1Z8LA

Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
695
structure length
695
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase II
publication title Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 201
structure length 695
sequence length 695
chains with identical sequence B, C, D
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 1z8lA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1z8lA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 1z8lA02
5I4MA 5LYFA 2WYRA 8CPAA 4MHYA 4NGSA 3FF3A 2AFOA 1BAVA 4FBEA 3PB6X 5K8NA 1XJOA 2V8HA 4C8AA 2PJ5A 4PPZA 4C84A 4NGPA 4UEEA 3QNVA 4WWVA 2O53A 2J9AA 3CPAA 3KHZA 2ZENA 1JQGA 1YW4A 2RFHA 5HVFA 3V38A 2AFUA 2PE3A 2IQ6A 3CPXA 4NGNA 3IO1A 3D7FA 5J1QA 4NJQA 3NH5A 4TNUA 3PEIA 1KWMA 4Q7AA 1QQ9A 3RAMA 4ZI6A 3VH9A 3H8EA 1TF8A 1HDUA 1LCPA 2ZEOA 3K9TA 4DYOA 3KHXA 5THWA 1VHEA 1ZG8A 3SJEA 2C6CA 2ABZA 2I3CA 4FUUA 3T8WA 4NJRA 1Q7LA 1VGYA 4OC1A 4C85A 1CPXA 4F9UA 3BHXA 1ELLP 2ZEHA 3SI2A 2FVGA 2GREA 4WJBA 1WVMA 3B35A 3KR4A 2PVWA 3VATA 5HVHA 4MCSA 3I6SA 4C9AA 3B3SA 4DJLA 4X2TA 4ZY1A 2JBJA 3D7GA 2PJ0A 3K2KA 4ZY2A 3IJ3A 4P4IA 2PJ2A 3TX8A 3WC6A 4P4BA 4CPAA 3FMCA 4W9YA 1LFWA 3B7IA 3KL9A 1DE4C 4NGMA 4UF4A 1M4LA 4G1PA 3FEEA 2V8VA 2OOTA 2EK8A 4TWEA 4C9EA 4JZ0A 3PB9X 4OC2A 5JH9A 2IMOA 2AFSA 4KSIA 3LMSA 1LAMA 2QYVA 4A39A 4IAVA 1R43A 2PRQA 4C86A 3B3TA 4NGRA 1TKJA 4RUHA 1LANA 4P44A 5D8NA 4K3NA 6CPAA 2BO9A 1Z8LA 4EMEA 4C8TA 1CP7A 4C8UA 3FEDA 4NGQA 1F57A 3HLPA 4ZX9A 3B2YA 3SJXA 4OC4A 4P4EA 2PJ7A 3IC1A 4MRIA 3D7HA 2ANPA 4H2KA 4BD9A 3PB8X 4O23A 4OC3A 1LAPA 2PCUA 3N5FA 1ZLHA 2BOAA 3SJFA 2PJ9A 3KGQA 4ONWA 3RZAA 3S9LA 3BXMA 2ZEPA 1RTQA 5IB9A 3I74A 4MCRA 4F8ZA 1CPSA 4ZY0A 1DTDA 1H8LA 4OIDA 2HC9A 4YU9A 1CG2A 1IGBA 3HUVA 5LRJA 2CF4A 2V77A 3GLJA 3SI0A 3B3VA 2XEJA 4P4FA 1Y7EA 3DLJA 2ZEMA 5F09A 2VL1A 2PJ1A 1HDQA 1VHOA 3FH4A 5JGFA 4X3RA 3ISZA 3LWUA 1YMEA 3IFEA 2POKA 4PXCA 1CBXA 1Z5RA 4FAIA 1CX8A 4OIWA 1F2PA 5DS0A 5LRGA 2F8HA 1ELMP 3IEHA 2AFZA 1ARLA 3ICUA 4IHMA 3FVLA 4ZX8A 4CDKA 4MMOA 5LYLA 2GU2A 5K8MA 3GB0A 2OR4A 1XMBA 1YSJA 3PRTA 3IIBA 4C8FA 2V8DA 4C9VA 1AYEA 2F7VA 1F2OA 4A94A 2EWBA 1Y9ZA 5JM6A 2ZOGA 3GUXA 3SI1A 4R76A 4A37A 2GLFA 2ZOFA 3NFZA 1V6CA 4NGTA 5K8PA 2PJ4A 1YW6A 4P10A 3FJUA 4OC0A 4UEZA 3D66A 4F9VA 2ZELA 3IWWA 1XFOA 1TKHA 4B6ZA 3S9NA 2Q51A 4MCQA 5ELYA 4Z65A 4DUKA 4YWYA 4AXVA 1QMUA 4P6YA 3EIFA 1UWYA 2C1CA 2PVVA 1EE3P 1PCAA 4KNGE 2AFMA 2CIJA 3B3CA 1HEEA 2ZEEA 1FNOA 4ZYQA 2Q4ZA 2JEWA 2C6GA 3D67A 3KI9A 4GM5A 4OC5A 2PIYA 4PXEA 4OP4A 3RBUA 4IK2A 4JYWA 3I1UA 3PB7X 3D7DA 5LYDA 5D29A 5K8OA 5LYIA 4EWTA 3FECA 4C9RA 4OKOA 3WABA 2PJ3A 2BCOA 2EK9A 2WZNA 3FX6A 3V7ZA 2IJZA 3VARA 3BI0A 5HVGA 4MHZA 3VTAA 2PJBA 3TC8A 3WC7A 2O4HA 5HXDA 1XRYA 2JBKA 2DEAA 4C8PA 1BPMA 2HB6A 4P4DA 2PIZA 1Y0YA 1FT7A 1TKFA 3KQXA 1VIXA 1R3NA 2Q43A 1ARMA 2QJ8A 4PXDA 1TF9A 2PJ6A 3MN8A 4TJVA 4A38A 1YLOA 1AMPA 4TJXA 1GYTA 7CPAA 3SJGA 3BI1A 2C6PA 3JRUA 3H8FA 3DGVA 3PBBA 4X8IA 3PB4X 4C99A 3PFOA 4P4JA 2V8GA 1PYTB 4R8FA 3D68A 4FWUA 2NSMA 4UIAA 4OMEA 2NYQA 3WC5A 2RB7A 2XEIA 4LQGA 2XEGA 1Y0RA 3KZWA 3PFEA 4MHNA 1CP6A 2CTBA 1XF1A 1NSAA 2PJAA 3D4UA 4C8CA 4YN3A 5LRKA 3S9MA 3H8GA 2ZEFA 4UEFA 1XBUA 4C9UA 1BPNA 1TXRA 4MCPA 4EFDA 3NH4A 1ZLIA 3KR5A 5CPAA 3CDXA 4MHPA 3KQZA 4PXBA 4NFRA 1BLLE 2QVPA 4P45A 3ISXA 1IY7A 3PBEA 4CDJA 2PJCA 1OBRA 2AFWA 2PJ8A 3MRUA 5CBMA 3NH8A 4R6TA 2ZEDA 4R7MA 1ZG9A 2GLJA 4MXUA 3NA6A 3WT4A 1Z2LA 2CTCA 1ZG7A 1LOKA 3L2NA 2G9DA 4UIBA 2ZEGA 2XEFA 3B3WA 4PQAA 3KASA 2AFXA 3CT9A
chains in the Genus database with same CATH superfamily
3VWDA 2FIWA 1A9XB 5I4MA 5LYFA 2YJTA 1QSOA 1XE4A 2WYRA 2K5TA 2ZPAA 4J3GA 4OLLA 4PSXA 8CPAA 1WWZA 2CNTA 4MHYA 4NGSA 3FF3A 2AFOA 4U9YA 1BAVA 1M4GA 3RNZA 4EVYA 4MY3A 4IIYA 4FBEA 3PB6X 5K8NA 2Z11A 1XJOA 2V8HA 4C8AA 2Q44A 2PJ5A 3H4QA 4PPZA 4BPXB 2Q04A 4C84A 4NGPA 1J4JA 1BOBA 2WPXA 4NSQA 4MHDA 2VQYA 2Y0MA 3QNVA 4UEEA 4WWVA 1ZYMA 2O53A 1CJWA 3BUWB 2J9AA 3CPAA 3KHZA 2ZENA 1JQGA 1YW4A 4KLWA 1S7FA 2RFHA 1U6MA 4KOWA 5HVFA 3N7ZA 3EZEA 1IICA 4QC6A 3V38A 1YQEA 1WK4A 1XIXA 2AFUA 2PE3A 4KVOE 2PCNA 2IQ6A 3CPXA 2D4OA 2Z0ZA 4E2AA 4XPLA 3HPGG 4NGNA 3OB1B 3D7FA 2EBJA 3IO1A 5J1QA 1IOFA 4NJQA 3TYXA 2DIKA 3NH5A 3GY9A 4TNUA 5IX3A 4A30A 4B13A 3PEIA 2GIVA 2ZW7A 4C7HA 2F5IA 4KS9A 1KWMA 4Q7AA 1QQ9A 3RAMA 3A9LA 3VH9A 4ZI6A 3H8EA 2VBQA 4UWJA 2PC1A 3TLZA 1TF8A 4R9MA 1XF8A 2FXFA 1HDUA 1LCPA 2ZEOA 3VRQA 3K9TA 3KHXA 5THWA 4DYOA 1JWQA 4NXYA 1M1DA 1BXRB 1VHEA 4BPUB 3EZBA 1VHSA 4H89A 2JDDA 3B8GA 4FD6A 1ZG8A 3E0KA 3SJEA 4Y49C 4E8OA 1CM0A 2YNCC 5I0CA 2C6CA 2OH1A 2JDCA 2ABZA 2I3CA 2E28A 1QSRA 2R98A 4FUUA 3DR6A 1LRZA 3T8WA 2QECA 3PLFB 2ZW6A 4NJRA 4R3LA 1Q7LA 1JDEA 3TLAA 1VGYA 1B47A 4OC1A 1CPXA 4C85A 4PXDA 1X12A 4F9UA 3K4IA 2IL4A 4X5KA 3D2MA 3BHXA 1ELLP 2ZEHA 4UA3A 4BINA 4H1HA 2BEIA 4CGNA 5AG7A 3SI2A 2FVGA 2GREA 2OZGA 4WJBA 3F5BA 1WVMA 4ORFA 5E96A 3B35A 3KR4A 2PVWA 4Q38A 3VATA 4KOXA 2H5MA 2NMTA 5HVHA 4MCSA 2X7BA 2EZCA 3B3SA 3I6SA 4C9AA 4DJLA 4BMHA 2FCKA 2CXAA 4AVBA 1IYKA 3TCVA 1IB1E 4CAXA 4X2TA 4CGPA 1ON0A 3IU1A 5JVLA 4ZY1A 2JBJA 2Q7BA 3OWCA 3VGOA 3D7GA 2B4DA 3SR3A 4AVCA 2ODFA 2PJ0A 3K2KA 5DWNA 4C2ZA 4CYNA 4ZY2A 3IJ3A 4P4IA 2PJ2A 4CRZB 3LD2A 3TX8A 3SHPA 3WC6A 4P4BA 2VI7A 3TFYA 3FYNA 1M4DA 2YNEA 4CPAA 1R61A 3FMCA 1Z8XA 4KORA 4W9YA 1LFWA 3TTHA 1IU8A 2Q4VA 3B7IA 4BPWB 3KL9A 1Z4EA 3VRPA 2QIRA 1DE4C 4AVAA 4CO9A 1BO4A 3ZZIA 4C68A 4FD4A 2B5GA 4NGMA 5KTAA 4JD6A 4KUAA 4UF4A 1M4LA 1TIQA 4G1PA 3FEEA 1SQHA 2V8VA 3QAHA 2OOTA 2EK8A 3JTKA 4UCNA 1ZL0A 4TWEA 4C9EA 1AUGA 4JZ0A 3PZJA 1KZFA 3PB9X 4JLYA 2DPTA 5J3XA 4MFQA 4OC2A 4M6IA 5JH9A 2IMOA 4II9A 2P6EA 3F8KA 1IIDA 2AJ6A 4BBHA 2HROA 2AFSA 4KSIA 1XMTA 2HQYA 1LAMA 2QYVA 3LMSA 2VZZA 4UBRA 1IOIA 4UFVA 3S6FA 1YGHA 4MI4A 4A39A 2CNMA 4IAVA 1R43A 2PRQA 4QVTA 1C3OB 3B3TA 4A37A 4C86A 4NGRA 5C88A 4CZ1A 1S7NA 1TKJA 2ZW5A 4JXQA 4RUHA 1LANA 3EXNA 4P44A 4H6ZA 5D8NA 2DF5A 3QAYA 4RR2B 2B4DB 3OP0A 1M4IA 4NF1A 1KUXA 4K3NA 6CPAA 2BO9A 1Z8LA 2I79A 4OADA 4EMEA 4QUSA 4HPSA 4C8TA 1CP7A 1KUVA 3FEDA 4NGQA 2Z3MA 2D4PA 4HNXB 2P6GA 2Q7SA 3S6KA 4CAVA 3CXPA 1N71A 5JQ4A 5K99A 1F57A 3HLPA 4ZX9A 4IF5A 1NE9A 3B2YA 1PU9A 4C2XA 3BUNB 3S6GA 3SJXA 4C8UA 4UWIA 3OAKA 4OC4A 4P4EA 2PJ7A 3IC1A 4MRIA 1R57A 3G23A 3D7HA 5C82A 2ANPA 4H2KA 4BD9A 4I49A 5BY0A 3T5MA 4JWPA 2B58A 4KZTA 4LUAA 4QB9A 5AGEA 4XNHB 4HKFA 4ZGYB 3PB8X 3D2PA 4O23A 4OC3A 3TT2A 4UFWA 4C2YA 4GPLB 1YREA 2PSWA 1LAPA 4OAEA 5AG5A 5G20A 2PCUA 3N5FA 1EZBA 1ZLHA 2BOAA 4HNYB 5G1ZA 3SJFA 2PJ9A 3KGQA 2FL4A 2KCWA 4ONWA 3RZAA 1CS0B 3S9LA 3UY5A 3BXMA 2ZEPA 4A4CA 1RTQA 5IB9A 3I74A 4MCRA 2J8NA 3F0AA 4F8ZA 1CPSA 5KTCA 4CS0B 4ZY0A 1DTDA 1H8LA 4OIDA 2HC9A 4YU9A 1CG2A 1MK4A 1IGBA 3HUVA 2AUMA 2WPWA 3TO9A 2D0PA 1PUAA 5LRJA 4RI1A 1A2ZA 2CF4A 2V77A 3GLJA 3SI0A 1Y9WA 4FD5A 3B3VA 2OU2A 4A2ZA 2XEJA 4P4FA 4XPKA 1NXJA 3C8OA 1Y7EA 3DLJA 3JUWA 4LQ6A 2ZEMA 5F09A 3R9FA 2VL1A 5ISVA 3TOAA 2PJ1A 2BL1A 2MP0A 5F5XA 2XPPA 5KTDA 3R95A 1GHEA 1M44A 2BUEA 1HDQA 4M6HA 1VHOA 4R57A 4CAWA 3FH4A 5JGFA 2Q4YA 4B5PA 5IR2A 1KBLA 2R7HA 1YK3A 4CYQA 4X3RA 3FXTA 3GIUA 3IWGA 5HH1A 1S7LA 3ISZA 2XPLA 3LWUA 4PK3A 1YMEA 3IFEA 2EUIA 4XPDC 2POKA 4CGOA 2ARHA 4PXCA 4YFJA 4PSWA 5HKWA 2FS5A 1CBXA 1Z5RA 4FAIA 5JYBA 1YR0A 1CX8A 1I1DA 4OIWA 5F1YA 3BLNA 1F2PA 5DS0A 5LRGA 2JLMA 2F8HA 4ZBGA 1ELMP 3ZJ0A 3W91A 2FIAA 2WSAA 3IEHA 2AFZA 3KKWA 5F49A 5F46A 2Z3LA 3LODA 3ZNIA 1ARLA 3ICUA 2FM4A 4IHMA 2R8VA 3FVLA 4ZX8A 2B4JC 5IB0A 4CDKA 4MMOA 5HKYA 5LYLA 2GU2A 1XEBA 5DWMA 5K8MA 4MFJA 4MFLA 1Q2CA 4YGOA 1GGOA 3GB0A 2B0AA 3T07A 2OR4A 1XMBA 4UCPA 4C8FA 1CE8B 3SXNA 1YSJA 3PRTA 4M85A 3EC4A 3IWEA 4MJXA 2FE7A 3IIBA 1KEEB 5H84A 4KOSA 2V8DA 4CYPA 4C9VA 1AYEA 2F7VA 3S6HA 1F2OA 1FY7A 2JEVA 3FBUA 3TLGA 4A94A 2EWBA 1Y9ZA 5JM6A 4CAFA 4COBA 1YLEA 1YVHA 2ATRA 3VWEA 2ZOGA 1Y7RA 3GUXA 3W6SA 1NMTA 3SI1A 4R76A 1DIKA 5EC4A 4XNHC 4BTFA 2GLFA 2ZOFA 2CNSA 3NFZA 5AG6A 3CXSA 2I00A 4NGTA 3IU2A 4B11A 4MFZA 1V6CA 4NCZA 5K8PA 5F48A 2PJ4A 3PP9A 1YW6A 4XPDB 5J8FA 3DDDA 1YVOA 3FJUA 4GS4A 4OC0A 4P10A 2AE6A 4UEZA 2Z3NA 4UCMA 4CRYB 4KOYA 3PGPA 1EZAA 2GFQA 2OZHA 1S60A 3TE4A 3D66A 3MGDA 2ZELA 4F9VA 2VKZG 1XFOA 3IWWA 5AXIA 1TKHA 3PFVA 2G0BA 4B6ZA 1Q2DA 3S9NA 2Q51A 2ZXVA 3VRRA 1QSNA 3GYAA 4MCQA 4QBJA 1S3ZA 5ELYA 4Z65A 1UFHA 3G3SA 2PR1A 3T9YA 4DUKA 1WJTA 4YWYA 4AXVA 4AG7A 1QMUA 2GE3A 4KUBA 5H86A 5FVJA 3D8PA 4P6YA 2WUUA 3P2FA 3EIFA 3VROA 1UWYA 2C1CA 5IV0A 5G22A 2PVVA 5F13A 1EE3P 1PCAA 4KNGE 2AFMA 2CIJA 1HEEA 3B3CA 1KUYA 4MBUA 3U1BA 3TLGB 2A4NA 1FNOA 2ZEEA 2HWGA 2XPOA 4ZYQA 4F6AA 4L89A 1L0CA 2Q4ZA 2YNDA 3EY5A 4KVXA 2JEWA 2C6GA 3D67A 5AG4A 5HKZA 3KI9A 3NE8A 2R1IA 4OC5A 4GM5A 2PIYA 4R87A 2B5GB 4CGLA 5BWAB 4NEXA 4PXEA 4OP4A 1Z9EA 2Y1NA 3RBUA 4IK2A 4HNWB 4JYWA 5GCNA 3I1UA 3BJ7A 3PB7X 2REFA 3D7DA 1EO0A 1T36B 5LYDA 5A27A 2GANA 3RYOA 5D29A 4KOUA 1VBHA 5K8OA 3R96A 2P0WA 4CYOA 4A4BA 5LYIA 4EWTA 4L8AA 2J8MA 4DNCA 2C5QA 4KSAA 3FECA 2YJVA 4C9RA 4OKOA 3WABA 4U9ZA 5F47A 2FT0A 2PJ3A 1JDBC 2D0OA 2BCOA 2EK9A 2WZNA 3EFAA 3NOJA 1ZRSA 2B4BA 1MJBA 2DPSA 5EMIA 3TOBA 3FX6A 3V7ZA 2IJZA 3VARA 3BI0A 5HVGA 3C26A 3GKRA 4MHZA 3TO6A 2OLSA 1I12A 3VTAA 3TLYA 2PJBA 4KOTA 3TC8A 1ZO0A 4E0AA 3WC7A 4INJA 3FB3A 2O4HA 5HXDA 1XRYA 2JBKA 3PT1A 1OZPA 2DEAA 3TO7A 2P6FA 4FD7A 2ZW4A 4C8PA 1IYLA 1BPMA 2HB6A 4F0YA 1M6VB 1C30B 3T05A 4P4DA 4JXRA 4LX9A 1I21A 1P4NA 2EO8A 1VKCA 1Y0YA 2OZUA 2PIZA 1FT7A 2BSWA 2YGWA 3I3GA 4Q36A 4KSFA 2Y1MA 1TKFA 3KQXA 1K4JA 2R82A 1VIXA 3GJZA 4RN7A 1R3NA 2J8RA 2Q43A 2RC4A 1Z8WA 1RO5A 2Q0YA 4A33A 3EZAA 5F9MA 1QSTA 4KOVA 1ARMA 3BUXB 2UV8G 1B87A 1TF9A 2CY2A 1Z4RA 2PDOA 2PJ6A 2QJ8A 3DNSA 4M3SA 5EBVA 3RO0A 3MN8A 4B14A 5J8CA 3BUOB 1YLOA 4A38A 4TJVA 4IUSA 4KVME 1S5KA 4IIXA 2EZBA 2G3AA 1AMPA 1YX0A 1Z8TA 3JVNA 3OB2B 4TJXA 3KRVA 2B3UA 3DSBA 3FIXA 4R3KA 2PQ8A 2VXKA 1GYTA 2YNCA 3SJGA 7CPAA 3BI1A 4K30A 1X10A 2C6PA 4YRHA 3FNCA 2HI6A 3NFQA 3VRNA 3JRUA 2X0SA 3H8FA 3DGVA 3PBBA 2VEZA 3LACA 4C7IA 4X8IA 4AG9A 3PB4X 3G8WA 1S7KA 2GP4A 2B3VA 4M8DA 4C99A 1NBWA 2DXQA 3PFOA 1VI4A 2CBLA 1Q2YA 5A28A 1QSMA 1KC7A 3V8IA 4MI1A 1FBVA 4P4JA 2Z10A 2V8GA 4MJ8A 1PYTB 4JJXA 3D68A 4FWUA 2PRBA 4R8FA 3HPHE 2REEA 2NSMA 3I9SA 3W6XA 4UIAA 4OMEA 1XOVA 2HUZA 2NYQA 2Z3KA 3WC5A 1Q5XA 2RB7A 2XEIA 4LQGA 3BUMB 2XEGA 1V0CA 3IGRA 4RS2A 3SXOA 1NSLA 4B5PB 2PR8A 1Y0RA 3KZWA 2Z3PA 4A31A 3PFEA 3NE7A 1CP6A 4MHNA 3O8ZA 2CTBA 4B5OA 2VZYA 2DLAA 4PK2A 4E5SA 1XF1A 1NSAA 2PJAA 3D4UA 4AB7A 5FD8A 4CGMA 4C8CA 4GXHA 4COGA 2XPNA 3F9KC 2C27A 1J3LA 4YN3A 5LRKA 4B10A 3S9MA 3EO4A 3T0TA 3H8GA 4PV6A 3WR7A 2ZEFA 3K9UA 4UEFA 1XBUA 2G3TA 4H6UA 4C9UA 1BPNA 3FRMA 4B12A 4EYSA 1TXRA 4MCPA 4EFDA 4MFKA 3T90A 2Z3OA 2HV2A 3NH4A 3R9EA 1ZLIA 3KR5A 4Y49B 4J0NA 3D3SA 5CPAA 3CDXA 4MHPA 1Z9UA 3KQZA 5HMNA 3HMJG 3R1KA 4PXBA 4MFPA 2EZAA 1B6BA 4F0XA 4E94A 4NFRA 1BLLE 4U5YA 3TLCA 3TLBA 2QVPA 3TLEA 4P45A 3ISXA 1IY7A 3PBEA 2FSRA 5G21A 4CDJA 2PJCA 1YVKA 4M6GA 3DR8A 3R9GA 4JVOA 1OBRA 4UFXA 1VBGA 2AFWA 2PJ8A 1P0HA 3U88C 2O28A 3MRUA 5CBMA 3NH8A 3CXQA 5JPHA 4ONUA 4R6TA 3BJ8A 2ZEDA 5CNPA 1Y9KA 4MY0A 4R7MA 4CAEA 2N3AB 1ZG9A 2GLJA 2OB0A 4MXUA 3NA6A 3P2HA 1Z2LA 3WT4A 2CTCA 1ZG7A 1LOKA 2AUNA 4A32A 3L2NA 2EVNA 3H5ZA 4A95A 1MJ9A 2G9DA 4UIBA 1RXTA 2ZEGA 2XEFA 3QB8A 1MJAA 2QMLA 3B3WA 3CZXA 4PQAA 3KASA 4KLVA 2AFXA 3CT9A
chains in the Genus database with same CATH topology
5I4MA 5LYFA 2WYRA 8CPAA 4MHYA 4NGSA 3FF3A 2AFOA 1BAVA 4FBEA 3PB6X 5K8NA 1XJOA 2V8HA 4C8AA 2PJ5A 4PPZA 4C84A 4NGPA 4UEEA 3QNVA 4WWVA 2O53A 2J9AA 3CPAA 3KHZA 2ZENA 1JQGA 1YW4A 2RFHA 5HVFA 3V38A 2AFUA 2PE3A 2IQ6A 3CPXA 4NGNA 3IO1A 3D7FA 5J1QA 4NJQA 3NH5A 4TNUA 3PEIA 1KWMA 4Q7AA 1QQ9A 3RAMA 4ZI6A 3VH9A 3H8EA 1TF8A 1HDUA 1LCPA 2ZEOA 3K9TA 4DYOA 3KHXA 5THWA 1VHEA 1ZG8A 3SJEA 2C6CA 2ABZA 2I3CA 4FUUA 3T8WA 4NJRA 1Q7LA 1VGYA 4OC1A 4C85A 1CPXA 4F9UA 3BHXA 1ELLP 2ZEHA 3SI2A 2FVGA 2GREA 4WJBA 1WVMA 3B35A 3KR4A 2PVWA 3VATA 5HVHA 4MCSA 3I6SA 4C9AA 3B3SA 4DJLA 4X2TA 4ZY1A 2JBJA 3D7GA 2PJ0A 3K2KA 4ZY2A 3IJ3A 4P4IA 2PJ2A 3TX8A 3WC6A 4P4BA 4CPAA 3FMCA 4W9YA 1LFWA 3B7IA 3KL9A 1DE4C 4NGMA 4UF4A 1M4LA 4G1PA 3FEEA 2V8VA 2OOTA 2EK8A 4TWEA 4C9EA 4JZ0A 3PB9X 4OC2A 5JH9A 2IMOA 2AFSA 4KSIA 3LMSA 1LAMA 2QYVA 4A39A 4IAVA 1R43A 2PRQA 4C86A 3B3TA 4NGRA 1TKJA 4RUHA 1LANA 4P44A 5D8NA 4K3NA 6CPAA 2BO9A 1Z8LA 4EMEA 4C8TA 1CP7A 4C8UA 3FEDA 4NGQA 1F57A 3HLPA 4ZX9A 3B2YA 3SJXA 4OC4A 4P4EA 2PJ7A 3IC1A 4MRIA 3D7HA 2ANPA 4H2KA 4BD9A 3PB8X 4O23A 4OC3A 1LAPA 2PCUA 3N5FA 1ZLHA 2BOAA 3SJFA 2PJ9A 3KGQA 4ONWA 3RZAA 3S9LA 3BXMA 2ZEPA 1RTQA 5IB9A 3I74A 4MCRA 4F8ZA 1CPSA 4ZY0A 1DTDA 1H8LA 4OIDA 2HC9A 4YU9A 1CG2A 1IGBA 3HUVA 5LRJA 2CF4A 2V77A 3GLJA 3SI0A 3B3VA 2XEJA 4P4FA 1Y7EA 3DLJA 2ZEMA 5F09A 2VL1A 2PJ1A 1HDQA 1VHOA 3FH4A 5JGFA 5IR2A 4X3RA 3ISZA 3LWUA 1YMEA 3IFEA 2POKA 4PXCA 1CBXA 1Z5RA 4FAIA 1CX8A 4OIWA 1F2PA 5DS0A 5LRGA 2F8HA 1ELMP 3IEHA 2AFZA 1ARLA 3ICUA 4IHMA 3FVLA 4ZX8A 4CDKA 4MMOA 5LYLA 2GU2A 5K8MA 3GB0A 2OR4A 1XMBA 1YSJA 3PRTA 3IIBA 4C8FA 2V8DA 4C9VA 1AYEA 2F7VA 1F2OA 4A94A 2EWBA 1Y9ZA 5JM6A 2ZOGA 3GUXA 3SI1A 4R76A 4A37A 2GLFA 2ZOFA 3NFZA 1V6CA 4NGTA 5K8PA 2PJ4A 1YW6A 4P10A 3FJUA 4OC0A 4UEZA 3D66A 4F9VA 2ZELA 3IWWA 1XFOA 1TKHA 4B6ZA 3S9NA 2Q51A 4MCQA 5ELYA 4Z65A 4DUKA 4YWYA 4AXVA 1QMUA 4P6YA 3EIFA 1UWYA 2C1CA 2PVVA 1EE3P 1PCAA 4KNGE 2AFMA 2CIJA 3B3CA 1HEEA 2ZEEA 1FNOA 4ZYQA 2Q4ZA 2JEWA 2C6GA 3D67A 3KI9A 4GM5A 4OC5A 2PIYA 4PXEA 4OP4A 3RBUA 4IK2A 4JYWA 3I1UA 3PB7X 3D7DA 5LYDA 5D29A 5K8OA 5LYIA 4EWTA 2C5QA 3FECA 4C9RA 4OKOA 3WABA 2PJ3A 2BCOA 2EK9A 2WZNA 3FX6A 3V7ZA 2IJZA 3VARA 3BI0A 5HVGA 4MHZA 3VTAA 2PJBA 3TC8A 3WC7A 2O4HA 5HXDA 1XRYA 2JBKA 2DEAA 4C8PA 1BPMA 2HB6A 4P4DA 2PIZA 1Y0YA 1FT7A 1TKFA 3KQXA 1VIXA 1R3NA 2Q43A 1ARMA 2QJ8A 4PXDA 1TF9A 2PJ6A 3MN8A 4TJVA 4A38A 1YLOA 1AMPA 4TJXA 1GYTA 7CPAA 3SJGA 3BI1A 2C6PA 3JRUA 3H8FA 3DGVA 3PBBA 4X8IA 3PB4X 2GP4A 4C99A 3PFOA 4P4JA 2V8GA 1PYTB 4R8FA 3D68A 4FWUA 2NSMA 4UIAA 4OMEA 2NYQA 3WC5A 2RB7A 2XEIA 4LQGA 2XEGA 1Y0RA 3KZWA 3PFEA 4MHNA 1CP6A 2CTBA 1XF1A 1NSAA 2PJAA 3D4UA 4C8CA 4YN3A 5LRKA 3S9MA 3H8GA 2ZEFA 4UEFA 1XBUA 4C9UA 1BPNA 1TXRA 4MCPA 4EFDA 3NH4A 1ZLIA 3KR5A 5CPAA 3CDXA 4MHPA 3KQZA 4PXBA 4NFRA 1BLLE 2QVPA 4P45A 3ISXA 1IY7A 3PBEA 4CDJA 2PJCA 1OBRA 2AFWA 2PJ8A 3MRUA 5CBMA 3NH8A 4R6TA 2ZEDA 4R7MA 1ZG9A 2GLJA 4MXUA 3NA6A 3WT4A 1Z2LA 2CTCA 1ZG7A 1LOKA 3L2NA 2G9DA 4UIBA 2ZEGA 2XEFA 3B3WA 4PQAA 3KASA 2AFXA 3CT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I4M A;  5LYF A;  2WYR A;  8CPA A;  4MHY A;  4NGS A;  3FF3 A;  2AFO A;  1BAV A;  4FBE A;  3PB6 X;  5K8N A;  1XJO A;  2V8H A;  4C8A A;  2PJ5 A;  4PPZ A;  4C84 A;  4NGP A;  4UEE A;  3QNV A;  4WWV A;  2O53 A;  2J9A A;  3CPA A;  3KHZ A;  2ZEN A;  1JQG A;  1YW4 A;  2RFH A;  5HVF A;  3V38 A;  2AFU A;  2PE3 A;  2IQ6 A;  3CPX A;  4NGN A;  3IO1 A;  3D7F A;  5J1Q A;  4NJQ A;  3NH5 A;  4TNU A;  3PEI A;  1KWM A;  4Q7A A;  1QQ9 A;  3RAM A;  4ZI6 A;  3VH9 A;  3H8E A;  1TF8 A;  1HDU A;  1LCP A;  2ZEO A;  3K9T A;  4DYO A;  3KHX A;  5THW A;  1VHE A;  1ZG8 A;  3SJE A;  2C6C A;  2ABZ A;  2I3C A;  4FUU A;  3T8W A;  4NJR A;  1Q7L A;  1VGY A;  4OC1 A;  4C85 A;  1CPX A;  4F9U A;  3BHX A;  1ELL P;  2ZEH A;  3SI2 A;  2FVG A;  2GRE A;  4WJB A;  1WVM A;  3B35 A;  3KR4 A;  2PVW A;  3VAT A;  5HVH A;  4MCS A;  3I6S A;  4C9A A;  3B3S A;  4DJL A;  4X2T A;  4ZY1 A;  2JBJ A;  3D7G A;  2PJ0 A;  3K2K A;  4ZY2 A;  3IJ3 A;  4P4I A;  2PJ2 A;  3TX8 A;  3WC6 A;  4P4B A;  4CPA A;  3FMC A;  4W9Y A;  1LFW A;  3B7I A;  3KL9 A;  1DE4 C;  4NGM A;  4UF4 A;  1M4L A;  4G1P A;  3FEE A;  2V8V A;  2OOT A;  2EK8 A;  4TWE A;  4C9E A;  4JZ0 A;  3PB9 X;  4OC2 A;  5JH9 A;  2IMO A;  2AFS A;  4KSI A;  3LMS A;  1LAM A;  2QYV A;  4A39 A;  4IAV A;  1R43 A;  2PRQ A;  4C86 A;  3B3T A;  4NGR A;  1TKJ A;  4RUH A;  1LAN A;  4P44 A;  5D8N A;  4K3N A;  6CPA A;  2BO9 A;  1Z8L A;  4EME A;  4C8T A;  1CP7 A;  4C8U A;  3FED A;  4NGQ A;  1F57 A;  3HLP A;  4ZX9 A;  3B2Y A;  3SJX A;  4OC4 A;  4P4E A;  2PJ7 A;  3IC1 A;  4MRI A;  3D7H A;  2ANP A;  4H2K A;  4BD9 A;  3PB8 X;  4O23 A;  4OC3 A;  1LAP A;  2PCU A;  3N5F A;  1ZLH A;  2BOA A;  3SJF A;  2PJ9 A;  3KGQ A;  4ONW A;  3RZA A;  3S9L A;  3BXM A;  2ZEP A;  1RTQ A;  5IB9 A;  3I74 A;  4MCR A;  4F8Z A;  1CPS A;  4ZY0 A;  1DTD A;  1H8L A;  4OID A;  2HC9 A;  4YU9 A;  1CG2 A;  1IGB A;  3HUV A;  5LRJ A;  2CF4 A;  2V77 A;  3GLJ A;  3SI0 A;  3B3V A;  2XEJ A;  4P4F A;  1Y7E A;  3DLJ A;  2ZEM A;  5F09 A;  2VL1 A;  2PJ1 A;  1HDQ A;  1VHO A;  3FH4 A;  5JGF A;  4X3R A;  3ISZ A;  3LWU A;  1YME A;  3IFE A;  2POK A;  4PXC A;  1CBX A;  1Z5R A;  4FAI A;  1CX8 A;  4OIW A;  1F2P A;  5DS0 A;  5LRG A;  2F8H A;  1ELM P;  3IEH A;  2AFZ A;  1ARL A;  3ICU A;  4IHM A;  3FVL A;  4ZX8 A;  4CDK A;  4MMO A;  5LYL A;  2GU2 A;  5K8M A;  3GB0 A;  2OR4 A;  1XMB A;  1YSJ A;  3PRT A;  3IIB A;  4C8F A;  2V8D A;  4C9V A;  1AYE A;  2F7V A;  1F2O A;  4A94 A;  2EWB A;  1Y9Z A;  5JM6 A;  2ZOG A;  3GUX A;  3SI1 A;  4R76 A;  4A37 A;  2GLF A;  2ZOF A;  3NFZ A;  1V6C A;  4NGT A;  5K8P A;  2PJ4 A;  1YW6 A;  4P10 A;  3FJU A;  4OC0 A;  4UEZ A;  3D66 A;  4F9V A;  2ZEL A;  3IWW A;  1XFO A;  1TKH A;  4B6Z A;  3S9N A;  2Q51 A;  4MCQ A;  5ELY A;  4Z65 A;  4DUK A;  4YWY A;  4AXV A;  1QMU A;  4P6Y A;  3EIF A;  1UWY A;  2C1C A;  2PVV A;  1EE3 P;  1PCA A;  4KNG E;  2AFM A;  2CIJ A;  3B3C A;  1HEE A;  2ZEE A;  1FNO A;  4ZYQ A;  2Q4Z A;  2JEW A;  2C6G A;  3D67 A;  3KI9 A;  4GM5 A;  4OC5 A;  2PIY A;  4PXE A;  4OP4 A;  3RBU A;  4IK2 A;  4JYW A;  3I1U A;  3PB7 X;  3D7D A;  5LYD A;  5D29 A;  5K8O A;  5LYI A;  4EWT A;  3FEC A;  4C9R A;  4OKO A;  3WAB A;  2PJ3 A;  2BCO A;  2EK9 A;  2WZN A;  3FX6 A;  3V7Z A;  2IJZ A;  3VAR A;  3BI0 A;  5HVG A;  4MHZ A;  3VTA A;  2PJB A;  3TC8 A;  3WC7 A;  2O4H A;  5HXD A;  1XRY A;  2JBK A;  2DEA A;  4C8P A;  1BPM A;  2HB6 A;  4P4D A;  2PIZ A;  1Y0Y A;  1FT7 A;  1TKF A;  3KQX A;  1VIX A;  1R3N A;  2Q43 A;  1ARM A;  2QJ8 A;  4PXD A;  1TF9 A;  2PJ6 A;  3MN8 A;  4TJV A;  4A38 A;  1YLO A;  1AMP A;  4TJX A;  1GYT A;  7CPA A;  3SJG A;  3BI1 A;  2C6P A;  3JRU A;  3H8F A;  3DGV A;  3PBB A;  4X8I A;  3PB4 X;  4C99 A;  3PFO A;  4P4J A;  2V8G A;  1PYT B;  4R8F A;  3D68 A;  4FWU A;  2NSM A;  4UIA A;  4OME A;  2NYQ A;  3WC5 A;  2RB7 A;  2XEI A;  4LQG A;  2XEG A;  1Y0R A;  3KZW A;  3PFE A;  4MHN A;  1CP6 A;  2CTB A;  1XF1 A;  1NSA A;  2PJA A;  3D4U A;  4C8C A;  4YN3 A;  5LRK A;  3S9M A;  3H8G A;  2ZEF A;  4UEF A;  1XBU A;  4C9U A;  1BPN A;  1TXR A;  4MCP A;  4EFD A;  3NH4 A;  1ZLI A;  3KR5 A;  5CPA A;  3CDX A;  4MHP A;  3KQZ A;  4PXB A;  4NFR A;  1BLL E;  2QVP A;  4P45 A;  3ISX A;  1IY7 A;  3PBE A;  4CDJ A;  2PJC A;  1OBR A;  2AFW A;  2PJ8 A;  3MRU A;  5CBM A;  3NH8 A;  4R6T A;  2ZED A;  4R7M A;  1ZG9 A;  2GLJ A;  4MXU A;  3NA6 A;  3WT4 A;  1Z2L A;  2CTC A;  1ZG7 A;  1LOK A;  3L2N A;  2G9D A;  4UIB A;  2ZEG A;  2XEF A;  3B3W A;  4PQA A;  3KAS A;  2AFX A;  3CT9 A; 
#chains in the Genus database with same CATH topology
 3VWD A;  2FIW A;  1A9X B;  5I4M A;  5LYF A;  2YJT A;  1QSO A;  1XE4 A;  2WYR A;  2K5T A;  2ZPA A;  4J3G A;  4OLL A;  4PSX A;  8CPA A;  1WWZ A;  2CNT A;  4MHY A;  4NGS A;  3FF3 A;  2AFO A;  4U9Y A;  1BAV A;  1M4G A;  3RNZ A;  4EVY A;  4MY3 A;  4IIY A;  4FBE A;  3PB6 X;  5K8N A;  2Z11 A;  1XJO A;  2V8H A;  4C8A A;  2Q44 A;  2PJ5 A;  3H4Q A;  4PPZ A;  4BPX B;  2Q04 A;  4C84 A;  4NGP A;  1J4J A;  1BOB A;  2WPX A;  4NSQ A;  4MHD A;  2VQY A;  2Y0M A;  3QNV A;  4UEE A;  4WWV A;  1ZYM A;  2O53 A;  1CJW A;  3BUW B;  2J9A A;  3CPA A;  3KHZ A;  2ZEN A;  1JQG A;  1YW4 A;  4KLW A;  1S7F A;  2RFH A;  1U6M A;  4KOW A;  5HVF A;  3N7Z A;  3EZE A;  1IIC A;  4QC6 A;  3V38 A;  1YQE A;  1WK4 A;  1XIX A;  2AFU A;  2PE3 A;  4KVO E;  2PCN A;  2IQ6 A;  3CPX A;  2D4O A;  2Z0Z A;  4E2A A;  4XPL A;  3HPG G;  4NGN A;  3OB1 B;  3D7F A;  2EBJ A;  3IO1 A;  5J1Q A;  1IOF A;  4NJQ A;  3TYX A;  2DIK A;  3NH5 A;  3GY9 A;  4TNU A;  5IX3 A;  4A30 A;  4B13 A;  3PEI A;  2GIV A;  2ZW7 A;  4C7H A;  2F5I A;  4KS9 A;  1KWM A;  4Q7A A;  1QQ9 A;  3RAM A;  3A9L A;  3VH9 A;  4ZI6 A;  3H8E A;  2VBQ A;  4UWJ A;  2PC1 A;  3TLZ A;  1TF8 A;  4R9M A;  1XF8 A;  2FXF A;  1HDU A;  1LCP A;  2ZEO A;  3VRQ A;  3K9T A;  3KHX A;  5THW A;  4DYO A;  1JWQ A;  4NXY A;  1M1D A;  1BXR B;  1VHE A;  4BPU B;  3EZB A;  1VHS A;  4H89 A;  2JDD A;  3B8G A;  4FD6 A;  1ZG8 A;  3E0K A;  3SJE A;  4Y49 C;  4E8O A;  1CM0 A;  2YNC C;  5I0C A;  2C6C A;  2OH1 A;  2JDC A;  2ABZ A;  2I3C A;  2E28 A;  1QSR A;  2R98 A;  4FUU A;  3DR6 A;  1LRZ A;  3T8W A;  2QEC A;  3PLF B;  2ZW6 A;  4NJR A;  4R3L A;  1Q7L A;  1JDE A;  3TLA A;  1VGY A;  1B47 A;  4OC1 A;  1CPX A;  4C85 A;  4PXD A;  1X12 A;  4F9U A;  3K4I A;  2IL4 A;  4X5K A;  3D2M A;  3BHX A;  1ELL P;  2ZEH A;  4UA3 A;  4BIN A;  4H1H A;  2BEI A;  4CGN A;  5AG7 A;  3SI2 A;  2FVG A;  2GRE A;  2OZG A;  4WJB A;  3F5B A;  1WVM A;  4ORF A;  5E96 A;  3B35 A;  3KR4 A;  2PVW A;  4Q38 A;  3VAT A;  4KOX A;  2H5M A;  2NMT A;  5HVH A;  4MCS A;  2X7B A;  2EZC A;  3B3S A;  3I6S A;  4C9A A;  4DJL A;  4BMH A;  2FCK A;  2CXA A;  4AVB A;  1IYK A;  3TCV A;  1IB1 E;  4CAX A;  4X2T A;  4CGP A;  1ON0 A;  3IU1 A;  5JVL A;  4ZY1 A;  2JBJ A;  2Q7B A;  3OWC A;  3VGO A;  3D7G A;  2B4D A;  3SR3 A;  4AVC A;  2ODF A;  2PJ0 A;  3K2K A;  5DWN A;  4C2Z A;  4CYN A;  4ZY2 A;  3IJ3 A;  4P4I A;  2PJ2 A;  4CRZ B;  3LD2 A;  3TX8 A;  3SHP A;  3WC6 A;  4P4B A;  2VI7 A;  3TFY A;  3FYN A;  1M4D A;  2YNE A;  4CPA A;  1R61 A;  3FMC A;  1Z8X A;  4KOR A;  4W9Y A;  1LFW A;  3TTH A;  1IU8 A;  2Q4V A;  3B7I A;  4BPW B;  3KL9 A;  1Z4E A;  3VRP A;  2QIR A;  1DE4 C;  4AVA A;  4CO9 A;  1BO4 A;  3ZZI A;  4C68 A;  4FD4 A;  2B5G A;  4NGM A;  5KTA A;  4JD6 A;  4KUA A;  4UF4 A;  1M4L A;  1TIQ A;  4G1P A;  3FEE A;  1SQH A;  2V8V A;  3QAH A;  2OOT A;  2EK8 A;  3JTK A;  4UCN A;  1ZL0 A;  4TWE A;  4C9E A;  1AUG A;  4JZ0 A;  3PZJ A;  1KZF A;  3PB9 X;  4JLY A;  2DPT A;  5J3X A;  4MFQ A;  4OC2 A;  4M6I A;  5JH9 A;  2IMO A;  4II9 A;  2P6E A;  3F8K A;  1IID A;  2AJ6 A;  4BBH A;  2HRO A;  2AFS A;  4KSI A;  1XMT A;  2HQY A;  1LAM A;  2QYV A;  3LMS A;  2VZZ A;  4UBR A;  1IOI A;  4UFV A;  3S6F A;  1YGH A;  4MI4 A;  4A39 A;  2CNM A;  4IAV A;  1R43 A;  2PRQ A;  4QVT A;  1C3O B;  3B3T A;  4A37 A;  4C86 A;  4NGR A;  5C88 A;  4CZ1 A;  1S7N A;  1TKJ A;  2ZW5 A;  4JXQ A;  4RUH A;  1LAN A;  3EXN A;  4P44 A;  4H6Z A;  5D8N A;  2DF5 A;  3QAY A;  4RR2 B;  2B4D B;  3OP0 A;  1M4I A;  4NF1 A;  1KUX A;  4K3N A;  6CPA A;  2BO9 A;  1Z8L A;  2I79 A;  4OAD A;  4EME A;  4QUS A;  4HPS A;  4C8T A;  1CP7 A;  1KUV A;  3FED A;  4NGQ A;  2Z3M A;  2D4P A;  4HNX B;  2P6G A;  2Q7S A;  3S6K A;  4CAV A;  3CXP A;  1N71 A;  5JQ4 A;  5K99 A;  1F57 A;  3HLP A;  4ZX9 A;  4IF5 A;  1NE9 A;  3B2Y A;  1PU9 A;  4C2X A;  3BUN B;  3S6G A;  3SJX A;  4C8U A;  4UWI A;  3OAK A;  4OC4 A;  4P4E A;  2PJ7 A;  3IC1 A;  4MRI A;  1R57 A;  3G23 A;  3D7H A;  5C82 A;  2ANP A;  4H2K A;  4BD9 A;  4I49 A;  5BY0 A;  3T5M A;  4JWP A;  2B58 A;  4KZT A;  4LUA A;  4QB9 A;  5AGE A;  4XNH B;  4HKF A;  4ZGY B;  3PB8 X;  3D2P A;  4O23 A;  4OC3 A;  3TT2 A;  4UFW A;  4C2Y A;  4GPL B;  1YRE A;  2PSW A;  1LAP A;  4OAE A;  5AG5 A;  5G20 A;  2PCU A;  3N5F A;  1EZB A;  1ZLH A;  2BOA A;  4HNY B;  5G1Z A;  3SJF A;  2PJ9 A;  3KGQ A;  2FL4 A;  2KCW A;  4ONW A;  3RZA A;  1CS0 B;  3S9L A;  3UY5 A;  3BXM A;  2ZEP A;  4A4C A;  1RTQ A;  5IB9 A;  3I74 A;  4MCR A;  2J8N A;  3F0A A;  4F8Z A;  1CPS A;  5KTC A;  4CS0 B;  4ZY0 A;  1DTD A;  1H8L A;  4OID A;  2HC9 A;  4YU9 A;  1CG2 A;  1MK4 A;  1IGB A;  3HUV A;  2AUM A;  2WPW A;  3TO9 A;  2D0P A;  1PUA A;  5LRJ A;  4RI1 A;  1A2Z A;  2CF4 A;  2V77 A;  3GLJ A;  3SI0 A;  1Y9W A;  4FD5 A;  3B3V A;  2OU2 A;  4A2Z A;  2XEJ A;  4P4F A;  4XPK A;  1NXJ A;  3C8O A;  1Y7E A;  3DLJ A;  3JUW A;  4LQ6 A;  2ZEM A;  5F09 A;  3R9F A;  2VL1 A;  5ISV A;  3TOA A;  2PJ1 A;  2BL1 A;  2MP0 A;  5F5X A;  2XPP A;  5KTD A;  3R95 A;  1GHE A;  1M44 A;  2BUE A;  1HDQ A;  4M6H A;  1VHO A;  4R57 A;  4CAW A;  3FH4 A;  5JGF A;  2Q4Y A;  4B5P A;  5IR2 A;  1KBL A;  2R7H A;  1YK3 A;  4CYQ A;  4X3R A;  3FXT A;  3GIU A;  3IWG A;  5HH1 A;  1S7L A;  3ISZ A;  2XPL A;  3LWU A;  4PK3 A;  1YME A;  3IFE A;  2EUI A;  4XPD C;  2POK A;  4CGO A;  2ARH A;  4PXC A;  4YFJ A;  4PSW A;  5HKW A;  2FS5 A;  1CBX A;  1Z5R A;  4FAI A;  5JYB A;  1YR0 A;  1CX8 A;  1I1D A;  4OIW A;  5F1Y A;  3BLN A;  1F2P A;  5DS0 A;  5LRG A;  2JLM A;  2F8H A;  4ZBG A;  1ELM P;  3ZJ0 A;  3W91 A;  2FIA A;  2WSA A;  3IEH A;  2AFZ A;  3KKW A;  5F49 A;  5F46 A;  2Z3L A;  3LOD A;  3ZNI A;  1ARL A;  3ICU A;  2FM4 A;  4IHM A;  2R8V A;  3FVL A;  4ZX8 A;  2B4J C;  5IB0 A;  4CDK A;  4MMO A;  5HKY A;  5LYL A;  2GU2 A;  1XEB A;  5DWM A;  5K8M A;  4MFJ A;  4MFL A;  1Q2C A;  4YGO A;  1GGO A;  3GB0 A;  2B0A A;  3T07 A;  2OR4 A;  1XMB A;  4UCP A;  4C8F A;  1CE8 B;  3SXN A;  1YSJ A;  3PRT A;  4M85 A;  3EC4 A;  3IWE A;  4MJX A;  2FE7 A;  3IIB A;  1KEE B;  5H84 A;  4KOS A;  2V8D A;  4CYP A;  4C9V A;  1AYE A;  2F7V A;  3S6H A;  1F2O A;  1FY7 A;  2JEV A;  3FBU A;  3TLG A;  4A94 A;  2EWB A;  1Y9Z A;  5JM6 A;  4CAF A;  4COB A;  1YLE A;  1YVH A;  2ATR A;  3VWE A;  2ZOG A;  1Y7R A;  3GUX A;  3W6S A;  1NMT A;  3SI1 A;  4R76 A;  1DIK A;  5EC4 A;  4XNH C;  4BTF A;  2GLF A;  2ZOF A;  2CNS A;  3NFZ A;  5AG6 A;  3CXS A;  2I00 A;  4NGT A;  3IU2 A;  4B11 A;  4MFZ A;  1V6C A;  4NCZ A;  5K8P A;  5F48 A;  2PJ4 A;  3PP9 A;  1YW6 A;  4XPD B;  5J8F A;  3DDD A;  1YVO A;  3FJU A;  4GS4 A;  4OC0 A;  4P10 A;  2AE6 A;  4UEZ A;  2Z3N A;  4UCM A;  4CRY B;  4KOY A;  3PGP A;  1EZA A;  2GFQ A;  2OZH A;  1S60 A;  3TE4 A;  3D66 A;  3MGD A;  2ZEL A;  4F9V A;  2VKZ G;  1XFO A;  3IWW A;  5AXI A;  1TKH A;  3PFV A;  2G0B A;  4B6Z A;  1Q2D A;  3S9N A;  2Q51 A;  2ZXV A;  3VRR A;  1QSN A;  3GYA A;  4MCQ A;  4QBJ A;  1S3Z A;  5ELY A;  4Z65 A;  1UFH A;  3G3S A;  2PR1 A;  3T9Y A;  4DUK A;  1WJT A;  4YWY A;  4AXV A;  4AG7 A;  1QMU A;  2GE3 A;  4KUB A;  5H86 A;  5FVJ A;  3D8P A;  4P6Y A;  2WUU A;  3P2F A;  3EIF A;  3VRO A;  1UWY A;  2C1C A;  5IV0 A;  5G22 A;  2PVV A;  5F13 A;  1EE3 P;  1PCA A;  4KNG E;  2AFM A;  2CIJ A;  1HEE A;  3B3C A;  1KUY A;  4MBU A;  3U1B A;  3TLG B;  2A4N A;  1FNO A;  2ZEE A;  2HWG A;  2XPO A;  4ZYQ A;  4F6A A;  4L89 A;  1L0C A;  2Q4Z A;  2YND A;  3EY5 A;  4KVX A;  2JEW A;  2C6G A;  3D67 A;  5AG4 A;  5HKZ A;  3KI9 A;  3NE8 A;  2R1I A;  4OC5 A;  4GM5 A;  2PIY A;  4R87 A;  2B5G B;  4CGL A;  5BWA B;  4NEX A;  4PXE A;  4OP4 A;  1Z9E A;  2Y1N A;  3RBU A;  4IK2 A;  4HNW B;  4JYW A;  5GCN A;  3I1U A;  3BJ7 A;  3PB7 X;  2REF A;  3D7D A;  1EO0 A;  1T36 B;  5LYD A;  5A27 A;  2GAN A;  3RYO A;  5D29 A;  4KOU A;  1VBH A;  5K8O A;  3R96 A;  2P0W A;  4CYO A;  4A4B A;  5LYI A;  4EWT A;  4L8A A;  2J8M A;  4DNC A;  2C5Q A;  4KSA A;  3FEC A;  2YJV A;  4C9R A;  4OKO A;  3WAB A;  4U9Z A;  5F47 A;  2FT0 A;  2PJ3 A;  1JDB C;  2D0O A;  2BCO A;  2EK9 A;  2WZN A;  3EFA A;  3NOJ A;  1ZRS A;  2B4B A;  1MJB A;  2DPS A;  5EMI A;  3TOB A;  3FX6 A;  3V7Z A;  2IJZ A;  3VAR A;  3BI0 A;  5HVG A;  3C26 A;  3GKR A;  4MHZ A;  3TO6 A;  2OLS A;  1I12 A;  3VTA A;  3TLY A;  2PJB A;  4KOT A;  3TC8 A;  1ZO0 A;  4E0A A;  3WC7 A;  4INJ A;  3FB3 A;  2O4H A;  5HXD A;  1XRY A;  2JBK A;  3PT1 A;  1OZP A;  2DEA A;  3TO7 A;  2P6F A;  4FD7 A;  2ZW4 A;  4C8P A;  1IYL A;  1BPM A;  2HB6 A;  4F0Y A;  1M6V B;  1C30 B;  3T05 A;  4P4D A;  4JXR A;  4LX9 A;  1I21 A;  1P4N A;  2EO8 A;  1VKC A;  1Y0Y A;  2OZU A;  2PIZ A;  1FT7 A;  2BSW A;  2YGW A;  3I3G A;  4Q36 A;  4KSF A;  2Y1M A;  1TKF A;  3KQX A;  1K4J A;  2R82 A;  1VIX A;  3GJZ A;  4RN7 A;  1R3N A;  2J8R A;  2Q43 A;  2RC4 A;  1Z8W A;  1RO5 A;  2Q0Y A;  4A33 A;  3EZA A;  5F9M A;  1QST A;  4KOV A;  1ARM A;  3BUX B;  2UV8 G;  1B87 A;  1TF9 A;  2CY2 A;  1Z4R A;  2PDO A;  2PJ6 A;  2QJ8 A;  3DNS A;  4M3S A;  5EBV A;  3RO0 A;  3MN8 A;  4B14 A;  5J8C A;  3BUO B;  1YLO A;  4A38 A;  4TJV A;  4IUS A;  4KVM E;  1S5K A;  4IIX A;  2EZB A;  2G3A A;  1AMP A;  1YX0 A;  1Z8T A;  3JVN A;  3OB2 B;  4TJX A;  3KRV A;  2B3U A;  3DSB A;  3FIX A;  4R3K A;  2PQ8 A;  2VXK A;  1GYT A;  2YNC A;  3SJG A;  7CPA A;  3BI1 A;  4K30 A;  1X10 A;  2C6P A;  4YRH A;  3FNC A;  2HI6 A;  3NFQ A;  3VRN A;  3JRU A;  2X0S A;  3H8F A;  3DGV A;  3PBB A;  2VEZ A;  3LAC A;  4C7I A;  4X8I A;  4AG9 A;  3PB4 X;  3G8W A;  1S7K A;  2GP4 A;  2B3V A;  4M8D A;  4C99 A;  1NBW A;  2DXQ A;  3PFO A;  1VI4 A;  2CBL A;  1Q2Y A;  5A28 A;  1QSM A;  1KC7 A;  3V8I A;  4MI1 A;  1FBV A;  4P4J A;  2Z10 A;  2V8G A;  4MJ8 A;  1PYT B;  4JJX A;  3D68 A;  4FWU A;  2PRB A;  4R8F A;  3HPH E;  2REE A;  2NSM A;  3I9S A;  3W6X A;  4UIA A;  4OME A;  1XOV A;  2HUZ A;  2NYQ A;  2Z3K A;  3WC5 A;  1Q5X A;  2RB7 A;  2XEI A;  4LQG A;  3BUM B;  2XEG A;  1V0C A;  3IGR A;  4RS2 A;  3SXO A;  1NSL A;  4B5P B;  2PR8 A;  1Y0R A;  3KZW A;  2Z3P A;  4A31 A;  3PFE A;  3NE7 A;  1CP6 A;  4MHN A;  3O8Z A;  2CTB A;  4B5O A;  2VZY A;  2DLA A;  4PK2 A;  4E5S A;  1XF1 A;  1NSA A;  2PJA A;  3D4U A;  4AB7 A;  5FD8 A;  4CGM A;  4C8C A;  4GXH A;  4COG A;  2XPN A;  3F9K C;  2C27 A;  1J3L A;  4YN3 A;  5LRK A;  4B10 A;  3S9M A;  3EO4 A;  3T0T A;  3H8G A;  4PV6 A;  3WR7 A;  2ZEF A;  3K9U A;  4UEF A;  1XBU A;  2G3T A;  4H6U A;  4C9U A;  1BPN A;  3FRM A;  4B12 A;  4EYS A;  1TXR A;  4MCP A;  4EFD A;  4MFK A;  3T90 A;  2Z3O A;  2HV2 A;  3NH4 A;  3R9E A;  1ZLI A;  3KR5 A;  4Y49 B;  4J0N A;  3D3S A;  5CPA A;  3CDX A;  4MHP A;  1Z9U A;  3KQZ A;  5HMN A;  3HMJ G;  3R1K A;  4PXB A;  4MFP A;  2EZA A;  1B6B A;  4F0X A;  4E94 A;  4NFR A;  1BLL E;  4U5Y A;  3TLC A;  3TLB A;  2QVP A;  3TLE A;  4P45 A;  3ISX A;  1IY7 A;  3PBE A;  2FSR A;  5G21 A;  4CDJ A;  2PJC A;  1YVK A;  4M6G A;  3DR8 A;  3R9G A;  4JVO A;  1OBR A;  4UFX A;  1VBG A;  2AFW A;  2PJ8 A;  1P0H A;  3U88 C;  2O28 A;  3MRU A;  5CBM A;  3NH8 A;  3CXQ A;  5JPH A;  4ONU A;  4R6T A;  3BJ8 A;  2ZED A;  5CNP A;  1Y9K A;  4MY0 A;  4R7M A;  4CAE A;  2N3A B;  1ZG9 A;  2GLJ A;  2OB0 A;  4MXU A;  3NA6 A;  3P2H A;  1Z2L A;  3WT4 A;  2CTC A;  1ZG7 A;  1LOK A;  2AUN A;  4A32 A;  3L2N A;  2EVN A;  3H5Z A;  4A95 A;  1MJ9 A;  2G9D A;  4UIB A;  1RXT A;  2ZEG A;  2XEF A;  3QB8 A;  1MJA A;  2QML A;  3B3W A;  3CZX A;  4PQA A;  3KAS A;  4KLV A;  2AFX A;  3CT9 A; 
#chains in the Genus database with same CATH homology
 5I4M A;  5LYF A;  2WYR A;  8CPA A;  4MHY A;  4NGS A;  3FF3 A;  2AFO A;  1BAV A;  4FBE A;  3PB6 X;  5K8N A;  1XJO A;  2V8H A;  4C8A A;  2PJ5 A;  4PPZ A;  4C84 A;  4NGP A;  4UEE A;  3QNV A;  4WWV A;  2O53 A;  2J9A A;  3CPA A;  3KHZ A;  2ZEN A;  1JQG A;  1YW4 A;  2RFH A;  5HVF A;  3V38 A;  2AFU A;  2PE3 A;  2IQ6 A;  3CPX A;  4NGN A;  3IO1 A;  3D7F A;  5J1Q A;  4NJQ A;  3NH5 A;  4TNU A;  3PEI A;  1KWM A;  4Q7A A;  1QQ9 A;  3RAM A;  4ZI6 A;  3VH9 A;  3H8E A;  1TF8 A;  1HDU A;  1LCP A;  2ZEO A;  3K9T A;  4DYO A;  3KHX A;  5THW A;  1VHE A;  1ZG8 A;  3SJE A;  2C6C A;  2ABZ A;  2I3C A;  4FUU A;  3T8W A;  4NJR A;  1Q7L A;  1VGY A;  4OC1 A;  4C85 A;  1CPX A;  4F9U A;  3BHX A;  1ELL P;  2ZEH A;  3SI2 A;  2FVG A;  2GRE A;  4WJB A;  1WVM A;  3B35 A;  3KR4 A;  2PVW A;  3VAT A;  5HVH A;  4MCS A;  3I6S A;  4C9A A;  3B3S A;  4DJL A;  4X2T A;  4ZY1 A;  2JBJ A;  3D7G A;  2PJ0 A;  3K2K A;  4ZY2 A;  3IJ3 A;  4P4I A;  2PJ2 A;  3TX8 A;  3WC6 A;  4P4B A;  4CPA A;  3FMC A;  4W9Y A;  1LFW A;  3B7I A;  3KL9 A;  1DE4 C;  4NGM A;  4UF4 A;  1M4L A;  4G1P A;  3FEE A;  2V8V A;  2OOT A;  2EK8 A;  4TWE A;  4C9E A;  4JZ0 A;  3PB9 X;  4OC2 A;  5JH9 A;  2IMO A;  2AFS A;  4KSI A;  3LMS A;  1LAM A;  2QYV A;  4A39 A;  4IAV A;  1R43 A;  2PRQ A;  4C86 A;  3B3T A;  4NGR A;  1TKJ A;  4RUH A;  1LAN A;  4P44 A;  5D8N A;  4K3N A;  6CPA A;  2BO9 A;  1Z8L A;  4EME A;  4C8T A;  1CP7 A;  4C8U A;  3FED A;  4NGQ A;  1F57 A;  3HLP A;  4ZX9 A;  3B2Y A;  3SJX A;  4OC4 A;  4P4E A;  2PJ7 A;  3IC1 A;  4MRI A;  3D7H A;  2ANP A;  4H2K A;  4BD9 A;  3PB8 X;  4O23 A;  4OC3 A;  1LAP A;  2PCU A;  3N5F A;  1ZLH A;  2BOA A;  3SJF A;  2PJ9 A;  3KGQ A;  4ONW A;  3RZA A;  3S9L A;  3BXM A;  2ZEP A;  1RTQ A;  5IB9 A;  3I74 A;  4MCR A;  4F8Z A;  1CPS A;  4ZY0 A;  1DTD A;  1H8L A;  4OID A;  2HC9 A;  4YU9 A;  1CG2 A;  1IGB A;  3HUV A;  5LRJ A;  2CF4 A;  2V77 A;  3GLJ A;  3SI0 A;  3B3V A;  2XEJ A;  4P4F A;  1Y7E A;  3DLJ A;  2ZEM A;  5F09 A;  2VL1 A;  2PJ1 A;  1HDQ A;  1VHO A;  3FH4 A;  5JGF A;  5IR2 A;  4X3R A;  3ISZ A;  3LWU A;  1YME A;  3IFE A;  2POK A;  4PXC A;  1CBX A;  1Z5R A;  4FAI A;  1CX8 A;  4OIW A;  1F2P A;  5DS0 A;  5LRG A;  2F8H A;  1ELM P;  3IEH A;  2AFZ A;  1ARL A;  3ICU A;  4IHM A;  3FVL A;  4ZX8 A;  4CDK A;  4MMO A;  5LYL A;  2GU2 A;  5K8M A;  3GB0 A;  2OR4 A;  1XMB A;  1YSJ A;  3PRT A;  3IIB A;  4C8F A;  2V8D A;  4C9V A;  1AYE A;  2F7V A;  1F2O A;  4A94 A;  2EWB A;  1Y9Z A;  5JM6 A;  2ZOG A;  3GUX A;  3SI1 A;  4R76 A;  4A37 A;  2GLF A;  2ZOF A;  3NFZ A;  1V6C A;  4NGT A;  5K8P A;  2PJ4 A;  1YW6 A;  4P10 A;  3FJU A;  4OC0 A;  4UEZ A;  3D66 A;  4F9V A;  2ZEL A;  3IWW A;  1XFO A;  1TKH A;  4B6Z A;  3S9N A;  2Q51 A;  4MCQ A;  5ELY A;  4Z65 A;  4DUK A;  4YWY A;  4AXV A;  1QMU A;  4P6Y A;  3EIF A;  1UWY A;  2C1C A;  2PVV A;  1EE3 P;  1PCA A;  4KNG E;  2AFM A;  2CIJ A;  3B3C A;  1HEE A;  2ZEE A;  1FNO A;  4ZYQ A;  2Q4Z A;  2JEW A;  2C6G A;  3D67 A;  3KI9 A;  4GM5 A;  4OC5 A;  2PIY A;  4PXE A;  4OP4 A;  3RBU A;  4IK2 A;  4JYW A;  3I1U A;  3PB7 X;  3D7D A;  5LYD A;  5D29 A;  5K8O A;  5LYI A;  4EWT A;  2C5Q A;  3FEC A;  4C9R A;  4OKO A;  3WAB A;  2PJ3 A;  2BCO A;  2EK9 A;  2WZN A;  3FX6 A;  3V7Z A;  2IJZ A;  3VAR A;  3BI0 A;  5HVG A;  4MHZ A;  3VTA A;  2PJB A;  3TC8 A;  3WC7 A;  2O4H A;  5HXD A;  1XRY A;  2JBK A;  2DEA A;  4C8P A;  1BPM A;  2HB6 A;  4P4D A;  2PIZ A;  1Y0Y A;  1FT7 A;  1TKF A;  3KQX A;  1VIX A;  1R3N A;  2Q43 A;  1ARM A;  2QJ8 A;  4PXD A;  1TF9 A;  2PJ6 A;  3MN8 A;  4TJV A;  4A38 A;  1YLO A;  1AMP A;  4TJX A;  1GYT A;  7CPA A;  3SJG A;  3BI1 A;  2C6P A;  3JRU A;  3H8F A;  3DGV A;  3PBB A;  4X8I A;  3PB4 X;  2GP4 A;  4C99 A;  3PFO A;  4P4J A;  2V8G A;  1PYT B;  4R8F A;  3D68 A;  4FWU A;  2NSM A;  4UIA A;  4OME A;  2NYQ A;  3WC5 A;  2RB7 A;  2XEI A;  4LQG A;  2XEG A;  1Y0R A;  3KZW A;  3PFE A;  4MHN A;  1CP6 A;  2CTB A;  1XF1 A;  1NSA A;  2PJA A;  3D4U A;  4C8C A;  4YN3 A;  5LRK A;  3S9M A;  3H8G A;  2ZEF A;  4UEF A;  1XBU A;  4C9U A;  1BPN A;  1TXR A;  4MCP A;  4EFD A;  3NH4 A;  1ZLI A;  3KR5 A;  5CPA A;  3CDX A;  4MHP A;  3KQZ A;  4PXB A;  4NFR A;  1BLL E;  2QVP A;  4P45 A;  3ISX A;  1IY7 A;  3PBE A;  4CDJ A;  2PJC A;  1OBR A;  2AFW A;  2PJ8 A;  3MRU A;  5CBM A;  3NH8 A;  4R6T A;  2ZED A;  4R7M A;  1ZG9 A;  2GLJ A;  4MXU A;  3NA6 A;  3WT4 A;  1Z2L A;  2CTC A;  1ZG7 A;  1LOK A;  3L2N A;  2G9D A;  4UIB A;  2ZEG A;  2XEF A;  3B3W A;  4PQA A;  3KAS A;  2AFX A;  3CT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...