3VRQA

Crystal structure of the tyrosine kinase binding domain of cbl-c (pl mutant)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
310
structure length
278
Chain Sequence
b'QWEEARALGRAVRMLQRLEEQCPPSLRDLLPRTAQLLREVAHSRPGGPGGSGDFLLIYLANLEAKSRQVAALSRLRRQLAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRLSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal transduction protein CBL-C
molecule tags Protein binding
source organism Homo sapiens
publication title Structural flexibility regulates phosphopeptide-binding activity of the tyrosine kinase binding domain of Cbl-c.
pubmed doi rcsb
total genus 95
structure length 278
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02262 Cbl_N CBL proto-oncogene N-terminal domain 1
A PF02761 Cbl_N2 CBL proto-oncogene N-terminus, EF hand-like domain
A PF02762 Cbl_N3 CBL proto-oncogene N-terminus, SH2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3vrqA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 3vrqA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3vrqA03
2LHIA 1HCSB 1AHRA 1J1EA 2OPOA 4GGFA 3OP0A 1R6PA 2WCFA 3CZTX 4I5LB 1QCFA 1XO5A 3O4YA 2ETZA 1Y6WA 1SPSA 1O4JA 1LCJA 2BCBA 1D4TA 5HKZA 2O5GA 1A1EA 1NCZA 2H2KA 1A4PA 1QTXA 2F33A 1SPYA 2G2BA 1Q80A 1RK9A 3BOWA 2NLNA 1QXPA 1BOCA 4PE4A 2EOBA 1R2UA 3S8NA 1XFZO 2KFGA 1YR5A 3KEVA 2K7AB 4K44A 4ICBA 1SR6B 3PALA 2SCPA 1MUXA 2MK2A 2Q4UA 4JPZB 2ZNDA 1U5IA 3QRXA 1LKJA 1OMVA 3OX5A 2LANA 2O60A 3O2PA 3WHUB 1R1QA 3NSLA 2DLZA 5I6VA 2GV5A 4GUKA 2KSPA 1YTZC 2L98A 2EC6B 2JXCA 4GNKB 5FYXA 4Q04A 1B8LA 2C0OA 3EAZA 1TCFA 2MLEC 1BLQA 1GRIA 2L51A 1CLLA 2AUGA 1B8RA 2AUCA 2DCRA 2CXJA 1F1WA 1IJ6A 2M49B 2LNWA 4DRWA 4MZJA 1CDNA 2BCXA 2RSYA 5EEQA 2K7CA 2KBIA 1TRFA 2AOAA 1X02A 1O4PA 1C7VA 1B7TZ 1SL9A 3WA4A 3M0WA 5DKQA 4PHMA 4QJ5B 3EK7A 5AULA 2M3WA 4N1FA 3CR4X 2C0TA 2OZOA 3LK0A 2FJUB 2FOTA 1XK4A 1LCKA 1V1FA 1UHKA 2EU0A 2KQYA 4H1OA 1IRJA 4MEWA 3TDIA 2MC1A 1DJWA 4U8DA 2CBLA 1O4CA 2SASA 1QATA 1YRUB 1QIVA 1SL8A 1QJTA 3EKJA 1QASA 1DJYA 2F3ZA 1UUSA 3I5GB 5G08A 1A07A 1B9AA 4NQGA 3NSIA 1SHAA 2C0IA 2CI8A 4JGHA 2CT9A 4GAOA 3HX4A 1C07A 1S5GY 2LP2A 2F3YA 1KK7Z 4ETOA 3CBLA 1BG1A 1TNWA 2M0RA 3SG2A 2K2FA 2BBUA 1ZFPE 3PN7C 4FL3A 2LQWA 4F59A 1FF1A 5PALA 1MILA 1SYMA 5D7FA 4K45A 1O43A 2HDVA 3TL0A 2LAPA 2LC5A 1MWNA 1PK0D 3CGAA 3KF9A 1FMKA 3LLEA 3PQZA 1BMOA 2BECA 1OMRA 2R2IA 3EVUA 1CFFA 1RROA 1TN4A 3HCKA 2WORA 2JNXA 1RFJA 1YURA 1QADA 2K7BA 3O78A 3TS5B 3GK1A 1UHHA 5DC9A 2KHNA 1ZMZA 2M8UA 1NX0A 2K7OA 1XVJA 1QV0A 4CLNA 1O4LA 3UF4A 2JWWA 1SK6D 2QPTA 3LL8B 3EKHA 4USLA 1K95A 1O4HA 2BBMA 1TOPA 3D10A 5AERA 4MZLA 4PCWA 3VRYA 1F4QA 1ZFSA 1SW8A 2I94A 4I5JA 4PE0A 1DTLA 3VRRA 2PLDA 1OZOA 1QIWA 1XFYO 1TNQA 4OV2A 1J1DA 1UHIA 2EYZA 3OX6A 1AD5A 1F71A 2JTZA 3OB1B 2AOBA 3DF0A 1N0YA 1D1ZA 3N84A 4H34A 2KK6A 4AQIA 2KI6D 3CXLA 2HETA 4P5OE 1S5GZ 2Q91A 1LVCD 1BR1B 4EIHA 1QLKA 1A29A 1RWYA 1NCXA 1QS7A 2FCDA 4C0LA 1OPLA 2B3OA 2PNAA 1NPQA 2KI6C 1A2XA 3SIAA 1GGWA 5D0JA 5JOLA 4MN0A 3BUOB 1QVIY 1IJ5A 4GGFC 1SMGA 1K94A 1AYDA 4PALA 4NDDA 2KNOA 3I5FC 5AXIA 2LCPA 1I3ZA 1JU5A 2CCMA 1O42A 1QX7A 3NXAA 2P6BB 3GXWA 1UHJA 4XJKA 1ODBA 2LNXA 2L4KA 3SJSA 2IUIA 1K96A 4YGBB 5TNCA 1MW4A 2MHHA 2EYYA 1AVSA 1XFUO 1CM1A 3FIAA 1S6IA 1WLMA 4F5AA 2KYFA 4WQ3A 1A81A 2PLEA 3DVJA 2BE6A 4YGDB 3TZ1A 5JJGA 1O49A 2CI9A 2TN4A 5EHRA 1W7JB 2K0JA 3OB2B 2PASA 3TS5C 1FPWA 2KYCA 2EKXA 3JVTB 4OHLA 4QJ3B 1PSBA 3PLFB 1DGUA 2LMTA 4GGNA 5AEQA 5K89A 1A75A 1KCYA 1FW4A 3EK4A 2L3TA 3TUYC 1SR6C 2KGBC 4IL1A 1SKJA 2SHPA 4NWGA 1G4YR 2BL0C 2RMXA 1IKUA 1HQVA 2K61A 3SG6A 4OHIA 3EK8A 2H8HA 4JWQA 3VRQA 2LLTA 1NP8A 3I5HB 2L50A 3KHEA 1KC2A 4ROJA 1CNPA 2HDXA 1R1PA 1QX2A 1OE9B 1WRLA 1JF2A 3BUNB 1B8CA 5HLVA 1BFJA 3D0YA 3RM1A 1KSMA 1LINA 4MRYA 3S8OA 1YRTB 3MXCA 1BMBA 4JQ0D 4X6SA 2MA2A 1TCEA 3T04A 1LXFC 1V1GA 1EL4A 2L0PA 1B47A 1SNLA 1XYDA 2ZNEA 1JWOA 2OS8B 2JC2A 5AFPA 1LA3A 2OQ1A 2HPSA 3PSRA 4ORAB 2JRFA 4PHJA 1A09A 2LQNA 2MBXA 1AYBA 2KAXA 2Y4QA 2BKHB 4GPLB 1IGVA 5KU1A 3DVKA 1K90D 2MQIA 2OS8C 1LKKA 3VS0A 5DKNA 1UWOA 3SIBA 2LVKA 1DT7B 2NZ0A 1CWEA 4UPGA 2H61A 3F45A 1LUIA 4YBHB 3GXXA 4NDCA 2NCOA 4DS7A 4E93A 1J55A 2LP3A 1JUOA 1O48A 1CDLA 3AAJA 3PSJA 1GQMA 2G9BA 3FWBA 2LV7A 1NZLA 4FTGA 2BE4A 5EG3B 1Y1UA 2F8PA 1AP4A 3VS1A 1AUIB 3AAKA 1WLZA 1BKLA 3VS3A 1O41A 2GGMA 2EGDA 2KNEA 2EL8A 2F2PA 1KQMC 1BHHA 1NYAA 4MLWA 2VIFA 4WWQA 3VS7A 1WY9A 2M97A 1KSOA 1CMFA 2PRUA 1RECA 1EG3A 4QJ4B 2GSBA 5CSNA 1MQ1A 1O4MA 2PTKA 1J7OA 4EY0A 4OVNF 1K93D 2SRCA 1FI6A 2JNFA 1Y1AA 4TNCA 3K21A 4A4CA 4ORCB 2DX0A 1QVIZ 1G8IA 3JVTC 4HSZA 4HRHA 4BTFA 2CR4A 3VRZA 3AKAA 2HQWA 3BYAA 1SPRA 1YUSA 4CFRA 4AOMA 3PN7B 3SG4A 2JYQA 1RQQC 1F8HA 4K11A 2L4HA 1O4BA 1B7TY 1S1EA 4OHHA 1AB2A 2AMIA 2KFFA 1IJRA 2HCKA 1NX1A 3NSKA 4DCKA 3VS6A 1U5IB 3NHNA 1CSYA 3IF7A 2LMUA 1O4FA 3DF0B 1KA7A 2F2OA 2JULA 1RJAA 2OTGB 3M7FA 5DC4A 1CDPA 2EHBA 3PATA 1QV1A 1WDCB 4MSPA 5CSFA 1O4OA 1FU6A 4P9VA 5DC0B 1QLSA 4DGXA 1B4CA 5BO4A 4YRUA 1P13A 1NUBA 1OO4A 2RVFA 4WRIA 4JEGA 1XFXO 2LHLA 1WQUA 2IUGA 1YVHA 3O6BA 2HF5A 4NDBA 5KAZA 1L7ZA 5ER4X 1FHSA 1K8UA 1O4GA 2Y3AB 3CTNA 1PULA 1HCTB 4PHKA 1SCMB 1SY9A 1KSWA 1S6JA 1EH2A 1UHNA 5BPJA 2K7DA 5ER5A 3NSOA 3BUWB 1F2FA 1O4IA 1K9UA 3I5IC 1CFDA 2LNKA 4GFTA 4CFQA 4M2QA 5B8IB 1FYRA 5I8NA 1LKLA 2ZFDA 1CTRA 2A4JA 3HIZB 2JQ6A 1A1BA 2BCAA 1JWDA 2GE9A 3S9KA 1XA5A 3VS2A 1M31A 2CTNA 2JOJA 2NCPA 2WC8A 2Y1NA 1LUKA 2HQ8A 1S3PA 1KFXS 2KDHA 2KI4B 3RLZA 2JXLA 1XFWO 1UURA 2K79B 1GGZA 2KAYA 5EHPA 3FS7A 3C1VA 3N8MA 1BR4B 2WCEA 1DJIA 3WXAA 5IBSA 5HKYA 2CNPA 1L2OB 1N65A 2RGIA 1CDMA 2L4IA 1J7PA 1NX3A 4N5XA 5HLOA 3SG7A 1DJHA 1M61A 5DF6A 1PVAA 1TCOB 3GOFA 1XA6A 1NX2A 2ZN8A 3WNXB 2FO0A 3OV1A 4OR9B 4F5BA 1DF0A 4PDZA 1L2OC 2KBMA 3TUYB 1O4AA 2YU7A 3DD4A 1B1GA 1YX8A 1NIWA 1IWQA 4YGEB 3LK1A 3SG5A 2LVVA 1OMDA 4E68A 4P9ZA 1CSZA 2DOQA 1NRVA 5GQQC 4OHEA 2GGZA 3EVVA 4OCIA 1RPYA 3C7IA 3IN7A 3I5FB 3SG3A 2LM5A 1O45A 2PNBA 1DJGA 1MHOA 1LUNA 2FCIA 1HT9A 1EJ3A 2I7AA 1JYUA 1A75B 1K9KA 3D0YB 4ORBB 3N7YA 3US4A 3S8LA 5D69A 1OOJA 4XZ0A 1AK8A 5GJHA 1Y0VH 4LUEA 1KK8B 2WCBA 2JZIA 3CLNA 3CWGA 3VS4A 1LUMA 2M7LA 2KGRA 2ZN9A 4PE7A 1BM2A 1KA6A 2LCTA 3PJPA 3JTDB 3HCMA 4A4BA 4I5NB 2BKIB 2LMVA 5J3XA 3IQQA 3ZNIA 1IQ5A 1F55A 1BT6A 1FBVA 5CPVA 1QG1E 2MRJA 1SL7A 1ZOTB 4YI9A 3OVEA 4U1PA 4D8KA 1NWDA 4R1EA 1MXEA 1H4BA 1KFUS 1SBJA 1YUTA 2COLB 1NCYA 1PSRA 3KPXA 4L1BB 3QWXX 1E8AA 1IS0A 1KWOC 1R1SA 2ZRSA 2WNDA 2Y1MA 1WRKA 3KO0A 2H5KA 1NSHA 4DUQA 3IMJA 1AJ5A 1FI5A 1OO3A 4ZCUA 2MAZA 2XP1A 2PMYA 3I5HC 5KSZA 3TKZA 1O4QA 5HKWA 1J7QA 2IZVA 3IMDA 2LLSA 1YX7A 1QX5B 1FBZA 3FWCA 1TNPA 2BBNA 1D4WA 4YI8A 1G83A 1SRAA 3K2MA 5CDWA 2CIAA 4FL2A 2EC6C 4CPVA 3I5IB 1S36A 4MRXA 1JBAA 1UP5A 4M2OA 4YGCB 4N1GA 5KTYA 4ZCVA 1A1AA 3HHMB 3KFJA 4NWFA 1GJYA 1M39A 2KOTA 1SHBA 3IN8A 1F70A 4XZ1A 1JF0A 4WQ2A 2Y5IA 1IQ3A 2FCEA 5I2OA 1KFUL 3AKBA 1CLBA 1FU5A 3PS5A 2K8MB 3IQOA 2CS0A 2ZRTA 3BOWB 2LUXA 4PE1A 4FBNA 1H9OA 1YUUA 2MRDA 4GWFA 2MJWB 4LUDA 2M7NA 1CMGA 1OSAA 3BQ3A 1CLMA 3BUXB 5AANA 3BXKA 3TDZA 4PHNA 1IH0A 2L6KA 1W7IB 2PALA 3A4UB 3MXYA 2NXQA 3UYOA 1AOTF 1M45A 3GQIB 1A03A 1ZUZA 1A08A 1C7WA 5IBWA 1CFPA 2H46E 2EYVA 1BHHB 4C0JA 2IUHA 2B1UA 2KFHA 3I5GC 4AQJA 4M2PA 1KK8C 1X6CA 2V53A 4BY5A 5HYDA 2VRGA 1O4RA 4HREE 3BKBA 1TTXA 4GL9E 1BJFA 2DVJA 3GK4X 1ZACA 1MR8A 1Z3KA 2K2AA 1O46A 1OPKA 1KK7Y 1DVIA 1K9PA 1EG4A 1MF8B 5IBMA 1H8BA 1CM4A 1M27A 1O4NA 1O4KA 1MXLC 1PICA 4I5KA 1JFJA 4TZIA 3EACA 1KWOB 1XK4C 2H61C 2KQ6A 2ZKMX 2LLUA 3ICBA 2QMSA 5I2QA 1D1OA 1F4OA 1SCVA 1O4DA 1Y57A 2IS9A 2RORA 2M1UA 1JFKA 2MLFC 4BY4A 1ALWA 1BU3A 2ECDA 3E3RA 3QWYA 2LE9B 3EVRA 2M9GA 1GHUA 1RJVA 2AAOA 1CB1A 4OKHA 2DLYA 1DGVA 1N2DA 3TDUA 3ZWHA 4D1EA 2EO6A 1TZEE 1KFXL 2JU0A 1S6CA 2LVJA 1SCMC 2ISDA 1PALA 1M46A 3CR5X 1ALVA 1AJ4A 3PM8A 3BUMB 3VRNA 3OHMB 5DKRA 1X0NA 1WDCC 3DVEA 5GJIA 1NZVA 1M63B 4MZKA 3GK2A 4F0ZB 1BF5A 5EELA 4MVFA 4K2RA 1G33A 2E6WA 1JYRA 2JPTA 2HMHA 4OHDA 1JC2A 2WOSA 3PFVA 1DF0B 1SKTA 2EO3A 1BLJA 4U17A 1O47A 1LA0A 2KI4C 1O4EA 2PSRA 4FQOA 1PRWA 4XYNA 1BFIA 2CRHA 3A8RA 2JTTA 3H4SE 4HRGA 4MBEA 2D8NA 1WRZA 5CSIA 1BHFA 1Y1XA 1OZSA 2JT3A 2QACA 5I2LA 1K9AA 2M1KB 2L2EA 1CKKA 4CIDA 1CFCA 1O44A 1F54A 1K2HA 4QSYA 1DJZA 1EXRA 4P2YB 4DGPA 1TIZA 3VRPA 2MRKA 3MAZA 4YGAA 1J7RA 1SHDA 3VGOA 1S26D 1KQVA 2DM0A 2C9WA 2HUWA 1YVLA 2JT0A 2OTGC 1CJ1A 2ABLA 4C0KA 1DMOA 3WHTB 2E30A 2I18A 4XJKB 2L5XB 1IG5A 1JSAA 1AYCA 1X27A 3DVMA 1VRKA 2PVBA 4JE4A 1AOUF 1BODA 4L9MA 3CD3A 2YSXA 2BL0B 3CS1A 3LCPC 3JTDC 3VROA 1A1CA 1OQPA 1JYQA 3PSKA 1AYAA 2LVIA 1TNXA 1RTP1 3VS5A 3MSEB 4GBAA 4M4ZA 3CR2A 1CWDL 2LUCA 1XFVO 1PVBA 1BKMA 1BLKA 2I2RE 2JT8A 2KAVA 5CSJA 1KQMB 2M29A 1DJXA 4DIRA 5F6TA
chains in the Genus database with same CATH superfamily
1AHRA 4GGFA 3OP0A 4I5LB 2ETZA 3FF3A 1SPSA 5HKZA 1A1EA 3QMEA 1NCZA 1QTXA 2G2BA 1Q80A 3S8NA 2QEOA 1SR6B 3SJFA 3OX5A 3B87A 3NSLA 2L98A 1GRIA 2WCLA 2AUGA 3NHTA 2M49B 4MZJA 1O4PA 1C7VA 1B7TZ 1SL9A 5DKQA 3CR4X 2C0TA 2FJUB 2FOTA 4INXA 3PM2A 3CZ1A 4MEWA 3TDIA 2SASA 5G08A 1SHAA 3NSIA 2CT9A 3HPGG 1S5GY 1KK7Z 4ETOA 1BG1A 4FL3A 5PALA 1SYMA 3TL0A 3KF9A 3LLEA 3EVUA 1TN4A 3HCKA 2WORA 1RFJA 5FI6A 2K7BA 1UHHA 2KHNA 1ZMZA 2M8UA 1XVJA 4CLNA 3UF4A 2JWWA 1SK6D 3LL8B 2BBMA 3D10A 3VRYA 1F4QA 4PE0A 3RBUA 3DF0A 3B88A 1S5GZ 1BR1B 2BAPA 5D0JA 3S0AA 5JOLA 3D7DA 2KNOA 2LCPA 1I3ZA 1OW4A 2P6BB 1DE4C 1UHJA 3GXWA 5BY0A 4YGBB 5TNCA 1WLMA 2PLEA 2BE6A 2K0JA 2PASA 2EKXA 3JVTB 1O43A 3PLFB 1KCYA 2L3TA 1A75A 3TUYC 1SR6C 1SKJA 4NWGA 2SHPA 3D74A 3EK8A 2LLTA 3KHEA 1CNPA 2HDXA 1QX2A 1B8CA 1LINA 3R72A 4MRYA 1DEKA 3SJEA 1YRTB 1LXFC 4IJ7A 2JC2A 5AFPA 2HPSA 3PSRA 2XEIA 2MBXA 2WCJA 2Y4QA 2BKHB 5KU1A 1IGVA 2OS8C 1LKKA 3VS0A 1UWOA 3SIBA 1CWEA 2NZ0A 3F45A 4YBHB 4DS7A 4E93A 1O48A 3AAJA 4P44A 4FTGA 1WLZA 2VIFA 4WWQA 4MLWA 1KSOA 3DYEA 1MQ1A 3S0BA 2PTKA 4OVNF 2DX0A 4F7FA 5BO4A 1QVIZ 4BTFA 3S9NA 1O4BA 3BFAA 2HCKA 3D78A 1CSYA 1O4FA 3M7FA 2FJYA 5DC4A 1CDPA 1WDCB 4MSPA 5DC0B 4P9VA 1OO4A 1XFXO 2LHLA 1YVHA 1L7ZA 1FHSA 1O4GA 2Y3AB 1OOHA 1KSWA 2K7DA 3BUWB 1O4IA 1CFDA 2LNKA 1FYRA 4CFQA 4M2QA 5B8IB 3SS4A 3HIZB 1JWDA 1M31A 2JOJA 2HQ8A 1KFXS 1T14A 1XFWO 1UURA 2KAYA 3SJGA 3WXAA 5IBSA 1N65A 1LUNA 1CDMA 1C3ZA 4N5XA 1NX2A 2FO0A 3TUYB 3DD4A 4YGEB 3LK1A 2KPHA 2P70A 5GQQC 4OHEA 3HMJG 2LM5A 2FCIA 1HT9A 3US4A 1ORGA 3N7YA 1Z9EA 3S8LA 5GJHA 4LUEA 3RZSA 3VS4A 1LUMA 3PJPA 1BM2A 4I5NB 4U1PA 1MXEA 1SBJA 2PVVA 1NCYA 2L5YA 1R1SA 2ZRSA 3O8ZA 1FI5A 1OO3A 4ZCUA 2XPLA 5HKWA 1J7QA 2IZVA 3IMDA 2LLSA 1YX7A 3CZ2A 3FWCA 3K2MA 1A1AA 5KTYA 3KFJA 1M39A 2KOTA 1SHBA 3F9KC 4XZ1A 2K60A 2FCEA 3PS5A 1KFUL 1CLBA 3BXMA 2CS0A 2ZRTA 1C3YA 4FBNA 1H9OA 1YUUA 5I94A 2MRDA 4GWFA 3TDZA 4PHNA 1W7IB 2PALA 1C7WA 5IBWA 1BHHB 2KFHA 3I5GC 4M2PA 1X6CA 3EG5B 5HYDA 4HREE 4GL9E 2DVJA 3CABA 1ZACA 1MR8A 2K2AA 1KK7Y 1K9PA 1EG4A 1MF8B 3ICBA 1XK4C 2KQ6A 4NGTA 1SCVA 2IS9A 3QWYA 4BY4A 1ALWA 1BU3A 3U88C 2LE9B 2WC6A 3N7HA 1CB1A 2DLYA 3ZWHA 4D1EA 1SCMC 3BUMB 3VRNA 1X0NA 1NZVA 1M63B 4MZKA 4F0ZB 1BF5A 4NGPA 4MVFA 1JC2A 1DF0B 1BFIA 2CRHA 3A8RA 3H4SE 2D8NA 1OZSA 4CIDA 1CFCA 1O44A 1K2HA 2MRKA 3MAZA 1J7RA 1KQVA 2OTGC 1CJ1A 2I18A 1JSAA 1IG5A 3DVMA 1AOUF 4JE4A 4L9MA 1JYQA 2QEVA 2LVIA 3VS5A 4GBAA 3D76A 2LUCA 1BKMA 1DJXA 1LS8A 5F6TA 2LHIA 2GTEA 2OPOA 2WCFA 3CZTX 1O4JA 2O5GA 3R1PA 2H2KA 3BOWA 2F33A 1SPYA 2NLNA 1QXPA 3KEVA 4MCPA 4ICBA 3PALA 4JPZB 2ZNDA 1LKJA 3O2PA 3WHUB 2DLZA 2EC6B 2WC5A 3EAZA 4Q04A 2OOTA 3FECA 1B8RA 2DCRA 5EEQA 2K7CA 2KBIA 3S0DA 1TRFA 3M0WA 5AULA 2M3WA 1LCKA 4H1OA 1DJWA 2CBLA 1QIVA 1SL8A 3EKJA 1DJYA 2F3ZA 4W9YA 1B9AA 1C07A 3BHXA 3OBVA 2CIJA 1XFRA 2LQWA 2HDVA 2LAPA 2LC5A 1PK0D 3CGAA 2UV8G 1RROA 2JNXA 3R1VA 1QADA 3TS5B 3GK1A 3CDNA 3S9MA 4USLA 1K95A 1TOPA 4PCWA 1SW8A 2I94A 1TNQA 1UHIA 2EYZA 4MCQA 1D1ZA 2KK6A 4AQIA 2KI6D 4P5OE 4EIHA 1LVCD 1A29A 1RWYA 1NCXA 2PNAA 2B3OA 2PVWA 1NPQA 3SIAA 4PALA 3I5FC 5AXIA 3S0FA 3SJSA 2L4KA 2IUIA 1K96A 2MHHA 1XFUO 3TZ1A 1W7JB 1FPWA 4OHLA 1QWVA 2LMTA 4GGNA 4IL1A 1G4YR 2BL0C 2RMXA 4JWQA 3VRQA 3I5HB 2L50A 1WRLA 1JF2A 1BFJA 5HLVA 3D0YA 3RM1A 1BMBA 4X6SA 1EL4A 2L0PA 1B47A 1SNLA 2OS8B 1LA3A 1A09A 4GPLB 3DXLA 1K90D 2MQIA 5DKNA 1DT7B 3GXXA 4UPGA 4NDCA 2NCOA 1J55A 2C6GA 1JUOA 2G9BA 1NZLA 2BE4A 1AP4A 2EL8A 2KNEA 3HPHE 4P4DA 1BHHA 3VS7A 2GSBA 1O4MA 2SRCA 1FI6A 1Y1AA 4A4CA 4HSZA 4HRHA 2CR4A 3AKAA 3UNWA 4AOMA 3SG4A 1TUJA 2JBJA 1RQQC 4K11A 2AMIA 2XEJA 4DCKA 2LMUA 1KA7A 2F2OA 2JULA 3PATA 1FU6A 4WRIA 4JEGA 1WQUA 3O6BA 5ER4X 5F13A 3CTNA 1PULA 1HCTB 1UHNA 4P45A 4P4EA 1K9UA 4X3RA 4GFTA 1LKLA 3SJXA 2ZFDA 2JQ6A 2BCAA 3S9KA 1XA5A 2NCPA 2WC8A 4OC2A 3RLZA 1GGZA 3N8MA 1BR4B 5FI7A 1L2OB 2RGIA 5HLOA 3SG7A 1PVAA 1XA6A 3OV1A 1DF0A 4PDZA 3BI1A 1YX8A 1NIWA 4E68A 4P9ZA 2GGZA 3EVVA 3IN7A 3NGVA 2PNBA 2I7AA 2WCBA 2JZIA 3BFBA 3CWGA 2M7LA 2KGRA 2ZN9A 4PE7A 2BKIB 2LMVA 5J3XA 1BT6A 1ZOTB 4YI9A 4D8KA 4L1BB 1KFUS 2WNDA 2Y1MA 2H5KA 4DUQA 5KSZA 4BPUB 1QX5B 1FBZA 1TNPA 4YI8A 1SRAA 2CIAA 4FL2A 4CPVA 3L4AA 1UP5A 4M2OA 4YGCB 4N1GA 3HHMB 4NWFA 1F70A 5I2OA 3AKBA 4MCRA 3BOWB 2LUXA 2ERBA 3S0EA 2MJWB 3FE9A 2N3AB 2L6KA 3MXYA 1AOTF 1M45A 1ZUZA 2H46E 2EYVA 4C0JA 1O4RA 1TTXA 5IBMA 1PICA 2KGYA 4I5KA 1KWOB 2H61C 2ZKMX 2QMSA 1D1OA 1O4DA 2RORA 1JFKA 2MLFC 3EVRA 2M9GA 3V2LA 1GHUA 1RJVA 1DGVA 2PQLA 3TDUA 5DICA 1TZEE 1KFXL 2JU0A 1P28A 2ISDA 3BFHA 1M46A 3CR5X 3NHIA 1ALVA 1AJ4A 3PM8A 1WDCC 2EO3A 1BLJA 1O47A 4OC0A 1O4EA 2DLAA 3T04A 4MBEA 1K9AA 4DGPA 4NGQA 4YGAA 5EL2A 3VGOA 2DM0A 1VRKA 3VROA 1OQPA 1TNXA 3MSEB 3CR2A 1XFVO 1PVBA 1BLKA 2I2RE 2KAVA 1KQMB 4NGNA 1HCSB 1J1EA 1R6PA 2XEFA 5ELYA 1QCFA 1A4PA 1BOCA 4PE4A 1R2UA 1XFZO 2KFGA 1YR5A 2K7AB 4K44A 5F09A 2Q4UA 3QRXA 1U5IA 1OMVA 2GV5A 4GUKA 2C0OA 2JXCA 1B8LA 3PJIA 2MLEC 4P4JA 3LYVA 1IJ6A 2LNWA 2RSYA 2AOAA 1X02A 2B4JC 4QJ5B 3EK7A 4N1FA 2OZOA 1XK4A 1V1FA 2EU0A 2C6PA 2KQYA 3K1EA 4U8DA 5HL1A 1YRUB 1QJTA 1QASA 3I5GB 2C0IA 2CI8A 4GAOA 2LP2A 2F3YA 1DQEA 3CBLA 2M0RA 2BBUA 3PN7C 4F59A 3OAKA 2JBKA 1MILA 1MWNA 3PQZA 1FMKA 4P4FA 2BECA 1OMRA 1YURA 3O78A 5DC9A 1NX0A 1QV0A 1O4LA 2QPTA 3EKHA 1O4HA 4I5JA 1ZFSA 2PLDA 1DTLA 2XPOA 1IIOA 1J1DA 3OX6A 1AD5A 1F71A 4H34A 3CXLA 2Q91A 1QS7A 4C0LA 1GGWA 3BUOB 4PT1A 1IJ5A 3S0GA 1K94A 1O42A 1JU5A 1QX7A 3NXAA 1ODBA 2EYYA 3FIAA 4F5AA 2KYFA 1A81A 4YGDB 5JJGA 1O49A 5EHRA 4JKTA 4QJ3B 1PSBA 1DGUA 2QEBA 3EK4A 2KGBC 1IKUA 1HQVA 4OHIA 3O4XA 1KC2A 4ROJA 1R1PA 1OE9B 3BUNB 1KSMA 3S8OA 4JQ0D 2MA2A 3BJHA 1XYDA 2ZNEA 1JWOA 1Z4HA 4PHJA 2KAXA 1LUIA 1GQMA 1DELA 2LV7A 1Y1UA 3VS1A 3IVTA 1BKLA 2C6CA 1O41A 4LQGA 2WCMA 1WY9A 2M97A 4QJ4B 3Q8IA 3DZTA 5CSNA 3FE8A 5D29A 1K93D 4OC4A 2XP1A 1G8IA 3L47A 2HQWA 1SPRA 1YUSA 3BI0A 4NGSA 1B7TY 1AB2A 2KFFA 3FEDA 1IJRA 1U5IB 3NHNA 1RJAA 5CSFA 1O4OA 1QLSA 1P13A 1NUBA 2RVFA 2IUGA 2HF5A 1K8UA 1EH2A 2BNXA 5ER5A 3NSOA 3I5IC 5I8NA 1CTRA 2A4JA 3VS2A 2CTNA 3B7AA 2QDIA 1S3PA 2KDHA 2KI4B 3FS7A 2WCEA 5HKYA 4P4BA 1J7PA 2L4IA 1NX3A 1DJHA 1M61A 3GOFA 2YU7A 2KBMA 1O4AA 1B1GA 4NGMA 1IWQA 2LVVA 4JD9A 1CSZA 2XPNA 3C7IA 3I5FB 1O45A 1DJGA 1MHOA 1EJ3A 1A75B 1K9KA 3D0YB 4ORBB 5D69A 1OOJA 1AK8A 1Y0VH 1KA6A 4A4BA 1F55A 5CPVA 1QG1E 3S9LA 4R1EA 1H4BA 3KPXA 2OR4A 1E8AA 1IS0A 3KO0A 3IMJA 3FE6A 2MAZA 3I5HC 3TKZA 1O4QA 2VKZG 1D4WA 1G83A 3I5IB 4ZCVA 3IN8A 1W9ZA 1JF0A 2Y5IA 1FU5A 3IQOA 3D73A 4PE1A 1CMGA 1IH0A 3BQ3A 1CLMA 3BUXB 3A4UB 2NXQA 3UYOA 3GQIB 1A08A 1CFPA 2B1UA 4AQJA 1KK8C 2V53A 3D75A 1BJFA 1O46A 1OPKA 2LRAA 1O4NA 1MXLC 1JFJA 4TZIA 3VS3A 1F4OA 2M1UA 4MCSA 2AAOA 4OKHA 1N2DA 2EO6A 5DKRA 3UO9A 5GJIA 3GK2A 5EELA 2E6WA 4OHDA 1JYRA 2JPTA 2HMHA 2WOSA 3PFVA 1SKTA 2QEHA 3D7GA 4FQOA 1PRWA 4XYNA 4HRGA 5CSIA 1WRZA 1BHFA 2M1KB 1CKKA 1F54A 1DJZA 4P2YB 1SHDA 1S26D 1YVLA 2JT0A 1DMOA 2E30A 4XJKB 1X27A 2PVBA 3CD3A 1TUZA 2YSXA 4NGRA 3LCPC 3PSKA 4BPWB 1AYAA 1RTP1 4M4ZA 5CSJA 2M29A 3OGNA 3D77A 1EO0A 1XO5A 3O4YA 1Y6WA 1LCJA 2BCBA 1D4TA 2EOBA 1RK9A 2SCPA 1MUXA 2MK2A 2YGUA 2LANA 2O60A 1OOFA 1R1QA 5I6VA 2KSPA 1YTZC 4GNKB 5FYXA 1TCFA 1BLQA 2L51A 1CLLA 2AUCA 2CXJA 1F1WA 4DRWA 2XPPA 1CDNA 2BCXA 3WA4A 4PHMA 3LK0A 1SSEB 1UHKA 1IRJA 2MC1A 1O4CA 1QATA 4RR2B 1UUSA 1A07A 4NQGA 4JGHA 3HX4A 4JZ0A 1TNWA 3SG2A 2K2FA 1ZFPE 1FF1A 4OZDA 5D7FA 4K45A 2KLEA 2XEGA 1BMOA 2R2IA 1CFFA 2K7OA 3NFQA 4INWA 5AERA 4MZLA 3VRRA 1OZOA 1QIWA 1XFYO 4OV2A 2JTZA 3OB1B 2AOBA 1N0YA 3N84A 3B86A 2HETA 1QLKA 3R1OA 2FCDA 1OPLA 5D3OA 2KI6C 1A2XA 4MN0A 4GGFC 1QVIY 1SMGA 1AYDA 4NDDA 2PYQA 1Z2CB 2CCMA 4XJKA 2LNXA 4OC1A 1MW4A 1AVSA 1CM1A 1S6IA 4WQ3A 3DVJA 2CI9A 2TN4A 3OB2B 3TS5C 2KYCA 4OC5A 5K89A 5AEQA 1FW4A 2K61A 3SG6A 2H8HA 1NP8A 3MXCA 1TCEA 1V1GA 2OQ1A 4ORAB 2JRFA 3VB1A 2LQNA 1Z8LA 1AYBA 3DVKA 2LVKA 3FEEA 2H61A 2LP3A 4KYNA 1CDLA 4FQTA 3PSJA 3FWBA 4BPXB 5EG3B 2F8PA 3SS3A 1AUIB 3AAKA 2L2CA 2GGMA 2EGDA 1KQMC 2F2PA 1NYAA 1CMFA 3SS5A 2PRUA 1RECA 1EG3A 1J7OA 4EY0A 2JNFA 4TNCA 3K21A 4ORCB 3VRZA 3JVTC 3BYAA 3CZ0A 4CFRA 3PN7B 2JYQA 1F8HA 2L4HA 1OOIX 4P4IA 3PT1A 1S1EA 4OHHA 1NX1A 3NSKA 3VS6A 3IF7A 3DF0B 2OTGB 2EHBA 1QV1A 4DGXA 1B4CA 4YRUA 3CYZA 4NDBA 5KAZA 1OOGA 4PHKA 1SCMB 1SY9A 4OMEA 1S6JA 5BPJA 1F2FA 2GE9A 1A1BA 2Y1NA 1LUKA 2JXLA 2K79B 5EHPA 3C1VA 1DJIA 2CNPA 5DF6A 1TCOB 2ZN8A 3WNXB 4F5BA 4OR9B 1L2OC 3SG5A 2JPOA 1OMDA 2WCHA 2DOQA 1NRVA 1DC1A 4OCIA 1RPYA 3SG3A 1JYUA 4XZ0A 1KK8B 3CLNA 1TWOA 2LCTA 3JTDB 3HCMA 2MRJA 3IQQA 3ZNIA 1IQ5A 1FBVA 3OVEA 3IWWA 1SL7A 1NWDA 1YUTA 2COLB 1PSRA 3KASA 3QWXX 1KWOC 1WRKA 1NSHA 1AJ5A 2PMYA 2BBNA 5CDWA 2EC6C 1S36A 4MRXA 1JBAA 1GJYA 4WQ2A 1IQ3A 1GM0A 2K8MB 4JYWA 4OC3A 4LUDA 1CX8A 2M7NA 1OSAA 5AANA 3BXKA 1A03A 3D7FA 2IUHA 4BY5A 2VRGA 3BKBA 3GK4X 1Z3KA 1DVIA 1H8BA 1CM4A 1M27A 1O4KA 2KLDA 3EACA 2LLUA 5I2QA 1Y57A 2ECDA 3E3RA 1S6CA 2LVJA 1PALA 3OHMB 3DVEA 3K2TA 5FI2A 4K2RA 1G33A 1WJTA 2P71A 4U17A 1LA0A 2KI4C 2PSRA 3L4LA 2H8VA 2JTTA 1Y1XA 2JT3A 2QACA 3B6XA 5I2LA 2L2EA 4QSYA 1EXRA 1TIZA 3VRPA 2HUWA 2C9WA 2ABLA 4C0KA 3WHTB 1AYCA 2L5XB 3DY9A 1BODA 2WCKA 2BL0B 3CS1A 1A1CA 3JTDC 1CWDL 3D7HA 2JT8A 4DIRA
chains in the Genus database with same CATH topology
2LHIA 1HCSB 1AHRA 1J1EA 2OPOA 4GGFA 3OP0A 1R6PA 2WCFA 3CZTX 4I5LB 1QCFA 1XO5A 3O4YA 2ETZA 1Y6WA 1SPSA 1O4JA 1LCJA 2BCBA 1D4TA 5HKZA 2O5GA 1A1EA 1NCZA 2H2KA 1A4PA 1QTXA 2F33A 1SPYA 2G2BA 1Q80A 1RK9A 3BOWA 2NLNA 1QXPA 1BOCA 4PE4A 2EOBA 1R2UA 3S8NA 1XFZO 2KFGA 1YR5A 3KEVA 2K7AB 4K44A 4ICBA 1SR6B 3PALA 2SCPA 1MUXA 2MK2A 2Q4UA 4JPZB 2ZNDA 1U5IA 3QRXA 1LKJA 1OMVA 3OX5A 2LANA 2O60A 3O2PA 3WHUB 1R1QA 3NSLA 2DLZA 5I6VA 2GV5A 4GUKA 2KSPA 1YTZC 2L98A 2EC6B 2JXCA 4GNKB 5FYXA 4Q04A 1B8LA 2C0OA 3EAZA 1TCFA 2MLEC 1BLQA 1GRIA 2L51A 1CLLA 2AUGA 1B8RA 2AUCA 2DCRA 2CXJA 1F1WA 1IJ6A 2M49B 2LNWA 4DRWA 4MZJA 1CDNA 2BCXA 2RSYA 5EEQA 2K7CA 2KBIA 1TRFA 2AOAA 1X02A 1O4PA 1C7VA 1B7TZ 1SL9A 3WA4A 3M0WA 5DKQA 4PHMA 4QJ5B 3EK7A 5AULA 2M3WA 4N1FA 3CR4X 2C0TA 2OZOA 3LK0A 2FJUB 2FOTA 1XK4A 1LCKA 1V1FA 1UHKA 2EU0A 2KQYA 4H1OA 1IRJA 4MEWA 3TDIA 2MC1A 1DJWA 4U8DA 2CBLA 1O4CA 2SASA 1QATA 1YRUB 1QIVA 1SL8A 1QJTA 3EKJA 1QASA 1DJYA 2F3ZA 1UUSA 3I5GB 5G08A 1A07A 1B9AA 4NQGA 3NSIA 1SHAA 2C0IA 2CI8A 4JGHA 2CT9A 4GAOA 3HX4A 1C07A 1S5GY 2LP2A 2F3YA 1KK7Z 4ETOA 3CBLA 1BG1A 1TNWA 2M0RA 3SG2A 2K2FA 2BBUA 1ZFPE 3PN7C 4FL3A 2LQWA 4F59A 1FF1A 5PALA 1MILA 1SYMA 5D7FA 4K45A 1O43A 2HDVA 3TL0A 2LAPA 2LC5A 1MWNA 1PK0D 3CGAA 3KF9A 1FMKA 3LLEA 3PQZA 1BMOA 2BECA 1OMRA 2R2IA 3EVUA 1CFFA 1RROA 1TN4A 3HCKA 2WORA 2JNXA 1RFJA 1YURA 1QADA 2K7BA 3O78A 3TS5B 3GK1A 1UHHA 5DC9A 2KHNA 1ZMZA 2M8UA 1NX0A 2K7OA 1XVJA 1QV0A 4CLNA 1O4LA 3UF4A 2JWWA 1SK6D 2QPTA 3LL8B 3EKHA 4USLA 1K95A 1O4HA 2BBMA 1TOPA 3D10A 5AERA 4MZLA 4PCWA 3VRYA 1F4QA 1ZFSA 1SW8A 2I94A 4I5JA 4PE0A 1DTLA 3VRRA 2PLDA 1OZOA 1QIWA 1XFYO 1TNQA 4OV2A 1J1DA 1UHIA 2EYZA 3OX6A 1AD5A 1F71A 2JTZA 3OB1B 2AOBA 3DF0A 1N0YA 1D1ZA 3N84A 4H34A 2KK6A 4AQIA 2KI6D 3CXLA 2HETA 4P5OE 1S5GZ 2Q91A 1LVCD 1BR1B 4EIHA 1QLKA 1A29A 1RWYA 1NCXA 1QS7A 2FCDA 4C0LA 1OPLA 2B3OA 2PNAA 1NPQA 2KI6C 1A2XA 3SIAA 1GGWA 5D0JA 5JOLA 4MN0A 3BUOB 1QVIY 1IJ5A 4GGFC 1SMGA 1K94A 1AYDA 4PALA 4NDDA 2KNOA 3I5FC 5AXIA 2LCPA 1I3ZA 1JU5A 2CCMA 1O42A 1QX7A 3NXAA 2P6BB 3GXWA 1UHJA 4XJKA 1ODBA 2LNXA 2L4KA 3SJSA 2IUIA 1K96A 4YGBB 5TNCA 1MW4A 2MHHA 2EYYA 1AVSA 1XFUO 1CM1A 3FIAA 1S6IA 1WLMA 4F5AA 2KYFA 4WQ3A 1A81A 2PLEA 3DVJA 2BE6A 4YGDB 3TZ1A 5JJGA 1O49A 2CI9A 2TN4A 5EHRA 1W7JB 2K0JA 3OB2B 2PASA 3TS5C 1FPWA 2KYCA 2EKXA 3JVTB 4OHLA 4QJ3B 1PSBA 3PLFB 1DGUA 2LMTA 4GGNA 5AEQA 5K89A 1A75A 1KCYA 1FW4A 3EK4A 2L3TA 3TUYC 1SR6C 2KGBC 4IL1A 1SKJA 2SHPA 4NWGA 1G4YR 2BL0C 2RMXA 1IKUA 1HQVA 2K61A 3SG6A 4OHIA 3EK8A 2H8HA 4JWQA 3VRQA 2LLTA 1NP8A 3I5HB 2L50A 3KHEA 1KC2A 4ROJA 1CNPA 2HDXA 1R1PA 1QX2A 1OE9B 1WRLA 1JF2A 3BUNB 1B8CA 5HLVA 1BFJA 3D0YA 3RM1A 1KSMA 1LINA 4MRYA 3S8OA 1YRTB 3MXCA 1BMBA 4JQ0D 4X6SA 2MA2A 1TCEA 3T04A 1LXFC 1V1GA 1EL4A 2L0PA 1B47A 1SNLA 1XYDA 2ZNEA 1JWOA 2OS8B 2JC2A 5AFPA 1LA3A 2OQ1A 2HPSA 3PSRA 4ORAB 2JRFA 4PHJA 1A09A 2LQNA 2MBXA 1AYBA 2KAXA 2Y4QA 2BKHB 4GPLB 1IGVA 5KU1A 3DVKA 1K90D 2MQIA 2OS8C 1LKKA 3VS0A 5DKNA 1UWOA 3SIBA 2LVKA 1DT7B 2NZ0A 1CWEA 4UPGA 2H61A 3F45A 1LUIA 4YBHB 3GXXA 4NDCA 2NCOA 4DS7A 4E93A 1J55A 2LP3A 1JUOA 1O48A 1CDLA 3AAJA 3PSJA 1GQMA 2G9BA 3FWBA 2LV7A 1NZLA 4FTGA 2BE4A 5EG3B 1Y1UA 2F8PA 1AP4A 3VS1A 1AUIB 3AAKA 1WLZA 1BKLA 3VS3A 1O41A 2GGMA 2EGDA 2KNEA 2EL8A 2F2PA 1KQMC 1BHHA 1NYAA 4MLWA 2VIFA 4WWQA 3VS7A 1WY9A 2M97A 1KSOA 1CMFA 2PRUA 1RECA 1EG3A 4QJ4B 2GSBA 5CSNA 1MQ1A 1O4MA 2PTKA 1J7OA 4EY0A 4OVNF 1K93D 2SRCA 1FI6A 2JNFA 1Y1AA 4TNCA 3K21A 4A4CA 4ORCB 2DX0A 1QVIZ 1G8IA 3JVTC 4HSZA 4HRHA 4BTFA 2CR4A 3VRZA 3AKAA 2HQWA 3BYAA 1SPRA 1YUSA 4CFRA 4AOMA 3PN7B 3SG4A 2JYQA 1RQQC 1F8HA 4K11A 2L4HA 1O4BA 1B7TY 1S1EA 4OHHA 1AB2A 2AMIA 2KFFA 1IJRA 2HCKA 1NX1A 3NSKA 4DCKA 3VS6A 1U5IB 3NHNA 1CSYA 3IF7A 2LMUA 1O4FA 3DF0B 1KA7A 2F2OA 2JULA 1RJAA 2OTGB 3M7FA 5DC4A 1CDPA 2EHBA 3PATA 1QV1A 1WDCB 4MSPA 5CSFA 1O4OA 1FU6A 4P9VA 5DC0B 1QLSA 4DGXA 1B4CA 5BO4A 4YRUA 1P13A 1NUBA 1OO4A 2RVFA 4WRIA 4JEGA 1XFXO 2LHLA 1WQUA 2IUGA 1YVHA 3O6BA 2HF5A 4NDBA 5KAZA 1L7ZA 5ER4X 1FHSA 1K8UA 1O4GA 2Y3AB 3CTNA 1PULA 1HCTB 4PHKA 1SCMB 1SY9A 1KSWA 1S6JA 1EH2A 1UHNA 5BPJA 2K7DA 5ER5A 3NSOA 3BUWB 1F2FA 1O4IA 1K9UA 3I5IC 1CFDA 2LNKA 4GFTA 4CFQA 4M2QA 5B8IB 1FYRA 5I8NA 1LKLA 2ZFDA 1CTRA 2A4JA 3HIZB 2JQ6A 1A1BA 2BCAA 1JWDA 2GE9A 3S9KA 1XA5A 3VS2A 1M31A 2CTNA 2JOJA 2NCPA 2WC8A 2Y1NA 1LUKA 2HQ8A 1S3PA 1KFXS 2KDHA 2KI4B 3RLZA 2JXLA 1XFWO 1UURA 2K79B 1GGZA 2KAYA 5EHPA 3FS7A 3C1VA 3N8MA 1BR4B 2WCEA 1DJIA 3WXAA 5IBSA 5HKYA 2CNPA 1L2OB 1N65A 2RGIA 1CDMA 2L4IA 1J7PA 1NX3A 4N5XA 5HLOA 3SG7A 1DJHA 1M61A 5DF6A 1PVAA 1TCOB 3GOFA 1XA6A 1NX2A 2ZN8A 3WNXB 2FO0A 3OV1A 4OR9B 4F5BA 1DF0A 4PDZA 1L2OC 2KBMA 3TUYB 1O4AA 2YU7A 3DD4A 1B1GA 1YX8A 1NIWA 1IWQA 4YGEB 3LK1A 3SG5A 2LVVA 1OMDA 4E68A 4P9ZA 1CSZA 2DOQA 1NRVA 5GQQC 4OHEA 2GGZA 3EVVA 4OCIA 1RPYA 3C7IA 3IN7A 3I5FB 3SG3A 2LM5A 1O45A 2PNBA 1DJGA 1MHOA 1LUNA 2FCIA 1HT9A 1EJ3A 2I7AA 1JYUA 1A75B 1K9KA 3D0YB 4ORBB 3N7YA 3US4A 3S8LA 5D69A 1OOJA 4XZ0A 1AK8A 5GJHA 1Y0VH 4LUEA 1KK8B 2WCBA 2JZIA 3CLNA 3CWGA 3VS4A 1LUMA 2M7LA 2KGRA 2ZN9A 4PE7A 1BM2A 1KA6A 2LCTA 3PJPA 3JTDB 3HCMA 4A4BA 4I5NB 2BKIB 2LMVA 5J3XA 3IQQA 3ZNIA 1IQ5A 1F55A 1BT6A 1FBVA 5CPVA 1QG1E 2MRJA 1SL7A 1ZOTB 4YI9A 3OVEA 4U1PA 4D8KA 1NWDA 4R1EA 1MXEA 1H4BA 1KFUS 1SBJA 1YUTA 2COLB 1NCYA 1PSRA 3KPXA 4L1BB 3QWXX 1E8AA 1IS0A 1KWOC 1R1SA 2ZRSA 2WNDA 2Y1MA 1WRKA 3KO0A 2H5KA 1NSHA 4DUQA 3IMJA 1AJ5A 1FI5A 1OO3A 4ZCUA 2MAZA 2XP1A 2PMYA 3I5HC 5KSZA 3TKZA 1O4QA 5HKWA 1J7QA 2IZVA 3IMDA 2LLSA 1YX7A 1QX5B 1FBZA 3FWCA 1TNPA 2BBNA 1D4WA 4YI8A 1G83A 1SRAA 3K2MA 5CDWA 2CIAA 4FL2A 2EC6C 4CPVA 3I5IB 1S36A 4MRXA 1JBAA 1UP5A 4M2OA 4YGCB 4N1GA 5KTYA 4ZCVA 1A1AA 3HHMB 3KFJA 4NWFA 1GJYA 1M39A 2KOTA 1SHBA 3IN8A 1F70A 4XZ1A 1JF0A 4WQ2A 2Y5IA 1IQ3A 2FCEA 5I2OA 1KFUL 3AKBA 1CLBA 1FU5A 3PS5A 2K8MB 3IQOA 2CS0A 2ZRTA 3BOWB 2LUXA 4PE1A 4FBNA 1H9OA 1YUUA 2MRDA 4GWFA 2MJWB 4LUDA 2M7NA 1CMGA 1OSAA 3BQ3A 1CLMA 3BUXB 5AANA 3BXKA 3TDZA 4PHNA 1IH0A 2L6KA 1W7IB 2PALA 3A4UB 3MXYA 2NXQA 3UYOA 1AOTF 1M45A 3GQIB 1A03A 1ZUZA 1A08A 1C7WA 5IBWA 1CFPA 2H46E 2EYVA 1BHHB 4C0JA 2IUHA 2B1UA 2KFHA 3I5GC 4AQJA 4M2PA 1KK8C 1X6CA 2V53A 4BY5A 5HYDA 2VRGA 1O4RA 4HREE 3BKBA 1TTXA 4GL9E 1BJFA 2DVJA 3GK4X 1ZACA 1MR8A 1Z3KA 2K2AA 1O46A 1OPKA 1KK7Y 1DVIA 1K9PA 1EG4A 1MF8B 5IBMA 1H8BA 1CM4A 1M27A 1O4NA 1O4KA 1MXLC 1PICA 4I5KA 1JFJA 4TZIA 3EACA 1KWOB 1XK4C 2H61C 2KQ6A 2ZKMX 2LLUA 3ICBA 2QMSA 5I2QA 1D1OA 1F4OA 1SCVA 1O4DA 1Y57A 2IS9A 2RORA 2M1UA 1JFKA 2MLFC 4BY4A 1ALWA 1BU3A 2ECDA 3E3RA 3QWYA 2LE9B 3EVRA 2M9GA 1GHUA 1RJVA 2AAOA 1CB1A 4OKHA 2DLYA 1DGVA 1N2DA 3TDUA 3ZWHA 4D1EA 2EO6A 1TZEE 1KFXL 2JU0A 1S6CA 2LVJA 1SCMC 2ISDA 1PALA 1M46A 3CR5X 1ALVA 1AJ4A 3PM8A 3BUMB 3VRNA 3OHMB 5DKRA 1X0NA 1WDCC 3DVEA 5GJIA 1NZVA 1M63B 4MZKA 3GK2A 4F0ZB 1BF5A 5EELA 4MVFA 4K2RA 1G33A 2E6WA 1JYRA 2JPTA 2HMHA 4OHDA 1JC2A 2WOSA 3PFVA 1DF0B 1SKTA 2EO3A 1BLJA 4U17A 1O47A 1LA0A 2KI4C 1O4EA 2PSRA 4FQOA 1PRWA 4XYNA 1BFIA 2CRHA 3A8RA 2JTTA 3H4SE 4HRGA 4MBEA 2D8NA 1WRZA 5CSIA 1BHFA 1Y1XA 1OZSA 2JT3A 2QACA 5I2LA 1K9AA 2M1KB 2L2EA 1CKKA 4CIDA 1CFCA 1O44A 1F54A 1K2HA 4QSYA 1DJZA 1EXRA 4P2YB 4DGPA 1TIZA 3VRPA 2MRKA 3MAZA 4YGAA 1J7RA 1SHDA 3VGOA 1S26D 1KQVA 2DM0A 2C9WA 2HUWA 1YVLA 2JT0A 2OTGC 1CJ1A 2ABLA 4C0KA 1DMOA 3WHTB 2E30A 2I18A 4XJKB 2L5XB 1IG5A 1JSAA 1AYCA 1X27A 3DVMA 1VRKA 2PVBA 4JE4A 1AOUF 1BODA 4L9MA 3CD3A 2YSXA 2BL0B 3CS1A 3LCPC 3JTDC 3VROA 1A1CA 1OQPA 1JYQA 3PSKA 1AYAA 2LVIA 1TNXA 1RTP1 3VS5A 3MSEB 4GBAA 4M4ZA 3CR2A 1CWDL 2LUCA 1XFVO 1PVBA 1BKMA 1BLKA 2I2RE 2JT8A 2KAVA 5CSJA 1KQMB 2M29A 1DJXA 4DIRA 5F6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHI A;  1HCS B;  1AHR A;  1J1E A;  2OPO A;  4GGF A;  3OP0 A;  1R6P A;  2WCF A;  3CZT X;  4I5L B;  1QCF A;  1XO5 A;  3O4Y A;  2ETZ A;  1Y6W A;  1SPS A;  1O4J A;  1LCJ A;  2BCB A;  1D4T A;  5HKZ A;  2O5G A;  1A1E A;  1NCZ A;  2H2K A;  1A4P A;  1QTX A;  2F33 A;  1SPY A;  2G2B A;  1Q80 A;  1RK9 A;  3BOW A;  2NLN A;  1QXP A;  1BOC A;  4PE4 A;  2EOB A;  1R2U A;  3S8N A;  1XFZ O;  2KFG A;  1YR5 A;  3KEV A;  2K7A B;  4K44 A;  4ICB A;  1SR6 B;  3PAL A;  2SCP A;  1MUX A;  2MK2 A;  2Q4U A;  4JPZ B;  2ZND A;  1U5I A;  3QRX A;  1LKJ A;  1OMV A;  3OX5 A;  2LAN A;  2O60 A;  3O2P A;  3WHU B;  1R1Q A;  3NSL A;  2DLZ A;  5I6V A;  2GV5 A;  4GUK A;  2KSP A;  1YTZ C;  2L98 A;  2EC6 B;  2JXC A;  4GNK B;  5FYX A;  4Q04 A;  1B8L A;  2C0O A;  3EAZ A;  1TCF A;  2MLE C;  1BLQ A;  1GRI A;  2L51 A;  1CLL A;  2AUG A;  1B8R A;  2AUC A;  2DCR A;  2CXJ A;  1F1W A;  1IJ6 A;  2M49 B;  2LNW A;  4DRW A;  4MZJ A;  1CDN A;  2BCX A;  2RSY A;  5EEQ A;  2K7C A;  2KBI A;  1TRF A;  2AOA A;  1X02 A;  1O4P A;  1C7V A;  1B7T Z;  1SL9 A;  3WA4 A;  3M0W A;  5DKQ A;  4PHM A;  4QJ5 B;  3EK7 A;  5AUL A;  2M3W A;  4N1F A;  3CR4 X;  2C0T A;  2OZO A;  3LK0 A;  2FJU B;  2FOT A;  1XK4 A;  1LCK A;  1V1F A;  1UHK A;  2EU0 A;  2KQY A;  4H1O A;  1IRJ A;  4MEW A;  3TDI A;  2MC1 A;  1DJW A;  4U8D A;  2CBL A;  1O4C A;  2SAS A;  1QAT A;  1YRU B;  1QIV A;  1SL8 A;  1QJT A;  3EKJ A;  1QAS A;  1DJY A;  2F3Z A;  1UUS A;  3I5G B;  5G08 A;  1A07 A;  1B9A A;  4NQG A;  3NSI A;  1SHA A;  2C0I A;  2CI8 A;  4JGH A;  2CT9 A;  4GAO A;  3HX4 A;  1C07 A;  1S5G Y;  2LP2 A;  2F3Y A;  1KK7 Z;  4ETO A;  3CBL A;  1BG1 A;  1TNW A;  2M0R A;  3SG2 A;  2K2F A;  2BBU A;  1ZFP E;  3PN7 C;  4FL3 A;  2LQW A;  4F59 A;  1FF1 A;  5PAL A;  1MIL A;  1SYM A;  5D7F A;  4K45 A;  1O43 A;  2HDV A;  3TL0 A;  2LAP A;  2LC5 A;  1MWN A;  1PK0 D;  3CGA A;  3KF9 A;  1FMK A;  3LLE A;  3PQZ A;  1BMO A;  2BEC A;  1OMR A;  2R2I A;  3EVU A;  1CFF A;  1RRO A;  1TN4 A;  3HCK A;  2WOR A;  2JNX A;  1RFJ A;  1YUR A;  1QAD A;  2K7B A;  3O78 A;  3TS5 B;  3GK1 A;  1UHH A;  5DC9 A;  2KHN A;  1ZMZ A;  2M8U A;  1NX0 A;  2K7O A;  1XVJ A;  1QV0 A;  4CLN A;  1O4L A;  3UF4 A;  2JWW A;  1SK6 D;  2QPT A;  3LL8 B;  3EKH A;  4USL A;  1K95 A;  1O4H A;  2BBM A;  1TOP A;  3D10 A;  5AER A;  4MZL A;  4PCW A;  3VRY A;  1F4Q A;  1ZFS A;  1SW8 A;  2I94 A;  4I5J A;  4PE0 A;  1DTL A;  3VRR A;  2PLD A;  1OZO A;  1QIW A;  1XFY O;  1TNQ A;  4OV2 A;  1J1D A;  1UHI A;  2EYZ A;  3OX6 A;  1AD5 A;  1F71 A;  2JTZ A;  3OB1 B;  2AOB A;  3DF0 A;  1N0Y A;  1D1Z A;  3N84 A;  4H34 A;  2KK6 A;  4AQI A;  2KI6 D;  3CXL A;  2HET A;  4P5O E;  1S5G Z;  2Q91 A;  1LVC D;  1BR1 B;  4EIH A;  1QLK A;  1A29 A;  1RWY A;  1NCX A;  1QS7 A;  2FCD A;  4C0L A;  1OPL A;  2B3O A;  2PNA A;  1NPQ A;  2KI6 C;  1A2X A;  3SIA A;  1GGW A;  5D0J A;  5JOL A;  4MN0 A;  3BUO B;  1QVI Y;  1IJ5 A;  4GGF C;  1SMG A;  1K94 A;  1AYD A;  4PAL A;  4NDD A;  2KNO A;  3I5F C;  5AXI A;  2LCP A;  1I3Z A;  1JU5 A;  2CCM A;  1O42 A;  1QX7 A;  3NXA A;  2P6B B;  3GXW A;  1UHJ A;  4XJK A;  1ODB A;  2LNX A;  2L4K A;  3SJS A;  2IUI A;  1K96 A;  4YGB B;  5TNC A;  1MW4 A;  2MHH A;  2EYY A;  1AVS A;  1XFU O;  1CM1 A;  3FIA A;  1S6I A;  1WLM A;  4F5A A;  2KYF A;  4WQ3 A;  1A81 A;  2PLE A;  3DVJ A;  2BE6 A;  4YGD B;  3TZ1 A;  5JJG A;  1O49 A;  2CI9 A;  2TN4 A;  5EHR A;  1W7J B;  2K0J A;  3OB2 B;  2PAS A;  3TS5 C;  1FPW A;  2KYC A;  2EKX A;  3JVT B;  4OHL A;  4QJ3 B;  1PSB A;  3PLF B;  1DGU A;  2LMT A;  4GGN A;  5AEQ A;  5K89 A;  1A75 A;  1KCY A;  1FW4 A;  3EK4 A;  2L3T A;  3TUY C;  1SR6 C;  2KGB C;  4IL1 A;  1SKJ A;  2SHP A;  4NWG A;  1G4Y R;  2BL0 C;  2RMX A;  1IKU A;  1HQV A;  2K61 A;  3SG6 A;  4OHI A;  3EK8 A;  2H8H A;  4JWQ A;  3VRQ A;  2LLT A;  1NP8 A;  3I5H B;  2L50 A;  3KHE A;  1KC2 A;  4ROJ A;  1CNP A;  2HDX A;  1R1P A;  1QX2 A;  1OE9 B;  1WRL A;  1JF2 A;  3BUN B;  1B8C A;  5HLV A;  1BFJ A;  3D0Y A;  3RM1 A;  1KSM A;  1LIN A;  4MRY A;  3S8O A;  1YRT B;  3MXC A;  1BMB A;  4JQ0 D;  4X6S A;  2MA2 A;  1TCE A;  3T04 A;  1LXF C;  1V1G A;  1EL4 A;  2L0P A;  1B47 A;  1SNL A;  1XYD A;  2ZNE A;  1JWO A;  2OS8 B;  2JC2 A;  5AFP A;  1LA3 A;  2OQ1 A;  2HPS A;  3PSR A;  4ORA B;  2JRF A;  4PHJ A;  1A09 A;  2LQN A;  2MBX A;  1AYB A;  2KAX A;  2Y4Q A;  2BKH B;  4GPL B;  1IGV A;  5KU1 A;  3DVK A;  1K90 D;  2MQI A;  2OS8 C;  1LKK A;  3VS0 A;  5DKN A;  1UWO A;  3SIB A;  2LVK A;  1DT7 B;  2NZ0 A;  1CWE A;  4UPG A;  2H61 A;  3F45 A;  1LUI A;  4YBH B;  3GXX A;  4NDC A;  2NCO A;  4DS7 A;  4E93 A;  1J55 A;  2LP3 A;  1JUO A;  1O48 A;  1CDL A;  3AAJ A;  3PSJ A;  1GQM A;  2G9B A;  3FWB A;  2LV7 A;  1NZL A;  4FTG A;  2BE4 A;  5EG3 B;  1Y1U A;  2F8P A;  1AP4 A;  3VS1 A;  1AUI B;  3AAK A;  1WLZ A;  1BKL A;  3VS3 A;  1O41 A;  2GGM A;  2EGD A;  2KNE A;  2EL8 A;  2F2P A;  1KQM C;  1BHH A;  1NYA A;  4MLW A;  2VIF A;  4WWQ A;  3VS7 A;  1WY9 A;  2M97 A;  1KSO A;  1CMF A;  2PRU A;  1REC A;  1EG3 A;  4QJ4 B;  2GSB A;  5CSN A;  1MQ1 A;  1O4M A;  2PTK A;  1J7O A;  4EY0 A;  4OVN F;  1K93 D;  2SRC A;  1FI6 A;  2JNF A;  1Y1A A;  4TNC A;  3K21 A;  4A4C A;  4ORC B;  2DX0 A;  1QVI Z;  1G8I A;  3JVT C;  4HSZ A;  4HRH A;  4BTF A;  2CR4 A;  3VRZ A;  3AKA A;  2HQW A;  3BYA A;  1SPR A;  1YUS A;  4CFR A;  4AOM A;  3PN7 B;  3SG4 A;  2JYQ A;  1RQQ C;  1F8H A;  4K11 A;  2L4H A;  1O4B A;  1B7T Y;  1S1E A;  4OHH A;  1AB2 A;  2AMI A;  2KFF A;  1IJR A;  2HCK A;  1NX1 A;  3NSK A;  4DCK A;  3VS6 A;  1U5I B;  3NHN A;  1CSY A;  3IF7 A;  2LMU A;  1O4F A;  3DF0 B;  1KA7 A;  2F2O A;  2JUL A;  1RJA A;  2OTG B;  3M7F A;  5DC4 A;  1CDP A;  2EHB A;  3PAT A;  1QV1 A;  1WDC B;  4MSP A;  5CSF A;  1O4O A;  1FU6 A;  4P9V A;  5DC0 B;  1QLS A;  4DGX A;  1B4C A;  5BO4 A;  4YRU A;  1P13 A;  1NUB A;  1OO4 A;  2RVF A;  4WRI A;  4JEG A;  1XFX O;  2LHL A;  1WQU A;  2IUG A;  1YVH A;  3O6B A;  2HF5 A;  4NDB A;  5KAZ A;  1L7Z A;  5ER4 X;  1FHS A;  1K8U A;  1O4G A;  2Y3A B;  3CTN A;  1PUL A;  1HCT B;  4PHK A;  1SCM B;  1SY9 A;  1KSW A;  1S6J A;  1EH2 A;  1UHN A;  5BPJ A;  2K7D A;  5ER5 A;  3NSO A;  3BUW B;  1F2F A;  1O4I A;  1K9U A;  3I5I C;  1CFD A;  2LNK A;  4GFT A;  4CFQ A;  4M2Q A;  5B8I B;  1FYR A;  5I8N A;  1LKL A;  2ZFD A;  1CTR A;  2A4J A;  3HIZ B;  2JQ6 A;  1A1B A;  2BCA A;  1JWD A;  2GE9 A;  3S9K A;  1XA5 A;  3VS2 A;  1M31 A;  2CTN A;  2JOJ A;  2NCP A;  2WC8 A;  2Y1N A;  1LUK A;  2HQ8 A;  1S3P A;  1KFX S;  2KDH A;  2KI4 B;  3RLZ A;  2JXL A;  1XFW O;  1UUR A;  2K79 B;  1GGZ A;  2KAY A;  5EHP A;  3FS7 A;  3C1V A;  3N8M A;  1BR4 B;  2WCE A;  1DJI A;  3WXA A;  5IBS A;  5HKY A;  2CNP A;  1L2O B;  1N65 A;  2RGI A;  1CDM A;  2L4I A;  1J7P A;  1NX3 A;  4N5X A;  5HLO A;  3SG7 A;  1DJH A;  1M61 A;  5DF6 A;  1PVA A;  1TCO B;  3GOF A;  1XA6 A;  1NX2 A;  2ZN8 A;  3WNX B;  2FO0 A;  3OV1 A;  4OR9 B;  4F5B A;  1DF0 A;  4PDZ A;  1L2O C;  2KBM A;  3TUY B;  1O4A A;  2YU7 A;  3DD4 A;  1B1G A;  1YX8 A;  1NIW A;  1IWQ A;  4YGE B;  3LK1 A;  3SG5 A;  2LVV A;  1OMD A;  4E68 A;  4P9Z A;  1CSZ A;  2DOQ A;  1NRV A;  5GQQ C;  4OHE A;  2GGZ A;  3EVV A;  4OCI A;  1RPY A;  3C7I A;  3IN7 A;  3I5F B;  3SG3 A;  2LM5 A;  1O45 A;  2PNB A;  1DJG A;  1MHO A;  1LUN A;  2FCI A;  1HT9 A;  1EJ3 A;  2I7A A;  1JYU A;  1A75 B;  1K9K A;  3D0Y B;  4ORB B;  3N7Y A;  3US4 A;  3S8L A;  5D69 A;  1OOJ A;  4XZ0 A;  1AK8 A;  5GJH A;  1Y0V H;  4LUE A;  1KK8 B;  2WCB A;  2JZI A;  3CLN A;  3CWG A;  3VS4 A;  1LUM A;  2M7L A;  2KGR A;  2ZN9 A;  4PE7 A;  1BM2 A;  1KA6 A;  2LCT A;  3PJP A;  3JTD B;  3HCM A;  4A4B A;  4I5N B;  2BKI B;  2LMV A;  5J3X A;  3IQQ A;  3ZNI A;  1IQ5 A;  1F55 A;  1BT6 A;  1FBV A;  5CPV A;  1QG1 E;  2MRJ A;  1SL7 A;  1ZOT B;  4YI9 A;  3OVE A;  4U1P A;  4D8K A;  1NWD A;  4R1E A;  1MXE A;  1H4B A;  1KFU S;  1SBJ A;  1YUT A;  2COL B;  1NCY A;  1PSR A;  3KPX A;  4L1B B;  3QWX X;  1E8A A;  1IS0 A;  1KWO C;  1R1S A;  2ZRS A;  2WND A;  2Y1M A;  1WRK A;  3KO0 A;  2H5K A;  1NSH A;  4DUQ A;  3IMJ A;  1AJ5 A;  1FI5 A;  1OO3 A;  4ZCU A;  2MAZ A;  2XP1 A;  2PMY A;  3I5H C;  5KSZ A;  3TKZ A;  1O4Q A;  5HKW A;  1J7Q A;  2IZV A;  3IMD A;  2LLS A;  1YX7 A;  1QX5 B;  1FBZ A;  3FWC A;  1TNP A;  2BBN A;  1D4W A;  4YI8 A;  1G83 A;  1SRA A;  3K2M A;  5CDW A;  2CIA A;  4FL2 A;  2EC6 C;  4CPV A;  3I5I B;  1S36 A;  4MRX A;  1JBA A;  1UP5 A;  4M2O A;  4YGC B;  4N1G A;  5KTY A;  4ZCV A;  1A1A A;  3HHM B;  3KFJ A;  4NWF A;  1GJY A;  1M39 A;  2KOT A;  1SHB A;  3IN8 A;  1F70 A;  4XZ1 A;  1JF0 A;  4WQ2 A;  2Y5I A;  1IQ3 A;  2FCE A;  5I2O A;  1KFU L;  3AKB A;  1CLB A;  1FU5 A;  3PS5 A;  2K8M B;  3IQO A;  2CS0 A;  2ZRT A;  3BOW B;  2LUX A;  4PE1 A;  4FBN A;  1H9O A;  1YUU A;  2MRD A;  4GWF A;  2MJW B;  4LUD A;  2M7N A;  1CMG A;  1OSA A;  3BQ3 A;  1CLM A;  3BUX B;  5AAN A;  3BXK A;  3TDZ A;  4PHN A;  1IH0 A;  2L6K A;  1W7I B;  2PAL A;  3A4U B;  3MXY A;  2NXQ A;  3UYO A;  1AOT F;  1M45 A;  3GQI B;  1A03 A;  1ZUZ A;  1A08 A;  1C7W A;  5IBW A;  1CFP A;  2H46 E;  2EYV A;  1BHH B;  4C0J A;  2IUH A;  2B1U A;  2KFH A;  3I5G C;  4AQJ A;  4M2P A;  1KK8 C;  1X6C A;  2V53 A;  4BY5 A;  5HYD A;  2VRG A;  1O4R A;  4HRE E;  3BKB A;  1TTX A;  4GL9 E;  1BJF A;  2DVJ A;  3GK4 X;  1ZAC A;  1MR8 A;  1Z3K A;  2K2A A;  1O46 A;  1OPK A;  1KK7 Y;  1DVI A;  1K9P A;  1EG4 A;  1MF8 B;  5IBM A;  1H8B A;  1CM4 A;  1M27 A;  1O4N A;  1O4K A;  1MXL C;  1PIC A;  4I5K A;  1JFJ A;  4TZI A;  3EAC A;  1KWO B;  1XK4 C;  2H61 C;  2KQ6 A;  2ZKM X;  2LLU A;  3ICB A;  2QMS A;  5I2Q A;  1D1O A;  1F4O A;  1SCV A;  1O4D A;  1Y57 A;  2IS9 A;  2ROR A;  2M1U A;  1JFK A;  2MLF C;  4BY4 A;  1ALW A;  1BU3 A;  2ECD A;  3E3R A;  3QWY A;  2LE9 B;  3EVR A;  2M9G A;  1GHU A;  1RJV A;  2AAO A;  1CB1 A;  4OKH A;  2DLY A;  1DGV A;  1N2D A;  3TDU A;  3ZWH A;  4D1E A;  2EO6 A;  1TZE E;  1KFX L;  2JU0 A;  1S6C A;  2LVJ A;  1SCM C;  2ISD A;  1PAL A;  1M46 A;  3CR5 X;  1ALV A;  1AJ4 A;  3PM8 A;  3BUM B;  3VRN A;  3OHM B;  5DKR A;  1X0N A;  1WDC C;  3DVE A;  5GJI A;  1NZV A;  1M63 B;  4MZK A;  3GK2 A;  4F0Z B;  1BF5 A;  5EEL A;  4MVF A;  4K2R A;  1G33 A;  2E6W A;  1JYR A;  2JPT A;  2HMH A;  4OHD A;  1JC2 A;  2WOS A;  3PFV A;  1DF0 B;  1SKT A;  2EO3 A;  1BLJ A;  4U17 A;  1O47 A;  1LA0 A;  2KI4 C;  1O4E A;  2PSR A;  4FQO A;  1PRW A;  4XYN A;  1BFI A;  2CRH A;  3A8R A;  2JTT A;  3H4S E;  4HRG A;  4MBE A;  2D8N A;  1WRZ A;  5CSI A;  1BHF A;  1Y1X A;  1OZS A;  2JT3 A;  2QAC A;  5I2L A;  1K9A A;  2M1K B;  2L2E A;  1CKK A;  4CID A;  1CFC A;  1O44 A;  1F54 A;  1K2H A;  4QSY A;  1DJZ A;  1EXR A;  4P2Y B;  4DGP A;  1TIZ A;  3VRP A;  2MRK A;  3MAZ A;  4YGA A;  1J7R A;  1SHD A;  3VGO A;  1S26 D;  1KQV A;  2DM0 A;  2C9W A;  2HUW A;  1YVL A;  2JT0 A;  2OTG C;  1CJ1 A;  2ABL A;  4C0K A;  1DMO A;  3WHT B;  2E30 A;  2I18 A;  4XJK B;  2L5X B;  1IG5 A;  1JSA A;  1AYC A;  1X27 A;  3DVM A;  1VRK A;  2PVB A;  4JE4 A;  1AOU F;  1BOD A;  4L9M A;  3CD3 A;  2YSX A;  2BL0 B;  3CS1 A;  3LCP C;  3JTD C;  3VRO A;  1A1C A;  1OQP A;  1JYQ A;  3PSK A;  1AYA A;  2LVI A;  1TNX A;  1RTP 1;  3VS5 A;  3MSE B;  4GBA A;  4M4Z A;  3CR2 A;  1CWD L;  2LUC A;  1XFV O;  1PVB A;  1BKM A;  1BLK A;  2I2R E;  2JT8 A;  2KAV A;  5CSJ A;  1KQM B;  2M29 A;  1DJX A;  4DIR A;  5F6T A; 
#chains in the Genus database with same CATH topology
 1AHR A;  4GGF A;  3OP0 A;  4I5L B;  2ETZ A;  3FF3 A;  1SPS A;  5HKZ A;  1A1E A;  3QME A;  1NCZ A;  1QTX A;  2G2B A;  1Q80 A;  3S8N A;  2QEO A;  1SR6 B;  3SJF A;  3OX5 A;  3B87 A;  3NSL A;  2L98 A;  1GRI A;  2WCL A;  2AUG A;  3NHT A;  2M49 B;  4MZJ A;  1O4P A;  1C7V A;  1B7T Z;  1SL9 A;  5DKQ A;  3CR4 X;  2C0T A;  2FJU B;  2FOT A;  4INX A;  3PM2 A;  3CZ1 A;  4MEW A;  3TDI A;  2SAS A;  5G08 A;  1SHA A;  3NSI A;  2CT9 A;  3HPG G;  1S5G Y;  1KK7 Z;  4ETO A;  1BG1 A;  4FL3 A;  5PAL A;  1SYM A;  3TL0 A;  3KF9 A;  3LLE A;  3EVU A;  1TN4 A;  3HCK A;  2WOR A;  1RFJ A;  5FI6 A;  2K7B A;  1UHH A;  2KHN A;  1ZMZ A;  2M8U A;  1XVJ A;  4CLN A;  3UF4 A;  2JWW A;  1SK6 D;  3LL8 B;  2BBM A;  3D10 A;  3VRY A;  1F4Q A;  4PE0 A;  3RBU A;  3DF0 A;  3B88 A;  1S5G Z;  1BR1 B;  2BAP A;  5D0J A;  3S0A A;  5JOL A;  3D7D A;  2KNO A;  2LCP A;  1I3Z A;  1OW4 A;  2P6B B;  1DE4 C;  1UHJ A;  3GXW A;  5BY0 A;  4YGB B;  5TNC A;  1WLM A;  2PLE A;  2BE6 A;  2K0J A;  2PAS A;  2EKX A;  3JVT B;  1O43 A;  3PLF B;  1KCY A;  2L3T A;  1A75 A;  3TUY C;  1SR6 C;  1SKJ A;  4NWG A;  2SHP A;  3D74 A;  3EK8 A;  2LLT A;  3KHE A;  1CNP A;  2HDX A;  1QX2 A;  1B8C A;  1LIN A;  3R72 A;  4MRY A;  1DEK A;  3SJE A;  1YRT B;  1LXF C;  4IJ7 A;  2JC2 A;  5AFP A;  2HPS A;  3PSR A;  2XEI A;  2MBX A;  2WCJ A;  2Y4Q A;  2BKH B;  5KU1 A;  1IGV A;  2OS8 C;  1LKK A;  3VS0 A;  1UWO A;  3SIB A;  1CWE A;  2NZ0 A;  3F45 A;  4YBH B;  4DS7 A;  4E93 A;  1O48 A;  3AAJ A;  4P44 A;  4FTG A;  1WLZ A;  2VIF A;  4WWQ A;  4MLW A;  1KSO A;  3DYE A;  1MQ1 A;  3S0B A;  2PTK A;  4OVN F;  2DX0 A;  4F7F A;  5BO4 A;  1QVI Z;  4BTF A;  3S9N A;  1O4B A;  3BFA A;  2HCK A;  3D78 A;  1CSY A;  1O4F A;  3M7F A;  2FJY A;  5DC4 A;  1CDP A;  1WDC B;  4MSP A;  5DC0 B;  4P9V A;  1OO4 A;  1XFX O;  2LHL A;  1YVH A;  1L7Z A;  1FHS A;  1O4G A;  2Y3A B;  1OOH A;  1KSW A;  2K7D A;  3BUW B;  1O4I A;  1CFD A;  2LNK A;  1FYR A;  4CFQ A;  4M2Q A;  5B8I B;  3SS4 A;  3HIZ B;  1JWD A;  1M31 A;  2JOJ A;  2HQ8 A;  1KFX S;  1T14 A;  1XFW O;  1UUR A;  2KAY A;  3SJG A;  3WXA A;  5IBS A;  1N65 A;  1LUN A;  1CDM A;  1C3Z A;  4N5X A;  1NX2 A;  2FO0 A;  3TUY B;  3DD4 A;  4YGE B;  3LK1 A;  2KPH A;  2P70 A;  5GQQ C;  4OHE A;  3HMJ G;  2LM5 A;  2FCI A;  1HT9 A;  3US4 A;  1ORG A;  3N7Y A;  1Z9E A;  3S8L A;  5GJH A;  4LUE A;  3RZS A;  3VS4 A;  1LUM A;  3PJP A;  1BM2 A;  4I5N B;  4U1P A;  1MXE A;  1SBJ A;  2PVV A;  1NCY A;  2L5Y A;  1R1S A;  2ZRS A;  3O8Z A;  1FI5 A;  1OO3 A;  4ZCU A;  2XPL A;  5HKW A;  1J7Q A;  2IZV A;  3IMD A;  2LLS A;  1YX7 A;  3CZ2 A;  3FWC A;  3K2M A;  1A1A A;  5KTY A;  3KFJ A;  1M39 A;  2KOT A;  1SHB A;  3F9K C;  4XZ1 A;  2K60 A;  2FCE A;  3PS5 A;  1KFU L;  1CLB A;  3BXM A;  2CS0 A;  2ZRT A;  1C3Y A;  4FBN A;  1H9O A;  1YUU A;  5I94 A;  2MRD A;  4GWF A;  3TDZ A;  4PHN A;  1W7I B;  2PAL A;  1C7W A;  5IBW A;  1BHH B;  2KFH A;  3I5G C;  4M2P A;  1X6C A;  3EG5 B;  5HYD A;  4HRE E;  4GL9 E;  2DVJ A;  3CAB A;  1ZAC A;  1MR8 A;  2K2A A;  1KK7 Y;  1K9P A;  1EG4 A;  1MF8 B;  3ICB A;  1XK4 C;  2KQ6 A;  4NGT A;  1SCV A;  2IS9 A;  3QWY A;  4BY4 A;  1ALW A;  1BU3 A;  3U88 C;  2LE9 B;  2WC6 A;  3N7H A;  1CB1 A;  2DLY A;  3ZWH A;  4D1E A;  1SCM C;  3BUM B;  3VRN A;  1X0N A;  1NZV A;  1M63 B;  4MZK A;  4F0Z B;  1BF5 A;  4NGP A;  4MVF A;  1JC2 A;  1DF0 B;  1BFI A;  2CRH A;  3A8R A;  3H4S E;  2D8N A;  1OZS A;  4CID A;  1CFC A;  1O44 A;  1K2H A;  2MRK A;  3MAZ A;  1J7R A;  1KQV A;  2OTG C;  1CJ1 A;  2I18 A;  1JSA A;  1IG5 A;  3DVM A;  1AOU F;  4JE4 A;  4L9M A;  1JYQ A;  2QEV A;  2LVI A;  3VS5 A;  4GBA A;  3D76 A;  2LUC A;  1BKM A;  1DJX A;  1LS8 A;  5F6T A;  2LHI A;  2GTE A;  2OPO A;  2WCF A;  3CZT X;  1O4J A;  2O5G A;  3R1P A;  2H2K A;  3BOW A;  2F33 A;  1SPY A;  2NLN A;  1QXP A;  3KEV A;  4MCP A;  4ICB A;  3PAL A;  4JPZ B;  2ZND A;  1LKJ A;  3O2P A;  3WHU B;  2DLZ A;  2EC6 B;  2WC5 A;  3EAZ A;  4Q04 A;  2OOT A;  3FEC A;  1B8R A;  2DCR A;  5EEQ A;  2K7C A;  2KBI A;  3S0D A;  1TRF A;  3M0W A;  5AUL A;  2M3W A;  1LCK A;  4H1O A;  1DJW A;  2CBL A;  1QIV A;  1SL8 A;  3EKJ A;  1DJY A;  2F3Z A;  4W9Y A;  1B9A A;  1C07 A;  3BHX A;  3OBV A;  2CIJ A;  1XFR A;  2LQW A;  2HDV A;  2LAP A;  2LC5 A;  1PK0 D;  3CGA A;  2UV8 G;  1RRO A;  2JNX A;  3R1V A;  1QAD A;  3TS5 B;  3GK1 A;  3CDN A;  3S9M A;  4USL A;  1K95 A;  1TOP A;  4PCW A;  1SW8 A;  2I94 A;  1TNQ A;  1UHI A;  2EYZ A;  4MCQ A;  1D1Z A;  2KK6 A;  4AQI A;  2KI6 D;  4P5O E;  4EIH A;  1LVC D;  1A29 A;  1RWY A;  1NCX A;  2PNA A;  2B3O A;  2PVW A;  1NPQ A;  3SIA A;  4PAL A;  3I5F C;  5AXI A;  3S0F A;  3SJS A;  2L4K A;  2IUI A;  1K96 A;  2MHH A;  1XFU O;  3TZ1 A;  1W7J B;  1FPW A;  4OHL A;  1QWV A;  2LMT A;  4GGN A;  4IL1 A;  1G4Y R;  2BL0 C;  2RMX A;  4JWQ A;  3VRQ A;  3I5H B;  2L50 A;  1WRL A;  1JF2 A;  1BFJ A;  5HLV A;  3D0Y A;  3RM1 A;  1BMB A;  4X6S A;  1EL4 A;  2L0P A;  1B47 A;  1SNL A;  2OS8 B;  1LA3 A;  1A09 A;  4GPL B;  3DXL A;  1K90 D;  2MQI A;  5DKN A;  1DT7 B;  3GXX A;  4UPG A;  4NDC A;  2NCO A;  1J55 A;  2C6G A;  1JUO A;  2G9B A;  1NZL A;  2BE4 A;  1AP4 A;  2EL8 A;  2KNE A;  3HPH E;  4P4D A;  1BHH A;  3VS7 A;  2GSB A;  1O4M A;  2SRC A;  1FI6 A;  1Y1A A;  4A4C A;  4HSZ A;  4HRH A;  2CR4 A;  3AKA A;  3UNW A;  4AOM A;  3SG4 A;  1TUJ A;  2JBJ A;  1RQQ C;  4K11 A;  2AMI A;  2XEJ A;  4DCK A;  2LMU A;  1KA7 A;  2F2O A;  2JUL A;  3PAT A;  1FU6 A;  4WRI A;  4JEG A;  1WQU A;  3O6B A;  5ER4 X;  5F13 A;  3CTN A;  1PUL A;  1HCT B;  1UHN A;  4P45 A;  4P4E A;  1K9U A;  4X3R A;  4GFT A;  1LKL A;  3SJX A;  2ZFD A;  2JQ6 A;  2BCA A;  3S9K A;  1XA5 A;  2NCP A;  2WC8 A;  4OC2 A;  3RLZ A;  1GGZ A;  3N8M A;  1BR4 B;  5FI7 A;  1L2O B;  2RGI A;  5HLO A;  3SG7 A;  1PVA A;  1XA6 A;  3OV1 A;  1DF0 A;  4PDZ A;  3BI1 A;  1YX8 A;  1NIW A;  4E68 A;  4P9Z A;  2GGZ A;  3EVV A;  3IN7 A;  3NGV A;  2PNB A;  2I7A A;  2WCB A;  2JZI A;  3BFB A;  3CWG A;  2M7L A;  2KGR A;  2ZN9 A;  4PE7 A;  2BKI B;  2LMV A;  5J3X A;  1BT6 A;  1ZOT B;  4YI9 A;  4D8K A;  4L1B B;  1KFU S;  2WND A;  2Y1M A;  2H5K A;  4DUQ A;  5KSZ A;  4BPU B;  1QX5 B;  1FBZ A;  1TNP A;  4YI8 A;  1SRA A;  2CIA A;  4FL2 A;  4CPV A;  3L4A A;  1UP5 A;  4M2O A;  4YGC B;  4N1G A;  3HHM B;  4NWF A;  1F70 A;  5I2O A;  3AKB A;  4MCR A;  3BOW B;  2LUX A;  2ERB A;  3S0E A;  2MJW B;  3FE9 A;  2N3A B;  2L6K A;  3MXY A;  1AOT F;  1M45 A;  1ZUZ A;  2H46 E;  2EYV A;  4C0J A;  1O4R A;  1TTX A;  5IBM A;  1PIC A;  2KGY A;  4I5K A;  1KWO B;  2H61 C;  2ZKM X;  2QMS A;  1D1O A;  1O4D A;  2ROR A;  1JFK A;  2MLF C;  3EVR A;  2M9G A;  3V2L A;  1GHU A;  1RJV A;  1DGV A;  2PQL A;  3TDU A;  5DIC A;  1TZE E;  1KFX L;  2JU0 A;  1P28 A;  2ISD A;  3BFH A;  1M46 A;  3CR5 X;  3NHI A;  1ALV A;  1AJ4 A;  3PM8 A;  1WDC C;  2EO3 A;  1BLJ A;  1O47 A;  4OC0 A;  1O4E A;  2DLA A;  3T04 A;  4MBE A;  1K9A A;  4DGP A;  4NGQ A;  4YGA A;  5EL2 A;  3VGO A;  2DM0 A;  1VRK A;  3VRO A;  1OQP A;  1TNX A;  3MSE B;  3CR2 A;  1XFV O;  1PVB A;  1BLK A;  2I2R E;  2KAV A;  1KQM B;  4NGN A;  1HCS B;  1J1E A;  1R6P A;  2XEF A;  5ELY A;  1QCF A;  1A4P A;  1BOC A;  4PE4 A;  1R2U A;  1XFZ O;  2KFG A;  1YR5 A;  2K7A B;  4K44 A;  5F09 A;  2Q4U A;  3QRX A;  1U5I A;  1OMV A;  2GV5 A;  4GUK A;  2C0O A;  2JXC A;  1B8L A;  3PJI A;  2MLE C;  4P4J A;  3LYV A;  1IJ6 A;  2LNW A;  2RSY A;  2AOA A;  1X02 A;  2B4J C;  4QJ5 B;  3EK7 A;  4N1F A;  2OZO A;  1XK4 A;  1V1F A;  2EU0 A;  2C6P A;  2KQY A;  3K1E A;  4U8D A;  5HL1 A;  1YRU B;  1QJT A;  1QAS A;  3I5G B;  2C0I A;  2CI8 A;  4GAO A;  2LP2 A;  2F3Y A;  1DQE A;  3CBL A;  2M0R A;  2BBU A;  3PN7 C;  4F59 A;  3OAK A;  2JBK A;  1MIL A;  1MWN A;  3PQZ A;  1FMK A;  4P4F A;  2BEC A;  1OMR A;  1YUR A;  3O78 A;  5DC9 A;  1NX0 A;  1QV0 A;  1O4L A;  2QPT A;  3EKH A;  1O4H A;  4I5J A;  1ZFS A;  2PLD A;  1DTL A;  2XPO A;  1IIO A;  1J1D A;  3OX6 A;  1AD5 A;  1F71 A;  4H34 A;  3CXL A;  2Q91 A;  1QS7 A;  4C0L A;  1GGW A;  3BUO B;  4PT1 A;  1IJ5 A;  3S0G A;  1K94 A;  1O42 A;  1JU5 A;  1QX7 A;  3NXA A;  1ODB A;  2EYY A;  3FIA A;  4F5A A;  2KYF A;  1A81 A;  4YGD B;  5JJG A;  1O49 A;  5EHR A;  4JKT A;  4QJ3 B;  1PSB A;  1DGU A;  2QEB A;  3EK4 A;  2KGB C;  1IKU A;  1HQV A;  4OHI A;  3O4X A;  1KC2 A;  4ROJ A;  1R1P A;  1OE9 B;  3BUN B;  1KSM A;  3S8O A;  4JQ0 D;  2MA2 A;  3BJH A;  1XYD A;  2ZNE A;  1JWO A;  1Z4H A;  4PHJ A;  2KAX A;  1LUI A;  1GQM A;  1DEL A;  2LV7 A;  1Y1U A;  3VS1 A;  3IVT A;  1BKL A;  2C6C A;  1O41 A;  4LQG A;  2WCM A;  1WY9 A;  2M97 A;  4QJ4 B;  3Q8I A;  3DZT A;  5CSN A;  3FE8 A;  5D29 A;  1K93 D;  4OC4 A;  2XP1 A;  1G8I A;  3L47 A;  2HQW A;  1SPR A;  1YUS A;  3BI0 A;  4NGS A;  1B7T Y;  1AB2 A;  2KFF A;  3FED A;  1IJR A;  1U5I B;  3NHN A;  1RJA A;  5CSF A;  1O4O A;  1QLS A;  1P13 A;  1NUB A;  2RVF A;  2IUG A;  2HF5 A;  1K8U A;  1EH2 A;  2BNX A;  5ER5 A;  3NSO A;  3I5I C;  5I8N A;  1CTR A;  2A4J A;  3VS2 A;  2CTN A;  3B7A A;  2QDI A;  1S3P A;  2KDH A;  2KI4 B;  3FS7 A;  2WCE A;  5HKY A;  4P4B A;  1J7P A;  2L4I A;  1NX3 A;  1DJH A;  1M61 A;  3GOF A;  2YU7 A;  2KBM A;  1O4A A;  1B1G A;  4NGM A;  1IWQ A;  2LVV A;  4JD9 A;  1CSZ A;  2XPN A;  3C7I A;  3I5F B;  1O45 A;  1DJG A;  1MHO A;  1EJ3 A;  1A75 B;  1K9K A;  3D0Y B;  4ORB B;  5D69 A;  1OOJ A;  1AK8 A;  1Y0V H;  1KA6 A;  4A4B A;  1F55 A;  5CPV A;  1QG1 E;  3S9L A;  4R1E A;  1H4B A;  3KPX A;  2OR4 A;  1E8A A;  1IS0 A;  3KO0 A;  3IMJ A;  3FE6 A;  2MAZ A;  3I5H C;  3TKZ A;  1O4Q A;  2VKZ G;  1D4W A;  1G83 A;  3I5I B;  4ZCV A;  3IN8 A;  1W9Z A;  1JF0 A;  2Y5I A;  1FU5 A;  3IQO A;  3D73 A;  4PE1 A;  1CMG A;  1IH0 A;  3BQ3 A;  1CLM A;  3BUX B;  3A4U B;  2NXQ A;  3UYO A;  3GQI B;  1A08 A;  1CFP A;  2B1U A;  4AQJ A;  1KK8 C;  2V53 A;  3D75 A;  1BJF A;  1O46 A;  1OPK A;  2LRA A;  1O4N A;  1MXL C;  1JFJ A;  4TZI A;  3VS3 A;  1F4O A;  2M1U A;  4MCS A;  2AAO A;  4OKH A;  1N2D A;  2EO6 A;  5DKR A;  3UO9 A;  5GJI A;  3GK2 A;  5EEL A;  2E6W A;  4OHD A;  1JYR A;  2JPT A;  2HMH A;  2WOS A;  3PFV A;  1SKT A;  2QEH A;  3D7G A;  4FQO A;  1PRW A;  4XYN A;  4HRG A;  5CSI A;  1WRZ A;  1BHF A;  2M1K B;  1CKK A;  1F54 A;  1DJZ A;  4P2Y B;  1SHD A;  1S26 D;  1YVL A;  2JT0 A;  1DMO A;  2E30 A;  4XJK B;  1X27 A;  2PVB A;  3CD3 A;  1TUZ A;  2YSX A;  4NGR A;  3LCP C;  3PSK A;  4BPW B;  1AYA A;  1RTP 1;  4M4Z A;  5CSJ A;  2M29 A;  3OGN A;  3D77 A;  1EO0 A;  1XO5 A;  3O4Y A;  1Y6W A;  1LCJ A;  2BCB A;  1D4T A;  2EOB A;  1RK9 A;  2SCP A;  1MUX A;  2MK2 A;  2YGU A;  2LAN A;  2O60 A;  1OOF A;  1R1Q A;  5I6V A;  2KSP A;  1YTZ C;  4GNK B;  5FYX A;  1TCF A;  1BLQ A;  2L51 A;  1CLL A;  2AUC A;  2CXJ A;  1F1W A;  4DRW A;  2XPP A;  1CDN A;  2BCX A;  3WA4 A;  4PHM A;  3LK0 A;  1SSE B;  1UHK A;  1IRJ A;  2MC1 A;  1O4C A;  1QAT A;  4RR2 B;  1UUS A;  1A07 A;  4NQG A;  4JGH A;  3HX4 A;  4JZ0 A;  1TNW A;  3SG2 A;  2K2F A;  1ZFP E;  1FF1 A;  4OZD A;  5D7F A;  4K45 A;  2KLE A;  2XEG A;  1BMO A;  2R2I A;  1CFF A;  2K7O A;  3NFQ A;  4INW A;  5AER A;  4MZL A;  3VRR A;  1OZO A;  1QIW A;  1XFY O;  4OV2 A;  2JTZ A;  3OB1 B;  2AOB A;  1N0Y A;  3N84 A;  3B86 A;  2HET A;  1QLK A;  3R1O A;  2FCD A;  1OPL A;  5D3O A;  2KI6 C;  1A2X A;  4MN0 A;  4GGF C;  1QVI Y;  1SMG A;  1AYD A;  4NDD A;  2PYQ A;  1Z2C B;  2CCM A;  4XJK A;  2LNX A;  4OC1 A;  1MW4 A;  1AVS A;  1CM1 A;  1S6I A;  4WQ3 A;  3DVJ A;  2CI9 A;  2TN4 A;  3OB2 B;  3TS5 C;  2KYC A;  4OC5 A;  5K89 A;  5AEQ A;  1FW4 A;  2K61 A;  3SG6 A;  2H8H A;  1NP8 A;  3MXC A;  1TCE A;  1V1G A;  2OQ1 A;  4ORA B;  2JRF A;  3VB1 A;  2LQN A;  1Z8L A;  1AYB A;  3DVK A;  2LVK A;  3FEE A;  2H61 A;  2LP3 A;  4KYN A;  1CDL A;  4FQT A;  3PSJ A;  3FWB A;  4BPX B;  5EG3 B;  2F8P A;  3SS3 A;  1AUI B;  3AAK A;  2L2C A;  2GGM A;  2EGD A;  1KQM C;  2F2P A;  1NYA A;  1CMF A;  3SS5 A;  2PRU A;  1REC A;  1EG3 A;  1J7O A;  4EY0 A;  2JNF A;  4TNC A;  3K21 A;  4ORC B;  3VRZ A;  3JVT C;  3BYA A;  3CZ0 A;  4CFR A;  3PN7 B;  2JYQ A;  1F8H A;  2L4H A;  1OOI X;  4P4I A;  3PT1 A;  1S1E A;  4OHH A;  1NX1 A;  3NSK A;  3VS6 A;  3IF7 A;  3DF0 B;  2OTG B;  2EHB A;  1QV1 A;  4DGX A;  1B4C A;  4YRU A;  3CYZ A;  4NDB A;  5KAZ A;  1OOG A;  4PHK A;  1SCM B;  1SY9 A;  4OME A;  1S6J A;  5BPJ A;  1F2F A;  2GE9 A;  1A1B A;  2Y1N A;  1LUK A;  2JXL A;  2K79 B;  5EHP A;  3C1V A;  1DJI A;  2CNP A;  5DF6 A;  1TCO B;  2ZN8 A;  3WNX B;  4F5B A;  4OR9 B;  1L2O C;  3SG5 A;  2JPO A;  1OMD A;  2WCH A;  2DOQ A;  1NRV A;  1DC1 A;  4OCI A;  1RPY A;  3SG3 A;  1JYU A;  4XZ0 A;  1KK8 B;  3CLN A;  1TWO A;  2LCT A;  3JTD B;  3HCM A;  2MRJ A;  3IQQ A;  3ZNI A;  1IQ5 A;  1FBV A;  3OVE A;  3IWW A;  1SL7 A;  1NWD A;  1YUT A;  2COL B;  1PSR A;  3KAS A;  3QWX X;  1KWO C;  1WRK A;  1NSH A;  1AJ5 A;  2PMY A;  2BBN A;  5CDW A;  2EC6 C;  1S36 A;  4MRX A;  1JBA A;  1GJY A;  4WQ2 A;  1IQ3 A;  1GM0 A;  2K8M B;  4JYW A;  4OC3 A;  4LUD A;  1CX8 A;  2M7N A;  1OSA A;  5AAN A;  3BXK A;  1A03 A;  3D7F A;  2IUH A;  4BY5 A;  2VRG A;  3BKB A;  3GK4 X;  1Z3K A;  1DVI A;  1H8B A;  1CM4 A;  1M27 A;  1O4K A;  2KLD A;  3EAC A;  2LLU A;  5I2Q A;  1Y57 A;  2ECD A;  3E3R A;  1S6C A;  2LVJ A;  1PAL A;  3OHM B;  3DVE A;  3K2T A;  5FI2 A;  4K2R A;  1G33 A;  1WJT A;  2P71 A;  4U17 A;  1LA0 A;  2KI4 C;  2PSR A;  3L4L A;  2H8V A;  2JTT A;  1Y1X A;  2JT3 A;  2QAC A;  3B6X A;  5I2L A;  2L2E A;  4QSY A;  1EXR A;  1TIZ A;  3VRP A;  2HUW A;  2C9W A;  2ABL A;  4C0K A;  3WHT B;  1AYC A;  2L5X B;  3DY9 A;  1BOD A;  2WCK A;  2BL0 B;  3CS1 A;  1A1C A;  3JTD C;  1CWD L;  3D7H A;  2JT8 A;  4DIR A; 
#chains in the Genus database with same CATH homology
 2LHI A;  1HCS B;  1AHR A;  1J1E A;  2OPO A;  4GGF A;  3OP0 A;  1R6P A;  2WCF A;  3CZT X;  4I5L B;  1QCF A;  1XO5 A;  3O4Y A;  2ETZ A;  1Y6W A;  1SPS A;  1O4J A;  1LCJ A;  2BCB A;  1D4T A;  5HKZ A;  2O5G A;  1A1E A;  1NCZ A;  2H2K A;  1A4P A;  1QTX A;  2F33 A;  1SPY A;  2G2B A;  1Q80 A;  1RK9 A;  3BOW A;  2NLN A;  1QXP A;  1BOC A;  4PE4 A;  2EOB A;  1R2U A;  3S8N A;  1XFZ O;  2KFG A;  1YR5 A;  3KEV A;  2K7A B;  4K44 A;  4ICB A;  1SR6 B;  3PAL A;  2SCP A;  1MUX A;  2MK2 A;  2Q4U A;  4JPZ B;  2ZND A;  1U5I A;  3QRX A;  1LKJ A;  1OMV A;  3OX5 A;  2LAN A;  2O60 A;  3O2P A;  3WHU B;  1R1Q A;  3NSL A;  2DLZ A;  5I6V A;  2GV5 A;  4GUK A;  2KSP A;  1YTZ C;  2L98 A;  2EC6 B;  2JXC A;  4GNK B;  5FYX A;  4Q04 A;  1B8L A;  2C0O A;  3EAZ A;  1TCF A;  2MLE C;  1BLQ A;  1GRI A;  2L51 A;  1CLL A;  2AUG A;  1B8R A;  2AUC A;  2DCR A;  2CXJ A;  1F1W A;  1IJ6 A;  2M49 B;  2LNW A;  4DRW A;  4MZJ A;  1CDN A;  2BCX A;  2RSY A;  5EEQ A;  2K7C A;  2KBI A;  1TRF A;  2AOA A;  1X02 A;  1O4P A;  1C7V A;  1B7T Z;  1SL9 A;  3WA4 A;  3M0W A;  5DKQ A;  4PHM A;  4QJ5 B;  3EK7 A;  5AUL A;  2M3W A;  4N1F A;  3CR4 X;  2C0T A;  2OZO A;  3LK0 A;  2FJU B;  2FOT A;  1XK4 A;  1LCK A;  1V1F A;  1UHK A;  2EU0 A;  2KQY A;  4H1O A;  1IRJ A;  4MEW A;  3TDI A;  2MC1 A;  1DJW A;  4U8D A;  2CBL A;  1O4C A;  2SAS A;  1QAT A;  1YRU B;  1QIV A;  1SL8 A;  1QJT A;  3EKJ A;  1QAS A;  1DJY A;  2F3Z A;  1UUS A;  3I5G B;  5G08 A;  1A07 A;  1B9A A;  4NQG A;  3NSI A;  1SHA A;  2C0I A;  2CI8 A;  4JGH A;  2CT9 A;  4GAO A;  3HX4 A;  1C07 A;  1S5G Y;  2LP2 A;  2F3Y A;  1KK7 Z;  4ETO A;  3CBL A;  1BG1 A;  1TNW A;  2M0R A;  3SG2 A;  2K2F A;  2BBU A;  1ZFP E;  3PN7 C;  4FL3 A;  2LQW A;  4F59 A;  1FF1 A;  5PAL A;  1MIL A;  1SYM A;  5D7F A;  4K45 A;  1O43 A;  2HDV A;  3TL0 A;  2LAP A;  2LC5 A;  1MWN A;  1PK0 D;  3CGA A;  3KF9 A;  1FMK A;  3LLE A;  3PQZ A;  1BMO A;  2BEC A;  1OMR A;  2R2I A;  3EVU A;  1CFF A;  1RRO A;  1TN4 A;  3HCK A;  2WOR A;  2JNX A;  1RFJ A;  1YUR A;  1QAD A;  2K7B A;  3O78 A;  3TS5 B;  3GK1 A;  1UHH A;  5DC9 A;  2KHN A;  1ZMZ A;  2M8U A;  1NX0 A;  2K7O A;  1XVJ A;  1QV0 A;  4CLN A;  1O4L A;  3UF4 A;  2JWW A;  1SK6 D;  2QPT A;  3LL8 B;  3EKH A;  4USL A;  1K95 A;  1O4H A;  2BBM A;  1TOP A;  3D10 A;  5AER A;  4MZL A;  4PCW A;  3VRY A;  1F4Q A;  1ZFS A;  1SW8 A;  2I94 A;  4I5J A;  4PE0 A;  1DTL A;  3VRR A;  2PLD A;  1OZO A;  1QIW A;  1XFY O;  1TNQ A;  4OV2 A;  1J1D A;  1UHI A;  2EYZ A;  3OX6 A;  1AD5 A;  1F71 A;  2JTZ A;  3OB1 B;  2AOB A;  3DF0 A;  1N0Y A;  1D1Z A;  3N84 A;  4H34 A;  2KK6 A;  4AQI A;  2KI6 D;  3CXL A;  2HET A;  4P5O E;  1S5G Z;  2Q91 A;  1LVC D;  1BR1 B;  4EIH A;  1QLK A;  1A29 A;  1RWY A;  1NCX A;  1QS7 A;  2FCD A;  4C0L A;  1OPL A;  2B3O A;  2PNA A;  1NPQ A;  2KI6 C;  1A2X A;  3SIA A;  1GGW A;  5D0J A;  5JOL A;  4MN0 A;  3BUO B;  1QVI Y;  1IJ5 A;  4GGF C;  1SMG A;  1K94 A;  1AYD A;  4PAL A;  4NDD A;  2KNO A;  3I5F C;  5AXI A;  2LCP A;  1I3Z A;  1JU5 A;  2CCM A;  1O42 A;  1QX7 A;  3NXA A;  2P6B B;  3GXW A;  1UHJ A;  4XJK A;  1ODB A;  2LNX A;  2L4K A;  3SJS A;  2IUI A;  1K96 A;  4YGB B;  5TNC A;  1MW4 A;  2MHH A;  2EYY A;  1AVS A;  1XFU O;  1CM1 A;  3FIA A;  1S6I A;  1WLM A;  4F5A A;  2KYF A;  4WQ3 A;  1A81 A;  2PLE A;  3DVJ A;  2BE6 A;  4YGD B;  3TZ1 A;  5JJG A;  1O49 A;  2CI9 A;  2TN4 A;  5EHR A;  1W7J B;  2K0J A;  3OB2 B;  2PAS A;  3TS5 C;  1FPW A;  2KYC A;  2EKX A;  3JVT B;  4OHL A;  4QJ3 B;  1PSB A;  3PLF B;  1DGU A;  2LMT A;  4GGN A;  5AEQ A;  5K89 A;  1A75 A;  1KCY A;  1FW4 A;  3EK4 A;  2L3T A;  3TUY C;  1SR6 C;  2KGB C;  4IL1 A;  1SKJ A;  2SHP A;  4NWG A;  1G4Y R;  2BL0 C;  2RMX A;  1IKU A;  1HQV A;  2K61 A;  3SG6 A;  4OHI A;  3EK8 A;  2H8H A;  4JWQ A;  3VRQ A;  2LLT A;  1NP8 A;  3I5H B;  2L50 A;  3KHE A;  1KC2 A;  4ROJ A;  1CNP A;  2HDX A;  1R1P A;  1QX2 A;  1OE9 B;  1WRL A;  1JF2 A;  3BUN B;  1B8C A;  5HLV A;  1BFJ A;  3D0Y A;  3RM1 A;  1KSM A;  1LIN A;  4MRY A;  3S8O A;  1YRT B;  3MXC A;  1BMB A;  4JQ0 D;  4X6S A;  2MA2 A;  1TCE A;  3T04 A;  1LXF C;  1V1G A;  1EL4 A;  2L0P A;  1B47 A;  1SNL A;  1XYD A;  2ZNE A;  1JWO A;  2OS8 B;  2JC2 A;  5AFP A;  1LA3 A;  2OQ1 A;  2HPS A;  3PSR A;  4ORA B;  2JRF A;  4PHJ A;  1A09 A;  2LQN A;  2MBX A;  1AYB A;  2KAX A;  2Y4Q A;  2BKH B;  4GPL B;  1IGV A;  5KU1 A;  3DVK A;  1K90 D;  2MQI A;  2OS8 C;  1LKK A;  3VS0 A;  5DKN A;  1UWO A;  3SIB A;  2LVK A;  1DT7 B;  2NZ0 A;  1CWE A;  4UPG A;  2H61 A;  3F45 A;  1LUI A;  4YBH B;  3GXX A;  4NDC A;  2NCO A;  4DS7 A;  4E93 A;  1J55 A;  2LP3 A;  1JUO A;  1O48 A;  1CDL A;  3AAJ A;  3PSJ A;  1GQM A;  2G9B A;  3FWB A;  2LV7 A;  1NZL A;  4FTG A;  2BE4 A;  5EG3 B;  1Y1U A;  2F8P A;  1AP4 A;  3VS1 A;  1AUI B;  3AAK A;  1WLZ A;  1BKL A;  3VS3 A;  1O41 A;  2GGM A;  2EGD A;  2KNE A;  2EL8 A;  2F2P A;  1KQM C;  1BHH A;  1NYA A;  4MLW A;  2VIF A;  4WWQ A;  3VS7 A;  1WY9 A;  2M97 A;  1KSO A;  1CMF A;  2PRU A;  1REC A;  1EG3 A;  4QJ4 B;  2GSB A;  5CSN A;  1MQ1 A;  1O4M A;  2PTK A;  1J7O A;  4EY0 A;  4OVN F;  1K93 D;  2SRC A;  1FI6 A;  2JNF A;  1Y1A A;  4TNC A;  3K21 A;  4A4C A;  4ORC B;  2DX0 A;  1QVI Z;  1G8I A;  3JVT C;  4HSZ A;  4HRH A;  4BTF A;  2CR4 A;  3VRZ A;  3AKA A;  2HQW A;  3BYA A;  1SPR A;  1YUS A;  4CFR A;  4AOM A;  3PN7 B;  3SG4 A;  2JYQ A;  1RQQ C;  1F8H A;  4K11 A;  2L4H A;  1O4B A;  1B7T Y;  1S1E A;  4OHH A;  1AB2 A;  2AMI A;  2KFF A;  1IJR A;  2HCK A;  1NX1 A;  3NSK A;  4DCK A;  3VS6 A;  1U5I B;  3NHN A;  1CSY A;  3IF7 A;  2LMU A;  1O4F A;  3DF0 B;  1KA7 A;  2F2O A;  2JUL A;  1RJA A;  2OTG B;  3M7F A;  5DC4 A;  1CDP A;  2EHB A;  3PAT A;  1QV1 A;  1WDC B;  4MSP A;  5CSF A;  1O4O A;  1FU6 A;  4P9V A;  5DC0 B;  1QLS A;  4DGX A;  1B4C A;  5BO4 A;  4YRU A;  1P13 A;  1NUB A;  1OO4 A;  2RVF A;  4WRI A;  4JEG A;  1XFX O;  2LHL A;  1WQU A;  2IUG A;  1YVH A;  3O6B A;  2HF5 A;  4NDB A;  5KAZ A;  1L7Z A;  5ER4 X;  1FHS A;  1K8U A;  1O4G A;  2Y3A B;  3CTN A;  1PUL A;  1HCT B;  4PHK A;  1SCM B;  1SY9 A;  1KSW A;  1S6J A;  1EH2 A;  1UHN A;  5BPJ A;  2K7D A;  5ER5 A;  3NSO A;  3BUW B;  1F2F A;  1O4I A;  1K9U A;  3I5I C;  1CFD A;  2LNK A;  4GFT A;  4CFQ A;  4M2Q A;  5B8I B;  1FYR A;  5I8N A;  1LKL A;  2ZFD A;  1CTR A;  2A4J A;  3HIZ B;  2JQ6 A;  1A1B A;  2BCA A;  1JWD A;  2GE9 A;  3S9K A;  1XA5 A;  3VS2 A;  1M31 A;  2CTN A;  2JOJ A;  2NCP A;  2WC8 A;  2Y1N A;  1LUK A;  2HQ8 A;  1S3P A;  1KFX S;  2KDH A;  2KI4 B;  3RLZ A;  2JXL A;  1XFW O;  1UUR A;  2K79 B;  1GGZ A;  2KAY A;  5EHP A;  3FS7 A;  3C1V A;  3N8M A;  1BR4 B;  2WCE A;  1DJI A;  3WXA A;  5IBS A;  5HKY A;  2CNP A;  1L2O B;  1N65 A;  2RGI A;  1CDM A;  2L4I A;  1J7P A;  1NX3 A;  4N5X A;  5HLO A;  3SG7 A;  1DJH A;  1M61 A;  5DF6 A;  1PVA A;  1TCO B;  3GOF A;  1XA6 A;  1NX2 A;  2ZN8 A;  3WNX B;  2FO0 A;  3OV1 A;  4OR9 B;  4F5B A;  1DF0 A;  4PDZ A;  1L2O C;  2KBM A;  3TUY B;  1O4A A;  2YU7 A;  3DD4 A;  1B1G A;  1YX8 A;  1NIW A;  1IWQ A;  4YGE B;  3LK1 A;  3SG5 A;  2LVV A;  1OMD A;  4E68 A;  4P9Z A;  1CSZ A;  2DOQ A;  1NRV A;  5GQQ C;  4OHE A;  2GGZ A;  3EVV A;  4OCI A;  1RPY A;  3C7I A;  3IN7 A;  3I5F B;  3SG3 A;  2LM5 A;  1O45 A;  2PNB A;  1DJG A;  1MHO A;  1LUN A;  2FCI A;  1HT9 A;  1EJ3 A;  2I7A A;  1JYU A;  1A75 B;  1K9K A;  3D0Y B;  4ORB B;  3N7Y A;  3US4 A;  3S8L A;  5D69 A;  1OOJ A;  4XZ0 A;  1AK8 A;  5GJH A;  1Y0V H;  4LUE A;  1KK8 B;  2WCB A;  2JZI A;  3CLN A;  3CWG A;  3VS4 A;  1LUM A;  2M7L A;  2KGR A;  2ZN9 A;  4PE7 A;  1BM2 A;  1KA6 A;  2LCT A;  3PJP A;  3JTD B;  3HCM A;  4A4B A;  4I5N B;  2BKI B;  2LMV A;  5J3X A;  3IQQ A;  3ZNI A;  1IQ5 A;  1F55 A;  1BT6 A;  1FBV A;  5CPV A;  1QG1 E;  2MRJ A;  1SL7 A;  1ZOT B;  4YI9 A;  3OVE A;  4U1P A;  4D8K A;  1NWD A;  4R1E A;  1MXE A;  1H4B A;  1KFU S;  1SBJ A;  1YUT A;  2COL B;  1NCY A;  1PSR A;  3KPX A;  4L1B B;  3QWX X;  1E8A A;  1IS0 A;  1KWO C;  1R1S A;  2ZRS A;  2WND A;  2Y1M A;  1WRK A;  3KO0 A;  2H5K A;  1NSH A;  4DUQ A;  3IMJ A;  1AJ5 A;  1FI5 A;  1OO3 A;  4ZCU A;  2MAZ A;  2XP1 A;  2PMY A;  3I5H C;  5KSZ A;  3TKZ A;  1O4Q A;  5HKW A;  1J7Q A;  2IZV A;  3IMD A;  2LLS A;  1YX7 A;  1QX5 B;  1FBZ A;  3FWC A;  1TNP A;  2BBN A;  1D4W A;  4YI8 A;  1G83 A;  1SRA A;  3K2M A;  5CDW A;  2CIA A;  4FL2 A;  2EC6 C;  4CPV A;  3I5I B;  1S36 A;  4MRX A;  1JBA A;  1UP5 A;  4M2O A;  4YGC B;  4N1G A;  5KTY A;  4ZCV A;  1A1A A;  3HHM B;  3KFJ A;  4NWF A;  1GJY A;  1M39 A;  2KOT A;  1SHB A;  3IN8 A;  1F70 A;  4XZ1 A;  1JF0 A;  4WQ2 A;  2Y5I A;  1IQ3 A;  2FCE A;  5I2O A;  1KFU L;  3AKB A;  1CLB A;  1FU5 A;  3PS5 A;  2K8M B;  3IQO A;  2CS0 A;  2ZRT A;  3BOW B;  2LUX A;  4PE1 A;  4FBN A;  1H9O A;  1YUU A;  2MRD A;  4GWF A;  2MJW B;  4LUD A;  2M7N A;  1CMG A;  1OSA A;  3BQ3 A;  1CLM A;  3BUX B;  5AAN A;  3BXK A;  3TDZ A;  4PHN A;  1IH0 A;  2L6K A;  1W7I B;  2PAL A;  3A4U B;  3MXY A;  2NXQ A;  3UYO A;  1AOT F;  1M45 A;  3GQI B;  1A03 A;  1ZUZ A;  1A08 A;  1C7W A;  5IBW A;  1CFP A;  2H46 E;  2EYV A;  1BHH B;  4C0J A;  2IUH A;  2B1U A;  2KFH A;  3I5G C;  4AQJ A;  4M2P A;  1KK8 C;  1X6C A;  2V53 A;  4BY5 A;  5HYD A;  2VRG A;  1O4R A;  4HRE E;  3BKB A;  1TTX A;  4GL9 E;  1BJF A;  2DVJ A;  3GK4 X;  1ZAC A;  1MR8 A;  1Z3K A;  2K2A A;  1O46 A;  1OPK A;  1KK7 Y;  1DVI A;  1K9P A;  1EG4 A;  1MF8 B;  5IBM A;  1H8B A;  1CM4 A;  1M27 A;  1O4N A;  1O4K A;  1MXL C;  1PIC A;  4I5K A;  1JFJ A;  4TZI A;  3EAC A;  1KWO B;  1XK4 C;  2H61 C;  2KQ6 A;  2ZKM X;  2LLU A;  3ICB A;  2QMS A;  5I2Q A;  1D1O A;  1F4O A;  1SCV A;  1O4D A;  1Y57 A;  2IS9 A;  2ROR A;  2M1U A;  1JFK A;  2MLF C;  4BY4 A;  1ALW A;  1BU3 A;  2ECD A;  3E3R A;  3QWY A;  2LE9 B;  3EVR A;  2M9G A;  1GHU A;  1RJV A;  2AAO A;  1CB1 A;  4OKH A;  2DLY A;  1DGV A;  1N2D A;  3TDU A;  3ZWH A;  4D1E A;  2EO6 A;  1TZE E;  1KFX L;  2JU0 A;  1S6C A;  2LVJ A;  1SCM C;  2ISD A;  1PAL A;  1M46 A;  3CR5 X;  1ALV A;  1AJ4 A;  3PM8 A;  3BUM B;  3VRN A;  3OHM B;  5DKR A;  1X0N A;  1WDC C;  3DVE A;  5GJI A;  1NZV A;  1M63 B;  4MZK A;  3GK2 A;  4F0Z B;  1BF5 A;  5EEL A;  4MVF A;  4K2R A;  1G33 A;  2E6W A;  1JYR A;  2JPT A;  2HMH A;  4OHD A;  1JC2 A;  2WOS A;  3PFV A;  1DF0 B;  1SKT A;  2EO3 A;  1BLJ A;  4U17 A;  1O47 A;  1LA0 A;  2KI4 C;  1O4E A;  2PSR A;  4FQO A;  1PRW A;  4XYN A;  1BFI A;  2CRH A;  3A8R A;  2JTT A;  3H4S E;  4HRG A;  4MBE A;  2D8N A;  1WRZ A;  5CSI A;  1BHF A;  1Y1X A;  1OZS A;  2JT3 A;  2QAC A;  5I2L A;  1K9A A;  2M1K B;  2L2E A;  1CKK A;  4CID A;  1CFC A;  1O44 A;  1F54 A;  1K2H A;  4QSY A;  1DJZ A;  1EXR A;  4P2Y B;  4DGP A;  1TIZ A;  3VRP A;  2MRK A;  3MAZ A;  4YGA A;  1J7R A;  1SHD A;  3VGO A;  1S26 D;  1KQV A;  2DM0 A;  2C9W A;  2HUW A;  1YVL A;  2JT0 A;  2OTG C;  1CJ1 A;  2ABL A;  4C0K A;  1DMO A;  3WHT B;  2E30 A;  2I18 A;  4XJK B;  2L5X B;  1IG5 A;  1JSA A;  1AYC A;  1X27 A;  3DVM A;  1VRK A;  2PVB A;  4JE4 A;  1AOU F;  1BOD A;  4L9M A;  3CD3 A;  2YSX A;  2BL0 B;  3CS1 A;  3LCP C;  3JTD C;  3VRO A;  1A1C A;  1OQP A;  1JYQ A;  3PSK A;  1AYA A;  2LVI A;  1TNX A;  1RTP 1;  3VS5 A;  3MSE B;  4GBA A;  4M4Z A;  3CR2 A;  1CWD L;  2LUC A;  1XFV O;  1PVB A;  1BKM A;  1BLK A;  2I2R E;  2JT8 A;  2KAV A;  5CSJ A;  1KQM B;  2M29 A;  1DJX A;  4DIR A;  5F6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...