4NGTA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 252
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngtA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngtA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngtA02
4DUKA 5D8NA 7CPAA 1ELMP 4FUUA 1YSJA 2GLJA 3KQXA 2V77A 3FX6A 5K8NA 3B3SA 3PB8X 3H8FA 3PFEA 2PJ3A 4P4FA 4R6TA 2PJBA 2C6CA 2O4HA 3CDXA 5JH9A 5K8MA 4EWTA 3CT9A 1QMUA 4MHNA 1TKJA 3BHXA 1F57A 2FVGA 2PCUA 4FWUA 1BPNA 1F2PA 5ELYA 2I3CA 4MCRA 3FECA 1TKHA 2V8GA 3VH9A 1ZLIA 4IAVA 3SJEA 1Q7LA 2HB6A 4C9EA 4Q7AA 3D7FA 3GB0A 3SI2A 4NGMA 2CTBA 2IMOA 4JYWA 2GREA 4MHZA 3S9NA 3CPXA 2PVVA 1VIXA 3PEIA 4C8AA 1ZG9A 2ZEOA 1LAMA 3HUVA 4UIBA 4MXUA 3I6SA 2EK9A 1NSAA 1Y0YA 5J1QA 3GLJA 3SJGA 2PJ5A 2BOAA 8CPAA 2PJ0A 2IQ6A 4FAIA 2PVWA 4FBEA 4EMEA 1ELLP 1BAVA 4ZY1A 2JEWA 3D7GA 4UEZA 1XMBA 3QNVA 2PIZA 1LOKA 4H2KA 4TJXA 4W9YA 3B35A 1PYTB 2OR4A 3WT4A 4MMOA 5CBMA 4NGRA 2ZELA 4C8TA 4OC3A 3NH4A 3D7DA 3IEHA 5I4MA 5F09A 2EWBA 4OMEA 3MN8A 1TXRA 1XBUA 4GM5A 2Q4ZA 3JRUA 3TC8A 4C9UA 4R76A 1ZG7A 1AYEA 4C99A 4BD9A 4F8ZA 1XRYA 3SJFA 1HDUA 2PJAA 4OKOA 4IK2A 4EFDA 4CPAA 3KI9A 1Z5RA 4C85A 3IIBA 1VHEA 3B3WA 3LMSA 1YW6A 4TWEA 5HVGA 3PB9X 2V8HA 2ZEEA 1Y7EA 3K9TA 1HEEA 1CPSA 2AFWA 2F8HA 1LANA 3NH8A 5THWA 4MCPA 2AFUA 2NSMA 3KGQA 4NGSA 2EK8A 4KNGE 2XEJA 1CBXA 3GUXA 4YWYA 4RUHA 4F9UA 1IGBA 3V38A 2DEAA 3KHXA 1XFOA 1YMEA 4PQAA 4OC4A 4OIWA 1ARLA 1Z2LA 3FMCA 4C8PA 3PFOA 3ICUA 2PIYA 1KWMA 1TF9A 4ZY0A 1TF8A 1YLOA 3FEEA 3PRTA 3SI1A 2ANPA 2VL1A 3ISZA 2O53A 3S9LA 3IJ3A 2QJ8A 4NGPA 4MHPA 3VATA 4NGQA 2PJCA 3T8WA 4MHYA 3RZAA 3FF3A 1LCPA 2CTCA 5LYFA 3FH4A 4R8FA 4UEEA 3VARA 3PB4X 4OC0A 4A94A 3BI1A 3D4UA 4C9AA 2ZEMA 1F2OA 3DGVA 2BCOA 2XEGA 4A39A 4O23A 1VHOA 4OC2A 1HDQA 1XJOA 2ABZA 3B3VA 3RBUA 2GLFA 4P6YA 1V6CA 3H8EA 3WC6A 2QVPA 4DYOA 4CDJA 2ZEPA 4A38A 3KQZA 3TX8A 4TNUA 3L2NA 1LAPA 4A37A 4OIDA 3EIFA 3I1UA 1YW4A 4PXEA 4P4BA 2WZNA 2PJ4A 3FJUA 1CG2A 1QQ9A 2NYQA 1TKFA 2GU2A 3D67A 4G1PA 3B7IA 4X2TA 4P44A 3IWWA 2AFZA 5K8OA 1DE4C 4ZX8A 1OBRA 4MRIA 2ZENA 1FNOA 1R43A 3HLPA 2AFOA 2C6GA 2PJ1A 1ZLHA 5CPAA 3V7ZA 3KASA 2JBKA 1CP7A 1RTQA 4CDKA 2BO9A 2CF4A 4AXVA 2JBJA 4UF4A 1GYTA 3SI0A 4NJRA 2CIJA 2OOTA 4C9VA 4C8FA 1CX8A 2XEFA 3B3CA 2HC9A 2AFXA 2Q51A 1LFWA 4ZYQA 3BXMA 4B6ZA 1CPXA 3WC5A 1PCAA 4P4JA 3PB6X 5D29A 2PJ9A 4PXDA 4ZI6A 4NGNA 2ZOGA 1R3NA 3ISXA 3IC1A 2PJ7A 5LYDA 4P45A 3KR5A 5LYIA 2AFSA 5LRJA 2IJZA 3KZWA 2RFHA 2PJ6A 2POKA 4OC1A 5LYLA 1Y9ZA 1CP6A 4MCSA 2XEIA 5DS0A 2ZEHA 1AMPA 2PJ8A 1BLLE 2AFMA 3NH5A 3FEDA 4OC5A 4PXBA 4K3NA 1Y0RA 4IHMA 1WVMA 3H8GA 5JM6A 3FVLA 3CPAA 4MCQA 4C8CA 4TJVA 2F7VA 1VGYA 2ZEFA 1EE3P 2ZOFA 1UWYA 3VTAA 4C86A 3I74A 4Z65A 1M4LA 1Z8LA 4JZ0A 4DJLA 4NJQA 4X8IA 5HVHA 2Q43A 3KR4A 1H8LA 4NFRA 4PPZA 1DTDA 2G9DA 2PE3A 4ONWA 3WABA 3KL9A 3S9MA 4R7MA 4WWVA 3KHZA 3RAMA 3B3TA 3PB7X 4P4EA 1IY7A 3D7HA 4PXCA 3PBBA 5K8PA 1ARMA 4WJBA 5JGFA 1JQGA 4F9VA 4KSIA 5HVFA 5LRGA 3IFEA 3N5FA 3PBEA 4LQGA 4P4IA 4C9RA 4X3RA 4C84A 3B2YA 4UEFA 2C1CA 3K2KA 4C8UA 6CPAA 4ZX9A 2PRQA 3MRUA 2V8VA 3D66A 4UIAA 3WC7A 4OP4A 4ZY2A 4YN3A 1BPMA 3NFZA 5IB9A 1XF1A 3D68A 5LRKA 1ZG8A 4YU9A 1FT7A 2V8DA 3NA6A 2ZEGA 2QYVA 2RB7A 2ZEDA 4P4DA 2PJ2A 3BI0A 2J9AA 5HXDA 4NGTA 4P10A 3LWUA 2C6PA 3IO1A 2WYRA 3SJXA 3DLJA
chains in the Genus database with same CATH superfamily
2VI7A 3N7ZA 4DUKA 2E28A 1Q2CA 4OADA 2WPXA 2EUIA 5D8NA 1XMTA 2RC4A 5G22A 4CGMA 1ELMP 2G3TA 1YSJA 1K4JA 2GLJA 4FUUA 7CPAA 3KQXA 2D0PA 4PSWA 3S6KA 1IOFA 2V77A 3T0TA 5F47A 3FX6A 5K8NA 3B3SA 1Q2YA 3PGPA 1NXJA 2JEVA 3PB8X 3H8FA 4KVOE 4UA3A 1T36B 3PFEA 4LX9A 2B4DA 2PJ3A 4P4FA 4A32A 4R6TA 2DXQA 2Q44A 4E0AA 2BL1A 2PJBA 1IIDA 2C6CA 4B11A 2O4HA 3CDXA 3IGRA 3TCVA 5JH9A 2VQYA 4U5YA 4HNWB 2YNDA 5K8MA 4KSFA 2OZHA 3CT9A 4CAEA 4EWTA 1U6MA 4COGA 1QMUA 2EBJA 2ZXVA 4MHNA 5AG6A 4CYPA 1TKJA 4MFQA 3EY5A 5G21A 4A31A 5I0CA 3BHXA 1F57A 2FVGA 2DF5A 4KOUA 4A30A 4CS0B 2PCUA 3BUXB 4FWUA 4UWJA 4E5SA 2OLSA 3QAHA 1JWQA 4M6HA 2X7BA 1BPNA 1F2PA 2IL4A 5H84A 5ELYA 2I3CA 5J8FA 3KRVA 4MCRA 4AG7A 2EVNA 3FECA 3TYXA 1TKHA 2F5IA 2GP4A 2V8GA 3OWCA 3VH9A 1FBVA 4CGLA 2YJTA 1ZLIA 4IAVA 1YREA 4YRHA 3SJEA 1P4NA 2HWGA 1Q7LA 4II9A 2Y1NA 3VRPA 1N71A 2HB6A 5F5XA 4C9EA 3EZEA 5DWNA 5EBVA 4M6GA 2I00A 2PR1A 4Q7AA 4Q36A 3D7FA 1MK4A 2PSWA 3GB0A 3SI2A 4EVYA 4NGMA 2MP0A 5J3XA 2CTBA 2IMOA 4JYWA 4NXYA 4BMHA 2D0OA 2GREA 4MHZA 4NCZA 4KOWA 4Q38A 2XPLA 3S9NA 2Z3OA 3CPXA 2PVVA 5BWAB 2XPPA 1VIXA 3PEIA 3BUWB 3ZJ0A 3HPGG 1YVOA 4C8AA 1ZG9A 2JDDA 2ZEOA 5K99A 3BUOB 1LAMA 3HUVA 1IB1E 4UIBA 2Q4YA 4HNXB 4MXUA 3I6SA 3TLGB 2EK9A 3SXNA 1NSAA 1Y0YA 5J1QA 5JVLA 3EXNA 2KCWA 3GLJA 3P2HA 3SJGA 4ZGYB 2J8NA 2PJ5A 4AB7A 2BOAA 8CPAA 3SR3A 2EZBA 4H1HA 3CXQA 2PJ0A 3TTHA 1KEEB 1VBGA 1CE8B 2FSRA 2HUZA 2WPWA 2IQ6A 4FAIA 2DIKA 1XEBA 2PVWA 2VXKA 4FBEA 4IIYA 4EMEA 4C2XA 1ELLP 1BAVA 4K30A 2CY2A 2FIAA 2XPNA 4ZY1A 2OU2A 1Z9EA 2P0WA 3BJ7A 4CRZB 4KZTA 3H4QA 2JEWA 3D7GA 4E8OA 4UEZA 3C8OA 3DR8A 2CBLA 5KTAA 1XMBA 3QNVA 2FE7A 2PC1A 3GY9A 1YR0A 4NSQA 2PIZA 4UFWA 1LOKA 5BY0A 1XOVA 1ZYMA 2J8RA 4H2KA 4AVBA 3EZAA 4TJXA 3V8IA 2I79A 2FXFA 1NMTA 4W9YA 1B87A 3F0AA 3PFVA 1LRZA 1PYTB 3B35A 2OR4A 4J3GA 3WT4A 4MMOA 1Q5XA 2R8VA 5CBMA 3W6SA 4MI1A 2Y0MA 4QVTA 5F46A 3PT1A 4NGRA 4INJA 3D2MA 2ZELA 4C8TA 4UCNA 4OC3A 3NH4A 3D7DA 4FD5A 3R9FA 2P6EA 1XIXA 2REEA 2CNTA 3IEHA 3R95A 4GXHA 5I4MA 4HPSA 5F09A 3PP9A 4H89A 2EWBA 4OMEA 1EO0A 3MN8A 1TXRA 4L89A 4PK3A 1XBUA 4GM5A 3TO7A 2AUNA 2CNSA 2OZGA 5IV0A 2Q4ZA 4QC6A 2HROA 4MY3A 3JRUA 3TC8A 5AG4A 4R76A 4C9UA 1ZG7A 4MFZA 4CO9A 1CS0B 4R87A 1AYEA 1YGHA 2ARHA 4C99A 4BD9A 4XPKA 4F8ZA 3TLBA 1XRYA 5E96A 2CXAA 3SJFA 1HDUA 3D8PA 2PJAA 4CYQA 2QIRA 3FRMA 4OKOA 4U9YA 2FM4A 4IK2A 1MJAA 5EMIA 2X0SA 4C2ZA 4JLYA 2Q0YA 3OB1B 4EFDA 4CPAA 3KI9A 1KUXA 1VHSA 2R1IA 1Z5RA 3GIUA 4YU9A 3IU2A 5G1ZA 3IIBA 1JDEA 1VHEA 3S6GA 4C85A 2B5GA 4KUBA 4MJXA 3B3WA 4MFPA 3LMSA 1IYKA 3FB3A 1YW6A 4TWEA 5HVGA 4CAXA 5C82A 1Z4EA 5HMNA 3PB9X 2HQYA 2V8HA 2ZEEA 3TLCA 1Y7EA 1C30B 3K9TA 1MJBA 2GE3A 1HEEA 3FBUA 1CPSA 2AFWA 2B5GB 2F8HA 3JTKA 4H6ZA 1LANA 4KOVA 4NEXA 1M44A 3NH8A 5THWA 2ZW4A 1AUGA 4MCPA 2AFUA 2NSMA 3GYAA 4NGSA 4A4BA 3KGQA 5GCNA 2EK8A 1VI4A 4KNGE 3VRNA 2XEJA 1CBXA 3GUXA 4AVCA 4YWYA 4RUHA 4MY0A 1L0CA 3DDDA 1X10A 4KLWA 3TFYA 4F9UA 1R57A 1IGBA 1A9XB 4UFXA 1X12A 3V38A 3VROA 1Z8XA 2DEAA 4M6IA 4UCPA 4XNHB 3KHXA 1XFOA 3KKWA 1YMEA 4C8UA 2OB0A 4PQAA 4OC4A 3T5MA 2WUUA 4OIWA 1ARLA 1Z2LA 3FMCA 3T05A 3PFOA 1NBWA 3ICUA 2PIYA 3UY5A 4C8PA 2Z3MA 1KWMA 2Z3NA 3WR7A 1TF9A 4ZY0A 1ZRSA 1TF8A 1YLOA 3FEEA 3PRTA 4M3SA 3SI1A 2R82A 2ANPA 2Q04A 2VL1A 4XPDC 3W6XA 4IIXA 5A27A 1UFHA 3ISZA 2O53A 3S9LA 3IJ3A 5KTCA 2QJ8A 1CJWA 2YGWA 4NGPA 4OLLA 3BLNA 4MHPA 3VATA 4NGQA 3R96A 2PJCA 2Z0ZA 3F5BA 4MHYA 3T8WA 3RZAA 3OP0A 4GS4A 3FF3A 3F9KC 3TLZA 1LCPA 4CGPA 2CTCA 3VWDA 2DLAA 4MBUA 5LYFA 1EZAA 3FH4A 4MFKA 4R8FA 4UEEA 3VARA 3K4IA 3PB4X 4M8DA 4OC0A 4M85A 4A94A 3B8GA 5F9MA 4YFJA 1NE9A 3BI1A 3D4UA 2JLMA 4R57A 3LODA 4C9AA 2ZEMA 1QSOA 1F2OA 5F49A 2P6FA 4JXQA 2FCKA 2BCOA 3DGVA 2XEGA 4HKFA 4A39A 3S6HA 4F6AA 5AXIA 4JWPA 4O23A 2VKZG 3VGOA 4IF5A 3T9YA 4BINA 1VHOA 4ORFA 2Y1MA 1P0HA 4KOXA 4OC2A 1HDQA 1XJOA 2ABZA 2Q7SA 2YNCC 3B3VA 3FIXA 4B5OA 4CGOA 1I21A 3RBUA 2GLFA 2Z11A 4KORA 3T07A 4A4CA 1WJTA 4P6YA 1YQEA 1V6CA 3H8EA 3WC6A 2PRBA 2QVPA 4DYOA 3IWEA 1R61A 2ZEPA 4A38A 4CDJA 5JPHA 2REFA 3KQZA 3TX8A 2G3AA 4HNYB 5HKWA 2AJ6A 3H5ZA 4KUAA 2EZCA 1JDBC 3FXTA 4TNUA 3QB8A 2FS5A 3L2NA 1LAPA 4A37A 3OB2B 2K5TA 2BEIA 4OIDA 3S6FA 3EIFA 5HKZA 1PUAA 5F13A 3I1UA 5EC4A 1BO4A 4B5PB 1YW4A 4PXEA 4B10A 2Z3KA 4P4BA 4E2AA 1YX0A 3FNCA 1DIKA 4Y49C 2WZNA 2PJ4A 1YLEA 2B4JC 3TOBA 2FL4A 4CYNA 3FJUA 3RO0A 5IB0A 3JUWA 1CG2A 1QQ9A 3R9EA 1EZBA 4KOSA 2NYQA 1TKFA 2GU2A 3D67A 3G8WA 1M6VB 4CZ1A 1Z8WA 3TE4A 4XPLA 1S7NA 4G1PA 5FVJA 4YGOA 5LRKA 3G23A 3B7IA 1S3ZA 1QSNA 4X2TA 4A95A 4P44A 3IWWA 1QSRA 1WK4A 3PLFB 2AFZA 2FIWA 4DNCA 1DE4C 4ZX8A 1IYLA 1OBRA 4JD6A 4MRIA 5K8OA 4RN7A 2ZENA 2B3VA 1ZL0A 5IX3A 1FNOA 1R43A 3EFAA 3HLPA 2AFOA 2OZUA 3BJ8A 2C6GA 4BTFA 2PJ1A 1ZLHA 1BOBA 1BXRB 5J8CA 4LUAA 4CGNA 4BPUB 5CPAA 3K9UA 3NE8A 4GPLB 3V7ZA 3JVNA 3KASA 2JBKA 1CP7A 1RTQA 2G0BA 5KTDA 1OZPA 4CDKA 2YJVA 2BO9A 2AE6A 5JYBA 2CF4A 2YNEA 2Z10A 3C26A 4AXVA 2JBJA 4UF4A 1GYTA 4KVME 3SI0A 3MGDA 4NJRA 1KBLA 2CIJA 2OOTA 3RNZA 2ZPAA 5HKYA 4C68A 4C9VA 1CX8A 4C8FA 2XEFA 3B3CA 2HC9A 2AFXA 1YK3A 4RR2B 2Q51A 1B6BA 1LFWA 2BSWA 5H86A 4ZYQA 3BXMA 4B6ZA 3CZXA 4QB9A 1CPXA 3WC5A 4FD7A 3TLGA 3TT2A 4KLVA 1PCAA 2A4NA 2DPSA 4P4JA 3U1BA 3PB6X 4CRYB 5D29A 2PJ9A 4PXDA 4RS2A 2VEZA 4ZI6A 4NGNA 2QMLA 2ZOGA 3D3SA 4IUSA 4LQ6A 4L8AA 4U9ZA 2PDOA 5AG5A 3R9GA 4QBJA 2N3AB 1R3NA 3ISXA 3IC1A 2PJ7A 4MHDA 5LYDA 2AUMA 4P45A 1J4JA 1M4DA 3KR5A 1FY7A 4FD4A 5LYIA 4B5PA 2AFSA 3NFQA 5LRJA 2IJZA 1C3OB 2EO8A 3VWEA 4J0NA 3KZWA 4KOYA 3TO6A 2RFHA 2PJ6A 5AGEA 4QUSA 3DSBA 1I12A 4OC1A 2POKA 5LYLA 1Y9ZA 1CP6A 4MCSA 2XEIA 2PQ8A 4A33A 2VZZA 1S60A 1MJ9A 5A28A 2C5QA 1RO5A 5DS0A 2GIVA 2ZEHA 3G3SA 1AMPA 5DWMA 2PJ8A 4E94A 1BLLE 1IOIA 2AFMA 2CNMA 5AG7A 1GHEA 3NH5A 1A2ZA 2C27A 3LD2A 3FEDA 4OC5A 4ONUA 4PSXA 2ZW5A 4PXBA 4AVAA 4K3NA 3VRRA 3W91A 1YVHA 1Y0RA 2H5MA 4IHMA 1WVMA 3H8GA 1B47A 2ATRA 2B58A 5JM6A 1ON0A 3FVLA 3R1KA 3TLYA 1YVKA 1NSLA 3CPAA 4C7HA 1TIQA 5IR2A 4JXRA 4RI1A 4MCQA 3DNSA 4PV6A 2Q7BA 4C8CA 2R7HA 4BPXB 3OAKA 2F7VA 4TJVA 4R3KA 1VGYA 2ZEFA 3TO9A 1EE3P 2ZOFA 1UWYA 1M4IA 3VTAA 4C86A 1M4GA 3I74A 4Z65A 1I1DA 1M4LA 5G20A 1V0CA 2D4PA 1Z8LA 1VBHA 1PU9A 1RXTA 4JZ0A 4DJLA 4BBHA 3PZJA 2HI6A 4NJQA 1XE4A 4KSAA 5ISVA 4X8IA 5HVHA 2Q43A 3KR4A 4A2ZA 1H8LA 4MJ8A 1VKCA 1Y9KA 4MI4A 4MFJA 4NFRA 4PPZA 1DTDA 2G9DA 1S7LA 2PE3A 4XPDB 3BUMB 2B4BA 1Y7RA 4ONWA 3WABA 3KL9A 3S9MA 1Q2DA 4R7MA 4KS9A 4WWVA 3KHZA 3HPHE 3B3TA 3CXSA 3PB7X 3RAMA 3LACA 1GGOA 2Q4VA 4P4EA 1IICA 4R9MA 4X5KA 1IY7A 3D7HA 4UFVA 1S7FA 3I3GA 4F0XA 2B0AA 2HV2A 2VBQA 3DR6A 3SXOA 4PXCA 1S5KA 3PBBA 4Y49B 5K8PA 2ZW7A 4B13A 3ZNIA 1ARMA 3GJZA 4WJBA 2GANA 5JGFA 2GFQA 1JQGA 2EZAA 3TLEA 2FT0A 2JDCA 3CXPA 3GKRA 1ZO0A 4CAVA 2OH1A 4F0YA 4F9VA 2ZW6A 3F8KA 4KSIA 4I49A 5HVFA 3I9SA 3A9LA 4KOTA 3BUNB 5LRGA 3IFEA 3N5FA 2QECA 3PBEA 2XPOA 4LQGA 4P4IA 3IU1A 4C9RA 4X3RA 4XNHC 4EYSA 2P6GA 4MFLA 2BUEA 1KUYA 1M1DA 1KC7A 3T90A 3O8ZA 3P2FA 4JJXA 4C84A 2B3UA 3B2YA 4UEFA 4H6UA 2C1CA 2Z3LA 3HMJG 4BPWB 4CAFA 2PCNA 3K2KA 5CNPA 5F48A 6CPAA 1Z8TA 4ZX9A 2UV8G 2PRQA 3MRUA 4UCMA 2V8VA 3TOAA 2DPTA 3D66A 4PK2A 3ZZIA 5JQ4A 4UIAA 3WC7A 1Z4RA 5F1YA 4OP4A 4B14A 1WWZA 2YNCA 3EZBA 4ZY2A 3IWGA 4C2YA 4YN3A 1CM0A 4CYOA 3EC4A 4FD6A 1BPMA 3NFZA 5IB9A 2B4DB 1XF1A 3D68A 3FYNA 1ZG8A 2R98A 1FT7A 2D4OA 2NMTA 2V8DA 4R3LA 2O28A 2ZEGA 3NA6A 3U88C 4C7IA 5FD8A 4UBRA 2QYVA 2RB7A 4AG9A 1Y9WA 4P4DA 2ZEDA 4COBA 3VRQA 1SQHA 2PJ2A 3NE7A 2WSAA 3BI0A 1KUVA 3SHPA 5C88A 3NOJA 4UWIA 3QAYA 1Z9UA 2J9AA 2ODFA 4KVXA 5HH1A 2PR8A 5HXDA 3TLAA 2Z3PA 3RYOA 4NF1A 2J8MA 4B12A 4NGTA 1QSTA 1IU8A 1QSMA 4OAEA 4ZBGA 4CAWA 4P10A 3LWUA 2VZYA 2C6PA 3IO1A 1J3LA 3E0KA 1XF8A 1KZFA 1S7KA 2WYRA 3D2PA 3SJXA 3DLJA 3EO4A 4JVOA
chains in the Genus database with same CATH topology
4DUKA 5D8NA 7CPAA 1ELMP 4FUUA 1YSJA 2GLJA 3KQXA 2V77A 3FX6A 5K8NA 3B3SA 3PB8X 3H8FA 3PFEA 2PJ3A 4P4FA 4R6TA 2PJBA 2C6CA 2O4HA 3CDXA 5JH9A 5K8MA 4EWTA 3CT9A 1QMUA 4MHNA 1TKJA 3BHXA 1F57A 2FVGA 2PCUA 4FWUA 1BPNA 1F2PA 5ELYA 2I3CA 4MCRA 3FECA 1TKHA 2GP4A 2V8GA 3VH9A 1ZLIA 4IAVA 3SJEA 1Q7LA 2HB6A 4C9EA 4Q7AA 3D7FA 3GB0A 3SI2A 4NGMA 2CTBA 2IMOA 4JYWA 2GREA 4MHZA 3S9NA 3CPXA 2PVVA 1VIXA 3PEIA 4C8AA 1ZG9A 2ZEOA 1LAMA 3HUVA 4UIBA 4MXUA 3I6SA 2EK9A 1NSAA 1Y0YA 5J1QA 3GLJA 3SJGA 2PJ5A 2BOAA 8CPAA 2PJ0A 2IQ6A 4FAIA 2PVWA 4FBEA 4EMEA 1ELLP 1BAVA 4ZY1A 2JEWA 3D7GA 4UEZA 1XMBA 3QNVA 2PIZA 1LOKA 4H2KA 4TJXA 4W9YA 3B35A 1PYTB 2OR4A 3WT4A 4MMOA 5CBMA 4NGRA 2ZELA 4C8TA 4OC3A 3NH4A 3D7DA 3IEHA 5I4MA 5F09A 2EWBA 4OMEA 3MN8A 1TXRA 1XBUA 4GM5A 2Q4ZA 3JRUA 3TC8A 4C9UA 4R76A 1ZG7A 1AYEA 4C99A 4BD9A 4F8ZA 1XRYA 3SJFA 1HDUA 2PJAA 4OKOA 4IK2A 4EFDA 4CPAA 3KI9A 1Z5RA 4C85A 3IIBA 1VHEA 3B3WA 3LMSA 1YW6A 4TWEA 5HVGA 3PB9X 2V8HA 2ZEEA 1Y7EA 3K9TA 1HEEA 1CPSA 2AFWA 2F8HA 1LANA 3NH8A 5THWA 4MCPA 2AFUA 2NSMA 3KGQA 4NGSA 2EK8A 4KNGE 2XEJA 1CBXA 3GUXA 4YWYA 4RUHA 4F9UA 1IGBA 3V38A 2DEAA 3KHXA 1XFOA 1YMEA 4PQAA 4OC4A 4OIWA 1ARLA 1Z2LA 3FMCA 4C8PA 3PFOA 3ICUA 2PIYA 1KWMA 1TF9A 4ZY0A 1TF8A 1YLOA 3FEEA 3PRTA 3SI1A 2ANPA 2VL1A 3ISZA 2O53A 3S9LA 3IJ3A 2QJ8A 4NGPA 4MHPA 3VATA 4NGQA 2PJCA 3T8WA 4MHYA 3RZAA 3FF3A 1LCPA 2CTCA 5LYFA 3FH4A 4R8FA 4UEEA 3VARA 3PB4X 4OC0A 4A94A 3BI1A 3D4UA 4C9AA 2ZEMA 1F2OA 3DGVA 2BCOA 2XEGA 4A39A 4O23A 1VHOA 4OC2A 1HDQA 1XJOA 2ABZA 3B3VA 3RBUA 2GLFA 4P6YA 1V6CA 3H8EA 3WC6A 2QVPA 4DYOA 4CDJA 2ZEPA 4A38A 3KQZA 3TX8A 4TNUA 3L2NA 1LAPA 4A37A 4OIDA 3EIFA 3I1UA 1YW4A 4PXEA 4P4BA 2WZNA 2PJ4A 3FJUA 1CG2A 1QQ9A 2NYQA 1TKFA 2GU2A 3D67A 4G1PA 3B7IA 4X2TA 4P44A 3IWWA 2AFZA 5K8OA 1DE4C 4ZX8A 1OBRA 4MRIA 2ZENA 1FNOA 1R43A 3HLPA 2AFOA 2C6GA 2PJ1A 1ZLHA 5CPAA 3V7ZA 3KASA 2JBKA 1CP7A 1RTQA 4CDKA 2BO9A 2CF4A 4AXVA 2JBJA 4UF4A 1GYTA 3SI0A 4NJRA 2CIJA 2OOTA 4C9VA 4C8FA 1CX8A 2XEFA 3B3CA 2HC9A 2AFXA 2Q51A 1LFWA 4ZYQA 3BXMA 4B6ZA 1CPXA 3WC5A 1PCAA 4P4JA 3PB6X 5D29A 2PJ9A 4PXDA 4ZI6A 4NGNA 2ZOGA 1R3NA 3ISXA 3IC1A 2PJ7A 5LYDA 4P45A 3KR5A 5LYIA 2AFSA 5LRJA 2IJZA 3KZWA 2RFHA 2PJ6A 2POKA 4OC1A 5LYLA 1Y9ZA 1CP6A 4MCSA 2XEIA 2C5QA 5DS0A 2ZEHA 1AMPA 2PJ8A 1BLLE 2AFMA 3NH5A 3FEDA 4OC5A 4PXBA 4K3NA 1Y0RA 4IHMA 1WVMA 3H8GA 5JM6A 3FVLA 3CPAA 5IR2A 4MCQA 4C8CA 4TJVA 2F7VA 1VGYA 2ZEFA 1EE3P 2ZOFA 1UWYA 3VTAA 4C86A 3I74A 4Z65A 1M4LA 1Z8LA 4JZ0A 4DJLA 4NJQA 4X8IA 5HVHA 2Q43A 3KR4A 1H8LA 4NFRA 4PPZA 1DTDA 2G9DA 2PE3A 4ONWA 3WABA 3KL9A 3S9MA 4R7MA 4WWVA 3KHZA 3RAMA 3B3TA 3PB7X 4P4EA 1IY7A 3D7HA 4PXCA 3PBBA 5K8PA 1ARMA 4WJBA 5JGFA 1JQGA 4F9VA 4KSIA 5HVFA 5LRGA 3IFEA 3N5FA 3PBEA 4LQGA 4P4IA 4C9RA 4X3RA 4C84A 3B2YA 4UEFA 2C1CA 3K2KA 4C8UA 6CPAA 4ZX9A 2PRQA 3MRUA 2V8VA 3D66A 4UIAA 3WC7A 4OP4A 4ZY2A 4YN3A 1BPMA 3NFZA 5IB9A 1XF1A 3D68A 5LRKA 1ZG8A 4YU9A 1FT7A 2V8DA 3NA6A 2ZEGA 2QYVA 2RB7A 2ZEDA 4P4DA 2PJ2A 3BI0A 2J9AA 5HXDA 4NGTA 4P10A 3LWUA 2C6PA 3IO1A 2WYRA 3SJXA 3DLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUK A;  5D8N A;  7CPA A;  1ELM P;  4FUU A;  1YSJ A;  2GLJ A;  3KQX A;  2V77 A;  3FX6 A;  5K8N A;  3B3S A;  3PB8 X;  3H8F A;  3PFE A;  2PJ3 A;  4P4F A;  4R6T A;  2PJB A;  2C6C A;  2O4H A;  3CDX A;  5JH9 A;  5K8M A;  4EWT A;  3CT9 A;  1QMU A;  4MHN A;  1TKJ A;  3BHX A;  1F57 A;  2FVG A;  2PCU A;  4FWU A;  1BPN A;  1F2P A;  5ELY A;  2I3C A;  4MCR A;  3FEC A;  1TKH A;  2V8G A;  3VH9 A;  1ZLI A;  4IAV A;  3SJE A;  1Q7L A;  2HB6 A;  4C9E A;  4Q7A A;  3D7F A;  3GB0 A;  3SI2 A;  4NGM A;  2CTB A;  2IMO A;  4JYW A;  2GRE A;  4MHZ A;  3S9N A;  3CPX A;  2PVV A;  1VIX A;  3PEI A;  4C8A A;  1ZG9 A;  2ZEO A;  1LAM A;  3HUV A;  4UIB A;  4MXU A;  3I6S A;  2EK9 A;  1NSA A;  1Y0Y A;  5J1Q A;  3GLJ A;  3SJG A;  2PJ5 A;  2BOA A;  8CPA A;  2PJ0 A;  2IQ6 A;  4FAI A;  2PVW A;  4FBE A;  4EME A;  1ELL P;  1BAV A;  4ZY1 A;  2JEW A;  3D7G A;  4UEZ A;  1XMB A;  3QNV A;  2PIZ A;  1LOK A;  4H2K A;  4TJX A;  4W9Y A;  3B35 A;  1PYT B;  2OR4 A;  3WT4 A;  4MMO A;  5CBM A;  4NGR A;  2ZEL A;  4C8T A;  4OC3 A;  3NH4 A;  3D7D A;  3IEH A;  5I4M A;  5F09 A;  2EWB A;  4OME A;  3MN8 A;  1TXR A;  1XBU A;  4GM5 A;  2Q4Z A;  3JRU A;  3TC8 A;  4C9U A;  4R76 A;  1ZG7 A;  1AYE A;  4C99 A;  4BD9 A;  4F8Z A;  1XRY A;  3SJF A;  1HDU A;  2PJA A;  4OKO A;  4IK2 A;  4EFD A;  4CPA A;  3KI9 A;  1Z5R A;  4C85 A;  3IIB A;  1VHE A;  3B3W A;  3LMS A;  1YW6 A;  4TWE A;  5HVG A;  3PB9 X;  2V8H A;  2ZEE A;  1Y7E A;  3K9T A;  1HEE A;  1CPS A;  2AFW A;  2F8H A;  1LAN A;  3NH8 A;  5THW A;  4MCP A;  2AFU A;  2NSM A;  3KGQ A;  4NGS A;  2EK8 A;  4KNG E;  2XEJ A;  1CBX A;  3GUX A;  4YWY A;  4RUH A;  4F9U A;  1IGB A;  3V38 A;  2DEA A;  3KHX A;  1XFO A;  1YME A;  4PQA A;  4OC4 A;  4OIW A;  1ARL A;  1Z2L A;  3FMC A;  4C8P A;  3PFO A;  3ICU A;  2PIY A;  1KWM A;  1TF9 A;  4ZY0 A;  1TF8 A;  1YLO A;  3FEE A;  3PRT A;  3SI1 A;  2ANP A;  2VL1 A;  3ISZ A;  2O53 A;  3S9L A;  3IJ3 A;  2QJ8 A;  4NGP A;  4MHP A;  3VAT A;  4NGQ A;  2PJC A;  3T8W A;  4MHY A;  3RZA A;  3FF3 A;  1LCP A;  2CTC A;  5LYF A;  3FH4 A;  4R8F A;  4UEE A;  3VAR A;  3PB4 X;  4OC0 A;  4A94 A;  3BI1 A;  3D4U A;  4C9A A;  2ZEM A;  1F2O A;  3DGV A;  2BCO A;  2XEG A;  4A39 A;  4O23 A;  1VHO A;  4OC2 A;  1HDQ A;  1XJO A;  2ABZ A;  3B3V A;  3RBU A;  2GLF A;  4P6Y A;  1V6C A;  3H8E A;  3WC6 A;  2QVP A;  4DYO A;  4CDJ A;  2ZEP A;  4A38 A;  3KQZ A;  3TX8 A;  4TNU A;  3L2N A;  1LAP A;  4A37 A;  4OID A;  3EIF A;  3I1U A;  1YW4 A;  4PXE A;  4P4B A;  2WZN A;  2PJ4 A;  3FJU A;  1CG2 A;  1QQ9 A;  2NYQ A;  1TKF A;  2GU2 A;  3D67 A;  4G1P A;  3B7I A;  4X2T A;  4P44 A;  3IWW A;  2AFZ A;  5K8O A;  1DE4 C;  4ZX8 A;  1OBR A;  4MRI A;  2ZEN A;  1FNO A;  1R43 A;  3HLP A;  2AFO A;  2C6G A;  2PJ1 A;  1ZLH A;  5CPA A;  3V7Z A;  3KAS A;  2JBK A;  1CP7 A;  1RTQ A;  4CDK A;  2BO9 A;  2CF4 A;  4AXV A;  2JBJ A;  4UF4 A;  1GYT A;  3SI0 A;  4NJR A;  2CIJ A;  2OOT A;  4C9V A;  4C8F A;  1CX8 A;  2XEF A;  3B3C A;  2HC9 A;  2AFX A;  2Q51 A;  1LFW A;  4ZYQ A;  3BXM A;  4B6Z A;  1CPX A;  3WC5 A;  1PCA A;  4P4J A;  3PB6 X;  5D29 A;  2PJ9 A;  4PXD A;  4ZI6 A;  4NGN A;  2ZOG A;  1R3N A;  3ISX A;  3IC1 A;  2PJ7 A;  5LYD A;  4P45 A;  3KR5 A;  5LYI A;  2AFS A;  5LRJ A;  2IJZ A;  3KZW A;  2RFH A;  2PJ6 A;  2POK A;  4OC1 A;  5LYL A;  1Y9Z A;  1CP6 A;  4MCS A;  2XEI A;  5DS0 A;  2ZEH A;  1AMP A;  2PJ8 A;  1BLL E;  2AFM A;  3NH5 A;  3FED A;  4OC5 A;  4PXB A;  4K3N A;  1Y0R A;  4IHM A;  1WVM A;  3H8G A;  5JM6 A;  3FVL A;  3CPA A;  4MCQ A;  4C8C A;  4TJV A;  2F7V A;  1VGY A;  2ZEF A;  1EE3 P;  2ZOF A;  1UWY A;  3VTA A;  4C86 A;  3I74 A;  4Z65 A;  1M4L A;  1Z8L A;  4JZ0 A;  4DJL A;  4NJQ A;  4X8I A;  5HVH A;  2Q43 A;  3KR4 A;  1H8L A;  4NFR A;  4PPZ A;  1DTD A;  2G9D A;  2PE3 A;  4ONW A;  3WAB A;  3KL9 A;  3S9M A;  4R7M A;  4WWV A;  3KHZ A;  3RAM A;  3B3T A;  3PB7 X;  4P4E A;  1IY7 A;  3D7H A;  4PXC A;  3PBB A;  5K8P A;  1ARM A;  4WJB A;  5JGF A;  1JQG A;  4F9V A;  4KSI A;  5HVF A;  5LRG A;  3IFE A;  3N5F A;  3PBE A;  4LQG A;  4P4I A;  4C9R A;  4X3R A;  4C84 A;  3B2Y A;  4UEF A;  2C1C A;  3K2K A;  4C8U A;  6CPA A;  4ZX9 A;  2PRQ A;  3MRU A;  2V8V A;  3D66 A;  4UIA A;  3WC7 A;  4OP4 A;  4ZY2 A;  4YN3 A;  1BPM A;  3NFZ A;  5IB9 A;  1XF1 A;  3D68 A;  5LRK A;  1ZG8 A;  4YU9 A;  1FT7 A;  2V8D A;  3NA6 A;  2ZEG A;  2QYV A;  2RB7 A;  2ZED A;  4P4D A;  2PJ2 A;  3BI0 A;  2J9A A;  5HXD A;  4NGT A;  4P10 A;  3LWU A;  2C6P A;  3IO1 A;  2WYR A;  3SJX A;  3DLJ A; 
#chains in the Genus database with same CATH topology
 2VI7 A;  3N7Z A;  4DUK A;  2E28 A;  1Q2C A;  4OAD A;  2WPX A;  2EUI A;  5D8N A;  1XMT A;  2RC4 A;  5G22 A;  4CGM A;  1ELM P;  2G3T A;  1YSJ A;  1K4J A;  2GLJ A;  4FUU A;  7CPA A;  3KQX A;  2D0P A;  4PSW A;  3S6K A;  1IOF A;  2V77 A;  3T0T A;  5F47 A;  3FX6 A;  5K8N A;  3B3S A;  1Q2Y A;  3PGP A;  1NXJ A;  2JEV A;  3PB8 X;  3H8F A;  4KVO E;  4UA3 A;  1T36 B;  3PFE A;  4LX9 A;  2B4D A;  2PJ3 A;  4P4F A;  4A32 A;  4R6T A;  2DXQ A;  2Q44 A;  4E0A A;  2BL1 A;  2PJB A;  1IID A;  2C6C A;  4B11 A;  2O4H A;  3CDX A;  3IGR A;  3TCV A;  5JH9 A;  2VQY A;  4U5Y A;  4HNW B;  2YND A;  5K8M A;  4KSF A;  2OZH A;  3CT9 A;  4CAE A;  4EWT A;  1U6M A;  4COG A;  1QMU A;  2EBJ A;  2ZXV A;  4MHN A;  5AG6 A;  4CYP A;  1TKJ A;  4MFQ A;  3EY5 A;  5G21 A;  4A31 A;  5I0C A;  3BHX A;  1F57 A;  2FVG A;  2DF5 A;  4KOU A;  4A30 A;  4CS0 B;  2PCU A;  3BUX B;  4FWU A;  4UWJ A;  4E5S A;  2OLS A;  3QAH A;  1JWQ A;  4M6H A;  2X7B A;  1BPN A;  1F2P A;  2IL4 A;  5H84 A;  5ELY A;  2I3C A;  5J8F A;  3KRV A;  4MCR A;  4AG7 A;  2EVN A;  3FEC A;  3TYX A;  1TKH A;  2F5I A;  2GP4 A;  2V8G A;  3OWC A;  3VH9 A;  1FBV A;  4CGL A;  2YJT A;  1ZLI A;  4IAV A;  1YRE A;  4YRH A;  3SJE A;  1P4N A;  2HWG A;  1Q7L A;  4II9 A;  2Y1N A;  3VRP A;  1N71 A;  2HB6 A;  5F5X A;  4C9E A;  3EZE A;  5DWN A;  5EBV A;  4M6G A;  2I00 A;  2PR1 A;  4Q7A A;  4Q36 A;  3D7F A;  1MK4 A;  2PSW A;  3GB0 A;  3SI2 A;  4EVY A;  4NGM A;  2MP0 A;  5J3X A;  2CTB A;  2IMO A;  4JYW A;  4NXY A;  4BMH A;  2D0O A;  2GRE A;  4MHZ A;  4NCZ A;  4KOW A;  4Q38 A;  2XPL A;  3S9N A;  2Z3O A;  3CPX A;  2PVV A;  5BWA B;  2XPP A;  1VIX A;  3PEI A;  3BUW B;  3ZJ0 A;  3HPG G;  1YVO A;  4C8A A;  1ZG9 A;  2JDD A;  2ZEO A;  5K99 A;  3BUO B;  1LAM A;  3HUV A;  1IB1 E;  4UIB A;  2Q4Y A;  4HNX B;  4MXU A;  3I6S A;  3TLG B;  2EK9 A;  3SXN A;  1NSA A;  1Y0Y A;  5J1Q A;  5JVL A;  3EXN A;  2KCW A;  3GLJ A;  3P2H A;  3SJG A;  4ZGY B;  2J8N A;  2PJ5 A;  4AB7 A;  2BOA A;  8CPA A;  3SR3 A;  2EZB A;  4H1H A;  3CXQ A;  2PJ0 A;  3TTH A;  1KEE B;  1VBG A;  1CE8 B;  2FSR A;  2HUZ A;  2WPW A;  2IQ6 A;  4FAI A;  2DIK A;  1XEB A;  2PVW A;  2VXK A;  4FBE A;  4IIY A;  4EME A;  4C2X A;  1ELL P;  1BAV A;  4K30 A;  2CY2 A;  2FIA A;  2XPN A;  4ZY1 A;  2OU2 A;  1Z9E A;  2P0W A;  3BJ7 A;  4CRZ B;  4KZT A;  3H4Q A;  2JEW A;  3D7G A;  4E8O A;  4UEZ A;  3C8O A;  3DR8 A;  2CBL A;  5KTA A;  1XMB A;  3QNV A;  2FE7 A;  2PC1 A;  3GY9 A;  1YR0 A;  4NSQ A;  2PIZ A;  4UFW A;  1LOK A;  5BY0 A;  1XOV A;  1ZYM A;  2J8R A;  4H2K A;  4AVB A;  3EZA A;  4TJX A;  3V8I A;  2I79 A;  2FXF A;  1NMT A;  4W9Y A;  1B87 A;  3F0A A;  3PFV A;  1LRZ A;  1PYT B;  3B35 A;  2OR4 A;  4J3G A;  3WT4 A;  4MMO A;  1Q5X A;  2R8V A;  5CBM A;  3W6S A;  4MI1 A;  2Y0M A;  4QVT A;  5F46 A;  3PT1 A;  4NGR A;  4INJ A;  3D2M A;  2ZEL A;  4C8T A;  4UCN A;  4OC3 A;  3NH4 A;  3D7D A;  4FD5 A;  3R9F A;  2P6E A;  1XIX A;  2REE A;  2CNT A;  3IEH A;  3R95 A;  4GXH A;  5I4M A;  4HPS A;  5F09 A;  3PP9 A;  4H89 A;  2EWB A;  4OME A;  1EO0 A;  3MN8 A;  1TXR A;  4L89 A;  4PK3 A;  1XBU A;  4GM5 A;  3TO7 A;  2AUN A;  2CNS A;  2OZG A;  5IV0 A;  2Q4Z A;  4QC6 A;  2HRO A;  4MY3 A;  3JRU A;  3TC8 A;  5AG4 A;  4R76 A;  4C9U A;  1ZG7 A;  4MFZ A;  4CO9 A;  1CS0 B;  4R87 A;  1AYE A;  1YGH A;  2ARH A;  4C99 A;  4BD9 A;  4XPK A;  4F8Z A;  3TLB A;  1XRY A;  5E96 A;  2CXA A;  3SJF A;  1HDU A;  3D8P A;  2PJA A;  4CYQ A;  2QIR A;  3FRM A;  4OKO A;  4U9Y A;  2FM4 A;  4IK2 A;  1MJA A;  5EMI A;  2X0S A;  4C2Z A;  4JLY A;  2Q0Y A;  3OB1 B;  4EFD A;  4CPA A;  3KI9 A;  1KUX A;  1VHS A;  2R1I A;  1Z5R A;  3GIU A;  4YU9 A;  3IU2 A;  5G1Z A;  3IIB A;  1JDE A;  1VHE A;  3S6G A;  4C85 A;  2B5G A;  4KUB A;  4MJX A;  3B3W A;  4MFP A;  3LMS A;  1IYK A;  3FB3 A;  1YW6 A;  4TWE A;  5HVG A;  4CAX A;  5C82 A;  1Z4E A;  5HMN A;  3PB9 X;  2HQY A;  2V8H A;  2ZEE A;  3TLC A;  1Y7E A;  1C30 B;  3K9T A;  1MJB A;  2GE3 A;  1HEE A;  3FBU A;  1CPS A;  2AFW A;  2B5G B;  2F8H A;  3JTK A;  4H6Z A;  1LAN A;  4KOV A;  4NEX A;  1M44 A;  3NH8 A;  5THW A;  2ZW4 A;  1AUG A;  4MCP A;  2AFU A;  2NSM A;  3GYA A;  4NGS A;  4A4B A;  3KGQ A;  5GCN A;  2EK8 A;  1VI4 A;  4KNG E;  3VRN A;  2XEJ A;  1CBX A;  3GUX A;  4AVC A;  4YWY A;  4RUH A;  4MY0 A;  1L0C A;  3DDD A;  1X10 A;  4KLW A;  3TFY A;  4F9U A;  1R57 A;  1IGB A;  1A9X B;  4UFX A;  1X12 A;  3V38 A;  3VRO A;  1Z8X A;  2DEA A;  4M6I A;  4UCP A;  4XNH B;  3KHX A;  1XFO A;  3KKW A;  1YME A;  4C8U A;  2OB0 A;  4PQA A;  4OC4 A;  3T5M A;  2WUU A;  4OIW A;  1ARL A;  1Z2L A;  3FMC A;  3T05 A;  3PFO A;  1NBW A;  3ICU A;  2PIY A;  3UY5 A;  4C8P A;  2Z3M A;  1KWM A;  2Z3N A;  3WR7 A;  1TF9 A;  4ZY0 A;  1ZRS A;  1TF8 A;  1YLO A;  3FEE A;  3PRT A;  4M3S A;  3SI1 A;  2R82 A;  2ANP A;  2Q04 A;  2VL1 A;  4XPD C;  3W6X A;  4IIX A;  5A27 A;  1UFH A;  3ISZ A;  2O53 A;  3S9L A;  3IJ3 A;  5KTC A;  2QJ8 A;  1CJW A;  2YGW A;  4NGP A;  4OLL A;  3BLN A;  4MHP A;  3VAT A;  4NGQ A;  3R96 A;  2PJC A;  2Z0Z A;  3F5B A;  4MHY A;  3T8W A;  3RZA A;  3OP0 A;  4GS4 A;  3FF3 A;  3F9K C;  3TLZ A;  1LCP A;  4CGP A;  2CTC A;  3VWD A;  2DLA A;  4MBU A;  5LYF A;  1EZA A;  3FH4 A;  4MFK A;  4R8F A;  4UEE A;  3VAR A;  3K4I A;  3PB4 X;  4M8D A;  4OC0 A;  4M85 A;  4A94 A;  3B8G A;  5F9M A;  4YFJ A;  1NE9 A;  3BI1 A;  3D4U A;  2JLM A;  4R57 A;  3LOD A;  4C9A A;  2ZEM A;  1QSO A;  1F2O A;  5F49 A;  2P6F A;  4JXQ A;  2FCK A;  2BCO A;  3DGV A;  2XEG A;  4HKF A;  4A39 A;  3S6H A;  4F6A A;  5AXI A;  4JWP A;  4O23 A;  2VKZ G;  3VGO A;  4IF5 A;  3T9Y A;  4BIN A;  1VHO A;  4ORF A;  2Y1M A;  1P0H A;  4KOX A;  4OC2 A;  1HDQ A;  1XJO A;  2ABZ A;  2Q7S A;  2YNC C;  3B3V A;  3FIX A;  4B5O A;  4CGO A;  1I21 A;  3RBU A;  2GLF A;  2Z11 A;  4KOR A;  3T07 A;  4A4C A;  1WJT A;  4P6Y A;  1YQE A;  1V6C A;  3H8E A;  3WC6 A;  2PRB A;  2QVP A;  4DYO A;  3IWE A;  1R61 A;  2ZEP A;  4A38 A;  4CDJ A;  5JPH A;  2REF A;  3KQZ A;  3TX8 A;  2G3A A;  4HNY B;  5HKW A;  2AJ6 A;  3H5Z A;  4KUA A;  2EZC A;  1JDB C;  3FXT A;  4TNU A;  3QB8 A;  2FS5 A;  3L2N A;  1LAP A;  4A37 A;  3OB2 B;  2K5T A;  2BEI A;  4OID A;  3S6F A;  3EIF A;  5HKZ A;  1PUA A;  5F13 A;  3I1U A;  5EC4 A;  1BO4 A;  4B5P B;  1YW4 A;  4PXE A;  4B10 A;  2Z3K A;  4P4B A;  4E2A A;  1YX0 A;  3FNC A;  1DIK A;  4Y49 C;  2WZN A;  2PJ4 A;  1YLE A;  2B4J C;  3TOB A;  2FL4 A;  4CYN A;  3FJU A;  3RO0 A;  5IB0 A;  3JUW A;  1CG2 A;  1QQ9 A;  3R9E A;  1EZB A;  4KOS A;  2NYQ A;  1TKF A;  2GU2 A;  3D67 A;  3G8W A;  1M6V B;  4CZ1 A;  1Z8W A;  3TE4 A;  4XPL A;  1S7N A;  4G1P A;  5FVJ A;  4YGO A;  5LRK A;  3G23 A;  3B7I A;  1S3Z A;  1QSN A;  4X2T A;  4A95 A;  4P44 A;  3IWW A;  1QSR A;  1WK4 A;  3PLF B;  2AFZ A;  2FIW A;  4DNC A;  1DE4 C;  4ZX8 A;  1IYL A;  1OBR A;  4JD6 A;  4MRI A;  5K8O A;  4RN7 A;  2ZEN A;  2B3V A;  1ZL0 A;  5IX3 A;  1FNO A;  1R43 A;  3EFA A;  3HLP A;  2AFO A;  2OZU A;  3BJ8 A;  2C6G A;  4BTF A;  2PJ1 A;  1ZLH A;  1BOB A;  1BXR B;  5J8C A;  4LUA A;  4CGN A;  4BPU B;  5CPA A;  3K9U A;  3NE8 A;  4GPL B;  3V7Z A;  3JVN A;  3KAS A;  2JBK A;  1CP7 A;  1RTQ A;  2G0B A;  5KTD A;  1OZP A;  4CDK A;  2YJV A;  2BO9 A;  2AE6 A;  5JYB A;  2CF4 A;  2YNE A;  2Z10 A;  3C26 A;  4AXV A;  2JBJ A;  4UF4 A;  1GYT A;  4KVM E;  3SI0 A;  3MGD A;  4NJR A;  1KBL A;  2CIJ A;  2OOT A;  3RNZ A;  2ZPA A;  5HKY A;  4C68 A;  4C9V A;  1CX8 A;  4C8F A;  2XEF A;  3B3C A;  2HC9 A;  2AFX A;  1YK3 A;  4RR2 B;  2Q51 A;  1B6B A;  1LFW A;  2BSW A;  5H86 A;  4ZYQ A;  3BXM A;  4B6Z A;  3CZX A;  4QB9 A;  1CPX A;  3WC5 A;  4FD7 A;  3TLG A;  3TT2 A;  4KLV A;  1PCA A;  2A4N A;  2DPS A;  4P4J A;  3U1B A;  3PB6 X;  4CRY B;  5D29 A;  2PJ9 A;  4PXD A;  4RS2 A;  2VEZ A;  4ZI6 A;  4NGN A;  2QML A;  2ZOG A;  3D3S A;  4IUS A;  4LQ6 A;  4L8A A;  4U9Z A;  2PDO A;  5AG5 A;  3R9G A;  4QBJ A;  2N3A B;  1R3N A;  3ISX A;  3IC1 A;  2PJ7 A;  4MHD A;  5LYD A;  2AUM A;  4P45 A;  1J4J A;  1M4D A;  3KR5 A;  1FY7 A;  4FD4 A;  5LYI A;  4B5P A;  2AFS A;  3NFQ A;  5LRJ A;  2IJZ A;  1C3O B;  2EO8 A;  3VWE A;  4J0N A;  3KZW A;  4KOY A;  3TO6 A;  2RFH A;  2PJ6 A;  5AGE A;  4QUS A;  3DSB A;  1I12 A;  4OC1 A;  2POK A;  5LYL A;  1Y9Z A;  1CP6 A;  4MCS A;  2XEI A;  2PQ8 A;  4A33 A;  2VZZ A;  1S60 A;  1MJ9 A;  5A28 A;  2C5Q A;  1RO5 A;  5DS0 A;  2GIV A;  2ZEH A;  3G3S A;  1AMP A;  5DWM A;  2PJ8 A;  4E94 A;  1BLL E;  1IOI A;  2AFM A;  2CNM A;  5AG7 A;  1GHE A;  3NH5 A;  1A2Z A;  2C27 A;  3LD2 A;  3FED A;  4OC5 A;  4ONU A;  4PSX A;  2ZW5 A;  4PXB A;  4AVA A;  4K3N A;  3VRR A;  3W91 A;  1YVH A;  1Y0R A;  2H5M A;  4IHM A;  1WVM A;  3H8G A;  1B47 A;  2ATR A;  2B58 A;  5JM6 A;  1ON0 A;  3FVL A;  3R1K A;  3TLY A;  1YVK A;  1NSL A;  3CPA A;  4C7H A;  1TIQ A;  5IR2 A;  4JXR A;  4RI1 A;  4MCQ A;  3DNS A;  4PV6 A;  2Q7B A;  4C8C A;  2R7H A;  4BPX B;  3OAK A;  2F7V A;  4TJV A;  4R3K A;  1VGY A;  2ZEF A;  3TO9 A;  1EE3 P;  2ZOF A;  1UWY A;  1M4I A;  3VTA A;  4C86 A;  1M4G A;  3I74 A;  4Z65 A;  1I1D A;  1M4L A;  5G20 A;  1V0C A;  2D4P A;  1Z8L A;  1VBH A;  1PU9 A;  1RXT A;  4JZ0 A;  4DJL A;  4BBH A;  3PZJ A;  2HI6 A;  4NJQ A;  1XE4 A;  4KSA A;  5ISV A;  4X8I A;  5HVH A;  2Q43 A;  3KR4 A;  4A2Z A;  1H8L A;  4MJ8 A;  1VKC A;  1Y9K A;  4MI4 A;  4MFJ A;  4NFR A;  4PPZ A;  1DTD A;  2G9D A;  1S7L A;  2PE3 A;  4XPD B;  3BUM B;  2B4B A;  1Y7R A;  4ONW A;  3WAB A;  3KL9 A;  3S9M A;  1Q2D A;  4R7M A;  4KS9 A;  4WWV A;  3KHZ A;  3HPH E;  3B3T A;  3CXS A;  3PB7 X;  3RAM A;  3LAC A;  1GGO A;  2Q4V A;  4P4E A;  1IIC A;  4R9M A;  4X5K A;  1IY7 A;  3D7H A;  4UFV A;  1S7F A;  3I3G A;  4F0X A;  2B0A A;  2HV2 A;  2VBQ A;  3DR6 A;  3SXO A;  4PXC A;  1S5K A;  3PBB A;  4Y49 B;  5K8P A;  2ZW7 A;  4B13 A;  3ZNI A;  1ARM A;  3GJZ A;  4WJB A;  2GAN A;  5JGF A;  2GFQ A;  1JQG A;  2EZA A;  3TLE A;  2FT0 A;  2JDC A;  3CXP A;  3GKR A;  1ZO0 A;  4CAV A;  2OH1 A;  4F0Y A;  4F9V A;  2ZW6 A;  3F8K A;  4KSI A;  4I49 A;  5HVF A;  3I9S A;  3A9L A;  4KOT A;  3BUN B;  5LRG A;  3IFE A;  3N5F A;  2QEC A;  3PBE A;  2XPO A;  4LQG A;  4P4I A;  3IU1 A;  4C9R A;  4X3R A;  4XNH C;  4EYS A;  2P6G A;  4MFL A;  2BUE A;  1KUY A;  1M1D A;  1KC7 A;  3T90 A;  3O8Z A;  3P2F A;  4JJX A;  4C84 A;  2B3U A;  3B2Y A;  4UEF A;  4H6U A;  2C1C A;  2Z3L A;  3HMJ G;  4BPW B;  4CAF A;  2PCN A;  3K2K A;  5CNP A;  5F48 A;  6CPA A;  1Z8T A;  4ZX9 A;  2UV8 G;  2PRQ A;  3MRU A;  4UCM A;  2V8V A;  3TOA A;  2DPT A;  3D66 A;  4PK2 A;  3ZZI A;  5JQ4 A;  4UIA A;  3WC7 A;  1Z4R A;  5F1Y A;  4OP4 A;  4B14 A;  1WWZ A;  2YNC A;  3EZB A;  4ZY2 A;  3IWG A;  4C2Y A;  4YN3 A;  1CM0 A;  4CYO A;  3EC4 A;  4FD6 A;  1BPM A;  3NFZ A;  5IB9 A;  2B4D B;  1XF1 A;  3D68 A;  3FYN A;  1ZG8 A;  2R98 A;  1FT7 A;  2D4O A;  2NMT A;  2V8D A;  4R3L A;  2O28 A;  2ZEG A;  3NA6 A;  3U88 C;  4C7I A;  5FD8 A;  4UBR A;  2QYV A;  2RB7 A;  4AG9 A;  1Y9W A;  4P4D A;  2ZED A;  4COB A;  3VRQ A;  1SQH A;  2PJ2 A;  3NE7 A;  2WSA A;  3BI0 A;  1KUV A;  3SHP A;  5C88 A;  3NOJ A;  4UWI A;  3QAY A;  1Z9U A;  2J9A A;  2ODF A;  4KVX A;  5HH1 A;  2PR8 A;  5HXD A;  3TLA A;  2Z3P A;  3RYO A;  4NF1 A;  2J8M A;  4B12 A;  4NGT A;  1QST A;  1IU8 A;  1QSM A;  4OAE A;  4ZBG A;  4CAW A;  4P10 A;  3LWU A;  2VZY A;  2C6P A;  3IO1 A;  1J3L A;  3E0K A;  1XF8 A;  1KZF A;  1S7K A;  2WYR A;  3D2P A;  3SJX A;  3DLJ A;  3EO4 A;  4JVO A; 
#chains in the Genus database with same CATH homology
 4DUK A;  5D8N A;  7CPA A;  1ELM P;  4FUU A;  1YSJ A;  2GLJ A;  3KQX A;  2V77 A;  3FX6 A;  5K8N A;  3B3S A;  3PB8 X;  3H8F A;  3PFE A;  2PJ3 A;  4P4F A;  4R6T A;  2PJB A;  2C6C A;  2O4H A;  3CDX A;  5JH9 A;  5K8M A;  4EWT A;  3CT9 A;  1QMU A;  4MHN A;  1TKJ A;  3BHX A;  1F57 A;  2FVG A;  2PCU A;  4FWU A;  1BPN A;  1F2P A;  5ELY A;  2I3C A;  4MCR A;  3FEC A;  1TKH A;  2GP4 A;  2V8G A;  3VH9 A;  1ZLI A;  4IAV A;  3SJE A;  1Q7L A;  2HB6 A;  4C9E A;  4Q7A A;  3D7F A;  3GB0 A;  3SI2 A;  4NGM A;  2CTB A;  2IMO A;  4JYW A;  2GRE A;  4MHZ A;  3S9N A;  3CPX A;  2PVV A;  1VIX A;  3PEI A;  4C8A A;  1ZG9 A;  2ZEO A;  1LAM A;  3HUV A;  4UIB A;  4MXU A;  3I6S A;  2EK9 A;  1NSA A;  1Y0Y A;  5J1Q A;  3GLJ A;  3SJG A;  2PJ5 A;  2BOA A;  8CPA A;  2PJ0 A;  2IQ6 A;  4FAI A;  2PVW A;  4FBE A;  4EME A;  1ELL P;  1BAV A;  4ZY1 A;  2JEW A;  3D7G A;  4UEZ A;  1XMB A;  3QNV A;  2PIZ A;  1LOK A;  4H2K A;  4TJX A;  4W9Y A;  3B35 A;  1PYT B;  2OR4 A;  3WT4 A;  4MMO A;  5CBM A;  4NGR A;  2ZEL A;  4C8T A;  4OC3 A;  3NH4 A;  3D7D A;  3IEH A;  5I4M A;  5F09 A;  2EWB A;  4OME A;  3MN8 A;  1TXR A;  1XBU A;  4GM5 A;  2Q4Z A;  3JRU A;  3TC8 A;  4C9U A;  4R76 A;  1ZG7 A;  1AYE A;  4C99 A;  4BD9 A;  4F8Z A;  1XRY A;  3SJF A;  1HDU A;  2PJA A;  4OKO A;  4IK2 A;  4EFD A;  4CPA A;  3KI9 A;  1Z5R A;  4C85 A;  3IIB A;  1VHE A;  3B3W A;  3LMS A;  1YW6 A;  4TWE A;  5HVG A;  3PB9 X;  2V8H A;  2ZEE A;  1Y7E A;  3K9T A;  1HEE A;  1CPS A;  2AFW A;  2F8H A;  1LAN A;  3NH8 A;  5THW A;  4MCP A;  2AFU A;  2NSM A;  3KGQ A;  4NGS A;  2EK8 A;  4KNG E;  2XEJ A;  1CBX A;  3GUX A;  4YWY A;  4RUH A;  4F9U A;  1IGB A;  3V38 A;  2DEA A;  3KHX A;  1XFO A;  1YME A;  4PQA A;  4OC4 A;  4OIW A;  1ARL A;  1Z2L A;  3FMC A;  4C8P A;  3PFO A;  3ICU A;  2PIY A;  1KWM A;  1TF9 A;  4ZY0 A;  1TF8 A;  1YLO A;  3FEE A;  3PRT A;  3SI1 A;  2ANP A;  2VL1 A;  3ISZ A;  2O53 A;  3S9L A;  3IJ3 A;  2QJ8 A;  4NGP A;  4MHP A;  3VAT A;  4NGQ A;  2PJC A;  3T8W A;  4MHY A;  3RZA A;  3FF3 A;  1LCP A;  2CTC A;  5LYF A;  3FH4 A;  4R8F A;  4UEE A;  3VAR A;  3PB4 X;  4OC0 A;  4A94 A;  3BI1 A;  3D4U A;  4C9A A;  2ZEM A;  1F2O A;  3DGV A;  2BCO A;  2XEG A;  4A39 A;  4O23 A;  1VHO A;  4OC2 A;  1HDQ A;  1XJO A;  2ABZ A;  3B3V A;  3RBU A;  2GLF A;  4P6Y A;  1V6C A;  3H8E A;  3WC6 A;  2QVP A;  4DYO A;  4CDJ A;  2ZEP A;  4A38 A;  3KQZ A;  3TX8 A;  4TNU A;  3L2N A;  1LAP A;  4A37 A;  4OID A;  3EIF A;  3I1U A;  1YW4 A;  4PXE A;  4P4B A;  2WZN A;  2PJ4 A;  3FJU A;  1CG2 A;  1QQ9 A;  2NYQ A;  1TKF A;  2GU2 A;  3D67 A;  4G1P A;  3B7I A;  4X2T A;  4P44 A;  3IWW A;  2AFZ A;  5K8O A;  1DE4 C;  4ZX8 A;  1OBR A;  4MRI A;  2ZEN A;  1FNO A;  1R43 A;  3HLP A;  2AFO A;  2C6G A;  2PJ1 A;  1ZLH A;  5CPA A;  3V7Z A;  3KAS A;  2JBK A;  1CP7 A;  1RTQ A;  4CDK A;  2BO9 A;  2CF4 A;  4AXV A;  2JBJ A;  4UF4 A;  1GYT A;  3SI0 A;  4NJR A;  2CIJ A;  2OOT A;  4C9V A;  4C8F A;  1CX8 A;  2XEF A;  3B3C A;  2HC9 A;  2AFX A;  2Q51 A;  1LFW A;  4ZYQ A;  3BXM A;  4B6Z A;  1CPX A;  3WC5 A;  1PCA A;  4P4J A;  3PB6 X;  5D29 A;  2PJ9 A;  4PXD A;  4ZI6 A;  4NGN A;  2ZOG A;  1R3N A;  3ISX A;  3IC1 A;  2PJ7 A;  5LYD A;  4P45 A;  3KR5 A;  5LYI A;  2AFS A;  5LRJ A;  2IJZ A;  3KZW A;  2RFH A;  2PJ6 A;  2POK A;  4OC1 A;  5LYL A;  1Y9Z A;  1CP6 A;  4MCS A;  2XEI A;  2C5Q A;  5DS0 A;  2ZEH A;  1AMP A;  2PJ8 A;  1BLL E;  2AFM A;  3NH5 A;  3FED A;  4OC5 A;  4PXB A;  4K3N A;  1Y0R A;  4IHM A;  1WVM A;  3H8G A;  5JM6 A;  3FVL A;  3CPA A;  5IR2 A;  4MCQ A;  4C8C A;  4TJV A;  2F7V A;  1VGY A;  2ZEF A;  1EE3 P;  2ZOF A;  1UWY A;  3VTA A;  4C86 A;  3I74 A;  4Z65 A;  1M4L A;  1Z8L A;  4JZ0 A;  4DJL A;  4NJQ A;  4X8I A;  5HVH A;  2Q43 A;  3KR4 A;  1H8L A;  4NFR A;  4PPZ A;  1DTD A;  2G9D A;  2PE3 A;  4ONW A;  3WAB A;  3KL9 A;  3S9M A;  4R7M A;  4WWV A;  3KHZ A;  3RAM A;  3B3T A;  3PB7 X;  4P4E A;  1IY7 A;  3D7H A;  4PXC A;  3PBB A;  5K8P A;  1ARM A;  4WJB A;  5JGF A;  1JQG A;  4F9V A;  4KSI A;  5HVF A;  5LRG A;  3IFE A;  3N5F A;  3PBE A;  4LQG A;  4P4I A;  4C9R A;  4X3R A;  4C84 A;  3B2Y A;  4UEF A;  2C1C A;  3K2K A;  4C8U A;  6CPA A;  4ZX9 A;  2PRQ A;  3MRU A;  2V8V A;  3D66 A;  4UIA A;  3WC7 A;  4OP4 A;  4ZY2 A;  4YN3 A;  1BPM A;  3NFZ A;  5IB9 A;  1XF1 A;  3D68 A;  5LRK A;  1ZG8 A;  4YU9 A;  1FT7 A;  2V8D A;  3NA6 A;  2ZEG A;  2QYV A;  2RB7 A;  2ZED A;  4P4D A;  2PJ2 A;  3BI0 A;  2J9A A;  5HXD A;  4NGT A;  4P10 A;  3LWU A;  2C6P A;  3IO1 A;  2WYR A;  3SJX A;  3DLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...