1Z8LA

Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
695
structure length
695
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase II
publication title Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase
pubmed doi rcsb
source organism Homo sapiens
total genus 201
structure length 695
sequence length 695
chains with identical sequence B, C, D
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 1z8lA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1z8lA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 1z8lA02
3PFOA 3PBEA 1BLLE 1CBXA 2GREA 1CPSA 4MHNA 3BXMA 1BPMA 4FBEA 4OC0A 4C86A 3KZWA 1CP7A 2FVGA 2Q51A 2Q4ZA 3HLPA 3BHXA 4MXUA 2RFHA 4EFDA 4MHYA 3T8WA 1YSJA 3BI1A 5CPAA 3KQZA 3I6SA 2DEAA 3CDXA 1Z2LA 4R7MA 2ZEDA 2PJ1A 4UIBA 3RAMA 4ZY2A 1M4LA 2ABZA 2PRQA 2PVVA 3PB4X 2C6CA 3B7IA 1PCAA 2PJ5A 4C85A 4FUUA 2PCUA 5HVGA 4C9UA 2PJ2A 1DE4C 1QMUA 2PJ4A 2JBJA 3FVLA 5D8NA 3TC8A 2I3CA 2ZEOA 5HXDA 1CP6A 3PB7X 2PIYA 4PXEA 4X2TA 1VIXA 1XBUA 2PJ6A 2CTCA 3KGQA 1ZG7A 2PE3A 1LCPA 5K8MA 4P4EA 5JGFA 5LYIA 4IK2A 4X3RA 4NGNA 2F7VA 3FMCA 2EK8A 4P4DA 3FEDA 4WWVA 3FH4A 2QYVA 3ICUA 4PXBA 4P4IA 2PJ3A 5THWA 3KHZA 3V7ZA 3NH8A 1EE3P 4C8TA 3D7FA 2PJCA 4NGSA 2WZNA 4WJBA 2PJ8A 4ONWA 4PXDA 4CDKA 3B3CA 1JQGA 3D7GA 2V8HA 5LYFA 3MN8A 2V8GA 2IMOA 2IQ6A 1LAMA 5JM6A 4P4JA 3D7HA 2ZOFA 4O23A 2HC9A 5IB9A 3D67A 4C8CA 3NA6A 3B35A 2GLJA 3D68A 2AFUA 2XEGA 2O4HA 5J1QA 3PFEA 4P10A 2POKA 2ZEFA 3KQXA 3KASA 5LYLA 2CTBA 1VHOA 3MRUA 4JZ0A 1UWYA 3H8EA 3K2KA 4EWTA 2XEJA 3CPAA 2WYRA 1V6CA 2PJAA 3B3VA 3SI0A 3LWUA 4A38A 4UEFA 4OMEA 3H8GA 4C8PA 3WC5A 3N5FA 4OKOA 4RUHA 1BPNA 1TKFA 4YN3A 4G1PA 2OOTA 2CF4A 3RZAA 3K9TA 4C8AA 4NGMA 1YW6A 3SI1A 4P4BA 3JRUA 4B6ZA 1XF1A 3KI9A 1TKJA 2ZEMA 3PBBA 4EMEA 3FEEA 1CG2A 3NFZA 6CPAA 3I1UA 3HUVA 2VL1A 4TJVA 1ZG8A 4P6YA 1LANA 3KR4A 4NJRA 3IEHA 3GUXA 3VH9A 1XFOA 1ZLHA 2XEFA 1FNOA 4A39A 2J9AA 4F9UA 4KNGE 3VTAA 4A37A 2AFSA 2AFMA 2G9DA 4C8UA 2HB6A 1R3NA 3V38A 4R76A 4OC3A 4C99A 3IJ3A 1TF8A 3B3WA 4W9YA 3CPXA 1BAVA 4ZI6A 4C9AA 1YMEA 1GYTA 1Q7LA 2V8VA 4MCSA 2ZELA 5LYDA 3ISXA 1NSAA 3KL9A 3S9NA 4C84A 3LMSA 4R8FA 2AFWA 3IO1A 3KR5A 1ELLP 2JEWA 4FAIA 3TX8A 1XRYA 4OIDA 3IWWA 3B3SA 5F09A 4ZY0A 4AXVA 3WC7A 3WABA 3WT4A 2GU2A 1AMPA 2C6PA 2PJ7A 5LRKA 4F8ZA 4X8IA 1VHEA 1VGYA 2PIZA 4MHPA 1IGBA 3VARA 2C1CA 5K8OA 5K8PA 1TKHA 4P44A 3NH4A 3FX6A 4NGTA 3B3TA 1TXRA 5JH9A 1ELMP 2BCOA 2OR4A 4PQAA 3PB6X 4DUKA 4IAVA 2XEIA 4PPZA 2RB7A 1XJOA 2Q43A 1CX8A 5I4MA 2IJZA 1Y9ZA 4P45A 3FECA 5D29A 2NSMA 1TF9A 4C8FA 4H2KA 4C9RA 3D4UA 3RBUA 2JBKA 4BD9A 3PEIA 4F9VA 3IFEA 3FF3A 1CPXA 2PJ9A 4CPAA 1PYTB 3KHXA 1HEEA 4A94A 4UEZA 1Y7EA 2GLFA 2ZENA 3QNVA 1HDUA 4OC1A 1LOKA 1R43A 4MCQA 2ZOGA 1Z5RA 2ANPA 2AFXA 2EWBA 1DTDA 1ARLA 4MCRA 4FWUA 3PB8X 4OC2A 3PRTA 4GM5A 1AYEA 1OBRA 4NGRA 3ISZA 3D66A 1H8LA 4C9VA 4MCPA 1Y0YA 5DS0A 8CPAA 4ZY1A 4MHZA 4TJXA 3B2YA 3SI2A 3EIFA 2AFZA 3FJUA 3IIBA 3SJFA 2QVPA 4JYWA 5LRJA 4R6TA 4UEEA 1Y0RA 2F8HA 2BO9A 5HVHA 1LAPA 2PJBA 3SJGA 1WVMA 3S9MA 4OC5A 2PVWA 1F2OA 1RTQA 2V8DA 1YW4A 1ZG9A 2NYQA 2EK9A 4MRIA 2PJ0A 2V77A 5ELYA 4PXCA 2O53A 2ZEEA 3GLJA 4DYOA 3L2NA 4IHMA 4UF4A 4ZX8A 4K3NA 5HVFA 3WC6A 1KWMA 7CPAA 3H8FA 3I74A 4OC4A 2QJ8A 1YLOA 4NJQA 2AFOA 3S9LA 3SJEA 1ARMA 2C6GA 4C9EA 3D7DA 2CIJA 2ZEPA 4TWEA 2BOAA 4OIWA 4Z65A 5K8NA 4YU9A 2ZEGA 3DGVA 4KSIA 4TNUA 4YWYA 4UIAA 1Z8LA 5LRGA 3IC1A 3CT9A 3NH5A 4P4FA 4NGQA 4ZYQA 3DLJA 4MMOA 4OP4A 3SJXA 4NFRA 1QQ9A 3PB9X 3GB0A 1FT7A 4DJLA 1HDQA 3VATA 3BI0A 2ZEHA 4LQGA 4CDJA 4NGPA 4Q7AA 4ZX9A 1F2PA 1F57A 1IY7A 1ZLIA 5CBMA 1XMBA 1LFWA
chains in the Genus database with same CATH superfamily
3PFOA 3HMJG 2OH1A 4JJXA 4CGLA 3RO0A 2FL4A 3PBEA 4CGMA 3C8OA 2Q04A 1BLLE 3CZXA 1CBXA 1I21A 2GREA 3VROA 1CPSA 2R8VA 2X0SA 4MHNA 3BXMA 1BPMA 2KCWA 3K9UA 2J8NA 4FBEA 4OC0A 1Q2CA 2FE7A 4C86A 2P0WA 4UFXA 4B11A 4CAEA 3KZWA 1CP7A 2Q7BA 3R9GA 2FVGA 2Q51A 2Q4ZA 4UCNA 1J3LA 4A4CA 3HLPA 4LUAA 3BHXA 5BY0A 5F13A 2Z3OA 2RFHA 3HPGG 3PP9A 1QSTA 4MXUA 4EFDA 4MHYA 5AGEA 3T8WA 4MFPA 1YSJA 1M4GA 3R95A 3BI1A 2WSAA 3A9LA 5CPAA 3KQZA 1S5KA 3I6SA 5G20A 4IF5A 1XOVA 2JLMA 5ISVA 1S7NA 5K99A 2DEAA 2PR1A 4H6UA 2B5GA 4UCMA 3CDXA 2VI7A 3VRQA 2Z3NA 1Z2LA 2GE3A 4R7MA 5IX3A 2ZEDA 3PGPA 2AUNA 1X10A 2PJ1A 2ATRA 4UIBA 2B0AA 3U88C 3RAMA 4ZY2A 4CAFA 1S7KA 2Y0MA 1M4LA 5KTDA 2ABZA 2PRQA 2PVVA 1B6BA 2C6CA 3PB4X 4A33A 4MFKA 3TLYA 2XPLA 4QVTA 4RN7A 3P2HA 3PFVA 4F0YA 2Q7SA 3B7IA 4R57A 1PCAA 2AJ6A 2NMTA 2PJ5A 4C85A 4FUUA 2PCUA 5HVGA 3BUOB 1YX0A 5JVLA 2YJVA 4C9UA 2PJ2A 1GGOA 2Z3LA 1DE4C 1QMUA 4MJ8A 2J8RA 2PJ4A 4CYQA 1KUVA 2PCNA 2JBJA 3FVLA 4OAEA 5D8NA 3TC8A 3TTHA 2I3CA 2ZEOA 4E94A 4ZBGA 1NSLA 4CRZB 5HXDA 3BUXB 1KEEB 1CP6A 3PB7X 1Q2DA 1S60A 4AG9A 4C2ZA 2G3AA 3TLGA 1XEBA 2PIYA 4PXEA 5G1ZA 1IYKA 4X2TA 3TCVA 3BJ7A 2FM4A 2C27A 3P2FA 1VIXA 1XBUA 2JDCA 1B87A 4IUSA 4KZTA 2PJ6A 1S3ZA 2CTCA 2FXFA 3EC4A 4YGOA 4E0AA 3VRRA 3BLNA 4YFJA 2B4BA 3DNSA 1JDBC 4MI1A 4CS0B 3KGQA 1DIKA 1Z4RA 1ZG7A 2PE3A 1LCPA 4U9ZA 4P4EA 5IV0A 5K8MA 3LACA 2UV8G 4R87A 5JGFA 5EC4A 5LYIA 1M44A 4IK2A 4X5KA 4X3RA 3F8KA 1VHSA 4NGNA 4PK2A 3D8PA 4RR2B 2F7VA 3FMCA 2C5QA 2EK8A 4P4DA 3R96A 3FEDA 4WWVA 3FH4A 4BPUB 2QYVA 3QAYA 4C2XA 4PXBA 3ICUA 2Z11A 2ODFA 3S6GA 4P4IA 2PJ3A 3IWGA 5THWA 3D2MA 3KHZA 5F5XA 3QB8A 3NH8A 3V7ZA 1MJAA 4BMHA 1EE3P 2DLAA 1FY7A 1MJBA 5A28A 4KLVA 3H4QA 4JWPA 3T90A 4C8TA 2FS5A 5J8CA 3VRPA 4KUBA 2CY2A 3D7FA 1CM0A 2PJCA 4NGSA 2EUIA 2WZNA 4MJXA 4I49A 4GS4A 3OB1B 1BXRB 4WJBA 2PJ8A 4ONWA 4PXDA 4CRYB 2R1IA 1JDEA 2FSRA 3LD2A 2AUMA 4CDKA 3B3CA 1JQGA 3D7GA 3SHPA 2V8HA 2CXAA 1L0CA 2OZUA 3GIUA 3MN8A 4R9MA 5LYFA 3TE4A 3FBUA 2Y1MA 1YVKA 2V8GA 3D3SA 2QIRA 2IMOA 2BUEA 2B5GB 4MFQA 4J0NA 2IQ6A 3PT1A 1LAMA 2DXQA 5JM6A 4P4JA 3D7HA 2ZOFA 5JYBA 4Q36A 5H86A 4O23A 3TLEA 4R3LA 5AG6A 1EZAA 4KOTA 2HC9A 5IB9A 4JD6A 4JXRA 3D67A 3FB3A 1Z9UA 3TO7A 3ZZIA 3NA6A 4C8CA 3BUNB 4CGNA 3B35A 4UBRA 2GLJA 3EO4A 4AVAA 2GANA 3D68A 2AFUA 2XEGA 2O4HA 5J1QA 1JWQA 3PFEA 4KSAA 4P10A 2X7BA 2POKA 2ZEFA 4C68A 1VI4A 3KQXA 3KRVA 1NBWA 3KASA 1SQHA 5LYLA 2CTBA 1VHOA 1YK3A 1LRZA 3MRUA 2HI6A 2B3UA 1XF8A 4B5PA 4CGPA 1YLEA 4JZ0A 2Z3PA 3O8ZA 1UWYA 3H8EA 4A4BA 4UFVA 1PUAA 1C30B 1T36B 4E2AA 1CJWA 1ZO0A 2XEJA 3K2KA 4EWTA 3CPAA 3G8WA 4UFWA 2WYRA 4MFLA 3TLGB 4L89A 1V6CA 1QSMA 4KORA 1RO5A 2PJAA 3B3VA 3TLBA 4Q38A 3SI0A 2EVNA 3SR3A 2P6FA 3LWUA 4A38A 4ZGYB 1IB1E 4UEFA 4OMEA 3H8GA 2F5IA 1Y9KA 4HKFA 3TOAA 4C8PA 4A30A 3WC5A 3N5FA 4U9YA 4OKOA 5K8OA 2EO8A 4RUHA 1BPNA 1TKFA 4YN3A 3MGDA 1YVOA 4G1PA 2OOTA 2CF4A 3RZAA 4Y49C 3K9TA 2DF5A 2VXKA 2Z10A 4MY3A 4NGMA 2B3VA 1YW6A 2QECA 4C8AA 1OZPA 1GHEA 4P4BA 2A4NA 3GY9A 2GIVA 5FVJA 3SI1A 3JRUA 4MI4A 4II9A 1WWZA 2O28A 4B6ZA 1XF1A 3KI9A 2REEA 2ZXVA 1TKJA 2B58A 2ZEMA 3B8GA 3DR8A 3PBBA 4H89A 4OLLA 4Y49B 2Z3KA 5J3XA 4EMEA 3FEEA 4KVXA 1N71A 2CBLA 2FT0A 1CG2A 2BL1A 4MHDA 2OU2A 3NFZA 4JLYA 4UWJA 6CPAA 1IU8A 2PC1A 2RC4A 3I1UA 1YGHA 1M6VB 4KVME 3NE7A 3SXOA 3SXNA 5DWNA 3HUVA 5AG5A 3GJZA 5IR2A 2EBJA 2VL1A 4GXHA 4TJVA 1ZG8A 1YQEA 2YNCA 5J8FA 4P6YA 1LANA 4M85A 2JEVA 4M6IA 3ZJ0A 3KR4A 1XE4A 4NJRA 2CNMA 3GUXA 2FIWA 3IEHA 3PZJA 1XFOA 1ZLHA 2XEFA 1FNOA 4QC6A 4XPDC 5E96A 4A39A 2J9AA 3LODA 2B4JC 4F9UA 3IGRA 2R82A 1NMTA 4E8OA 3R1KA 4KOXA 4KNGE 4BPXB 5AXIA 3VTAA 4NEXA 4A37A 2AFSA 3JUWA 2D0OA 2AE6A 3HPHE 4KLWA 3TYXA 2AFMA 1M4IA 2G9DA 2QMLA 4F6AA 2HB6A 3DDDA 4C8UA 3NOJA 4HNWB 4XPDB 4R3KA 3T0TA 1R3NA 3V38A 4R76A 4B5PB 2G0BA 4OC3A 3BUMB 3VWEA 1NXJA 3TLAA 2PDOA 4C99A 3IJ3A 2YGWA 2Q44A 4JXQA 1TF8A 4E5SA 3B3WA 4W9YA 3CPXA 3H5ZA 2ZW4A 1BAVA 4KVOE 1MJ9A 3T07A 1TIQA 4ZI6A 4IIXA 1IICA 1YMEA 1GYTA 1Q7LA 2JDDA 4MCSA 2V8VA 2Z3MA 2ZELA 5LYDA 4NF1A 2D4OA 3OWCA 3ISXA 1R57A 1NSAA 4RS2A 3KL9A 4AB7A 2GP4A 1U6MA 3S9NA 1C3OB 3EZBA 4B10A 4C84A 3TT2A 3LMSA 4INJA 1A9XB 4R8FA 5HH1A 2B4DA 4QB9A 1Z9EA 2AFWA 4B14A 2P6GA 3IO1A 3KR5A 1ELLP 2JEWA 4FAIA 5C88A 2CNSA 1M4DA 3TX8A 2Q4YA 2HQYA 1XRYA 4OIDA 3IWWA 3B3SA 5F09A 1Z8XA 4C7IA 4ZY0A 4AXVA 3WC7A 1MK4A 3WABA 3WT4A 4GPLB 2GU2A 4B5OA 4JVOA 2Q0YA 3GYAA 2EZAA 1AMPA 4M6GA 2C6PA 3RNZA 5H84A 2PJ7A 3CXQA 4BINA 2Y1NA 5LRKA 4F8ZA 4X8IA 3RYOA 1VHEA 2VKZG 1VGYA 3FRMA 5F49A 2YNCC 3BJ8A 2PIZA 3VRNA 4MHPA 1R61A 1IGBA 4HNXB 4K30A 4NSQA 5F48A 2C1CA 3VARA 2R98A 4AVCA 1TKHA 1Z8TA 4MY0A 4P44A 3FIXA 3NH4A 1YVHA 3FX6A 4BBHA 4NGTA 2E28A 5JQ4A 2HUZA 3ZNIA 5EMIA 3F9KC 1ZL0A 3B3TA 3TLCA 1TXRA 1UFHA 5JH9A 5FD8A 1ELMP 2OLSA 2ZW7A 1YREA 2BCOA 2PQ8A 4FD6A 2OR4A 1S7LA 2G3TA 3PB6X 4PQAA 2BEIA 2N3AB 4HPSA 2PRBA 4DUKA 4IAVA 4OADA 2XEIA 4PPZA 2RB7A 3VH9A 4L8AA 3G3SA 1XJOA 2Q43A 1A2ZA 1CX8A 1I12A 5I4MA 4COGA 2IJZA 1Y9ZA 1IIDA 4P45A 3DR6A 3CXPA 3FECA 4ONUA 5D29A 3EZAA 3F0AA 2NSMA 5BWAB 1TF9A 1RXTA 2WPWA 4H2KA 5KTCA 4C8FA 3DSBA 4C9RA 2ARHA 1V0CA 1Z4EA 3D4UA 3BUWB 3RBUA 1M1DA 3R9FA 2VQYA 5HKYA 4DNCA 2YNDA 2JBKA 3EY5A 4BD9A 3PEIA 3S6HA 4CYNA 4KUAA 4F9VA 2HWGA 5F46A 3IFEA 3FF3A 1CPXA 2PJ9A 2PSWA 4B13A 4CPAA 3U1BA 3FXTA 4KOSA 1PYTB 4A95A 2P6EA 1HEEA 3KHXA 4A94A 3T5MA 4ORFA 4UEZA 1Y7EA 2GLFA 2ZENA 3QNVA 1HDUA 2H5MA 4OC1A 4H6ZA 1LOKA 5CNPA 1R43A 4KOVA 4MCQA 1J4JA 1Z5RA 2ZOGA 4PK3A 4B12A 3QAHA 4BPWB 2ZW5A 4CAVA 2ANPA 1KBLA 2AFXA 2EWBA 1CE8B 1DTDA 3S6KA 1ARLA 4MCRA 3TOBA 1EZBA 4FWUA 4MFJA 5F1YA 2B4DB 1S7FA 1BOBA 1P4NA 3D2PA 3PB8X 2I00A 1ON0A 4NXYA 5F47A 4C9AA 4U5YA 4OC2A 5GCNA 3PRTA 4GM5A 1AYEA 2BSWA 2PR8A 3TO9A 1OBRA 4NGRA 4H1HA 2K5TA 3D66A 3ISZA 3EXNA 1H8LA 1WJTA 3N7ZA 4A2ZA 1VBHA 4C9VA 4MCPA 1X12A 4A32A 4EYSA 1Y0YA 2VBQA 1BO4A 5DS0A 5EBVA 4LQ6A 3FNCA 4FD5A 8CPAA 4ZY1A 3E0KA 4MHZA 3B2YA 3SI2A 3EIFA 4TJXA 2AFZA 3FJUA 1I1DA 3IIBA 3K4IA 3PLFB 4PV6A 3SJFA 2QVPA 4JYWA 2D4PA 5LRJA 3NE8A 4KOYA 4M6HA 4PSWA 2FIAA 4R6TA 4CGOA 4UEEA 2Q4VA 5HKWA 2CNTA 1Y0RA 2F8HA 2FCKA 1XMTA 2BO9A 3EFAA 5HVHA 1LAPA 2PJBA 2WUUA 3SJGA 1AUGA 1WVMA 2XPNA 3S9MA 3FYNA 3I9SA 4OC5A 2PVWA 4XPLA 3R9EA 5AG7A 1F2OA 1RTQA 4F0XA 3EZEA 2YJTA 2OZGA 2WPXA 3IWEA 2V8DA 3IU1A 2DIKA 1YW4A 4UWIA 1ZG9A 1Y7RA 1VBGA 2NYQA 2ZW6A 2EK9A 4MRIA 3W6XA 2PJ0A 2V77A 2VEZA 5ELYA 4PXCA 4CYPA 4UCPA 4C7HA 2DPSA 2I79A 2J8MA 2O53A 1KUYA 4RI1A 2ZEEA 1FBVA 2IL4A 3GLJA 1P0HA 4DYOA 4NCZA 3L2NA 4IHMA 1WK4A 4XNHC 1IOIA 4C2YA 4UF4A 5IB0A 4ZX8A 3S6FA 4EVYA 4BTFA 4K3NA 5HVFA 1NE9A 3WC6A 3G23A 5AG4A 3T9YA 1KWMA 1EO0A 7CPAA 4COBA 3OB2B 5I0CA 3H8FA 5DWMA 4XNHB 2MP0A 3W6SA 1ZYMA 1K4JA 3I74A 4OC4A 1IOFA 1KUXA 5KTAA 2QJ8A 1YLOA 3OAKA 2VZYA 4NJQA 3KKWA 4AG7A 2OB0A 2AFOA 4QUSA 2YNEA 3S9LA 4YRHA 3JTKA 3T05A 1KC7A 1Y9WA 3SJEA 2EZBA 1ARMA 1XIXA 2C6GA 4C9EA 3W91A 4CYOA 3D7DA 1PU9A 3TFYA 3NFQA 2D0PA 4KS9A 5A27A 2HV2A 1QSNA 3VWDA 4AVBA 5F9MA 2CIJA 1Q2YA 2ZEPA 3F5BA 1B47A 2BOAA 3CXSA 1YR0A 4OIWA 4TWEA 4Z65A 4KSFA 4YU9A 2ZEGA 3IU2A 2ZPAA 4PSXA 5K8NA 2HROA 4FD7A 4XPKA 2EZCA 1QSRA 1QSOA 3DGVA 4KOWA 4KSIA 3C26A 4TNUA 4UIAA 2R7HA 4YWYA 3WR7A 1KZFA 1CS0B 1Z8LA 5HKZA 5LRGA 1Q5XA 3IC1A 2Z0ZA 4M3SA 3CT9A 4CAWA 4UA3A 3NH5A 4P4FA 4NGQA 4ZYQA 4MBUA 3DLJA 3TO6A 3UY5A 4CZ1A 3JVNA 2XPPA 3GKRA 2OZHA 3TLZA 2GFQA 4MMOA 4OP4A 5C82A 2REFA 4A31A 3SJXA 4NFRA 3I3GA 1QQ9A 3PB9X 3GB0A 1FT7A 4DJLA 5G22A 1HDQA 4HNYB 3BI0A 4LX9A 3VATA 4CO9A 2ZEHA 4CAXA 4LQGA 4KOUA 2XPOA 4CDJA 4J3GA 4NGPA 1ZRSA 4Q7AA 4M8DA 4ZX9A 1Z8WA 2VZZA 1F2PA 1IYLA 1VKCA 3VGOA 3V8IA 5G21A 5JPHA 4IIYA 1F57A 5K8PA 1IY7A 4QBJA 5HMNA 3OP0A 1ZLIA 5CBMA 1XMBA 4MFZA 1LFWA 4FD4A 2DPTA
chains in the Genus database with same CATH topology
3PFOA 3PBEA 1BLLE 1CBXA 2GREA 1CPSA 4MHNA 3BXMA 1BPMA 4FBEA 4OC0A 4C86A 3KZWA 1CP7A 2FVGA 2Q51A 2Q4ZA 3HLPA 3BHXA 4MXUA 2RFHA 4EFDA 4MHYA 3T8WA 1YSJA 3BI1A 5CPAA 3KQZA 3I6SA 2DEAA 3CDXA 1Z2LA 4R7MA 2ZEDA 2PJ1A 4UIBA 3RAMA 4ZY2A 1M4LA 2ABZA 2PRQA 2PVVA 3PB4X 2C6CA 3B7IA 1PCAA 2PJ5A 4C85A 4FUUA 2PCUA 5HVGA 4C9UA 2PJ2A 1DE4C 1QMUA 2PJ4A 2JBJA 3FVLA 5D8NA 3TC8A 2I3CA 2ZEOA 5HXDA 1CP6A 3PB7X 2PIYA 4PXEA 4X2TA 1VIXA 1XBUA 2PJ6A 2CTCA 3KGQA 1ZG7A 2PE3A 1LCPA 5K8MA 4P4EA 5JGFA 5LYIA 4IK2A 4X3RA 4NGNA 2C5QA 2F7VA 3FMCA 2EK8A 4P4DA 3FEDA 4WWVA 3FH4A 2QYVA 3ICUA 4PXBA 4P4IA 2PJ3A 5THWA 3KHZA 3V7ZA 3NH8A 1EE3P 4C8TA 3D7FA 2PJCA 4NGSA 2WZNA 4WJBA 2PJ8A 4ONWA 4PXDA 4CDKA 3B3CA 1JQGA 3D7GA 2V8HA 5LYFA 3MN8A 2V8GA 2IMOA 2IQ6A 1LAMA 5JM6A 4P4JA 3D7HA 2ZOFA 4O23A 2HC9A 5IB9A 3D67A 4C8CA 3NA6A 3B35A 2GLJA 3D68A 2AFUA 2XEGA 2O4HA 5J1QA 3PFEA 4P10A 2POKA 2ZEFA 3KQXA 3KASA 5LYLA 2CTBA 1VHOA 3MRUA 4JZ0A 1UWYA 3H8EA 3K2KA 4EWTA 2XEJA 3CPAA 2WYRA 1V6CA 2PJAA 3B3VA 3SI0A 3LWUA 4A38A 4UEFA 4OMEA 3H8GA 4C8PA 3WC5A 3N5FA 4OKOA 4RUHA 1BPNA 1TKFA 4YN3A 4G1PA 2OOTA 2CF4A 3RZAA 3K9TA 4C8AA 4NGMA 1YW6A 3SI1A 4P4BA 3JRUA 4B6ZA 1XF1A 3KI9A 1TKJA 2ZEMA 3PBBA 4EMEA 3FEEA 1CG2A 3NFZA 6CPAA 3I1UA 3HUVA 5IR2A 2VL1A 4TJVA 1ZG8A 4P6YA 1LANA 3KR4A 4NJRA 3IEHA 3GUXA 3VH9A 1XFOA 1ZLHA 2XEFA 1FNOA 4A39A 2J9AA 4F9UA 4KNGE 3VTAA 4A37A 2AFSA 2AFMA 2G9DA 4C8UA 2HB6A 1R3NA 3V38A 4R76A 4OC3A 4C99A 3IJ3A 1TF8A 3B3WA 4W9YA 3CPXA 1BAVA 4ZI6A 4C9AA 1YMEA 1GYTA 1Q7LA 2V8VA 4MCSA 2ZELA 5LYDA 3ISXA 1NSAA 2GP4A 3KL9A 3S9NA 4C84A 3LMSA 4R8FA 2AFWA 3IO1A 3KR5A 1ELLP 2JEWA 4FAIA 3TX8A 1XRYA 4OIDA 3IWWA 3B3SA 5F09A 4ZY0A 4AXVA 3WC7A 3WABA 3WT4A 2GU2A 1AMPA 2C6PA 2PJ7A 5LRKA 4F8ZA 4X8IA 1VHEA 1VGYA 2PIZA 4MHPA 1IGBA 3VARA 2C1CA 5K8OA 5K8PA 1TKHA 4P44A 3NH4A 3FX6A 4NGTA 3B3TA 1TXRA 5JH9A 1ELMP 2BCOA 2OR4A 4PQAA 3PB6X 4DUKA 4IAVA 2XEIA 4PPZA 2RB7A 1XJOA 2Q43A 1CX8A 5I4MA 2IJZA 1Y9ZA 4P45A 3FECA 5D29A 2NSMA 1TF9A 4C8FA 4H2KA 4C9RA 3D4UA 3RBUA 2JBKA 4BD9A 3PEIA 4F9VA 3IFEA 3FF3A 1CPXA 2PJ9A 4CPAA 1PYTB 3KHXA 1HEEA 4A94A 4UEZA 1Y7EA 2GLFA 2ZENA 3QNVA 1HDUA 4OC1A 1LOKA 1R43A 4MCQA 2ZOGA 1Z5RA 2ANPA 2AFXA 2EWBA 1DTDA 1ARLA 4MCRA 4FWUA 3PB8X 4OC2A 3PRTA 4GM5A 1AYEA 1OBRA 4NGRA 3ISZA 3D66A 1H8LA 4C9VA 4MCPA 1Y0YA 5DS0A 8CPAA 4ZY1A 4MHZA 4TJXA 3B2YA 3SI2A 3EIFA 2AFZA 3FJUA 3IIBA 3SJFA 2QVPA 4JYWA 5LRJA 4R6TA 4UEEA 1Y0RA 2F8HA 2BO9A 5HVHA 1LAPA 2PJBA 3SJGA 1WVMA 3S9MA 4OC5A 2PVWA 1F2OA 1RTQA 2V8DA 1YW4A 1ZG9A 2NYQA 2EK9A 4MRIA 2PJ0A 2V77A 5ELYA 4PXCA 2O53A 2ZEEA 3GLJA 4DYOA 3L2NA 4IHMA 4UF4A 4ZX8A 4K3NA 5HVFA 3WC6A 1KWMA 7CPAA 3H8FA 3I74A 4OC4A 2QJ8A 1YLOA 4NJQA 2AFOA 3S9LA 3SJEA 1ARMA 2C6GA 4C9EA 3D7DA 2CIJA 2ZEPA 4TWEA 2BOAA 4OIWA 4Z65A 5K8NA 4YU9A 2ZEGA 3DGVA 4KSIA 4TNUA 4YWYA 4UIAA 1Z8LA 5LRGA 3IC1A 3CT9A 3NH5A 4P4FA 4NGQA 4ZYQA 3DLJA 4MMOA 4OP4A 3SJXA 4NFRA 1QQ9A 3PB9X 3GB0A 1FT7A 4DJLA 1HDQA 3VATA 3BI0A 2ZEHA 4LQGA 4CDJA 4NGPA 4Q7AA 4ZX9A 1F2PA 1F57A 1IY7A 1ZLIA 5CBMA 1XMBA 1LFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFO A;  3PBE A;  1BLL E;  1CBX A;  2GRE A;  1CPS A;  4MHN A;  3BXM A;  1BPM A;  4FBE A;  4OC0 A;  4C86 A;  3KZW A;  1CP7 A;  2FVG A;  2Q51 A;  2Q4Z A;  3HLP A;  3BHX A;  4MXU A;  2RFH A;  4EFD A;  4MHY A;  3T8W A;  1YSJ A;  3BI1 A;  5CPA A;  3KQZ A;  3I6S A;  2DEA A;  3CDX A;  1Z2L A;  4R7M A;  2ZED A;  2PJ1 A;  4UIB A;  3RAM A;  4ZY2 A;  1M4L A;  2ABZ A;  2PRQ A;  2PVV A;  3PB4 X;  2C6C A;  3B7I A;  1PCA A;  2PJ5 A;  4C85 A;  4FUU A;  2PCU A;  5HVG A;  4C9U A;  2PJ2 A;  1DE4 C;  1QMU A;  2PJ4 A;  2JBJ A;  3FVL A;  5D8N A;  3TC8 A;  2I3C A;  2ZEO A;  5HXD A;  1CP6 A;  3PB7 X;  2PIY A;  4PXE A;  4X2T A;  1VIX A;  1XBU A;  2PJ6 A;  2CTC A;  3KGQ A;  1ZG7 A;  2PE3 A;  1LCP A;  5K8M A;  4P4E A;  5JGF A;  5LYI A;  4IK2 A;  4X3R A;  4NGN A;  2F7V A;  3FMC A;  2EK8 A;  4P4D A;  3FED A;  4WWV A;  3FH4 A;  2QYV A;  3ICU A;  4PXB A;  4P4I A;  2PJ3 A;  5THW A;  3KHZ A;  3V7Z A;  3NH8 A;  1EE3 P;  4C8T A;  3D7F A;  2PJC A;  4NGS A;  2WZN A;  4WJB A;  2PJ8 A;  4ONW A;  4PXD A;  4CDK A;  3B3C A;  1JQG A;  3D7G A;  2V8H A;  5LYF A;  3MN8 A;  2V8G A;  2IMO A;  2IQ6 A;  1LAM A;  5JM6 A;  4P4J A;  3D7H A;  2ZOF A;  4O23 A;  2HC9 A;  5IB9 A;  3D67 A;  4C8C A;  3NA6 A;  3B35 A;  2GLJ A;  3D68 A;  2AFU A;  2XEG A;  2O4H A;  5J1Q A;  3PFE A;  4P10 A;  2POK A;  2ZEF A;  3KQX A;  3KAS A;  5LYL A;  2CTB A;  1VHO A;  3MRU A;  4JZ0 A;  1UWY A;  3H8E A;  3K2K A;  4EWT A;  2XEJ A;  3CPA A;  2WYR A;  1V6C A;  2PJA A;  3B3V A;  3SI0 A;  3LWU A;  4A38 A;  4UEF A;  4OME A;  3H8G A;  4C8P A;  3WC5 A;  3N5F A;  4OKO A;  4RUH A;  1BPN A;  1TKF A;  4YN3 A;  4G1P A;  2OOT A;  2CF4 A;  3RZA A;  3K9T A;  4C8A A;  4NGM A;  1YW6 A;  3SI1 A;  4P4B A;  3JRU A;  4B6Z A;  1XF1 A;  3KI9 A;  1TKJ A;  2ZEM A;  3PBB A;  4EME A;  3FEE A;  1CG2 A;  3NFZ A;  6CPA A;  3I1U A;  3HUV A;  2VL1 A;  4TJV A;  1ZG8 A;  4P6Y A;  1LAN A;  3KR4 A;  4NJR A;  3IEH A;  3GUX A;  3VH9 A;  1XFO A;  1ZLH A;  2XEF A;  1FNO A;  4A39 A;  2J9A A;  4F9U A;  4KNG E;  3VTA A;  4A37 A;  2AFS A;  2AFM A;  2G9D A;  4C8U A;  2HB6 A;  1R3N A;  3V38 A;  4R76 A;  4OC3 A;  4C99 A;  3IJ3 A;  1TF8 A;  3B3W A;  4W9Y A;  3CPX A;  1BAV A;  4ZI6 A;  4C9A A;  1YME A;  1GYT A;  1Q7L A;  2V8V A;  4MCS A;  2ZEL A;  5LYD A;  3ISX A;  1NSA A;  3KL9 A;  3S9N A;  4C84 A;  3LMS A;  4R8F A;  2AFW A;  3IO1 A;  3KR5 A;  1ELL P;  2JEW A;  4FAI A;  3TX8 A;  1XRY A;  4OID A;  3IWW A;  3B3S A;  5F09 A;  4ZY0 A;  4AXV A;  3WC7 A;  3WAB A;  3WT4 A;  2GU2 A;  1AMP A;  2C6P A;  2PJ7 A;  5LRK A;  4F8Z A;  4X8I A;  1VHE A;  1VGY A;  2PIZ A;  4MHP A;  1IGB A;  3VAR A;  2C1C A;  5K8O A;  5K8P A;  1TKH A;  4P44 A;  3NH4 A;  3FX6 A;  4NGT A;  3B3T A;  1TXR A;  5JH9 A;  1ELM P;  2BCO A;  2OR4 A;  4PQA A;  3PB6 X;  4DUK A;  4IAV A;  2XEI A;  4PPZ A;  2RB7 A;  1XJO A;  2Q43 A;  1CX8 A;  5I4M A;  2IJZ A;  1Y9Z A;  4P45 A;  3FEC A;  5D29 A;  2NSM A;  1TF9 A;  4C8F A;  4H2K A;  4C9R A;  3D4U A;  3RBU A;  2JBK A;  4BD9 A;  3PEI A;  4F9V A;  3IFE A;  3FF3 A;  1CPX A;  2PJ9 A;  4CPA A;  1PYT B;  3KHX A;  1HEE A;  4A94 A;  4UEZ A;  1Y7E A;  2GLF A;  2ZEN A;  3QNV A;  1HDU A;  4OC1 A;  1LOK A;  1R43 A;  4MCQ A;  2ZOG A;  1Z5R A;  2ANP A;  2AFX A;  2EWB A;  1DTD A;  1ARL A;  4MCR A;  4FWU A;  3PB8 X;  4OC2 A;  3PRT A;  4GM5 A;  1AYE A;  1OBR A;  4NGR A;  3ISZ A;  3D66 A;  1H8L A;  4C9V A;  4MCP A;  1Y0Y A;  5DS0 A;  8CPA A;  4ZY1 A;  4MHZ A;  4TJX A;  3B2Y A;  3SI2 A;  3EIF A;  2AFZ A;  3FJU A;  3IIB A;  3SJF A;  2QVP A;  4JYW A;  5LRJ A;  4R6T A;  4UEE A;  1Y0R A;  2F8H A;  2BO9 A;  5HVH A;  1LAP A;  2PJB A;  3SJG A;  1WVM A;  3S9M A;  4OC5 A;  2PVW A;  1F2O A;  1RTQ A;  2V8D A;  1YW4 A;  1ZG9 A;  2NYQ A;  2EK9 A;  4MRI A;  2PJ0 A;  2V77 A;  5ELY A;  4PXC A;  2O53 A;  2ZEE A;  3GLJ A;  4DYO A;  3L2N A;  4IHM A;  4UF4 A;  4ZX8 A;  4K3N A;  5HVF A;  3WC6 A;  1KWM A;  7CPA A;  3H8F A;  3I74 A;  4OC4 A;  2QJ8 A;  1YLO A;  4NJQ A;  2AFO A;  3S9L A;  3SJE A;  1ARM A;  2C6G A;  4C9E A;  3D7D A;  2CIJ A;  2ZEP A;  4TWE A;  2BOA A;  4OIW A;  4Z65 A;  5K8N A;  4YU9 A;  2ZEG A;  3DGV A;  4KSI A;  4TNU A;  4YWY A;  4UIA A;  1Z8L A;  5LRG A;  3IC1 A;  3CT9 A;  3NH5 A;  4P4F A;  4NGQ A;  4ZYQ A;  3DLJ A;  4MMO A;  4OP4 A;  3SJX A;  4NFR A;  1QQ9 A;  3PB9 X;  3GB0 A;  1FT7 A;  4DJL A;  1HDQ A;  3VAT A;  3BI0 A;  2ZEH A;  4LQG A;  4CDJ A;  4NGP A;  4Q7A A;  4ZX9 A;  1F2P A;  1F57 A;  1IY7 A;  1ZLI A;  5CBM A;  1XMB A;  1LFW A; 
#chains in the Genus database with same CATH topology
 3PFO A;  3HMJ G;  2OH1 A;  4JJX A;  4CGL A;  3RO0 A;  2FL4 A;  3PBE A;  4CGM A;  3C8O A;  2Q04 A;  1BLL E;  3CZX A;  1CBX A;  1I21 A;  2GRE A;  3VRO A;  1CPS A;  2R8V A;  2X0S A;  4MHN A;  3BXM A;  1BPM A;  2KCW A;  3K9U A;  2J8N A;  4FBE A;  4OC0 A;  1Q2C A;  2FE7 A;  4C86 A;  2P0W A;  4UFX A;  4B11 A;  4CAE A;  3KZW A;  1CP7 A;  2Q7B A;  3R9G A;  2FVG A;  2Q51 A;  2Q4Z A;  4UCN A;  1J3L A;  4A4C A;  3HLP A;  4LUA A;  3BHX A;  5BY0 A;  5F13 A;  2Z3O A;  2RFH A;  3HPG G;  3PP9 A;  1QST A;  4MXU A;  4EFD A;  4MHY A;  5AGE A;  3T8W A;  4MFP A;  1YSJ A;  1M4G A;  3R95 A;  3BI1 A;  2WSA A;  3A9L A;  5CPA A;  3KQZ A;  1S5K A;  3I6S A;  5G20 A;  4IF5 A;  1XOV A;  2JLM A;  5ISV A;  1S7N A;  5K99 A;  2DEA A;  2PR1 A;  4H6U A;  2B5G A;  4UCM A;  3CDX A;  2VI7 A;  3VRQ A;  2Z3N A;  1Z2L A;  2GE3 A;  4R7M A;  5IX3 A;  2ZED A;  3PGP A;  2AUN A;  1X10 A;  2PJ1 A;  2ATR A;  4UIB A;  2B0A A;  3U88 C;  3RAM A;  4ZY2 A;  4CAF A;  1S7K A;  2Y0M A;  1M4L A;  5KTD A;  2ABZ A;  2PRQ A;  2PVV A;  1B6B A;  2C6C A;  3PB4 X;  4A33 A;  4MFK A;  3TLY A;  2XPL A;  4QVT A;  4RN7 A;  3P2H A;  3PFV A;  4F0Y A;  2Q7S A;  3B7I A;  4R57 A;  1PCA A;  2AJ6 A;  2NMT A;  2PJ5 A;  4C85 A;  4FUU A;  2PCU A;  5HVG A;  3BUO B;  1YX0 A;  5JVL A;  2YJV A;  4C9U A;  2PJ2 A;  1GGO A;  2Z3L A;  1DE4 C;  1QMU A;  4MJ8 A;  2J8R A;  2PJ4 A;  4CYQ A;  1KUV A;  2PCN A;  2JBJ A;  3FVL A;  4OAE A;  5D8N A;  3TC8 A;  3TTH A;  2I3C A;  2ZEO A;  4E94 A;  4ZBG A;  1NSL A;  4CRZ B;  5HXD A;  3BUX B;  1KEE B;  1CP6 A;  3PB7 X;  1Q2D A;  1S60 A;  4AG9 A;  4C2Z A;  2G3A A;  3TLG A;  1XEB A;  2PIY A;  4PXE A;  5G1Z A;  1IYK A;  4X2T A;  3TCV A;  3BJ7 A;  2FM4 A;  2C27 A;  3P2F A;  1VIX A;  1XBU A;  2JDC A;  1B87 A;  4IUS A;  4KZT A;  2PJ6 A;  1S3Z A;  2CTC A;  2FXF A;  3EC4 A;  4YGO A;  4E0A A;  3VRR A;  3BLN A;  4YFJ A;  2B4B A;  3DNS A;  1JDB C;  4MI1 A;  4CS0 B;  3KGQ A;  1DIK A;  1Z4R A;  1ZG7 A;  2PE3 A;  1LCP A;  4U9Z A;  4P4E A;  5IV0 A;  5K8M A;  3LAC A;  2UV8 G;  4R87 A;  5JGF A;  5EC4 A;  5LYI A;  1M44 A;  4IK2 A;  4X5K A;  4X3R A;  3F8K A;  1VHS A;  4NGN A;  4PK2 A;  3D8P A;  4RR2 B;  2F7V A;  3FMC A;  2C5Q A;  2EK8 A;  4P4D A;  3R96 A;  3FED A;  4WWV A;  3FH4 A;  4BPU B;  2QYV A;  3QAY A;  4C2X A;  4PXB A;  3ICU A;  2Z11 A;  2ODF A;  3S6G A;  4P4I A;  2PJ3 A;  3IWG A;  5THW A;  3D2M A;  3KHZ A;  5F5X A;  3QB8 A;  3NH8 A;  3V7Z A;  1MJA A;  4BMH A;  1EE3 P;  2DLA A;  1FY7 A;  1MJB A;  5A28 A;  4KLV A;  3H4Q A;  4JWP A;  3T90 A;  4C8T A;  2FS5 A;  5J8C A;  3VRP A;  4KUB A;  2CY2 A;  3D7F A;  1CM0 A;  2PJC A;  4NGS A;  2EUI A;  2WZN A;  4MJX A;  4I49 A;  4GS4 A;  3OB1 B;  1BXR B;  4WJB A;  2PJ8 A;  4ONW A;  4PXD A;  4CRY B;  2R1I A;  1JDE A;  2FSR A;  3LD2 A;  2AUM A;  4CDK A;  3B3C A;  1JQG A;  3D7G A;  3SHP A;  2V8H A;  2CXA A;  1L0C A;  2OZU A;  3GIU A;  3MN8 A;  4R9M A;  5LYF A;  3TE4 A;  3FBU A;  2Y1M A;  1YVK A;  2V8G A;  3D3S A;  2QIR A;  2IMO A;  2BUE A;  2B5G B;  4MFQ A;  4J0N A;  2IQ6 A;  3PT1 A;  1LAM A;  2DXQ A;  5JM6 A;  4P4J A;  3D7H A;  2ZOF A;  5JYB A;  4Q36 A;  5H86 A;  4O23 A;  3TLE A;  4R3L A;  5AG6 A;  1EZA A;  4KOT A;  2HC9 A;  5IB9 A;  4JD6 A;  4JXR A;  3D67 A;  3FB3 A;  1Z9U A;  3TO7 A;  3ZZI A;  3NA6 A;  4C8C A;  3BUN B;  4CGN A;  3B35 A;  4UBR A;  2GLJ A;  3EO4 A;  4AVA A;  2GAN A;  3D68 A;  2AFU A;  2XEG A;  2O4H A;  5J1Q A;  1JWQ A;  3PFE A;  4KSA A;  4P10 A;  2X7B A;  2POK A;  2ZEF A;  4C68 A;  1VI4 A;  3KQX A;  3KRV A;  1NBW A;  3KAS A;  1SQH A;  5LYL A;  2CTB A;  1VHO A;  1YK3 A;  1LRZ A;  3MRU A;  2HI6 A;  2B3U A;  1XF8 A;  4B5P A;  4CGP A;  1YLE A;  4JZ0 A;  2Z3P A;  3O8Z A;  1UWY A;  3H8E A;  4A4B A;  4UFV A;  1PUA A;  1C30 B;  1T36 B;  4E2A A;  1CJW A;  1ZO0 A;  2XEJ A;  3K2K A;  4EWT A;  3CPA A;  3G8W A;  4UFW A;  2WYR A;  4MFL A;  3TLG B;  4L89 A;  1V6C A;  1QSM A;  4KOR A;  1RO5 A;  2PJA A;  3B3V A;  3TLB A;  4Q38 A;  3SI0 A;  2EVN A;  3SR3 A;  2P6F A;  3LWU A;  4A38 A;  4ZGY B;  1IB1 E;  4UEF A;  4OME A;  3H8G A;  2F5I A;  1Y9K A;  4HKF A;  3TOA A;  4C8P A;  4A30 A;  3WC5 A;  3N5F A;  4U9Y A;  4OKO A;  5K8O A;  2EO8 A;  4RUH A;  1BPN A;  1TKF A;  4YN3 A;  3MGD A;  1YVO A;  4G1P A;  2OOT A;  2CF4 A;  3RZA A;  4Y49 C;  3K9T A;  2DF5 A;  2VXK A;  2Z10 A;  4MY3 A;  4NGM A;  2B3V A;  1YW6 A;  2QEC A;  4C8A A;  1OZP A;  1GHE A;  4P4B A;  2A4N A;  3GY9 A;  2GIV A;  5FVJ A;  3SI1 A;  3JRU A;  4MI4 A;  4II9 A;  1WWZ A;  2O28 A;  4B6Z A;  1XF1 A;  3KI9 A;  2REE A;  2ZXV A;  1TKJ A;  2B58 A;  2ZEM A;  3B8G A;  3DR8 A;  3PBB A;  4H89 A;  4OLL A;  4Y49 B;  2Z3K A;  5J3X A;  4EME A;  3FEE A;  4KVX A;  1N71 A;  2CBL A;  2FT0 A;  1CG2 A;  2BL1 A;  4MHD A;  2OU2 A;  3NFZ A;  4JLY A;  4UWJ A;  6CPA A;  1IU8 A;  2PC1 A;  2RC4 A;  3I1U A;  1YGH A;  1M6V B;  4KVM E;  3NE7 A;  3SXO A;  3SXN A;  5DWN A;  3HUV A;  5AG5 A;  3GJZ A;  5IR2 A;  2EBJ A;  2VL1 A;  4GXH A;  4TJV A;  1ZG8 A;  1YQE A;  2YNC A;  5J8F A;  4P6Y A;  1LAN A;  4M85 A;  2JEV A;  4M6I A;  3ZJ0 A;  3KR4 A;  1XE4 A;  4NJR A;  2CNM A;  3GUX A;  2FIW A;  3IEH A;  3PZJ A;  1XFO A;  1ZLH A;  2XEF A;  1FNO A;  4QC6 A;  4XPD C;  5E96 A;  4A39 A;  2J9A A;  3LOD A;  2B4J C;  4F9U A;  3IGR A;  2R82 A;  1NMT A;  4E8O A;  3R1K A;  4KOX A;  4KNG E;  4BPX B;  5AXI A;  3VTA A;  4NEX A;  4A37 A;  2AFS A;  3JUW A;  2D0O A;  2AE6 A;  3HPH E;  4KLW A;  3TYX A;  2AFM A;  1M4I A;  2G9D A;  2QML A;  4F6A A;  2HB6 A;  3DDD A;  4C8U A;  3NOJ A;  4HNW B;  4XPD B;  4R3K A;  3T0T A;  1R3N A;  3V38 A;  4R76 A;  4B5P B;  2G0B A;  4OC3 A;  3BUM B;  3VWE A;  1NXJ A;  3TLA A;  2PDO A;  4C99 A;  3IJ3 A;  2YGW A;  2Q44 A;  4JXQ A;  1TF8 A;  4E5S A;  3B3W A;  4W9Y A;  3CPX A;  3H5Z A;  2ZW4 A;  1BAV A;  4KVO E;  1MJ9 A;  3T07 A;  1TIQ A;  4ZI6 A;  4IIX A;  1IIC A;  1YME A;  1GYT A;  1Q7L A;  2JDD A;  4MCS A;  2V8V A;  2Z3M A;  2ZEL A;  5LYD A;  4NF1 A;  2D4O A;  3OWC A;  3ISX A;  1R57 A;  1NSA A;  4RS2 A;  3KL9 A;  4AB7 A;  2GP4 A;  1U6M A;  3S9N A;  1C3O B;  3EZB A;  4B10 A;  4C84 A;  3TT2 A;  3LMS A;  4INJ A;  1A9X B;  4R8F A;  5HH1 A;  2B4D A;  4QB9 A;  1Z9E A;  2AFW A;  4B14 A;  2P6G A;  3IO1 A;  3KR5 A;  1ELL P;  2JEW A;  4FAI A;  5C88 A;  2CNS A;  1M4D A;  3TX8 A;  2Q4Y A;  2HQY A;  1XRY A;  4OID A;  3IWW A;  3B3S A;  5F09 A;  1Z8X A;  4C7I A;  4ZY0 A;  4AXV A;  3WC7 A;  1MK4 A;  3WAB A;  3WT4 A;  4GPL B;  2GU2 A;  4B5O A;  4JVO A;  2Q0Y A;  3GYA A;  2EZA A;  1AMP A;  4M6G A;  2C6P A;  3RNZ A;  5H84 A;  2PJ7 A;  3CXQ A;  4BIN A;  2Y1N A;  5LRK A;  4F8Z A;  4X8I A;  3RYO A;  1VHE A;  2VKZ G;  1VGY A;  3FRM A;  5F49 A;  2YNC C;  3BJ8 A;  2PIZ A;  3VRN A;  4MHP A;  1R61 A;  1IGB A;  4HNX B;  4K30 A;  4NSQ A;  5F48 A;  2C1C A;  3VAR A;  2R98 A;  4AVC A;  1TKH A;  1Z8T A;  4MY0 A;  4P44 A;  3FIX A;  3NH4 A;  1YVH A;  3FX6 A;  4BBH A;  4NGT A;  2E28 A;  5JQ4 A;  2HUZ A;  3ZNI A;  5EMI A;  3F9K C;  1ZL0 A;  3B3T A;  3TLC A;  1TXR A;  1UFH A;  5JH9 A;  5FD8 A;  1ELM P;  2OLS A;  2ZW7 A;  1YRE A;  2BCO A;  2PQ8 A;  4FD6 A;  2OR4 A;  1S7L A;  2G3T A;  3PB6 X;  4PQA A;  2BEI A;  2N3A B;  4HPS A;  2PRB A;  4DUK A;  4IAV A;  4OAD A;  2XEI A;  4PPZ A;  2RB7 A;  3VH9 A;  4L8A A;  3G3S A;  1XJO A;  2Q43 A;  1A2Z A;  1CX8 A;  1I12 A;  5I4M A;  4COG A;  2IJZ A;  1Y9Z A;  1IID A;  4P45 A;  3DR6 A;  3CXP A;  3FEC A;  4ONU A;  5D29 A;  3EZA A;  3F0A A;  2NSM A;  5BWA B;  1TF9 A;  1RXT A;  2WPW A;  4H2K A;  5KTC A;  4C8F A;  3DSB A;  4C9R A;  2ARH A;  1V0C A;  1Z4E A;  3D4U A;  3BUW B;  3RBU A;  1M1D A;  3R9F A;  2VQY A;  5HKY A;  4DNC A;  2YND A;  2JBK A;  3EY5 A;  4BD9 A;  3PEI A;  3S6H A;  4CYN A;  4KUA A;  4F9V A;  2HWG A;  5F46 A;  3IFE A;  3FF3 A;  1CPX A;  2PJ9 A;  2PSW A;  4B13 A;  4CPA A;  3U1B A;  3FXT A;  4KOS A;  1PYT B;  4A95 A;  2P6E A;  1HEE A;  3KHX A;  4A94 A;  3T5M A;  4ORF A;  4UEZ A;  1Y7E A;  2GLF A;  2ZEN A;  3QNV A;  1HDU A;  2H5M A;  4OC1 A;  4H6Z A;  1LOK A;  5CNP A;  1R43 A;  4KOV A;  4MCQ A;  1J4J A;  1Z5R A;  2ZOG A;  4PK3 A;  4B12 A;  3QAH A;  4BPW B;  2ZW5 A;  4CAV A;  2ANP A;  1KBL A;  2AFX A;  2EWB A;  1CE8 B;  1DTD A;  3S6K A;  1ARL A;  4MCR A;  3TOB A;  1EZB A;  4FWU A;  4MFJ A;  5F1Y A;  2B4D B;  1S7F A;  1BOB A;  1P4N A;  3D2P A;  3PB8 X;  2I00 A;  1ON0 A;  4NXY A;  5F47 A;  4C9A A;  4U5Y A;  4OC2 A;  5GCN A;  3PRT A;  4GM5 A;  1AYE A;  2BSW A;  2PR8 A;  3TO9 A;  1OBR A;  4NGR A;  4H1H A;  2K5T A;  3D66 A;  3ISZ A;  3EXN A;  1H8L A;  1WJT A;  3N7Z A;  4A2Z A;  1VBH A;  4C9V A;  4MCP A;  1X12 A;  4A32 A;  4EYS A;  1Y0Y A;  2VBQ A;  1BO4 A;  5DS0 A;  5EBV A;  4LQ6 A;  3FNC A;  4FD5 A;  8CPA A;  4ZY1 A;  3E0K A;  4MHZ A;  3B2Y A;  3SI2 A;  3EIF A;  4TJX A;  2AFZ A;  3FJU A;  1I1D A;  3IIB A;  3K4I A;  3PLF B;  4PV6 A;  3SJF A;  2QVP A;  4JYW A;  2D4P A;  5LRJ A;  3NE8 A;  4KOY A;  4M6H A;  4PSW A;  2FIA A;  4R6T A;  4CGO A;  4UEE A;  2Q4V A;  5HKW A;  2CNT A;  1Y0R A;  2F8H A;  2FCK A;  1XMT A;  2BO9 A;  3EFA A;  5HVH A;  1LAP A;  2PJB A;  2WUU A;  3SJG A;  1AUG A;  1WVM A;  2XPN A;  3S9M A;  3FYN A;  3I9S A;  4OC5 A;  2PVW A;  4XPL A;  3R9E A;  5AG7 A;  1F2O A;  1RTQ A;  4F0X A;  3EZE A;  2YJT A;  2OZG A;  2WPX A;  3IWE A;  2V8D A;  3IU1 A;  2DIK A;  1YW4 A;  4UWI A;  1ZG9 A;  1Y7R A;  1VBG A;  2NYQ A;  2ZW6 A;  2EK9 A;  4MRI A;  3W6X A;  2PJ0 A;  2V77 A;  2VEZ A;  5ELY A;  4PXC A;  4CYP A;  4UCP A;  4C7H A;  2DPS A;  2I79 A;  2J8M A;  2O53 A;  1KUY A;  4RI1 A;  2ZEE A;  1FBV A;  2IL4 A;  3GLJ A;  1P0H A;  4DYO A;  4NCZ A;  3L2N A;  4IHM A;  1WK4 A;  4XNH C;  1IOI A;  4C2Y A;  4UF4 A;  5IB0 A;  4ZX8 A;  3S6F A;  4EVY A;  4BTF A;  4K3N A;  5HVF A;  1NE9 A;  3WC6 A;  3G23 A;  5AG4 A;  3T9Y A;  1KWM A;  1EO0 A;  7CPA A;  4COB A;  3OB2 B;  5I0C A;  3H8F A;  5DWM A;  4XNH B;  2MP0 A;  3W6S A;  1ZYM A;  1K4J A;  3I74 A;  4OC4 A;  1IOF A;  1KUX A;  5KTA A;  2QJ8 A;  1YLO A;  3OAK A;  2VZY A;  4NJQ A;  3KKW A;  4AG7 A;  2OB0 A;  2AFO A;  4QUS A;  2YNE A;  3S9L A;  4YRH A;  3JTK A;  3T05 A;  1KC7 A;  1Y9W A;  3SJE A;  2EZB A;  1ARM A;  1XIX A;  2C6G A;  4C9E A;  3W91 A;  4CYO A;  3D7D A;  1PU9 A;  3TFY A;  3NFQ A;  2D0P A;  4KS9 A;  5A27 A;  2HV2 A;  1QSN A;  3VWD A;  4AVB A;  5F9M A;  2CIJ A;  1Q2Y A;  2ZEP A;  3F5B A;  1B47 A;  2BOA A;  3CXS A;  1YR0 A;  4OIW A;  4TWE A;  4Z65 A;  4KSF A;  4YU9 A;  2ZEG A;  3IU2 A;  2ZPA A;  4PSX A;  5K8N A;  2HRO A;  4FD7 A;  4XPK A;  2EZC A;  1QSR A;  1QSO A;  3DGV A;  4KOW A;  4KSI A;  3C26 A;  4TNU A;  4UIA A;  2R7H A;  4YWY A;  3WR7 A;  1KZF A;  1CS0 B;  1Z8L A;  5HKZ A;  5LRG A;  1Q5X A;  3IC1 A;  2Z0Z A;  4M3S A;  3CT9 A;  4CAW A;  4UA3 A;  3NH5 A;  4P4F A;  4NGQ A;  4ZYQ A;  4MBU A;  3DLJ A;  3TO6 A;  3UY5 A;  4CZ1 A;  3JVN A;  2XPP A;  3GKR A;  2OZH A;  3TLZ A;  2GFQ A;  4MMO A;  4OP4 A;  5C82 A;  2REF A;  4A31 A;  3SJX A;  4NFR A;  3I3G A;  1QQ9 A;  3PB9 X;  3GB0 A;  1FT7 A;  4DJL A;  5G22 A;  1HDQ A;  4HNY B;  3BI0 A;  4LX9 A;  3VAT A;  4CO9 A;  2ZEH A;  4CAX A;  4LQG A;  4KOU A;  2XPO A;  4CDJ A;  4J3G A;  4NGP A;  1ZRS A;  4Q7A A;  4M8D A;  4ZX9 A;  1Z8W A;  2VZZ A;  1F2P A;  1IYL A;  1VKC A;  3VGO A;  3V8I A;  5G21 A;  5JPH A;  4IIY A;  1F57 A;  5K8P A;  1IY7 A;  4QBJ A;  5HMN A;  3OP0 A;  1ZLI A;  5CBM A;  1XMB A;  4MFZ A;  1LFW A;  4FD4 A;  2DPT A; 
#chains in the Genus database with same CATH homology
 3PFO A;  3PBE A;  1BLL E;  1CBX A;  2GRE A;  1CPS A;  4MHN A;  3BXM A;  1BPM A;  4FBE A;  4OC0 A;  4C86 A;  3KZW A;  1CP7 A;  2FVG A;  2Q51 A;  2Q4Z A;  3HLP A;  3BHX A;  4MXU A;  2RFH A;  4EFD A;  4MHY A;  3T8W A;  1YSJ A;  3BI1 A;  5CPA A;  3KQZ A;  3I6S A;  2DEA A;  3CDX A;  1Z2L A;  4R7M A;  2ZED A;  2PJ1 A;  4UIB A;  3RAM A;  4ZY2 A;  1M4L A;  2ABZ A;  2PRQ A;  2PVV A;  3PB4 X;  2C6C A;  3B7I A;  1PCA A;  2PJ5 A;  4C85 A;  4FUU A;  2PCU A;  5HVG A;  4C9U A;  2PJ2 A;  1DE4 C;  1QMU A;  2PJ4 A;  2JBJ A;  3FVL A;  5D8N A;  3TC8 A;  2I3C A;  2ZEO A;  5HXD A;  1CP6 A;  3PB7 X;  2PIY A;  4PXE A;  4X2T A;  1VIX A;  1XBU A;  2PJ6 A;  2CTC A;  3KGQ A;  1ZG7 A;  2PE3 A;  1LCP A;  5K8M A;  4P4E A;  5JGF A;  5LYI A;  4IK2 A;  4X3R A;  4NGN A;  2C5Q A;  2F7V A;  3FMC A;  2EK8 A;  4P4D A;  3FED A;  4WWV A;  3FH4 A;  2QYV A;  3ICU A;  4PXB A;  4P4I A;  2PJ3 A;  5THW A;  3KHZ A;  3V7Z A;  3NH8 A;  1EE3 P;  4C8T A;  3D7F A;  2PJC A;  4NGS A;  2WZN A;  4WJB A;  2PJ8 A;  4ONW A;  4PXD A;  4CDK A;  3B3C A;  1JQG A;  3D7G A;  2V8H A;  5LYF A;  3MN8 A;  2V8G A;  2IMO A;  2IQ6 A;  1LAM A;  5JM6 A;  4P4J A;  3D7H A;  2ZOF A;  4O23 A;  2HC9 A;  5IB9 A;  3D67 A;  4C8C A;  3NA6 A;  3B35 A;  2GLJ A;  3D68 A;  2AFU A;  2XEG A;  2O4H A;  5J1Q A;  3PFE A;  4P10 A;  2POK A;  2ZEF A;  3KQX A;  3KAS A;  5LYL A;  2CTB A;  1VHO A;  3MRU A;  4JZ0 A;  1UWY A;  3H8E A;  3K2K A;  4EWT A;  2XEJ A;  3CPA A;  2WYR A;  1V6C A;  2PJA A;  3B3V A;  3SI0 A;  3LWU A;  4A38 A;  4UEF A;  4OME A;  3H8G A;  4C8P A;  3WC5 A;  3N5F A;  4OKO A;  4RUH A;  1BPN A;  1TKF A;  4YN3 A;  4G1P A;  2OOT A;  2CF4 A;  3RZA A;  3K9T A;  4C8A A;  4NGM A;  1YW6 A;  3SI1 A;  4P4B A;  3JRU A;  4B6Z A;  1XF1 A;  3KI9 A;  1TKJ A;  2ZEM A;  3PBB A;  4EME A;  3FEE A;  1CG2 A;  3NFZ A;  6CPA A;  3I1U A;  3HUV A;  5IR2 A;  2VL1 A;  4TJV A;  1ZG8 A;  4P6Y A;  1LAN A;  3KR4 A;  4NJR A;  3IEH A;  3GUX A;  3VH9 A;  1XFO A;  1ZLH A;  2XEF A;  1FNO A;  4A39 A;  2J9A A;  4F9U A;  4KNG E;  3VTA A;  4A37 A;  2AFS A;  2AFM A;  2G9D A;  4C8U A;  2HB6 A;  1R3N A;  3V38 A;  4R76 A;  4OC3 A;  4C99 A;  3IJ3 A;  1TF8 A;  3B3W A;  4W9Y A;  3CPX A;  1BAV A;  4ZI6 A;  4C9A A;  1YME A;  1GYT A;  1Q7L A;  2V8V A;  4MCS A;  2ZEL A;  5LYD A;  3ISX A;  1NSA A;  2GP4 A;  3KL9 A;  3S9N A;  4C84 A;  3LMS A;  4R8F A;  2AFW A;  3IO1 A;  3KR5 A;  1ELL P;  2JEW A;  4FAI A;  3TX8 A;  1XRY A;  4OID A;  3IWW A;  3B3S A;  5F09 A;  4ZY0 A;  4AXV A;  3WC7 A;  3WAB A;  3WT4 A;  2GU2 A;  1AMP A;  2C6P A;  2PJ7 A;  5LRK A;  4F8Z A;  4X8I A;  1VHE A;  1VGY A;  2PIZ A;  4MHP A;  1IGB A;  3VAR A;  2C1C A;  5K8O A;  5K8P A;  1TKH A;  4P44 A;  3NH4 A;  3FX6 A;  4NGT A;  3B3T A;  1TXR A;  5JH9 A;  1ELM P;  2BCO A;  2OR4 A;  4PQA A;  3PB6 X;  4DUK A;  4IAV A;  2XEI A;  4PPZ A;  2RB7 A;  1XJO A;  2Q43 A;  1CX8 A;  5I4M A;  2IJZ A;  1Y9Z A;  4P45 A;  3FEC A;  5D29 A;  2NSM A;  1TF9 A;  4C8F A;  4H2K A;  4C9R A;  3D4U A;  3RBU A;  2JBK A;  4BD9 A;  3PEI A;  4F9V A;  3IFE A;  3FF3 A;  1CPX A;  2PJ9 A;  4CPA A;  1PYT B;  3KHX A;  1HEE A;  4A94 A;  4UEZ A;  1Y7E A;  2GLF A;  2ZEN A;  3QNV A;  1HDU A;  4OC1 A;  1LOK A;  1R43 A;  4MCQ A;  2ZOG A;  1Z5R A;  2ANP A;  2AFX A;  2EWB A;  1DTD A;  1ARL A;  4MCR A;  4FWU A;  3PB8 X;  4OC2 A;  3PRT A;  4GM5 A;  1AYE A;  1OBR A;  4NGR A;  3ISZ A;  3D66 A;  1H8L A;  4C9V A;  4MCP A;  1Y0Y A;  5DS0 A;  8CPA A;  4ZY1 A;  4MHZ A;  4TJX A;  3B2Y A;  3SI2 A;  3EIF A;  2AFZ A;  3FJU A;  3IIB A;  3SJF A;  2QVP A;  4JYW A;  5LRJ A;  4R6T A;  4UEE A;  1Y0R A;  2F8H A;  2BO9 A;  5HVH A;  1LAP A;  2PJB A;  3SJG A;  1WVM A;  3S9M A;  4OC5 A;  2PVW A;  1F2O A;  1RTQ A;  2V8D A;  1YW4 A;  1ZG9 A;  2NYQ A;  2EK9 A;  4MRI A;  2PJ0 A;  2V77 A;  5ELY A;  4PXC A;  2O53 A;  2ZEE A;  3GLJ A;  4DYO A;  3L2N A;  4IHM A;  4UF4 A;  4ZX8 A;  4K3N A;  5HVF A;  3WC6 A;  1KWM A;  7CPA A;  3H8F A;  3I74 A;  4OC4 A;  2QJ8 A;  1YLO A;  4NJQ A;  2AFO A;  3S9L A;  3SJE A;  1ARM A;  2C6G A;  4C9E A;  3D7D A;  2CIJ A;  2ZEP A;  4TWE A;  2BOA A;  4OIW A;  4Z65 A;  5K8N A;  4YU9 A;  2ZEG A;  3DGV A;  4KSI A;  4TNU A;  4YWY A;  4UIA A;  1Z8L A;  5LRG A;  3IC1 A;  3CT9 A;  3NH5 A;  4P4F A;  4NGQ A;  4ZYQ A;  3DLJ A;  4MMO A;  4OP4 A;  3SJX A;  4NFR A;  1QQ9 A;  3PB9 X;  3GB0 A;  1FT7 A;  4DJL A;  1HDQ A;  3VAT A;  3BI0 A;  2ZEH A;  4LQG A;  4CDJ A;  4NGP A;  4Q7A A;  4ZX9 A;  1F2P A;  1F57 A;  1IY7 A;  1ZLI A;  5CBM A;  1XMB A;  1LFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...