3VRQA

Crystal structure of the tyrosine kinase binding domain of cbl-c (pl mutant)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
310
structure length
278
Chain Sequence
b'QWEEARALGRAVRMLQRLEEQCPPSLRDLLPRTAQLLREVAHSRPGGPGGSGDFLLIYLANLEAKSRQVAALSRLRRQLAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRLSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal transduction protein CBL-C
publication title Structural flexibility regulates phosphopeptide-binding activity of the tyrosine kinase binding domain of Cbl-c.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 95
structure length 278
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02262 Cbl_N CBL proto-oncogene N-terminal domain 1
A PF02761 Cbl_N2 CBL proto-oncogene N-terminus, EF hand-like domain
A PF02762 Cbl_N3 CBL proto-oncogene N-terminus, SH2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3vrqA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 3vrqA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3vrqA03
3CTNA 3EKJA 5KAZA 1SPSA 3BUXB 1UHHA 3VS7A 1MXEA 1FW4A 1EJ3A 2HF5A 2LHLA 1H4BA 4MZLA 1TCEA 1D1ZA 1RJVA 2L4HA 1A1AA 1D4WA 2H46E 2LVKA 2AUCA 4K2RA 5GJHA 1TZEE 1K96A 1AD5A 1QS7A 1Q80A 4AQIA 3K21A 1TNXA 3C1VA 3I5HB 4ROJA 3SG7A 1LUIA 5HLVA 1CDLA 3VS4A 2EGDA 4H1OA 1K2HA 2ZRTA 4OHEA 1PSRA 5BO4A 1F4QA 3PN7C 1SW8A 1G8IA 2MAZA 4GGNA 2GGZA 2CNPA 1KK8C 1OO4A 2FO0A 2M1UA 4FBNA 1QV0A 2BKIB 2K7BA 3EVRA 3A4UB 2LHIA 3HX4A 2AOAA 3K2MA 1C7WA 1MF8B 1WQUA 2LLSA 2SCPA 4PDZA 4BY4A 1FMKA 1PVBA 4N1FA 2EYVA 1Y6WA 2JZIA 5EHPA 3SG2A 2WORA 1S26D 4GUKA 5GQQC 1KK8B 1NPQA 2ZNDA 2DCRA 2PNBA 1OMRA 1YR5A 2KAVA 2EOBA 5DC0B 1CM1A 2ZNEA 3BQ3A 2NCPA 3OX6A 1FBZA 4MRYA 1O4IA 2L6KA 5AFPA 1LKKA 2SASA 1J1EA 1IH0A 1KA6A 3FIAA 1BMOA 2MRKA 1BHFA 1LUNA 1DGUA 4PE1A 1PK0D 1AP4A 2HDXA 3N84A 5EG3B 3JVTB 3PSRA 4NQGA 1GGZA 3HHMB 1GJYA 1TRFA 1XVJA 2CXJA 2OPOA 1SKTA 2ZKMX 1A09A 4QJ3B 1B7TY 1L2OB 1AUIB 1K95A 1QX7A 1CNPA 1BLQA 1G83A 2RGIA 4K44A 5HKWA 1ODBA 3KPXA 1PALA 4OHHA 4TZIA 1KFUL 3OB2B 1M63B 5TNCA 3LCPC 2JXCA 2I7AA 2KI6D 1YUUA 4WQ3A 1XFVO 2LC5A 1EH2A 3SJSA 1TTXA 1JSAA 5GJIA 3BXKA 3CR5X 1D1OA 1BFJA 1O4HA 4NDBA 3SG3A 2LM5A 1QLSA 1YUSA 2Y3AB 1NZLA 1QADA 2KBIA 4FL2A 1UHIA 2FJUB 2K79B 1NIWA 1B47A 1K93D 1TIZA 2L4IA 3I5GB 1N0YA 1F55A 1SHDA 2D8NA 2KI4C 1I3ZA 2MRDA 1NCXA 2NCOA 2DM0A 2EC6B 4YI9A 1N2DA 3TS5C 1R1QA 2LVIA 4CIDA 3VS3A 2L4KA 1DJGA 2AMIA 4I5LB 2HUWA 1Y1UA 1U5IA 2IUGA 2MHHA 1MR8A 4C0LA 5EEQA 2JNXA 2BCXA 1IWQA 1O4RA 2C0IA 1S5GZ 4MSPA 5JOLA 2LVVA 1HQVA 3LK1A 2CIAA 2VIFA 4K45A 4LUDA 4XYNA 1C7VA 3VS6A 1SL7A 4OKHA 4F5BA 3T04A 1UUSA 4PHKA 4PHJA 2H61C 4U1PA 1J7RA 1V1GA 4OR9B 4D1EA 1IS0A 1PICA 4A4BA 1GHUA 1O4EA 5DC9A 3GXXA 1DMOA 4X6SA 5CSJA 1DJIA 1YURA 2CT9A 1IKUA 1RQQC 2RORA 1JF2A 3GOFA 2HDVA 1ALWA 2PSRA 3SG4A 3I5IC 1FU6A 2LE9B 4MVFA 1DGVA 3NSOA 4ORAB 1QCFA 4OCIA 2ABLA 2RSYA 2JTTA 2MJWB 2Y4QA 3PSJA 3GK1A 1CFCA 1CSZA 1DF0A 1IG5A 4OV2A 5HLOA 3VRRA 1GQMA 3EK4A 2O5GA 4YI8A 4XZ1A 1XA5A 4FQOA 5BPJA 1BKMA 2QMSA 1M61A 1SR6C 1O4GA 2HQ8A 3NHNA 4M4ZA 1LINA 2OTGC 2LCPA 2WCEA 4ZCUA 4YGBB 1XK4C 2BE4A 3PS5A 4GWFA 1AOUF 4HRHA 1HCSB 2DLYA 1AYDA 3DF0A 2PLEA 1XFUO 3DVEA 2AAOA 3D0YA 1JWOA 2JOJA 2K2AA 1S6IA 1F8HA 3GQIB 4H34A 1MW4A 2LP3A 3NSKA 2LAPA 1XFXO 2GV5A 1KQVA 2GSBA 4GL9E 1XFWO 1CMGA 2K0JA 1CLMA 4NWGA 5I2QA 4DUQA 2L2EA 2L51A 3I5HC 3O2PA 1NX1A 5ER5A 5AXIA 1TNQA 2KYFA 3IF7A 5HYDA 1H9OA 2DVJA 1CM4A 5CDWA 3KHEA 2EL8A 1B8LA 1BU3A 2M9GA 1L7ZA 1A2XA 3EVVA 3S8NA 1S36A 2BBMA 1QASA 2LUCA 2L50A 3TDZA 4PE4A 2IUHA 1B1GA 2M49B 2F3ZA 1NZVA 1KQMB 1RFJA 1TN4A 1PRWA 1OOJA 4GGFA 1R6PA 2JTZA 2KI6C 2B3OA 2OQ1A 5DC4A 1NCZA 3HCKA 3DVJA 1LKLA 4FL3A 1O4MA 2PNAA 3VRYA 3US4A 1U5IB 1A81A 1LUKA 3OVEA 1K9UA 1OZSA 2M8UA 2EO3A 4P2YB 1FF1A 3E3RA 1BT6A 5IBWA 5D0JA 1AJ4A 4XZ0A 3KFJA 1RECA 3PATA 1EG3A 2CCMA 2PRUA 4GAOA 5FYXA 1F71A 2E30A 2YU7A 1AB2A 1O4BA 3IQOA 4R1EA 3IN8A 4OHDA 5J3XA 3CWGA 1ZACA 2ZFDA 3JVTC 2WOSA 1FBVA 2G2BA 3F45A 1X6CA 2CBLA 1K90D 2PASA 4CPVA 1H8BA 1O4OA 2BE6A 1L2OC 2L3TA 3FS7A 4F5AA 2FOTA 2KGRA 2MLEC 1KSWA 5F6TA 1FYRA 1GRIA 2IUIA 3NXAA 1YX8A 3I5FB 4UPGA 4JEGA 2KFGA 1W7IB 3H4SE 1ZFSA 2K61A 3MXYA 1JUOA 3AKBA 4K11A 1G33A 1IQ3A 3TDUA 1RROA 1DF0B 4DIRA 3VRZA 1K9PA 1QG1E 1UWOA 2O60A 2ZRSA 1B9AA 1QV1A 1SMGA 1QIVA 3I5GC 1KWOC 4YRUA 2BBNA 4WQ2A 2AOBA 4EIHA 2EC6C 2VRGA 5G08A 3N7YA 1JWDA 3DF0B 4P9ZA 1AJ5A 1O47A 1XA6A 3EAZA 4QJ4B 2K7OA 3M7FA 1KK7Y 1DJZA 4F59A 2I94A 1CLBA 1UHKA 1OE9B 1S6JA 1KWOB 2COLB 2PMYA 1RTP1 2HPSA 2LVJA 1F4OA 4MZJA 4AOMA 1BF5A 1QXPA 1A75A 2F2OA 1O4KA 2OS8B 1A1CA 3GXWA 4AQJA 1JYUA 1NRVA 1TOPA 2JPTA 4YGEB 1UHNA 1ZOTB 1S3PA 1AHRA 3MSEB 4JQ0D 2B1UA 1A03A 3GK4X 4NDCA 3CR4X 3TZ1A 1SHBA 1Y57A 1P13A 2CTNA 1CDNA 1FI6A 1OO3A 2BL0B 5CPVA 4I5JA 1KCYA 1B7TZ 1OZOA 4CFQA 1CJ1A 1CFDA 1NYAA 5AULA 1KFXS 1SYMA 3PJPA 4ETOA 2DX0A 1O4LA 1OPLA 4YBHB 3OX5A 1XO5A 1WDCB 1M27A 4QJ5B 1O4DA 1DJHA 2NXQA 2V53A 2JT3A 4WRIA 1SHAA 3CLNA 4U8DA 2SRCA 4GNKB 3CBLA 3N8MA 1WRKA 3TUYB 3LL8B 1RWYA 1JFJA 1F54A 1DJWA 2KHNA 1VRKA 1BMBA 2BECA 1D4TA 1S1EA 1O46A 1CDMA 1SCVA 1WLZA 2F3YA 2KFFA 1J1DA 5CSFA 1ZFPE 1QTXA 3UYOA 2KFHA 1QVIY 2MBXA 2KSPA 1IJRA 1RK9A 1R1PA 3QWXX 2BCBA 4Q04A 1MQ1A 5CSIA 2JQ6A 5HKZA 1B4CA 1SBJA 2OZOA 1FHSA 3AAJA 4C0JA 1BOCA 1LXFC 1A08A 1O48A 2KYCA 2H5KA 2K7AB 3IMDA 4NWFA 3EKHA 2HMHA 2WNDA 1Y0VH 2ETZA 5DKNA 1M31A 1NX0A 1OSAA 2AUGA 4HRGA 3VROA 2M7NA 3CS1A 4GBAA 4E93A 1ZUZA 4MLWA 1LVCD 1XFYO 2K7DA 4FTGA 2JU0A 1M46A 1MUXA 2KGBC 2EYYA 3A8RA 1TCFA 2LMUA 1K9KA 2CS0A 1J7QA 2SHPA 5AANA 1SRAA 3VS1A 4ORCB 1LCKA 1O45A 2KBMA 3FWCA 2MA2A 3CR2A 2LUXA 5KU1A 4OHLA 3TDIA 1OQPA 1O4QA 3C7IA 1O4NA 4HSZA 1JF0A 2MK2A 1NCYA 1KQMC 5I6VA 1K9AA 4MEWA 4MZKA 2LP2A 2JRFA 3WA4A 2DOQA 3HCMA 1A1BA 1J7PA 1BR1B 3O78A 1YVLA 1LA3A 1DT7B 1XFZO 2Q91A 2KAYA 1UHJA 1MHOA 1SKJA 3ZWHA 2KOTA 2XP1A 2FCEA 2ZN9A 3CXLA 1WRLA 3ICBA 1AOTF 1CWDL 2LNWA 1BKLA 4N1GA 1YRUB 3DVKA 2P6BB 3BOWA 2GGMA 1JBAA 2LQWA 3WHTB 2F33A 2L0PA 3JTDC 1F2FA 1NX2A 1A75B 1NX3A 1QLKA 1SK6D 2LLUA 1QX2A 1KFUS 4N5XA 3WNXB 3KO0A 2EYZA 3LK0A 1A29A 1BR4B 2JULA 3CZTX 4ORBB 4C0KA 3VS0A 4BY5A 3QRXA 2KDHA 4JGHA 3VS2A 1TNPA 1CFFA 4P5OE 2M0RA 3JTDB 3IQQA 4LUEA 1HCTB 1QIWA 4YGCB 3WXAA 3IN7A 5IBMA 5AERA 3VRPA 3OHMB 1JC2A 2JXLA 4HREE 1CFPA 2ISDA 1J55A 2JWWA 2K8MB 2M3WA 1BM2A 1CB1A 2JNFA 3I5FC 1TCOB 1WRZA 2NZ0A 4DCKA 1BG1A 1C07A 3CD3A 3KF9A 1O42A 2F8PA 1QX5B 5EHRA 2CRHA 1DVIA 4PALA 1F1WA 1CSYA 2L5XB 3KEVA 1O4AA 3OV1A 3BUNB 1FU5A 2IZVA 3TKZA 4PE7A 3EK8A 1SL9A 2BKHB 2M29A 3WHUB 1AYCA 2K7CA 2MC1A 4E68A 1BFIA 1CWEA 3FWBA 4ZCVA 2M1KB 1BODA 5DKRA 4JPZB 4MN0A 2KAXA 2M97A 4XJKA 2EHBA 3M0WA 3PN7B 2H61A 3BUOB 5CSNA 3CGAA 1WLMA 5KSZA 2EU0A 3D10A 3GK2A 3ZNIA 3HIZB 2RVFA 1M45A 2NLNA 4GFTA 1AYBA 1LA0A 4F0ZB 3QWYA 5D69A 3AAKA 1O41A 1BHHA 3BUWB 1R1SA 4QSYA 1W7JB 1MWNA 5I8NA 1KSMA 2G9BA 1KC2A 4M2PA 4OVNF 5D7FA 2OS8C 2Y1NA 2I18A 1UURA 2BCAA 3NSLA 1DJXA 3D0YB 2JC2A 4I5KA 4I5NB 2CR4A 2KNOA 2EKXA 4PCWA 2LNKA 2MLFC 2FCIA 3AKAA 2KQYA 2CI9A 1TNWA 3UF4A 5IBSA 3SG6A 5AEQA 4YGDB 1S5GY 1WY9A 3DD4A 1FI5A 2WC8A 3NSIA 2BL0C 4MRXA 1SNLA 1SPYA 4GGFC 1XYDA 1ALVA 2JT0A 2LANA 1NUBA 2M7LA 3VGOA 1O4PA 1FPWA 1X27A 2LCTA 3MAZA 4PHMA 1XK4A 3RLZA 1MILA 2GE9A 1IJ6A 1WDCC 2QPTA 2PVBA 4DS7A 4BTFA 2Y1MA 2WCFA 1Y1AA 3LLEA 1LCJA 2RMXA 3BOWB 1IGVA 2I2RE 4GPLB 1JFKA 3TUYC 1QATA 1EL4A 1YVHA 4M2OA 4JE4A 4ICBA 3TL0A 3S8OA 1CMFA 1HT9A 2A4JA 4DGXA 4D8KA 1K8UA 4NDDA 3SIBA 1KSOA 3SG5A 1BJFA 1YX7A 4L9MA 1X02A 1J7OA 1OMVA 2KK6A 5K89A 1PSBA 3BKBA 4PE0A 5JJGA 2KQ6A 2MQIA 4DRWA 2YSXA 1YTZC 1QJTA 4IL1A 5KTYA 1YRTB 1SPRA 1EG4A 5ER4X 4EY0A 4CLNA 2LQNA 1V1FA 4PHNA 2JT8A 1E8AA 2PALA 1PVAA 2ZN8A 1O4JA 1KK7Z 2HETA 1M39A 2FCDA 2QACA 3BUMB 2H8HA 2PLDA 1BLJA 1IJ5A 1B8CA 3PM8A 2IS9A 2KI4B 1X0NA 2L98A 2K2FA 2LMTA 1JYQA 2TN4A 3PQZA 2Y5IA 1BLKA 2HCKA 3SIAA 5HKYA 1Z3KA 1AVSA 1K94A 1CLLA 3TS5B 1CTRA 5DKQA 1PULA 1R2UA 3PFVA 1O4FA 5B8IB 2E6WA 1UP5A 2MRJA 4JWQA 3VS5A 4M2QA 2C0TA 4MBEA 1NP8A 1OMDA 2C9WA 3O6BA 2LNXA 3EVUA 3OB1B 4OHIA 5I2OA 1Y1XA 4CFRA 3VRQA 1G4YR 1O44A 2WCBA 1AK8A 1A1EA 1RPYA 1JYRA 1SCMC 1DTLA 4XJKB 1IQ5A 1O49A 2LMVA 2KNEA 1O43A 4WWQA 2JYQA 1A4PA 1AYAA 2LLTA 2EO6A 2HQWA 1S6CA 1ZMZA 5PALA 3OP0A 2LV7A 1GGWA 3EACA 1KA7A 1YUTA 1JU5A 2PTKA 1SY9A 1NWDA 2R2IA 1CDPA 3DVMA 2Q4UA 3BYAA 4A4CA 1BHHB 3PALA 4U17A 1MXLC 1LUMA 1N65A 4TNCA 1SCMB 3S8LA 1SL8A 5EELA 3VRNA 1O4CA 3I5IB 2BBUA 1QVIZ 2DLZA 3PSKA 5DF6A 3PLFB 3S9KA 1OPKA 1EXRA 1LKJA 1DJYA 4YGAA 5I2LA 3IMJA 4L1BB 4USLA 1RJAA 2ECDA 1IRJA 4P9VA 1B8RA 2C0OA 1SR6B 3MXCA 2F2PA 3O4YA 3EK7A 1CKKA 2OTGB 1A07A 1NSHA 2H2KA 1F70A 2CI8A 1KFXL 4DGPA 3RM1A
chains in the Genus database with same CATH superfamily
3EKJA 1SPSA 1UHHA 1FW4A 1H4BA 2LHLA 4MZLA 1D1ZA 1A1AA 1AD5A 1DEKA 2GTEA 3C1VA 3I5HB 5HLVA 2XPLA 2ZRTA 1PSRA 2MAZA 2FO0A 3B87A 1OO4A 2XEGA 2M1UA 2ERBA 2C6CA 4PDZA 2EYVA 1Y6WA 5EHPA 4P4BA 4GUKA 1NPQA 2PNBA 2EOBA 3SJXA 2ZNEA 1O4IA 1LKKA 1KA6A 1IH0A 1BMOA 2MRKA 2HDXA 1Z2CB 1TRFA 1XVJA 1SKTA 3HPGG 4K44A 1BLQA 5HKWA 1PALA 3S0FA 3O4XA 3LCPC 2JXCA 2LC5A 5GJIA 3SJSA 3CR5X 3NHIA 2LM5A 1NZLA 2K79B 1B47A 3L4AA 3I5GB 1F55A 1N0YA 1SHDA 2D8NA 2KI4C 1NCXA 3O8ZA 4YI9A 2WC5A 2LVIA 4I5LB 3D73A 2PQLA 2MHHA 2VIFA 3Q8IA 4OKHA 1UUSA 1C3YA 3FECA 4PHKA 2H61C 1J7RA 4D1EA 1O4EA 1DMOA 4X6SA 2CT9A 2RORA 3GOFA 1XFRA 4MCQA 3SG4A 2KPHA 3SJFA 3PSJA 1IG5A 3VRRA 3EK4A 2O5GA 4FQOA 1BKMA 1O4GA 4OC5A 2LCPA 3R72A 2PLEA 2K2AA 1F8HA 4GL9E 2LAPA 2GV5A 3S0DA 4DUQA 1NX1A 1CM4A 2M9GA 1L7ZA 1A2XA 1S36A 2K60A 3TDZA 2IUHA 1KQMB 1RFJA 3D7GA 1PRWA 2OQ1A 2JTZA 2KI6C 5DC4A 3CYZA 4OMEA 1LKLA 1OOFA 1K9UA 1OZSA 1FF1A 4BPXB 3E3RA 5IBWA 1RECA 2YU7A 2G2BA 1H8BA 2MLEC 1KSWA 1GRIA 2P70A 1YX8A 3I5FB 1JUOA 1G33A 1IQ3A 3KASA 1K9PA 1TUJA 2ZRSA 1QIVA 2AOBA 1KWOC 4WQ2A 1JWDA 3DF0B 4QJ4B 1KK7Y 1DJZA 1A75A 1O4KA 1A1CA 3GXWA 3N7HA 1DELA 4YGEB 1UHNA 1AHRA 3MSEB 4JQ0D 2CTNA 3DXLA 1CDNA 1OO3A 5CPVA 1OZOA 2WCMA 4CFQA 1XO5A 1O4DA 1SHAA 2JT3A 4WRIA 3CLNA 3N8MA 4GNKB 3LL8B 1F54A 1DJWA 2BECA 1CDMA 1ZFPE 2F3YA 5CSFA 2KFHA 1QVIY 1RK9A 2BCBA 5CSIA 5HKZA 5F13A 1O48A 3IMDA 4OC2A 2HMHA 2WNDA 2ETZA 1OSAA 5F09A 4MLWA 1MUXA 1K9KA 2SHPA 2KBMA 5KU1A 2LUXA 3C7IA 2MK2A 1K9AA 4MEWA 4MZKA 1LA3A 2Q91A 1MHOA 1SKJA 2ZN9A 3CXLA 2LNWA 3DVKA 2F33A 3JTDC 1F2FA 3DZTA 2EYZA 1BR4B 2JULA 3QRXA 1QIWA 3WXAA 3VRPA 1OOIX 4HREE 1CFPA 2ISDA 1J55A 2JWWA 2M3WA 4DCKA 3D7DA 1O42A 5EHRA 1DVIA 2L5XB 3KEVA 3BUNB 1FU5A 3TKZA 3CZ0A 2BKHB 3WHUB 4ZCVA 4JPZB 2EHBA 3PN7B 3ZNIA 2VKZG 4NGTA 4JYWA 1BHHA 3BUWB 1MWNA 2G9BA 4OVNF 5D7FA 2OS8C 3UNWA 1UURA 4I5NB 2KNOA 3CDNA 4PCWA 3S0EA 2KQYA 1TNWA 5IBSA 4YGDB 4NGSA 3DD4A 2LANA 1ALVA 2JT0A 3CABA 1NUBA 2M7LA 1X27A 1MILA 3VB1A 2QPTA 1WDCC 4BTFA 2Y1MA 1C3ZA 1JFKA 3TUYC 1QATA 1YVHA 3S8OA 1HT9A 3SG5A 4L9MA 3SS4A 3BKBA 4PE0A 2KQ6A 5KTYA 4CLNA 2JT8A 1PVAA 2ZN8A 1O4JA 1M39A 2QACA 4JKTA 3PM8A 1JYQA 2HCKA 3RZSA 1AVSA 1K94A 3TS5B 1CTRA 1R2UA 4JWQA 3VS5A 5I2OA 1A1EA 1RPYA 1DTLA 1O49A 2LMVA 1O43A 3EG5B 3EACA 1ZMZA 5PALA 3OP0A 2LV7A 1Z8LA 1YUTA 1JU5A 2Q4UA 3BYAA 4TNCA 1SCMB 1SL8A 5EELA 3S0BA 4YGAA 1DJYA 3CZ2A 4USLA 3O4YA 1OW4A 1CKKA 3IWWA 5ELYA 2H2KA 5KAZA 1K96A 4LQGA 1QS7A 2WCKA 4ROJA 3SG7A 4H1OA 4OHEA 1F4QA 1G8IA 2BKIB 2K7BA 3HX4A 3BFAA 3K2MA 1C7WA 1FMKA 1PVBA 4N1FA 2JZIA 2ZNDA 2DCRA 1OMRA 1CM1A 1SSEB 2XEIA 1BHFA 1LUNA 3S9LA 3JVTB 3D74A 3HHMB 3FEEA 2OPOA 1G83A 1B7TY 1K95A 4OC3A 3KPXA 3OB2B 4OC1A 1EH2A 1JSAA 3BXKA 1D1OA 4NDBA 2Y3AB 1QADA 2KBIA 4NGQA 2FJUB 1NIWA 1TIZA 2MRDA 2DM0A 4F7FA 1R1QA 1DJGA 1Y1UA 2IUGA 1MR8A 2JNXA 1O4RA 1S5GZ 4MSPA 1HQVA 4LUDA 3K1EA 4XYNA 4F5BA 2XEFA 4PHJA 4U1PA 2OR4A 1IS0A 2OOTA 1GHUA 1IKUA 1RQQC 2HDVA 1ALWA 3NSOA 4ORAB 4OCIA 2JTTA 2Y4QA 3GK1A 1CSZA 2QMSA 3NHNA 3NFQA 1LINA 4M4ZA 3BJHA 2PVWA 3PS5A 4HRHA 1EO0A 1AYDA 3DF0A 4JZ0A 3DVEA 4H34A 1XFXO 1XFWO 2KLEA 5I2QA 3O2PA 3S9NA 5AXIA 1H9OA 1TNQA 2KYFA 1B8LA 1BU3A 2L50A 1NZVA 4GGFA 1NCZA 4FL3A 3DVJA 3FE8A 3US4A 1U5IB 3KFJA 2CCMA 4GAOA 4INXA 4R1EA 3IN8A 3CWGA 1CX8A 1K90D 4CPVA 4F5AA 2BE6A 1L2OC 3FS7A 2FOTA 2KGRA 3OGNA 3UO9A 1FYRA 2IUIA 3NXAA 2KFGA 1W7IB 3AKBA 4RR2B 1RROA 1DF0B 3VRZA 3D7HA 2O60A 1SMGA 4YRUA 4EIHA 2EC6C 2VRGA 5G08A 3BFBA 3M7FA 1S6JA 2COLB 1LS8A 4MZJA 1QXPA 1TOPA 3B7AA 2JPTA 1DC1A 1ZOTB 2B1UA 1A03A 4NDCA 1Y57A 1FI6A 2BL0B 4ETOA 2DX0A 1OPLA 3OX5A 2V53A 4U8DA 3CBLA 1RWYA 1JFJA 3BHXA 2KLDA 4P4DA 1O46A 1QTXA 1R1PA 1SBJA 3AAJA 1NX0A 3CS1A 4E93A 3D78A 1ZUZA 2JU0A 1M46A 2KGBC 1TCFA 2CS0A 5D29A 5AANA 1SRAA 4ORCB 2MA2A 1OQPA 4HSZA 1J7PA 1BR1B 3RBUA 2KAYA 1UHJA 3ZWHA 2KOTA 2QEVA 1JBAA 2GGMA 1NX2A 2LLUA 1QX2A 1KFUS 4N5XA 3WNXB 4ORBB 3VS0A 4JGHA 1TNPA 2PYQA 1CFFA 2M0RA 3IQQA 4LUEA 3IN7A 5AERA 1JC2A 2CIJA 2K8MB 1C07A 1WRZA 3FE9A 1BG1A 2KGYA 3KF9A 1QX5B 4PE7A 3EK8A 2N3AB 2MC1A 3FWBA 2M1KB 4MN0A 3BI0A 2KAXA 3M0WA 5CSNA 3HIZB 2NLNA 4GFTA 1AYBA 1LA0A 1KSMA 4M2PA 3B6XA 2I18A 3SS3A 2LNKA 1WY9A 3PM2A 4JD9A 1SPYA 3VGOA 1O4PA 2LCTA 3MAZA 1XK4A 2GE9A 1Y1AA 3LLEA 3BOWB 4JE4A 3TL0A 3B88A 3QMEA 1KSOA 3R1PA 1J7OA 2KK6A 1PSBA 2YGUA 2LQNA 2PALA 2PLDA 1BLJA 2IS9A 2KI4B 2Y5IA 1PULA 4M2QA 2C0TA 1OMDA 2LNXA 3O6BA 3EVUA 1Y1XA 1O44A 1SCMC 4XJKB 4WWQA 2HQWA 1GGWA 4KYNA 2JBJA 3PALA 4U17A 1LUMA 4X3RA 5DF6A 3PLFB 3S9KA 1EXRA 3L47A 3SS5A 4P9VA 1B8RA 3F9KC 2C0OA 2F2PA 4NGMA 1A07A 1NSHA 1F70A 2JBKA 3VS7A 2WCHA 1TCEA 1RJVA 2H46E 2LVKA 2AUCA 5GJHA 1TUZA 3K21A 1LUIA 1OOHA 1CDLA 2B4JC 3VS4A 5BO4A 3D77A 4FBNA 4NGPA 3EVRA 2LHIA 1MF8B 2C6PA 2SCPA 4BY4A 1S26D 5GQQC 1KK8B 3OX6A 3BQ3A 2NCPA 4MRYA 4P4IA 2SASA 4P45A 4PE1A 1PK0D 1AP4A 3N84A 5EG3B 4P4JA 3PSRA 4BPWB 4NQGA 2CXJA 2ZKMX 4QJ3B 1AUIB 1CNPA 2XPNA 1ODBA 4OHHA 1M63B 5TNCA 2KI6D 2I7AA 1YUUA 2H8VA 3SG3A 1YUSA 2L2CA 2L4IA 4INWA 1Z4HA 3VS3A 2AMIA 1U5IA 4C0LA 1IWQA 2C0IA 5JOLA 2CIAA 3LK1A 1C7VA 3VS6A 4A4BA 5DC9A 3GXXA 3CZ1A 5CSJA 5I94A 1JF2A 2PSRA 3I5IC 2LE9B 2ABLA 1CFCA 1DF0A 4OV2A 5HLOA 1GQMA 4YI8A 4XZ1A 1SR6C 1IIOA 2HQ8A 2OTGC 4YGBB 2BE4A 4GWFA 1AOUF 1JWOA 3GQIB 2JOJA 1MW4A 2LP3A 2GSBA 5EL2A 2K0JA 4NWGA 3I5HC 2DVJA 3KHEA 3S8NA 2BBMA 2LUCA 1QASA 4PE4A 1TN4A 1TWOA 3HCKA 1O4MA 2M8UA 2EO3A 5D0JA 1AJ4A 4XZ0A 3PATA 2PRUA 1F71A 5FYXA 1AB2A 3IQOA 4OHDA 1ZACA 2ZFDA 2WOSA 1FBVA 1O4OA 2L3TA 4JEGA 2K61A 4DIRA 2DLAA 1QG1E 1B9AA 1QV1A 4OC0A 3I5GC 2BBNA 2XPPA 3LYVA 4P9ZA 1AJ5A 3EAZA 2K7OA 4F59A 2I94A 1CLBA 1UHKA 2PMYA 1RTP1 1F4OA 1BF5A 4AOMA 2OS8B 1JYUA 3GK4X 3TZ1A 1SHBA 1P13A 4I5JA 2JPOA 5AULA 1KFXS 3PJPA 1WDCB 4QJ5B 2NXQA 3TUYB 2KHNA 2KFFA 1SCVA 4P44A 1J1DA 3BXMA 2MBXA 1IJRA 1MQ1A 2JQ6A 1B4CA 1A08A 2KYCA 2K7AB 3EKHA 5DKNA 4HRGA 2M7NA 4GBAA 1LVCD 1XFYO 4FTGA 2EYYA 2LMUA 1J7QA 4OHLA 3CR2A 3TDIA 3R1VA 1O4NA 1KQMC 2DOQA 3HCMA 3SJEA 1A1BA 1W9ZA 3O78A 1YVLA 1DT7B 2XP1A 4P4FA 2FCEA 1WRLA 3ICBA 1AOTF 4N1GA 3BOWA 2L0PA 1QLKA 1SK6D 3KO0A 3LK0A 1A29A 4C0KA 3CZTX 4BY5A 2KDHA 5FI7A 4P5OE 5IBMA 3OHMB 3L4LA 2JXLA 3B86A 1CB1A 3I5FC 1TCOB 3CD3A 2F8PA 2CRHA 4PALA 1F1WA 1CSYA 1O4AA 1SL9A 2K7CA 4E68A 1BODA 5DKRA 2M97A 4XJKA 2H61A 3BUOB 3FE6A 3CGAA 1WLMA 5KSZA 3D10A 4NGRA 4F0ZB 1GM0A 2XPOA 1R1SA 1W7JB 1DJXA 2CR4A 2JC2A 4I5KA 2EKXA 3BI1A 2FCIA 3SG6A 1S5GY 1SNLA 4GGFC 1XYDA 1FPWA 3RLZA 4DS7A 4MCSA 1EL4A 4M2OA 4ICBA 5D3OA 1CMFA 3SIBA 1BJFA 1X02A 5K89A 5JJGA 4DRWA 2YSXA 1YTZC 4IL1A 1YRTB 1EG4A 5ER4X 4EY0A 1V1FA 1KK7Z 2HETA 2FCDA 3BUMB 4P4EA 2H8HA 2BAPA 1IJ5A 1B8CA 1X0NA 3PQZA 2L98A 2LMTA 2TN4A 3SIAA 1Z3KA 3R1OA 1CLLA 3PFVA 1O4FA 2MRJA 2QEHA 1NP8A 4OHIA 3OB1B 2QEOA 3VRQA 1G4YR 2WCBA 1AK8A 4OC4A 4NGNA 2JYQA 1A4PA 4OZDA 2LLTA 1AYAA 1KA7A 2PTKA 1SY9A 3DVMA 4A4CA 1N65A 2WCJA 3VRNA 1O4CA 2BBUA 2L5YA 1QVIZ 3PSKA 4L1BB 1LKJA 5I2LA 3V2LA 5HL1A 2ECDA 2FJYA 1IRJA 3MXCA 2CI8A 3CTNA 3BUXB 1MXEA 2HF5A 1EJ3A 1QWVA 2L4HA 4K2RA 1D4WA 1TZEE 1Q80A 4AQIA 1TNXA 2EGDA 1K2HA 3PN7C 1SW8A 4GGNA 2GGZA 2CNPA 1KK8C 1QV0A 2AOAA 3A4UB 1WQUA 2LLSA 3SG2A 2WORA 2KAVA 1YR5A 5DC0B 1FBZA 2L6KA 5AFPA 1J1EA 3FIAA 1DGUA 2PVVA 1Z9EA 3DY9A 1GGZA 1GJYA 3D7FA 1A09A 1L2OB 1QX7A 2RGIA 4TZIA 1KFUL 4FQTA 4WQ3A 1XFVO 1TTXA 1BFJA 1O4HA 1QLSA 4FL2A 1UHIA 1K93D 1I3ZA 2NCOA 2EC6B 1N2DA 3TS5C 3NGVA 4CIDA 2L4KA 2HUWA 1P28A 1T14A 5EEQA 2BCXA 3SJGA 2LVVA 4K45A 1SL7A 3T04A 1V1GA 4OR9B 1PICA 1DJIA 1YURA 3D76A 1FU6A 4MVFA 1DGVA 1QCFA 2RSYA 2MJWB 3FF3A 1XA5A 5BPJA 1M61A 2WCEA 4ZCUA 1XK4C 1HCSB 2DLYA 1XFUO 2AAOA 3D0YA 3OAKA 1S6IA 3HPHE 4BPUB 3BFHA 3NSKA 1KQVA 1CMGA 3OBVA 1CLMA 2L2EA 2L51A 5ER5A 2OZOA 3IF7A 5HYDA 5CDWA 2EL8A 3EVVA 2QDIA 1B1GA 2M49B 2F3ZA 2UV8G 1OOJA 2B3OA 1R6PA 2QEBA 2PNAA 3VRYA 1A81A 1LUKA 3OVEA 4P2YB 1BT6A 1EG3A 2E30A 4MCRA 1O4BA 5J3XA 2C6GA 3JVTC 1WJTA 3F45A 1X6CA 2CBLA 2PASA 2LRAA 2BNXA 5F6TA 4UPGA 3H4SE 3MXYA 1ZFSA 4K11A 3TDUA 4MCPA 1UWOA 2WC6A 4PT1A 2XEJA 3N7YA 1O47A 1XA6A 1OE9B 1KWOB 2HPSA 2LVJA 2F2OA 4AQJA 1NRVA 1S3PA 3CR4X 1KCYA 1B7TZ 1CJ1A 1CFDA 1NYAA 1SYMA 1O4LA 4YBHB 1M27A 1DJHA 2SRCA 3U88C 1WRKA 1VRKA 1BMBA 1D4TA 1S1EA 1WLZA 3HMJG 3UYOA 2KSPA 3QWXX 4Q04A 1FHSA 4C0JA 1BOCA 1LXFC 2H5KA 4NWFA 3DYEA 3S0AA 1Y0VH 1M31A 2AUGA 3VROA 2K7DA 3A8RA 3S0GA 5BY0A 3VS1A 5FI6A 1LCKA 1O45A 3FWCA 1O4QA 1JF0A 5I6VA 1NCYA 2LP2A 2JRFA 3WA4A 1XFZO 1CWDL 1BKLA 1YRUB 2P6BB 2LQWA 3WHTB 1A75B 1NX3A 3VS2A 3JTDB 1HCTB 3NHTA 4YGCB 2WCLA 1BM2A 2JNFA 2NZ0A 4IJ7A 3PJIA 3OV1A 2IZVA 2M29A 1AYCA 1BFIA 1CWEA 3FEDA 2EU0A 3GK2A 2RVFA 1M45A 3QWYA 5D69A 3AAKA 1O41A 4QSYA 5I8NA 3S9MA 1KC2A 2Y1NA 2BCAA 3NSLA 3D0YB 2MLFC 3AKAA 3PT1A 2CI9A 3UF4A 5AEQA 1FI5A 2WC8A 3NSIA 2BL0C 4MRXA 4PHMA 1IJ6A 2PVBA 1DE4C 2WCFA 1LCJA 2RMXA 1IGVA 2I2RE 4GPLB 3K2TA 2A4JA 4DGXA 3IVTA 1K8UA 4NDDA 4D8KA 1YX7A 1ORGA 1OMVA 5FI2A 2MQIA 1QJTA 1SPRA 4PHNA 1E8AA 1OOGA 2K2FA 1BLKA 5HKYA 5DKQA 5B8IB 2E6WA 1UP5A 4MBEA 2C9WA 4W9YA 4CFRA 1JYRA 1DQEA 1IQ5A 2KNEA 2EO6A 1S6CA 1NWDA 2R2IA 1CDPA 1BHHB 1MXLC 3S8LA 3I5IB 2DLZA 1OPKA 3IMJA 1RJAA 5DICA 1SR6B 3EK7A 2OTGB 2P71A 3D75A 1KFXL 4DGPA 3RM1A
chains in the Genus database with same CATH topology
3CTNA 3EKJA 5KAZA 1SPSA 3BUXB 1UHHA 3VS7A 1MXEA 1FW4A 1EJ3A 2HF5A 2LHLA 1H4BA 4MZLA 1TCEA 1D1ZA 1RJVA 2L4HA 1A1AA 1D4WA 2H46E 2LVKA 2AUCA 4K2RA 5GJHA 1TZEE 1K96A 1AD5A 1QS7A 1Q80A 4AQIA 3K21A 1TNXA 3C1VA 3I5HB 4ROJA 3SG7A 1LUIA 5HLVA 1CDLA 3VS4A 2EGDA 4H1OA 1K2HA 2ZRTA 4OHEA 1PSRA 5BO4A 1F4QA 3PN7C 1SW8A 1G8IA 2MAZA 4GGNA 2GGZA 2CNPA 1KK8C 1OO4A 2FO0A 2M1UA 4FBNA 1QV0A 2BKIB 2K7BA 3EVRA 3A4UB 2LHIA 3HX4A 2AOAA 3K2MA 1C7WA 1MF8B 1WQUA 2LLSA 2SCPA 4PDZA 4BY4A 1FMKA 1PVBA 4N1FA 2EYVA 1Y6WA 2JZIA 5EHPA 3SG2A 2WORA 1S26D 4GUKA 5GQQC 1KK8B 1NPQA 2ZNDA 2DCRA 2PNBA 1OMRA 1YR5A 2KAVA 2EOBA 5DC0B 1CM1A 2ZNEA 3BQ3A 2NCPA 3OX6A 1FBZA 4MRYA 1O4IA 2L6KA 5AFPA 1LKKA 2SASA 1J1EA 1IH0A 1KA6A 3FIAA 1BMOA 2MRKA 1BHFA 1LUNA 1DGUA 4PE1A 1PK0D 1AP4A 2HDXA 3N84A 5EG3B 3JVTB 3PSRA 4NQGA 1GGZA 3HHMB 1GJYA 1TRFA 1XVJA 2CXJA 2OPOA 1SKTA 2ZKMX 1A09A 4QJ3B 1B7TY 1L2OB 1AUIB 1K95A 1QX7A 1CNPA 1BLQA 1G83A 2RGIA 4K44A 5HKWA 1ODBA 3KPXA 1PALA 4OHHA 4TZIA 1KFUL 3OB2B 1M63B 5TNCA 3LCPC 2JXCA 2I7AA 2KI6D 1YUUA 4WQ3A 1XFVO 2LC5A 1EH2A 3SJSA 1TTXA 1JSAA 5GJIA 3BXKA 3CR5X 1D1OA 1BFJA 1O4HA 4NDBA 3SG3A 2LM5A 1QLSA 1YUSA 2Y3AB 1NZLA 1QADA 2KBIA 4FL2A 1UHIA 2FJUB 2K79B 1NIWA 1B47A 1K93D 1TIZA 2L4IA 3I5GB 1N0YA 1F55A 1SHDA 2D8NA 2KI4C 1I3ZA 2MRDA 1NCXA 2NCOA 2DM0A 2EC6B 4YI9A 1N2DA 3TS5C 1R1QA 2LVIA 4CIDA 3VS3A 2L4KA 1DJGA 2AMIA 4I5LB 2HUWA 1Y1UA 1U5IA 2IUGA 2MHHA 1MR8A 4C0LA 5EEQA 2JNXA 2BCXA 1IWQA 1O4RA 2C0IA 1S5GZ 4MSPA 5JOLA 2LVVA 1HQVA 3LK1A 2CIAA 2VIFA 4K45A 4LUDA 4XYNA 1C7VA 3VS6A 1SL7A 4OKHA 4F5BA 3T04A 1UUSA 4PHKA 4PHJA 2H61C 4U1PA 1J7RA 1V1GA 4OR9B 4D1EA 1IS0A 1PICA 4A4BA 1GHUA 1O4EA 5DC9A 3GXXA 1DMOA 4X6SA 5CSJA 1DJIA 1YURA 2CT9A 1IKUA 1RQQC 2RORA 1JF2A 3GOFA 2HDVA 1ALWA 2PSRA 3SG4A 3I5IC 1FU6A 2LE9B 4MVFA 1DGVA 3NSOA 4ORAB 1QCFA 4OCIA 2ABLA 2RSYA 2JTTA 2MJWB 2Y4QA 3PSJA 3GK1A 1CFCA 1CSZA 1DF0A 1IG5A 4OV2A 5HLOA 3VRRA 1GQMA 3EK4A 2O5GA 4YI8A 4XZ1A 1XA5A 4FQOA 5BPJA 1BKMA 2QMSA 1M61A 1SR6C 1O4GA 2HQ8A 3NHNA 4M4ZA 1LINA 2OTGC 2LCPA 2WCEA 4ZCUA 4YGBB 1XK4C 2BE4A 3PS5A 4GWFA 1AOUF 4HRHA 1HCSB 2DLYA 1AYDA 3DF0A 2PLEA 1XFUO 3DVEA 2AAOA 3D0YA 1JWOA 2JOJA 2K2AA 1S6IA 1F8HA 3GQIB 4H34A 1MW4A 2LP3A 3NSKA 2LAPA 1XFXO 2GV5A 1KQVA 2GSBA 4GL9E 1XFWO 1CMGA 2K0JA 1CLMA 4NWGA 5I2QA 4DUQA 2L2EA 2L51A 3I5HC 3O2PA 1NX1A 5ER5A 5AXIA 1TNQA 2KYFA 3IF7A 5HYDA 1H9OA 2DVJA 1CM4A 5CDWA 3KHEA 2EL8A 1B8LA 1BU3A 2M9GA 1L7ZA 1A2XA 3EVVA 3S8NA 1S36A 2BBMA 1QASA 2LUCA 2L50A 3TDZA 4PE4A 2IUHA 1B1GA 2M49B 2F3ZA 1NZVA 1KQMB 1RFJA 1TN4A 1PRWA 1OOJA 4GGFA 1R6PA 2JTZA 2KI6C 2B3OA 2OQ1A 5DC4A 1NCZA 3HCKA 3DVJA 1LKLA 4FL3A 1O4MA 2PNAA 3VRYA 3US4A 1U5IB 1A81A 1LUKA 3OVEA 1K9UA 1OZSA 2M8UA 2EO3A 4P2YB 1FF1A 3E3RA 1BT6A 5IBWA 5D0JA 1AJ4A 4XZ0A 3KFJA 1RECA 3PATA 1EG3A 2CCMA 2PRUA 4GAOA 5FYXA 1F71A 2E30A 2YU7A 1AB2A 1O4BA 3IQOA 4R1EA 3IN8A 4OHDA 5J3XA 3CWGA 1ZACA 2ZFDA 3JVTC 2WOSA 1FBVA 2G2BA 3F45A 1X6CA 2CBLA 1K90D 2PASA 4CPVA 1H8BA 1O4OA 2BE6A 1L2OC 2L3TA 3FS7A 4F5AA 2FOTA 2KGRA 2MLEC 1KSWA 5F6TA 1FYRA 1GRIA 2IUIA 3NXAA 1YX8A 3I5FB 4UPGA 4JEGA 2KFGA 1W7IB 3H4SE 1ZFSA 2K61A 3MXYA 1JUOA 3AKBA 4K11A 1G33A 1IQ3A 3TDUA 1RROA 1DF0B 4DIRA 3VRZA 1K9PA 1QG1E 1UWOA 2O60A 2ZRSA 1B9AA 1QV1A 1SMGA 1QIVA 3I5GC 1KWOC 4YRUA 2BBNA 4WQ2A 2AOBA 4EIHA 2EC6C 2VRGA 5G08A 3N7YA 1JWDA 3DF0B 4P9ZA 1AJ5A 1O47A 1XA6A 3EAZA 4QJ4B 2K7OA 3M7FA 1KK7Y 1DJZA 4F59A 2I94A 1CLBA 1UHKA 1OE9B 1S6JA 1KWOB 2COLB 2PMYA 1RTP1 2HPSA 2LVJA 1F4OA 4MZJA 4AOMA 1BF5A 1QXPA 1A75A 2F2OA 1O4KA 2OS8B 1A1CA 3GXWA 4AQJA 1JYUA 1NRVA 1TOPA 2JPTA 4YGEB 1UHNA 1ZOTB 1S3PA 1AHRA 3MSEB 4JQ0D 2B1UA 1A03A 3GK4X 4NDCA 3CR4X 3TZ1A 1SHBA 1Y57A 1P13A 2CTNA 1CDNA 1FI6A 1OO3A 2BL0B 5CPVA 4I5JA 1KCYA 1B7TZ 1OZOA 4CFQA 1CJ1A 1CFDA 1NYAA 5AULA 1KFXS 1SYMA 3PJPA 4ETOA 2DX0A 1O4LA 1OPLA 4YBHB 3OX5A 1XO5A 1WDCB 1M27A 4QJ5B 1O4DA 1DJHA 2NXQA 2V53A 2JT3A 4WRIA 1SHAA 3CLNA 4U8DA 2SRCA 4GNKB 3CBLA 3N8MA 1WRKA 3TUYB 3LL8B 1RWYA 1JFJA 1F54A 1DJWA 2KHNA 1VRKA 1BMBA 2BECA 1D4TA 1S1EA 1O46A 1CDMA 1SCVA 1WLZA 2F3YA 2KFFA 1J1DA 5CSFA 1ZFPE 1QTXA 3UYOA 2KFHA 1QVIY 2MBXA 2KSPA 1IJRA 1RK9A 1R1PA 3QWXX 2BCBA 4Q04A 1MQ1A 5CSIA 2JQ6A 5HKZA 1B4CA 1SBJA 2OZOA 1FHSA 3AAJA 4C0JA 1BOCA 1LXFC 1A08A 1O48A 2KYCA 2H5KA 2K7AB 3IMDA 4NWFA 3EKHA 2HMHA 2WNDA 1Y0VH 2ETZA 5DKNA 1M31A 1NX0A 1OSAA 2AUGA 4HRGA 3VROA 2M7NA 3CS1A 4GBAA 4E93A 1ZUZA 4MLWA 1LVCD 1XFYO 2K7DA 4FTGA 2JU0A 1M46A 1MUXA 2KGBC 2EYYA 3A8RA 1TCFA 2LMUA 1K9KA 2CS0A 1J7QA 2SHPA 5AANA 1SRAA 3VS1A 4ORCB 1LCKA 1O45A 2KBMA 3FWCA 2MA2A 3CR2A 2LUXA 5KU1A 4OHLA 3TDIA 1OQPA 1O4QA 3C7IA 1O4NA 4HSZA 1JF0A 2MK2A 1NCYA 1KQMC 5I6VA 1K9AA 4MEWA 4MZKA 2LP2A 2JRFA 3WA4A 2DOQA 3HCMA 1A1BA 1J7PA 1BR1B 3O78A 1YVLA 1LA3A 1DT7B 1XFZO 2Q91A 2KAYA 1UHJA 1MHOA 1SKJA 3ZWHA 2KOTA 2XP1A 2FCEA 2ZN9A 3CXLA 1WRLA 3ICBA 1AOTF 1CWDL 2LNWA 1BKLA 4N1GA 1YRUB 3DVKA 2P6BB 3BOWA 2GGMA 1JBAA 2LQWA 3WHTB 2F33A 2L0PA 3JTDC 1F2FA 1NX2A 1A75B 1NX3A 1QLKA 1SK6D 2LLUA 1QX2A 1KFUS 4N5XA 3WNXB 3KO0A 2EYZA 3LK0A 1A29A 1BR4B 2JULA 3CZTX 4ORBB 4C0KA 3VS0A 4BY5A 3QRXA 2KDHA 4JGHA 3VS2A 1TNPA 1CFFA 4P5OE 2M0RA 3JTDB 3IQQA 4LUEA 1HCTB 1QIWA 4YGCB 3WXAA 3IN7A 5IBMA 5AERA 3VRPA 3OHMB 1JC2A 2JXLA 4HREE 1CFPA 2ISDA 1J55A 2JWWA 2K8MB 2M3WA 1BM2A 1CB1A 2JNFA 3I5FC 1TCOB 1WRZA 2NZ0A 4DCKA 1BG1A 1C07A 3CD3A 3KF9A 1O42A 2F8PA 1QX5B 5EHRA 2CRHA 1DVIA 4PALA 1F1WA 1CSYA 2L5XB 3KEVA 1O4AA 3OV1A 3BUNB 1FU5A 2IZVA 3TKZA 4PE7A 3EK8A 1SL9A 2BKHB 2M29A 3WHUB 1AYCA 2K7CA 2MC1A 4E68A 1BFIA 1CWEA 3FWBA 4ZCVA 2M1KB 1BODA 5DKRA 4JPZB 4MN0A 2KAXA 2M97A 4XJKA 2EHBA 3M0WA 3PN7B 2H61A 3BUOB 5CSNA 3CGAA 1WLMA 5KSZA 2EU0A 3D10A 3GK2A 3ZNIA 3HIZB 2RVFA 1M45A 2NLNA 4GFTA 1AYBA 1LA0A 4F0ZB 3QWYA 5D69A 3AAKA 1O41A 1BHHA 3BUWB 1R1SA 4QSYA 1W7JB 1MWNA 5I8NA 1KSMA 2G9BA 1KC2A 4M2PA 4OVNF 5D7FA 2OS8C 2Y1NA 2I18A 1UURA 2BCAA 3NSLA 1DJXA 3D0YB 2JC2A 4I5KA 4I5NB 2CR4A 2KNOA 2EKXA 4PCWA 2LNKA 2MLFC 2FCIA 3AKAA 2KQYA 2CI9A 1TNWA 3UF4A 5IBSA 3SG6A 5AEQA 4YGDB 1S5GY 1WY9A 3DD4A 1FI5A 2WC8A 3NSIA 2BL0C 4MRXA 1SNLA 1SPYA 4GGFC 1XYDA 1ALVA 2JT0A 2LANA 1NUBA 2M7LA 3VGOA 1O4PA 1FPWA 1X27A 2LCTA 3MAZA 4PHMA 1XK4A 3RLZA 1MILA 2GE9A 1IJ6A 1WDCC 2QPTA 2PVBA 4DS7A 4BTFA 2Y1MA 2WCFA 1Y1AA 3LLEA 1LCJA 2RMXA 3BOWB 1IGVA 2I2RE 4GPLB 1JFKA 3TUYC 1QATA 1EL4A 1YVHA 4M2OA 4JE4A 4ICBA 3TL0A 3S8OA 1CMFA 1HT9A 2A4JA 4DGXA 4D8KA 1K8UA 4NDDA 3SIBA 1KSOA 3SG5A 1BJFA 1YX7A 4L9MA 1X02A 1J7OA 1OMVA 2KK6A 5K89A 1PSBA 3BKBA 4PE0A 5JJGA 2KQ6A 2MQIA 4DRWA 2YSXA 1YTZC 1QJTA 4IL1A 5KTYA 1YRTB 1SPRA 1EG4A 5ER4X 4EY0A 4CLNA 2LQNA 1V1FA 4PHNA 2JT8A 1E8AA 2PALA 1PVAA 2ZN8A 1O4JA 1KK7Z 2HETA 1M39A 2FCDA 2QACA 3BUMB 2H8HA 2PLDA 1BLJA 1IJ5A 1B8CA 3PM8A 2IS9A 2KI4B 1X0NA 2L98A 2K2FA 2LMTA 1JYQA 2TN4A 3PQZA 2Y5IA 1BLKA 2HCKA 3SIAA 5HKYA 1Z3KA 1AVSA 1K94A 1CLLA 3TS5B 1CTRA 5DKQA 1PULA 1R2UA 3PFVA 1O4FA 5B8IB 2E6WA 1UP5A 2MRJA 4JWQA 3VS5A 4M2QA 2C0TA 4MBEA 1NP8A 1OMDA 2C9WA 3O6BA 2LNXA 3EVUA 3OB1B 4OHIA 5I2OA 1Y1XA 4CFRA 3VRQA 1G4YR 1O44A 2WCBA 1AK8A 1A1EA 1RPYA 1JYRA 1SCMC 1DTLA 4XJKB 1IQ5A 1O49A 2LMVA 2KNEA 1O43A 4WWQA 2JYQA 1A4PA 1AYAA 2LLTA 2EO6A 2HQWA 1S6CA 1ZMZA 5PALA 3OP0A 2LV7A 1GGWA 3EACA 1KA7A 1YUTA 1JU5A 2PTKA 1SY9A 1NWDA 2R2IA 1CDPA 3DVMA 2Q4UA 3BYAA 4A4CA 1BHHB 3PALA 4U17A 1MXLC 1LUMA 1N65A 4TNCA 1SCMB 3S8LA 1SL8A 5EELA 3VRNA 1O4CA 3I5IB 2BBUA 1QVIZ 2DLZA 3PSKA 5DF6A 3PLFB 3S9KA 1OPKA 1EXRA 1LKJA 1DJYA 4YGAA 5I2LA 3IMJA 4L1BB 4USLA 1RJAA 2ECDA 1IRJA 4P9VA 1B8RA 2C0OA 1SR6B 3MXCA 2F2PA 3O4YA 3EK7A 1CKKA 2OTGB 1A07A 1NSHA 2H2KA 1F70A 2CI8A 1KFXL 4DGPA 3RM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTN A;  3EKJ A;  5KAZ A;  1SPS A;  3BUX B;  1UHH A;  3VS7 A;  1MXE A;  1FW4 A;  1EJ3 A;  2HF5 A;  2LHL A;  1H4B A;  4MZL A;  1TCE A;  1D1Z A;  1RJV A;  2L4H A;  1A1A A;  1D4W A;  2H46 E;  2LVK A;  2AUC A;  4K2R A;  5GJH A;  1TZE E;  1K96 A;  1AD5 A;  1QS7 A;  1Q80 A;  4AQI A;  3K21 A;  1TNX A;  3C1V A;  3I5H B;  4ROJ A;  3SG7 A;  1LUI A;  5HLV A;  1CDL A;  3VS4 A;  2EGD A;  4H1O A;  1K2H A;  2ZRT A;  4OHE A;  1PSR A;  5BO4 A;  1F4Q A;  3PN7 C;  1SW8 A;  1G8I A;  2MAZ A;  4GGN A;  2GGZ A;  2CNP A;  1KK8 C;  1OO4 A;  2FO0 A;  2M1U A;  4FBN A;  1QV0 A;  2BKI B;  2K7B A;  3EVR A;  3A4U B;  2LHI A;  3HX4 A;  2AOA A;  3K2M A;  1C7W A;  1MF8 B;  1WQU A;  2LLS A;  2SCP A;  4PDZ A;  4BY4 A;  1FMK A;  1PVB A;  4N1F A;  2EYV A;  1Y6W A;  2JZI A;  5EHP A;  3SG2 A;  2WOR A;  1S26 D;  4GUK A;  5GQQ C;  1KK8 B;  1NPQ A;  2ZND A;  2DCR A;  2PNB A;  1OMR A;  1YR5 A;  2KAV A;  2EOB A;  5DC0 B;  1CM1 A;  2ZNE A;  3BQ3 A;  2NCP A;  3OX6 A;  1FBZ A;  4MRY A;  1O4I A;  2L6K A;  5AFP A;  1LKK A;  2SAS A;  1J1E A;  1IH0 A;  1KA6 A;  3FIA A;  1BMO A;  2MRK A;  1BHF A;  1LUN A;  1DGU A;  4PE1 A;  1PK0 D;  1AP4 A;  2HDX A;  3N84 A;  5EG3 B;  3JVT B;  3PSR A;  4NQG A;  1GGZ A;  3HHM B;  1GJY A;  1TRF A;  1XVJ A;  2CXJ A;  2OPO A;  1SKT A;  2ZKM X;  1A09 A;  4QJ3 B;  1B7T Y;  1L2O B;  1AUI B;  1K95 A;  1QX7 A;  1CNP A;  1BLQ A;  1G83 A;  2RGI A;  4K44 A;  5HKW A;  1ODB A;  3KPX A;  1PAL A;  4OHH A;  4TZI A;  1KFU L;  3OB2 B;  1M63 B;  5TNC A;  3LCP C;  2JXC A;  2I7A A;  2KI6 D;  1YUU A;  4WQ3 A;  1XFV O;  2LC5 A;  1EH2 A;  3SJS A;  1TTX A;  1JSA A;  5GJI A;  3BXK A;  3CR5 X;  1D1O A;  1BFJ A;  1O4H A;  4NDB A;  3SG3 A;  2LM5 A;  1QLS A;  1YUS A;  2Y3A B;  1NZL A;  1QAD A;  2KBI A;  4FL2 A;  1UHI A;  2FJU B;  2K79 B;  1NIW A;  1B47 A;  1K93 D;  1TIZ A;  2L4I A;  3I5G B;  1N0Y A;  1F55 A;  1SHD A;  2D8N A;  2KI4 C;  1I3Z A;  2MRD A;  1NCX A;  2NCO A;  2DM0 A;  2EC6 B;  4YI9 A;  1N2D A;  3TS5 C;  1R1Q A;  2LVI A;  4CID A;  3VS3 A;  2L4K A;  1DJG A;  2AMI A;  4I5L B;  2HUW A;  1Y1U A;  1U5I A;  2IUG A;  2MHH A;  1MR8 A;  4C0L A;  5EEQ A;  2JNX A;  2BCX A;  1IWQ A;  1O4R A;  2C0I A;  1S5G Z;  4MSP A;  5JOL A;  2LVV A;  1HQV A;  3LK1 A;  2CIA A;  2VIF A;  4K45 A;  4LUD A;  4XYN A;  1C7V A;  3VS6 A;  1SL7 A;  4OKH A;  4F5B A;  3T04 A;  1UUS A;  4PHK A;  4PHJ A;  2H61 C;  4U1P A;  1J7R A;  1V1G A;  4OR9 B;  4D1E A;  1IS0 A;  1PIC A;  4A4B A;  1GHU A;  1O4E A;  5DC9 A;  3GXX A;  1DMO A;  4X6S A;  5CSJ A;  1DJI A;  1YUR A;  2CT9 A;  1IKU A;  1RQQ C;  2ROR A;  1JF2 A;  3GOF A;  2HDV A;  1ALW A;  2PSR A;  3SG4 A;  3I5I C;  1FU6 A;  2LE9 B;  4MVF A;  1DGV A;  3NSO A;  4ORA B;  1QCF A;  4OCI A;  2ABL A;  2RSY A;  2JTT A;  2MJW B;  2Y4Q A;  3PSJ A;  3GK1 A;  1CFC A;  1CSZ A;  1DF0 A;  1IG5 A;  4OV2 A;  5HLO A;  3VRR A;  1GQM A;  3EK4 A;  2O5G A;  4YI8 A;  4XZ1 A;  1XA5 A;  4FQO A;  5BPJ A;  1BKM A;  2QMS A;  1M61 A;  1SR6 C;  1O4G A;  2HQ8 A;  3NHN A;  4M4Z A;  1LIN A;  2OTG C;  2LCP A;  2WCE A;  4ZCU A;  4YGB B;  1XK4 C;  2BE4 A;  3PS5 A;  4GWF A;  1AOU F;  4HRH A;  1HCS B;  2DLY A;  1AYD A;  3DF0 A;  2PLE A;  1XFU O;  3DVE A;  2AAO A;  3D0Y A;  1JWO A;  2JOJ A;  2K2A A;  1S6I A;  1F8H A;  3GQI B;  4H34 A;  1MW4 A;  2LP3 A;  3NSK A;  2LAP A;  1XFX O;  2GV5 A;  1KQV A;  2GSB A;  4GL9 E;  1XFW O;  1CMG A;  2K0J A;  1CLM A;  4NWG A;  5I2Q A;  4DUQ A;  2L2E A;  2L51 A;  3I5H C;  3O2P A;  1NX1 A;  5ER5 A;  5AXI A;  1TNQ A;  2KYF A;  3IF7 A;  5HYD A;  1H9O A;  2DVJ A;  1CM4 A;  5CDW A;  3KHE A;  2EL8 A;  1B8L A;  1BU3 A;  2M9G A;  1L7Z A;  1A2X A;  3EVV A;  3S8N A;  1S36 A;  2BBM A;  1QAS A;  2LUC A;  2L50 A;  3TDZ A;  4PE4 A;  2IUH A;  1B1G A;  2M49 B;  2F3Z A;  1NZV A;  1KQM B;  1RFJ A;  1TN4 A;  1PRW A;  1OOJ A;  4GGF A;  1R6P A;  2JTZ A;  2KI6 C;  2B3O A;  2OQ1 A;  5DC4 A;  1NCZ A;  3HCK A;  3DVJ A;  1LKL A;  4FL3 A;  1O4M A;  2PNA A;  3VRY A;  3US4 A;  1U5I B;  1A81 A;  1LUK A;  3OVE A;  1K9U A;  1OZS A;  2M8U A;  2EO3 A;  4P2Y B;  1FF1 A;  3E3R A;  1BT6 A;  5IBW A;  5D0J A;  1AJ4 A;  4XZ0 A;  3KFJ A;  1REC A;  3PAT A;  1EG3 A;  2CCM A;  2PRU A;  4GAO A;  5FYX A;  1F71 A;  2E30 A;  2YU7 A;  1AB2 A;  1O4B A;  3IQO A;  4R1E A;  3IN8 A;  4OHD A;  5J3X A;  3CWG A;  1ZAC A;  2ZFD A;  3JVT C;  2WOS A;  1FBV A;  2G2B A;  3F45 A;  1X6C A;  2CBL A;  1K90 D;  2PAS A;  4CPV A;  1H8B A;  1O4O A;  2BE6 A;  1L2O C;  2L3T A;  3FS7 A;  4F5A A;  2FOT A;  2KGR A;  2MLE C;  1KSW A;  5F6T A;  1FYR A;  1GRI A;  2IUI A;  3NXA A;  1YX8 A;  3I5F B;  4UPG A;  4JEG A;  2KFG A;  1W7I B;  3H4S E;  1ZFS A;  2K61 A;  3MXY A;  1JUO A;  3AKB A;  4K11 A;  1G33 A;  1IQ3 A;  3TDU A;  1RRO A;  1DF0 B;  4DIR A;  3VRZ A;  1K9P A;  1QG1 E;  1UWO A;  2O60 A;  2ZRS A;  1B9A A;  1QV1 A;  1SMG A;  1QIV A;  3I5G C;  1KWO C;  4YRU A;  2BBN A;  4WQ2 A;  2AOB A;  4EIH A;  2EC6 C;  2VRG A;  5G08 A;  3N7Y A;  1JWD A;  3DF0 B;  4P9Z A;  1AJ5 A;  1O47 A;  1XA6 A;  3EAZ A;  4QJ4 B;  2K7O A;  3M7F A;  1KK7 Y;  1DJZ A;  4F59 A;  2I94 A;  1CLB A;  1UHK A;  1OE9 B;  1S6J A;  1KWO B;  2COL B;  2PMY A;  1RTP 1;  2HPS A;  2LVJ A;  1F4O A;  4MZJ A;  4AOM A;  1BF5 A;  1QXP A;  1A75 A;  2F2O A;  1O4K A;  2OS8 B;  1A1C A;  3GXW A;  4AQJ A;  1JYU A;  1NRV A;  1TOP A;  2JPT A;  4YGE B;  1UHN A;  1ZOT B;  1S3P A;  1AHR A;  3MSE B;  4JQ0 D;  2B1U A;  1A03 A;  3GK4 X;  4NDC A;  3CR4 X;  3TZ1 A;  1SHB A;  1Y57 A;  1P13 A;  2CTN A;  1CDN A;  1FI6 A;  1OO3 A;  2BL0 B;  5CPV A;  4I5J A;  1KCY A;  1B7T Z;  1OZO A;  4CFQ A;  1CJ1 A;  1CFD A;  1NYA A;  5AUL A;  1KFX S;  1SYM A;  3PJP A;  4ETO A;  2DX0 A;  1O4L A;  1OPL A;  4YBH B;  3OX5 A;  1XO5 A;  1WDC B;  1M27 A;  4QJ5 B;  1O4D A;  1DJH A;  2NXQ A;  2V53 A;  2JT3 A;  4WRI A;  1SHA A;  3CLN A;  4U8D A;  2SRC A;  4GNK B;  3CBL A;  3N8M A;  1WRK A;  3TUY B;  3LL8 B;  1RWY A;  1JFJ A;  1F54 A;  1DJW A;  2KHN A;  1VRK A;  1BMB A;  2BEC A;  1D4T A;  1S1E A;  1O46 A;  1CDM A;  1SCV A;  1WLZ A;  2F3Y A;  2KFF A;  1J1D A;  5CSF A;  1ZFP E;  1QTX A;  3UYO A;  2KFH A;  1QVI Y;  2MBX A;  2KSP A;  1IJR A;  1RK9 A;  1R1P A;  3QWX X;  2BCB A;  4Q04 A;  1MQ1 A;  5CSI A;  2JQ6 A;  5HKZ A;  1B4C A;  1SBJ A;  2OZO A;  1FHS A;  3AAJ A;  4C0J A;  1BOC A;  1LXF C;  1A08 A;  1O48 A;  2KYC A;  2H5K A;  2K7A B;  3IMD A;  4NWF A;  3EKH A;  2HMH A;  2WND A;  1Y0V H;  2ETZ A;  5DKN A;  1M31 A;  1NX0 A;  1OSA A;  2AUG A;  4HRG A;  3VRO A;  2M7N A;  3CS1 A;  4GBA A;  4E93 A;  1ZUZ A;  4MLW A;  1LVC D;  1XFY O;  2K7D A;  4FTG A;  2JU0 A;  1M46 A;  1MUX A;  2KGB C;  2EYY A;  3A8R A;  1TCF A;  2LMU A;  1K9K A;  2CS0 A;  1J7Q A;  2SHP A;  5AAN A;  1SRA A;  3VS1 A;  4ORC B;  1LCK A;  1O45 A;  2KBM A;  3FWC A;  2MA2 A;  3CR2 A;  2LUX A;  5KU1 A;  4OHL A;  3TDI A;  1OQP A;  1O4Q A;  3C7I A;  1O4N A;  4HSZ A;  1JF0 A;  2MK2 A;  1NCY A;  1KQM C;  5I6V A;  1K9A A;  4MEW A;  4MZK A;  2LP2 A;  2JRF A;  3WA4 A;  2DOQ A;  3HCM A;  1A1B A;  1J7P A;  1BR1 B;  3O78 A;  1YVL A;  1LA3 A;  1DT7 B;  1XFZ O;  2Q91 A;  2KAY A;  1UHJ A;  1MHO A;  1SKJ A;  3ZWH A;  2KOT A;  2XP1 A;  2FCE A;  2ZN9 A;  3CXL A;  1WRL A;  3ICB A;  1AOT F;  1CWD L;  2LNW A;  1BKL A;  4N1G A;  1YRU B;  3DVK A;  2P6B B;  3BOW A;  2GGM A;  1JBA A;  2LQW A;  3WHT B;  2F33 A;  2L0P A;  3JTD C;  1F2F A;  1NX2 A;  1A75 B;  1NX3 A;  1QLK A;  1SK6 D;  2LLU A;  1QX2 A;  1KFU S;  4N5X A;  3WNX B;  3KO0 A;  2EYZ A;  3LK0 A;  1A29 A;  1BR4 B;  2JUL A;  3CZT X;  4ORB B;  4C0K A;  3VS0 A;  4BY5 A;  3QRX A;  2KDH A;  4JGH A;  3VS2 A;  1TNP A;  1CFF A;  4P5O E;  2M0R A;  3JTD B;  3IQQ A;  4LUE A;  1HCT B;  1QIW A;  4YGC B;  3WXA A;  3IN7 A;  5IBM A;  5AER A;  3VRP A;  3OHM B;  1JC2 A;  2JXL A;  4HRE E;  1CFP A;  2ISD A;  1J55 A;  2JWW A;  2K8M B;  2M3W A;  1BM2 A;  1CB1 A;  2JNF A;  3I5F C;  1TCO B;  1WRZ A;  2NZ0 A;  4DCK A;  1BG1 A;  1C07 A;  3CD3 A;  3KF9 A;  1O42 A;  2F8P A;  1QX5 B;  5EHR A;  2CRH A;  1DVI A;  4PAL A;  1F1W A;  1CSY A;  2L5X B;  3KEV A;  1O4A A;  3OV1 A;  3BUN B;  1FU5 A;  2IZV A;  3TKZ A;  4PE7 A;  3EK8 A;  1SL9 A;  2BKH B;  2M29 A;  3WHU B;  1AYC A;  2K7C A;  2MC1 A;  4E68 A;  1BFI A;  1CWE A;  3FWB A;  4ZCV A;  2M1K B;  1BOD A;  5DKR A;  4JPZ B;  4MN0 A;  2KAX A;  2M97 A;  4XJK A;  2EHB A;  3M0W A;  3PN7 B;  2H61 A;  3BUO B;  5CSN A;  3CGA A;  1WLM A;  5KSZ A;  2EU0 A;  3D10 A;  3GK2 A;  3ZNI A;  3HIZ B;  2RVF A;  1M45 A;  2NLN A;  4GFT A;  1AYB A;  1LA0 A;  4F0Z B;  3QWY A;  5D69 A;  3AAK A;  1O41 A;  1BHH A;  3BUW B;  1R1S A;  4QSY A;  1W7J B;  1MWN A;  5I8N A;  1KSM A;  2G9B A;  1KC2 A;  4M2P A;  4OVN F;  5D7F A;  2OS8 C;  2Y1N A;  2I18 A;  1UUR A;  2BCA A;  3NSL A;  1DJX A;  3D0Y B;  2JC2 A;  4I5K A;  4I5N B;  2CR4 A;  2KNO A;  2EKX A;  4PCW A;  2LNK A;  2MLF C;  2FCI A;  3AKA A;  2KQY A;  2CI9 A;  1TNW A;  3UF4 A;  5IBS A;  3SG6 A;  5AEQ A;  4YGD B;  1S5G Y;  1WY9 A;  3DD4 A;  1FI5 A;  2WC8 A;  3NSI A;  2BL0 C;  4MRX A;  1SNL A;  1SPY A;  4GGF C;  1XYD A;  1ALV A;  2JT0 A;  2LAN A;  1NUB A;  2M7L A;  3VGO A;  1O4P A;  1FPW A;  1X27 A;  2LCT A;  3MAZ A;  4PHM A;  1XK4 A;  3RLZ A;  1MIL A;  2GE9 A;  1IJ6 A;  1WDC C;  2QPT A;  2PVB A;  4DS7 A;  4BTF A;  2Y1M A;  2WCF A;  1Y1A A;  3LLE A;  1LCJ A;  2RMX A;  3BOW B;  1IGV A;  2I2R E;  4GPL B;  1JFK A;  3TUY C;  1QAT A;  1EL4 A;  1YVH A;  4M2O A;  4JE4 A;  4ICB A;  3TL0 A;  3S8O A;  1CMF A;  1HT9 A;  2A4J A;  4DGX A;  4D8K A;  1K8U A;  4NDD A;  3SIB A;  1KSO A;  3SG5 A;  1BJF A;  1YX7 A;  4L9M A;  1X02 A;  1J7O A;  1OMV A;  2KK6 A;  5K89 A;  1PSB A;  3BKB A;  4PE0 A;  5JJG A;  2KQ6 A;  2MQI A;  4DRW A;  2YSX A;  1YTZ C;  1QJT A;  4IL1 A;  5KTY A;  1YRT B;  1SPR A;  1EG4 A;  5ER4 X;  4EY0 A;  4CLN A;  2LQN A;  1V1F A;  4PHN A;  2JT8 A;  1E8A A;  2PAL A;  1PVA A;  2ZN8 A;  1O4J A;  1KK7 Z;  2HET A;  1M39 A;  2FCD A;  2QAC A;  3BUM B;  2H8H A;  2PLD A;  1BLJ A;  1IJ5 A;  1B8C A;  3PM8 A;  2IS9 A;  2KI4 B;  1X0N A;  2L98 A;  2K2F A;  2LMT A;  1JYQ A;  2TN4 A;  3PQZ A;  2Y5I A;  1BLK A;  2HCK A;  3SIA A;  5HKY A;  1Z3K A;  1AVS A;  1K94 A;  1CLL A;  3TS5 B;  1CTR A;  5DKQ A;  1PUL A;  1R2U A;  3PFV A;  1O4F A;  5B8I B;  2E6W A;  1UP5 A;  2MRJ A;  4JWQ A;  3VS5 A;  4M2Q A;  2C0T A;  4MBE A;  1NP8 A;  1OMD A;  2C9W A;  3O6B A;  2LNX A;  3EVU A;  3OB1 B;  4OHI A;  5I2O A;  1Y1X A;  4CFR A;  3VRQ A;  1G4Y R;  1O44 A;  2WCB A;  1AK8 A;  1A1E A;  1RPY A;  1JYR A;  1SCM C;  1DTL A;  4XJK B;  1IQ5 A;  1O49 A;  2LMV A;  2KNE A;  1O43 A;  4WWQ A;  2JYQ A;  1A4P A;  1AYA A;  2LLT A;  2EO6 A;  2HQW A;  1S6C A;  1ZMZ A;  5PAL A;  3OP0 A;  2LV7 A;  1GGW A;  3EAC A;  1KA7 A;  1YUT A;  1JU5 A;  2PTK A;  1SY9 A;  1NWD A;  2R2I A;  1CDP A;  3DVM A;  2Q4U A;  3BYA A;  4A4C A;  1BHH B;  3PAL A;  4U17 A;  1MXL C;  1LUM A;  1N65 A;  4TNC A;  1SCM B;  3S8L A;  1SL8 A;  5EEL A;  3VRN A;  1O4C A;  3I5I B;  2BBU A;  1QVI Z;  2DLZ A;  3PSK A;  5DF6 A;  3PLF B;  3S9K A;  1OPK A;  1EXR A;  1LKJ A;  1DJY A;  4YGA A;  5I2L A;  3IMJ A;  4L1B B;  4USL A;  1RJA A;  2ECD A;  1IRJ A;  4P9V A;  1B8R A;  2C0O A;  1SR6 B;  3MXC A;  2F2P A;  3O4Y A;  3EK7 A;  1CKK A;  2OTG B;  1A07 A;  1NSH A;  2H2K A;  1F70 A;  2CI8 A;  1KFX L;  4DGP A;  3RM1 A; 
#chains in the Genus database with same CATH topology
 3EKJ A;  1SPS A;  1UHH A;  1FW4 A;  1H4B A;  2LHL A;  4MZL A;  1D1Z A;  1A1A A;  1AD5 A;  1DEK A;  2GTE A;  3C1V A;  3I5H B;  5HLV A;  2XPL A;  2ZRT A;  1PSR A;  2MAZ A;  2FO0 A;  3B87 A;  1OO4 A;  2XEG A;  2M1U A;  2ERB A;  2C6C A;  4PDZ A;  2EYV A;  1Y6W A;  5EHP A;  4P4B A;  4GUK A;  1NPQ A;  2PNB A;  2EOB A;  3SJX A;  2ZNE A;  1O4I A;  1LKK A;  1KA6 A;  1IH0 A;  1BMO A;  2MRK A;  2HDX A;  1Z2C B;  1TRF A;  1XVJ A;  1SKT A;  3HPG G;  4K44 A;  1BLQ A;  5HKW A;  1PAL A;  3S0F A;  3O4X A;  3LCP C;  2JXC A;  2LC5 A;  5GJI A;  3SJS A;  3CR5 X;  3NHI A;  2LM5 A;  1NZL A;  2K79 B;  1B47 A;  3L4A A;  3I5G B;  1F55 A;  1N0Y A;  1SHD A;  2D8N A;  2KI4 C;  1NCX A;  3O8Z A;  4YI9 A;  2WC5 A;  2LVI A;  4I5L B;  3D73 A;  2PQL A;  2MHH A;  2VIF A;  3Q8I A;  4OKH A;  1UUS A;  1C3Y A;  3FEC A;  4PHK A;  2H61 C;  1J7R A;  4D1E A;  1O4E A;  1DMO A;  4X6S A;  2CT9 A;  2ROR A;  3GOF A;  1XFR A;  4MCQ A;  3SG4 A;  2KPH A;  3SJF A;  3PSJ A;  1IG5 A;  3VRR A;  3EK4 A;  2O5G A;  4FQO A;  1BKM A;  1O4G A;  4OC5 A;  2LCP A;  3R72 A;  2PLE A;  2K2A A;  1F8H A;  4GL9 E;  2LAP A;  2GV5 A;  3S0D A;  4DUQ A;  1NX1 A;  1CM4 A;  2M9G A;  1L7Z A;  1A2X A;  1S36 A;  2K60 A;  3TDZ A;  2IUH A;  1KQM B;  1RFJ A;  3D7G A;  1PRW A;  2OQ1 A;  2JTZ A;  2KI6 C;  5DC4 A;  3CYZ A;  4OME A;  1LKL A;  1OOF A;  1K9U A;  1OZS A;  1FF1 A;  4BPX B;  3E3R A;  5IBW A;  1REC A;  2YU7 A;  2G2B A;  1H8B A;  2MLE C;  1KSW A;  1GRI A;  2P70 A;  1YX8 A;  3I5F B;  1JUO A;  1G33 A;  1IQ3 A;  3KAS A;  1K9P A;  1TUJ A;  2ZRS A;  1QIV A;  2AOB A;  1KWO C;  4WQ2 A;  1JWD A;  3DF0 B;  4QJ4 B;  1KK7 Y;  1DJZ A;  1A75 A;  1O4K A;  1A1C A;  3GXW A;  3N7H A;  1DEL A;  4YGE B;  1UHN A;  1AHR A;  3MSE B;  4JQ0 D;  2CTN A;  3DXL A;  1CDN A;  1OO3 A;  5CPV A;  1OZO A;  2WCM A;  4CFQ A;  1XO5 A;  1O4D A;  1SHA A;  2JT3 A;  4WRI A;  3CLN A;  3N8M A;  4GNK B;  3LL8 B;  1F54 A;  1DJW A;  2BEC A;  1CDM A;  1ZFP E;  2F3Y A;  5CSF A;  2KFH A;  1QVI Y;  1RK9 A;  2BCB A;  5CSI A;  5HKZ A;  5F13 A;  1O48 A;  3IMD A;  4OC2 A;  2HMH A;  2WND A;  2ETZ A;  1OSA A;  5F09 A;  4MLW A;  1MUX A;  1K9K A;  2SHP A;  2KBM A;  5KU1 A;  2LUX A;  3C7I A;  2MK2 A;  1K9A A;  4MEW A;  4MZK A;  1LA3 A;  2Q91 A;  1MHO A;  1SKJ A;  2ZN9 A;  3CXL A;  2LNW A;  3DVK A;  2F33 A;  3JTD C;  1F2F A;  3DZT A;  2EYZ A;  1BR4 B;  2JUL A;  3QRX A;  1QIW A;  3WXA A;  3VRP A;  1OOI X;  4HRE E;  1CFP A;  2ISD A;  1J55 A;  2JWW A;  2M3W A;  4DCK A;  3D7D A;  1O42 A;  5EHR A;  1DVI A;  2L5X B;  3KEV A;  3BUN B;  1FU5 A;  3TKZ A;  3CZ0 A;  2BKH B;  3WHU B;  4ZCV A;  4JPZ B;  2EHB A;  3PN7 B;  3ZNI A;  2VKZ G;  4NGT A;  4JYW A;  1BHH A;  3BUW B;  1MWN A;  2G9B A;  4OVN F;  5D7F A;  2OS8 C;  3UNW A;  1UUR A;  4I5N B;  2KNO A;  3CDN A;  4PCW A;  3S0E A;  2KQY A;  1TNW A;  5IBS A;  4YGD B;  4NGS A;  3DD4 A;  2LAN A;  1ALV A;  2JT0 A;  3CAB A;  1NUB A;  2M7L A;  1X27 A;  1MIL A;  3VB1 A;  2QPT A;  1WDC C;  4BTF A;  2Y1M A;  1C3Z A;  1JFK A;  3TUY C;  1QAT A;  1YVH A;  3S8O A;  1HT9 A;  3SG5 A;  4L9M A;  3SS4 A;  3BKB A;  4PE0 A;  2KQ6 A;  5KTY A;  4CLN A;  2JT8 A;  1PVA A;  2ZN8 A;  1O4J A;  1M39 A;  2QAC A;  4JKT A;  3PM8 A;  1JYQ A;  2HCK A;  3RZS A;  1AVS A;  1K94 A;  3TS5 B;  1CTR A;  1R2U A;  4JWQ A;  3VS5 A;  5I2O A;  1A1E A;  1RPY A;  1DTL A;  1O49 A;  2LMV A;  1O43 A;  3EG5 B;  3EAC A;  1ZMZ A;  5PAL A;  3OP0 A;  2LV7 A;  1Z8L A;  1YUT A;  1JU5 A;  2Q4U A;  3BYA A;  4TNC A;  1SCM B;  1SL8 A;  5EEL A;  3S0B A;  4YGA A;  1DJY A;  3CZ2 A;  4USL A;  3O4Y A;  1OW4 A;  1CKK A;  3IWW A;  5ELY A;  2H2K A;  5KAZ A;  1K96 A;  4LQG A;  1QS7 A;  2WCK A;  4ROJ A;  3SG7 A;  4H1O A;  4OHE A;  1F4Q A;  1G8I A;  2BKI B;  2K7B A;  3HX4 A;  3BFA A;  3K2M A;  1C7W A;  1FMK A;  1PVB A;  4N1F A;  2JZI A;  2ZND A;  2DCR A;  1OMR A;  1CM1 A;  1SSE B;  2XEI A;  1BHF A;  1LUN A;  3S9L A;  3JVT B;  3D74 A;  3HHM B;  3FEE A;  2OPO A;  1G83 A;  1B7T Y;  1K95 A;  4OC3 A;  3KPX A;  3OB2 B;  4OC1 A;  1EH2 A;  1JSA A;  3BXK A;  1D1O A;  4NDB A;  2Y3A B;  1QAD A;  2KBI A;  4NGQ A;  2FJU B;  1NIW A;  1TIZ A;  2MRD A;  2DM0 A;  4F7F A;  1R1Q A;  1DJG A;  1Y1U A;  2IUG A;  1MR8 A;  2JNX A;  1O4R A;  1S5G Z;  4MSP A;  1HQV A;  4LUD A;  3K1E A;  4XYN A;  4F5B A;  2XEF A;  4PHJ A;  4U1P A;  2OR4 A;  1IS0 A;  2OOT A;  1GHU A;  1IKU A;  1RQQ C;  2HDV A;  1ALW A;  3NSO A;  4ORA B;  4OCI A;  2JTT A;  2Y4Q A;  3GK1 A;  1CSZ A;  2QMS A;  3NHN A;  3NFQ A;  1LIN A;  4M4Z A;  3BJH A;  2PVW A;  3PS5 A;  4HRH A;  1EO0 A;  1AYD A;  3DF0 A;  4JZ0 A;  3DVE A;  4H34 A;  1XFX O;  1XFW O;  2KLE A;  5I2Q A;  3O2P A;  3S9N A;  5AXI A;  1H9O A;  1TNQ A;  2KYF A;  1B8L A;  1BU3 A;  2L50 A;  1NZV A;  4GGF A;  1NCZ A;  4FL3 A;  3DVJ A;  3FE8 A;  3US4 A;  1U5I B;  3KFJ A;  2CCM A;  4GAO A;  4INX A;  4R1E A;  3IN8 A;  3CWG A;  1CX8 A;  1K90 D;  4CPV A;  4F5A A;  2BE6 A;  1L2O C;  3FS7 A;  2FOT A;  2KGR A;  3OGN A;  3UO9 A;  1FYR A;  2IUI A;  3NXA A;  2KFG A;  1W7I B;  3AKB A;  4RR2 B;  1RRO A;  1DF0 B;  3VRZ A;  3D7H A;  2O60 A;  1SMG A;  4YRU A;  4EIH A;  2EC6 C;  2VRG A;  5G08 A;  3BFB A;  3M7F A;  1S6J A;  2COL B;  1LS8 A;  4MZJ A;  1QXP A;  1TOP A;  3B7A A;  2JPT A;  1DC1 A;  1ZOT B;  2B1U A;  1A03 A;  4NDC A;  1Y57 A;  1FI6 A;  2BL0 B;  4ETO A;  2DX0 A;  1OPL A;  3OX5 A;  2V53 A;  4U8D A;  3CBL A;  1RWY A;  1JFJ A;  3BHX A;  2KLD A;  4P4D A;  1O46 A;  1QTX A;  1R1P A;  1SBJ A;  3AAJ A;  1NX0 A;  3CS1 A;  4E93 A;  3D78 A;  1ZUZ A;  2JU0 A;  1M46 A;  2KGB C;  1TCF A;  2CS0 A;  5D29 A;  5AAN A;  1SRA A;  4ORC B;  2MA2 A;  1OQP A;  4HSZ A;  1J7P A;  1BR1 B;  3RBU A;  2KAY A;  1UHJ A;  3ZWH A;  2KOT A;  2QEV A;  1JBA A;  2GGM A;  1NX2 A;  2LLU A;  1QX2 A;  1KFU S;  4N5X A;  3WNX B;  4ORB B;  3VS0 A;  4JGH A;  1TNP A;  2PYQ A;  1CFF A;  2M0R A;  3IQQ A;  4LUE A;  3IN7 A;  5AER A;  1JC2 A;  2CIJ A;  2K8M B;  1C07 A;  1WRZ A;  3FE9 A;  1BG1 A;  2KGY A;  3KF9 A;  1QX5 B;  4PE7 A;  3EK8 A;  2N3A B;  2MC1 A;  3FWB A;  2M1K B;  4MN0 A;  3BI0 A;  2KAX A;  3M0W A;  5CSN A;  3HIZ B;  2NLN A;  4GFT A;  1AYB A;  1LA0 A;  1KSM A;  4M2P A;  3B6X A;  2I18 A;  3SS3 A;  2LNK A;  1WY9 A;  3PM2 A;  4JD9 A;  1SPY A;  3VGO A;  1O4P A;  2LCT A;  3MAZ A;  1XK4 A;  2GE9 A;  1Y1A A;  3LLE A;  3BOW B;  4JE4 A;  3TL0 A;  3B88 A;  3QME A;  1KSO A;  3R1P A;  1J7O A;  2KK6 A;  1PSB A;  2YGU A;  2LQN A;  2PAL A;  2PLD A;  1BLJ A;  2IS9 A;  2KI4 B;  2Y5I A;  1PUL A;  4M2Q A;  2C0T A;  1OMD A;  2LNX A;  3O6B A;  3EVU A;  1Y1X A;  1O44 A;  1SCM C;  4XJK B;  4WWQ A;  2HQW A;  1GGW A;  4KYN A;  2JBJ A;  3PAL A;  4U17 A;  1LUM A;  4X3R A;  5DF6 A;  3PLF B;  3S9K A;  1EXR A;  3L47 A;  3SS5 A;  4P9V A;  1B8R A;  3F9K C;  2C0O A;  2F2P A;  4NGM A;  1A07 A;  1NSH A;  1F70 A;  2JBK A;  3VS7 A;  2WCH A;  1TCE A;  1RJV A;  2H46 E;  2LVK A;  2AUC A;  5GJH A;  1TUZ A;  3K21 A;  1LUI A;  1OOH A;  1CDL A;  2B4J C;  3VS4 A;  5BO4 A;  3D77 A;  4FBN A;  4NGP A;  3EVR A;  2LHI A;  1MF8 B;  2C6P A;  2SCP A;  4BY4 A;  1S26 D;  5GQQ C;  1KK8 B;  3OX6 A;  3BQ3 A;  2NCP A;  4MRY A;  4P4I A;  2SAS A;  4P45 A;  4PE1 A;  1PK0 D;  1AP4 A;  3N84 A;  5EG3 B;  4P4J A;  3PSR A;  4BPW B;  4NQG A;  2CXJ A;  2ZKM X;  4QJ3 B;  1AUI B;  1CNP A;  2XPN A;  1ODB A;  4OHH A;  1M63 B;  5TNC A;  2KI6 D;  2I7A A;  1YUU A;  2H8V A;  3SG3 A;  1YUS A;  2L2C A;  2L4I A;  4INW A;  1Z4H A;  3VS3 A;  2AMI A;  1U5I A;  4C0L A;  1IWQ A;  2C0I A;  5JOL A;  2CIA A;  3LK1 A;  1C7V A;  3VS6 A;  4A4B A;  5DC9 A;  3GXX A;  3CZ1 A;  5CSJ A;  5I94 A;  1JF2 A;  2PSR A;  3I5I C;  2LE9 B;  2ABL A;  1CFC A;  1DF0 A;  4OV2 A;  5HLO A;  1GQM A;  4YI8 A;  4XZ1 A;  1SR6 C;  1IIO A;  2HQ8 A;  2OTG C;  4YGB B;  2BE4 A;  4GWF A;  1AOU F;  1JWO A;  3GQI B;  2JOJ A;  1MW4 A;  2LP3 A;  2GSB A;  5EL2 A;  2K0J A;  4NWG A;  3I5H C;  2DVJ A;  3KHE A;  3S8N A;  2BBM A;  2LUC A;  1QAS A;  4PE4 A;  1TN4 A;  1TWO A;  3HCK A;  1O4M A;  2M8U A;  2EO3 A;  5D0J A;  1AJ4 A;  4XZ0 A;  3PAT A;  2PRU A;  1F71 A;  5FYX A;  1AB2 A;  3IQO A;  4OHD A;  1ZAC A;  2ZFD A;  2WOS A;  1FBV A;  1O4O A;  2L3T A;  4JEG A;  2K61 A;  4DIR A;  2DLA A;  1QG1 E;  1B9A A;  1QV1 A;  4OC0 A;  3I5G C;  2BBN A;  2XPP A;  3LYV A;  4P9Z A;  1AJ5 A;  3EAZ A;  2K7O A;  4F59 A;  2I94 A;  1CLB A;  1UHK A;  2PMY A;  1RTP 1;  1F4O A;  1BF5 A;  4AOM A;  2OS8 B;  1JYU A;  3GK4 X;  3TZ1 A;  1SHB A;  1P13 A;  4I5J A;  2JPO A;  5AUL A;  1KFX S;  3PJP A;  1WDC B;  4QJ5 B;  2NXQ A;  3TUY B;  2KHN A;  2KFF A;  1SCV A;  4P44 A;  1J1D A;  3BXM A;  2MBX A;  1IJR A;  1MQ1 A;  2JQ6 A;  1B4C A;  1A08 A;  2KYC A;  2K7A B;  3EKH A;  5DKN A;  4HRG A;  2M7N A;  4GBA A;  1LVC D;  1XFY O;  4FTG A;  2EYY A;  2LMU A;  1J7Q A;  4OHL A;  3CR2 A;  3TDI A;  3R1V A;  1O4N A;  1KQM C;  2DOQ A;  3HCM A;  3SJE A;  1A1B A;  1W9Z A;  3O78 A;  1YVL A;  1DT7 B;  2XP1 A;  4P4F A;  2FCE A;  1WRL A;  3ICB A;  1AOT F;  4N1G A;  3BOW A;  2L0P A;  1QLK A;  1SK6 D;  3KO0 A;  3LK0 A;  1A29 A;  4C0K A;  3CZT X;  4BY5 A;  2KDH A;  5FI7 A;  4P5O E;  5IBM A;  3OHM B;  3L4L A;  2JXL A;  3B86 A;  1CB1 A;  3I5F C;  1TCO B;  3CD3 A;  2F8P A;  2CRH A;  4PAL A;  1F1W A;  1CSY A;  1O4A A;  1SL9 A;  2K7C A;  4E68 A;  1BOD A;  5DKR A;  2M97 A;  4XJK A;  2H61 A;  3BUO B;  3FE6 A;  3CGA A;  1WLM A;  5KSZ A;  3D10 A;  4NGR A;  4F0Z B;  1GM0 A;  2XPO A;  1R1S A;  1W7J B;  1DJX A;  2CR4 A;  2JC2 A;  4I5K A;  2EKX A;  3BI1 A;  2FCI A;  3SG6 A;  1S5G Y;  1SNL A;  4GGF C;  1XYD A;  1FPW A;  3RLZ A;  4DS7 A;  4MCS A;  1EL4 A;  4M2O A;  4ICB A;  5D3O A;  1CMF A;  3SIB A;  1BJF A;  1X02 A;  5K89 A;  5JJG A;  4DRW A;  2YSX A;  1YTZ C;  4IL1 A;  1YRT B;  1EG4 A;  5ER4 X;  4EY0 A;  1V1F A;  1KK7 Z;  2HET A;  2FCD A;  3BUM B;  4P4E A;  2H8H A;  2BAP A;  1IJ5 A;  1B8C A;  1X0N A;  3PQZ A;  2L98 A;  2LMT A;  2TN4 A;  3SIA A;  1Z3K A;  3R1O A;  1CLL A;  3PFV A;  1O4F A;  2MRJ A;  2QEH A;  1NP8 A;  4OHI A;  3OB1 B;  2QEO A;  3VRQ A;  1G4Y R;  2WCB A;  1AK8 A;  4OC4 A;  4NGN A;  2JYQ A;  1A4P A;  4OZD A;  2LLT A;  1AYA A;  1KA7 A;  2PTK A;  1SY9 A;  3DVM A;  4A4C A;  1N65 A;  2WCJ A;  3VRN A;  1O4C A;  2BBU A;  2L5Y A;  1QVI Z;  3PSK A;  4L1B B;  1LKJ A;  5I2L A;  3V2L A;  5HL1 A;  2ECD A;  2FJY A;  1IRJ A;  3MXC A;  2CI8 A;  3CTN A;  3BUX B;  1MXE A;  2HF5 A;  1EJ3 A;  1QWV A;  2L4H A;  4K2R A;  1D4W A;  1TZE E;  1Q80 A;  4AQI A;  1TNX A;  2EGD A;  1K2H A;  3PN7 C;  1SW8 A;  4GGN A;  2GGZ A;  2CNP A;  1KK8 C;  1QV0 A;  2AOA A;  3A4U B;  1WQU A;  2LLS A;  3SG2 A;  2WOR A;  2KAV A;  1YR5 A;  5DC0 B;  1FBZ A;  2L6K A;  5AFP A;  1J1E A;  3FIA A;  1DGU A;  2PVV A;  1Z9E A;  3DY9 A;  1GGZ A;  1GJY A;  3D7F A;  1A09 A;  1L2O B;  1QX7 A;  2RGI A;  4TZI A;  1KFU L;  4FQT A;  4WQ3 A;  1XFV O;  1TTX A;  1BFJ A;  1O4H A;  1QLS A;  4FL2 A;  1UHI A;  1K93 D;  1I3Z A;  2NCO A;  2EC6 B;  1N2D A;  3TS5 C;  3NGV A;  4CID A;  2L4K A;  2HUW A;  1P28 A;  1T14 A;  5EEQ A;  2BCX A;  3SJG A;  2LVV A;  4K45 A;  1SL7 A;  3T04 A;  1V1G A;  4OR9 B;  1PIC A;  1DJI A;  1YUR A;  3D76 A;  1FU6 A;  4MVF A;  1DGV A;  1QCF A;  2RSY A;  2MJW B;  3FF3 A;  1XA5 A;  5BPJ A;  1M61 A;  2WCE A;  4ZCU A;  1XK4 C;  1HCS B;  2DLY A;  1XFU O;  2AAO A;  3D0Y A;  3OAK A;  1S6I A;  3HPH E;  4BPU B;  3BFH A;  3NSK A;  1KQV A;  1CMG A;  3OBV A;  1CLM A;  2L2E A;  2L51 A;  5ER5 A;  2OZO A;  3IF7 A;  5HYD A;  5CDW A;  2EL8 A;  3EVV A;  2QDI A;  1B1G A;  2M49 B;  2F3Z A;  2UV8 G;  1OOJ A;  2B3O A;  1R6P A;  2QEB A;  2PNA A;  3VRY A;  1A81 A;  1LUK A;  3OVE A;  4P2Y B;  1BT6 A;  1EG3 A;  2E30 A;  4MCR A;  1O4B A;  5J3X A;  2C6G A;  3JVT C;  1WJT A;  3F45 A;  1X6C A;  2CBL A;  2PAS A;  2LRA A;  2BNX A;  5F6T A;  4UPG A;  3H4S E;  3MXY A;  1ZFS A;  4K11 A;  3TDU A;  4MCP A;  1UWO A;  2WC6 A;  4PT1 A;  2XEJ A;  3N7Y A;  1O47 A;  1XA6 A;  1OE9 B;  1KWO B;  2HPS A;  2LVJ A;  2F2O A;  4AQJ A;  1NRV A;  1S3P A;  3CR4 X;  1KCY A;  1B7T Z;  1CJ1 A;  1CFD A;  1NYA A;  1SYM A;  1O4L A;  4YBH B;  1M27 A;  1DJH A;  2SRC A;  3U88 C;  1WRK A;  1VRK A;  1BMB A;  1D4T A;  1S1E A;  1WLZ A;  3HMJ G;  3UYO A;  2KSP A;  3QWX X;  4Q04 A;  1FHS A;  4C0J A;  1BOC A;  1LXF C;  2H5K A;  4NWF A;  3DYE A;  3S0A A;  1Y0V H;  1M31 A;  2AUG A;  3VRO A;  2K7D A;  3A8R A;  3S0G A;  5BY0 A;  3VS1 A;  5FI6 A;  1LCK A;  1O45 A;  3FWC A;  1O4Q A;  1JF0 A;  5I6V A;  1NCY A;  2LP2 A;  2JRF A;  3WA4 A;  1XFZ O;  1CWD L;  1BKL A;  1YRU B;  2P6B B;  2LQW A;  3WHT B;  1A75 B;  1NX3 A;  3VS2 A;  3JTD B;  1HCT B;  3NHT A;  4YGC B;  2WCL A;  1BM2 A;  2JNF A;  2NZ0 A;  4IJ7 A;  3PJI A;  3OV1 A;  2IZV A;  2M29 A;  1AYC A;  1BFI A;  1CWE A;  3FED A;  2EU0 A;  3GK2 A;  2RVF A;  1M45 A;  3QWY A;  5D69 A;  3AAK A;  1O41 A;  4QSY A;  5I8N A;  3S9M A;  1KC2 A;  2Y1N A;  2BCA A;  3NSL A;  3D0Y B;  2MLF C;  3AKA A;  3PT1 A;  2CI9 A;  3UF4 A;  5AEQ A;  1FI5 A;  2WC8 A;  3NSI A;  2BL0 C;  4MRX A;  4PHM A;  1IJ6 A;  2PVB A;  1DE4 C;  2WCF A;  1LCJ A;  2RMX A;  1IGV A;  2I2R E;  4GPL B;  3K2T A;  2A4J A;  4DGX A;  3IVT A;  1K8U A;  4NDD A;  4D8K A;  1YX7 A;  1ORG A;  1OMV A;  5FI2 A;  2MQI A;  1QJT A;  1SPR A;  4PHN A;  1E8A A;  1OOG A;  2K2F A;  1BLK A;  5HKY A;  5DKQ A;  5B8I B;  2E6W A;  1UP5 A;  4MBE A;  2C9W A;  4W9Y A;  4CFR A;  1JYR A;  1DQE A;  1IQ5 A;  2KNE A;  2EO6 A;  1S6C A;  1NWD A;  2R2I A;  1CDP A;  1BHH B;  1MXL C;  3S8L A;  3I5I B;  2DLZ A;  1OPK A;  3IMJ A;  1RJA A;  5DIC A;  1SR6 B;  3EK7 A;  2OTG B;  2P71 A;  3D75 A;  1KFX L;  4DGP A;  3RM1 A; 
#chains in the Genus database with same CATH homology
 3CTN A;  3EKJ A;  5KAZ A;  1SPS A;  3BUX B;  1UHH A;  3VS7 A;  1MXE A;  1FW4 A;  1EJ3 A;  2HF5 A;  2LHL A;  1H4B A;  4MZL A;  1TCE A;  1D1Z A;  1RJV A;  2L4H A;  1A1A A;  1D4W A;  2H46 E;  2LVK A;  2AUC A;  4K2R A;  5GJH A;  1TZE E;  1K96 A;  1AD5 A;  1QS7 A;  1Q80 A;  4AQI A;  3K21 A;  1TNX A;  3C1V A;  3I5H B;  4ROJ A;  3SG7 A;  1LUI A;  5HLV A;  1CDL A;  3VS4 A;  2EGD A;  4H1O A;  1K2H A;  2ZRT A;  4OHE A;  1PSR A;  5BO4 A;  1F4Q A;  3PN7 C;  1SW8 A;  1G8I A;  2MAZ A;  4GGN A;  2GGZ A;  2CNP A;  1KK8 C;  1OO4 A;  2FO0 A;  2M1U A;  4FBN A;  1QV0 A;  2BKI B;  2K7B A;  3EVR A;  3A4U B;  2LHI A;  3HX4 A;  2AOA A;  3K2M A;  1C7W A;  1MF8 B;  1WQU A;  2LLS A;  2SCP A;  4PDZ A;  4BY4 A;  1FMK A;  1PVB A;  4N1F A;  2EYV A;  1Y6W A;  2JZI A;  5EHP A;  3SG2 A;  2WOR A;  1S26 D;  4GUK A;  5GQQ C;  1KK8 B;  1NPQ A;  2ZND A;  2DCR A;  2PNB A;  1OMR A;  1YR5 A;  2KAV A;  2EOB A;  5DC0 B;  1CM1 A;  2ZNE A;  3BQ3 A;  2NCP A;  3OX6 A;  1FBZ A;  4MRY A;  1O4I A;  2L6K A;  5AFP A;  1LKK A;  2SAS A;  1J1E A;  1IH0 A;  1KA6 A;  3FIA A;  1BMO A;  2MRK A;  1BHF A;  1LUN A;  1DGU A;  4PE1 A;  1PK0 D;  1AP4 A;  2HDX A;  3N84 A;  5EG3 B;  3JVT B;  3PSR A;  4NQG A;  1GGZ A;  3HHM B;  1GJY A;  1TRF A;  1XVJ A;  2CXJ A;  2OPO A;  1SKT A;  2ZKM X;  1A09 A;  4QJ3 B;  1B7T Y;  1L2O B;  1AUI B;  1K95 A;  1QX7 A;  1CNP A;  1BLQ A;  1G83 A;  2RGI A;  4K44 A;  5HKW A;  1ODB A;  3KPX A;  1PAL A;  4OHH A;  4TZI A;  1KFU L;  3OB2 B;  1M63 B;  5TNC A;  3LCP C;  2JXC A;  2I7A A;  2KI6 D;  1YUU A;  4WQ3 A;  1XFV O;  2LC5 A;  1EH2 A;  3SJS A;  1TTX A;  1JSA A;  5GJI A;  3BXK A;  3CR5 X;  1D1O A;  1BFJ A;  1O4H A;  4NDB A;  3SG3 A;  2LM5 A;  1QLS A;  1YUS A;  2Y3A B;  1NZL A;  1QAD A;  2KBI A;  4FL2 A;  1UHI A;  2FJU B;  2K79 B;  1NIW A;  1B47 A;  1K93 D;  1TIZ A;  2L4I A;  3I5G B;  1N0Y A;  1F55 A;  1SHD A;  2D8N A;  2KI4 C;  1I3Z A;  2MRD A;  1NCX A;  2NCO A;  2DM0 A;  2EC6 B;  4YI9 A;  1N2D A;  3TS5 C;  1R1Q A;  2LVI A;  4CID A;  3VS3 A;  2L4K A;  1DJG A;  2AMI A;  4I5L B;  2HUW A;  1Y1U A;  1U5I A;  2IUG A;  2MHH A;  1MR8 A;  4C0L A;  5EEQ A;  2JNX A;  2BCX A;  1IWQ A;  1O4R A;  2C0I A;  1S5G Z;  4MSP A;  5JOL A;  2LVV A;  1HQV A;  3LK1 A;  2CIA A;  2VIF A;  4K45 A;  4LUD A;  4XYN A;  1C7V A;  3VS6 A;  1SL7 A;  4OKH A;  4F5B A;  3T04 A;  1UUS A;  4PHK A;  4PHJ A;  2H61 C;  4U1P A;  1J7R A;  1V1G A;  4OR9 B;  4D1E A;  1IS0 A;  1PIC A;  4A4B A;  1GHU A;  1O4E A;  5DC9 A;  3GXX A;  1DMO A;  4X6S A;  5CSJ A;  1DJI A;  1YUR A;  2CT9 A;  1IKU A;  1RQQ C;  2ROR A;  1JF2 A;  3GOF A;  2HDV A;  1ALW A;  2PSR A;  3SG4 A;  3I5I C;  1FU6 A;  2LE9 B;  4MVF A;  1DGV A;  3NSO A;  4ORA B;  1QCF A;  4OCI A;  2ABL A;  2RSY A;  2JTT A;  2MJW B;  2Y4Q A;  3PSJ A;  3GK1 A;  1CFC A;  1CSZ A;  1DF0 A;  1IG5 A;  4OV2 A;  5HLO A;  3VRR A;  1GQM A;  3EK4 A;  2O5G A;  4YI8 A;  4XZ1 A;  1XA5 A;  4FQO A;  5BPJ A;  1BKM A;  2QMS A;  1M61 A;  1SR6 C;  1O4G A;  2HQ8 A;  3NHN A;  4M4Z A;  1LIN A;  2OTG C;  2LCP A;  2WCE A;  4ZCU A;  4YGB B;  1XK4 C;  2BE4 A;  3PS5 A;  4GWF A;  1AOU F;  4HRH A;  1HCS B;  2DLY A;  1AYD A;  3DF0 A;  2PLE A;  1XFU O;  3DVE A;  2AAO A;  3D0Y A;  1JWO A;  2JOJ A;  2K2A A;  1S6I A;  1F8H A;  3GQI B;  4H34 A;  1MW4 A;  2LP3 A;  3NSK A;  2LAP A;  1XFX O;  2GV5 A;  1KQV A;  2GSB A;  4GL9 E;  1XFW O;  1CMG A;  2K0J A;  1CLM A;  4NWG A;  5I2Q A;  4DUQ A;  2L2E A;  2L51 A;  3I5H C;  3O2P A;  1NX1 A;  5ER5 A;  5AXI A;  1TNQ A;  2KYF A;  3IF7 A;  5HYD A;  1H9O A;  2DVJ A;  1CM4 A;  5CDW A;  3KHE A;  2EL8 A;  1B8L A;  1BU3 A;  2M9G A;  1L7Z A;  1A2X A;  3EVV A;  3S8N A;  1S36 A;  2BBM A;  1QAS A;  2LUC A;  2L50 A;  3TDZ A;  4PE4 A;  2IUH A;  1B1G A;  2M49 B;  2F3Z A;  1NZV A;  1KQM B;  1RFJ A;  1TN4 A;  1PRW A;  1OOJ A;  4GGF A;  1R6P A;  2JTZ A;  2KI6 C;  2B3O A;  2OQ1 A;  5DC4 A;  1NCZ A;  3HCK A;  3DVJ A;  1LKL A;  4FL3 A;  1O4M A;  2PNA A;  3VRY A;  3US4 A;  1U5I B;  1A81 A;  1LUK A;  3OVE A;  1K9U A;  1OZS A;  2M8U A;  2EO3 A;  4P2Y B;  1FF1 A;  3E3R A;  1BT6 A;  5IBW A;  5D0J A;  1AJ4 A;  4XZ0 A;  3KFJ A;  1REC A;  3PAT A;  1EG3 A;  2CCM A;  2PRU A;  4GAO A;  5FYX A;  1F71 A;  2E30 A;  2YU7 A;  1AB2 A;  1O4B A;  3IQO A;  4R1E A;  3IN8 A;  4OHD A;  5J3X A;  3CWG A;  1ZAC A;  2ZFD A;  3JVT C;  2WOS A;  1FBV A;  2G2B A;  3F45 A;  1X6C A;  2CBL A;  1K90 D;  2PAS A;  4CPV A;  1H8B A;  1O4O A;  2BE6 A;  1L2O C;  2L3T A;  3FS7 A;  4F5A A;  2FOT A;  2KGR A;  2MLE C;  1KSW A;  5F6T A;  1FYR A;  1GRI A;  2IUI A;  3NXA A;  1YX8 A;  3I5F B;  4UPG A;  4JEG A;  2KFG A;  1W7I B;  3H4S E;  1ZFS A;  2K61 A;  3MXY A;  1JUO A;  3AKB A;  4K11 A;  1G33 A;  1IQ3 A;  3TDU A;  1RRO A;  1DF0 B;  4DIR A;  3VRZ A;  1K9P A;  1QG1 E;  1UWO A;  2O60 A;  2ZRS A;  1B9A A;  1QV1 A;  1SMG A;  1QIV A;  3I5G C;  1KWO C;  4YRU A;  2BBN A;  4WQ2 A;  2AOB A;  4EIH A;  2EC6 C;  2VRG A;  5G08 A;  3N7Y A;  1JWD A;  3DF0 B;  4P9Z A;  1AJ5 A;  1O47 A;  1XA6 A;  3EAZ A;  4QJ4 B;  2K7O A;  3M7F A;  1KK7 Y;  1DJZ A;  4F59 A;  2I94 A;  1CLB A;  1UHK A;  1OE9 B;  1S6J A;  1KWO B;  2COL B;  2PMY A;  1RTP 1;  2HPS A;  2LVJ A;  1F4O A;  4MZJ A;  4AOM A;  1BF5 A;  1QXP A;  1A75 A;  2F2O A;  1O4K A;  2OS8 B;  1A1C A;  3GXW A;  4AQJ A;  1JYU A;  1NRV A;  1TOP A;  2JPT A;  4YGE B;  1UHN A;  1ZOT B;  1S3P A;  1AHR A;  3MSE B;  4JQ0 D;  2B1U A;  1A03 A;  3GK4 X;  4NDC A;  3CR4 X;  3TZ1 A;  1SHB A;  1Y57 A;  1P13 A;  2CTN A;  1CDN A;  1FI6 A;  1OO3 A;  2BL0 B;  5CPV A;  4I5J A;  1KCY A;  1B7T Z;  1OZO A;  4CFQ A;  1CJ1 A;  1CFD A;  1NYA A;  5AUL A;  1KFX S;  1SYM A;  3PJP A;  4ETO A;  2DX0 A;  1O4L A;  1OPL A;  4YBH B;  3OX5 A;  1XO5 A;  1WDC B;  1M27 A;  4QJ5 B;  1O4D A;  1DJH A;  2NXQ A;  2V53 A;  2JT3 A;  4WRI A;  1SHA A;  3CLN A;  4U8D A;  2SRC A;  4GNK B;  3CBL A;  3N8M A;  1WRK A;  3TUY B;  3LL8 B;  1RWY A;  1JFJ A;  1F54 A;  1DJW A;  2KHN A;  1VRK A;  1BMB A;  2BEC A;  1D4T A;  1S1E A;  1O46 A;  1CDM A;  1SCV A;  1WLZ A;  2F3Y A;  2KFF A;  1J1D A;  5CSF A;  1ZFP E;  1QTX A;  3UYO A;  2KFH A;  1QVI Y;  2MBX A;  2KSP A;  1IJR A;  1RK9 A;  1R1P A;  3QWX X;  2BCB A;  4Q04 A;  1MQ1 A;  5CSI A;  2JQ6 A;  5HKZ A;  1B4C A;  1SBJ A;  2OZO A;  1FHS A;  3AAJ A;  4C0J A;  1BOC A;  1LXF C;  1A08 A;  1O48 A;  2KYC A;  2H5K A;  2K7A B;  3IMD A;  4NWF A;  3EKH A;  2HMH A;  2WND A;  1Y0V H;  2ETZ A;  5DKN A;  1M31 A;  1NX0 A;  1OSA A;  2AUG A;  4HRG A;  3VRO A;  2M7N A;  3CS1 A;  4GBA A;  4E93 A;  1ZUZ A;  4MLW A;  1LVC D;  1XFY O;  2K7D A;  4FTG A;  2JU0 A;  1M46 A;  1MUX A;  2KGB C;  2EYY A;  3A8R A;  1TCF A;  2LMU A;  1K9K A;  2CS0 A;  1J7Q A;  2SHP A;  5AAN A;  1SRA A;  3VS1 A;  4ORC B;  1LCK A;  1O45 A;  2KBM A;  3FWC A;  2MA2 A;  3CR2 A;  2LUX A;  5KU1 A;  4OHL A;  3TDI A;  1OQP A;  1O4Q A;  3C7I A;  1O4N A;  4HSZ A;  1JF0 A;  2MK2 A;  1NCY A;  1KQM C;  5I6V A;  1K9A A;  4MEW A;  4MZK A;  2LP2 A;  2JRF A;  3WA4 A;  2DOQ A;  3HCM A;  1A1B A;  1J7P A;  1BR1 B;  3O78 A;  1YVL A;  1LA3 A;  1DT7 B;  1XFZ O;  2Q91 A;  2KAY A;  1UHJ A;  1MHO A;  1SKJ A;  3ZWH A;  2KOT A;  2XP1 A;  2FCE A;  2ZN9 A;  3CXL A;  1WRL A;  3ICB A;  1AOT F;  1CWD L;  2LNW A;  1BKL A;  4N1G A;  1YRU B;  3DVK A;  2P6B B;  3BOW A;  2GGM A;  1JBA A;  2LQW A;  3WHT B;  2F33 A;  2L0P A;  3JTD C;  1F2F A;  1NX2 A;  1A75 B;  1NX3 A;  1QLK A;  1SK6 D;  2LLU A;  1QX2 A;  1KFU S;  4N5X A;  3WNX B;  3KO0 A;  2EYZ A;  3LK0 A;  1A29 A;  1BR4 B;  2JUL A;  3CZT X;  4ORB B;  4C0K A;  3VS0 A;  4BY5 A;  3QRX A;  2KDH A;  4JGH A;  3VS2 A;  1TNP A;  1CFF A;  4P5O E;  2M0R A;  3JTD B;  3IQQ A;  4LUE A;  1HCT B;  1QIW A;  4YGC B;  3WXA A;  3IN7 A;  5IBM A;  5AER A;  3VRP A;  3OHM B;  1JC2 A;  2JXL A;  4HRE E;  1CFP A;  2ISD A;  1J55 A;  2JWW A;  2K8M B;  2M3W A;  1BM2 A;  1CB1 A;  2JNF A;  3I5F C;  1TCO B;  1WRZ A;  2NZ0 A;  4DCK A;  1BG1 A;  1C07 A;  3CD3 A;  3KF9 A;  1O42 A;  2F8P A;  1QX5 B;  5EHR A;  2CRH A;  1DVI A;  4PAL A;  1F1W A;  1CSY A;  2L5X B;  3KEV A;  1O4A A;  3OV1 A;  3BUN B;  1FU5 A;  2IZV A;  3TKZ A;  4PE7 A;  3EK8 A;  1SL9 A;  2BKH B;  2M29 A;  3WHU B;  1AYC A;  2K7C A;  2MC1 A;  4E68 A;  1BFI A;  1CWE A;  3FWB A;  4ZCV A;  2M1K B;  1BOD A;  5DKR A;  4JPZ B;  4MN0 A;  2KAX A;  2M97 A;  4XJK A;  2EHB A;  3M0W A;  3PN7 B;  2H61 A;  3BUO B;  5CSN A;  3CGA A;  1WLM A;  5KSZ A;  2EU0 A;  3D10 A;  3GK2 A;  3ZNI A;  3HIZ B;  2RVF A;  1M45 A;  2NLN A;  4GFT A;  1AYB A;  1LA0 A;  4F0Z B;  3QWY A;  5D69 A;  3AAK A;  1O41 A;  1BHH A;  3BUW B;  1R1S A;  4QSY A;  1W7J B;  1MWN A;  5I8N A;  1KSM A;  2G9B A;  1KC2 A;  4M2P A;  4OVN F;  5D7F A;  2OS8 C;  2Y1N A;  2I18 A;  1UUR A;  2BCA A;  3NSL A;  1DJX A;  3D0Y B;  2JC2 A;  4I5K A;  4I5N B;  2CR4 A;  2KNO A;  2EKX A;  4PCW A;  2LNK A;  2MLF C;  2FCI A;  3AKA A;  2KQY A;  2CI9 A;  1TNW A;  3UF4 A;  5IBS A;  3SG6 A;  5AEQ A;  4YGD B;  1S5G Y;  1WY9 A;  3DD4 A;  1FI5 A;  2WC8 A;  3NSI A;  2BL0 C;  4MRX A;  1SNL A;  1SPY A;  4GGF C;  1XYD A;  1ALV A;  2JT0 A;  2LAN A;  1NUB A;  2M7L A;  3VGO A;  1O4P A;  1FPW A;  1X27 A;  2LCT A;  3MAZ A;  4PHM A;  1XK4 A;  3RLZ A;  1MIL A;  2GE9 A;  1IJ6 A;  1WDC C;  2QPT A;  2PVB A;  4DS7 A;  4BTF A;  2Y1M A;  2WCF A;  1Y1A A;  3LLE A;  1LCJ A;  2RMX A;  3BOW B;  1IGV A;  2I2R E;  4GPL B;  1JFK A;  3TUY C;  1QAT A;  1EL4 A;  1YVH A;  4M2O A;  4JE4 A;  4ICB A;  3TL0 A;  3S8O A;  1CMF A;  1HT9 A;  2A4J A;  4DGX A;  4D8K A;  1K8U A;  4NDD A;  3SIB A;  1KSO A;  3SG5 A;  1BJF A;  1YX7 A;  4L9M A;  1X02 A;  1J7O A;  1OMV A;  2KK6 A;  5K89 A;  1PSB A;  3BKB A;  4PE0 A;  5JJG A;  2KQ6 A;  2MQI A;  4DRW A;  2YSX A;  1YTZ C;  1QJT A;  4IL1 A;  5KTY A;  1YRT B;  1SPR A;  1EG4 A;  5ER4 X;  4EY0 A;  4CLN A;  2LQN A;  1V1F A;  4PHN A;  2JT8 A;  1E8A A;  2PAL A;  1PVA A;  2ZN8 A;  1O4J A;  1KK7 Z;  2HET A;  1M39 A;  2FCD A;  2QAC A;  3BUM B;  2H8H A;  2PLD A;  1BLJ A;  1IJ5 A;  1B8C A;  3PM8 A;  2IS9 A;  2KI4 B;  1X0N A;  2L98 A;  2K2F A;  2LMT A;  1JYQ A;  2TN4 A;  3PQZ A;  2Y5I A;  1BLK A;  2HCK A;  3SIA A;  5HKY A;  1Z3K A;  1AVS A;  1K94 A;  1CLL A;  3TS5 B;  1CTR A;  5DKQ A;  1PUL A;  1R2U A;  3PFV A;  1O4F A;  5B8I B;  2E6W A;  1UP5 A;  2MRJ A;  4JWQ A;  3VS5 A;  4M2Q A;  2C0T A;  4MBE A;  1NP8 A;  1OMD A;  2C9W A;  3O6B A;  2LNX A;  3EVU A;  3OB1 B;  4OHI A;  5I2O A;  1Y1X A;  4CFR A;  3VRQ A;  1G4Y R;  1O44 A;  2WCB A;  1AK8 A;  1A1E A;  1RPY A;  1JYR A;  1SCM C;  1DTL A;  4XJK B;  1IQ5 A;  1O49 A;  2LMV A;  2KNE A;  1O43 A;  4WWQ A;  2JYQ A;  1A4P A;  1AYA A;  2LLT A;  2EO6 A;  2HQW A;  1S6C A;  1ZMZ A;  5PAL A;  3OP0 A;  2LV7 A;  1GGW A;  3EAC A;  1KA7 A;  1YUT A;  1JU5 A;  2PTK A;  1SY9 A;  1NWD A;  2R2I A;  1CDP A;  3DVM A;  2Q4U A;  3BYA A;  4A4C A;  1BHH B;  3PAL A;  4U17 A;  1MXL C;  1LUM A;  1N65 A;  4TNC A;  1SCM B;  3S8L A;  1SL8 A;  5EEL A;  3VRN A;  1O4C A;  3I5I B;  2BBU A;  1QVI Z;  2DLZ A;  3PSK A;  5DF6 A;  3PLF B;  3S9K A;  1OPK A;  1EXR A;  1LKJ A;  1DJY A;  4YGA A;  5I2L A;  3IMJ A;  4L1B B;  4USL A;  1RJA A;  2ECD A;  1IRJ A;  4P9V A;  1B8R A;  2C0O A;  1SR6 B;  3MXC A;  2F2P A;  3O4Y A;  3EK7 A;  1CKK A;  2OTG B;  1A07 A;  1NSH A;  2H2K A;  1F70 A;  2CI8 A;  1KFX L;  4DGP A;  3RM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...