O4A A;  4FQT A;  2PVB A;  3FE8 A;  3OVE A;  3I5H B;  1NRV A;  3KAS A;  1CDN A;  1O45 A;  5D29 A;  3RM1 A;  2Y1N A;  1S5G Z;  4NQG A;  1BMO A;  1J55 A;  2KLD A;  1XFY O;  1CFP A;  3CD3 A;  3OX6 A;  4ROJ A;  1QV1 A;  3SG4 A;  4ORC B;  1IWQ A;  2XPP A;  1L7Z A;  1BOD A;  2ISD A;  2EYV A;  1CJ1 A;  4I5N B;  2JOJ A;  2P71 A;  1O43 A;  2JWW A;  3JVT C;  1O4L A;  4OCI A;  1OZS A;  1ZFP E;  3D10 A;  4FL3 A;  4C0L A;  1NZV A;  4E68 A;  3QRX A;  1O44 A;  1C07 A;  1TNQ A;  2JRF A;  5FI7 A;  1CX8 A;  2M3W A;  1GQM A;  5CPV A;  4JPZ B;  2WCE A;  3EK8 A;  1OOI X;  2M9G A;  4YGD B;  1BR4 B;  4P44 A;  2L4K A;  2XEG A;  2CI9 A;  1YX8 A;  2QEO A;  1NPQ A;  2LVI A;  3V2L A;  1SW8 A;  2DLA A;  3WHT B;  1OQP A;  1Z3K A;  1UUR A;  4MZL A;  4JE4 A;  1TWO A;  1SPS A;  1DJG A;  5JJG A;  3OBV A;  1JSA A;  1CKK A;  1K9K A;  1PK0 D;  1C3Y A;  4YI8 A;  1TNW A;  1B7T Z;  3IF7 A;  2EC6 C;  2ROR A;  5DIC A;  1J7R A;  2MRJ A;  4M4Z A;  1FMK A;  5K89 A;  3EVR A;  3L47 A;  2PRU A;  2JUL A;  2K7O A;  1DTL A;  5AUL A;  1SHB A;  2KOT A;  4P4E A;  3KFJ A;  1F4O A;  4XZ0 A;  4MRX A;  1SNL A;  2HF5 A;  3B88 A;  2M1U A;  4OHL A;  1RRO A;  2DM0 A;  1LKJ A;  2JTT A;  4PDZ A;  4EY0 A;  2KI6 D;  4PCW A;  3O2P A;  1DJX A;  1WLM A;  2L4H A;  4RR2 B;  3HIZ B;  1K90 D;  1B47 A;  4FQO A;  2ZND A;  4PE0 A;  2KLE A;  1RTP 1;  2FJU B;  2KBM A;  4P4B A;  3A8R A;  1U5I A;  2BBN A;  2KFH A;  1R1Q A;  2MRK A;  4X6S A;  1NSH A;  1WY9 A;  1RK9 A;  2KAV A;  3NHI A;  2IS9 A;  3EKJ A;  3SG2 A;  4DUQ A;  2GSB A;  2PLD A;  2PLE A;  3L4A A;  1SK6 D;  3K21 A;  2JT3 A;  2QPT A;  1O4M A;  3CGA A;  3CLN A;  1RPY A;  4JWQ A;  2PSR A;  2L4I A;  4OHD A;  4DIR A;  2LAP A;  3VS7 A;  1NIW A;  1G8I A;  1IGV A;  5CSN A;  2PAS A;  2MHH A;  2M1K B;  1O46 A;  3VRZ A;  2H8V A;  3BUW B;  4DGX A;  1DF0 B;  2EOB A;  1BR1 B;  1ODB A;  5ER5 A;  1EH2 A;  3PAL A;  2GV5 A;  4FL2 A;  1ZMZ A;  1FYR A;  1LKL A;  3S8L A;  4GGN A;  1DJY A;  3VS0 A;  1EO0 A;  5HKW A;  1LUN A;  1PSR A;  3O78 A;  3VB1 A;  3AKA A;  3O6B A;  1R6P A;  3SG3 A;  3BFH A;  3BOW B;  1MR8 A;  1KWO B;  4A4C A;  1TTX A;  4LQG A;  4OC5 A;  1HCT B;  3EAZ A;  2JTZ A;  3LK0 A;  1BHF A;  1F54 A;  4JD9 A;  1BLJ A;  2K7D A;  1S6I A;  4MVF A;  1YUS A;  1UHJ A;  2LVJ A;  2IZV A;  2KNO A;  1AYA A;  1WJT A;  2F3Z A;  2CRH A;  1K94 A;  2K7B A;  2OZO A;  1XFV O;  1OMD A;  1AD5 A;  5I2L A;  1N0Y A;  1YUT A;  2LUC A;  2C6C A;  4GNK B;  4W9Y A;  5KSZ A;  1BF5 A;  1YUU A;  4BPX B;  1NZL A;  1F71 A;  1K96 A;  4QJ3 B;  5EHR A;  1GJY A;  1J7Q A;  1CLB A;  2LVK A;  1GGZ A;  1RJV A;  1MQ1 A;  1A29 A;  3O4Y A;  1UHK A;  4R1E A;  1CSY A;  1CLM A;  1CWE A;  2I7A A;  2PAL A;  2HQW A;  4WQ2 A;  1JYR A;  1M46 A;  3CR2 A;  4DRW A;  4YRU A;  1CMG A;  1LS8 A;  2WCK A;  1NX3 A;  3RZS A;  2JT8 A;  1HT9 A;  1XK4 A;  4N1F A;  2WOS A;  1DJW A;  2VRG A;  1IIO A;  3BUM B;  3SJG A;  2LMV A;  4MCQ A;  4I5J A;  1S36 A;  4AOM A;  2FCD A;  3TDZ A;  2KI4 C;  2M49 B;  3M0W A;  2LAN A;  2AOA A;  3HMJ G;  4UPG A;  4YI9 A;  5HLO A;  3HCK A;  1LUM A;  3RBU A;  1ALW A;  1K8U A;  3BQ3 A;  3WA4 A;  1P28 A;  2E30 A;  1QX7 A;  1QAD A;  1XFW O;  2KDH A;  2JBK A;  2XEF A;  3VGO A;  5HKZ A;  4I5L B;  1A81 A;  2KI6 C;  3D74 A;  4H34 A;  4MZJ A;  3GK4 X;  5EL2 A;  2M29 A;  2CXJ A;  4I5K A;  2RVF A;  5AXI A;  4D1E A;  1X0N A;  4CPV A;  4P4I A;  3CAB A;  1GHU A;  4MLW A;  1TCE A;  2KAX A;  3US4 A;  2Q91 A;  3C1V A;  1WLZ A;  3HCM A;  1JF2 A;  3TDI A;  4WQ3 A;  3SIB A;  3D76 A;  2XPO A;  3VS3 A;  3B87 A;  3TKZ A;  4EIH A;  3CWG A;  4BTF A;  2CIA A;  3OV1 A;  2OTG B;  1IH0 A;  2YU7 A;  1CLL A;  1O4R A;  1EJ3 A;  3IMD A;  1MHO A;  1OOF A;  2ZRT A;  1PVB A;  2JT0 A;  2KBI A;  5DKQ A;  4Q04 A;  3LK1 A;  4NWF A;  4USL A;  2F2P A;  1IKU A;  1MXL C;  5CSI A;  3SJE A;  1YX7 A;  1DMO A;  4PE7 A;  2CS0 A;  1BT6 A;  3R72 A;  1RQQ C;  4JEG A;  4LUD A;  3VS6 A;  1F2F A;  1DF0 A;  4P4D A;  1SCV A;  2RGI A;  1M27 A;  3I5I B;  2DX0 A;  1K93 D;  4JYW A;  2H46 E;  1SHA A;  3VRN A;  1TUZ A;  2MC1 A;  5I8N A;  1IJR A;  2NLN A;  4DCK A;  3IQQ A;  4MRY A;  3S0A A;  1O4K A;  1TCO B;  4E93 A;  2K61 A;  2BAP A;  4L9M A;  3BOW A;  3FS7 A;  1C3Z A;  4M2Q A;  2EU0 A;  3SS5 A;  1AK8 A;  3VS1 A;  2MQI A;  5AER A;  4GWF A;  1Z4H A;  2JPO A;  1B4C A;  1UWO A;  1CSZ A;  1YVL A;  1LVC D;  3ZWH A;  1PSB A;  1FHS A;  1W9Z A;  1H9O A;  1Y1A A;  2PMY A;  3EVU A;  5BO4 A;  3UF4 A;  4QJ4 B;  1SR6 C;  4ZCV A;  2PNA A;  2JXC A;  4YBH B;  1XFZ O;  2MLF C;  3JTD C;  1RFJ A;  3S8O A;  1D4W A;  1KQM B;  1B1G A;  1MWN A;  5BY0 A;  4OC1 A;  1SCM B;  3S9K A;  3R1P A;  3BI1 A;  3LYV A;  4MCS A;  5DKN A;  2QAC A;  2HCK A;  2KYF A;  5CSJ A;  1O4P A;  1B8C A;  2QEV A;  3PN7 B;  3HX4 A;  2XEI A;  1O4C A;  3FE6 A;  1WRK A;  2O60 A;  1KK8 B;  2LLS A;  4JQ0 D;  2GE9 A;  2ECD A;  2CCM A;  1Y6W A;  1NCX A;  3S9M A;  1DVI A;  4C0J A;  1DJI A;  1SMG A;  4OKH A;  5DC0 B;  2PYQ A;  1UHI A;  1Z2C B;  2BNX A;  1AYB A;  1O4I A;  3C7I A;  1UHH A;  3BUN B;  1G33 A;  2EO3 A;  2FCI A;  4MCR A;  1I3Z A;  2OS8 C;  2L0P A;  2K79 B;  4XYN A;  1KSM A;  4PE4 A;  1A09 A;  2YGU A;  4NGN A;  2KNE A;  2BL0 C;  2SAS A;  3LLE A;  2LCP A;  3N84 A;  4L1B B;  5KAZ A;  4PE1 A;  1QG1 E;  1ZOT B;  4FBN A;  5I2O A;  2FCE A;  2LRA A;  1JU5 A;  1TN4 A;  1R1S A;  2LNX A;  4U17 A;  3PAT A;  4PHN A;  2JBJ A;  1J7O A;  1DGV A;  4INX A;  1O49 A;  2MAZ A;  2B4J C;  1A1B A;  1QX5 B;  4ICB A;  3N8M A;  3TUY B;  2MRD A;  4NDB A;  1B8L A;  2JZI A;  1SL9 A;  2Q4U A;  3CZT X;  2M7L A;  2LE9 B;  1A75 A;  5D0J A;  3SJF A;  5IBM A;  1JBA A;  1BKL A;  4K2R A;  1N65 A;  1LIN A;  2XP1 A;  2GGZ A;  1M39 A;  1EG3 A;  4MBE A;  4OHH A;  2FJY A;  1JWD A;  5IBS A;  3BFB A;  3DF0 B;  3GXW A;  2B1U A;  3PJI A;  4FTG A;  4N1G A;  4MEW A;  2LQN A;  5CSF A;  2F33 A;  2K8M B;  1MF8 B;  1BKM A;  1BFJ A;  3TS5 C;  1EG4 A;  1OZO A;  3BFA A;  3B7A A;  4NGP A;  2QEH A;  1PVA A;  3GOF A;  1N2D A;  4XZ1 A;  1H8B A;  3PS5 A;  3BJH A;  3DVM A;  3CXL A;  2EGD A;  2KHN A;  5GJI A;  2PNB A;  1F4Q A;  3KEV A;  1DJZ A;  2XEJ A;  2HQ8 A;  2H2K A;  2EL8 A;  1F1W A;  3IN8 A;  1NCZ A;  1PIC A;  1AYC A;  2XPN A;  4GGF A;  2K60 A;  3ZNI A;  2MA2 A;  1FI6 A;  1SL7 A;  5TNC A;  3NGV A;  3BUO B;  1IS0 A;  1YR5 A;  2ETZ A;  3BHX A;  3D7D A;  1BOC A;  5I2Q A;  1OO3 A;  4INW A;  2JPT A;  2KQY A;  2XPL A;  3CS1 A;  5HLV A;  3BYA A;  3CYZ A;  3OHM B;  2K0J A;  5ELY A;  5AFP A;  3NSI A;  2FO0 A;  3F9K C;  1JYU A;  1O42 A;  2K2A A;  3JVT B;  1O41 A;  1O4H A;  4NGS A;  4PT1 A;  3HPG G;  1YTZ C;  1L2O C;  1A1C A;  2NCP A;  2VIF A;  3FF3 A;  1KCY A;  2HMH A;  1CMF A;  2HET A;  2E6W A;  3BXK A;  1LUK A;  4K44 A;  4YGC B;  2RSY A;  2F2O A;  1X02 A;  3AAJ A;  1WDC C;  3I5F C;  2EKX A;  3FEE A;  2BCA A;  1KFU S;  1AHR A;  2F3Y A;  5AAN A;  4P5O E;  2KGR A;  2HDV A;  1C7V A;  1SKT A;  3M7F A;  3RLZ A;  3L4L A;  3MXY A;  4LUE A;  4NDC A;  2L2C A;  1G83 A;  1DC1 A;  2PTK A;  3S9L A;  2ZRS A;  2EC6 B;  1OW4 A;  2Y3A B;  2CNP A;  4BY4 A;  1SKJ A;  1VRK A;  1O48 A;  3TL0 A;  3I5G C;  1HQV A;  1BJF A;  1XVJ A;  1JYQ A;  5EEQ A;  1QIV A;  5BPJ A;  3Q8I A;  1ALV A;  1TNP A;  1K9A A;  1J1D A;  1CM1 A;  3GK2 A;  2NXQ A;  3E3R A;  2HUW A;  3UNW A;  1F70 A;  4OHI A;  1FU6 A;  4TNC A;  2ZN8 A;  3UYO A;  2LNW A;  1FBZ A;  5FI2 A;  1B8R A;  1AOT F;  2IUI A;  2KSP A;  1D1Z A;  1S6J A;  3WHU B;  2BKI B;  1CWD L;  1M63 B;  4OC2 A;  3DY9 A;  1CB1 A;  1CDM A;  3CBL A;  1OMV A;  1WRZ A;  3FED A;  2H61 A;  3IQO A;  1KSW A;  3I5H C;  1LXF C;  1SYM A;  2OPO A;  1V1G A;  1XFR A;  2LV7 A;  2M7N A;  3SG6 A;  3MXC A;  1S26 D;  2YSX A;  1DE4 C;  3AKB A;  2WCB A;  1S6C A;  3B6X A;  1ZUZ A;  1A1E A;  3D7F A;  1OOJ A;  4ORA B;  1REC A;  1O4E A;  4P45 A;  4F5B A;  4OR9 B;  3DF0 A;  1CDL A;  2MLE C;  3IMJ A;  3S0B A;  3D73 A;  3HPH E;  4HRE E;  2LLT A;  1KC2 A;  1RWY A;  2K7A B;  1JWO A;  1A75 B;  2AMI A;  4N5X A;  1TUJ A;  2WCH A;  2KPH A;  3D78 A;  2Y1M A;  2WCM A;  1LCK A;  4XJK B;  4IJ7 A;  1KK7 Y;  2F8P A;  5DF6 A;  1JFK A;  1O4J A;  1Y1X A;  3VS2 A;  1HCS B;  4P9Z A;  2DLY A;  1Z8L A;  1NWD A;  1LA0 A;  3D77 A;  4JZ0 A;  3SS4 A;  1XK4 C;  5DKR A;  1Q80 A;  4K11 A;  1NUB A;  3IVT A;  2OOT A;  1AJ4 A;  1BG1 A;  4F59 A;  4AQJ A;  5DC4 A;  2L50 A;  2DVJ A;  1XO5 A;  2LC5 A;  2KGY A;  1A2X A;  4YGA A;  3OP0 A;  1NX0 A;  1ZFS A;  3HHM B;  3IWW A;  1FBV A;  1OO4 A;  2LLU A;  3PJP A;  1BMB A;  2G9B A;  1KFU L;  1SY9 A;  1TNX A;  4P4J A;  2PVW A;  2CI8 A;  2LUX A;  4AQI A;  1NX1 A;  2L51 A;  3K1E A;  1DEK A;  4TZI A;  5D69 A;  3CZ1 A;  3BKB A;  2C6G A;  1NCY A;  4F0Z B;  4M2O A;  4GL9 E;  2L5X B;  1OPK A;  1OOG A;  3FWC A;  1X27 A;  3D0Y B;  2PQL A;  5F6T A;  2H5K A;  3FEC A;  3CR4 X;  3CDN A;  2JC2 A;  1SL8 A;  5HKY A;  1RJA A;  1FI5 A;  5J3X A;  4X3R A;  1W7J B;  2B3O A;  2A4J A;  4PHJ A;  3K2T A;  1C7W A;  4OC4 A;  1DT7 B;  4DGP A;  3D75 A;  5D3O A;  1QVI Y;  1YRT B;  1BLQ A;  1IQ5 A;  1LA3 A;  3N7Y A;  1R2U A;  3DVJ A;  1AOU F;  4NDD A;  2WC6 A;  1PUL A;  2SRC A;  4U8D A;  2WC8 A;  1MW4 A;  1NP8 A;  1XYD A;  1K2H A;  2QDI A;  3VRP A;  2CIJ A;  1QAS A;  5ER4 X;  2KI4 B;  1K9U A;  4MSP A;  1DGU A;  4MZK A;  1A1A A;  1IRJ A;  1LCJ A;  2ERB A;  1XFX O;  3WNX B;  4QJ5 B;  3KPX A;  3NSO A;  5EHP A;  3SJS A;  2ZN9 A;  1SRA A;  1QX2 A;  2PVV A;  1JUO A;  3NSK A;  3SG5 A;  2Y5I A;  1CFF A;  3DYE A;  1IJ6 A;  1D1O A;  3CZ0 A;  2CR4 A;  1F8H A;  1W7I B;  3PM2 A;  2SHP A;  1QIW A;  1A4P A;  3A4U B;  3DZT A;  3CR5 X;  1KWO C;  2LQW A;  5KTY A;  2KGB C;  2K2F A;  2L5Y A;  3S0F A;  1BM2 A;  2LP2 A;  1CDP A;  1CTR A;  2C9W A;  1OMR A;  1KSO A;  2MBX A;  2BEC A;  3LCP C;  4BPW B;  1NYA A;  1LUI A;  3CZ2 A;  4P4F A;  2MJW B;  1M31 A;  4HRH A;  3VRY A;  1QV0 A;  2CT9 A;  3SS3 A;  1FF1 A;  1JC2 A;  1QS7 A;  1QLK A;  1S5G Y;  2AAO A;  1P13 A;  4YGE B;  3EAC A;  2WCJ A;  1UUS A;  2COL B;  3LL8 B;  2ABL A;  1D4T A;  5HL1 A;  3PSJ A;  5FI6 A;  1OSA A;  1O4G A;  4JGH A;  1KA6 A;  2ZNE A;  4XJK A;  1J7P A;  2JXL A;  2LHI A;  1FPW A;  1Y57 A;  2KFF A;  2EYY A;  4OHE A;  5FYX A;  4OVN F;  2BE4 A;  5F13 A;  2C0I A;  1NX2 A;  2Y4Q A;  3BXM A;  2EHB A;  3U88 C;  2HDX A;  2JU0 A;  1BHH B;  1S3P A;  5AEQ A;  2LMT A;  4F5A A;  5F09 A;  2DCR A;  2G2B A;  5DC9 A;  3PFV A;  3S9N A;  3KHE A;  2WND A;  4OC0 A;  5D7F A;  1V1F A;  1SSE B;  2C0O A;  1WRL A;  4GBA A;  3DVE A;  2M97 A;  1CFD A;  5PAL A;  4BPU B;  3QME A;  1M45 A;  1O47 A;  2JYQ A;  2NCO A;  4DS7 A;  1B9A A;  1B7T Y;  2JNX A;  1SR6 B;  5IBW A;  3JTD B;  1IQ3 A;  1BU3 A;  1QJT A;  3EKH A;  1QTX A;  2JQ6 A;  4QSY A;  1OPL A;  1H4B A;  4IL1 A;  1TOP A;  1QWV A;  1Y0V H;  4NWG A;  4OME A;  3S8N A;  3OX5 A;  1A03 A;  1DQE A;  3MSE B;  1O4D A;  3EK7 A;  1KFX S;  1X6C A;  3PLF B;  1IJ5 A;  3D0Y A;  1A08 A;  1R1P A;  1MXE A;  5I6V A;  1XFU O;  2TN4 A;  4F7F A;  3R1O A;  4PHK A;  4JKT A;  3B86 A;  1O4Q A;  2LM5 A;  3DXL A;  4K45 A;  2AUC A;  3AAK A;  1GRI A;  1YVH A;  4PAL A;  3EK4 A;  2LP3 A;  3QWX X;  3K2M A;  5EG3 B;  1E8A A;  3S0E A;  2OS8 B;  2OTG C;  2P70 A;  4HSZ A;  4C0K A;  3O8Z A;  1UHN A;  4GPL B;  2LCT A;  2BL0 B;  5KU1 A;  2C0T A;  3KF9 A;  5GJH A;  1JFJ A;  1FU5 A;  2I94 A;  2AUG A;  3VS4 A;  2KK6 A;  2GTE A;  1WQU A;  3T04 A;  2NZ0 A;  1JF0 A;  2P6B B;  4ETO A;  2HPS A;  3FE9 A;  1S1E A;  2O5G A;  1AVS A;  3UO9 A;  3BUX B;  1O4O A;  2BCX A;  3VRQ A;  3I5I C;  4OC3 A;  2WCL A;  1PAL A;  1PRW A;  3VS5 A;  1QLS A;  5EEL A;  1TIZ A;  2I18 A;  2QMS A;  1AJ5 A;  2LVV A;  3VRR A;  3PQZ A;  2V53 A;  3BI0 A;  2BE6 A;  1TZE E;  1AP4 A;  1SPR A;  4GGF C;  1IG5 A;  1F55 A;  4OV2 A;  3TZ1 A;  2IUH A;  1FW4 A;  1G4Y R;  5B8I B;  3NHT A;  2L3T A;  1TCF A;  3GQI B;  1DJH A;  3D7G A;  2KQ6 A;  4HRG A;  2LMU A;  4CID A;  3ICB A;  3OB2 B;  3GXX A;  1M61 A;  4CFQ A;  2VKZ G;  3KO0 A;  3EG5 B;  5JOL A;  2M8U A;  2C6P A;  2UV8 G;  3DVK A;  3S0D A;  3FWB A;  2KFG A;  1SBJ A;  2RMX A;  1KK7 Z;  1KQM C;  4NGM A;  2DOQ A;  1SCM C;  4NGT A;  1MUX A;  2MK2 A;  2WOR A;  3TS5 B;  3R1V A;  3PSK A;  1Z9E A;  1CM4 A;  1ZAC A;  2BBU A;  2I2R E;  3PN7 C;  1ORG A;  2WC5 A;  1KK8 C;  1MIL A;  3PT1 A;  2LNK A;  4KYN A;  3QWY A;  3NHN A;  1GGW A;  2OQ1 A;  4OZD A;  1CFC A;  1CNP A;  4A4B A;  3SG7 A;  1TRF A;  3NFQ A;  5HYD A;  3NXA A;  2EO6 A;  2KYC A;  3OB1 B;  3PSR A;  4GFT A;  1BLK A;  3OGN A;  2IUG A;  2EYZ A;  2L98 A;  1AB2 A;  4NGR A;  3D7H A;  1EL4 A;  1YRU B;  1BHH A;  1KFX L;  5I94 A;  2BCB A;  3MAZ A;  1QXP A;  3PM8 A;  1J1E A;  2R2I A;  1GM0 A;  4WRI A;  4MN0 A;  3SJX A;  3VRO A;  1K95 A;  1DEL A;  4CLN A;  3S0G A;  1AYD A;  2L6K A;  2LHL A;  1QAT A;  1OOH A;  2JNF A;  3WXA A;  2CTN A;  5G08 A;  3DD4 A;  1L2O B;  2BKH B;  4NGQ A;  3TUY C;  1QVI Z;  3H4S E;  4H1O A;  2ZKM X;  1KA7 A;  2WCF A;  2OR4 A;  2H61 C;  2K7C A;  1KQV A;  2CBL A;  2FOT A;  1LKK A;  1A07 A;  1WDC B;  3O4X A;  1U5I B;  3I5F B;  2SCP A;  4P9V A;  2M0R A;  1OE9 B; 
#chains in the Genus database with same CATH homology
 1YR5 A;  2JT8 A;  2KAY A;  2ETZ A;  1HT9 A;  4U1P A;  1XK4 A;  1OMR A;  1KSO A;  4N1F A;  2MBX A;  1BOC A;  2WOS A;  1DJW A;  4WWQ A;  2BEC A;  3F45 A;  3LCP C;  1NYA A;  2VRG A;  5I2Q A;  1LUI A;  4ORB B;  3GK1 A;  3BUM B;  1SPY A;  2BBM A;  1OO3 A;  4D8K A;  4M2P A;  2LMV A;  4I5J A;  1Z3K A;  2MJW B;  2JPT A;  1M31 A;  4HRH A;  1S36 A;  1XA5 A;  2KQY A;  3EVV A;  4AOM A;  3CS1 A;  2FCD A;  5HLV A;  3TDZ A;  5EHR A;  5CDW A;  3VRY A;  1QV0 A;  1YUR A;  1BFI A;  2KI4 C;  2CT9 A;  3BYA A;  2M49 B;  3M0W A;  2LAN A;  3OHM B;  4PHM A;  2K0J A;  2AOA A;  1EXR A;  1UP5 A;  1FF1 A;  1JC2 A;  3I5G B;  4UPG A;  4YI9 A;  5AFP A;  5HLO A;  2D8N A;  1QS7 A;  1QLK A;  3NSI A;  1LUM A;  3HCK A;  3FIA A;  2FO0 A;  1ALW A;  1S5G Y;  2AAO A;  1JYU A;  4YGE B;  1O42 A;  1K8U A;  1P13 A;  3EAC A;  3BQ3 A;  1UUS A;  2COL B;  1O4B A;  2AOB A;  3WA4 A;  3LL8 B;  2E30 A;  1QX7 A;  2K2A A;  2ABL A;  1D4T A;  3JVT B;  1O41 A;  1XFW O;  1O4H A;  1QAD A;  2KDH A;  4CFR A;  4GUK A;  3PSJ A;  1YTZ C;  1L2O C;  3CTN A;  3VGO A;  1QCF A;  1A1C A;  2DLZ A;  1OSA A;  1O4G A;  2NCP A;  4JGH A;  5HKZ A;  2VIF A;  4I5L B;  1A81 A;  2KI6 C;  2GGM A;  1KCY A;  4P2Y B;  4BY5 A;  2HMH A;  4H34 A;  1KA6 A;  4MZJ A;  1CMF A;  1SHD A;  3GK4 X;  2HET A;  2E6W A;  2ZNE A;  3BXK A;  4XJK A;  1K9P A;  3NSL A;  1J7P A;  1LUK A;  2IUI A;  4K44 A;  4YGC B;  4ZCU A;  2M29 A;  2RSY A;  3IN7 A;  2CXJ A;  1XA6 A;  4I5K A;  2RVF A;  5AXI A;  4YGB B;  2F2O A;  2JXL A;  4D1E A;  1X0N A;  2L2E A;  1AUI B;  2LHI A;  2ZFD A;  1X02 A;  3AAJ A;  1WDC C;  4CPV A;  1FPW A;  2H8H A;  1Y57 A;  2KFF A;  2EYY A;  3TDU A;  1O4N A;  4OHE A;  5FYX A;  4OVN F;  3SIA A;  3I5F C;  4GAO A;  5GQQ C;  1Y1U A;  2BE4 A;  2EKX A;  1O4F A;  2BCA A;  1O4A A;  1KFU S;  1AHR A;  1GHU A;  2PVB A;  4MLW A;  2C0I A;  2F3Y A;  5AAN A;  1TCE A;  4P5O E;  2KGR A;  3OVE A;  2KAX A;  3US4 A;  2Q91 A;  2HDV A;  3I5H B;  1C7V A;  3C1V A;  1NX2 A;  1SKT A;  2Y4Q A;  3M7F A;  3RLZ A;  1WLZ A;  3MXY A;  3HCM A;  1JF2 A;  1NRV A;  3TDI A;  4LUE A;  4WQ3 A;  4NDC A;  1CDN A;  3SIB A;  1G83 A;  2EHB A;  1O45 A;  2HDX A;  2PTK A;  3RM1 A;  2JU0 A;  2Y1N A;  3VS3 A;  1S5G Z;  4NQG A;  1BHH B;  1BMO A;  1J55 A;  3TKZ A;  1S3P A;  5AEQ A;  2LMT A;  4EIH A;  4F5A A;  1XFY O;  1CFP A;  3CD3 A;  3CWG A;  2ZRS A;  3OX6 A;  2EC6 B;  4BTF A;  2DCR A;  2G2B A;  2Y3A B;  2CIA A;  4ROJ A;  1QV1 A;  2CNP A;  3PFV A;  3OV1 A;  3KHE A;  2WND A;  2OTG B;  3SG4 A;  4BY4 A;  1SKJ A;  1VRK A;  1V1F A;  4ORC B;  5D7F A;  1IH0 A;  2C0O A;  1IWQ A;  2YU7 A;  1O48 A;  1CLL A;  1WRL A;  3TL0 A;  4GBA A;  1O4R A;  3DVE A;  3I5G C;  1EJ3 A;  2M97 A;  1HQV A;  1MHO A;  1CFD A;  2ZRT A;  5PAL A;  1PVB A;  1BJF A;  3IMD A;  2JT0 A;  2KBI A;  1L7Z A;  1XVJ A;  4Q04 A;  5DKQ A;  1M45 A;  1O47 A;  1JYQ A;  1BOD A;  2JYQ A;  3LK1 A;  2NCO A;  2ISD A;  4DS7 A;  5EEQ A;  1QIV A;  4NWF A;  2EYV A;  5BPJ A;  4USL A;  1B9A A;  1B7T Y;  1CJ1 A;  4I5N B;  2F2P A;  2JOJ A;  2JNX A;  1SR6 B;  1IKU A;  1O43 A;  2JWW A;  3JVT C;  1O4L A;  1MXL C;  1ALV A;  1TNP A;  1YX7 A;  4OCI A;  5CSI A;  5IBW A;  1DMO A;  1OZS A;  3JTD B;  4PE7 A;  1IQ3 A;  1K9A A;  1BU3 A;  1QJT A;  1ZFP E;  1J1D A;  1CM1 A;  3EKH A;  3GK2 A;  2NXQ A;  2CS0 A;  1BT6 A;  1RQQ C;  1QTX A;  4JEG A;  4LUD A;  2JQ6 A;  3E3R A;  2HUW A;  3VS6 A;  3D10 A;  1F70 A;  4FL3 A;  4C0L A;  4OHI A;  1NZV A;  4QSY A;  1FU6 A;  1OPL A;  1H4B A;  1F2F A;  1DF0 A;  4TNC A;  2ZN8 A;  4E68 A;  3QRX A;  3UYO A;  4IL1 A;  1TOP A;  1O44 A;  1C07 A;  2LNW A;  1TNQ A;  1SCV A;  2RGI A;  1FBZ A;  2JRF A;  3I5I B;  1M27 A;  1Y0V H;  4NWG A;  3S8N A;  1B8R A;  2M3W A;  3OX5 A;  1A03 A;  3MSE B;  1AOT F;  2DX0 A;  1K93 D;  2KSP A;  1D1Z A;  1O4D A;  1GQM A;  1S6J A;  3EK7 A;  2H46 E;  5CPV A;  1KFX S;  1X6C A;  4JPZ B;  3WHU B;  2BKI B;  3PLF B;  1SHA A;  2WCE A;  3VRN A;  2MC1 A;  3EK8 A;  1CWD L;  1M63 B;  5I8N A;  1IJ5 A;  2M9G A;  3D0Y A;  4YGD B;  1A08 A;  2NLN A;  1BR4 B;  1IJR A;  4DCK A;  3IQQ A;  1MXE A;  1CB1 A;  1R1P A;  4MRY A;  2L4K A;  1CDM A;  1O4K A;  2CI9 A;  3CBL A;  1OMV A;  1WRZ A;  1YX8 A;  5I6V A;  1TCO B;  1XFU O;  2TN4 A;  1NPQ A;  2LVI A;  2H61 A;  1SW8 A;  3IQO A;  1KSW A;  2K61 A;  4E93 A;  3I5H C;  1LXF C;  3WHT B;  1OQP A;  1SYM A;  2OPO A;  1UUR A;  1V1G A;  2LV7 A;  4L9M A;  4MZL A;  3BOW A;  3FS7 A;  4PHK A;  2M7N A;  3SG6 A;  3MXC A;  4M2Q A;  1O4Q A;  2LM5 A;  4JE4 A;  1S26 D;  1SPS A;  4K45 A;  2AUC A;  1DJG A;  2EU0 A;  2YSX A;  5JJG A;  3AAK A;  1AK8 A;  1JSA A;  2MQI A;  3VS1 A;  1GRI A;  1CKK A;  1YVH A;  3AKB A;  4PAL A;  5AER A;  1K9K A;  4GWF A;  1PK0 D;  3EK4 A;  2WCB A;  4YI8 A;  1S6C A;  2LP3 A;  1TNW A;  3QWX X;  1ZUZ A;  1B7T Z;  3IF7 A;  3K2M A;  2EC6 C;  5EG3 B;  1A1E A;  1B4C A;  1UWO A;  1E8A A;  5DC9 A;  2OS8 B;  2OTG C;  1CSZ A;  1OOJ A;  1YVL A;  2ROR A;  4ORA B;  1REC A;  1J7R A;  1O4E A;  4HSZ A;  1LVC D;  4F5B A;  4C0K A;  3ZWH A;  2MRJ A;  1PSB A;  1FHS A;  4M4Z A;  1UHN A;  4GPL B;  4OR9 B;  1FMK A;  2LCT A;  3DF0 A;  1H9O A;  2BL0 B;  5K89 A;  1Y1A A;  3EVR A;  5KU1 A;  2C0T A;  2PMY A;  3EVU A;  3KF9 A;  1CDL A;  2PRU A;  5BO4 A;  5GJH A;  2MLE C;  2JUL A;  3UF4 A;  3IMJ A;  2K7O A;  4QJ4 B;  1SR6 C;  1DTL A;  4ZCV A;  2PNA A;  5AUL A;  2JXC A;  4YBH B;  1JFJ A;  1XFZ O;  2MLF C;  1FU5 A;  4HRE E;  3JTD C;  1RFJ A;  2I94 A;  1SHB A;  2AUG A;  3VS4 A;  3S8O A;  2KK6 A;  1D4W A;  1KQM B;  2KOT A;  2LLT A;  1WQU A;  1KC2 A;  3T04 A;  1RWY A;  2K7A B;  3KFJ A;  1JWO A;  2NZ0 A;  1JF0 A;  1A75 B;  1F4O A;  2AMI A;  2HPS A;  2P6B B;  4N5X A;  4ETO A;  1B1G A;  4XZ0 A;  1MWN A;  1S1E A;  2O5G A;  1AVS A;  3BUX B;  1SCM B;  1O4O A;  3S9K A;  2Y1M A;  2BCX A;  4MRX A;  1SNL A;  2HF5 A;  3VRQ A;  5DKN A;  2M1U A;  3I5I C;  1LCK A;  1PAL A;  1PRW A;  2QAC A;  1QLS A;  2HCK A;  4OHL A;  5EEL A;  1RRO A;  2DM0 A;  3VS5 A;  1TIZ A;  2I18 A;  4XJK B;  2QMS A;  1LKJ A;  1KK7 Y;  2KYF A;  2JTT A;  2F8P A;  4PDZ A;  5CSJ A;  1AJ5 A;  4EY0 A;  2LVV A;  5DF6 A;  3VRR A;  2KI6 D;  4PCW A;  1JFK A;  1O4P A;  2V53 A;  3O2P A;  3PQZ A;  1DJX A;  1WLM A;  1O4J A;  2BE6 A;  1TZE E;  1B8C A;  1Y1X A;  1AP4 A;  2L4H A;  3PN7 B;  3VS2 A;  3HX4 A;  1O4C A;  1HCS B;  3HIZ B;  1K90 D;  1WRK A;  2O60 A;  1SPR A;  2DLY A;  1B47 A;  1KK8 B;  2LLS A;  4GGF C;  4P9Z A;  4JQ0 D;  1NWD A;  2GE9 A;  4FQO A;  2ZND A;  1LA0 A;  4PE0 A;  2ECD A;  1RTP 1;  2CCM A;  1Y6W A;  1NCX A;  2FJU B;  1DVI A;  1IG5 A;  2KBM A;  1F55 A;  4C0J A;  1DJI A;  1SMG A;  3A8R A;  4OV2 A;  4OKH A;  1U5I A;  2BBN A;  2KFH A;  5DC0 B;  1R1Q A;  2MRK A;  1UHI A;  1XK4 C;  1NSH A;  1WY9 A;  3TZ1 A;  2IUH A;  4X6S A;  5DKR A;  1Q80 A;  1RK9 A;  2KAV A;  1FW4 A;  1G4Y R;  4K11 A;  5B8I B;  1NUB A;  2IS9 A;  3EKJ A;  3SG2 A;  4DUQ A;  1AYB A;  1TCF A;  1O4I A;  2L3T A;  3C7I A;  1UHH A;  1AJ4 A;  2GSB A;  1BG1 A;  4F59 A;  3BUN B;  4AQJ A;  3GQI B;  5DC4 A;  2L50 A;  1G33 A;  2EO3 A;  2FCI A;  1I3Z A;  2DVJ A;  2OS8 C;  2L0P A;  2K79 B;  1DJH A;  1XO5 A;  2LC5 A;  4XYN A;  1A2X A;  2KQ6 A;  2PLD A;  1KSM A;  4PE4 A;  4YGA A;  2PLE A;  4HRG A;  2LMU A;  4CID A;  3OP0 A;  1A09 A;  3ICB A;  1NX0 A;  1SK6 D;  3OB2 B;  3GXX A;  1ZFS A;  2KNE A;  1M61 A;  2BL0 C;  2SAS A;  3LLE A;  2LCP A;  4CFQ A;  3HHM B;  3N84 A;  3K21 A;  3KO0 A;  4L1B B;  2JT3 A;  4PE1 A;  1QG1 E;  2QPT A;  5KAZ A;  5JOL A;  1O4M A;  1ZOT B;  2M8U A;  3CGA A;  3CLN A;  1RPY A;  4JWQ A;  4FBN A;  1FBV A;  2PSR A;  5I2O A;  2L4I A;  1OO4 A;  3DVK A;  4OHD A;  3FWB A;  2FCE A;  2KFG A;  1SBJ A;  4DIR A;  2RMX A;  1KK7 Z;  2LLU A;  1JU5 A;  3PJP A;  1BMB A;  1KQM C;  1TN4 A;  2G9B A;  1KFU L;  2LAP A;  1SY9 A;  3VS7 A;  1TNX A;  1R1S A;  2CI8 A;  2LNX A;  1NIW A;  1G8I A;  4U17 A;  3PAT A;  2DOQ A;  1IGV A;  2LUX A;  5CSN A;  1SCM C;  4AQI A;  4PHN A;  1NX1 A;  2L51 A;  1MUX A;  2MK2 A;  2WOR A;  4TZI A;  2PAS A;  2MHH A;  5D69 A;  2M1K B;  1J7O A;  1DGV A;  3TS5 B;  1O46 A;  3BKB A;  3VRZ A;  1NCY A;  3BUW B;  4F0Z B;  4DGX A;  1O49 A;  1DF0 B;  4M2O A;  2EOB A;  4GL9 E;  1BR1 B;  2L5X B;  1ODB A;  5ER5 A;  1OPK A;  2MAZ A;  3PSK A;  1EH2 A;  1A1B A;  1CM4 A;  1ZAC A;  3FWC A;  3PAL A;  2I2R E;  2BBU A;  3PN7 C;  2GV5 A;  1QX5 B;  1X27 A;  4FL2 A;  1ZMZ A;  1KK8 C;  3D0Y B;  4ICB A;  5F6T A;  2H5K A;  1FYR A;  3N8M A;  3TUY B;  1MIL A;  1LKL A;  3S8L A;  4GGN A;  1DJY A;  3CR4 X;  3VS0 A;  2MRD A;  4NDB A;  1B8L A;  2JC2 A;  2LNK A;  5HKW A;  2JZI A;  1PSR A;  1SL8 A;  3O78 A;  1LUN A;  1SL9 A;  2Q4U A;  3AKA A;  3NHN A;  3CZT X;  5HKY A;  1RJA A;  3O6B A;  1FI5 A;  3QWY A;  1GGW A;  1R6P A;  3SG3 A;  2M7L A;  2LE9 B;  5J3X A;  2OQ1 A;  3BOW B;  1MR8 A;  1CFC A;  4A4B A;  1CNP A;  1W7J B;  1KWO B;  3SG7 A;  2B3O A;  1A75 A;  1TRF A;  4A4C A;  1TTX A;  2A4J A;  4PHJ A;  1C7W A;  1HCT B;  3EAZ A;  1DT7 B;  5D0J A;  4DGP A;  2JTZ A;  3LK0 A;  1QVI Y;  1JBA A;  5HYD A;  1BHF A;  1YRT B;  1BKL A;  3NXA A;  5IBM A;  2EO6 A;  2KYC A;  4K2R A;  3OB1 B;  3PSR A;  4GFT A;  1F54 A;  1BLK A;  1BLQ A;  1IQ5 A;  1BLJ A;  1N65 A;  1LA3 A;  2K7D A;  1LIN A;  2IUG A;  3N7Y A;  1R2U A;  2EYZ A;  1S6I A;  2GGZ A;  2L98 A;  4MVF A;  3DVJ A;  2XP1 A;  1AB2 A;  1M39 A;  1YUS A;  1AOU F;  1EG3 A;  4NDD A;  1UHJ A;  4MBE A;  1EL4 A;  1YRU B;  2LVJ A;  1PUL A;  1KFX L;  1BHH A;  2IZV A;  2KNO A;  4U8D A;  1JWD A;  2SRC A;  4OHH A;  5IBS A;  2BCB A;  3DF0 B;  3MAZ A;  1AYA A;  2WC8 A;  1MW4 A;  1QXP A;  1NP8 A;  2F3Z A;  3GXW A;  1XYD A;  3PM8 A;  1J1E A;  2R2I A;  2B1U A;  1K2H A;  2CRH A;  1K94 A;  3VRP A;  4WRI A;  1QAS A;  4MN0 A;  2K7B A;  3VRO A;  2OZO A;  1K95 A;  1XFV O;  2KI4 B;  4FTG A;  4MEW A;  4N1G A;  1OMD A;  5ER4 X;  2LQN A;  1K9U A;  1AD5 A;  4MSP A;  5CSF A;  1DGU A;  1N0Y A;  1YUT A;  2F33 A;  5I2L A;  2K8M B;  1MF8 B;  2LUC A;  4MZK A;  1BKM A;  4CLN A;  1IRJ A;  1A1A A;  1BFJ A;  3TS5 C;  1EG4 A;  1LCJ A;  1AYD A;  1XFX O;  1OZO A;  3WNX B;  2L6K A;  4QJ5 B;  3KPX A;  2LHL A;  3NSO A;  4GNK B;  5EHP A;  3SJS A;  1QAT A;  2ZN9 A;  1SRA A;  1PVA A;  3GOF A;  5KSZ A;  1QX2 A;  1N2D A;  1JUO A;  3NSK A;  3SG5 A;  1BF5 A;  1YUU A;  2JNF A;  3WXA A;  2Y5I A;  1CFF A;  4XZ1 A;  2CTN A;  5G08 A;  3DD4 A;  1F71 A;  1H8B A;  1IJ6 A;  1NZL A;  3PS5 A;  2BKH B;  1K96 A;  1L2O B;  3DVM A;  1GJY A;  4QJ3 B;  1D1O A;  1J7Q A;  2EGD A;  1CLB A;  2LVK A;  2CR4 A;  3CXL A;  3TUY C;  1QVI Z;  3H4S E;  1F8H A;  2KHN A;  4H1O A;  5GJI A;  1W7I B;  2PNB A;  1GGZ A;  1RJV A;  2ZKM X;  1KA7 A;  1F4Q A;  2WCF A;  3KEV A;  2H61 C;  2K7C A;  1KQV A;  1MQ1 A;  1A29 A;  1DJZ A;  1QIW A;  2CBL A;  2FOT A;  3O4Y A;  2SHP A;  1A4P A;  1UHK A;  3A4U B;  4R1E A;  1LKK A;  1CSY A;  3CR5 X;  1A07 A;  2HQ8 A;  1CLM A;  1CWE A;  1KWO C;  2LQW A;  2I7A A;  1WDC B;  2HQW A;  2H2K A;  2KGB C;  2PAL A;  2K2F A;  4WQ2 A;  5KTY A;  1JYR A;  2EL8 A;  1U5I B;  1F1W A;  3IN8 A;  1M46 A;  3CR2 A;  1BM2 A;  1NCZ A;  1PIC A;  1AYC A;  2LP2 A;  3I5F B;  4GGF A;  1CDP A;  2SCP A;  4P9V A;  2M0R A;  4DRW A;  4YRU A;  3ZNI A;  2MA2 A;  1FI6 A;  1CMG A;  1CTR A;  2C9W A;  1OE9 B;  1SL7 A;  5TNC A;  1NX3 A;  3BUO B;  1IS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...