1Z8LA

Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
695
structure length
695
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase II
total genus 201
structure length 695
sequence length 695
chains with identical sequence B, C, D
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 1z8lA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1z8lA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 1z8lA02
3S9NA 4UIBA 1LAMA 2QYVA 2PJ8A 4OIWA 3KHXA 2PE3A 1CX8A 4DJLA 2AFXA 1YMEA 2POKA 1AYEA 4NGTA 3HLPA 2PIZA 2PCUA 4OC0A 3HUVA 2ZEMA 3B3VA 2Q51A 1Y9ZA 4KNGE 4C9VA 3KZWA 4IAVA 4MCRA 5LRGA 3MRUA 4OP4A 4C9AA 2WYRA 4OMEA 2OR4A 2CTBA 3CT9A 3KR4A 2ZEGA 4K3NA 3B3TA 3B3WA 4MMOA 1IGBA 2ZELA 1XFOA 3FVLA 4P6YA 4OC5A 2GU2A 2I3CA 2ZEHA 4OIDA 4NGPA 3ISZA 1GYTA 4EFDA 1TKFA 3PBEA 5I4MA 4C8PA 1LAPA 1HDUA 4P4IA 3T8WA 5D29A 4C9EA 3WC7A 3I6SA 4P4DA 1YSJA 1YW6A 2Q4ZA 1CP7A 3IO1A 4OKOA 3VARA 4ZY0A 1R3NA 2F8HA 3D7FA 3TX8A 1HDQA 4C86A 1Y0RA 6CPAA 1ARLA 3QNVA 4MCSA 3RZAA 2C6GA 5K8PA 4UF4A 3IWWA 4P4JA 2GLFA 2C6CA 2HB6A 3FEDA 4UEZA 3BHXA 4JYWA 2V8DA 1Y0YA 4P10A 4YN3A 4PQAA 5HVFA 4X3RA 4DYOA 1QQ9A 3FF3A 5LYFA 1BPMA 4ZI6A 2PJ7A 3NFZA 4IHMA 1BAVA 1VHEA 1LCPA 3PRTA 1Q7LA 1FT7A 3RAMA 5LRJA 4WJBA 3KHZA 4ZY2A 2ZENA 1NSAA 5F09A 1UWYA 2PJ3A 1M4LA 4PPZA 5JGFA 4PXEA 2V8HA 4C9UA 1TF8A 2JBKA 4NJQA 4H2KA 2WZNA 4B6ZA 2JBJA 3D68A 8CPAA 4F8ZA 4X2TA 4TJXA 4C8FA 3WC6A 4PXDA 1RTQA 4MXUA 4UEEA 1V6CA 3CPXA 3PFEA 2JEWA 2CTCA 2O53A 3VATA 3WT4A 4R76A 1YLOA 4C8TA 3SI1A 2QVPA 4GM5A 5J1QA 3D66A 2F7VA 1Z5RA 1LOKA 2BCOA 5LRKA 2PJ5A 4JZ0A 3PB8X 1KWMA 3B3SA 1ELLP 3IFEA 3D7HA 4PXBA 4A37A 4YWYA 4MHYA 3H8GA 1TKHA 4CPAA 3SI0A 4OC1A 3D7GA 3S9LA 2GLJA 2EWBA 4ZYQA 3LWUA 1FNOA 3CDXA 3NH4A 3SJEA 4O23A 4C8CA 3PB4X 3KQXA 2PJBA 2PJAA 1PYTB 2ZEOA 2CF4A 2PIYA 2Q43A 2AFZA 2G9DA 3D7DA 3NA6A 2PVVA 2CIJA 2FVGA 4KSIA 1LFWA 5JH9A 1ZLIA 4P4BA 2V8GA 5HXDA 5LYDA 3KR5A 4G1PA 4EWTA 2J9AA 4A94A 4C84A 3WC5A 4NGQA 4UIAA 1WVMA 4Z65A 4ZX8A 2GREA 4DUKA 3FJUA 1H8LA 1XMBA 4ZY1A 3KQZA 3LMSA 1XBUA 2EK9A 4C85A 3FEEA 1Z8LA 2NYQA 1EE3P 3CPAA 1CG2A 1Z2LA 4FAIA 4FUUA 3SJGA 5CBMA 3BXMA 4NGSA 4TJVA 2XEFA 2O4HA 2PJ4A 3PBBA 3TC8A 2OOTA 4PXCA 3EIFA 2ZOFA 3S9MA 2PRQA 3K2KA 4MHNA 3I1UA 1ZG8A 3K9TA 4ZX9A 3SJFA 1VGYA 4WWVA 7CPAA 3H8EA 4A39A 2NSMA 1TF9A 3PB6X 4P4EA 2PVWA 4CDKA 3FMCA 5JM6A 2C6PA 2VL1A 3MN8A 4TWEA 3D67A 1ZG9A 5THWA 4OC4A 2AFSA 4R7MA 4C99A 3PB7X 3NH5A 3VH9A 4UEFA 3DGVA 3SJXA 3N5FA 5IB9A 3B35A 3NH8A 4NGRA 1CBXA 4ONWA 3H8FA 5K8NA 2PJ2A 3V7ZA 3ISXA 1DTDA 4P44A 1ZLHA 1VHOA 4R8FA 1ARMA 1ZG7A 1LANA 3DLJA 3FECA 3RBUA 2IMOA 1CP6A 1F2OA 2RB7A 2XEGA 4A38A 2V8VA 4C8AA 1HEEA 2C1CA 2RFHA 3IC1A 1DE4C 5D8NA 1Y7EA 4FBEA 2QJ8A 3FH4A 3BI0A 1QMUA 3KASA 2ABZA 2XEIA 2AFMA 2IJZA 3GB0A 3IJ3A 4OC2A 5K8OA 4BD9A 4MHPA 2AFOA 4MCPA 2AFUA 4AXVA 5HVHA 3KI9A 4OC3A 1F57A 1VIXA 4EMEA 1TKJA 4P4FA 4C8UA 3IEHA 4NGMA 2AFWA 3L2NA 4RUHA 3B7IA 3IIBA 4C9RA 1YW4A 3B2YA 1XRYA 1XJOA 2BOAA 1BPNA 3PFOA 3V38A 5ELYA 4NGNA 1R43A 4CDJA 1IY7A 1CPSA 2ZEEA 4X8IA 5CPAA 1OBRA 5K8MA 2HC9A 3WABA 3JRUA 2PJCA 2XEJA 4FWUA 1AMPA 3GUXA 4IK2A 1TXRA 1ELMP 1PCAA 4F9UA 3ICUA 4F9VA 3SI2A 3B3CA 5LYIA 2PJ0A 3BI1A 2EK8A 2V77A 5LYLA 1CPXA 4W9YA 2ZOGA 2PJ9A 2ZEPA 3PB9X 4R6TA 5HVGA 1F2PA 3D4UA 2IQ6A 3PEIA 4MCQA 1BLLE 2PJ1A 3GLJA 1JQGA 4TNUA 2DEAA 2ZEFA 4MHZA 4MRIA 4P45A 2ANPA 3VTAA 3FX6A 4Q7AA 1XF1A 4NJRA 2PJ6A 2ZEDA 3KL9A 3I74A 2BO9A 4YU9A 5DS0A 3KGQA 4NFRA 4LQGA
chains in the Genus database with same CATH superfamily
3S9NA 2EUIA 4CRZB 4COGA 4UIBA 1LAMA 2QYVA 3FRMA 4J3GA 2PJ8A 4OIWA 2FL4A 3KHXA 2PE3A 4R3LA 1M4GA 1CX8A 2EO8A 2AFXA 1YMEA 2POKA 2QMLA 4DJLA 1AYEA 1YVHA 1S7LA 2N3AB 4UWJA 4NGTA 3EFAA 4H6UA 4MY3A 3HLPA 1X10A 2G3TA 2PIZA 2PCUA 3TTHA 4OC0A 2B4JC 1M4IA 1PUAA 3HUVA 4UCMA 2P0WA 1NXJA 2ZEMA 1MK4A 2Q44A 3B3VA 3QAYA 2Q51A 4KS9A 4NSQA 3TOBA 1Y9ZA 4J0NA 4UCNA 4KNGE 2JLMA 2WPXA 1N71A 4C9VA 1GHEA 4H1HA 3KZWA 2Y1MA 3GJZA 3PGPA 1IOIA 4IAVA 4MCRA 2Z3PA 1YVOA 2VZYA 3JTKA 3MRUA 4OP4A 5LRGA 4M6GA 4JWPA 2OH1A 4OMEA 2WYRA 3WR7A 4AB7A 2OR4A 5A28A 3N7ZA 2CTBA 3CT9A 4CAVA 3KR4A 1XIXA 3TLGA 2CNSA 2ZEGA 4K3NA 4IIXA 3B3TA 3B3WA 3FBUA 4MMOA 1IGBA 4XNHC 2ZELA 1XFOA 5G22A 3TO9A 4LQ6A 3NOJA 1A2ZA 2CNTA 3FVLA 4P6YA 4OC5A 2GU2A 1ZL0A 2I3CA 1M4DA 2ZEHA 2OZUA 4OIDA 2R8VA 1CE8B 4NGPA 1FBVA 2Q4VA 3ISZA 1GYTA 2FT0A 4A4BA 4H89A 1QSMA 4EFDA 5JYBA 1TKFA 3FXTA 2A4NA 3IGRA 3PBEA 5I4MA 1IU8A 4U5YA 2J8NA 4II9A 4RI1A 3DSBA 3VROA 1OZPA 1VKCA 1QSRA 4C8PA 4LX9A 1LAPA 4UCPA 1HDUA 1V0CA 3IWEA 4DNCA 5IX3A 4P4IA 3T8WA 5D29A 2EZCA 1IIDA 4C7HA 1I1DA 4F0XA 4ZGYB 4C9EA 3WC7A 3I6SA 4P4DA 3TLBA 1YSJA 4B5OA 1YW6A 3TOAA 1Y9KA 4Q36A 2FM4A 2Q4ZA 1CP7A 3IO1A 4HNXB 4OKOA 3TCVA 3VARA 4AVBA 4ZY0A 4BTFA 2OLSA 1B87A 1R3NA 2F8HA 3D7FA 4BMHA 3TX8A 1HDQA 2J8RA 4Q38A 5HH1A 4C86A 1Y0RA 4B10A 6CPAA 1ARLA 2UV8G 3QNVA 4MCSA 3DDDA 3RZAA 5IB0A 3ZJ0A 1IYLA 3P2HA 5IV0A 2GP4A 2C6GA 4OAEA 4E2AA 4MFJA 3TE4A 5K8PA 5AG6A 4UF4A 5C82A 1IYKA 3IWWA 3CXSA 2G0BA 4P4JA 2GLFA 4KVOE 5H86A 4C68A 3TLCA 2C6CA 4B12A 2HB6A 3FEDA 2ATRA 2AE6A 5JQ4A 4JD6A 4UEZA 2C27A 3BHXA 3OP0A 4JYWA 2V8DA 3BJ8A 5J8CA 4LUAA 1Y0YA 4P10A 2FE7A 4YN3A 2R7HA 3T0TA 4PQAA 5DWMA 5HVFA 4CGPA 4X3RA 3QAHA 4QUSA 4DYOA 1WK4A 4M6IA 1XMTA 2NMTA 4BBHA 2PDOA 2GFQA 2P6FA 2REFA 1A9XB 2VZZA 1QQ9A 3P2FA 3FF3A 5HKYA 4JLYA 1BPMA 4ZI6A 5K8OA 5LYFA 2R82A 5G21A 2PJ7A 1XEBA 1J3LA 5A27A 3NFZA 4IHMA 4F6AA 1BAVA 3RNZA 1LRZA 1VHEA 2YNEA 1LCPA 3D2PA 3PRTA 3A9LA 1Q7LA 1FT7A 3BUMB 3RAMA 5LRJA 4WJBA 4XNHB 1S7FA 5G1ZA 5CNPA 4ORFA 1NBWA 3KHZA 1IB1E 1CS0B 4MI4A 4ZY2A 2D4PA 5F1YA 3R9FA 2ZENA 3PT1A 4RR2B 5F09A 1NSAA 1UWYA 2DPTA 3RYOA 2GANA 2PJ3A 1M4LA 4JJXA 2K5TA 1Q2YA 4PPZA 3U1BA 2FXFA 2ZW5A 2ZW4A 5JGFA 1IOFA 3OB1B 4ZBGA 4E8OA 4PXEA 2V8HA 3W91A 1Z8WA 4C9UA 4HPSA 2AUMA 1TF8A 1Z8XA 2JBKA 2GIVA 2REEA 4NJQA 4H2KA 4CYOA 1Y7RA 3OB2B 3TT2A 2YJTA 4PK3A 3VRQA 3FNCA 2X0SA 2WZNA 4B6ZA 4CAWA 2Z3KA 2HQYA 2JBJA 2WUUA 3D68A 3HMJG 2B0AA 8CPAA 4F8ZA 2P6EA 4X2TA 4YRHA 3FIXA 2DF5A 2HV2A 2R98A 4TJXA 3ZNIA 2FIWA 2PCNA 4C8FA 3EZAA 4QB9A 5H84A 2Q7SA 4KOTA 2Q0YA 4PXDA 1RTQA 4MXUA 4UEEA 3WC6A 1V6CA 3CPXA 3PFEA 4YGOA 3T05A 3IU2A 5F46A 2JEWA 2CTCA 2O53A 4M85A 3VATA 3WT4A 2IL4A 4B13A 4C7IA 4R76A 1YLOA 4C8TA 2VEZA 3SI1A 1YREA 4MI1A 5FD8A 3KKWA 2QVPA 1FY7A 3CXQA 4GM5A 4KSFA 3D66A 4R3KA 4A30A 5J1QA 1DIKA 2F7VA 1Z5RA 1LOKA 2BCOA 3I9SA 5LRKA 2BL1A 2PJ5A 5KTAA 4FD6A 2WSAA 2Z11A 3E0KA 4JZ0A 3PB8X 1BO4A 1KWMA 1ELLP 3B3SA 3IFEA 1K4JA 4QVTA 2FSRA 4UFXA 3EXNA 1WJTA 3D7HA 4PXBA 1YK3A 3C26A 4IUSA 4YWYA 4A37A 5K99A 4MHYA 4RN7A 1UFHA 3T07A 3H8GA 2AUNA 1TKHA 4CPAA 3SI0A 3EO4A 5ISVA 4OC1A 3D7GA 4ONUA 1S60A 3S9LA 2GLJA 2GE3A 3I3GA 3VRNA 2EWBA 1WWZA 4ZYQA 3LWUA 5G20A 4KOUA 4BPXB 4MHDA 2QECA 1FNOA 3CDXA 2JDCA 3NH4A 4CGOA 1M6VB 2OZGA 3JUWA 4KLWA 3NE8A 1VBGA 3NFQA 4B11A 3CXPA 3SJEA 3H4QA 4CYNA 4O23A 4JXQA 2D4OA 3PB4X 4C8CA 3PP9A 3KQXA 3W6XA 1YVKA 2PJBA 1Y9WA 4B5PB 2PJAA 1L0CA 4KOYA 4MBUA 1PYTB 1J4JA 2B4BA 2ZEOA 3FYNA 4GS4A 2CF4A 1ZRSA 3C8OA 3BUNB 4A4CA 1EO0A 4IF5A 5C88A 3PZJA 3KRVA 2PIYA 2CNMA 2Q43A 2AFZA 2X7BA 1AUGA 5AXIA 1I12A 2G9DA 4AG9A 3D7DA 3NA6A 2B5GB 2PVVA 2CIJA 2FVGA 4KSIA 4R9MA 3K4IA 2ZW6A 3TLAA 1Q2CA 1LFWA 2Q4YA 4CAEA 1ZLIA 3BUXB 4P4BA 2V8GA 5JH9A 5HXDA 4CGMA 3EC4A 5E96A 5LYDA 5AGEA 3KR5A 4G1PA 4NXYA 3VGOA 1KUVA 4EWTA 2J9AA 2YNCA 4A94A 2CXAA 1YGHA 5EC4A 2CY2A 2BSWA 3G8WA 3WC5A 4C84A 4NGQA 4UIAA 1XOVA 4NCZA 1Q5XA 4MFKA 1WVMA 4Z65A 4ZX8A 4A33A 2GREA 4DUKA 2XPPA 1H8LA 1NE9A 1XMBA 3FJUA 3KQZA 4ZY1A 3LMSA 1XBUA 1SQHA 1YX0A 3OWCA 5J3XA 1MJ9A 2EK9A 2FS5A 4C85A 3FEEA 3R95A 1GGOA 3R9EA 1Z8LA 2NYQA 3JVNA 1EE3P 3VWEA 2Q7BA 2B3UA 2YNCC 4X5KA 2FCKA 4KOWA 5AG4A 3CPAA 2CBLA 1CG2A 5JVLA 1XE4A 1Z2LA 2AJ6A 4FAIA 4FUUA 1P4NA 3SJGA 3IU1A 5CBMA 3BXMA 4NGSA 3GY9A 3LACA 4XPLA 4TJVA 2XEFA 1VHSA 2O4HA 4E94A 4H6ZA 1M44A 2PJ4A 1Z9EA 3PBBA 3TC8A 4F0YA 2OOTA 3VRRA 4PXCA 4CRYB 2JEVA 1C30B 1RO5A 2VI7A 2VBQA 3EIFA 3D3SA 2ZOFA 3S9MA 2PRQA 3TLGB 4MFPA 3K2KA 4MHNA 3I1UA 5EBVA 1ZG8A 3K9TA 4ZX9A 3SJFA 4I49A 1VGYA 4KORA 4WWVA 7CPAA 5HMNA 3H8EA 4A39A 1B6BA 1S7NA 2NSMA 3BLNA 3MGDA 1TF9A 2XPOA 1ON0A 1Z9UA 3PB6X 4P4EA 3DR8A 5AG5A 4AVAA 4CAFA 2PVWA 2H5MA 4CDKA 4R87A 2PQ8A 2Z10A 3FMCA 5JM6A 1KC7A 2C6PA 2VL1A 4B5PA 2XPNA 3MN8A 1BXRB 5J8FA 4BINA 4TWEA 3F8KA 3D67A 1ZG9A 4XPDB 5THWA 2OB0A 3IWGA 4NEXA 2Y0MA 4OC4A 2AFSA 4R7MA 3V8IA 4OADA 3SXNA 4C99A 3PB7X 4KOVA 5IR2A 3NH5A 4XPDC 3VH9A 4UEFA 4QBJA 3SR3A 4K30A 2Z3MA 3DGVA 2MP0A 4E5SA 2DPSA 3SJXA 3BJ7A 3N5FA 4UFVA 1U6MA 4Y49C 5IB9A 3T9YA 3B35A 5JPHA 3LODA 3NH8A 4CZ1A 3S6KA 4NGRA 4KZTA 1CBXA 2B3VA 2F5IA 4ONWA 4EYSA 3H8FA 5K8NA 2PJ2A 3QB8A 1JWQA 2B4DB 2EBJA 3V7ZA 3ISXA 4C2ZA 1Z4EA 1DTDA 3R1KA 4P44A 1ZYMA 5HKZA 1YLEA 1ZLHA 1VHOA 2HUZA 4MY0A 1ARMA 1ZG7A 4R8FA 1LANA 3DLJA 3FECA 3GKRA 2P6GA 2VXKA 3RBUA 2IMOA 1CP6A 4MFZA 1NMTA 5EMIA 3TLYA 3NE7A 1F2OA 1S7KA 2RB7A 2XEGA 4GXHA 4HKFA 3R96A 1EZAA 5BWAB 1YQEA 4A38A 4KOXA 2V8VA 4KVME 4C8AA 1HEEA 2VQYA 2YJVA 2C1CA 2RFHA 3IC1A 1DE4C 5GCNA 2C5QA 5D8NA 1Y7EA 4CO9A 4CS0B 4FBEA 2RC4A 2QJ8A 2WPWA 3FH4A 3BI0A 4OLLA 1QMUA 3KASA 3D8PA 4M8DA 2BEIA 2ABZA 2XEIA 3EZEA 2AFMA 1KUXA 2IJZA 5I0CA 4MJXA 5F49A 3GB0A 3IJ3A 3TO7A 1ZO0A 1QSTA 1YR0A 4OC2A 2VKZG 2KCWA 4KVXA 3F5BA 2AFOA 4MHPA 4BD9A 1VI4A 2PR1A 4MCPA 4EVYA 2AFUA 5F48A 4XPKA 2HWGA 3R9GA 1R61A 4M6HA 4AXVA 5HVHA 3G3SA 4BPUB 4UWIA 3KI9A 4KLVA 1JDBC 3RO0A 5BY0A 4OC3A 1F57A 3UY5A 1VIXA 1EZBA 3TLZA 3S6HA 4EMEA 1TKJA 5KTDA 4P4FA 2B58A 2OZHA 4M3SA 4HNYB 2D0OA 4C8UA 3IEHA 4CGNA 4NGMA 2B4DA 2AFWA 2OU2A 4MFQA 4CAXA 3GIUA 3G23A 4JVOA 3L2NA 4MJ8A 3B7IA 4RUHA 2BUEA 4FD5A 3IIBA 2Z3LA 4B14A 3O8ZA 1YW4A 2HI6A 4C9RA 4YFJA 4CYPA 1Z8TA 2PRBA 3B2YA 4R57A 2EZAA 5F13A 1XRYA 4PSWA 3TFYA 3HPGG 1M1DA 1XJOA 5F47A 4FD7A 1B47A 2BOAA 1BPNA 3SXOA 3EZBA 4A95A 2XPLA 3PFOA 3V38A 4A32A 5FVJA 3T90A 4PSXA 4AG7A 3VWDA 5ELYA 2Y1NA 3S6GA 4NGNA 2JDDA 1BOBA 1R43A 1KEEB 4PV6A 4CDJA 1IY7A 2O28A 4KUBA 1CPSA 2ZEEA 4X8IA 5CPAA 4C2XA 2QIRA 1NSLA 1OBRA 1S5KA 4UA3A 3F9KC 1JDEA 5K8MA 3BUWB 4KUAA 2HC9A 3CZXA 3K9UA 4L89A 2YNDA 3WABA 3ZZIA 2G3AA 1QSNA 5F5XA 1KBLA 1MJAA 2D0PA 2E28A 2ODFA 1CJWA 3JRUA 2DLAA 2PJCA 2XEJA 1IICA 3D2MA 3PFVA 1AMPA 3GUXA 4FWUA 4KOSA 4U9ZA 1KZFA 2I79A 3BUOB 1TXRA 3F0AA 4IK2A 3TLEA 1ELMP 1PCAA 4F9UA 1XF8A 3TO6A 2HROA 4MFLA 3ICUA 4CGLA 2PSWA 3T5MA 4F9VA 3SI2A 3B3CA 4GPLB 1Z4RA 2Z0ZA 1MJBA 5LYIA 1PU9A 1I21A 2PJ0A 3BI1A 3DNSA 2EK8A 2V77A 1S3ZA 3B8GA 4L8AA 4A31A 5LYLA 1R57A 4C9AA 1CPXA 2ZPAA 4BPWB 4W9YA 3W6SA 2ZOGA 4UBRA 5KTCA 1C3OB 1RXTA 2PJ9A 2ZEPA 3PB9X 4CYQA 4IIYA 4INJA 2Z3NA 4RS2A 4R6TA 5HVGA 2I00A 4PK2A 1F2PA 1QSOA 4AVCA 2ZXVA 4E0AA 2ZW7A 3D4UA 1CM0A 2DXQA 2IQ6A 3PEIA 4MCQA 1BLLE 4JXRA 4A2ZA 1Q2DA 1T36B 2J8MA 2PJ1A 4U9YA 3GLJA 4C2YA 1JQGA 4TNUA 2DEAA 2ZEFA 3DR6A 2PC1A 3SHPA 2Q04A 3EY5A 3GYAA 1KUYA 4MHZA 4MRIA 4P45A 2ANPA 1P0HA 2YGWA 3FX6A 3H5ZA 4Q7AA 3VTAA 3OAKA 2ARHA 2EVNA 4KSAA 1XF1A 3LD2A 4FD4A 3S6FA 1VBHA 3TYXA 3U88C 3VRPA 4NJRA 2PJ6A 2DIKA 3PLFB 4Y49B 1X12A 2ZEDA 3KL9A 3FB3A 3I74A 2BO9A 5AG7A 2EZBA 2PR8A 4COBA 4YU9A 5DS0A 2B5GA 4HNWB 4NF1A 4QC6A 2FIAA 3HPHE 5HKWA 4UFWA 2R1IA 5F9MA 1TIQA 3KGQA 2Z3OA 4NFRA 5DWNA 4LQGA
chains in the Genus database with same CATH topology
3S9NA 4UIBA 1LAMA 2QYVA 2PJ8A 4OIWA 3KHXA 2PE3A 1CX8A 4DJLA 2AFXA 1YMEA 2POKA 1AYEA 4NGTA 3HLPA 2PIZA 2PCUA 4OC0A 3HUVA 2ZEMA 3B3VA 2Q51A 1Y9ZA 4KNGE 4C9VA 3KZWA 4IAVA 4MCRA 5LRGA 3MRUA 4OP4A 4C9AA 2WYRA 4OMEA 2OR4A 2CTBA 3CT9A 3KR4A 2ZEGA 4K3NA 3B3TA 3B3WA 4MMOA 1IGBA 2ZELA 1XFOA 3FVLA 4P6YA 4OC5A 2GU2A 2I3CA 2ZEHA 4OIDA 4NGPA 3ISZA 1GYTA 4EFDA 1TKFA 3PBEA 5I4MA 4C8PA 1LAPA 1HDUA 4P4IA 3T8WA 5D29A 4C9EA 3WC7A 3I6SA 4P4DA 1YSJA 1YW6A 2Q4ZA 1CP7A 3IO1A 4OKOA 3VARA 4ZY0A 1R3NA 2F8HA 3D7FA 3TX8A 1HDQA 4C86A 1Y0RA 6CPAA 1ARLA 3QNVA 4MCSA 3RZAA 2GP4A 2C6GA 5K8PA 4UF4A 3IWWA 4P4JA 2GLFA 2C6CA 2HB6A 3FEDA 4UEZA 3BHXA 4JYWA 2V8DA 1Y0YA 4P10A 4YN3A 4PQAA 5HVFA 4X3RA 4DYOA 1QQ9A 3FF3A 5LYFA 1BPMA 4ZI6A 2PJ7A 3NFZA 4IHMA 1BAVA 1VHEA 1LCPA 3PRTA 1Q7LA 1FT7A 3RAMA 5LRJA 4WJBA 3KHZA 4ZY2A 2ZENA 1NSAA 5F09A 1UWYA 2PJ3A 1M4LA 4PPZA 5JGFA 4PXEA 2V8HA 4C9UA 1TF8A 2JBKA 4NJQA 4H2KA 2WZNA 4B6ZA 2JBJA 3D68A 8CPAA 4F8ZA 4X2TA 4TJXA 4C8FA 3WC6A 4PXDA 1RTQA 4MXUA 4UEEA 1V6CA 3CPXA 3PFEA 2JEWA 2CTCA 2O53A 3VATA 3WT4A 4R76A 1YLOA 4C8TA 3SI1A 2QVPA 4GM5A 5J1QA 3D66A 2F7VA 1Z5RA 1LOKA 2BCOA 5LRKA 2PJ5A 4JZ0A 3PB8X 1KWMA 3B3SA 1ELLP 3IFEA 3D7HA 4PXBA 4A37A 4YWYA 4MHYA 3H8GA 1TKHA 4CPAA 3SI0A 4OC1A 3D7GA 3S9LA 2GLJA 2EWBA 4ZYQA 3LWUA 1FNOA 3CDXA 3NH4A 3SJEA 4O23A 4C8CA 3PB4X 3KQXA 2PJBA 2PJAA 1PYTB 2ZEOA 2CF4A 2PIYA 2Q43A 2AFZA 2G9DA 3D7DA 3NA6A 2PVVA 2CIJA 2FVGA 4KSIA 1LFWA 5JH9A 1ZLIA 4P4BA 2V8GA 5HXDA 5LYDA 3KR5A 4G1PA 4EWTA 2J9AA 4A94A 4C84A 3WC5A 4NGQA 4UIAA 1WVMA 4Z65A 4ZX8A 2GREA 4DUKA 3FJUA 1H8LA 1XMBA 4ZY1A 3KQZA 3LMSA 1XBUA 2EK9A 4C85A 3FEEA 1Z8LA 2NYQA 1EE3P 3CPAA 1CG2A 1Z2LA 4FAIA 4FUUA 3SJGA 5CBMA 3BXMA 4NGSA 4TJVA 2XEFA 2O4HA 2PJ4A 3PBBA 3TC8A 2OOTA 4PXCA 3EIFA 2ZOFA 3S9MA 2PRQA 3K2KA 4MHNA 3I1UA 1ZG8A 3K9TA 4ZX9A 3SJFA 1VGYA 4WWVA 7CPAA 3H8EA 4A39A 2NSMA 1TF9A 3PB6X 4P4EA 2PVWA 4CDKA 3FMCA 5JM6A 2C6PA 2VL1A 3MN8A 4TWEA 3D67A 1ZG9A 5THWA 4OC4A 2AFSA 4R7MA 4C99A 3PB7X 5IR2A 3NH5A 3VH9A 4UEFA 3DGVA 3SJXA 3N5FA 5IB9A 3B35A 3NH8A 4NGRA 1CBXA 4ONWA 3H8FA 5K8NA 2PJ2A 3V7ZA 3ISXA 1DTDA 4P44A 1ZLHA 1VHOA 4R8FA 1ARMA 1ZG7A 1LANA 3DLJA 3FECA 3RBUA 2IMOA 1CP6A 1F2OA 2RB7A 2XEGA 4A38A 2V8VA 4C8AA 1HEEA 2C1CA 2RFHA 3IC1A 1DE4C 2C5QA 5D8NA 1Y7EA 4FBEA 2QJ8A 3FH4A 3BI0A 1QMUA 3KASA 2ABZA 2XEIA 2AFMA 2IJZA 3GB0A 3IJ3A 4OC2A 5K8OA 4BD9A 4MHPA 2AFOA 4MCPA 2AFUA 4AXVA 5HVHA 3KI9A 4OC3A 1F57A 1VIXA 4EMEA 1TKJA 4P4FA 4C8UA 3IEHA 4NGMA 2AFWA 3L2NA 4RUHA 3B7IA 3IIBA 4C9RA 1YW4A 3B2YA 1XRYA 1XJOA 2BOAA 1BPNA 3PFOA 3V38A 5ELYA 4NGNA 1R43A 4CDJA 1IY7A 1CPSA 2ZEEA 4X8IA 5CPAA 1OBRA 5K8MA 2HC9A 3WABA 3JRUA 2PJCA 2XEJA 4FWUA 1AMPA 3GUXA 4IK2A 1TXRA 1ELMP 1PCAA 4F9UA 3ICUA 4F9VA 3SI2A 3B3CA 5LYIA 2PJ0A 3BI1A 2EK8A 2V77A 5LYLA 1CPXA 4W9YA 2ZOGA 2PJ9A 2ZEPA 3PB9X 4R6TA 5HVGA 1F2PA 3D4UA 2IQ6A 3PEIA 4MCQA 1BLLE 2PJ1A 3GLJA 1JQGA 4TNUA 2DEAA 2ZEFA 4MHZA 4MRIA 4P45A 2ANPA 3VTAA 3FX6A 4Q7AA 1XF1A 4NJRA 2PJ6A 2ZEDA 3KL9A 3I74A 2BO9A 4YU9A 5DS0A 3KGQA 4NFRA 4LQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9N A;  4UIB A;  1LAM A;  2QYV A;  2PJ8 A;  4OIW A;  3KHX A;  2PE3 A;  1CX8 A;  4DJL A;  2AFX A;  1YME A;  2POK A;  1AYE A;  4NGT A;  3HLP A;  2PIZ A;  2PCU A;  4OC0 A;  3HUV A;  2ZEM A;  3B3V A;  2Q51 A;  1Y9Z A;  4KNG E;  4C9V A;  3KZW A;  4IAV A;  4MCR A;  5LRG A;  3MRU A;  4OP4 A;  4C9A A;  2WYR A;  4OME A;  2OR4 A;  2CTB A;  3CT9 A;  3KR4 A;  2ZEG A;  4K3N A;  3B3T A;  3B3W A;  4MMO A;  1IGB A;  2ZEL A;  1XFO A;  3FVL A;  4P6Y A;  4OC5 A;  2GU2 A;  2I3C A;  2ZEH A;  4OID A;  4NGP A;  3ISZ A;  1GYT A;  4EFD A;  1TKF A;  3PBE A;  5I4M A;  4C8P A;  1LAP A;  1HDU A;  4P4I A;  3T8W A;  5D29 A;  4C9E A;  3WC7 A;  3I6S A;  4P4D A;  1YSJ A;  1YW6 A;  2Q4Z A;  1CP7 A;  3IO1 A;  4OKO A;  3VAR A;  4ZY0 A;  1R3N A;  2F8H A;  3D7F A;  3TX8 A;  1HDQ A;  4C86 A;  1Y0R A;  6CPA A;  1ARL A;  3QNV A;  4MCS A;  3RZA A;  2C6G A;  5K8P A;  4UF4 A;  3IWW A;  4P4J A;  2GLF A;  2C6C A;  2HB6 A;  3FED A;  4UEZ A;  3BHX A;  4JYW A;  2V8D A;  1Y0Y A;  4P10 A;  4YN3 A;  4PQA A;  5HVF A;  4X3R A;  4DYO A;  1QQ9 A;  3FF3 A;  5LYF A;  1BPM A;  4ZI6 A;  2PJ7 A;  3NFZ A;  4IHM A;  1BAV A;  1VHE A;  1LCP A;  3PRT A;  1Q7L A;  1FT7 A;  3RAM A;  5LRJ A;  4WJB A;  3KHZ A;  4ZY2 A;  2ZEN A;  1NSA A;  5F09 A;  1UWY A;  2PJ3 A;  1M4L A;  4PPZ A;  5JGF A;  4PXE A;  2V8H A;  4C9U A;  1TF8 A;  2JBK A;  4NJQ A;  4H2K A;  2WZN A;  4B6Z A;  2JBJ A;  3D68 A;  8CPA A;  4F8Z A;  4X2T A;  4TJX A;  4C8F A;  3WC6 A;  4PXD A;  1RTQ A;  4MXU A;  4UEE A;  1V6C A;  3CPX A;  3PFE A;  2JEW A;  2CTC A;  2O53 A;  3VAT A;  3WT4 A;  4R76 A;  1YLO A;  4C8T A;  3SI1 A;  2QVP A;  4GM5 A;  5J1Q A;  3D66 A;  2F7V A;  1Z5R A;  1LOK A;  2BCO A;  5LRK A;  2PJ5 A;  4JZ0 A;  3PB8 X;  1KWM A;  3B3S A;  1ELL P;  3IFE A;  3D7H A;  4PXB A;  4A37 A;  4YWY A;  4MHY A;  3H8G A;  1TKH A;  4CPA A;  3SI0 A;  4OC1 A;  3D7G A;  3S9L A;  2GLJ A;  2EWB A;  4ZYQ A;  3LWU A;  1FNO A;  3CDX A;  3NH4 A;  3SJE A;  4O23 A;  4C8C A;  3PB4 X;  3KQX A;  2PJB A;  2PJA A;  1PYT B;  2ZEO A;  2CF4 A;  2PIY A;  2Q43 A;  2AFZ A;  2G9D A;  3D7D A;  3NA6 A;  2PVV A;  2CIJ A;  2FVG A;  4KSI A;  1LFW A;  5JH9 A;  1ZLI A;  4P4B A;  2V8G A;  5HXD A;  5LYD A;  3KR5 A;  4G1P A;  4EWT A;  2J9A A;  4A94 A;  4C84 A;  3WC5 A;  4NGQ A;  4UIA A;  1WVM A;  4Z65 A;  4ZX8 A;  2GRE A;  4DUK A;  3FJU A;  1H8L A;  1XMB A;  4ZY1 A;  3KQZ A;  3LMS A;  1XBU A;  2EK9 A;  4C85 A;  3FEE A;  1Z8L A;  2NYQ A;  1EE3 P;  3CPA A;  1CG2 A;  1Z2L A;  4FAI A;  4FUU A;  3SJG A;  5CBM A;  3BXM A;  4NGS A;  4TJV A;  2XEF A;  2O4H A;  2PJ4 A;  3PBB A;  3TC8 A;  2OOT A;  4PXC A;  3EIF A;  2ZOF A;  3S9M A;  2PRQ A;  3K2K A;  4MHN A;  3I1U A;  1ZG8 A;  3K9T A;  4ZX9 A;  3SJF A;  1VGY A;  4WWV A;  7CPA A;  3H8E A;  4A39 A;  2NSM A;  1TF9 A;  3PB6 X;  4P4E A;  2PVW A;  4CDK A;  3FMC A;  5JM6 A;  2C6P A;  2VL1 A;  3MN8 A;  4TWE A;  3D67 A;  1ZG9 A;  5THW A;  4OC4 A;  2AFS A;  4R7M A;  4C99 A;  3PB7 X;  3NH5 A;  3VH9 A;  4UEF A;  3DGV A;  3SJX A;  3N5F A;  5IB9 A;  3B35 A;  3NH8 A;  4NGR A;  1CBX A;  4ONW A;  3H8F A;  5K8N A;  2PJ2 A;  3V7Z A;  3ISX A;  1DTD A;  4P44 A;  1ZLH A;  1VHO A;  4R8F A;  1ARM A;  1ZG7 A;  1LAN A;  3DLJ A;  3FEC A;  3RBU A;  2IMO A;  1CP6 A;  1F2O A;  2RB7 A;  2XEG A;  4A38 A;  2V8V A;  4C8A A;  1HEE A;  2C1C A;  2RFH A;  3IC1 A;  1DE4 C;  5D8N A;  1Y7E A;  4FBE A;  2QJ8 A;  3FH4 A;  3BI0 A;  1QMU A;  3KAS A;  2ABZ A;  2XEI A;  2AFM A;  2IJZ A;  3GB0 A;  3IJ3 A;  4OC2 A;  5K8O A;  4BD9 A;  4MHP A;  2AFO A;  4MCP A;  2AFU A;  4AXV A;  5HVH A;  3KI9 A;  4OC3 A;  1F57 A;  1VIX A;  4EME A;  1TKJ A;  4P4F A;  4C8U A;  3IEH A;  4NGM A;  2AFW A;  3L2N A;  4RUH A;  3B7I A;  3IIB A;  4C9R A;  1YW4 A;  3B2Y A;  1XRY A;  1XJO A;  2BOA A;  1BPN A;  3PFO A;  3V38 A;  5ELY A;  4NGN A;  1R43 A;  4CDJ A;  1IY7 A;  1CPS A;  2ZEE A;  4X8I A;  5CPA A;  1OBR A;  5K8M A;  2HC9 A;  3WAB A;  3JRU A;  2PJC A;  2XEJ A;  4FWU A;  1AMP A;  3GUX A;  4IK2 A;  1TXR A;  1ELM P;  1PCA A;  4F9U A;  3ICU A;  4F9V A;  3SI2 A;  3B3C A;  5LYI A;  2PJ0 A;  3BI1 A;  2EK8 A;  2V77 A;  5LYL A;  1CPX A;  4W9Y A;  2ZOG A;  2PJ9 A;  2ZEP A;  3PB9 X;  4R6T A;  5HVG A;  1F2P A;  3D4U A;  2IQ6 A;  3PEI A;  4MCQ A;  1BLL E;  2PJ1 A;  3GLJ A;  1JQG A;  4TNU A;  2DEA A;  2ZEF A;  4MHZ A;  4MRI A;  4P45 A;  2ANP A;  3VTA A;  3FX6 A;  4Q7A A;  1XF1 A;  4NJR A;  2PJ6 A;  2ZED A;  3KL9 A;  3I74 A;  2BO9 A;  4YU9 A;  5DS0 A;  3KGQ A;  4NFR A;  4LQG A; 
#chains in the Genus database with same CATH topology
 3S9N A;  2EUI A;  4CRZ B;  4COG A;  4UIB A;  1LAM A;  2QYV A;  3FRM A;  4J3G A;  2PJ8 A;  4OIW A;  2FL4 A;  3KHX A;  2PE3 A;  4R3L A;  1M4G A;  1CX8 A;  2EO8 A;  2AFX A;  1YME A;  2POK A;  2QML A;  4DJL A;  1AYE A;  1YVH A;  1S7L A;  2N3A B;  4UWJ A;  4NGT A;  3EFA A;  4H6U A;  4MY3 A;  3HLP A;  1X10 A;  2G3T A;  2PIZ A;  2PCU A;  3TTH A;  4OC0 A;  2B4J C;  1M4I A;  1PUA A;  3HUV A;  4UCM A;  2P0W A;  1NXJ A;  2ZEM A;  1MK4 A;  2Q44 A;  3B3V A;  3QAY A;  2Q51 A;  4KS9 A;  4NSQ A;  3TOB A;  1Y9Z A;  4J0N A;  4UCN A;  4KNG E;  2JLM A;  2WPX A;  1N71 A;  4C9V A;  1GHE A;  4H1H A;  3KZW A;  2Y1M A;  3GJZ A;  3PGP A;  1IOI A;  4IAV A;  4MCR A;  2Z3P A;  1YVO A;  2VZY A;  3JTK A;  3MRU A;  4OP4 A;  5LRG A;  4M6G A;  4JWP A;  2OH1 A;  4OME A;  2WYR A;  3WR7 A;  4AB7 A;  2OR4 A;  5A28 A;  3N7Z A;  2CTB A;  3CT9 A;  4CAV A;  3KR4 A;  1XIX A;  3TLG A;  2CNS A;  2ZEG A;  4K3N A;  4IIX A;  3B3T A;  3B3W A;  3FBU A;  4MMO A;  1IGB A;  4XNH C;  2ZEL A;  1XFO A;  5G22 A;  3TO9 A;  4LQ6 A;  3NOJ A;  1A2Z A;  2CNT A;  3FVL A;  4P6Y A;  4OC5 A;  2GU2 A;  1ZL0 A;  2I3C A;  1M4D A;  2ZEH A;  2OZU A;  4OID A;  2R8V A;  1CE8 B;  4NGP A;  1FBV A;  2Q4V A;  3ISZ A;  1GYT A;  2FT0 A;  4A4B A;  4H89 A;  1QSM A;  4EFD A;  5JYB A;  1TKF A;  3FXT A;  2A4N A;  3IGR A;  3PBE A;  5I4M A;  1IU8 A;  4U5Y A;  2J8N A;  4II9 A;  4RI1 A;  3DSB A;  3VRO A;  1OZP A;  1VKC A;  1QSR A;  4C8P A;  4LX9 A;  1LAP A;  4UCP A;  1HDU A;  1V0C A;  3IWE A;  4DNC A;  5IX3 A;  4P4I A;  3T8W A;  5D29 A;  2EZC A;  1IID A;  4C7H A;  1I1D A;  4F0X A;  4ZGY B;  4C9E A;  3WC7 A;  3I6S A;  4P4D A;  3TLB A;  1YSJ A;  4B5O A;  1YW6 A;  3TOA A;  1Y9K A;  4Q36 A;  2FM4 A;  2Q4Z A;  1CP7 A;  3IO1 A;  4HNX B;  4OKO A;  3TCV A;  3VAR A;  4AVB A;  4ZY0 A;  4BTF A;  2OLS A;  1B87 A;  1R3N A;  2F8H A;  3D7F A;  4BMH A;  3TX8 A;  1HDQ A;  2J8R A;  4Q38 A;  5HH1 A;  4C86 A;  1Y0R A;  4B10 A;  6CPA A;  1ARL A;  2UV8 G;  3QNV A;  4MCS A;  3DDD A;  3RZA A;  5IB0 A;  3ZJ0 A;  1IYL A;  3P2H A;  5IV0 A;  2GP4 A;  2C6G A;  4OAE A;  4E2A A;  4MFJ A;  3TE4 A;  5K8P A;  5AG6 A;  4UF4 A;  5C82 A;  1IYK A;  3IWW A;  3CXS A;  2G0B A;  4P4J A;  2GLF A;  4KVO E;  5H86 A;  4C68 A;  3TLC A;  2C6C A;  4B12 A;  2HB6 A;  3FED A;  2ATR A;  2AE6 A;  5JQ4 A;  4JD6 A;  4UEZ A;  2C27 A;  3BHX A;  3OP0 A;  4JYW A;  2V8D A;  3BJ8 A;  5J8C A;  4LUA A;  1Y0Y A;  4P10 A;  2FE7 A;  4YN3 A;  2R7H A;  3T0T A;  4PQA A;  5DWM A;  5HVF A;  4CGP A;  4X3R A;  3QAH A;  4QUS A;  4DYO A;  1WK4 A;  4M6I A;  1XMT A;  2NMT A;  4BBH A;  2PDO A;  2GFQ A;  2P6F A;  2REF A;  1A9X B;  2VZZ A;  1QQ9 A;  3P2F A;  3FF3 A;  5HKY A;  4JLY A;  1BPM A;  4ZI6 A;  5K8O A;  5LYF A;  2R82 A;  5G21 A;  2PJ7 A;  1XEB A;  1J3L A;  5A27 A;  3NFZ A;  4IHM A;  4F6A A;  1BAV A;  3RNZ A;  1LRZ A;  1VHE A;  2YNE A;  1LCP A;  3D2P A;  3PRT A;  3A9L A;  1Q7L A;  1FT7 A;  3BUM B;  3RAM A;  5LRJ A;  4WJB A;  4XNH B;  1S7F A;  5G1Z A;  5CNP A;  4ORF A;  1NBW A;  3KHZ A;  1IB1 E;  1CS0 B;  4MI4 A;  4ZY2 A;  2D4P A;  5F1Y A;  3R9F A;  2ZEN A;  3PT1 A;  4RR2 B;  5F09 A;  1NSA A;  1UWY A;  2DPT A;  3RYO A;  2GAN A;  2PJ3 A;  1M4L A;  4JJX A;  2K5T A;  1Q2Y A;  4PPZ A;  3U1B A;  2FXF A;  2ZW5 A;  2ZW4 A;  5JGF A;  1IOF A;  3OB1 B;  4ZBG A;  4E8O A;  4PXE A;  2V8H A;  3W91 A;  1Z8W A;  4C9U A;  4HPS A;  2AUM A;  1TF8 A;  1Z8X A;  2JBK A;  2GIV A;  2REE A;  4NJQ A;  4H2K A;  4CYO A;  1Y7R A;  3OB2 B;  3TT2 A;  2YJT A;  4PK3 A;  3VRQ A;  3FNC A;  2X0S A;  2WZN A;  4B6Z A;  4CAW A;  2Z3K A;  2HQY A;  2JBJ A;  2WUU A;  3D68 A;  3HMJ G;  2B0A A;  8CPA A;  4F8Z A;  2P6E A;  4X2T A;  4YRH A;  3FIX A;  2DF5 A;  2HV2 A;  2R98 A;  4TJX A;  3ZNI A;  2FIW A;  2PCN A;  4C8F A;  3EZA A;  4QB9 A;  5H84 A;  2Q7S A;  4KOT A;  2Q0Y A;  4PXD A;  1RTQ A;  4MXU A;  4UEE A;  3WC6 A;  1V6C A;  3CPX A;  3PFE A;  4YGO A;  3T05 A;  3IU2 A;  5F46 A;  2JEW A;  2CTC A;  2O53 A;  4M85 A;  3VAT A;  3WT4 A;  2IL4 A;  4B13 A;  4C7I A;  4R76 A;  1YLO A;  4C8T A;  2VEZ A;  3SI1 A;  1YRE A;  4MI1 A;  5FD8 A;  3KKW A;  2QVP A;  1FY7 A;  3CXQ A;  4GM5 A;  4KSF A;  3D66 A;  4R3K A;  4A30 A;  5J1Q A;  1DIK A;  2F7V A;  1Z5R A;  1LOK A;  2BCO A;  3I9S A;  5LRK A;  2BL1 A;  2PJ5 A;  5KTA A;  4FD6 A;  2WSA A;  2Z11 A;  3E0K A;  4JZ0 A;  3PB8 X;  1BO4 A;  1KWM A;  1ELL P;  3B3S A;  3IFE A;  1K4J A;  4QVT A;  2FSR A;  4UFX A;  3EXN A;  1WJT A;  3D7H A;  4PXB A;  1YK3 A;  3C26 A;  4IUS A;  4YWY A;  4A37 A;  5K99 A;  4MHY A;  4RN7 A;  1UFH A;  3T07 A;  3H8G A;  2AUN A;  1TKH A;  4CPA A;  3SI0 A;  3EO4 A;  5ISV A;  4OC1 A;  3D7G A;  4ONU A;  1S60 A;  3S9L A;  2GLJ A;  2GE3 A;  3I3G A;  3VRN A;  2EWB A;  1WWZ A;  4ZYQ A;  3LWU A;  5G20 A;  4KOU A;  4BPX B;  4MHD A;  2QEC A;  1FNO A;  3CDX A;  2JDC A;  3NH4 A;  4CGO A;  1M6V B;  2OZG A;  3JUW A;  4KLW A;  3NE8 A;  1VBG A;  3NFQ A;  4B11 A;  3CXP A;  3SJE A;  3H4Q A;  4CYN A;  4O23 A;  4JXQ A;  2D4O A;  3PB4 X;  4C8C A;  3PP9 A;  3KQX A;  3W6X A;  1YVK A;  2PJB A;  1Y9W A;  4B5P B;  2PJA A;  1L0C A;  4KOY A;  4MBU A;  1PYT B;  1J4J A;  2B4B A;  2ZEO A;  3FYN A;  4GS4 A;  2CF4 A;  1ZRS A;  3C8O A;  3BUN B;  4A4C A;  1EO0 A;  4IF5 A;  5C88 A;  3PZJ A;  3KRV A;  2PIY A;  2CNM A;  2Q43 A;  2AFZ A;  2X7B A;  1AUG A;  5AXI A;  1I12 A;  2G9D A;  4AG9 A;  3D7D A;  3NA6 A;  2B5G B;  2PVV A;  2CIJ A;  2FVG A;  4KSI A;  4R9M A;  3K4I A;  2ZW6 A;  3TLA A;  1Q2C A;  1LFW A;  2Q4Y A;  4CAE A;  1ZLI A;  3BUX B;  4P4B A;  2V8G A;  5JH9 A;  5HXD A;  4CGM A;  3EC4 A;  5E96 A;  5LYD A;  5AGE A;  3KR5 A;  4G1P A;  4NXY A;  3VGO A;  1KUV A;  4EWT A;  2J9A A;  2YNC A;  4A94 A;  2CXA A;  1YGH A;  5EC4 A;  2CY2 A;  2BSW A;  3G8W A;  3WC5 A;  4C84 A;  4NGQ A;  4UIA A;  1XOV A;  4NCZ A;  1Q5X A;  4MFK A;  1WVM A;  4Z65 A;  4ZX8 A;  4A33 A;  2GRE A;  4DUK A;  2XPP A;  1H8L A;  1NE9 A;  1XMB A;  3FJU A;  3KQZ A;  4ZY1 A;  3LMS A;  1XBU A;  1SQH A;  1YX0 A;  3OWC A;  5J3X A;  1MJ9 A;  2EK9 A;  2FS5 A;  4C85 A;  3FEE A;  3R95 A;  1GGO A;  3R9E A;  1Z8L A;  2NYQ A;  3JVN A;  1EE3 P;  3VWE A;  2Q7B A;  2B3U A;  2YNC C;  4X5K A;  2FCK A;  4KOW A;  5AG4 A;  3CPA A;  2CBL A;  1CG2 A;  5JVL A;  1XE4 A;  1Z2L A;  2AJ6 A;  4FAI A;  4FUU A;  1P4N A;  3SJG A;  3IU1 A;  5CBM A;  3BXM A;  4NGS A;  3GY9 A;  3LAC A;  4XPL A;  4TJV A;  2XEF A;  1VHS A;  2O4H A;  4E94 A;  4H6Z A;  1M44 A;  2PJ4 A;  1Z9E A;  3PBB A;  3TC8 A;  4F0Y A;  2OOT A;  3VRR A;  4PXC A;  4CRY B;  2JEV A;  1C30 B;  1RO5 A;  2VI7 A;  2VBQ A;  3EIF A;  3D3S A;  2ZOF A;  3S9M A;  2PRQ A;  3TLG B;  4MFP A;  3K2K A;  4MHN A;  3I1U A;  5EBV A;  1ZG8 A;  3K9T A;  4ZX9 A;  3SJF A;  4I49 A;  1VGY A;  4KOR A;  4WWV A;  7CPA A;  5HMN A;  3H8E A;  4A39 A;  1B6B A;  1S7N A;  2NSM A;  3BLN A;  3MGD A;  1TF9 A;  2XPO A;  1ON0 A;  1Z9U A;  3PB6 X;  4P4E A;  3DR8 A;  5AG5 A;  4AVA A;  4CAF A;  2PVW A;  2H5M A;  4CDK A;  4R87 A;  2PQ8 A;  2Z10 A;  3FMC A;  5JM6 A;  1KC7 A;  2C6P A;  2VL1 A;  4B5P A;  2XPN A;  3MN8 A;  1BXR B;  5J8F A;  4BIN A;  4TWE A;  3F8K A;  3D67 A;  1ZG9 A;  4XPD B;  5THW A;  2OB0 A;  3IWG A;  4NEX A;  2Y0M A;  4OC4 A;  2AFS A;  4R7M A;  3V8I A;  4OAD A;  3SXN A;  4C99 A;  3PB7 X;  4KOV A;  5IR2 A;  3NH5 A;  4XPD C;  3VH9 A;  4UEF A;  4QBJ A;  3SR3 A;  4K30 A;  2Z3M A;  3DGV A;  2MP0 A;  4E5S A;  2DPS A;  3SJX A;  3BJ7 A;  3N5F A;  4UFV A;  1U6M A;  4Y49 C;  5IB9 A;  3T9Y A;  3B35 A;  5JPH A;  3LOD A;  3NH8 A;  4CZ1 A;  3S6K A;  4NGR A;  4KZT A;  1CBX A;  2B3V A;  2F5I A;  4ONW A;  4EYS A;  3H8F A;  5K8N A;  2PJ2 A;  3QB8 A;  1JWQ A;  2B4D B;  2EBJ A;  3V7Z A;  3ISX A;  4C2Z A;  1Z4E A;  1DTD A;  3R1K A;  4P44 A;  1ZYM A;  5HKZ A;  1YLE A;  1ZLH A;  1VHO A;  2HUZ A;  4MY0 A;  1ARM A;  1ZG7 A;  4R8F A;  1LAN A;  3DLJ A;  3FEC A;  3GKR A;  2P6G A;  2VXK A;  3RBU A;  2IMO A;  1CP6 A;  4MFZ A;  1NMT A;  5EMI A;  3TLY A;  3NE7 A;  1F2O A;  1S7K A;  2RB7 A;  2XEG A;  4GXH A;  4HKF A;  3R96 A;  1EZA A;  5BWA B;  1YQE A;  4A38 A;  4KOX A;  2V8V A;  4KVM E;  4C8A A;  1HEE A;  2VQY A;  2YJV A;  2C1C A;  2RFH A;  3IC1 A;  1DE4 C;  5GCN A;  2C5Q A;  5D8N A;  1Y7E A;  4CO9 A;  4CS0 B;  4FBE A;  2RC4 A;  2QJ8 A;  2WPW A;  3FH4 A;  3BI0 A;  4OLL A;  1QMU A;  3KAS A;  3D8P A;  4M8D A;  2BEI A;  2ABZ A;  2XEI A;  3EZE A;  2AFM A;  1KUX A;  2IJZ A;  5I0C A;  4MJX A;  5F49 A;  3GB0 A;  3IJ3 A;  3TO7 A;  1ZO0 A;  1QST A;  1YR0 A;  4OC2 A;  2VKZ G;  2KCW A;  4KVX A;  3F5B A;  2AFO A;  4MHP A;  4BD9 A;  1VI4 A;  2PR1 A;  4MCP A;  4EVY A;  2AFU A;  5F48 A;  4XPK A;  2HWG A;  3R9G A;  1R61 A;  4M6H A;  4AXV A;  5HVH A;  3G3S A;  4BPU B;  4UWI A;  3KI9 A;  4KLV A;  1JDB C;  3RO0 A;  5BY0 A;  4OC3 A;  1F57 A;  3UY5 A;  1VIX A;  1EZB A;  3TLZ A;  3S6H A;  4EME A;  1TKJ A;  5KTD A;  4P4F A;  2B58 A;  2OZH A;  4M3S A;  4HNY B;  2D0O A;  4C8U A;  3IEH A;  4CGN A;  4NGM A;  2B4D A;  2AFW A;  2OU2 A;  4MFQ A;  4CAX A;  3GIU A;  3G23 A;  4JVO A;  3L2N A;  4MJ8 A;  3B7I A;  4RUH A;  2BUE A;  4FD5 A;  3IIB A;  2Z3L A;  4B14 A;  3O8Z A;  1YW4 A;  2HI6 A;  4C9R A;  4YFJ A;  4CYP A;  1Z8T A;  2PRB A;  3B2Y A;  4R57 A;  2EZA A;  5F13 A;  1XRY A;  4PSW A;  3TFY A;  3HPG G;  1M1D A;  1XJO A;  5F47 A;  4FD7 A;  1B47 A;  2BOA A;  1BPN A;  3SXO A;  3EZB A;  4A95 A;  2XPL A;  3PFO A;  3V38 A;  4A32 A;  5FVJ A;  3T90 A;  4PSX A;  4AG7 A;  3VWD A;  5ELY A;  2Y1N A;  3S6G A;  4NGN A;  2JDD A;  1BOB A;  1R43 A;  1KEE B;  4PV6 A;  4CDJ A;  1IY7 A;  2O28 A;  4KUB A;  1CPS A;  2ZEE A;  4X8I A;  5CPA A;  4C2X A;  2QIR A;  1NSL A;  1OBR A;  1S5K A;  4UA3 A;  3F9K C;  1JDE A;  5K8M A;  3BUW B;  4KUA A;  2HC9 A;  3CZX A;  3K9U A;  4L89 A;  2YND A;  3WAB A;  3ZZI A;  2G3A A;  1QSN A;  5F5X A;  1KBL A;  1MJA A;  2D0P A;  2E28 A;  2ODF A;  1CJW A;  3JRU A;  2DLA A;  2PJC A;  2XEJ A;  1IIC A;  3D2M A;  3PFV A;  1AMP A;  3GUX A;  4FWU A;  4KOS A;  4U9Z A;  1KZF A;  2I79 A;  3BUO B;  1TXR A;  3F0A A;  4IK2 A;  3TLE A;  1ELM P;  1PCA A;  4F9U A;  1XF8 A;  3TO6 A;  2HRO A;  4MFL A;  3ICU A;  4CGL A;  2PSW A;  3T5M A;  4F9V A;  3SI2 A;  3B3C A;  4GPL B;  1Z4R A;  2Z0Z A;  1MJB A;  5LYI A;  1PU9 A;  1I21 A;  2PJ0 A;  3BI1 A;  3DNS A;  2EK8 A;  2V77 A;  1S3Z A;  3B8G A;  4L8A A;  4A31 A;  5LYL A;  1R57 A;  4C9A A;  1CPX A;  2ZPA A;  4BPW B;  4W9Y A;  3W6S A;  2ZOG A;  4UBR A;  5KTC A;  1C3O B;  1RXT A;  2PJ9 A;  2ZEP A;  3PB9 X;  4CYQ A;  4IIY A;  4INJ A;  2Z3N A;  4RS2 A;  4R6T A;  5HVG A;  2I00 A;  4PK2 A;  1F2P A;  1QSO A;  4AVC A;  2ZXV A;  4E0A A;  2ZW7 A;  3D4U A;  1CM0 A;  2DXQ A;  2IQ6 A;  3PEI A;  4MCQ A;  1BLL E;  4JXR A;  4A2Z A;  1Q2D A;  1T36 B;  2J8M A;  2PJ1 A;  4U9Y A;  3GLJ A;  4C2Y A;  1JQG A;  4TNU A;  2DEA A;  2ZEF A;  3DR6 A;  2PC1 A;  3SHP A;  2Q04 A;  3EY5 A;  3GYA A;  1KUY A;  4MHZ A;  4MRI A;  4P45 A;  2ANP A;  1P0H A;  2YGW A;  3FX6 A;  3H5Z A;  4Q7A A;  3VTA A;  3OAK A;  2ARH A;  2EVN A;  4KSA A;  1XF1 A;  3LD2 A;  4FD4 A;  3S6F A;  1VBH A;  3TYX A;  3U88 C;  3VRP A;  4NJR A;  2PJ6 A;  2DIK A;  3PLF B;  4Y49 B;  1X12 A;  2ZED A;  3KL9 A;  3FB3 A;  3I74 A;  2BO9 A;  5AG7 A;  2EZB A;  2PR8 A;  4COB A;  4YU9 A;  5DS0 A;  2B5G A;  4HNW B;  4NF1 A;  4QC6 A;  2FIA A;  3HPH E;  5HKW A;  4UFW A;  2R1I A;  5F9M A;  1TIQ A;  3KGQ A;  2Z3O A;  4NFR A;  5DWN A;  4LQG A; 
#chains in the Genus database with same CATH homology
 3S9N A;  4UIB A;  1LAM A;  2QYV A;  2PJ8 A;  4OIW A;  3KHX A;  2PE3 A;  1CX8 A;  4DJL A;  2AFX A;  1YME A;  2POK A;  1AYE A;  4NGT A;  3HLP A;  2PIZ A;  2PCU A;  4OC0 A;  3HUV A;  2ZEM A;  3B3V A;  2Q51 A;  1Y9Z A;  4KNG E;  4C9V A;  3KZW A;  4IAV A;  4MCR A;  5LRG A;  3MRU A;  4OP4 A;  4C9A A;  2WYR A;  4OME A;  2OR4 A;  2CTB A;  3CT9 A;  3KR4 A;  2ZEG A;  4K3N A;  3B3T A;  3B3W A;  4MMO A;  1IGB A;  2ZEL A;  1XFO A;  3FVL A;  4P6Y A;  4OC5 A;  2GU2 A;  2I3C A;  2ZEH A;  4OID A;  4NGP A;  3ISZ A;  1GYT A;  4EFD A;  1TKF A;  3PBE A;  5I4M A;  4C8P A;  1LAP A;  1HDU A;  4P4I A;  3T8W A;  5D29 A;  4C9E A;  3WC7 A;  3I6S A;  4P4D A;  1YSJ A;  1YW6 A;  2Q4Z A;  1CP7 A;  3IO1 A;  4OKO A;  3VAR A;  4ZY0 A;  1R3N A;  2F8H A;  3D7F A;  3TX8 A;  1HDQ A;  4C86 A;  1Y0R A;  6CPA A;  1ARL A;  3QNV A;  4MCS A;  3RZA A;  2GP4 A;  2C6G A;  5K8P A;  4UF4 A;  3IWW A;  4P4J A;  2GLF A;  2C6C A;  2HB6 A;  3FED A;  4UEZ A;  3BHX A;  4JYW A;  2V8D A;  1Y0Y A;  4P10 A;  4YN3 A;  4PQA A;  5HVF A;  4X3R A;  4DYO A;  1QQ9 A;  3FF3 A;  5LYF A;  1BPM A;  4ZI6 A;  2PJ7 A;  3NFZ A;  4IHM A;  1BAV A;  1VHE A;  1LCP A;  3PRT A;  1Q7L A;  1FT7 A;  3RAM A;  5LRJ A;  4WJB A;  3KHZ A;  4ZY2 A;  2ZEN A;  1NSA A;  5F09 A;  1UWY A;  2PJ3 A;  1M4L A;  4PPZ A;  5JGF A;  4PXE A;  2V8H A;  4C9U A;  1TF8 A;  2JBK A;  4NJQ A;  4H2K A;  2WZN A;  4B6Z A;  2JBJ A;  3D68 A;  8CPA A;  4F8Z A;  4X2T A;  4TJX A;  4C8F A;  3WC6 A;  4PXD A;  1RTQ A;  4MXU A;  4UEE A;  1V6C A;  3CPX A;  3PFE A;  2JEW A;  2CTC A;  2O53 A;  3VAT A;  3WT4 A;  4R76 A;  1YLO A;  4C8T A;  3SI1 A;  2QVP A;  4GM5 A;  5J1Q A;  3D66 A;  2F7V A;  1Z5R A;  1LOK A;  2BCO A;  5LRK A;  2PJ5 A;  4JZ0 A;  3PB8 X;  1KWM A;  3B3S A;  1ELL P;  3IFE A;  3D7H A;  4PXB A;  4A37 A;  4YWY A;  4MHY A;  3H8G A;  1TKH A;  4CPA A;  3SI0 A;  4OC1 A;  3D7G A;  3S9L A;  2GLJ A;  2EWB A;  4ZYQ A;  3LWU A;  1FNO A;  3CDX A;  3NH4 A;  3SJE A;  4O23 A;  4C8C A;  3PB4 X;  3KQX A;  2PJB A;  2PJA A;  1PYT B;  2ZEO A;  2CF4 A;  2PIY A;  2Q43 A;  2AFZ A;  2G9D A;  3D7D A;  3NA6 A;  2PVV A;  2CIJ A;  2FVG A;  4KSI A;  1LFW A;  5JH9 A;  1ZLI A;  4P4B A;  2V8G A;  5HXD A;  5LYD A;  3KR5 A;  4G1P A;  4EWT A;  2J9A A;  4A94 A;  4C84 A;  3WC5 A;  4NGQ A;  4UIA A;  1WVM A;  4Z65 A;  4ZX8 A;  2GRE A;  4DUK A;  3FJU A;  1H8L A;  1XMB A;  4ZY1 A;  3KQZ A;  3LMS A;  1XBU A;  2EK9 A;  4C85 A;  3FEE A;  1Z8L A;  2NYQ A;  1EE3 P;  3CPA A;  1CG2 A;  1Z2L A;  4FAI A;  4FUU A;  3SJG A;  5CBM A;  3BXM A;  4NGS A;  4TJV A;  2XEF A;  2O4H A;  2PJ4 A;  3PBB A;  3TC8 A;  2OOT A;  4PXC A;  3EIF A;  2ZOF A;  3S9M A;  2PRQ A;  3K2K A;  4MHN A;  3I1U A;  1ZG8 A;  3K9T A;  4ZX9 A;  3SJF A;  1VGY A;  4WWV A;  7CPA A;  3H8E A;  4A39 A;  2NSM A;  1TF9 A;  3PB6 X;  4P4E A;  2PVW A;  4CDK A;  3FMC A;  5JM6 A;  2C6P A;  2VL1 A;  3MN8 A;  4TWE A;  3D67 A;  1ZG9 A;  5THW A;  4OC4 A;  2AFS A;  4R7M A;  4C99 A;  3PB7 X;  5IR2 A;  3NH5 A;  3VH9 A;  4UEF A;  3DGV A;  3SJX A;  3N5F A;  5IB9 A;  3B35 A;  3NH8 A;  4NGR A;  1CBX A;  4ONW A;  3H8F A;  5K8N A;  2PJ2 A;  3V7Z A;  3ISX A;  1DTD A;  4P44 A;  1ZLH A;  1VHO A;  4R8F A;  1ARM A;  1ZG7 A;  1LAN A;  3DLJ A;  3FEC A;  3RBU A;  2IMO A;  1CP6 A;  1F2O A;  2RB7 A;  2XEG A;  4A38 A;  2V8V A;  4C8A A;  1HEE A;  2C1C A;  2RFH A;  3IC1 A;  1DE4 C;  2C5Q A;  5D8N A;  1Y7E A;  4FBE A;  2QJ8 A;  3FH4 A;  3BI0 A;  1QMU A;  3KAS A;  2ABZ A;  2XEI A;  2AFM A;  2IJZ A;  3GB0 A;  3IJ3 A;  4OC2 A;  5K8O A;  4BD9 A;  4MHP A;  2AFO A;  4MCP A;  2AFU A;  4AXV A;  5HVH A;  3KI9 A;  4OC3 A;  1F57 A;  1VIX A;  4EME A;  1TKJ A;  4P4F A;  4C8U A;  3IEH A;  4NGM A;  2AFW A;  3L2N A;  4RUH A;  3B7I A;  3IIB A;  4C9R A;  1YW4 A;  3B2Y A;  1XRY A;  1XJO A;  2BOA A;  1BPN A;  3PFO A;  3V38 A;  5ELY A;  4NGN A;  1R43 A;  4CDJ A;  1IY7 A;  1CPS A;  2ZEE A;  4X8I A;  5CPA A;  1OBR A;  5K8M A;  2HC9 A;  3WAB A;  3JRU A;  2PJC A;  2XEJ A;  4FWU A;  1AMP A;  3GUX A;  4IK2 A;  1TXR A;  1ELM P;  1PCA A;  4F9U A;  3ICU A;  4F9V A;  3SI2 A;  3B3C A;  5LYI A;  2PJ0 A;  3BI1 A;  2EK8 A;  2V77 A;  5LYL A;  1CPX A;  4W9Y A;  2ZOG A;  2PJ9 A;  2ZEP A;  3PB9 X;  4R6T A;  5HVG A;  1F2P A;  3D4U A;  2IQ6 A;  3PEI A;  4MCQ A;  1BLL E;  2PJ1 A;  3GLJ A;  1JQG A;  4TNU A;  2DEA A;  2ZEF A;  4MHZ A;  4MRI A;  4P45 A;  2ANP A;  3VTA A;  3FX6 A;  4Q7A A;  1XF1 A;  4NJR A;  2PJ6 A;  2ZED A;  3KL9 A;  3I74 A;  2BO9 A;  4YU9 A;  5DS0 A;  3KGQ A;  4NFR A;  4LQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...