1Z8LA

Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
695
structure length
695
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase II
publication title Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 201
structure length 695
sequence length 695
chains with identical sequence B, C, D
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 1z8lA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1z8lA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 1z8lA02
4A39A 3JRUA 2XEFA 4G1PA 3VARA 3KQZA 3ISZA 3RZAA 2JEWA 2HB6A 4Z65A 4YU9A 4OC4A 2PJ0A 3I1UA 4CDJA 1R3NA 4NGQA 3CDXA 4MRIA 2PJ5A 2ZEPA 2FVGA 3VH9A 1YMEA 3D68A 4C9AA 4C84A 2PJ3A 4FAIA 2BOAA 4C8CA 3B2YA 5F09A 3IC1A 3NFZA 4OMEA 1BLLE 3GLJA 3B35A 1XBUA 4KSIA 3CT9A 4ZX8A 2PJAA 3KR5A 3B3CA 3S9MA 4FUUA 3RAMA 4OC0A 2BCOA 4C9UA 4C8TA 3LWUA 2JBKA 1FNOA 3NH8A 4K3NA 3V7ZA 2JBJA 3BHXA 1LAMA 3D7FA 2PJ8A 4P6YA 2CTCA 1YW6A 4P4IA 1VIXA 3VATA 1Y7EA 3S9LA 1TF8A 2ZELA 3KASA 5IB9A 2GU2A 5D29A 4KNGE 3KL9A 1LOKA 4A94A 1ARLA 1R43A 3KQXA 1TKFA 3CPAA 4MHPA 3PB9X 2ANPA 4OIWA 3SJFA 4P10A 4C8PA 4NGPA 5I4MA 4A37A 4P45A 4F9UA 4DUKA 1GYTA 3PFEA 3TX8A 3D7GA 5THWA 3TC8A 3FMCA 4MCPA 1TXRA 4PPZA 2PJ2A 2IMOA 2OR4A 5LRJA 2PJBA 2ZOGA 1ARMA 2V77A 3QNVA 4PXCA 2ZEFA 2XEJA 4OIDA 4ZX9A 3DLJA 1CP7A 3IFEA 1TKJA 1YLOA 3N5FA 1BAVA 2C6GA 1WVMA 3KHZA 2CTBA 8CPAA 1XMBA 3PRTA 1CG2A 3T8WA 1Y9ZA 1Y0RA 5LYFA 2O53A 1F57A 3H8GA 4B6ZA 4UIBA 2RFHA 4UEEA 2BO9A 4GM5A 2QJ8A 2ZEDA 1AYEA 5HVFA 1IGBA 2PCUA 1LFWA 2ZEOA 3B3TA 3FF3A 3KZWA 2IJZA 4WWVA 1UWYA 2QVPA 3HUVA 1Z2LA 3WT4A 4NGRA 1XRYA 3PBBA 3KR4A 2EK9A 4IK2A 4A38A 3NA6A 4X8IA 1TF9A 3FVLA 4W9YA 1QMUA 2ZOFA 2V8GA 3EIFA 3WC6A 5ELYA 2PE3A 2V8VA 4MCQA 3PB6X 4MHNA 3BI1A 4TJVA 1OBRA 4EMEA 4MXUA 3FEEA 2PIZA 2PJCA 1DTDA 5JGFA 4CPAA 4C9RA 3S9NA 2EK8A 1CBXA 2ABZA 4R7MA 3WC7A 3PB4X 3NH4A 1Z5RA 4IAVA 1VGYA 5LYIA 3SJXA 4R76A 1DE4C 4C86A 4PXDA 2GLFA 3I6SA 3H8FA 1YSJA 4YN3A 4C85A 1PCAA 2ZENA 4PQAA 3PB7X 4MCSA 3WABA 3LMSA 4NJRA 4DYOA 2Q4ZA 1JQGA 1ELLP 4Q7AA 4DJLA 1CPSA 3ICUA 3PFOA 2POKA 4UIAA 4C8UA 3ISXA 4P4BA 2XEIA 2PVWA 4ZY0A 1XF1A 4FBEA 2ZEMA 3PBEA 4EWTA 3SJGA 1AMPA 2F7VA 1KWMA 1Z8LA 3VTAA 1BPMA 1HDQA 2C6CA 4P4FA 3D7DA 3GUXA 2WZNA 3RBUA 2G9DA 5J1QA 3IWWA 3KI9A 4C9VA 4CDKA 2PJ9A 4OC3A 2AFXA 1Q7LA 1RTQA 1ZG8A 2CIJA 4NGSA 4ZY1A 4FWUA 1ELMP 2CF4A 3MRUA 1FT7A 4C8AA 2PJ7A 1HEEA 5DS0A 3D7HA 4YWYA 2GREA 3WC5A 4OKOA 5HVGA 3SI2A 4BD9A 2DEAA 4ZY2A 1NSAA 5K8PA 5LRGA 4X3RA 2AFOA 4P4DA 4OC2A 3PB8X 4UEZA 1BPNA 1XJOA 2WYRA 4MMOA 3NH5A 3K2KA 2NYQA 2PRQA 3KGQA 1ZLIA 1ZG9A 4OP4A 5LYDA 2GLJA 5JH9A 2PJ6A 4AXVA 2IQ6A 2RB7A 2V8HA 1HDUA 3FEDA 5K8NA 4R6TA 2Q51A 3IJ3A 3MN8A 1ZG7A 1Y0YA 2OOTA 3BI0A 4F8ZA 3B7IA 4JYWA 2J9AA 3B3VA 1CX8A 2ZEHA 4JZ0A 2I3CA 1IY7A 4OC1A 4R8FA 5D8NA 1CPXA 4P4JA 4UEFA 2EWBA 2HC9A 4C99A 5LYLA 2F8HA 3FX6A 4WJBA 3D67A 5CPAA 1H8LA 3IEHA 4TJXA 1LANA 2PVVA 3BXMA 4ZYQA 4ZI6A 4PXEA 3KHXA 4EFDA 4NFRA 2VL1A 4X2TA 4F9VA 3PEIA 5HXDA 5HVHA 1F2PA 1EE3P 4NGNA 1TKHA 1ZLHA 4PXBA 3CPXA 1M4LA 2O4HA 2PJ1A 5LRKA 6CPAA 2C6PA 4IHMA 3SI1A 4MCRA 2XEGA 3D66A 5K8OA 2ZEGA 4C9EA 2NSMA 3HLPA 3DGVA 4NGTA 1CP6A 5K8MA 3FJUA 7CPAA 3B3WA 1F2OA 2C1CA 3SJEA 2AFMA 3GB0A 3IO1A 3H8EA 3FECA 3IIBA 1VHOA 4ONWA 4NGMA 3I74A 4MHYA 2AFUA 2PIYA 4P4EA 4P44A 1XFOA 2QYVA 4UF4A 2ZEEA 4LQGA 3SI0A 3FH4A 3L2NA 5JM6A 1QQ9A 2PJ4A 3B3SA 4C8FA 4NJQA 2AFZA 2AFWA 4TNUA 3K9TA 4O23A 3V38A 1VHEA 5CBMA 2Q43A 4H2KA 1YW4A 1LCPA 4MHZA 4OC5A 1PYTB 1LAPA 4RUHA 1V6CA 3D4UA 4TWEA 2AFSA 2V8DA
chains in the Genus database with same CATH superfamily
1YVKA 4A39A 4CGPA 4CAVA 3TFYA 2CXAA 2OZGA 3JRUA 2XEFA 4G1PA 4UCPA 3VARA 4AVAA 3KQZA 5J8CA 3ISZA 4XPDC 2E28A 5IV0A 1V0CA 4J0NA 1M4GA 2JEWA 3RZAA 3TYXA 2CBLA 1Z4EA 2FL4A 2HB6A 2Q44A 4BPXB 4HKFA 4Z65A 5JVLA 5IR2A 4YU9A 3H5ZA 4OC4A 2PJ0A 3R9GA 3I1UA 4CDJA 2AUMA 1KUYA 5H86A 4KOVA 1WJTA 4R87A 1R3NA 4QUSA 4NGQA 3CDXA 3IWEA 2B4BA 4MRIA 2PJ5A 3TCVA 1XEBA 2ZEPA 4JWPA 2R7HA 3TE4A 2FVGA 2FIAA 5GCNA 3G3SA 3DNSA 4HNXB 3VH9A 2DIKA 2OLSA 1YMEA 3D68A 4KVME 3VGOA 4CAFA 4C9AA 4C84A 2PJ3A 3G8WA 5HKWA 1P4NA 2BOAA 3BUMB 3B2YA 3LD2A 4FAIA 4C8CA 3BUNB 5F09A 3IC1A 3NFZA 4OMEA 1BLLE 1Y9KA 3GLJA 3B35A 3NE8A 3FNCA 1IU8A 4AB7A 4YFJA 3K9UA 1XBUA 2X7BA 3CT9A 3EFAA 4KSIA 2PJAA 3KKWA 3KR5A 4U5YA 4ZX8A 3ZJ0A 2C5QA 1M1DA 3B3CA 1L0CA 5C82A 2F5IA 3S9MA 5AG5A 4FUUA 4UFVA 3HMJG 3RAMA 4OC0A 4FD7A 3U1BA 2QECA 3TLEA 2BCOA 3VROA 2Z0ZA 4FD6A 4C9UA 1CM0A 2D0PA 2VXKA 3TO9A 4C8TA 3LWUA 2JBKA 2D0OA 1FNOA 1YQEA 4NSQA 3NH8A 1WK4A 4K3NA 3V7ZA 2Q4VA 4MY0A 4UFWA 2JBJA 1NXJA 3BHXA 2GP4A 1PU9A 1LAMA 3F5BA 3D7FA 2PJ8A 2Q7SA 2FM4A 4P6YA 2CTCA 1CS0B 2FS5A 5EBVA 1YW6A 4EVYA 3G23A 2CNTA 3EXNA 4XPKA 4CGLA 1ZL0A 1X10A 4P4IA 3F0AA 1VIXA 4MFLA 4NF1A 3VATA 1ZRSA 2B0AA 1KC7A 1Y7EA 3S9LA 3W6XA 1TF8A 5I0CA 2FCKA 1FBVA 2ZELA 3KASA 5IB9A 2GU2A 2J8MA 2CNSA 2OZHA 2EUIA 1XE4A 5D29A 1QSRA 2EBJA 3EC4A 5F47A 4B11A 1DIKA 5AG4A 3NOJA 1YLEA 3KL9A 4CGMA 4KNGE 1LOKA 3VWDA 1JDEA 3E0KA 2A4NA 3V8IA 5F5XA 3NE7A 4A94A 1I21A 3R1KA 1ARLA 1R43A 3KQXA 1TKFA 3CPAA 4MHPA 4BTFA 3SXNA 4IIYA 1P0HA 3PB9X 2ANPA 4OIWA 4QVTA 1N71A 3SJFA 4RR2B 4P10A 1NBWA 1EZBA 1A2ZA 1T36B 3EO4A 4A30A 4C8PA 4NGPA 3D8PA 5I4MA 1J3LA 4A37A 3W6SA 4P45A 2D4OA 1Z4RA 1M44A 4F9UA 4DUKA 4RS2A 4H6UA 1GYTA 3PGPA 3PFEA 3TX8A 3D7GA 3VRRA 4R57A 5THWA 1YVHA 3TC8A 1Q2YA 4IUSA 1Y9WA 4CAXA 5KTCA 3FMCA 4MCPA 4GPLB 1TXRA 4NEXA 4CAEA 4PPZA 2PJ2A 2IMOA 2OR4A 5LRJA 2PJBA 2H5MA 2WSAA 2ZOGA 1VKCA 1Z8TA 1ARMA 2V77A 2Z3LA 1XF8A 3QNVA 4PXCA 2ZEFA 4ZBGA 2XEJA 4XPDB 4OIDA 3IU2A 4JLYA 4ZX9A 4PK2A 3DLJA 4JD6A 4KUBA 2CNMA 1NMTA 2PRBA 4BMHA 1CP7A 4A95A 3IFEA 3TLBA 1IOIA 2XPNA 2PSWA 1TKJA 1KEEB 3BUOB 3GY9A 2HQYA 1GGOA 1YLOA 2P6GA 3IWGA 2R82A 3N5FA 4LX9A 1BAVA 2Z3PA 2C6GA 3PLFB 2VKZG 4MI4A 1WVMA 3KRVA 2B5GA 3KHZA 2CTBA 2Y1NA 1XMBA 3BJ8A 3PRTA 1CG2A 4M6GA 8CPAA 3NFQA 2J8RA 5IX3A 3T07A 3TTHA 3T8WA 1Y9ZA 1MK4A 2B5GB 4L89A 3U88C 1Y0RA 5LYFA 2O53A 1F57A 3H8GA 5A28A 4CZ1A 4B6ZA 4UIBA 2EO8A 2RFHA 4UEEA 2BO9A 5F1YA 4B13A 4GM5A 2QJ8A 4UWJA 2ZEDA 4DNCA 3TLZA 1AYEA 5HVFA 1IGBA 2PCUA 5AG7A 1ZYMA 3RNZA 2FT0A 1LFWA 1RO5A 2QMLA 3TO7A 2ZEOA 3B3TA 3TLYA 3ZZIA 2Z3MA 3FF3A 2OU2A 3GKRA 3KZWA 5EMIA 3T5MA 4CO9A 4RI1A 2IJZA 4C68A 4WWVA 1S7KA 2GE3A 5FVJA 1UWYA 2BL1A 2QVPA 3HUVA 4KSFA 2JEVA 1Z2LA 4II9A 3EZEA 3WT4A 4NGRA 4MI1A 1IB1E 1Z9UA 1XRYA 3I3GA 3DR6A 2DPTA 3PBBA 3KR4A 3OP0A 2Z10A 4A4CA 2XPPA 2EK9A 3CXPA 3NA6A 2ZPAA 4IK2A 4Y49C 3RO0A 3S6FA 4A38A 1RXTA 3WR7A 3IGRA 5A27A 4X8IA 1TF9A 4I49A 2BSWA 1Q2DA 3FVLA 4AG9A 5HMNA 4C2XA 4IIXA 4W9YA 1QMUA 2ZOFA 1B6BA 4INJA 4MFPA 2V8GA 3EIFA 3BUWB 4CGOA 3WC6A 5ELYA 2PQ8A 2PE3A 2V8VA 1VI4A 2HWGA 4QBJA 5F46A 4MCQA 2YNCA 3PB6X 4MHNA 4C7IA 3BI1A 4E0AA 4TJVA 1OBRA 4B5PA 4MXUA 3FEEA 2PIZA 4EMEA 3BLNA 3VRNA 2PJCA 1DTDA 3H4QA 5JGFA 1YGHA 4B5PB 3D2MA 3QAYA 5C88A 3FYNA 5IB0A 2FXFA 4CPAA 1KBLA 2DLAA 4C9RA 4A32A 3S9NA 2EK8A 1CBXA 2PR8A 3TLGA 4JVOA 2ABZA 4ONUA 2REEA 4XPLA 2R98A 4R7MA 2EZCA 3GIUA 4F0XA 3WC7A 3TLGB 3TLAA 2OB0A 3T9YA 3PB4X 3NH4A 1Z5RA 2XPLA 4IAVA 1VGYA 1YR0A 4A4BA 2HV2A 2ZW4A 3PP9A 5LYIA 4A31A 3CXQA 5J8FA 3SJXA 4R76A 1DE4C 3TOBA 3R95A 4C86A 4Q38A 4PXDA 3O8ZA 2GLFA 2GANA 2JLMA 1LRZA 3H8FA 3I6SA 1YSJA 2VZZA 2UV8G 2Z11A 3W91A 4CS0B 4R3KA 2DF5A 2N3AB 4CYPA 1PCAA 4YN3A 4C85A 4COGA 2ZENA 4PQAA 3PB7X 4MCSA 5G22A 4UBRA 3WABA 3LMSA 3FBUA 4NJRA 4DYOA 2Q4ZA 3S6HA 3GJZA 1JQGA 2JDDA 1ELLP 4Q7AA 4DJLA 5HKYA 1CPSA 3K4IA 2WPXA 4L8AA 4B10A 3ICUA 4KVXA 3PFOA 2POKA 1YVOA 4UIAA 4CYNA 4C8UA 2YNDA 2YGWA 2YJTA 3ISXA 4P4BA 2XEIA 1EO0A 2PVWA 3ZNIA 2BUEA 2P6FA 4MHDA 4ZY0A 1XF1A 1M4DA 3GYAA 4FBEA 2ZEMA 3PBEA 4M6IA 2ATRA 4EWTA 3EZBA 3SJGA 2HROA 1AMPA 4CGNA 2Z3OA 5KTAA 2F7VA 3VRPA 5G20A 1KWMA 1C3OB 2X0SA 4KOSA 4E2AA 2JDCA 5EC4A 4MY3A 1Z8LA 1X12A 4U9YA 3VTAA 4XNHB 1A9XB 3LACA 1BPMA 2GIVA 4NCZA 2WUUA 4AVBA 1HDQA 5KTDA 2PC1A 2C6CA 4P4FA 1I12A 2FSRA 4FD4A 1OZPA 2B3VA 2G3AA 2ZW5A 3D7DA 2QIRA 2VEZA 4KS9A 4NXYA 1XOVA 3R9EA 3GUXA 2MP0A 2WZNA 1CE8B 3RBUA 2G9DA 4E5SA 3QB8A 4UFXA 4GXHA 5J1QA 3IWWA 3DR8A 1JDBC 1JWQA 3KI9A 4C9VA 5HKZA 4KOUA 5F48A 4CDKA 2PJ9A 1IYKA 4H89A 3EZAA 2VZYA 4KOWA 3S6GA 4OC3A 2AFXA 1Q7LA 1RTQA 1ZG8A 2VQYA 2CIJA 5HH1A 4CYQA 4NGSA 4ZY1A 4FWUA 4B5OA 1ELMP 1QSMA 1Z8WA 2CF4A 4A33A 5ISVA 1MJ9A 4FD5A 2EVNA 1BXRB 2VI7A 1R57A 1PUAA 3MRUA 4OAEA 5DWMA 1FT7A 3SXOA 4C8AA 1XIXA 2PJ7A 4M3SA 1HEEA 3R9FA 4UA3A 5DS0A 3D7HA 1S5KA 2P0WA 4YWYA 5BY0A 3FIXA 1S7LA 4U9ZA 2GREA 2HI6A 3T05A 2B4JC 3WC5A 1MJAA 4GS4A 4OKOA 5HVGA 3SI2A 4BD9A 2IL4A 2DEAA 4ZY2A 3A9LA 3OB1B 1NSAA 4KUAA 5K8PA 5LRGA 3OAKA 3PZJA 4X3RA 5JPHA 1ZO0A 4CRZB 2AFOA 4P4DA 2EZBA 4OC2A 1UFHA 3JUWA 3PB8X 4KOYA 4OLLA 4UEZA 1BPNA 4E94A 1XJOA 2DPSA 1Q2CA 1WWZA 2WYRA 4R9MA 3C8OA 3QAHA 3P2FA 3NH5A 4MMOA 2AJ6A 3K2KA 1S60A 1VHSA 4ZGYB 2Y1MA 2NYQA 2REFA 2WPWA 4MJXA 1BO4A 2PRQA 4B12A 4M8DA 3KGQA 1ZLIA 1ZG9A 4OP4A 4YGOA 2GLJA 5LYDA 5JH9A 4B14A 2PJ6A 3D3SA 4AXVA 4X5KA 2FE7A 2IQ6A 2B58A 2RB7A 2ZW7A 2I00A 5AG6A 5JYBA 2Y0MA 2Q04A 2V8HA 4PSXA 5F49A 1HDUA 3C26A 3FEDA 1QSTA 4QC6A 4K30A 4R6TA 2Q51A 5K8NA 4F0YA 3IJ3A 2RC4A 3FB3A 1SQHA 3LODA 4AVCA 5FD8A 3CZXA 1ZG7A 1Y0YA 2OOTA 3BI0A 3MN8A 4OADA 5G1ZA 3B7IA 4F8ZA 5K99A 4LUAA 4BPWB 2KCWA 4JYWA 2J9AA 2YJVA 3PFVA 1TIQA 2B4DA 3B3VA 4IF5A 4RN7A 3I9SA 2EZAA 3R96A 2B3UA 1CX8A 2ZEHA 1CJWA 2B4DB 4JZ0A 2I3CA 1IY7A 2VBQA 4ORFA 4H1HA 4OC1A 4C2ZA 2I79A 1U6MA 4PV6A 4PSWA 4R8FA 5D8NA 4KOTA 4QB9A 2GFQA 4JXQA 5H84A 2R8VA 1CPXA 4P4JA 4UEFA 2EWBA 2HC9A 4C99A 5LYLA 2F8HA 3BUXB 3F8KA 4C2YA 1I1DA 3FX6A 4WJBA 3B8GA 4EYSA 1VBHA 2OH1A 3JVNA 1Y7RA 2PCNA 3D67A 1KUVA 1YREA 2Z3NA 3D2PA 4MFZA 4R3LA 3DSBA 5CPAA 1H8LA 3IEHA 5AXIA 3N7ZA 3F9KC 1J4JA 3OWCA 1LANA 4CRYB 4TJXA 4M6HA 2O28A 1GHEA 2PVVA 1IYLA 3BXMA 5J3XA 4ZYQA 4CYOA 2C27A 4ZI6A 4HPSA 4PXEA 3KHXA 4EFDA 4F6AA 4NFRA 2VL1A 3FXTA 4KLVA 3PEIA 4UCMA 4X2TA 3UY5A 4F9VA 5HXDA 3EY5A 4A2ZA 1IICA 5HVHA 1NSLA 1F2PA 2FIWA 3VRQA 4UCNA 1K4JA 2Z3KA 1EE3P 4MFKA 4NGNA 1KZFA 1TKHA 1ZLHA 4PXBA 3VWEA 3CPXA 4BBHA 1R61A 1M4LA 3TT2A 5JQ4A 2O4HA 3DDDA 1IIDA 1S3ZA 2BEIA 2CY2A 2K5TA 2PDOA 2YNCC 4MBUA 3JTKA 2PJ1A 1QSOA 3P2HA 4PK3A 5LRKA 6CPAA 2C6PA 4HNWB 4IHMA 2ZXVA 2AUNA 3SI1A 2Q4YA 4MCRA 4COBA 1ON0A 1VBGA 4UWIA 2XEGA 3D66A 4Q36A 5E96A 3TO6A 5K8OA 2AE6A 4H6ZA 4MFQA 5DWNA 3SHPA 4BPUB 2Q7BA 2ZEGA 1S7NA 2NSMA 2ARHA 3HLPA 4C9EA 3DGVA 4NGTA 1CP6A 1NE9A 4C7HA 3FJUA 7CPAA 5K8MA 3TLCA 2YNEA 3B3WA 1F2OA 2C1CA 1AUGA 1B47A 3SJEA 1IOFA 2NMTA 2AFMA 3GB0A 3IU1A 4M85A 3IO1A 3FECA 3H8EA 1Z9EA 1VHOA 2R1IA 3IIBA 4ONWA 4KORA 3T90A 1Z8XA 4NGMA 3I74A 1MJBA 2ZW6A 5CNPA 1Q5XA 2PR1A 3BJ7A 4MHYA 2AFUA 2PIYA 4KZTA 2DXQA 3RYOA 1FY7A 2D4PA 4KSAA 4P4EA 4P44A 1XFOA 2QYVA 5F13A 3S6KA 4MJ8A 2XPOA 1YK3A 1EZAA 1XMTA 4UF4A 2ZEEA 3MGDA 4AG7A 4LQGA 3SI0A 4KOXA 4BINA 2Q0YA 3FH4A 3L2NA 3TOAA 2P6EA 1QQ9A 2PJ4A 3B3SA 4E8OA 5JM6A 1B87A 4C8FA 4LQ6A 3HPGG 3PT1A 1BOBA 3SR3A 4Y49B 1YX0A 4NJQA 2AFZA 2HUZA 2AFWA 4TNUA 3K9TA 4O23A 4CAWA 1C30B 2ODFA 1M6VB 4KLWA 3CXSA 4YRHA 2J8NA 3OB2B 2OZUA 1S7FA 1VHEA 2Q43A 1KUXA 3V38A 5CBMA 5AGEA 4H2KA 4JXRA 4XNHC 4JJXA 1YW4A 2G0BA 1LCPA 2G3TA 1QSNA 3HPHE 4MHZA 4OC5A 1M4IA 1PYTB 1LAPA 4KVOE 4RUHA 3D4UA 4J3GA 1V6CA 4MFJA 4HNYB 4TWEA 5G21A 3T0TA 5BWAB 5F9MA 2AFSA 3FRMA 2V8DA
chains in the Genus database with same CATH topology
4A39A 3JRUA 2XEFA 4G1PA 3VARA 3KQZA 3ISZA 3RZAA 2JEWA 2HB6A 4Z65A 5IR2A 4YU9A 4OC4A 2PJ0A 3I1UA 4CDJA 1R3NA 4NGQA 3CDXA 4MRIA 2PJ5A 2ZEPA 2FVGA 3VH9A 1YMEA 3D68A 4C9AA 4C84A 2PJ3A 4FAIA 2BOAA 4C8CA 3B2YA 5F09A 3IC1A 3NFZA 4OMEA 1BLLE 3GLJA 3B35A 1XBUA 4KSIA 3CT9A 4ZX8A 2PJAA 3KR5A 2C5QA 3B3CA 3S9MA 4FUUA 3RAMA 4OC0A 2BCOA 4C9UA 4C8TA 3LWUA 2JBKA 1FNOA 3NH8A 4K3NA 3V7ZA 2JBJA 3BHXA 2GP4A 1LAMA 3D7FA 2PJ8A 4P6YA 2CTCA 1YW6A 4P4IA 1VIXA 3VATA 1Y7EA 3S9LA 1TF8A 2ZELA 3KASA 5IB9A 2GU2A 5D29A 4KNGE 3KL9A 1LOKA 4A94A 1ARLA 1R43A 3KQXA 1TKFA 3CPAA 4MHPA 3PB9X 2ANPA 4OIWA 3SJFA 4P10A 4C8PA 4NGPA 5I4MA 4A37A 4P45A 4F9UA 4DUKA 1GYTA 3PFEA 3TX8A 3D7GA 5THWA 3TC8A 3FMCA 4MCPA 1TXRA 4PPZA 2PJ2A 2IMOA 2OR4A 5LRJA 2PJBA 2ZOGA 1ARMA 2V77A 3QNVA 4PXCA 2ZEFA 2XEJA 4OIDA 4ZX9A 3DLJA 1CP7A 3IFEA 1TKJA 1YLOA 3N5FA 1BAVA 2C6GA 1WVMA 3KHZA 2CTBA 8CPAA 1XMBA 3PRTA 1CG2A 3T8WA 1Y9ZA 1Y0RA 5LYFA 2O53A 1F57A 3H8GA 4B6ZA 4UIBA 2RFHA 4UEEA 2BO9A 4GM5A 2QJ8A 2ZEDA 1AYEA 5HVFA 1IGBA 2PCUA 1LFWA 2ZEOA 3B3TA 3FF3A 3KZWA 2IJZA 4WWVA 1UWYA 2QVPA 3HUVA 1Z2LA 3WT4A 4NGRA 1XRYA 3PBBA 3KR4A 2EK9A 4IK2A 4A38A 3NA6A 4X8IA 1TF9A 3FVLA 4W9YA 1QMUA 2ZOFA 2V8GA 3EIFA 3WC6A 5ELYA 2PE3A 2V8VA 4MCQA 3PB6X 4MHNA 3BI1A 4TJVA 1OBRA 4EMEA 4MXUA 3FEEA 2PIZA 2PJCA 1DTDA 5JGFA 4CPAA 4C9RA 3S9NA 2EK8A 1CBXA 2ABZA 4R7MA 3WC7A 3PB4X 3NH4A 1Z5RA 4IAVA 1VGYA 5LYIA 3SJXA 4R76A 1DE4C 4C86A 4PXDA 2GLFA 3I6SA 3H8FA 1YSJA 4YN3A 4C85A 1PCAA 2ZENA 4PQAA 3PB7X 4MCSA 3WABA 3LMSA 4NJRA 4DYOA 2Q4ZA 1JQGA 1ELLP 4Q7AA 4DJLA 1CPSA 3ICUA 3PFOA 2POKA 4UIAA 4C8UA 3ISXA 4P4BA 2XEIA 2PVWA 4ZY0A 1XF1A 4FBEA 2ZEMA 3PBEA 4EWTA 3SJGA 1AMPA 2F7VA 1KWMA 1Z8LA 3VTAA 1BPMA 1HDQA 2C6CA 4P4FA 3D7DA 3GUXA 2WZNA 3RBUA 2G9DA 5J1QA 3IWWA 3KI9A 4C9VA 4CDKA 2PJ9A 4OC3A 2AFXA 1Q7LA 1RTQA 1ZG8A 2CIJA 4NGSA 4ZY1A 4FWUA 1ELMP 2CF4A 3MRUA 1FT7A 4C8AA 2PJ7A 1HEEA 5DS0A 3D7HA 4YWYA 2GREA 3WC5A 4OKOA 5HVGA 3SI2A 4BD9A 2DEAA 4ZY2A 1NSAA 5K8PA 5LRGA 4X3RA 2AFOA 4P4DA 4OC2A 3PB8X 4UEZA 1BPNA 1XJOA 2WYRA 4MMOA 3NH5A 3K2KA 2NYQA 2PRQA 3KGQA 1ZLIA 1ZG9A 4OP4A 5LYDA 2GLJA 5JH9A 2PJ6A 4AXVA 2IQ6A 2RB7A 2V8HA 1HDUA 3FEDA 5K8NA 4R6TA 2Q51A 3IJ3A 3MN8A 1ZG7A 1Y0YA 2OOTA 3BI0A 4F8ZA 3B7IA 4JYWA 2J9AA 3B3VA 1CX8A 2ZEHA 4JZ0A 2I3CA 1IY7A 4OC1A 4R8FA 5D8NA 1CPXA 4P4JA 4UEFA 2EWBA 2HC9A 4C99A 5LYLA 2F8HA 3FX6A 4WJBA 3D67A 5CPAA 1H8LA 3IEHA 4TJXA 1LANA 2PVVA 3BXMA 4ZYQA 4ZI6A 4PXEA 3KHXA 4EFDA 4NFRA 2VL1A 4X2TA 4F9VA 3PEIA 5HXDA 5HVHA 1F2PA 1EE3P 4NGNA 1TKHA 1ZLHA 4PXBA 3CPXA 1M4LA 2O4HA 2PJ1A 5LRKA 6CPAA 2C6PA 4IHMA 3SI1A 4MCRA 2XEGA 3D66A 5K8OA 2ZEGA 4C9EA 2NSMA 3HLPA 3DGVA 4NGTA 1CP6A 5K8MA 3FJUA 7CPAA 3B3WA 1F2OA 2C1CA 3SJEA 2AFMA 3GB0A 3IO1A 3H8EA 3FECA 3IIBA 1VHOA 4ONWA 4NGMA 3I74A 4MHYA 2AFUA 2PIYA 4P4EA 4P44A 1XFOA 2QYVA 4UF4A 2ZEEA 4LQGA 3SI0A 3FH4A 3L2NA 5JM6A 1QQ9A 2PJ4A 3B3SA 4C8FA 4NJQA 2AFZA 2AFWA 4TNUA 3K9TA 4O23A 3V38A 1VHEA 5CBMA 2Q43A 4H2KA 1YW4A 1LCPA 4MHZA 4OC5A 1PYTB 1LAPA 4RUHA 1V6CA 3D4UA 4TWEA 2AFSA 2V8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A39 A;  3JRU A;  2XEF A;  4G1P A;  3VAR A;  3KQZ A;  3ISZ A;  3RZA A;  2JEW A;  2HB6 A;  4Z65 A;  4YU9 A;  4OC4 A;  2PJ0 A;  3I1U A;  4CDJ A;  1R3N A;  4NGQ A;  3CDX A;  4MRI A;  2PJ5 A;  2ZEP A;  2FVG A;  3VH9 A;  1YME A;  3D68 A;  4C9A A;  4C84 A;  2PJ3 A;  4FAI A;  2BOA A;  4C8C A;  3B2Y A;  5F09 A;  3IC1 A;  3NFZ A;  4OME A;  1BLL E;  3GLJ A;  3B35 A;  1XBU A;  4KSI A;  3CT9 A;  4ZX8 A;  2PJA A;  3KR5 A;  3B3C A;  3S9M A;  4FUU A;  3RAM A;  4OC0 A;  2BCO A;  4C9U A;  4C8T A;  3LWU A;  2JBK A;  1FNO A;  3NH8 A;  4K3N A;  3V7Z A;  2JBJ A;  3BHX A;  1LAM A;  3D7F A;  2PJ8 A;  4P6Y A;  2CTC A;  1YW6 A;  4P4I A;  1VIX A;  3VAT A;  1Y7E A;  3S9L A;  1TF8 A;  2ZEL A;  3KAS A;  5IB9 A;  2GU2 A;  5D29 A;  4KNG E;  3KL9 A;  1LOK A;  4A94 A;  1ARL A;  1R43 A;  3KQX A;  1TKF A;  3CPA A;  4MHP A;  3PB9 X;  2ANP A;  4OIW A;  3SJF A;  4P10 A;  4C8P A;  4NGP A;  5I4M A;  4A37 A;  4P45 A;  4F9U A;  4DUK A;  1GYT A;  3PFE A;  3TX8 A;  3D7G A;  5THW A;  3TC8 A;  3FMC A;  4MCP A;  1TXR A;  4PPZ A;  2PJ2 A;  2IMO A;  2OR4 A;  5LRJ A;  2PJB A;  2ZOG A;  1ARM A;  2V77 A;  3QNV A;  4PXC A;  2ZEF A;  2XEJ A;  4OID A;  4ZX9 A;  3DLJ A;  1CP7 A;  3IFE A;  1TKJ A;  1YLO A;  3N5F A;  1BAV A;  2C6G A;  1WVM A;  3KHZ A;  2CTB A;  8CPA A;  1XMB A;  3PRT A;  1CG2 A;  3T8W A;  1Y9Z A;  1Y0R A;  5LYF A;  2O53 A;  1F57 A;  3H8G A;  4B6Z A;  4UIB A;  2RFH A;  4UEE A;  2BO9 A;  4GM5 A;  2QJ8 A;  2ZED A;  1AYE A;  5HVF A;  1IGB A;  2PCU A;  1LFW A;  2ZEO A;  3B3T A;  3FF3 A;  3KZW A;  2IJZ A;  4WWV A;  1UWY A;  2QVP A;  3HUV A;  1Z2L A;  3WT4 A;  4NGR A;  1XRY A;  3PBB A;  3KR4 A;  2EK9 A;  4IK2 A;  4A38 A;  3NA6 A;  4X8I A;  1TF9 A;  3FVL A;  4W9Y A;  1QMU A;  2ZOF A;  2V8G A;  3EIF A;  3WC6 A;  5ELY A;  2PE3 A;  2V8V A;  4MCQ A;  3PB6 X;  4MHN A;  3BI1 A;  4TJV A;  1OBR A;  4EME A;  4MXU A;  3FEE A;  2PIZ A;  2PJC A;  1DTD A;  5JGF A;  4CPA A;  4C9R A;  3S9N A;  2EK8 A;  1CBX A;  2ABZ A;  4R7M A;  3WC7 A;  3PB4 X;  3NH4 A;  1Z5R A;  4IAV A;  1VGY A;  5LYI A;  3SJX A;  4R76 A;  1DE4 C;  4C86 A;  4PXD A;  2GLF A;  3I6S A;  3H8F A;  1YSJ A;  4YN3 A;  4C85 A;  1PCA A;  2ZEN A;  4PQA A;  3PB7 X;  4MCS A;  3WAB A;  3LMS A;  4NJR A;  4DYO A;  2Q4Z A;  1JQG A;  1ELL P;  4Q7A A;  4DJL A;  1CPS A;  3ICU A;  3PFO A;  2POK A;  4UIA A;  4C8U A;  3ISX A;  4P4B A;  2XEI A;  2PVW A;  4ZY0 A;  1XF1 A;  4FBE A;  2ZEM A;  3PBE A;  4EWT A;  3SJG A;  1AMP A;  2F7V A;  1KWM A;  1Z8L A;  3VTA A;  1BPM A;  1HDQ A;  2C6C A;  4P4F A;  3D7D A;  3GUX A;  2WZN A;  3RBU A;  2G9D A;  5J1Q A;  3IWW A;  3KI9 A;  4C9V A;  4CDK A;  2PJ9 A;  4OC3 A;  2AFX A;  1Q7L A;  1RTQ A;  1ZG8 A;  2CIJ A;  4NGS A;  4ZY1 A;  4FWU A;  1ELM P;  2CF4 A;  3MRU A;  1FT7 A;  4C8A A;  2PJ7 A;  1HEE A;  5DS0 A;  3D7H A;  4YWY A;  2GRE A;  3WC5 A;  4OKO A;  5HVG A;  3SI2 A;  4BD9 A;  2DEA A;  4ZY2 A;  1NSA A;  5K8P A;  5LRG A;  4X3R A;  2AFO A;  4P4D A;  4OC2 A;  3PB8 X;  4UEZ A;  1BPN A;  1XJO A;  2WYR A;  4MMO A;  3NH5 A;  3K2K A;  2NYQ A;  2PRQ A;  3KGQ A;  1ZLI A;  1ZG9 A;  4OP4 A;  5LYD A;  2GLJ A;  5JH9 A;  2PJ6 A;  4AXV A;  2IQ6 A;  2RB7 A;  2V8H A;  1HDU A;  3FED A;  5K8N A;  4R6T A;  2Q51 A;  3IJ3 A;  3MN8 A;  1ZG7 A;  1Y0Y A;  2OOT A;  3BI0 A;  4F8Z A;  3B7I A;  4JYW A;  2J9A A;  3B3V A;  1CX8 A;  2ZEH A;  4JZ0 A;  2I3C A;  1IY7 A;  4OC1 A;  4R8F A;  5D8N A;  1CPX A;  4P4J A;  4UEF A;  2EWB A;  2HC9 A;  4C99 A;  5LYL A;  2F8H A;  3FX6 A;  4WJB A;  3D67 A;  5CPA A;  1H8L A;  3IEH A;  4TJX A;  1LAN A;  2PVV A;  3BXM A;  4ZYQ A;  4ZI6 A;  4PXE A;  3KHX A;  4EFD A;  4NFR A;  2VL1 A;  4X2T A;  4F9V A;  3PEI A;  5HXD A;  5HVH A;  1F2P A;  1EE3 P;  4NGN A;  1TKH A;  1ZLH A;  4PXB A;  3CPX A;  1M4L A;  2O4H A;  2PJ1 A;  5LRK A;  6CPA A;  2C6P A;  4IHM A;  3SI1 A;  4MCR A;  2XEG A;  3D66 A;  5K8O A;  2ZEG A;  4C9E A;  2NSM A;  3HLP A;  3DGV A;  4NGT A;  1CP6 A;  5K8M A;  3FJU A;  7CPA A;  3B3W A;  1F2O A;  2C1C A;  3SJE A;  2AFM A;  3GB0 A;  3IO1 A;  3H8E A;  3FEC A;  3IIB A;  1VHO A;  4ONW A;  4NGM A;  3I74 A;  4MHY A;  2AFU A;  2PIY A;  4P4E A;  4P44 A;  1XFO A;  2QYV A;  4UF4 A;  2ZEE A;  4LQG A;  3SI0 A;  3FH4 A;  3L2N A;  5JM6 A;  1QQ9 A;  2PJ4 A;  3B3S A;  4C8F A;  4NJQ A;  2AFZ A;  2AFW A;  4TNU A;  3K9T A;  4O23 A;  3V38 A;  1VHE A;  5CBM A;  2Q43 A;  4H2K A;  1YW4 A;  1LCP A;  4MHZ A;  4OC5 A;  1PYT B;  1LAP A;  4RUH A;  1V6C A;  3D4U A;  4TWE A;  2AFS A;  2V8D A; 
#chains in the Genus database with same CATH topology
 1YVK A;  4A39 A;  4CGP A;  4CAV A;  3TFY A;  2CXA A;  2OZG A;  3JRU A;  2XEF A;  4G1P A;  4UCP A;  3VAR A;  4AVA A;  3KQZ A;  5J8C A;  3ISZ A;  4XPD C;  2E28 A;  5IV0 A;  1V0C A;  4J0N A;  1M4G A;  2JEW A;  3RZA A;  3TYX A;  2CBL A;  1Z4E A;  2FL4 A;  2HB6 A;  2Q44 A;  4BPX B;  4HKF A;  4Z65 A;  5JVL A;  5IR2 A;  4YU9 A;  3H5Z A;  4OC4 A;  2PJ0 A;  3R9G A;  3I1U A;  4CDJ A;  2AUM A;  1KUY A;  5H86 A;  4KOV A;  1WJT A;  4R87 A;  1R3N A;  4QUS A;  4NGQ A;  3CDX A;  3IWE A;  2B4B A;  4MRI A;  2PJ5 A;  3TCV A;  1XEB A;  2ZEP A;  4JWP A;  2R7H A;  3TE4 A;  2FVG A;  2FIA A;  5GCN A;  3G3S A;  3DNS A;  4HNX B;  3VH9 A;  2DIK A;  2OLS A;  1YME A;  3D68 A;  4KVM E;  3VGO A;  4CAF A;  4C9A A;  4C84 A;  2PJ3 A;  3G8W A;  5HKW A;  1P4N A;  2BOA A;  3BUM B;  3B2Y A;  3LD2 A;  4FAI A;  4C8C A;  3BUN B;  5F09 A;  3IC1 A;  3NFZ A;  4OME A;  1BLL E;  1Y9K A;  3GLJ A;  3B35 A;  3NE8 A;  3FNC A;  1IU8 A;  4AB7 A;  4YFJ A;  3K9U A;  1XBU A;  2X7B A;  3CT9 A;  3EFA A;  4KSI A;  2PJA A;  3KKW A;  3KR5 A;  4U5Y A;  4ZX8 A;  3ZJ0 A;  2C5Q A;  1M1D A;  3B3C A;  1L0C A;  5C82 A;  2F5I A;  3S9M A;  5AG5 A;  4FUU A;  4UFV A;  3HMJ G;  3RAM A;  4OC0 A;  4FD7 A;  3U1B A;  2QEC A;  3TLE A;  2BCO A;  3VRO A;  2Z0Z A;  4FD6 A;  4C9U A;  1CM0 A;  2D0P A;  2VXK A;  3TO9 A;  4C8T A;  3LWU A;  2JBK A;  2D0O A;  1FNO A;  1YQE A;  4NSQ A;  3NH8 A;  1WK4 A;  4K3N A;  3V7Z A;  2Q4V A;  4MY0 A;  4UFW A;  2JBJ A;  1NXJ A;  3BHX A;  2GP4 A;  1PU9 A;  1LAM A;  3F5B A;  3D7F A;  2PJ8 A;  2Q7S A;  2FM4 A;  4P6Y A;  2CTC A;  1CS0 B;  2FS5 A;  5EBV A;  1YW6 A;  4EVY A;  3G23 A;  2CNT A;  3EXN A;  4XPK A;  4CGL A;  1ZL0 A;  1X10 A;  4P4I A;  3F0A A;  1VIX A;  4MFL A;  4NF1 A;  3VAT A;  1ZRS A;  2B0A A;  1KC7 A;  1Y7E A;  3S9L A;  3W6X A;  1TF8 A;  5I0C A;  2FCK A;  1FBV A;  2ZEL A;  3KAS A;  5IB9 A;  2GU2 A;  2J8M A;  2CNS A;  2OZH A;  2EUI A;  1XE4 A;  5D29 A;  1QSR A;  2EBJ A;  3EC4 A;  5F47 A;  4B11 A;  1DIK A;  5AG4 A;  3NOJ A;  1YLE A;  3KL9 A;  4CGM A;  4KNG E;  1LOK A;  3VWD A;  1JDE A;  3E0K A;  2A4N A;  3V8I A;  5F5X A;  3NE7 A;  4A94 A;  1I21 A;  3R1K A;  1ARL A;  1R43 A;  3KQX A;  1TKF A;  3CPA A;  4MHP A;  4BTF A;  3SXN A;  4IIY A;  1P0H A;  3PB9 X;  2ANP A;  4OIW A;  4QVT A;  1N71 A;  3SJF A;  4RR2 B;  4P10 A;  1NBW A;  1EZB A;  1A2Z A;  1T36 B;  3EO4 A;  4A30 A;  4C8P A;  4NGP A;  3D8P A;  5I4M A;  1J3L A;  4A37 A;  3W6S A;  4P45 A;  2D4O A;  1Z4R A;  1M44 A;  4F9U A;  4DUK A;  4RS2 A;  4H6U A;  1GYT A;  3PGP A;  3PFE A;  3TX8 A;  3D7G A;  3VRR A;  4R57 A;  5THW A;  1YVH A;  3TC8 A;  1Q2Y A;  4IUS A;  1Y9W A;  4CAX A;  5KTC A;  3FMC A;  4MCP A;  4GPL B;  1TXR A;  4NEX A;  4CAE A;  4PPZ A;  2PJ2 A;  2IMO A;  2OR4 A;  5LRJ A;  2PJB A;  2H5M A;  2WSA A;  2ZOG A;  1VKC A;  1Z8T A;  1ARM A;  2V77 A;  2Z3L A;  1XF8 A;  3QNV A;  4PXC A;  2ZEF A;  4ZBG A;  2XEJ A;  4XPD B;  4OID A;  3IU2 A;  4JLY A;  4ZX9 A;  4PK2 A;  3DLJ A;  4JD6 A;  4KUB A;  2CNM A;  1NMT A;  2PRB A;  4BMH A;  1CP7 A;  4A95 A;  3IFE A;  3TLB A;  1IOI A;  2XPN A;  2PSW A;  1TKJ A;  1KEE B;  3BUO B;  3GY9 A;  2HQY A;  1GGO A;  1YLO A;  2P6G A;  3IWG A;  2R82 A;  3N5F A;  4LX9 A;  1BAV A;  2Z3P A;  2C6G A;  3PLF B;  2VKZ G;  4MI4 A;  1WVM A;  3KRV A;  2B5G A;  3KHZ A;  2CTB A;  2Y1N A;  1XMB A;  3BJ8 A;  3PRT A;  1CG2 A;  4M6G A;  8CPA A;  3NFQ A;  2J8R A;  5IX3 A;  3T07 A;  3TTH A;  3T8W A;  1Y9Z A;  1MK4 A;  2B5G B;  4L89 A;  3U88 C;  1Y0R A;  5LYF A;  2O53 A;  1F57 A;  3H8G A;  5A28 A;  4CZ1 A;  4B6Z A;  4UIB A;  2EO8 A;  2RFH A;  4UEE A;  2BO9 A;  5F1Y A;  4B13 A;  4GM5 A;  2QJ8 A;  4UWJ A;  2ZED A;  4DNC A;  3TLZ A;  1AYE A;  5HVF A;  1IGB A;  2PCU A;  5AG7 A;  1ZYM A;  3RNZ A;  2FT0 A;  1LFW A;  1RO5 A;  2QML A;  3TO7 A;  2ZEO A;  3B3T A;  3TLY A;  3ZZI A;  2Z3M A;  3FF3 A;  2OU2 A;  3GKR A;  3KZW A;  5EMI A;  3T5M A;  4CO9 A;  4RI1 A;  2IJZ A;  4C68 A;  4WWV A;  1S7K A;  2GE3 A;  5FVJ A;  1UWY A;  2BL1 A;  2QVP A;  3HUV A;  4KSF A;  2JEV A;  1Z2L A;  4II9 A;  3EZE A;  3WT4 A;  4NGR A;  4MI1 A;  1IB1 E;  1Z9U A;  1XRY A;  3I3G A;  3DR6 A;  2DPT A;  3PBB A;  3KR4 A;  3OP0 A;  2Z10 A;  4A4C A;  2XPP A;  2EK9 A;  3CXP A;  3NA6 A;  2ZPA A;  4IK2 A;  4Y49 C;  3RO0 A;  3S6F A;  4A38 A;  1RXT A;  3WR7 A;  3IGR A;  5A27 A;  4X8I A;  1TF9 A;  4I49 A;  2BSW A;  1Q2D A;  3FVL A;  4AG9 A;  5HMN A;  4C2X A;  4IIX A;  4W9Y A;  1QMU A;  2ZOF A;  1B6B A;  4INJ A;  4MFP A;  2V8G A;  3EIF A;  3BUW B;  4CGO A;  3WC6 A;  5ELY A;  2PQ8 A;  2PE3 A;  2V8V A;  1VI4 A;  2HWG A;  4QBJ A;  5F46 A;  4MCQ A;  2YNC A;  3PB6 X;  4MHN A;  4C7I A;  3BI1 A;  4E0A A;  4TJV A;  1OBR A;  4B5P A;  4MXU A;  3FEE A;  2PIZ A;  4EME A;  3BLN A;  3VRN A;  2PJC A;  1DTD A;  3H4Q A;  5JGF A;  1YGH A;  4B5P B;  3D2M A;  3QAY A;  5C88 A;  3FYN A;  5IB0 A;  2FXF A;  4CPA A;  1KBL A;  2DLA A;  4C9R A;  4A32 A;  3S9N A;  2EK8 A;  1CBX A;  2PR8 A;  3TLG A;  4JVO A;  2ABZ A;  4ONU A;  2REE A;  4XPL A;  2R98 A;  4R7M A;  2EZC A;  3GIU A;  4F0X A;  3WC7 A;  3TLG B;  3TLA A;  2OB0 A;  3T9Y A;  3PB4 X;  3NH4 A;  1Z5R A;  2XPL A;  4IAV A;  1VGY A;  1YR0 A;  4A4B A;  2HV2 A;  2ZW4 A;  3PP9 A;  5LYI A;  4A31 A;  3CXQ A;  5J8F A;  3SJX A;  4R76 A;  1DE4 C;  3TOB A;  3R95 A;  4C86 A;  4Q38 A;  4PXD A;  3O8Z A;  2GLF A;  2GAN A;  2JLM A;  1LRZ A;  3H8F A;  3I6S A;  1YSJ A;  2VZZ A;  2UV8 G;  2Z11 A;  3W91 A;  4CS0 B;  4R3K A;  2DF5 A;  2N3A B;  4CYP A;  1PCA A;  4YN3 A;  4C85 A;  4COG A;  2ZEN A;  4PQA A;  3PB7 X;  4MCS A;  5G22 A;  4UBR A;  3WAB A;  3LMS A;  3FBU A;  4NJR A;  4DYO A;  2Q4Z A;  3S6H A;  3GJZ A;  1JQG A;  2JDD A;  1ELL P;  4Q7A A;  4DJL A;  5HKY A;  1CPS A;  3K4I A;  2WPX A;  4L8A A;  4B10 A;  3ICU A;  4KVX A;  3PFO A;  2POK A;  1YVO A;  4UIA A;  4CYN A;  4C8U A;  2YND A;  2YGW A;  2YJT A;  3ISX A;  4P4B A;  2XEI A;  1EO0 A;  2PVW A;  3ZNI A;  2BUE A;  2P6F A;  4MHD A;  4ZY0 A;  1XF1 A;  1M4D A;  3GYA A;  4FBE A;  2ZEM A;  3PBE A;  4M6I A;  2ATR A;  4EWT A;  3EZB A;  3SJG A;  2HRO A;  1AMP A;  4CGN A;  2Z3O A;  5KTA A;  2F7V A;  3VRP A;  5G20 A;  1KWM A;  1C3O B;  2X0S A;  4KOS A;  4E2A A;  2JDC A;  5EC4 A;  4MY3 A;  1Z8L A;  1X12 A;  4U9Y A;  3VTA A;  4XNH B;  1A9X B;  3LAC A;  1BPM A;  2GIV A;  4NCZ A;  2WUU A;  4AVB A;  1HDQ A;  5KTD A;  2PC1 A;  2C6C A;  4P4F A;  1I12 A;  2FSR A;  4FD4 A;  1OZP A;  2B3V A;  2G3A A;  2ZW5 A;  3D7D A;  2QIR A;  2VEZ A;  4KS9 A;  4NXY A;  1XOV A;  3R9E A;  3GUX A;  2MP0 A;  2WZN A;  1CE8 B;  3RBU A;  2G9D A;  4E5S A;  3QB8 A;  4UFX A;  4GXH A;  5J1Q A;  3IWW A;  3DR8 A;  1JDB C;  1JWQ A;  3KI9 A;  4C9V A;  5HKZ A;  4KOU A;  5F48 A;  4CDK A;  2PJ9 A;  1IYK A;  4H89 A;  3EZA A;  2VZY A;  4KOW A;  3S6G A;  4OC3 A;  2AFX A;  1Q7L A;  1RTQ A;  1ZG8 A;  2VQY A;  2CIJ A;  5HH1 A;  4CYQ A;  4NGS A;  4ZY1 A;  4FWU A;  4B5O A;  1ELM P;  1QSM A;  1Z8W A;  2CF4 A;  4A33 A;  5ISV A;  1MJ9 A;  4FD5 A;  2EVN A;  1BXR B;  2VI7 A;  1R57 A;  1PUA A;  3MRU A;  4OAE A;  5DWM A;  1FT7 A;  3SXO A;  4C8A A;  1XIX A;  2PJ7 A;  4M3S A;  1HEE A;  3R9F A;  4UA3 A;  5DS0 A;  3D7H A;  1S5K A;  2P0W A;  4YWY A;  5BY0 A;  3FIX A;  1S7L A;  4U9Z A;  2GRE A;  2HI6 A;  3T05 A;  2B4J C;  3WC5 A;  1MJA A;  4GS4 A;  4OKO A;  5HVG A;  3SI2 A;  4BD9 A;  2IL4 A;  2DEA A;  4ZY2 A;  3A9L A;  3OB1 B;  1NSA A;  4KUA A;  5K8P A;  5LRG A;  3OAK A;  3PZJ A;  4X3R A;  5JPH A;  1ZO0 A;  4CRZ B;  2AFO A;  4P4D A;  2EZB A;  4OC2 A;  1UFH A;  3JUW A;  3PB8 X;  4KOY A;  4OLL A;  4UEZ A;  1BPN A;  4E94 A;  1XJO A;  2DPS A;  1Q2C A;  1WWZ A;  2WYR A;  4R9M A;  3C8O A;  3QAH A;  3P2F A;  3NH5 A;  4MMO A;  2AJ6 A;  3K2K A;  1S60 A;  1VHS A;  4ZGY B;  2Y1M A;  2NYQ A;  2REF A;  2WPW A;  4MJX A;  1BO4 A;  2PRQ A;  4B12 A;  4M8D A;  3KGQ A;  1ZLI A;  1ZG9 A;  4OP4 A;  4YGO A;  2GLJ A;  5LYD A;  5JH9 A;  4B14 A;  2PJ6 A;  3D3S A;  4AXV A;  4X5K A;  2FE7 A;  2IQ6 A;  2B58 A;  2RB7 A;  2ZW7 A;  2I00 A;  5AG6 A;  5JYB A;  2Y0M A;  2Q04 A;  2V8H A;  4PSX A;  5F49 A;  1HDU A;  3C26 A;  3FED A;  1QST A;  4QC6 A;  4K30 A;  4R6T A;  2Q51 A;  5K8N A;  4F0Y A;  3IJ3 A;  2RC4 A;  3FB3 A;  1SQH A;  3LOD A;  4AVC A;  5FD8 A;  3CZX A;  1ZG7 A;  1Y0Y A;  2OOT A;  3BI0 A;  3MN8 A;  4OAD A;  5G1Z A;  3B7I A;  4F8Z A;  5K99 A;  4LUA A;  4BPW B;  2KCW A;  4JYW A;  2J9A A;  2YJV A;  3PFV A;  1TIQ A;  2B4D A;  3B3V A;  4IF5 A;  4RN7 A;  3I9S A;  2EZA A;  3R96 A;  2B3U A;  1CX8 A;  2ZEH A;  1CJW A;  2B4D B;  4JZ0 A;  2I3C A;  1IY7 A;  2VBQ A;  4ORF A;  4H1H A;  4OC1 A;  4C2Z A;  2I79 A;  1U6M A;  4PV6 A;  4PSW A;  4R8F A;  5D8N A;  4KOT A;  4QB9 A;  2GFQ A;  4JXQ A;  5H84 A;  2R8V A;  1CPX A;  4P4J A;  4UEF A;  2EWB A;  2HC9 A;  4C99 A;  5LYL A;  2F8H A;  3BUX B;  3F8K A;  4C2Y A;  1I1D A;  3FX6 A;  4WJB A;  3B8G A;  4EYS A;  1VBH A;  2OH1 A;  3JVN A;  1Y7R A;  2PCN A;  3D67 A;  1KUV A;  1YRE A;  2Z3N A;  3D2P A;  4MFZ A;  4R3L A;  3DSB A;  5CPA A;  1H8L A;  3IEH A;  5AXI A;  3N7Z A;  3F9K C;  1J4J A;  3OWC A;  1LAN A;  4CRY B;  4TJX A;  4M6H A;  2O28 A;  1GHE A;  2PVV A;  1IYL A;  3BXM A;  5J3X A;  4ZYQ A;  4CYO A;  2C27 A;  4ZI6 A;  4HPS A;  4PXE A;  3KHX A;  4EFD A;  4F6A A;  4NFR A;  2VL1 A;  3FXT A;  4KLV A;  3PEI A;  4UCM A;  4X2T A;  3UY5 A;  4F9V A;  5HXD A;  3EY5 A;  4A2Z A;  1IIC A;  5HVH A;  1NSL A;  1F2P A;  2FIW A;  3VRQ A;  4UCN A;  1K4J A;  2Z3K A;  1EE3 P;  4MFK A;  4NGN A;  1KZF A;  1TKH A;  1ZLH A;  4PXB A;  3VWE A;  3CPX A;  4BBH A;  1R61 A;  1M4L A;  3TT2 A;  5JQ4 A;  2O4H A;  3DDD A;  1IID A;  1S3Z A;  2BEI A;  2CY2 A;  2K5T A;  2PDO A;  2YNC C;  4MBU A;  3JTK A;  2PJ1 A;  1QSO A;  3P2H A;  4PK3 A;  5LRK A;  6CPA A;  2C6P A;  4HNW B;  4IHM A;  2ZXV A;  2AUN A;  3SI1 A;  2Q4Y A;  4MCR A;  4COB A;  1ON0 A;  1VBG A;  4UWI A;  2XEG A;  3D66 A;  4Q36 A;  5E96 A;  3TO6 A;  5K8O A;  2AE6 A;  4H6Z A;  4MFQ A;  5DWN A;  3SHP A;  4BPU B;  2Q7B A;  2ZEG A;  1S7N A;  2NSM A;  2ARH A;  3HLP A;  4C9E A;  3DGV A;  4NGT A;  1CP6 A;  1NE9 A;  4C7H A;  3FJU A;  7CPA A;  5K8M A;  3TLC A;  2YNE A;  3B3W A;  1F2O A;  2C1C A;  1AUG A;  1B47 A;  3SJE A;  1IOF A;  2NMT A;  2AFM A;  3GB0 A;  3IU1 A;  4M85 A;  3IO1 A;  3FEC A;  3H8E A;  1Z9E A;  1VHO A;  2R1I A;  3IIB A;  4ONW A;  4KOR A;  3T90 A;  1Z8X A;  4NGM A;  3I74 A;  1MJB A;  2ZW6 A;  5CNP A;  1Q5X A;  2PR1 A;  3BJ7 A;  4MHY A;  2AFU A;  2PIY A;  4KZT A;  2DXQ A;  3RYO A;  1FY7 A;  2D4P A;  4KSA A;  4P4E A;  4P44 A;  1XFO A;  2QYV A;  5F13 A;  3S6K A;  4MJ8 A;  2XPO A;  1YK3 A;  1EZA A;  1XMT A;  4UF4 A;  2ZEE A;  3MGD A;  4AG7 A;  4LQG A;  3SI0 A;  4KOX A;  4BIN A;  2Q0Y A;  3FH4 A;  3L2N A;  3TOA A;  2P6E A;  1QQ9 A;  2PJ4 A;  3B3S A;  4E8O A;  5JM6 A;  1B87 A;  4C8F A;  4LQ6 A;  3HPG G;  3PT1 A;  1BOB A;  3SR3 A;  4Y49 B;  1YX0 A;  4NJQ A;  2AFZ A;  2HUZ A;  2AFW A;  4TNU A;  3K9T A;  4O23 A;  4CAW A;  1C30 B;  2ODF A;  1M6V B;  4KLW A;  3CXS A;  4YRH A;  2J8N A;  3OB2 B;  2OZU A;  1S7F A;  1VHE A;  2Q43 A;  1KUX A;  3V38 A;  5CBM A;  5AGE A;  4H2K A;  4JXR A;  4XNH C;  4JJX A;  1YW4 A;  2G0B A;  1LCP A;  2G3T A;  1QSN A;  3HPH E;  4MHZ A;  4OC5 A;  1M4I A;  1PYT B;  1LAP A;  4KVO E;  4RUH A;  3D4U A;  4J3G A;  1V6C A;  4MFJ A;  4HNY B;  4TWE A;  5G21 A;  3T0T A;  5BWA B;  5F9M A;  2AFS A;  3FRM A;  2V8D A; 
#chains in the Genus database with same CATH homology
 4A39 A;  3JRU A;  2XEF A;  4G1P A;  3VAR A;  3KQZ A;  3ISZ A;  3RZA A;  2JEW A;  2HB6 A;  4Z65 A;  5IR2 A;  4YU9 A;  4OC4 A;  2PJ0 A;  3I1U A;  4CDJ A;  1R3N A;  4NGQ A;  3CDX A;  4MRI A;  2PJ5 A;  2ZEP A;  2FVG A;  3VH9 A;  1YME A;  3D68 A;  4C9A A;  4C84 A;  2PJ3 A;  4FAI A;  2BOA A;  4C8C A;  3B2Y A;  5F09 A;  3IC1 A;  3NFZ A;  4OME A;  1BLL E;  3GLJ A;  3B35 A;  1XBU A;  4KSI A;  3CT9 A;  4ZX8 A;  2PJA A;  3KR5 A;  2C5Q A;  3B3C A;  3S9M A;  4FUU A;  3RAM A;  4OC0 A;  2BCO A;  4C9U A;  4C8T A;  3LWU A;  2JBK A;  1FNO A;  3NH8 A;  4K3N A;  3V7Z A;  2JBJ A;  3BHX A;  2GP4 A;  1LAM A;  3D7F A;  2PJ8 A;  4P6Y A;  2CTC A;  1YW6 A;  4P4I A;  1VIX A;  3VAT A;  1Y7E A;  3S9L A;  1TF8 A;  2ZEL A;  3KAS A;  5IB9 A;  2GU2 A;  5D29 A;  4KNG E;  3KL9 A;  1LOK A;  4A94 A;  1ARL A;  1R43 A;  3KQX A;  1TKF A;  3CPA A;  4MHP A;  3PB9 X;  2ANP A;  4OIW A;  3SJF A;  4P10 A;  4C8P A;  4NGP A;  5I4M A;  4A37 A;  4P45 A;  4F9U A;  4DUK A;  1GYT A;  3PFE A;  3TX8 A;  3D7G A;  5THW A;  3TC8 A;  3FMC A;  4MCP A;  1TXR A;  4PPZ A;  2PJ2 A;  2IMO A;  2OR4 A;  5LRJ A;  2PJB A;  2ZOG A;  1ARM A;  2V77 A;  3QNV A;  4PXC A;  2ZEF A;  2XEJ A;  4OID A;  4ZX9 A;  3DLJ A;  1CP7 A;  3IFE A;  1TKJ A;  1YLO A;  3N5F A;  1BAV A;  2C6G A;  1WVM A;  3KHZ A;  2CTB A;  8CPA A;  1XMB A;  3PRT A;  1CG2 A;  3T8W A;  1Y9Z A;  1Y0R A;  5LYF A;  2O53 A;  1F57 A;  3H8G A;  4B6Z A;  4UIB A;  2RFH A;  4UEE A;  2BO9 A;  4GM5 A;  2QJ8 A;  2ZED A;  1AYE A;  5HVF A;  1IGB A;  2PCU A;  1LFW A;  2ZEO A;  3B3T A;  3FF3 A;  3KZW A;  2IJZ A;  4WWV A;  1UWY A;  2QVP A;  3HUV A;  1Z2L A;  3WT4 A;  4NGR A;  1XRY A;  3PBB A;  3KR4 A;  2EK9 A;  4IK2 A;  4A38 A;  3NA6 A;  4X8I A;  1TF9 A;  3FVL A;  4W9Y A;  1QMU A;  2ZOF A;  2V8G A;  3EIF A;  3WC6 A;  5ELY A;  2PE3 A;  2V8V A;  4MCQ A;  3PB6 X;  4MHN A;  3BI1 A;  4TJV A;  1OBR A;  4EME A;  4MXU A;  3FEE A;  2PIZ A;  2PJC A;  1DTD A;  5JGF A;  4CPA A;  4C9R A;  3S9N A;  2EK8 A;  1CBX A;  2ABZ A;  4R7M A;  3WC7 A;  3PB4 X;  3NH4 A;  1Z5R A;  4IAV A;  1VGY A;  5LYI A;  3SJX A;  4R76 A;  1DE4 C;  4C86 A;  4PXD A;  2GLF A;  3I6S A;  3H8F A;  1YSJ A;  4YN3 A;  4C85 A;  1PCA A;  2ZEN A;  4PQA A;  3PB7 X;  4MCS A;  3WAB A;  3LMS A;  4NJR A;  4DYO A;  2Q4Z A;  1JQG A;  1ELL P;  4Q7A A;  4DJL A;  1CPS A;  3ICU A;  3PFO A;  2POK A;  4UIA A;  4C8U A;  3ISX A;  4P4B A;  2XEI A;  2PVW A;  4ZY0 A;  1XF1 A;  4FBE A;  2ZEM A;  3PBE A;  4EWT A;  3SJG A;  1AMP A;  2F7V A;  1KWM A;  1Z8L A;  3VTA A;  1BPM A;  1HDQ A;  2C6C A;  4P4F A;  3D7D A;  3GUX A;  2WZN A;  3RBU A;  2G9D A;  5J1Q A;  3IWW A;  3KI9 A;  4C9V A;  4CDK A;  2PJ9 A;  4OC3 A;  2AFX A;  1Q7L A;  1RTQ A;  1ZG8 A;  2CIJ A;  4NGS A;  4ZY1 A;  4FWU A;  1ELM P;  2CF4 A;  3MRU A;  1FT7 A;  4C8A A;  2PJ7 A;  1HEE A;  5DS0 A;  3D7H A;  4YWY A;  2GRE A;  3WC5 A;  4OKO A;  5HVG A;  3SI2 A;  4BD9 A;  2DEA A;  4ZY2 A;  1NSA A;  5K8P A;  5LRG A;  4X3R A;  2AFO A;  4P4D A;  4OC2 A;  3PB8 X;  4UEZ A;  1BPN A;  1XJO A;  2WYR A;  4MMO A;  3NH5 A;  3K2K A;  2NYQ A;  2PRQ A;  3KGQ A;  1ZLI A;  1ZG9 A;  4OP4 A;  5LYD A;  2GLJ A;  5JH9 A;  2PJ6 A;  4AXV A;  2IQ6 A;  2RB7 A;  2V8H A;  1HDU A;  3FED A;  5K8N A;  4R6T A;  2Q51 A;  3IJ3 A;  3MN8 A;  1ZG7 A;  1Y0Y A;  2OOT A;  3BI0 A;  4F8Z A;  3B7I A;  4JYW A;  2J9A A;  3B3V A;  1CX8 A;  2ZEH A;  4JZ0 A;  2I3C A;  1IY7 A;  4OC1 A;  4R8F A;  5D8N A;  1CPX A;  4P4J A;  4UEF A;  2EWB A;  2HC9 A;  4C99 A;  5LYL A;  2F8H A;  3FX6 A;  4WJB A;  3D67 A;  5CPA A;  1H8L A;  3IEH A;  4TJX A;  1LAN A;  2PVV A;  3BXM A;  4ZYQ A;  4ZI6 A;  4PXE A;  3KHX A;  4EFD A;  4NFR A;  2VL1 A;  4X2T A;  4F9V A;  3PEI A;  5HXD A;  5HVH A;  1F2P A;  1EE3 P;  4NGN A;  1TKH A;  1ZLH A;  4PXB A;  3CPX A;  1M4L A;  2O4H A;  2PJ1 A;  5LRK A;  6CPA A;  2C6P A;  4IHM A;  3SI1 A;  4MCR A;  2XEG A;  3D66 A;  5K8O A;  2ZEG A;  4C9E A;  2NSM A;  3HLP A;  3DGV A;  4NGT A;  1CP6 A;  5K8M A;  3FJU A;  7CPA A;  3B3W A;  1F2O A;  2C1C A;  3SJE A;  2AFM A;  3GB0 A;  3IO1 A;  3H8E A;  3FEC A;  3IIB A;  1VHO A;  4ONW A;  4NGM A;  3I74 A;  4MHY A;  2AFU A;  2PIY A;  4P4E A;  4P44 A;  1XFO A;  2QYV A;  4UF4 A;  2ZEE A;  4LQG A;  3SI0 A;  3FH4 A;  3L2N A;  5JM6 A;  1QQ9 A;  2PJ4 A;  3B3S A;  4C8F A;  4NJQ A;  2AFZ A;  2AFW A;  4TNU A;  3K9T A;  4O23 A;  3V38 A;  1VHE A;  5CBM A;  2Q43 A;  4H2K A;  1YW4 A;  1LCP A;  4MHZ A;  4OC5 A;  1PYT B;  1LAP A;  4RUH A;  1V6C A;  3D4U A;  4TWE A;  2AFS A;  2V8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...