4NGTA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 252
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngtA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngtA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngtA02
1JQGA 3PB8X 3GB0A 2ZEMA 2PJ6A 4KSIA 2AFWA 1YLOA 3TC8A 3BI0A 2PIYA 1YW4A 4ZX8A 1LAPA 3QNVA 4O23A 4X8IA 4DYOA 3SI1A 4NGNA 3HUVA 2XEIA 5F09A 4A37A 1QMUA 2NYQA 4MMOA 5HVGA 2ZOFA 1ARMA 2JEWA 3IEHA 5THWA 3NH8A 4C9UA 2J9AA 4MCRA 2Q43A 3VATA 2FVGA 3S9NA 3K2KA 4EMEA 3V38A 3WT4A 3BHXA 1TKHA 2V8DA 2IMOA 1CBXA 2PIZA 4MHYA 3SJEA 4NGSA 4LQGA 2ZEEA 2PCUA 4C9AA 1ARLA 4JZ0A 3D7FA 5JM6A 2EK9A 1Y0YA 2GREA 5LYLA 3FH4A 2ZENA 3LWUA 3DGVA 3H8GA 3RAMA 2ZEPA 1LAMA 4A38A 1FNOA 2OOTA 1ZG7A 4IHMA 4ZY1A 3B3TA 3D7HA 2BCOA 3WABA 1ELMP 3IJ3A 3K9TA 3PFEA 3D7DA 1CX8A 1PYTB 2V8VA 2F7VA 3BI1A 2Q51A 3CT9A 5K8PA 4RUHA 3KR5A 3KQZA 3T8WA 3SJGA 4P4IA 1XFOA 1H8LA 3TX8A 1IY7A 2O53A 4C9RA 3H8EA 4WWVA 3D68A 1LANA 1CPSA 1CG2A 4MXUA 3ISZA 2PJ5A 1V6CA 3S9LA 4P45A 3B3SA 3MN8A 3PEIA 1NSAA 4P4JA 1ZG9A 2AFZA 4G1PA 1LCPA 3RBUA 3KZWA 2PJAA 3B3VA 4OIDA 4MRIA 4UEEA 2O4HA 2PJ7A 3CDXA 3KL9A 4PXCA 4NGPA 3KR4A 3DLJA 5CPAA 3GUXA 2EWBA 1HDQA 4AXVA 4PPZA 5JH9A 2C6CA 2C1CA 1AMPA 1ZG8A 3FJUA 1FT7A 3PB9X 1F2OA 2JBJA 2ZEFA 3H8FA 2PJ9A 5D29A 4F8ZA 3FF3A 4ZY0A 4C9VA 1VHOA 4MCQA 1OBRA 3NH4A 4PXEA 4JYWA 2ZOGA 5JGFA 5K8MA 5K8OA 1YW6A 4Q7AA 2QVPA 3WC7A 3FVLA 3N5FA 2PJ1A 4A94A 2ZEGA 3FEDA 1IGBA 4PXBA 4TJVA 1AYEA 2G9DA 5LYIA 2PJ3A 3PBEA 1Q7LA 1QQ9A 2C6PA 2JBKA 5J1QA 4EFDA 4P10A 4P44A 4C84A 5D8NA 3HLPA 2PJ8A 4C99A 2PVVA 3PFOA 1EE3P 4C8TA 1Z2LA 3SI0A 2EK8A 3KHZA 2XEJA 4MHPA 4FAIA 4UEFA 4CPAA 2PJ2A 3B7IA 2Q4ZA 1VHEA 4MHZA 4EWTA 3VTAA 4C8AA 1BLLE 2CIJA 3FMCA 5LRGA 4OC1A 1TKJA 4TNUA 4MCPA 4KNGE 2AFOA 3MRUA 1XMBA 3EIFA 2V8HA 4C8PA 1Y7EA 4B6ZA 4PQAA 4NJQA 2V8GA 3NFZA 2AFXA 2PJCA 3B2YA 3CPAA 1GYTA 4R7MA 1Y9ZA 4OC5A 4P4DA 2ABZA 2F8HA 3JRUA 4NJRA 2AFSA 1Y0RA 4UEZA 2PE3A 2POKA 1PCAA 3D7GA 3FECA 4OC2A 4OMEA 1XJOA 4NGQA 3ICUA 4FWUA 4R8FA 2ANPA 2GLJA 3GLJA 2PJBA 3WC6A 1M4LA 4ZI6A 1DE4C 5ELYA 3PB6X 2XEFA 5LRJA 4CDKA 2XEGA 3I74A 4ZX9A 1HDUA 4C85A 1R43A 1WVMA 2V77A 4CDJA 3ISXA 4R6TA 7CPAA 2ZEDA 1UWYA 1VIXA 1ZLHA 3KI9A 4NGTA 4YN3A 1ZLIA 2AFMA 5I4MA 4C86A 4OKOA 4A39A 2PRQA 4ONWA 4W9YA 2ZEOA 2DEAA 1TF8A 2HB6A 3D66A 1YMEA 3NH5A 4DUKA 4F9UA 4OP4A 3VH9A 4UIAA 4WJBA 1LOKA 8CPAA 4YWYA 1CP6A 2I3CA 3I1UA 3BXMA 1HEEA 3KGQA 4OC4A 4TWEA 4K3NA 3PB7X 4R76A 3D67A 6CPAA 4C8UA 3FX6A 3PB4X 2WYRA 1BAVA 4ZYQA 4GM5A 2C6GA 2QYVA 5HXDA 3B3WA 5LRKA 1Z5RA 3V7ZA 3PBBA 1DTDA 3L2NA 4NGMA 2NSMA 5LYDA 2GLFA 1RTQA 4OC3A 5K8NA 3B3CA 1XBUA 1TXRA 3KQXA 1KWMA 2GU2A 3KHXA 4C9EA 4C8CA 4ZY2A 2BO9A 3IWWA 2HC9A 2OR4A 1CP7A 3IC1A 4PXDA 4FBEA 2WZNA 2ZEHA 3IIBA 4FUUA 1LFWA 4F9VA 2IQ6A 3WC5A 1BPNA 1XF1A 4OIWA 4X2TA 3IO1A 2RB7A 5HVFA 4H2KA 4P6YA 3RZAA 3D4UA 4DJLA 4IAVA 4MHNA 3KASA 1R3NA 5LYFA 1VGYA 2ZELA 3LMSA 1YSJA 4IK2A 2CTCA 5IB9A 4Z65A 4OC0A 1BPMA 3I6SA 3B35A 3FEEA 2CTBA 1TF9A 4UIBA 3SI2A 4NFRA 1TKFA 2AFUA 4YU9A 1Z8LA 4P4FA 4UF4A 2IJZA 3CPXA 3S9MA 5DS0A 2PJ0A 4BD9A 3VARA 2BOAA 3IFEA 1F57A 4X3RA 2PJ4A 1XRYA 5HVHA 4C8FA 5CBMA 2QJ8A 4P4EA 1ELLP 1CPXA 3SJXA 4MCSA 4NGRA 3PRTA 2CF4A 4TJXA 3NA6A 4P4BA 3SJFA 1F2PA 2VL1A 2RFHA 2PVWA
chains in the Genus database with same CATH superfamily
1JQGA 3PB8X 3NFQA 5A27A 3GB0A 3GIUA 2ZEMA 3FBUA 2PJ6A 4U9YA 4KSIA 5DWMA 2AFWA 1YLOA 3TC8A 3BI0A 3F9KC 3BUWB 2PIYA 5E96A 5H84A 2YJTA 4KLWA 1YW4A 4NF1A 4ZX8A 4KVXA 4CAWA 2GP4A 1LAPA 3QNVA 4O23A 4X8IA 4OAEA 4BINA 4RR2B 3SI1A 4DYOA 4MY0A 4R3KA 3OP0A 4NGNA 3RNZA 1EO0A 4QBJA 5K99A 2YNEA 4UA3A 3HUVA 2XEIA 5F09A 4A37A 1QMUA 2NYQA 4MMOA 1LRZA 1P0HA 1I1DA 2VZZA 4E94A 5HVGA 2P0WA 2ZOFA 1ARMA 2JEWA 3IEHA 5THWA 3NH8A 4C9UA 2J9AA 2OLSA 1BO4A 4MCRA 2Q43A 4PV6A 3VATA 2FVGA 3H5ZA 3S9NA 3S6HA 3K2KA 4JJXA 4IIYA 1XMTA 4EMEA 3G8WA 3V38A 2QECA 4Y49B 3WT4A 3BHXA 3PP9A 3D3SA 1DIKA 1TKHA 1XF8A 4C7HA 4A2ZA 2V8DA 2IMOA 5G1ZA 1NBWA 1CBXA 1S3ZA 5JPHA 2PIZA 4CYOA 4MHYA 3HPGG 3SJEA 5G22A 4U5YA 4NGSA 4MJXA 4LQGA 2ZEEA 4M6IA 2G0BA 2PCUA 3K9UA 4AVCA 4KOVA 2WUUA 5I0CA 2B5GB 4C9AA 1ARLA 3D2MA 4KVOE 4J0NA 3DDDA 3FYNA 4JZ0A 2CNTA 2Z3PA 3D7FA 2HROA 3VGOA 2R82A 2DXQA 3G3SA 4CS0B 1NE9A 1RXTA 1PU9A 4H6UA 4U9ZA 2BUEA 2EK9A 5JM6A 2DF5A 1Y0YA 2GREA 3LODA 5LYLA 3FH4A 3JUWA 1GHEA 2ZENA 3LWUA 3DGVA 3H8GA 2DPTA 2Q4YA 4MI4A 4IUSA 3RAMA 3TOAA 4B5PB 2ZEPA 3TLBA 1LAMA 2P6FA 2Z3LA 1FNOA 4A38A 5IX3A 2OOTA 2X0SA 2XPOA 4C2ZA 1ZG7A 4Q38A 4IHMA 4ZY1A 3B3TA 1MJBA 5JQ4A 2ATRA 3TOBA 1X12A 3D7HA 5F1YA 2BCOA 1X10A 4KUAA 1ELMP 3WABA 1M4IA 3SXOA 5FD8A 3IJ3A 2P6EA 2B5GA 3FNCA 3K9TA 4NEXA 4C2YA 1S7NA 4M85A 4UFWA 3PFEA 1C3OB 3T9YA 4JD6A 3D7DA 3PGPA 1Y7RA 2JDCA 4BTFA 3CXQA 1CX8A 2N3AB 1QSNA 1PYTB 4KSFA 4YFJA 2J8NA 4XPDB 1FBVA 2V8VA 2F7VA 1U6MA 3VWDA 3BI1A 3RZAA 2Q51A 2Q44A 3CT9A 3LD2A 4I49A 4X5KA 3S6GA 4R57A 3E0KA 4A31A 4RUHA 3ZNIA 1YX0A 4ZBGA 3KR5A 1BOBA 3KQZA 3R96A 4KOWA 2B3UA 4PK3A 2FCKA 4L8AA 1IYKA 4NCZA 3T8WA 3TO6A 1KEEB 3SJGA 4UFVA 4P4IA 3R9FA 1ZO0A 2Q04A 1XFOA 1H8LA 3TO9A 3TX8A 1IY7A 1B47A 2O53A 3TYXA 3DR8A 3TLGB 4KUBA 4ZGYB 2Q7BA 4CAVA 1IU8A 3H8EA 1ZL0A 4WWVA 4C9RA 3VRPA 3D68A 3D8PA 3FXTA 3RO0A 4A4CA 2GANA 1LANA 1CPSA 1CG2A 1M4GA 4MXUA 1IIDA 2VXKA 3GY9A 4COBA 1QSMA 3ISZA 2FE7A 2PJ5A 2QIRA 3JVNA 4KVME 2DLAA 1YR0A 3OB1B 1V6CA 3W6SA 3T05A 3S9LA 4P45A 1L0CA 3B3SA 3MN8A 4C7IA 3HPHE 3PEIA 2OB0A 1NSAA 4P4JA 1ZG9A 2AFZA 2PDOA 4A95A 3MGDA 2OZHA 4G1PA 1LCPA 2B0AA 3RBUA 3KZWA 1Z8TA 4E5SA 3PLFB 5DWNA 1M6VB 3OAKA 3I9SA 4QUSA 5AG4A 2Z3MA 2PJAA 3B3VA 4OIDA 4MRIA 4XPDC 2R8VA 2OU2A 2RC4A 2O4HA 3U88C 2PJ7A 3CDXA 4PSXA 4UEEA 3KL9A 1NMTA 3DR6A 4PXCA 2B4BA 4NGPA 3KR4A 2UV8G 3DLJA 5CPAA 4MFQA 3ZZIA 3GUXA 4DJLA 2EWBA 1HDQA 4AXVA 4YU9A 5G21A 4PPZA 5JH9A 1PUAA 3VWEA 2C6CA 2C1CA 1AMPA 4JWPA 4MFJA 1ZG8A 4ORFA 2REEA 3TT2A 5HMNA 4A32A 3FJUA 1FT7A 3PB9X 5IB0A 1F2OA 4CYQA 3T0TA 4MFPA 5HKWA 2JBJA 2ZEFA 3H8FA 2PJ9A 5D29A 3IWEA 4F8ZA 3EXNA 4QC6A 4BBHA 2X7BA 2EZAA 1KUYA 3FF3A 2B4JC 2PR8A 2Z11A 1Q5XA 4K30A 4BMHA 1M1DA 4ZY0A 4HNXB 1M44A 4C9VA 1YLEA 1VHOA 4B5OA 4CAXA 4CGNA 4MCQA 1OBRA 3NH4A 4PXEA 4CGLA 4JYWA 4CYPA 2ZOGA 2EZCA 5J8CA 1Z8WA 3TE4A 5JGFA 4BPXB 5K8MA 3K4IA 5K8OA 1MJ9A 1VKCA 1YW6A 4Q7AA 2QVPA 3SR3A 2FS5A 2C5QA 1MJAA 2JLMA 3WC7A 3BUNB 3FVLA 3N5FA 1I21A 1IYLA 1BXRB 2PJ1A 1NSLA 1Q2YA 2CNMA 3NE7A 4A94A 2ZEGA 4B13A 3FEDA 1IGBA 3I3GA 4PXBA 4TJVA 1AYEA 2G9DA 4NSQA 5LYIA 2FM4A 2PJ3A 3PBEA 1S60A 1Q7LA 2Y0MA 1QQ9A 2C6PA 2B4DB 2JBKA 3P2FA 1C30B 4CGOA 3BJ8A 1OZPA 3R9EA 5J1QA 2H5MA 1EZBA 4KLVA 4M6HA 4EFDA 1SQHA 2AUMA 3S6KA 3TLAA 2VKZG 4P10A 4P44A 3BLNA 1XEBA 4C84A 1Z9UA 1CM0A 4PSWA 4FD6A 5FVJA 1XE4A 4MFKA 5D8NA 3VRQA 3HLPA 2QMLA 2PJ8A 4C99A 2PVVA 3A9LA 3PFOA 4M3SA 3BUMB 1EE3P 2OZGA 4MFZA 4C8TA 1Z2LA 1CS0B 1WK4A 3GYAA 1JDBC 1IOIA 2EK8A 3SI0A 3KHZA 2XEJA 3R1KA 2PQ8A 3CZXA 4MHPA 2G3TA 4CAFA 2YNDA 4MI1A 4AB7A 2D4OA 5AXIA 4GS4A 4FAIA 5F9MA 4UEFA 2CXAA 4CPAA 5GCNA 1V0CA 2PJ2A 3B7IA 4AVAA 4PK2A 2Q4ZA 1VHEA 4MHZA 4EWTA 3H4QA 4MY3A 3W91A 4Y49C 3EZEA 3VTAA 4C8AA 1BLLE 2FT0A 2CIJA 3FMCA 5LRGA 4OC1A 1TKJA 2R98A 2EUIA 3TFYA 2AJ6A 3OB2B 4KOUA 3LACA 1I12A 4TNUA 1ZRSA 4MCPA 4KNGE 3QAHA 2AFOA 1J4JA 4B5PA 3F0AA 2FSRA 2WPWA 3MRUA 3PFVA 1XMBA 4R9MA 3NOJA 3EIFA 2V8HA 3F8KA 4C8PA 1Y7EA 4B6ZA 2R7HA 4H6ZA 4INJA 1S5KA 4C68A 4PQAA 4NJQA 2V8GA 3NFZA 5ISVA 1NXJA 2AFXA 4F6AA 4BPUB 4HPSA 3U1BA 2DPSA 2PJCA 3B2YA 3JTKA 2FIWA 2ZW7A 4BPWB 3CPAA 3UY5A 2K5TA 1GYTA 4R7MA 1Y9ZA 3KRVA 5HKYA 5BWAB 3P2HA 4OC5A 3FRMA 4P4DA 4LQ6A 4DNCA 2Y1MA 1S7KA 2FIAA 4J3GA 2ABZA 4XNHB 2F8HA 3JRUA 4NJRA 3T07A 2AFSA 3W6XA 1Y0RA 4UEZA 5AG6A 5K8PA 2PE3A 2POKA 5F48A 1PCAA 3D7GA 2PR1A 3FECA 3RYOA 4OC2A 4CZ1A 1TIQA 4OMEA 2J8MA 1EZAA 2NMTA 1XJOA 4NGQA 2YJVA 3PZJA 2J8RA 3ICUA 1VI4A 1Z9EA 2D4PA 4FWUA 4C2XA 4R8FA 4UWJA 2ANPA 2GLJA 1YQEA 2YGWA 3GLJA 2PJBA 3WC6A 1M4LA 2VI7A 3EY5A 4ZI6A 1DE4C 5ELYA 5A28A 3PB6X 2XEFA 1CJWA 2G3AA 2HV2A 2ZXVA 4KOTA 4JLYA 2ZW6A 3TLGA 2D0OA 5LRJA 4CDKA 4B12A 5C88A 2XEGA 3I74A 4ZX9A 1HDUA 1RO5A 4C85A 1YGHA 1R43A 4H1HA 1WVMA 2V77A 4GPLB 4XPLA 4CDJA 3ISXA 4UWIA 4OADA 3VROA 4LX9A 4RN7A 4R6TA 7CPAA 2ZEDA 4KSAA 4L89A 4IF5A 2B3VA 1UWYA 3O8ZA 1VIXA 1ZLHA 4NGTA 2GIVA 3KI9A 2DIKA 4YN3A 1Z4EA 1ZLIA 2AFMA 5C82A 1IB1E 1A2ZA 1Z8XA 1KUXA 1R61A 4KORA 5I4MA 4C86A 4OKOA 4HNYB 4UFXA 4A39A 1Q2CA 2PRQA 4H89A 4ONWA 4CYNA 2HI6A 4OLLA 3ZJ0A 4B10A 1KZFA 1JWQA 3FB3A 4M6GA 4E8OA 4W9YA 2WSAA 3BUOB 2DEAA 1TF8A 2HB6A 2ZEOA 3D66A 1YMEA 5G20A 4M8DA 3NH5A 3EZBA 4CRYB 3DNSA 4DUKA 1ZYMA 1YVKA 4EYSA 4F9UA 4OP4A 1B6BA 1WJTA 4UCMA 2Q7SA 3TLCA 2OZUA 3VH9A 4EVYA 3WR7A 2FL4A 2HUZA 4MBUA 2Z10A 1WWZA 4UIAA 4IIXA 1IOFA 1LOKA 4MHDA 4WJBA 4AG9A 3IU1A 4AG7A 5H86A 8CPAA 3OWCA 2ZPAA 3S6FA 4HKFA 4CGPA 4YWYA 3BUXB 1CP6A 2I3CA 2VQYA 4F0YA 5JYBA 2PRBA 3PT1A 3BXMA 3I1UA 4B14A 1HEEA 3TLEA 3KGQA 3HMJG 4OC4A 1J3LA 2BL1A 4TWEA 1MK4A 5HKZA 4K3NA 3PB7X 5HH1A 4R76A 3D67A 2B58A 1S7FA 4JVOA 1YVHA 1ON0A 4FD7A 1GGOA 6CPAA 1IICA 3V8IA 4C8UA 4ONUA 2EZBA 3FX6A 4QVTA 1UFHA 3VRNA 1YREA 4YRHA 3PB4X 2WYRA 1BAVA 2KCWA 2Z3OA 2I79A 5F5XA 2Z0ZA 4CAEA 4ZYQA 5BY0A 1JDEA 1VBGA 4GM5A 2C6GA 1B87A 2QYVA 2XPNA 5J3XA 3SXNA 3B3WA 5HXDA 1VBHA 5LRKA 1Z5RA 2YNCA 1Q2DA 3V7ZA 3PBBA 1DTDA 3L2NA 4NGMA 2NSMA 2OH1A 4QB9A 2GLFA 2JDDA 5LYDA 4R3LA 1RTQA 1CE8B 4OC3A 4HNWB 2Y1NA 5K8NA 2R1IA 3B3CA 1XBUA 1TXRA 5AGEA 3KQXA 1KWMA 1YVOA 2GU2A 5CNPA 4KZTA 4FD4A 5KTCA 2P6GA 4AVBA 4COGA 3KHXA 2FXFA 1Y9KA 5EMIA 2PCNA 4C9EA 4JXRA 5IR2A 1M4DA 4ZY2A 4C8CA 2BO9A 2Z3KA 2EO8A 2VZYA 1KBLA 3IWWA 2HC9A 2OR4A 1CP7A 2B4DA 4MFLA 2ODFA 4UBRA 2YNCC 3IC1A 4PXDA 4FBEA 4GXHA 2WZNA 2C27A 2ZEHA 4A30A 3QAYA 2EVNA 2PC1A 3IIBA 4FUUA 4CO9A 4II9A 1AUGA 1LFWA 4E2AA 4F0XA 3N7ZA 2VEZA 3B8GA 3TLZA 4F9VA 2IQ6A 1S7LA 2Z3NA 3IWGA 3SHPA 5KTAA 3EC4A 4NXYA 1BPNA 1R57A 2ZW5A 3WC5A 1XF1A 4OIWA 4X2TA 4XPKA 3T90A 4CGMA 3CXSA 4RS2A 1K4JA 5EC4A 2HWGA 4MJ8A 3IO1A 4Q36A 2RB7A 5HVFA 4KOYA 4H2KA 4P6YA 4R87A 5AG5A 5F46A 2GE3A 2CY2A 3GJZA 2HQYA 3D4UA 2F5IA 2O28A 2VBQA 4IAVA 4MHNA 3KASA 1R3NA 3R9GA 1N71A 2PSWA 1VGYA 2ZELA 2ARHA 3LMSA 5LYFA 2D0PA 1YSJA 4IK2A 2CTCA 5IB9A 3R95A 4Z65A 3KKWA 4OC0A 1XIXA 4FD5A 4LUAA 1BPMA 2GFQA 3IU2A 3I6SA 2ZW4A 4RI1A 5F13A 2XPLA 1Z4RA 3B35A 3FEEA 3C26A 1Y9WA 4KOSA 4CRZB 4A4BA 2A4NA 3TCVA 1FY7A 2JEVA 1QSTA 2Q4VA 2CTBA 3DSBA 5J8FA 1A9XB 2EBJA 1TF9A 4UIBA 3SI2A 3TO7A 4NFRA 1TKFA 2AFUA 2XPPA 1Z8LA 4P4FA 2BSWA 2CNSA 2IJZA 4UF4A 4UCNA 3CPXA 3S9MA 2AE6A 5EBVA 5KTDA 3BJ7A 4A33A 1YK3A 2AUNA 3FIXA 2CBLA 5IV0A 4KOXA 3EO4A 5DS0A 2E28A 3T5MA 1QSRA 2PJ0A 3QB8A 4KS9A 4YGOA 2WPXA 2REFA 3IGRA 2BOAA 3VARA 3IFEA 4BD9A 1F57A 4X3RA 3EFAA 3TLYA 3D2PA 2PJ4A 1VHSA 1QSOA 1KC7A 1XRYA 4E0AA 5HVHA 4C8FA 5CBMA 1KUVA 5JVLA 4B11A 2QJ8A 2IL4A 2MP0A 3G23A 4JXQA 4P4EA 3VRRA 3C8OA 1ELLP 1CPXA 5F49A 3SJXA 3NE8A 1XOVA 4MCSA 1T36B 3TTHA 4NGRA 4UCPA 5AG7A 3CXPA 3PRTA 2CF4A 4TJXA 3EZAA 2I00A 3F5BA 1P4NA 4XNHC 3NA6A 2BEIA 5F47A 4P4BA 2Q0YA 3SJFA 1F2PA 2VL1A 2RFHA 3GKRA 2PVWA
chains in the Genus database with same CATH topology
1JQGA 3PB8X 3GB0A 2ZEMA 2PJ6A 4KSIA 2AFWA 1YLOA 3TC8A 3BI0A 2PIYA 1YW4A 4ZX8A 2GP4A 1LAPA 3QNVA 4O23A 4X8IA 4DYOA 3SI1A 4NGNA 3HUVA 2XEIA 5F09A 4A37A 1QMUA 2NYQA 4MMOA 5HVGA 2ZOFA 1ARMA 2JEWA 3IEHA 5THWA 3NH8A 4C9UA 2J9AA 4MCRA 2Q43A 3VATA 2FVGA 3S9NA 3K2KA 4EMEA 3V38A 3WT4A 3BHXA 1TKHA 2V8DA 2IMOA 1CBXA 2PIZA 4MHYA 3SJEA 4NGSA 4LQGA 2ZEEA 2PCUA 4C9AA 1ARLA 4JZ0A 3D7FA 5JM6A 2EK9A 1Y0YA 2GREA 5LYLA 3FH4A 2ZENA 3LWUA 3DGVA 3H8GA 3RAMA 2ZEPA 1LAMA 4A38A 1FNOA 2OOTA 1ZG7A 4IHMA 4ZY1A 3B3TA 3D7HA 2BCOA 3WABA 1ELMP 3IJ3A 3K9TA 3PFEA 3D7DA 1CX8A 1PYTB 2V8VA 2F7VA 3BI1A 2Q51A 3CT9A 5K8PA 4RUHA 3KR5A 3KQZA 3T8WA 3SJGA 4P4IA 1XFOA 1H8LA 3TX8A 1IY7A 2O53A 4C9RA 3H8EA 4WWVA 3D68A 1LANA 1CPSA 1CG2A 4MXUA 3ISZA 2PJ5A 1V6CA 3S9LA 4P45A 3B3SA 3MN8A 3PEIA 1NSAA 4P4JA 1ZG9A 2AFZA 4G1PA 1LCPA 3RBUA 3KZWA 2PJAA 3B3VA 4OIDA 4MRIA 4UEEA 2O4HA 2PJ7A 3CDXA 3KL9A 4PXCA 4NGPA 3KR4A 3DLJA 5CPAA 3GUXA 2EWBA 1HDQA 4AXVA 4PPZA 5JH9A 2C6CA 2C1CA 1AMPA 1ZG8A 3FJUA 1FT7A 3PB9X 1F2OA 2JBJA 2ZEFA 3H8FA 2PJ9A 5D29A 4F8ZA 3FF3A 4ZY0A 4C9VA 1VHOA 4MCQA 1OBRA 3NH4A 4PXEA 4JYWA 2ZOGA 5JGFA 5K8MA 5K8OA 1YW6A 4Q7AA 2QVPA 2C5QA 3WC7A 3FVLA 3N5FA 2PJ1A 4A94A 2ZEGA 3FEDA 1IGBA 4PXBA 4TJVA 1AYEA 2G9DA 5LYIA 2PJ3A 3PBEA 1Q7LA 1QQ9A 2C6PA 2JBKA 5J1QA 4EFDA 4P10A 4P44A 4C84A 5D8NA 3HLPA 2PJ8A 4C99A 2PVVA 3PFOA 1EE3P 4C8TA 1Z2LA 3SI0A 2EK8A 3KHZA 2XEJA 4MHPA 4FAIA 4UEFA 4CPAA 2PJ2A 3B7IA 2Q4ZA 1VHEA 4MHZA 4EWTA 3VTAA 4C8AA 1BLLE 2CIJA 3FMCA 5LRGA 4OC1A 1TKJA 4TNUA 4MCPA 4KNGE 2AFOA 3MRUA 1XMBA 3EIFA 2V8HA 4C8PA 1Y7EA 4B6ZA 4PQAA 4NJQA 2V8GA 3NFZA 2AFXA 2PJCA 3B2YA 3CPAA 1GYTA 4R7MA 1Y9ZA 4OC5A 4P4DA 2ABZA 2F8HA 3JRUA 4NJRA 2AFSA 1Y0RA 4UEZA 2PE3A 2POKA 1PCAA 3D7GA 3FECA 4OC2A 4OMEA 1XJOA 4NGQA 3ICUA 4FWUA 4R8FA 2ANPA 2GLJA 3GLJA 2PJBA 3WC6A 1M4LA 4ZI6A 1DE4C 5ELYA 3PB6X 2XEFA 5LRJA 4CDKA 2XEGA 3I74A 4ZX9A 1HDUA 4C85A 1R43A 1WVMA 2V77A 4CDJA 3ISXA 4R6TA 7CPAA 2ZEDA 1UWYA 1VIXA 1ZLHA 3KI9A 4NGTA 4YN3A 1ZLIA 2AFMA 5I4MA 4C86A 4OKOA 4A39A 2PRQA 4ONWA 4W9YA 2ZEOA 2DEAA 1TF8A 2HB6A 3D66A 1YMEA 3NH5A 4DUKA 4F9UA 4OP4A 3VH9A 4UIAA 4WJBA 1LOKA 8CPAA 4YWYA 1CP6A 2I3CA 3I1UA 3BXMA 1HEEA 3KGQA 4OC4A 4TWEA 4K3NA 3PB7X 4R76A 3D67A 6CPAA 4C8UA 3FX6A 3PB4X 2WYRA 1BAVA 4ZYQA 4GM5A 2C6GA 2QYVA 5HXDA 3B3WA 5LRKA 1Z5RA 3V7ZA 3PBBA 1DTDA 3L2NA 4NGMA 2NSMA 5LYDA 2GLFA 1RTQA 4OC3A 5K8NA 3B3CA 1XBUA 1TXRA 3KQXA 1KWMA 2GU2A 3KHXA 4C9EA 5IR2A 4ZY2A 4C8CA 2BO9A 3IWWA 2HC9A 2OR4A 1CP7A 3IC1A 4PXDA 4FBEA 2WZNA 2ZEHA 3IIBA 4FUUA 1LFWA 4F9VA 2IQ6A 3WC5A 1BPNA 1XF1A 4OIWA 4X2TA 3IO1A 2RB7A 5HVFA 4H2KA 4P6YA 3RZAA 3D4UA 4DJLA 4IAVA 4MHNA 3KASA 1R3NA 5LYFA 1VGYA 2ZELA 3LMSA 1YSJA 4IK2A 2CTCA 5IB9A 4Z65A 4OC0A 1BPMA 3I6SA 3B35A 3FEEA 2CTBA 1TF9A 4UIBA 3SI2A 4NFRA 1TKFA 2AFUA 4YU9A 1Z8LA 4P4FA 4UF4A 2IJZA 3CPXA 3S9MA 5DS0A 2PJ0A 4BD9A 3VARA 2BOAA 3IFEA 1F57A 4X3RA 2PJ4A 1XRYA 5HVHA 4C8FA 5CBMA 2QJ8A 4P4EA 1ELLP 1CPXA 3SJXA 4MCSA 4NGRA 3PRTA 2CF4A 4TJXA 3NA6A 4P4BA 3SJFA 1F2PA 2VL1A 2RFHA 2PVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQG A;  3PB8 X;  3GB0 A;  2ZEM A;  2PJ6 A;  4KSI A;  2AFW A;  1YLO A;  3TC8 A;  3BI0 A;  2PIY A;  1YW4 A;  4ZX8 A;  1LAP A;  3QNV A;  4O23 A;  4X8I A;  4DYO A;  3SI1 A;  4NGN A;  3HUV A;  2XEI A;  5F09 A;  4A37 A;  1QMU A;  2NYQ A;  4MMO A;  5HVG A;  2ZOF A;  1ARM A;  2JEW A;  3IEH A;  5THW A;  3NH8 A;  4C9U A;  2J9A A;  4MCR A;  2Q43 A;  3VAT A;  2FVG A;  3S9N A;  3K2K A;  4EME A;  3V38 A;  3WT4 A;  3BHX A;  1TKH A;  2V8D A;  2IMO A;  1CBX A;  2PIZ A;  4MHY A;  3SJE A;  4NGS A;  4LQG A;  2ZEE A;  2PCU A;  4C9A A;  1ARL A;  4JZ0 A;  3D7F A;  5JM6 A;  2EK9 A;  1Y0Y A;  2GRE A;  5LYL A;  3FH4 A;  2ZEN A;  3LWU A;  3DGV A;  3H8G A;  3RAM A;  2ZEP A;  1LAM A;  4A38 A;  1FNO A;  2OOT A;  1ZG7 A;  4IHM A;  4ZY1 A;  3B3T A;  3D7H A;  2BCO A;  3WAB A;  1ELM P;  3IJ3 A;  3K9T A;  3PFE A;  3D7D A;  1CX8 A;  1PYT B;  2V8V A;  2F7V A;  3BI1 A;  2Q51 A;  3CT9 A;  5K8P A;  4RUH A;  3KR5 A;  3KQZ A;  3T8W A;  3SJG A;  4P4I A;  1XFO A;  1H8L A;  3TX8 A;  1IY7 A;  2O53 A;  4C9R A;  3H8E A;  4WWV A;  3D68 A;  1LAN A;  1CPS A;  1CG2 A;  4MXU A;  3ISZ A;  2PJ5 A;  1V6C A;  3S9L A;  4P45 A;  3B3S A;  3MN8 A;  3PEI A;  1NSA A;  4P4J A;  1ZG9 A;  2AFZ A;  4G1P A;  1LCP A;  3RBU A;  3KZW A;  2PJA A;  3B3V A;  4OID A;  4MRI A;  4UEE A;  2O4H A;  2PJ7 A;  3CDX A;  3KL9 A;  4PXC A;  4NGP A;  3KR4 A;  3DLJ A;  5CPA A;  3GUX A;  2EWB A;  1HDQ A;  4AXV A;  4PPZ A;  5JH9 A;  2C6C A;  2C1C A;  1AMP A;  1ZG8 A;  3FJU A;  1FT7 A;  3PB9 X;  1F2O A;  2JBJ A;  2ZEF A;  3H8F A;  2PJ9 A;  5D29 A;  4F8Z A;  3FF3 A;  4ZY0 A;  4C9V A;  1VHO A;  4MCQ A;  1OBR A;  3NH4 A;  4PXE A;  4JYW A;  2ZOG A;  5JGF A;  5K8M A;  5K8O A;  1YW6 A;  4Q7A A;  2QVP A;  3WC7 A;  3FVL A;  3N5F A;  2PJ1 A;  4A94 A;  2ZEG A;  3FED A;  1IGB A;  4PXB A;  4TJV A;  1AYE A;  2G9D A;  5LYI A;  2PJ3 A;  3PBE A;  1Q7L A;  1QQ9 A;  2C6P A;  2JBK A;  5J1Q A;  4EFD A;  4P10 A;  4P44 A;  4C84 A;  5D8N A;  3HLP A;  2PJ8 A;  4C99 A;  2PVV A;  3PFO A;  1EE3 P;  4C8T A;  1Z2L A;  3SI0 A;  2EK8 A;  3KHZ A;  2XEJ A;  4MHP A;  4FAI A;  4UEF A;  4CPA A;  2PJ2 A;  3B7I A;  2Q4Z A;  1VHE A;  4MHZ A;  4EWT A;  3VTA A;  4C8A A;  1BLL E;  2CIJ A;  3FMC A;  5LRG A;  4OC1 A;  1TKJ A;  4TNU A;  4MCP A;  4KNG E;  2AFO A;  3MRU A;  1XMB A;  3EIF A;  2V8H A;  4C8P A;  1Y7E A;  4B6Z A;  4PQA A;  4NJQ A;  2V8G A;  3NFZ A;  2AFX A;  2PJC A;  3B2Y A;  3CPA A;  1GYT A;  4R7M A;  1Y9Z A;  4OC5 A;  4P4D A;  2ABZ A;  2F8H A;  3JRU A;  4NJR A;  2AFS A;  1Y0R A;  4UEZ A;  2PE3 A;  2POK A;  1PCA A;  3D7G A;  3FEC A;  4OC2 A;  4OME A;  1XJO A;  4NGQ A;  3ICU A;  4FWU A;  4R8F A;  2ANP A;  2GLJ A;  3GLJ A;  2PJB A;  3WC6 A;  1M4L A;  4ZI6 A;  1DE4 C;  5ELY A;  3PB6 X;  2XEF A;  5LRJ A;  4CDK A;  2XEG A;  3I74 A;  4ZX9 A;  1HDU A;  4C85 A;  1R43 A;  1WVM A;  2V77 A;  4CDJ A;  3ISX A;  4R6T A;  7CPA A;  2ZED A;  1UWY A;  1VIX A;  1ZLH A;  3KI9 A;  4NGT A;  4YN3 A;  1ZLI A;  2AFM A;  5I4M A;  4C86 A;  4OKO A;  4A39 A;  2PRQ A;  4ONW A;  4W9Y A;  2ZEO A;  2DEA A;  1TF8 A;  2HB6 A;  3D66 A;  1YME A;  3NH5 A;  4DUK A;  4F9U A;  4OP4 A;  3VH9 A;  4UIA A;  4WJB A;  1LOK A;  8CPA A;  4YWY A;  1CP6 A;  2I3C A;  3I1U A;  3BXM A;  1HEE A;  3KGQ A;  4OC4 A;  4TWE A;  4K3N A;  3PB7 X;  4R76 A;  3D67 A;  6CPA A;  4C8U A;  3FX6 A;  3PB4 X;  2WYR A;  1BAV A;  4ZYQ A;  4GM5 A;  2C6G A;  2QYV A;  5HXD A;  3B3W A;  5LRK A;  1Z5R A;  3V7Z A;  3PBB A;  1DTD A;  3L2N A;  4NGM A;  2NSM A;  5LYD A;  2GLF A;  1RTQ A;  4OC3 A;  5K8N A;  3B3C A;  1XBU A;  1TXR A;  3KQX A;  1KWM A;  2GU2 A;  3KHX A;  4C9E A;  4C8C A;  4ZY2 A;  2BO9 A;  3IWW A;  2HC9 A;  2OR4 A;  1CP7 A;  3IC1 A;  4PXD A;  4FBE A;  2WZN A;  2ZEH A;  3IIB A;  4FUU A;  1LFW A;  4F9V A;  2IQ6 A;  3WC5 A;  1BPN A;  1XF1 A;  4OIW A;  4X2T A;  3IO1 A;  2RB7 A;  5HVF A;  4H2K A;  4P6Y A;  3RZA A;  3D4U A;  4DJL A;  4IAV A;  4MHN A;  3KAS A;  1R3N A;  5LYF A;  1VGY A;  2ZEL A;  3LMS A;  1YSJ A;  4IK2 A;  2CTC A;  5IB9 A;  4Z65 A;  4OC0 A;  1BPM A;  3I6S A;  3B35 A;  3FEE A;  2CTB A;  1TF9 A;  4UIB A;  3SI2 A;  4NFR A;  1TKF A;  2AFU A;  4YU9 A;  1Z8L A;  4P4F A;  4UF4 A;  2IJZ A;  3CPX A;  3S9M A;  5DS0 A;  2PJ0 A;  4BD9 A;  3VAR A;  2BOA A;  3IFE A;  1F57 A;  4X3R A;  2PJ4 A;  1XRY A;  5HVH A;  4C8F A;  5CBM A;  2QJ8 A;  4P4E A;  1ELL P;  1CPX A;  3SJX A;  4MCS A;  4NGR A;  3PRT A;  2CF4 A;  4TJX A;  3NA6 A;  4P4B A;  3SJF A;  1F2P A;  2VL1 A;  2RFH A;  2PVW A; 
#chains in the Genus database with same CATH topology
 1JQG A;  3PB8 X;  3NFQ A;  5A27 A;  3GB0 A;  3GIU A;  2ZEM A;  3FBU A;  2PJ6 A;  4U9Y A;  4KSI A;  5DWM A;  2AFW A;  1YLO A;  3TC8 A;  3BI0 A;  3F9K C;  3BUW B;  2PIY A;  5E96 A;  5H84 A;  2YJT A;  4KLW A;  1YW4 A;  4NF1 A;  4ZX8 A;  4KVX A;  4CAW A;  2GP4 A;  1LAP A;  3QNV A;  4O23 A;  4X8I A;  4OAE A;  4BIN A;  4RR2 B;  3SI1 A;  4DYO A;  4MY0 A;  4R3K A;  3OP0 A;  4NGN A;  3RNZ A;  1EO0 A;  4QBJ A;  5K99 A;  2YNE A;  4UA3 A;  3HUV A;  2XEI A;  5F09 A;  4A37 A;  1QMU A;  2NYQ A;  4MMO A;  1LRZ A;  1P0H A;  1I1D A;  2VZZ A;  4E94 A;  5HVG A;  2P0W A;  2ZOF A;  1ARM A;  2JEW A;  3IEH A;  5THW A;  3NH8 A;  4C9U A;  2J9A A;  2OLS A;  1BO4 A;  4MCR A;  2Q43 A;  4PV6 A;  3VAT A;  2FVG A;  3H5Z A;  3S9N A;  3S6H A;  3K2K A;  4JJX A;  4IIY A;  1XMT A;  4EME A;  3G8W A;  3V38 A;  2QEC A;  4Y49 B;  3WT4 A;  3BHX A;  3PP9 A;  3D3S A;  1DIK A;  1TKH A;  1XF8 A;  4C7H A;  4A2Z A;  2V8D A;  2IMO A;  5G1Z A;  1NBW A;  1CBX A;  1S3Z A;  5JPH A;  2PIZ A;  4CYO A;  4MHY A;  3HPG G;  3SJE A;  5G22 A;  4U5Y A;  4NGS A;  4MJX A;  4LQG A;  2ZEE A;  4M6I A;  2G0B A;  2PCU A;  3K9U A;  4AVC A;  4KOV A;  2WUU A;  5I0C A;  2B5G B;  4C9A A;  1ARL A;  3D2M A;  4KVO E;  4J0N A;  3DDD A;  3FYN A;  4JZ0 A;  2CNT A;  2Z3P A;  3D7F A;  2HRO A;  3VGO A;  2R82 A;  2DXQ A;  3G3S A;  4CS0 B;  1NE9 A;  1RXT A;  1PU9 A;  4H6U A;  4U9Z A;  2BUE A;  2EK9 A;  5JM6 A;  2DF5 A;  1Y0Y A;  2GRE A;  3LOD A;  5LYL A;  3FH4 A;  3JUW A;  1GHE A;  2ZEN A;  3LWU A;  3DGV A;  3H8G A;  2DPT A;  2Q4Y A;  4MI4 A;  4IUS A;  3RAM A;  3TOA A;  4B5P B;  2ZEP A;  3TLB A;  1LAM A;  2P6F A;  2Z3L A;  1FNO A;  4A38 A;  5IX3 A;  2OOT A;  2X0S A;  2XPO A;  4C2Z A;  1ZG7 A;  4Q38 A;  4IHM A;  4ZY1 A;  3B3T A;  1MJB A;  5JQ4 A;  2ATR A;  3TOB A;  1X12 A;  3D7H A;  5F1Y A;  2BCO A;  1X10 A;  4KUA A;  1ELM P;  3WAB A;  1M4I A;  3SXO A;  5FD8 A;  3IJ3 A;  2P6E A;  2B5G A;  3FNC A;  3K9T A;  4NEX A;  4C2Y A;  1S7N A;  4M85 A;  4UFW A;  3PFE A;  1C3O B;  3T9Y A;  4JD6 A;  3D7D A;  3PGP A;  1Y7R A;  2JDC A;  4BTF A;  3CXQ A;  1CX8 A;  2N3A B;  1QSN A;  1PYT B;  4KSF A;  4YFJ A;  2J8N A;  4XPD B;  1FBV A;  2V8V A;  2F7V A;  1U6M A;  3VWD A;  3BI1 A;  3RZA A;  2Q51 A;  2Q44 A;  3CT9 A;  3LD2 A;  4I49 A;  4X5K A;  3S6G A;  4R57 A;  3E0K A;  4A31 A;  4RUH A;  3ZNI A;  1YX0 A;  4ZBG A;  3KR5 A;  1BOB A;  3KQZ A;  3R96 A;  4KOW A;  2B3U A;  4PK3 A;  2FCK A;  4L8A A;  1IYK A;  4NCZ A;  3T8W A;  3TO6 A;  1KEE B;  3SJG A;  4UFV A;  4P4I A;  3R9F A;  1ZO0 A;  2Q04 A;  1XFO A;  1H8L A;  3TO9 A;  3TX8 A;  1IY7 A;  1B47 A;  2O53 A;  3TYX A;  3DR8 A;  3TLG B;  4KUB A;  4ZGY B;  2Q7B A;  4CAV A;  1IU8 A;  3H8E A;  1ZL0 A;  4WWV A;  4C9R A;  3VRP A;  3D68 A;  3D8P A;  3FXT A;  3RO0 A;  4A4C A;  2GAN A;  1LAN A;  1CPS A;  1CG2 A;  1M4G A;  4MXU A;  1IID A;  2VXK A;  3GY9 A;  4COB A;  1QSM A;  3ISZ A;  2FE7 A;  2PJ5 A;  2QIR A;  3JVN A;  4KVM E;  2DLA A;  1YR0 A;  3OB1 B;  1V6C A;  3W6S A;  3T05 A;  3S9L A;  4P45 A;  1L0C A;  3B3S A;  3MN8 A;  4C7I A;  3HPH E;  3PEI A;  2OB0 A;  1NSA A;  4P4J A;  1ZG9 A;  2AFZ A;  2PDO A;  4A95 A;  3MGD A;  2OZH A;  4G1P A;  1LCP A;  2B0A A;  3RBU A;  3KZW A;  1Z8T A;  4E5S A;  3PLF B;  5DWN A;  1M6V B;  3OAK A;  3I9S A;  4QUS A;  5AG4 A;  2Z3M A;  2PJA A;  3B3V A;  4OID A;  4MRI A;  4XPD C;  2R8V A;  2OU2 A;  2RC4 A;  2O4H A;  3U88 C;  2PJ7 A;  3CDX A;  4PSX A;  4UEE A;  3KL9 A;  1NMT A;  3DR6 A;  4PXC A;  2B4B A;  4NGP A;  3KR4 A;  2UV8 G;  3DLJ A;  5CPA A;  4MFQ A;  3ZZI A;  3GUX A;  4DJL A;  2EWB A;  1HDQ A;  4AXV A;  4YU9 A;  5G21 A;  4PPZ A;  5JH9 A;  1PUA A;  3VWE A;  2C6C A;  2C1C A;  1AMP A;  4JWP A;  4MFJ A;  1ZG8 A;  4ORF A;  2REE A;  3TT2 A;  5HMN A;  4A32 A;  3FJU A;  1FT7 A;  3PB9 X;  5IB0 A;  1F2O A;  4CYQ A;  3T0T A;  4MFP A;  5HKW A;  2JBJ A;  2ZEF A;  3H8F A;  2PJ9 A;  5D29 A;  3IWE A;  4F8Z A;  3EXN A;  4QC6 A;  4BBH A;  2X7B A;  2EZA A;  1KUY A;  3FF3 A;  2B4J C;  2PR8 A;  2Z11 A;  1Q5X A;  4K30 A;  4BMH A;  1M1D A;  4ZY0 A;  4HNX B;  1M44 A;  4C9V A;  1YLE A;  1VHO A;  4B5O A;  4CAX A;  4CGN A;  4MCQ A;  1OBR A;  3NH4 A;  4PXE A;  4CGL A;  4JYW A;  4CYP A;  2ZOG A;  2EZC A;  5J8C A;  1Z8W A;  3TE4 A;  5JGF A;  4BPX B;  5K8M A;  3K4I A;  5K8O A;  1MJ9 A;  1VKC A;  1YW6 A;  4Q7A A;  2QVP A;  3SR3 A;  2FS5 A;  2C5Q A;  1MJA A;  2JLM A;  3WC7 A;  3BUN B;  3FVL A;  3N5F A;  1I21 A;  1IYL A;  1BXR B;  2PJ1 A;  1NSL A;  1Q2Y A;  2CNM A;  3NE7 A;  4A94 A;  2ZEG A;  4B13 A;  3FED A;  1IGB A;  3I3G A;  4PXB A;  4TJV A;  1AYE A;  2G9D A;  4NSQ A;  5LYI A;  2FM4 A;  2PJ3 A;  3PBE A;  1S60 A;  1Q7L A;  2Y0M A;  1QQ9 A;  2C6P A;  2B4D B;  2JBK A;  3P2F A;  1C30 B;  4CGO A;  3BJ8 A;  1OZP A;  3R9E A;  5J1Q A;  2H5M A;  1EZB A;  4KLV A;  4M6H A;  4EFD A;  1SQH A;  2AUM A;  3S6K A;  3TLA A;  2VKZ G;  4P10 A;  4P44 A;  3BLN A;  1XEB A;  4C84 A;  1Z9U A;  1CM0 A;  4PSW A;  4FD6 A;  5FVJ A;  1XE4 A;  4MFK A;  5D8N A;  3VRQ A;  3HLP A;  2QML A;  2PJ8 A;  4C99 A;  2PVV A;  3A9L A;  3PFO A;  4M3S A;  3BUM B;  1EE3 P;  2OZG A;  4MFZ A;  4C8T A;  1Z2L A;  1CS0 B;  1WK4 A;  3GYA A;  1JDB C;  1IOI A;  2EK8 A;  3SI0 A;  3KHZ A;  2XEJ A;  3R1K A;  2PQ8 A;  3CZX A;  4MHP A;  2G3T A;  4CAF A;  2YND A;  4MI1 A;  4AB7 A;  2D4O A;  5AXI A;  4GS4 A;  4FAI A;  5F9M A;  4UEF A;  2CXA A;  4CPA A;  5GCN A;  1V0C A;  2PJ2 A;  3B7I A;  4AVA A;  4PK2 A;  2Q4Z A;  1VHE A;  4MHZ A;  4EWT A;  3H4Q A;  4MY3 A;  3W91 A;  4Y49 C;  3EZE A;  3VTA A;  4C8A A;  1BLL E;  2FT0 A;  2CIJ A;  3FMC A;  5LRG A;  4OC1 A;  1TKJ A;  2R98 A;  2EUI A;  3TFY A;  2AJ6 A;  3OB2 B;  4KOU A;  3LAC A;  1I12 A;  4TNU A;  1ZRS A;  4MCP A;  4KNG E;  3QAH A;  2AFO A;  1J4J A;  4B5P A;  3F0A A;  2FSR A;  2WPW A;  3MRU A;  3PFV A;  1XMB A;  4R9M A;  3NOJ A;  3EIF A;  2V8H A;  3F8K A;  4C8P A;  1Y7E A;  4B6Z A;  2R7H A;  4H6Z A;  4INJ A;  1S5K A;  4C68 A;  4PQA A;  4NJQ A;  2V8G A;  3NFZ A;  5ISV A;  1NXJ A;  2AFX A;  4F6A A;  4BPU B;  4HPS A;  3U1B A;  2DPS A;  2PJC A;  3B2Y A;  3JTK A;  2FIW A;  2ZW7 A;  4BPW B;  3CPA A;  3UY5 A;  2K5T A;  1GYT A;  4R7M A;  1Y9Z A;  3KRV A;  5HKY A;  5BWA B;  3P2H A;  4OC5 A;  3FRM A;  4P4D A;  4LQ6 A;  4DNC A;  2Y1M A;  1S7K A;  2FIA A;  4J3G A;  2ABZ A;  4XNH B;  2F8H A;  3JRU A;  4NJR A;  3T07 A;  2AFS A;  3W6X A;  1Y0R A;  4UEZ A;  5AG6 A;  5K8P A;  2PE3 A;  2POK A;  5F48 A;  1PCA A;  3D7G A;  2PR1 A;  3FEC A;  3RYO A;  4OC2 A;  4CZ1 A;  1TIQ A;  4OME A;  2J8M A;  1EZA A;  2NMT A;  1XJO A;  4NGQ A;  2YJV A;  3PZJ A;  2J8R A;  3ICU A;  1VI4 A;  1Z9E A;  2D4P A;  4FWU A;  4C2X A;  4R8F A;  4UWJ A;  2ANP A;  2GLJ A;  1YQE A;  2YGW A;  3GLJ A;  2PJB A;  3WC6 A;  1M4L A;  2VI7 A;  3EY5 A;  4ZI6 A;  1DE4 C;  5ELY A;  5A28 A;  3PB6 X;  2XEF A;  1CJW A;  2G3A A;  2HV2 A;  2ZXV A;  4KOT A;  4JLY A;  2ZW6 A;  3TLG A;  2D0O A;  5LRJ A;  4CDK A;  4B12 A;  5C88 A;  2XEG A;  3I74 A;  4ZX9 A;  1HDU A;  1RO5 A;  4C85 A;  1YGH A;  1R43 A;  4H1H A;  1WVM A;  2V77 A;  4GPL B;  4XPL A;  4CDJ A;  3ISX A;  4UWI A;  4OAD A;  3VRO A;  4LX9 A;  4RN7 A;  4R6T A;  7CPA A;  2ZED A;  4KSA A;  4L89 A;  4IF5 A;  2B3V A;  1UWY A;  3O8Z A;  1VIX A;  1ZLH A;  4NGT A;  2GIV A;  3KI9 A;  2DIK A;  4YN3 A;  1Z4E A;  1ZLI A;  2AFM A;  5C82 A;  1IB1 E;  1A2Z A;  1Z8X A;  1KUX A;  1R61 A;  4KOR A;  5I4M A;  4C86 A;  4OKO A;  4HNY B;  4UFX A;  4A39 A;  1Q2C A;  2PRQ A;  4H89 A;  4ONW A;  4CYN A;  2HI6 A;  4OLL A;  3ZJ0 A;  4B10 A;  1KZF A;  1JWQ A;  3FB3 A;  4M6G A;  4E8O A;  4W9Y A;  2WSA A;  3BUO B;  2DEA A;  1TF8 A;  2HB6 A;  2ZEO A;  3D66 A;  1YME A;  5G20 A;  4M8D A;  3NH5 A;  3EZB A;  4CRY B;  3DNS A;  4DUK A;  1ZYM A;  1YVK A;  4EYS A;  4F9U A;  4OP4 A;  1B6B A;  1WJT A;  4UCM A;  2Q7S A;  3TLC A;  2OZU A;  3VH9 A;  4EVY A;  3WR7 A;  2FL4 A;  2HUZ A;  4MBU A;  2Z10 A;  1WWZ A;  4UIA A;  4IIX A;  1IOF A;  1LOK A;  4MHD A;  4WJB A;  4AG9 A;  3IU1 A;  4AG7 A;  5H86 A;  8CPA A;  3OWC A;  2ZPA A;  3S6F A;  4HKF A;  4CGP A;  4YWY A;  3BUX B;  1CP6 A;  2I3C A;  2VQY A;  4F0Y A;  5JYB A;  2PRB A;  3PT1 A;  3BXM A;  3I1U A;  4B14 A;  1HEE A;  3TLE A;  3KGQ A;  3HMJ G;  4OC4 A;  1J3L A;  2BL1 A;  4TWE A;  1MK4 A;  5HKZ A;  4K3N A;  3PB7 X;  5HH1 A;  4R76 A;  3D67 A;  2B58 A;  1S7F A;  4JVO A;  1YVH A;  1ON0 A;  4FD7 A;  1GGO A;  6CPA A;  1IIC A;  3V8I A;  4C8U A;  4ONU A;  2EZB A;  3FX6 A;  4QVT A;  1UFH A;  3VRN A;  1YRE A;  4YRH A;  3PB4 X;  2WYR A;  1BAV A;  2KCW A;  2Z3O A;  2I79 A;  5F5X A;  2Z0Z A;  4CAE A;  4ZYQ A;  5BY0 A;  1JDE A;  1VBG A;  4GM5 A;  2C6G A;  1B87 A;  2QYV A;  2XPN A;  5J3X A;  3SXN A;  3B3W A;  5HXD A;  1VBH A;  5LRK A;  1Z5R A;  2YNC A;  1Q2D A;  3V7Z A;  3PBB A;  1DTD A;  3L2N A;  4NGM A;  2NSM A;  2OH1 A;  4QB9 A;  2GLF A;  2JDD A;  5LYD A;  4R3L A;  1RTQ A;  1CE8 B;  4OC3 A;  4HNW B;  2Y1N A;  5K8N A;  2R1I A;  3B3C A;  1XBU A;  1TXR A;  5AGE A;  3KQX A;  1KWM A;  1YVO A;  2GU2 A;  5CNP A;  4KZT A;  4FD4 A;  5KTC A;  2P6G A;  4AVB A;  4COG A;  3KHX A;  2FXF A;  1Y9K A;  5EMI A;  2PCN A;  4C9E A;  4JXR A;  5IR2 A;  1M4D A;  4ZY2 A;  4C8C A;  2BO9 A;  2Z3K A;  2EO8 A;  2VZY A;  1KBL A;  3IWW A;  2HC9 A;  2OR4 A;  1CP7 A;  2B4D A;  4MFL A;  2ODF A;  4UBR A;  2YNC C;  3IC1 A;  4PXD A;  4FBE A;  4GXH A;  2WZN A;  2C27 A;  2ZEH A;  4A30 A;  3QAY A;  2EVN A;  2PC1 A;  3IIB A;  4FUU A;  4CO9 A;  4II9 A;  1AUG A;  1LFW A;  4E2A A;  4F0X A;  3N7Z A;  2VEZ A;  3B8G A;  3TLZ A;  4F9V A;  2IQ6 A;  1S7L A;  2Z3N A;  3IWG A;  3SHP A;  5KTA A;  3EC4 A;  4NXY A;  1BPN A;  1R57 A;  2ZW5 A;  3WC5 A;  1XF1 A;  4OIW A;  4X2T A;  4XPK A;  3T90 A;  4CGM A;  3CXS A;  4RS2 A;  1K4J A;  5EC4 A;  2HWG A;  4MJ8 A;  3IO1 A;  4Q36 A;  2RB7 A;  5HVF A;  4KOY A;  4H2K A;  4P6Y A;  4R87 A;  5AG5 A;  5F46 A;  2GE3 A;  2CY2 A;  3GJZ A;  2HQY A;  3D4U A;  2F5I A;  2O28 A;  2VBQ A;  4IAV A;  4MHN A;  3KAS A;  1R3N A;  3R9G A;  1N71 A;  2PSW A;  1VGY A;  2ZEL A;  2ARH A;  3LMS A;  5LYF A;  2D0P A;  1YSJ A;  4IK2 A;  2CTC A;  5IB9 A;  3R95 A;  4Z65 A;  3KKW A;  4OC0 A;  1XIX A;  4FD5 A;  4LUA A;  1BPM A;  2GFQ A;  3IU2 A;  3I6S A;  2ZW4 A;  4RI1 A;  5F13 A;  2XPL A;  1Z4R A;  3B35 A;  3FEE A;  3C26 A;  1Y9W A;  4KOS A;  4CRZ B;  4A4B A;  2A4N A;  3TCV A;  1FY7 A;  2JEV A;  1QST A;  2Q4V A;  2CTB A;  3DSB A;  5J8F A;  1A9X B;  2EBJ A;  1TF9 A;  4UIB A;  3SI2 A;  3TO7 A;  4NFR A;  1TKF A;  2AFU A;  2XPP A;  1Z8L A;  4P4F A;  2BSW A;  2CNS A;  2IJZ A;  4UF4 A;  4UCN A;  3CPX A;  3S9M A;  2AE6 A;  5EBV A;  5KTD A;  3BJ7 A;  4A33 A;  1YK3 A;  2AUN A;  3FIX A;  2CBL A;  5IV0 A;  4KOX A;  3EO4 A;  5DS0 A;  2E28 A;  3T5M A;  1QSR A;  2PJ0 A;  3QB8 A;  4KS9 A;  4YGO A;  2WPX A;  2REF A;  3IGR A;  2BOA A;  3VAR A;  3IFE A;  4BD9 A;  1F57 A;  4X3R A;  3EFA A;  3TLY A;  3D2P A;  2PJ4 A;  1VHS A;  1QSO A;  1KC7 A;  1XRY A;  4E0A A;  5HVH A;  4C8F A;  5CBM A;  1KUV A;  5JVL A;  4B11 A;  2QJ8 A;  2IL4 A;  2MP0 A;  3G23 A;  4JXQ A;  4P4E A;  3VRR A;  3C8O A;  1ELL P;  1CPX A;  5F49 A;  3SJX A;  3NE8 A;  1XOV A;  4MCS A;  1T36 B;  3TTH A;  4NGR A;  4UCP A;  5AG7 A;  3CXP A;  3PRT A;  2CF4 A;  4TJX A;  3EZA A;  2I00 A;  3F5B A;  1P4N A;  4XNH C;  3NA6 A;  2BEI A;  5F47 A;  4P4B A;  2Q0Y A;  3SJF A;  1F2P A;  2VL1 A;  2RFH A;  3GKR A;  2PVW A; 
#chains in the Genus database with same CATH homology
 1JQG A;  3PB8 X;  3GB0 A;  2ZEM A;  2PJ6 A;  4KSI A;  2AFW A;  1YLO A;  3TC8 A;  3BI0 A;  2PIY A;  1YW4 A;  4ZX8 A;  2GP4 A;  1LAP A;  3QNV A;  4O23 A;  4X8I A;  4DYO A;  3SI1 A;  4NGN A;  3HUV A;  2XEI A;  5F09 A;  4A37 A;  1QMU A;  2NYQ A;  4MMO A;  5HVG A;  2ZOF A;  1ARM A;  2JEW A;  3IEH A;  5THW A;  3NH8 A;  4C9U A;  2J9A A;  4MCR A;  2Q43 A;  3VAT A;  2FVG A;  3S9N A;  3K2K A;  4EME A;  3V38 A;  3WT4 A;  3BHX A;  1TKH A;  2V8D A;  2IMO A;  1CBX A;  2PIZ A;  4MHY A;  3SJE A;  4NGS A;  4LQG A;  2ZEE A;  2PCU A;  4C9A A;  1ARL A;  4JZ0 A;  3D7F A;  5JM6 A;  2EK9 A;  1Y0Y A;  2GRE A;  5LYL A;  3FH4 A;  2ZEN A;  3LWU A;  3DGV A;  3H8G A;  3RAM A;  2ZEP A;  1LAM A;  4A38 A;  1FNO A;  2OOT A;  1ZG7 A;  4IHM A;  4ZY1 A;  3B3T A;  3D7H A;  2BCO A;  3WAB A;  1ELM P;  3IJ3 A;  3K9T A;  3PFE A;  3D7D A;  1CX8 A;  1PYT B;  2V8V A;  2F7V A;  3BI1 A;  2Q51 A;  3CT9 A;  5K8P A;  4RUH A;  3KR5 A;  3KQZ A;  3T8W A;  3SJG A;  4P4I A;  1XFO A;  1H8L A;  3TX8 A;  1IY7 A;  2O53 A;  4C9R A;  3H8E A;  4WWV A;  3D68 A;  1LAN A;  1CPS A;  1CG2 A;  4MXU A;  3ISZ A;  2PJ5 A;  1V6C A;  3S9L A;  4P45 A;  3B3S A;  3MN8 A;  3PEI A;  1NSA A;  4P4J A;  1ZG9 A;  2AFZ A;  4G1P A;  1LCP A;  3RBU A;  3KZW A;  2PJA A;  3B3V A;  4OID A;  4MRI A;  4UEE A;  2O4H A;  2PJ7 A;  3CDX A;  3KL9 A;  4PXC A;  4NGP A;  3KR4 A;  3DLJ A;  5CPA A;  3GUX A;  2EWB A;  1HDQ A;  4AXV A;  4PPZ A;  5JH9 A;  2C6C A;  2C1C A;  1AMP A;  1ZG8 A;  3FJU A;  1FT7 A;  3PB9 X;  1F2O A;  2JBJ A;  2ZEF A;  3H8F A;  2PJ9 A;  5D29 A;  4F8Z A;  3FF3 A;  4ZY0 A;  4C9V A;  1VHO A;  4MCQ A;  1OBR A;  3NH4 A;  4PXE A;  4JYW A;  2ZOG A;  5JGF A;  5K8M A;  5K8O A;  1YW6 A;  4Q7A A;  2QVP A;  2C5Q A;  3WC7 A;  3FVL A;  3N5F A;  2PJ1 A;  4A94 A;  2ZEG A;  3FED A;  1IGB A;  4PXB A;  4TJV A;  1AYE A;  2G9D A;  5LYI A;  2PJ3 A;  3PBE A;  1Q7L A;  1QQ9 A;  2C6P A;  2JBK A;  5J1Q A;  4EFD A;  4P10 A;  4P44 A;  4C84 A;  5D8N A;  3HLP A;  2PJ8 A;  4C99 A;  2PVV A;  3PFO A;  1EE3 P;  4C8T A;  1Z2L A;  3SI0 A;  2EK8 A;  3KHZ A;  2XEJ A;  4MHP A;  4FAI A;  4UEF A;  4CPA A;  2PJ2 A;  3B7I A;  2Q4Z A;  1VHE A;  4MHZ A;  4EWT A;  3VTA A;  4C8A A;  1BLL E;  2CIJ A;  3FMC A;  5LRG A;  4OC1 A;  1TKJ A;  4TNU A;  4MCP A;  4KNG E;  2AFO A;  3MRU A;  1XMB A;  3EIF A;  2V8H A;  4C8P A;  1Y7E A;  4B6Z A;  4PQA A;  4NJQ A;  2V8G A;  3NFZ A;  2AFX A;  2PJC A;  3B2Y A;  3CPA A;  1GYT A;  4R7M A;  1Y9Z A;  4OC5 A;  4P4D A;  2ABZ A;  2F8H A;  3JRU A;  4NJR A;  2AFS A;  1Y0R A;  4UEZ A;  2PE3 A;  2POK A;  1PCA A;  3D7G A;  3FEC A;  4OC2 A;  4OME A;  1XJO A;  4NGQ A;  3ICU A;  4FWU A;  4R8F A;  2ANP A;  2GLJ A;  3GLJ A;  2PJB A;  3WC6 A;  1M4L A;  4ZI6 A;  1DE4 C;  5ELY A;  3PB6 X;  2XEF A;  5LRJ A;  4CDK A;  2XEG A;  3I74 A;  4ZX9 A;  1HDU A;  4C85 A;  1R43 A;  1WVM A;  2V77 A;  4CDJ A;  3ISX A;  4R6T A;  7CPA A;  2ZED A;  1UWY A;  1VIX A;  1ZLH A;  3KI9 A;  4NGT A;  4YN3 A;  1ZLI A;  2AFM A;  5I4M A;  4C86 A;  4OKO A;  4A39 A;  2PRQ A;  4ONW A;  4W9Y A;  2ZEO A;  2DEA A;  1TF8 A;  2HB6 A;  3D66 A;  1YME A;  3NH5 A;  4DUK A;  4F9U A;  4OP4 A;  3VH9 A;  4UIA A;  4WJB A;  1LOK A;  8CPA A;  4YWY A;  1CP6 A;  2I3C A;  3I1U A;  3BXM A;  1HEE A;  3KGQ A;  4OC4 A;  4TWE A;  4K3N A;  3PB7 X;  4R76 A;  3D67 A;  6CPA A;  4C8U A;  3FX6 A;  3PB4 X;  2WYR A;  1BAV A;  4ZYQ A;  4GM5 A;  2C6G A;  2QYV A;  5HXD A;  3B3W A;  5LRK A;  1Z5R A;  3V7Z A;  3PBB A;  1DTD A;  3L2N A;  4NGM A;  2NSM A;  5LYD A;  2GLF A;  1RTQ A;  4OC3 A;  5K8N A;  3B3C A;  1XBU A;  1TXR A;  3KQX A;  1KWM A;  2GU2 A;  3KHX A;  4C9E A;  5IR2 A;  4ZY2 A;  4C8C A;  2BO9 A;  3IWW A;  2HC9 A;  2OR4 A;  1CP7 A;  3IC1 A;  4PXD A;  4FBE A;  2WZN A;  2ZEH A;  3IIB A;  4FUU A;  1LFW A;  4F9V A;  2IQ6 A;  3WC5 A;  1BPN A;  1XF1 A;  4OIW A;  4X2T A;  3IO1 A;  2RB7 A;  5HVF A;  4H2K A;  4P6Y A;  3RZA A;  3D4U A;  4DJL A;  4IAV A;  4MHN A;  3KAS A;  1R3N A;  5LYF A;  1VGY A;  2ZEL A;  3LMS A;  1YSJ A;  4IK2 A;  2CTC A;  5IB9 A;  4Z65 A;  4OC0 A;  1BPM A;  3I6S A;  3B35 A;  3FEE A;  2CTB A;  1TF9 A;  4UIB A;  3SI2 A;  4NFR A;  1TKF A;  2AFU A;  4YU9 A;  1Z8L A;  4P4F A;  4UF4 A;  2IJZ A;  3CPX A;  3S9M A;  5DS0 A;  2PJ0 A;  4BD9 A;  3VAR A;  2BOA A;  3IFE A;  1F57 A;  4X3R A;  2PJ4 A;  1XRY A;  5HVH A;  4C8F A;  5CBM A;  2QJ8 A;  4P4E A;  1ELL P;  1CPX A;  3SJX A;  4MCS A;  4NGR A;  3PRT A;  2CF4 A;  4TJX A;  3NA6 A;  4P4B A;  3SJF A;  1F2P A;  2VL1 A;  2RFH A;  2PVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...