4NGTA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
total genus 252
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngtA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngtA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngtA02
4P6YA 3BHXA 1IGBA 4EWTA 4NGMA 4MHZA 2ZEEA 2C6GA 2POKA 3LMSA 4OC3A 1JQGA 1HDQA 3JRUA 3GUXA 2NSMA 3KR4A 1R3NA 2JBKA 5JGFA 3TC8A 4KNGE 5K8MA 1VHEA 2Q4ZA 3EIFA 2C6PA 3IC1A 1TKFA 1Y9ZA 5LYFA 3RZAA 4A94A 1ELMP 3K2KA 4NGNA 4C85A 2OR4A 4C84A 5LRKA 4C9VA 3CDXA 1Y0RA 1Y0YA 4ZX8A 2PJ7A 1LAPA 2XEGA 3NFZA 2ZEDA 4P44A 4PXBA 4P4JA 1FT7A 4OC1A 1CBXA 3PB4X 4OC4A 2PVWA 4UIBA 1DE4C 4MCRA 1LFWA 4OIWA 4R8FA 4X8IA 4C86A 4IK2A 3WC7A 4A37A 3V38A 1EE3P 4ZY2A 4P4EA 3IEHA 2EK9A 4NGPA 4UEEA 3IO1A 3T8WA 4TWEA 3SI0A 4FAIA 3I1UA 4C8AA 1ZG9A 5DS0A 4ONWA 2PJ6A 4P4FA 1LOKA 1QQ9A 3VATA 4NGTA 3H8FA 2V8GA 3KQZA 3FMCA 1BPNA 3PBBA 1LAMA 2PJ3A 3SI2A 4IAVA 3NH4A 2PE3A 3PFOA 5HVGA 4R6TA 4P4DA 4G1PA 3SJGA 2PJAA 3D66A 3VH9A 1ZLIA 4YU9A 4JZ0A 2QYVA 1XFOA 4C99A 3WT4A 5ELYA 3TX8A 3FH4A 3QNVA 4X3RA 4OC5A 4P4IA 1PCAA 3CT9A 3S9MA 3S9LA 4FUUA 4EMEA 5LRGA 2RB7A 2PRQA 2EWBA 3ICUA 1KWMA 4C9AA 3KL9A 2EK8A 2PJ1A 3B3WA 3ISXA 5K8NA 4PPZA 4Z65A 4ZY0A 3NH5A 3B3SA 4DJLA 5LYLA 3HLPA 1F57A 1VHOA 2CF4A 5I4MA 2XEFA 1TF9A 2PJ0A 2ZEMA 3MN8A 2WZNA 5K8OA 4C8PA 2AFWA 2ZENA 5IB9A 4P45A 1M4LA 2O53A 1GYTA 4CDKA 4A39A 4R7MA 2PJ4A 2ZEHA 2PIYA 3S9NA 5D8NA 1Y7EA 5LRJA 4Q7AA 5CBMA 1V6CA 4ZYQA 3CPAA 2HC9A 1IY7A 3GB0A 4MCPA 4C9UA 1F2OA 2PIZA 1AYEA 1CX8A 4A38A 2WYRA 4UF4A 5THWA 3VARA 4UIAA 4IHMA 2AFZA 2DEAA 2BOAA 1HEEA 2AFOA 6CPAA 1QMUA 3N5FA 4KSIA 4MCQA 1CG2A 3HUVA 3IIBA 2C6CA 3PB8X 3MRUA 4LQGA 3FX6A 1LCPA 1BPMA 4P4BA 4F8ZA 3B3VA 1CPXA 4RUHA 4K3NA 4O23A 2ZEPA 2AFMA 1XBUA 4YWYA 4PXCA 2GREA 2JBJA 2ZEFA 3BI0A 2V8HA 3PEIA 3I6SA 4NGQA 2PJBA 5CPAA 4C9EA 2I3CA 1ELLP 1XF1A 2OOTA 2F8HA 4ZY1A 2GLFA 3FF3A 2PJ2A 2ZEOA 2BO9A 1ZLHA 2RFHA 3K9TA 3KI9A 1CP6A 4TJXA 4NJQA 2PCUA 3PRTA 7CPAA 4DYOA 1XJOA 3DGVA 2BCOA 2IMOA 2XEIA 4PXEA 5HVFA 2XEJA 4P10A 3B3TA 3D7DA 4NFRA 4OC0A 1ARLA 1RTQA 3I74A 2O4HA 3WC6A 4CDJA 2QVPA 2IJZA 3PB7X 4UEFA 4TJVA 3NH8A 1F2PA 2V77A 1NSAA 4MHNA 1TKHA 3PBEA 4FWUA 4TNUA 3RBUA 4R76A 4H2KA 1OBRA 1CPSA 4MXUA 4OC2A 5JM6A 3IJ3A 4GM5A 3SJEA 2CTCA 4BD9A 5JH9A 3RAMA 2AFSA 5HXDA 3D7GA 2AFUA 3B2YA 3D7FA 1TKJA 5K8PA 3VTAA 3PFEA 4C8CA 3GLJA 3KHZA 3L2NA 3FEEA 3H8GA 4ZX9A 3H8EA 4DUKA 4OP4A 1R43A 2QJ8A 3B7IA 4MRIA 1LANA 1HDUA 4C8FA 4CPAA 1Z8LA 5LYDA 2ANPA 2PJ5A 4UEZA 2NYQA 3SJXA 1ARMA 3B35A 2V8VA 4B6ZA 2F7VA 1PYTB 4PQAA 4C8TA 2J9AA 2ZOFA 3FJUA 4MHPA 1Q7LA 2ABZA 3KASA 3PB9X 1YLOA 4OMEA 1AMPA 2PJ8A 1BLLE 2ZOGA 4X2TA 1H8LA 1ZG8A 1UWYA 3KHXA 4WJBA 1TXRA 3IWWA 4YN3A 2G9DA 3SI1A 5HVHA 1ZG7A 4MCSA 4OKOA 3B3CA 2VL1A 2FVGA 4ZI6A 4OIDA 4F9UA 3KZWA 4JYWA 2JEWA 1FNOA 2Q43A 2CIJA 1YW6A 5J1QA 4AXVA 3WC5A 3D4UA 4NJRA 1BAVA 3DLJA 4PXDA 2C1CA 4NGRA 3LWUA 4W9YA 3FECA 2PJ9A 3BXMA 3D68A 3PB6X 3NA6A 2V8DA 4FBEA 8CPAA 1WVMA 4MHYA 1VIXA 1VGYA 3SJFA 2PVVA 2ZELA 1XRYA 3ISZA 3BI1A 2PJCA 3KQXA 3CPXA 3D7HA 1TF8A 3WABA 4NGSA 3V7ZA 1Z2LA 1Z5RA 2GLJA 3FEDA 2IQ6A 2HB6A 3KGQA 4C8UA 1YMEA 4MMOA 2CTBA 3KR5A 1YSJA 1DTDA 1CP7A 2GU2A 4WWVA 5D29A 2Q51A 5LYIA 1XMBA 4C9RA 1YW4A 3IFEA 3FVLA 2ZEGA 2AFXA 5F09A 4EFDA 4F9VA 3D67A
chains in the Genus database with same CATH superfamily
1S7LA 4KOYA 4P6YA 3BHXA 1IGBA 4KZTA 4MFKA 5E96A 4EWTA 4NGMA 4MHZA 3VWDA 5KTCA 3TLGB 2ZEEA 2VKZG 2C6GA 3I9SA 2POKA 4PV6A 1Z8XA 3LMSA 4OC3A 1M1DA 1JQGA 4HNYB 1HDQA 2P6EA 1X10A 2B5GA 2DLAA 3JRUA 2HQYA 2NSMA 3GUXA 1R3NA 3KR4A 4R9MA 3T9YA 1QSTA 3TT2A 2JBKA 5G21A 5JGFA 3TLYA 3TC8A 3TOBA 4BPUB 1YLEA 1M6VB 4KNGE 5K8MA 2GIVA 4KOVA 1VHEA 1MJAA 2Q4ZA 3EIFA 3NFQA 2C6PA 3BUNB 5I0CA 4A32A 2G3TA 3TO7A 1NXJA 4MFQA 3IC1A 1TKFA 2FCKA 1Y9ZA 5LYFA 3W91A 3RZAA 4PSXA 2AUNA 2ODFA 4A94A 1ELMP 5IV0A 3T07A 5K99A 4GS4A 4B12A 4KSAA 3R1KA 3K2KA 1NSLA 4NGNA 4CAEA 2OR4A 4IF5A 4C84A 4C85A 5LRKA 2GFQA 1YQEA 3B8GA 3TLGA 4C9VA 5F47A 3CDXA 4CGPA 1GGOA 4IUSA 1Y0RA 2JDCA 4ZBGA 4IIYA 3VROA 3NE8A 4BPXB 3TLEA 5AXIA 4XPDB 3G23A 1Y0YA 4MI1A 4CAWA 1YK3A 2PJ7A 4ZX8A 3HPHE 1LAPA 2XEGA 3TO9A 5JPHA 2P0WA 5G22A 2XPNA 3NFZA 1ON0A 2QECA 1C30B 2ZEDA 2C5QA 2Z3PA 4P44A 4PXBA 3RNZA 4P4JA 4MFJA 4UWJA 3R96A 3BUXB 1FT7A 2CNMA 3TLCA 4OC1A 1SQHA 1CBXA 3PB4X 2PDOA 4CS0B 4OC4A 2PVWA 3OWCA 4UIBA 1R61A 2CY2A 2OH1A 4OAEA 2Z3NA 1DE4C 4MCRA 1GHEA 2O28A 4M6HA 4UA3A 4II9A 1LFWA 5F5XA 4OIWA 4R8FA 4X8IA 4C86A 2ZPAA 2WSAA 4UCMA 2OLSA 2DF5A 1EO0A 4IK2A 3WC7A 2DIKA 2I79A 5H84A 2B3UA 4A37A 3C26A 1YVKA 3DR8A 2VZZA 2Q44A 4NF1A 1VBHA 4H89A 3D3SA 1EE3P 4ZY2A 4P4EA 3IEHA 2EK9A 4NGPA 4J3GA 3V38A 4HPSA 3EZAA 3VRQA 4CRZB 2FM4A 4UEEA 3U88C 3IO1A 3T8WA 3VRNA 2F5IA 2I00A 4TWEA 3SI0A 4FAIA 3I1UA 3VRPA 4QBJA 1AUGA 4C8AA 1Z4EA 1ZG9A 4H6UA 4MJ8A 1Z9UA 5DS0A 4L8AA 4R3KA 3F0AA 4ONWA 2PJ6A 4P4FA 1JWQA 1LOKA 1QQ9A 4F6AA 5J8CA 1Q5XA 4JLYA 5HKYA 3VATA 4NGTA 3G8WA 5H86A 2REFA 3H8FA 2V8GA 3PFVA 3KQZA 1BOBA 3FMCA 2B58A 1IU8A 1BPNA 4CRYB 1A2ZA 2R8VA 3EXNA 3PBBA 4R57A 1LAMA 3BJ7A 2PJ3A 3SI2A 4IAVA 3TOAA 1Q2CA 3NH4A 2HI6A 2PE3A 3PFOA 4CYOA 1Y9WA 2Q4VA 2Z11A 1KUXA 2VQYA 2FXFA 4P4DA 4R6TA 4G1PA 3SJGA 3PP9A 4CGMA 2PJAA 3D66A 1JDEA 3VH9A 2EZCA 5JQ4A 1ZLIA 4ORFA 4YU9A 4JZ0A 2QYVA 3PLFB 1XFOA 3SHPA 4C99A 3WT4A 5ELYA 1OZPA 4KORA 3FH4A 3QNVA 3TX8A 2J8NA 4J0NA 4RR2B 2Q7BA 3VWEA 3TTHA 1IIDA 2HWGA 1T36B 4B5PB 1XE4A 4X3RA 1MK4A 4BPWB 3IU2A 4OC5A 4MJXA 3JUWA 4RI1A 4P4IA 1PCAA 4H1HA 1C3OB 2OZGA 3NE7A 4F0YA 2R98A 5HMNA 3CT9A 3S9MA 4E8OA 4EYSA 4YGOA 3OB1B 3S9LA 3GYAA 1Y7RA 4FD5A 1YX0A 2Z3MA 4EVYA 4FUUA 4E5SA 1NMTA 4EMEA 5LRGA 4CGNA 1EZAA 2G3AA 2RB7A 5FD8A 3PT1A 2PRQA 2EWBA 4CYPA 4FD4A 2ZW7A 3CZXA 2DXQA 1KWMA 2HROA 3ICUA 3JTKA 2K5TA 4KOTA 4C9AA 4C7HA 2CNSA 3KL9A 2EK8A 2R7HA 2PJ1A 2VEZA 3B3WA 3ISXA 4P10A 5K8NA 3A9LA 2OB0A 4PPZA 2J8MA 4PK2A 3VGOA 2FIWA 3FRMA 4L89A 2YJTA 4Z65A 3SXNA 4ZY0A 3NH5A 2BSWA 4HKFA 3B3SA 1I21A 4DJLA 5LYLA 3HLPA 1IOFA 1F57A 1VHOA 2CF4A 4B5PA 4CYNA 5C82A 2XEFA 5I4MA 1TF9A 2PJ0A 2ZEMA 4B13A 4M85A 4DNCA 3T05A 4I49A 4H6ZA 3MN8A 4R87A 2WZNA 5K8OA 4C8PA 2AFWA 2JLMA 4E94A 2ZENA 1CJWA 5IB9A 3D2MA 4P45A 1M4LA 2O53A 1GYTA 2Z3KA 5J8FA 1S7FA 4UFXA 1MJBA 4CDKA 2YNDA 2H5MA 3TO6A 4A39A 1V0CA 1P4NA 2B4BA 4R7MA 4A31A 2PJ4A 5KTAA 2ZXVA 5EMIA 2ZEHA 2PIYA 2Z3OA 3S9NA 5D8NA 1Y7EA 5F13A 4LUAA 3GY9A 5LRJA 1ZRSA 1A9XB 4Q7AA 2QMLA 3FBUA 5CBMA 2PQ8A 1V6CA 4ZYQA 3QAHA 3CPAA 4B11A 2HC9A 1IY7A 3FXTA 3GB0A 1KZFA 4MCPA 4XPKA 1EZBA 4XPLA 3TLBA 5DWNA 3BUOB 4C9UA 1F2OA 2PIZA 1AYEA 1CX8A 1IYLA 2G0BA 4A38A 5HKZA 2WYRA 2PSWA 4E2AA 4UF4A 3SR3A 4GXHA 1J4JA 2GANA 5THWA 3VARA 4INJA 4UIAA 3R9GA 1XEBA 5IR2A 4IHMA 3O8ZA 2AFZA 2VBQA 2Q7SA 3EO4A 1XOVA 2DEAA 4QVTA 2BOAA 1ZL0A 1HEEA 4CZ1A 4KVME 5A28A 4CO9A 2AFOA 1KBLA 6CPAA 1QMUA 4COBA 3N5FA 4KSIA 5JYBA 4MCQA 1CG2A 2FT0A 3HUVA 3IIBA 2C6CA 3OB2B 1M4DA 3MRUA 3PB8X 5F49A 4LQGA 3FX6A 1U6MA 1KUYA 1BPMA 1LCPA 3OAKA 1Q2YA 5EBVA 4P4BA 2PCNA 4C2ZA 4F8ZA 3B3VA 1CPXA 4RUHA 4QB9A 4OADA 4K3NA 4O23A 2R82A 2EUIA 2ZEPA 4UFWA 3BLNA 4KOXA 4NSQA 2AFMA 1XBUA 2ATRA 2R1IA 3JVNA 4PXCA 4YWYA 2GREA 4C2YA 2JBJA 2ZEFA 3EY5A 4KOUA 4B5OA 3PGPA 2YJVA 1Z8TA 3BI0A 1YVOA 4JXQA 4OLLA 5EC4A 2V8HA 3TFYA 1ZYMA 3PEIA 5GCNA 3I6SA 3T5MA 4NGQA 2PR8A 4Q36A 1M4IA 1YREA 2PJBA 4MY3A 2P6FA 2Z3LA 1S5KA 2CNTA 1S7NA 2XPLA 2VZYA 5CPAA 1PU9A 2D0PA 3R95A 4C9EA 4C68A 4UCPA 2I3CA 1ELLP 2AE6A 4COGA 1XF1A 2OOTA 4UBRA 2F8HA 2EVNA 4ZY1A 3FNCA 4C7IA 2GLFA 3FF3A 1XMTA 2B4DB 2VXKA 1QSRA 3KKWA 2PJ2A 1B6BA 2YGWA 2ZEOA 4AVBA 5HVGA 3TLAA 2BO9A 1N71A 1ZLHA 2RFHA 3CXQA 3K9TA 4KSFA 4CAFA 1RXTA 2PR1A 3KI9A 3TYXA 4CGLA 2MP0A 1CP6A 4MBUA 4TJXA 3W6SA 3CXSA 1I12A 1IICA 2PCUA 3PRTA 4NJQA 4A33A 7CPAA 1CE8B 3G3SA 1BO4A 4BMHA 2JEVA 2VI7A 4AG7A 4MY0A 2J8RA 4KUAA 2AUMA 2GE3A 2EO8A 1XJOA 3DGVA 4DYOA 2BCOA 2IMOA 2XEIA 1R57A 4PXEA 1P0HA 3IWGA 2XEJA 3ZNIA 3B3TA 4JD6A 3D7DA 2REEA 4OC0A 4NFRA 3H5ZA 1Z9EA 1ARLA 1RTQA 2FE7A 2EZBA 3I74A 2O4HA 5AG5A 2CBLA 2B3VA 3N7ZA 4NEXA 3RYOA 3WC6A 4CDJA 4HNXB 4U5YA 3H4QA 2Q4YA 3DSBA 1NBWA 3SXOA 2QVPA 5F9MA 3V8IA 2IJZA 3PB7X 4UEFA 4TJVA 3NH8A 4KOSA 1UFHA 1F2PA 2BUEA 4A4BA 5AGEA 5HVFA 2XPPA 1NSAA 2B4DA 2DPSA 2V77A 3QAYA 4MHNA 1TKHA 5AG4A 3TCVA 2IL4A 3PBEA 4FWUA 4TNUA 2EBJA 3RBUA 4R76A 4CAXA 5IX3A 4H2KA 4YRHA 5BWAB 3P2HA 1OBRA 1CPSA 3DDDA 3FYNA 4MXUA 1BXRB 4OC2A 5JM6A 3IJ3A 1IYKA 3SJEA 2CTCA 4GM5A 2OZHA 4UFVA 1KUVA 4M6IA 4BD9A 5JH9A 2WPXA 3K4IA 3RAMA 2AFSA 5HXDA 1Y9KA 3D7GA 2AFUA 1YR0A 2KCWA 3B2YA 4KVOE 3D7FA 1TKJA 2ZW4A 3DNSA 3QB8A 5K8PA 3VTAA 1Z8WA 3PFEA 2RC4A 4XNHC 4C8CA 3GLJA 3KHZA 3L2NA 3ZZIA 3FEEA 3F9KC 3H8GA 4ZX9A 3H8EA 4DUKA 1NE9A 4OP4A 1R43A 2QJ8A 2CXAA 2FL4A 3B7IA 4MRIA 1J3LA 2EZAA 1LANA 1HDUA 3LODA 5FVJA 5KTDA 4C8FA 1Z4RA 4CPAA 3P2FA 1Z8LA 5LYDA 2B0AA 2ANPA 2PJ5A 4K30A 4QUSA 4KS9A 4UEZA 2ZW6A 2FSRA 4KLVA 2NYQA 4NCZA 3KRVA 2Z10A 1JDBC 4M6GA 1QSNA 4KUBA 3C8OA 3SJXA 1ARMA 3B35A 2GP4A 3GKRA 3TLZA 1I1DA 2V8VA 2ZW5A 3D2PA 3W6XA 2F7VA 4B6ZA 2E28A 1QSOA 1PYTB 4AB7A 3BUMB 2Y0MA 4MFLA 4X5KA 4PQAA 4ONUA 5A27A 2Y1NA 1TIQA 4C8TA 5G20A 5BY0A 2J9AA 1DIKA 2YNCC 2ZOFA 4R3LA 3FJUA 4MHPA 2HUZA 3T90A 1Q7LA 2ABZA 4KVXA 2Y1MA 1FY7A 3KASA 1IB1E 4AG9A 3PB9X 5IB0A 1YLOA 2P6GA 4PK3A 4OMEA 5CNPA 3EFAA 3GJZA 1VHSA 4B10A 1AMPA 2PJ8A 1BLLE 2ZOGA 4JWPA 4X2TA 3S6KA 4AVAA 1H8LA 1ZG8A 1UWYA 3KHXA 1MJ9A 2PC1A 4WJBA 4Q38A 5AG6A 4XNHB 1YVHA 1TXRA 3IWWA 4YN3A 2G9DA 3SI1A 5HVHA 1ZG7A 2Q04A 4KOWA 1XIXA 3R9EA 4MCSA 4OKOA 3F8KA 2QIRA 3EC4A 2ARHA 1QSMA 1IOIA 2WPWA 3B3CA 2VL1A 5ISVA 2FVGA 4ZI6A 2A4NA 4OIDA 4F9UA 2FIAA 4JYWA 3I3GA 3KZWA 4RN7A 1VKCA 1S3ZA 3FB3A 2JEWA 1FNOA 2Q43A 2CIJA 1YW6A 3IGRA 4AXVA 5HKWA 5J1QA 5F48A 3R9FA 3S6HA 4CGOA 4M8DA 3FIXA 2BEIA 3WC5A 3D4UA 4NJRA 1BAVA 3DLJA 4PXDA 4A30A 1VI4A 3K9UA 2C1CA 4NGRA 3HPGG 4FD7A 4A95A 4CAVA 3U1BA 1X12A 4W9YA 3LWUA 3RO0A 3FECA 1VBGA 2PJ9A 3BXMA 1ZO0A 3EZEA 5G1ZA 3D68A 2DPTA 3E0KA 3PB6X 4U9ZA 3NA6A 2UV8G 1Q2DA 4Y49C 2V8DA 4AVCA 4FBEA 8CPAA 1WVMA 2N3AB 4LX9A 4MHYA 4IIXA 1VIXA 4HNWB 3HMJG 2D4PA 5J3XA 1S60A 3BUWB 4BBHA 4PSWA 3EZBA 2Z0ZA 1VGYA 4CYQA 1PUAA 3SJFA 3LACA 3DR6A 3WR7A 2PVVA 2X7BA 2ZELA 3PZJA 4LQ6A 5DWMA 4ZGYB 4JVOA 1XRYA 1YGHA 4NXYA 4BINA 4KLWA 3ISZA 1RO5A 1B47A 1WWZA 3IWEA 2AJ6A 3BI1A 2Q0YA 5F46A 3OP0A 3VRRA 2PJCA 2YNCA 1KC7A 2XPOA 3CPXA 3KQXA 3D7HA 1TF8A 5AG7A 4FD6A 5HH1A 3WABA 2NMTA 4NGSA 3LD2A 4MFZA 4YFJA 3UY5A 3V7ZA 1Z2LA 4F0XA 5C88A 3TE4A 4E0AA 1Z5RA 3T0TA 2BL1A 4QC6A 4C2XA 3D8PA 4GPLB 2OU2A 2GLJA 1LRZA 3MGDA 1WK4A 4A4CA 3FEDA 1S7KA 3F5BA 1KEEB 2D0OA 5F1YA 2IQ6A 4MHDA 2OZUA 4BTFA 2HB6A 1B87A 2B5GB 1CM0A 3KGQA 4UWIA 4JJXA 1CS0B 2HV2A 2PRBA 1YMEA 2JDDA 4UCNA 4C8UA 4MMOA 2CTBA 3KR5A 1YSJA 1DTDA 3ZJ0A 4M3SA 3S6GA 1CP7A 1M44A 2B4JC 4MI4A 4RS2A 2GU2A 4WWVA 2C27A 5D29A 2Q51A 1L0CA 3CXPA 4MFPA 3IU1A 4Y49B 5LYIA 1M4GA 1XMBA 3BJ8A 2YNEA 4U9YA 4A2ZA 1YW4A 4C9RA 5JVLA 1XF8A 2WUUA 3IFEA 2X0SA 4XPDC 1WJTA 1K4JA 1FBVA 2FS5A 2ZEGA 3FVLA 4JXRA 3GIUA 2D4OA 2AFXA 5F09A 4B14A 4EFDA 3NOJA 3S6FA 4F9VA 3D67A
chains in the Genus database with same CATH topology
4P6YA 3BHXA 1IGBA 4EWTA 4NGMA 4MHZA 2ZEEA 2C6GA 2POKA 3LMSA 4OC3A 1JQGA 1HDQA 3JRUA 3GUXA 2NSMA 3KR4A 1R3NA 2JBKA 5JGFA 3TC8A 4KNGE 5K8MA 1VHEA 2Q4ZA 3EIFA 2C6PA 3IC1A 1TKFA 1Y9ZA 5LYFA 3RZAA 4A94A 1ELMP 3K2KA 4NGNA 4C85A 2OR4A 4C84A 5LRKA 4C9VA 3CDXA 1Y0RA 1Y0YA 4ZX8A 2PJ7A 1LAPA 2XEGA 3NFZA 2C5QA 2ZEDA 4P44A 4PXBA 4P4JA 1FT7A 4OC1A 1CBXA 3PB4X 4OC4A 2PVWA 4UIBA 1DE4C 4MCRA 1LFWA 4OIWA 4R8FA 4X8IA 4C86A 4IK2A 3WC7A 4A37A 3V38A 1EE3P 4ZY2A 4P4EA 3IEHA 2EK9A 4NGPA 4UEEA 3IO1A 3T8WA 4TWEA 3SI0A 4FAIA 3I1UA 4C8AA 1ZG9A 5DS0A 4ONWA 2PJ6A 4P4FA 1LOKA 1QQ9A 3VATA 4NGTA 3H8FA 2V8GA 3KQZA 3FMCA 1BPNA 3PBBA 1LAMA 2PJ3A 3SI2A 4IAVA 3NH4A 2PE3A 3PFOA 5HVGA 4R6TA 4P4DA 4G1PA 3SJGA 2PJAA 3D66A 3VH9A 1ZLIA 4YU9A 4JZ0A 2QYVA 1XFOA 4C99A 3WT4A 5ELYA 3TX8A 3FH4A 3QNVA 4X3RA 4OC5A 4P4IA 1PCAA 3CT9A 3S9MA 3S9LA 4FUUA 4EMEA 5LRGA 2RB7A 2PRQA 2EWBA 3ICUA 1KWMA 4C9AA 3KL9A 2EK8A 2PJ1A 3B3WA 3ISXA 5K8NA 4PPZA 4Z65A 4ZY0A 3NH5A 3B3SA 4DJLA 5LYLA 3HLPA 1F57A 1VHOA 2CF4A 5I4MA 2XEFA 1TF9A 2PJ0A 2ZEMA 3MN8A 2WZNA 5K8OA 4C8PA 2AFWA 2ZENA 5IB9A 4P45A 1M4LA 2O53A 1GYTA 4CDKA 4A39A 4R7MA 2PJ4A 2ZEHA 2PIYA 3S9NA 5D8NA 1Y7EA 5LRJA 4Q7AA 5CBMA 1V6CA 4ZYQA 3CPAA 2HC9A 1IY7A 3GB0A 4MCPA 4C9UA 1F2OA 2PIZA 1AYEA 1CX8A 4A38A 2WYRA 4UF4A 5THWA 3VARA 4UIAA 5IR2A 4IHMA 2AFZA 2DEAA 2BOAA 1HEEA 2AFOA 6CPAA 1QMUA 3N5FA 4KSIA 4MCQA 1CG2A 3HUVA 3IIBA 2C6CA 3PB8X 3MRUA 4LQGA 3FX6A 1LCPA 1BPMA 4P4BA 4F8ZA 3B3VA 1CPXA 4RUHA 4K3NA 4O23A 2ZEPA 2AFMA 1XBUA 4YWYA 4PXCA 2GREA 2JBJA 2ZEFA 3BI0A 2V8HA 3PEIA 3I6SA 4NGQA 2PJBA 5CPAA 4C9EA 2I3CA 1ELLP 1XF1A 2OOTA 2F8HA 4ZY1A 2GLFA 3FF3A 2PJ2A 2ZEOA 2BO9A 1ZLHA 2RFHA 3K9TA 3KI9A 1CP6A 4TJXA 4NJQA 2PCUA 3PRTA 7CPAA 4DYOA 1XJOA 3DGVA 2BCOA 2IMOA 2XEIA 4PXEA 5HVFA 2XEJA 4P10A 3B3TA 3D7DA 4NFRA 4OC0A 1ARLA 1RTQA 3I74A 2O4HA 3WC6A 4CDJA 2QVPA 2IJZA 3PB7X 4UEFA 4TJVA 3NH8A 1F2PA 2V77A 1NSAA 4MHNA 1TKHA 3PBEA 4FWUA 4TNUA 3RBUA 4R76A 4H2KA 1OBRA 1CPSA 4MXUA 4OC2A 5JM6A 3IJ3A 4GM5A 3SJEA 2CTCA 4BD9A 5JH9A 3RAMA 2AFSA 5HXDA 3D7GA 2AFUA 3B2YA 3D7FA 1TKJA 5K8PA 3VTAA 3PFEA 4C8CA 3GLJA 3KHZA 3L2NA 3FEEA 3H8GA 4ZX9A 3H8EA 4DUKA 4OP4A 1R43A 2QJ8A 3B7IA 4MRIA 1LANA 1HDUA 4C8FA 4CPAA 1Z8LA 5LYDA 2ANPA 2PJ5A 4UEZA 2NYQA 3SJXA 1ARMA 3B35A 2GP4A 2V8VA 4B6ZA 2F7VA 1PYTB 4PQAA 4C8TA 2J9AA 2ZOFA 3FJUA 4MHPA 1Q7LA 2ABZA 3KASA 3PB9X 1YLOA 4OMEA 1AMPA 2PJ8A 1BLLE 2ZOGA 4X2TA 1H8LA 1ZG8A 1UWYA 3KHXA 4WJBA 1TXRA 3IWWA 4YN3A 2G9DA 3SI1A 5HVHA 1ZG7A 4MCSA 4OKOA 3B3CA 2VL1A 2FVGA 4ZI6A 4OIDA 4F9UA 3KZWA 4JYWA 2JEWA 1FNOA 2Q43A 2CIJA 1YW6A 5J1QA 4AXVA 3WC5A 3D4UA 4NJRA 1BAVA 3DLJA 4PXDA 2C1CA 4NGRA 3LWUA 4W9YA 3FECA 2PJ9A 3BXMA 3D68A 3PB6X 3NA6A 2V8DA 4FBEA 8CPAA 1WVMA 4MHYA 1VIXA 1VGYA 3SJFA 2PVVA 2ZELA 1XRYA 3ISZA 3BI1A 2PJCA 3KQXA 3CPXA 3D7HA 1TF8A 3WABA 4NGSA 3V7ZA 1Z2LA 1Z5RA 2GLJA 3FEDA 2IQ6A 2HB6A 3KGQA 4C8UA 1YMEA 4MMOA 2CTBA 3KR5A 1YSJA 1DTDA 1CP7A 2GU2A 4WWVA 5D29A 2Q51A 5LYIA 1XMBA 4C9RA 1YW4A 3IFEA 3FVLA 2ZEGA 2AFXA 5F09A 4EFDA 4F9VA 3D67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6Y A;  3BHX A;  1IGB A;  4EWT A;  4NGM A;  4MHZ A;  2ZEE A;  2C6G A;  2POK A;  3LMS A;  4OC3 A;  1JQG A;  1HDQ A;  3JRU A;  3GUX A;  2NSM A;  3KR4 A;  1R3N A;  2JBK A;  5JGF A;  3TC8 A;  4KNG E;  5K8M A;  1VHE A;  2Q4Z A;  3EIF A;  2C6P A;  3IC1 A;  1TKF A;  1Y9Z A;  5LYF A;  3RZA A;  4A94 A;  1ELM P;  3K2K A;  4NGN A;  4C85 A;  2OR4 A;  4C84 A;  5LRK A;  4C9V A;  3CDX A;  1Y0R A;  1Y0Y A;  4ZX8 A;  2PJ7 A;  1LAP A;  2XEG A;  3NFZ A;  2ZED A;  4P44 A;  4PXB A;  4P4J A;  1FT7 A;  4OC1 A;  1CBX A;  3PB4 X;  4OC4 A;  2PVW A;  4UIB A;  1DE4 C;  4MCR A;  1LFW A;  4OIW A;  4R8F A;  4X8I A;  4C86 A;  4IK2 A;  3WC7 A;  4A37 A;  3V38 A;  1EE3 P;  4ZY2 A;  4P4E A;  3IEH A;  2EK9 A;  4NGP A;  4UEE A;  3IO1 A;  3T8W A;  4TWE A;  3SI0 A;  4FAI A;  3I1U A;  4C8A A;  1ZG9 A;  5DS0 A;  4ONW A;  2PJ6 A;  4P4F A;  1LOK A;  1QQ9 A;  3VAT A;  4NGT A;  3H8F A;  2V8G A;  3KQZ A;  3FMC A;  1BPN A;  3PBB A;  1LAM A;  2PJ3 A;  3SI2 A;  4IAV A;  3NH4 A;  2PE3 A;  3PFO A;  5HVG A;  4R6T A;  4P4D A;  4G1P A;  3SJG A;  2PJA A;  3D66 A;  3VH9 A;  1ZLI A;  4YU9 A;  4JZ0 A;  2QYV A;  1XFO A;  4C99 A;  3WT4 A;  5ELY A;  3TX8 A;  3FH4 A;  3QNV A;  4X3R A;  4OC5 A;  4P4I A;  1PCA A;  3CT9 A;  3S9M A;  3S9L A;  4FUU A;  4EME A;  5LRG A;  2RB7 A;  2PRQ A;  2EWB A;  3ICU A;  1KWM A;  4C9A A;  3KL9 A;  2EK8 A;  2PJ1 A;  3B3W A;  3ISX A;  5K8N A;  4PPZ A;  4Z65 A;  4ZY0 A;  3NH5 A;  3B3S A;  4DJL A;  5LYL A;  3HLP A;  1F57 A;  1VHO A;  2CF4 A;  5I4M A;  2XEF A;  1TF9 A;  2PJ0 A;  2ZEM A;  3MN8 A;  2WZN A;  5K8O A;  4C8P A;  2AFW A;  2ZEN A;  5IB9 A;  4P45 A;  1M4L A;  2O53 A;  1GYT A;  4CDK A;  4A39 A;  4R7M A;  2PJ4 A;  2ZEH A;  2PIY A;  3S9N A;  5D8N A;  1Y7E A;  5LRJ A;  4Q7A A;  5CBM A;  1V6C A;  4ZYQ A;  3CPA A;  2HC9 A;  1IY7 A;  3GB0 A;  4MCP A;  4C9U A;  1F2O A;  2PIZ A;  1AYE A;  1CX8 A;  4A38 A;  2WYR A;  4UF4 A;  5THW A;  3VAR A;  4UIA A;  4IHM A;  2AFZ A;  2DEA A;  2BOA A;  1HEE A;  2AFO A;  6CPA A;  1QMU A;  3N5F A;  4KSI A;  4MCQ A;  1CG2 A;  3HUV A;  3IIB A;  2C6C A;  3PB8 X;  3MRU A;  4LQG A;  3FX6 A;  1LCP A;  1BPM A;  4P4B A;  4F8Z A;  3B3V A;  1CPX A;  4RUH A;  4K3N A;  4O23 A;  2ZEP A;  2AFM A;  1XBU A;  4YWY A;  4PXC A;  2GRE A;  2JBJ A;  2ZEF A;  3BI0 A;  2V8H A;  3PEI A;  3I6S A;  4NGQ A;  2PJB A;  5CPA A;  4C9E A;  2I3C A;  1ELL P;  1XF1 A;  2OOT A;  2F8H A;  4ZY1 A;  2GLF A;  3FF3 A;  2PJ2 A;  2ZEO A;  2BO9 A;  1ZLH A;  2RFH A;  3K9T A;  3KI9 A;  1CP6 A;  4TJX A;  4NJQ A;  2PCU A;  3PRT A;  7CPA A;  4DYO A;  1XJO A;  3DGV A;  2BCO A;  2IMO A;  2XEI A;  4PXE A;  5HVF A;  2XEJ A;  4P10 A;  3B3T A;  3D7D A;  4NFR A;  4OC0 A;  1ARL A;  1RTQ A;  3I74 A;  2O4H A;  3WC6 A;  4CDJ A;  2QVP A;  2IJZ A;  3PB7 X;  4UEF A;  4TJV A;  3NH8 A;  1F2P A;  2V77 A;  1NSA A;  4MHN A;  1TKH A;  3PBE A;  4FWU A;  4TNU A;  3RBU A;  4R76 A;  4H2K A;  1OBR A;  1CPS A;  4MXU A;  4OC2 A;  5JM6 A;  3IJ3 A;  4GM5 A;  3SJE A;  2CTC A;  4BD9 A;  5JH9 A;  3RAM A;  2AFS A;  5HXD A;  3D7G A;  2AFU A;  3B2Y A;  3D7F A;  1TKJ A;  5K8P A;  3VTA A;  3PFE A;  4C8C A;  3GLJ A;  3KHZ A;  3L2N A;  3FEE A;  3H8G A;  4ZX9 A;  3H8E A;  4DUK A;  4OP4 A;  1R43 A;  2QJ8 A;  3B7I A;  4MRI A;  1LAN A;  1HDU A;  4C8F A;  4CPA A;  1Z8L A;  5LYD A;  2ANP A;  2PJ5 A;  4UEZ A;  2NYQ A;  3SJX A;  1ARM A;  3B35 A;  2V8V A;  4B6Z A;  2F7V A;  1PYT B;  4PQA A;  4C8T A;  2J9A A;  2ZOF A;  3FJU A;  4MHP A;  1Q7L A;  2ABZ A;  3KAS A;  3PB9 X;  1YLO A;  4OME A;  1AMP A;  2PJ8 A;  1BLL E;  2ZOG A;  4X2T A;  1H8L A;  1ZG8 A;  1UWY A;  3KHX A;  4WJB A;  1TXR A;  3IWW A;  4YN3 A;  2G9D A;  3SI1 A;  5HVH A;  1ZG7 A;  4MCS A;  4OKO A;  3B3C A;  2VL1 A;  2FVG A;  4ZI6 A;  4OID A;  4F9U A;  3KZW A;  4JYW A;  2JEW A;  1FNO A;  2Q43 A;  2CIJ A;  1YW6 A;  5J1Q A;  4AXV A;  3WC5 A;  3D4U A;  4NJR A;  1BAV A;  3DLJ A;  4PXD A;  2C1C A;  4NGR A;  3LWU A;  4W9Y A;  3FEC A;  2PJ9 A;  3BXM A;  3D68 A;  3PB6 X;  3NA6 A;  2V8D A;  4FBE A;  8CPA A;  1WVM A;  4MHY A;  1VIX A;  1VGY A;  3SJF A;  2PVV A;  2ZEL A;  1XRY A;  3ISZ A;  3BI1 A;  2PJC A;  3KQX A;  3CPX A;  3D7H A;  1TF8 A;  3WAB A;  4NGS A;  3V7Z A;  1Z2L A;  1Z5R A;  2GLJ A;  3FED A;  2IQ6 A;  2HB6 A;  3KGQ A;  4C8U A;  1YME A;  4MMO A;  2CTB A;  3KR5 A;  1YSJ A;  1DTD A;  1CP7 A;  2GU2 A;  4WWV A;  5D29 A;  2Q51 A;  5LYI A;  1XMB A;  4C9R A;  1YW4 A;  3IFE A;  3FVL A;  2ZEG A;  2AFX A;  5F09 A;  4EFD A;  4F9V A;  3D67 A; 
#chains in the Genus database with same CATH topology
 1S7L A;  4KOY A;  4P6Y A;  3BHX A;  1IGB A;  4KZT A;  4MFK A;  5E96 A;  4EWT A;  4NGM A;  4MHZ A;  3VWD A;  5KTC A;  3TLG B;  2ZEE A;  2VKZ G;  2C6G A;  3I9S A;  2POK A;  4PV6 A;  1Z8X A;  3LMS A;  4OC3 A;  1M1D A;  1JQG A;  4HNY B;  1HDQ A;  2P6E A;  1X10 A;  2B5G A;  2DLA A;  3JRU A;  2HQY A;  2NSM A;  3GUX A;  1R3N A;  3KR4 A;  4R9M A;  3T9Y A;  1QST A;  3TT2 A;  2JBK A;  5G21 A;  5JGF A;  3TLY A;  3TC8 A;  3TOB A;  4BPU B;  1YLE A;  1M6V B;  4KNG E;  5K8M A;  2GIV A;  4KOV A;  1VHE A;  1MJA A;  2Q4Z A;  3EIF A;  3NFQ A;  2C6P A;  3BUN B;  5I0C A;  4A32 A;  2G3T A;  3TO7 A;  1NXJ A;  4MFQ A;  3IC1 A;  1TKF A;  2FCK A;  1Y9Z A;  5LYF A;  3W91 A;  3RZA A;  4PSX A;  2AUN A;  2ODF A;  4A94 A;  1ELM P;  5IV0 A;  3T07 A;  5K99 A;  4GS4 A;  4B12 A;  4KSA A;  3R1K A;  3K2K A;  1NSL A;  4NGN A;  4CAE A;  2OR4 A;  4IF5 A;  4C84 A;  4C85 A;  5LRK A;  2GFQ A;  1YQE A;  3B8G A;  3TLG A;  4C9V A;  5F47 A;  3CDX A;  4CGP A;  1GGO A;  4IUS A;  1Y0R A;  2JDC A;  4ZBG A;  4IIY A;  3VRO A;  3NE8 A;  4BPX B;  3TLE A;  5AXI A;  4XPD B;  3G23 A;  1Y0Y A;  4MI1 A;  4CAW A;  1YK3 A;  2PJ7 A;  4ZX8 A;  3HPH E;  1LAP A;  2XEG A;  3TO9 A;  5JPH A;  2P0W A;  5G22 A;  2XPN A;  3NFZ A;  1ON0 A;  2QEC A;  1C30 B;  2ZED A;  2C5Q A;  2Z3P A;  4P44 A;  4PXB A;  3RNZ A;  4P4J A;  4MFJ A;  4UWJ A;  3R96 A;  3BUX B;  1FT7 A;  2CNM A;  3TLC A;  4OC1 A;  1SQH A;  1CBX A;  3PB4 X;  2PDO A;  4CS0 B;  4OC4 A;  2PVW A;  3OWC A;  4UIB A;  1R61 A;  2CY2 A;  2OH1 A;  4OAE A;  2Z3N A;  1DE4 C;  4MCR A;  1GHE A;  2O28 A;  4M6H A;  4UA3 A;  4II9 A;  1LFW A;  5F5X A;  4OIW A;  4R8F A;  4X8I A;  4C86 A;  2ZPA A;  2WSA A;  4UCM A;  2OLS A;  2DF5 A;  1EO0 A;  4IK2 A;  3WC7 A;  2DIK A;  2I79 A;  5H84 A;  2B3U A;  4A37 A;  3C26 A;  1YVK A;  3DR8 A;  2VZZ A;  2Q44 A;  4NF1 A;  1VBH A;  4H89 A;  3D3S A;  1EE3 P;  4ZY2 A;  4P4E A;  3IEH A;  2EK9 A;  4NGP A;  4J3G A;  3V38 A;  4HPS A;  3EZA A;  3VRQ A;  4CRZ B;  2FM4 A;  4UEE A;  3U88 C;  3IO1 A;  3T8W A;  3VRN A;  2F5I A;  2I00 A;  4TWE A;  3SI0 A;  4FAI A;  3I1U A;  3VRP A;  4QBJ A;  1AUG A;  4C8A A;  1Z4E A;  1ZG9 A;  4H6U A;  4MJ8 A;  1Z9U A;  5DS0 A;  4L8A A;  4R3K A;  3F0A A;  4ONW A;  2PJ6 A;  4P4F A;  1JWQ A;  1LOK A;  1QQ9 A;  4F6A A;  5J8C A;  1Q5X A;  4JLY A;  5HKY A;  3VAT A;  4NGT A;  3G8W A;  5H86 A;  2REF A;  3H8F A;  2V8G A;  3PFV A;  3KQZ A;  1BOB A;  3FMC A;  2B58 A;  1IU8 A;  1BPN A;  4CRY B;  1A2Z A;  2R8V A;  3EXN A;  3PBB A;  4R57 A;  1LAM A;  3BJ7 A;  2PJ3 A;  3SI2 A;  4IAV A;  3TOA A;  1Q2C A;  3NH4 A;  2HI6 A;  2PE3 A;  3PFO A;  4CYO A;  1Y9W A;  2Q4V A;  2Z11 A;  1KUX A;  2VQY A;  2FXF A;  4P4D A;  4R6T A;  4G1P A;  3SJG A;  3PP9 A;  4CGM A;  2PJA A;  3D66 A;  1JDE A;  3VH9 A;  2EZC A;  5JQ4 A;  1ZLI A;  4ORF A;  4YU9 A;  4JZ0 A;  2QYV A;  3PLF B;  1XFO A;  3SHP A;  4C99 A;  3WT4 A;  5ELY A;  1OZP A;  4KOR A;  3FH4 A;  3QNV A;  3TX8 A;  2J8N A;  4J0N A;  4RR2 B;  2Q7B A;  3VWE A;  3TTH A;  1IID A;  2HWG A;  1T36 B;  4B5P B;  1XE4 A;  4X3R A;  1MK4 A;  4BPW B;  3IU2 A;  4OC5 A;  4MJX A;  3JUW A;  4RI1 A;  4P4I A;  1PCA A;  4H1H A;  1C3O B;  2OZG A;  3NE7 A;  4F0Y A;  2R98 A;  5HMN A;  3CT9 A;  3S9M A;  4E8O A;  4EYS A;  4YGO A;  3OB1 B;  3S9L A;  3GYA A;  1Y7R A;  4FD5 A;  1YX0 A;  2Z3M A;  4EVY A;  4FUU A;  4E5S A;  1NMT A;  4EME A;  5LRG A;  4CGN A;  1EZA A;  2G3A A;  2RB7 A;  5FD8 A;  3PT1 A;  2PRQ A;  2EWB A;  4CYP A;  4FD4 A;  2ZW7 A;  3CZX A;  2DXQ A;  1KWM A;  2HRO A;  3ICU A;  3JTK A;  2K5T A;  4KOT A;  4C9A A;  4C7H A;  2CNS A;  3KL9 A;  2EK8 A;  2R7H A;  2PJ1 A;  2VEZ A;  3B3W A;  3ISX A;  4P10 A;  5K8N A;  3A9L A;  2OB0 A;  4PPZ A;  2J8M A;  4PK2 A;  3VGO A;  2FIW A;  3FRM A;  4L89 A;  2YJT A;  4Z65 A;  3SXN A;  4ZY0 A;  3NH5 A;  2BSW A;  4HKF A;  3B3S A;  1I21 A;  4DJL A;  5LYL A;  3HLP A;  1IOF A;  1F57 A;  1VHO A;  2CF4 A;  4B5P A;  4CYN A;  5C82 A;  2XEF A;  5I4M A;  1TF9 A;  2PJ0 A;  2ZEM A;  4B13 A;  4M85 A;  4DNC A;  3T05 A;  4I49 A;  4H6Z A;  3MN8 A;  4R87 A;  2WZN A;  5K8O A;  4C8P A;  2AFW A;  2JLM A;  4E94 A;  2ZEN A;  1CJW A;  5IB9 A;  3D2M A;  4P45 A;  1M4L A;  2O53 A;  1GYT A;  2Z3K A;  5J8F A;  1S7F A;  4UFX A;  1MJB A;  4CDK A;  2YND A;  2H5M A;  3TO6 A;  4A39 A;  1V0C A;  1P4N A;  2B4B A;  4R7M A;  4A31 A;  2PJ4 A;  5KTA A;  2ZXV A;  5EMI A;  2ZEH A;  2PIY A;  2Z3O A;  3S9N A;  5D8N A;  1Y7E A;  5F13 A;  4LUA A;  3GY9 A;  5LRJ A;  1ZRS A;  1A9X B;  4Q7A A;  2QML A;  3FBU A;  5CBM A;  2PQ8 A;  1V6C A;  4ZYQ A;  3QAH A;  3CPA A;  4B11 A;  2HC9 A;  1IY7 A;  3FXT A;  3GB0 A;  1KZF A;  4MCP A;  4XPK A;  1EZB A;  4XPL A;  3TLB A;  5DWN A;  3BUO B;  4C9U A;  1F2O A;  2PIZ A;  1AYE A;  1CX8 A;  1IYL A;  2G0B A;  4A38 A;  5HKZ A;  2WYR A;  2PSW A;  4E2A A;  4UF4 A;  3SR3 A;  4GXH A;  1J4J A;  2GAN A;  5THW A;  3VAR A;  4INJ A;  4UIA A;  3R9G A;  1XEB A;  5IR2 A;  4IHM A;  3O8Z A;  2AFZ A;  2VBQ A;  2Q7S A;  3EO4 A;  1XOV A;  2DEA A;  4QVT A;  2BOA A;  1ZL0 A;  1HEE A;  4CZ1 A;  4KVM E;  5A28 A;  4CO9 A;  2AFO A;  1KBL A;  6CPA A;  1QMU A;  4COB A;  3N5F A;  4KSI A;  5JYB A;  4MCQ A;  1CG2 A;  2FT0 A;  3HUV A;  3IIB A;  2C6C A;  3OB2 B;  1M4D A;  3MRU A;  3PB8 X;  5F49 A;  4LQG A;  3FX6 A;  1U6M A;  1KUY A;  1BPM A;  1LCP A;  3OAK A;  1Q2Y A;  5EBV A;  4P4B A;  2PCN A;  4C2Z A;  4F8Z A;  3B3V A;  1CPX A;  4RUH A;  4QB9 A;  4OAD A;  4K3N A;  4O23 A;  2R82 A;  2EUI A;  2ZEP A;  4UFW A;  3BLN A;  4KOX A;  4NSQ A;  2AFM A;  1XBU A;  2ATR A;  2R1I A;  3JVN A;  4PXC A;  4YWY A;  2GRE A;  4C2Y A;  2JBJ A;  2ZEF A;  3EY5 A;  4KOU A;  4B5O A;  3PGP A;  2YJV A;  1Z8T A;  3BI0 A;  1YVO A;  4JXQ A;  4OLL A;  5EC4 A;  2V8H A;  3TFY A;  1ZYM A;  3PEI A;  5GCN A;  3I6S A;  3T5M A;  4NGQ A;  2PR8 A;  4Q36 A;  1M4I A;  1YRE A;  2PJB A;  4MY3 A;  2P6F A;  2Z3L A;  1S5K A;  2CNT A;  1S7N A;  2XPL A;  2VZY A;  5CPA A;  1PU9 A;  2D0P A;  3R95 A;  4C9E A;  4C68 A;  4UCP A;  2I3C A;  1ELL P;  2AE6 A;  4COG A;  1XF1 A;  2OOT A;  4UBR A;  2F8H A;  2EVN A;  4ZY1 A;  3FNC A;  4C7I A;  2GLF A;  3FF3 A;  1XMT A;  2B4D B;  2VXK A;  1QSR A;  3KKW A;  2PJ2 A;  1B6B A;  2YGW A;  2ZEO A;  4AVB A;  5HVG A;  3TLA A;  2BO9 A;  1N71 A;  1ZLH A;  2RFH A;  3CXQ A;  3K9T A;  4KSF A;  4CAF A;  1RXT A;  2PR1 A;  3KI9 A;  3TYX A;  4CGL A;  2MP0 A;  1CP6 A;  4MBU A;  4TJX A;  3W6S A;  3CXS A;  1I12 A;  1IIC A;  2PCU A;  3PRT A;  4NJQ A;  4A33 A;  7CPA A;  1CE8 B;  3G3S A;  1BO4 A;  4BMH A;  2JEV A;  2VI7 A;  4AG7 A;  4MY0 A;  2J8R A;  4KUA A;  2AUM A;  2GE3 A;  2EO8 A;  1XJO A;  3DGV A;  4DYO A;  2BCO A;  2IMO A;  2XEI A;  1R57 A;  4PXE A;  1P0H A;  3IWG A;  2XEJ A;  3ZNI A;  3B3T A;  4JD6 A;  3D7D A;  2REE A;  4OC0 A;  4NFR A;  3H5Z A;  1Z9E A;  1ARL A;  1RTQ A;  2FE7 A;  2EZB A;  3I74 A;  2O4H A;  5AG5 A;  2CBL A;  2B3V A;  3N7Z A;  4NEX A;  3RYO A;  3WC6 A;  4CDJ A;  4HNX B;  4U5Y A;  3H4Q A;  2Q4Y A;  3DSB A;  1NBW A;  3SXO A;  2QVP A;  5F9M A;  3V8I A;  2IJZ A;  3PB7 X;  4UEF A;  4TJV A;  3NH8 A;  4KOS A;  1UFH A;  1F2P A;  2BUE A;  4A4B A;  5AGE A;  5HVF A;  2XPP A;  1NSA A;  2B4D A;  2DPS A;  2V77 A;  3QAY A;  4MHN A;  1TKH A;  5AG4 A;  3TCV A;  2IL4 A;  3PBE A;  4FWU A;  4TNU A;  2EBJ A;  3RBU A;  4R76 A;  4CAX A;  5IX3 A;  4H2K A;  4YRH A;  5BWA B;  3P2H A;  1OBR A;  1CPS A;  3DDD A;  3FYN A;  4MXU A;  1BXR B;  4OC2 A;  5JM6 A;  3IJ3 A;  1IYK A;  3SJE A;  2CTC A;  4GM5 A;  2OZH A;  4UFV A;  1KUV A;  4M6I A;  4BD9 A;  5JH9 A;  2WPX A;  3K4I A;  3RAM A;  2AFS A;  5HXD A;  1Y9K A;  3D7G A;  2AFU A;  1YR0 A;  2KCW A;  3B2Y A;  4KVO E;  3D7F A;  1TKJ A;  2ZW4 A;  3DNS A;  3QB8 A;  5K8P A;  3VTA A;  1Z8W A;  3PFE A;  2RC4 A;  4XNH C;  4C8C A;  3GLJ A;  3KHZ A;  3L2N A;  3ZZI A;  3FEE A;  3F9K C;  3H8G A;  4ZX9 A;  3H8E A;  4DUK A;  1NE9 A;  4OP4 A;  1R43 A;  2QJ8 A;  2CXA A;  2FL4 A;  3B7I A;  4MRI A;  1J3L A;  2EZA A;  1LAN A;  1HDU A;  3LOD A;  5FVJ A;  5KTD A;  4C8F A;  1Z4R A;  4CPA A;  3P2F A;  1Z8L A;  5LYD A;  2B0A A;  2ANP A;  2PJ5 A;  4K30 A;  4QUS A;  4KS9 A;  4UEZ A;  2ZW6 A;  2FSR A;  4KLV A;  2NYQ A;  4NCZ A;  3KRV A;  2Z10 A;  1JDB C;  4M6G A;  1QSN A;  4KUB A;  3C8O A;  3SJX A;  1ARM A;  3B35 A;  2GP4 A;  3GKR A;  3TLZ A;  1I1D A;  2V8V A;  2ZW5 A;  3D2P A;  3W6X A;  2F7V A;  4B6Z A;  2E28 A;  1QSO A;  1PYT B;  4AB7 A;  3BUM B;  2Y0M A;  4MFL A;  4X5K A;  4PQA A;  4ONU A;  5A27 A;  2Y1N A;  1TIQ A;  4C8T A;  5G20 A;  5BY0 A;  2J9A A;  1DIK A;  2YNC C;  2ZOF A;  4R3L A;  3FJU A;  4MHP A;  2HUZ A;  3T90 A;  1Q7L A;  2ABZ A;  4KVX A;  2Y1M A;  1FY7 A;  3KAS A;  1IB1 E;  4AG9 A;  3PB9 X;  5IB0 A;  1YLO A;  2P6G A;  4PK3 A;  4OME A;  5CNP A;  3EFA A;  3GJZ A;  1VHS A;  4B10 A;  1AMP A;  2PJ8 A;  1BLL E;  2ZOG A;  4JWP A;  4X2T A;  3S6K A;  4AVA A;  1H8L A;  1ZG8 A;  1UWY A;  3KHX A;  1MJ9 A;  2PC1 A;  4WJB A;  4Q38 A;  5AG6 A;  4XNH B;  1YVH A;  1TXR A;  3IWW A;  4YN3 A;  2G9D A;  3SI1 A;  5HVH A;  1ZG7 A;  2Q04 A;  4KOW A;  1XIX A;  3R9E A;  4MCS A;  4OKO A;  3F8K A;  2QIR A;  3EC4 A;  2ARH A;  1QSM A;  1IOI A;  2WPW A;  3B3C A;  2VL1 A;  5ISV A;  2FVG A;  4ZI6 A;  2A4N A;  4OID A;  4F9U A;  2FIA A;  4JYW A;  3I3G A;  3KZW A;  4RN7 A;  1VKC A;  1S3Z A;  3FB3 A;  2JEW A;  1FNO A;  2Q43 A;  2CIJ A;  1YW6 A;  3IGR A;  4AXV A;  5HKW A;  5J1Q A;  5F48 A;  3R9F A;  3S6H A;  4CGO A;  4M8D A;  3FIX A;  2BEI A;  3WC5 A;  3D4U A;  4NJR A;  1BAV A;  3DLJ A;  4PXD A;  4A30 A;  1VI4 A;  3K9U A;  2C1C A;  4NGR A;  3HPG G;  4FD7 A;  4A95 A;  4CAV A;  3U1B A;  1X12 A;  4W9Y A;  3LWU A;  3RO0 A;  3FEC A;  1VBG A;  2PJ9 A;  3BXM A;  1ZO0 A;  3EZE A;  5G1Z A;  3D68 A;  2DPT A;  3E0K A;  3PB6 X;  4U9Z A;  3NA6 A;  2UV8 G;  1Q2D A;  4Y49 C;  2V8D A;  4AVC A;  4FBE A;  8CPA A;  1WVM A;  2N3A B;  4LX9 A;  4MHY A;  4IIX A;  1VIX A;  4HNW B;  3HMJ G;  2D4P A;  5J3X A;  1S60 A;  3BUW B;  4BBH A;  4PSW A;  3EZB A;  2Z0Z A;  1VGY A;  4CYQ A;  1PUA A;  3SJF A;  3LAC A;  3DR6 A;  3WR7 A;  2PVV A;  2X7B A;  2ZEL A;  3PZJ A;  4LQ6 A;  5DWM A;  4ZGY B;  4JVO A;  1XRY A;  1YGH A;  4NXY A;  4BIN A;  4KLW A;  3ISZ A;  1RO5 A;  1B47 A;  1WWZ A;  3IWE A;  2AJ6 A;  3BI1 A;  2Q0Y A;  5F46 A;  3OP0 A;  3VRR A;  2PJC A;  2YNC A;  1KC7 A;  2XPO A;  3CPX A;  3KQX A;  3D7H A;  1TF8 A;  5AG7 A;  4FD6 A;  5HH1 A;  3WAB A;  2NMT A;  4NGS A;  3LD2 A;  4MFZ A;  4YFJ A;  3UY5 A;  3V7Z A;  1Z2L A;  4F0X A;  5C88 A;  3TE4 A;  4E0A A;  1Z5R A;  3T0T A;  2BL1 A;  4QC6 A;  4C2X A;  3D8P A;  4GPL B;  2OU2 A;  2GLJ A;  1LRZ A;  3MGD A;  1WK4 A;  4A4C A;  3FED A;  1S7K A;  3F5B A;  1KEE B;  2D0O A;  5F1Y A;  2IQ6 A;  4MHD A;  2OZU A;  4BTF A;  2HB6 A;  1B87 A;  2B5G B;  1CM0 A;  3KGQ A;  4UWI A;  4JJX A;  1CS0 B;  2HV2 A;  2PRB A;  1YME A;  2JDD A;  4UCN A;  4C8U A;  4MMO A;  2CTB A;  3KR5 A;  1YSJ A;  1DTD A;  3ZJ0 A;  4M3S A;  3S6G A;  1CP7 A;  1M44 A;  2B4J C;  4MI4 A;  4RS2 A;  2GU2 A;  4WWV A;  2C27 A;  5D29 A;  2Q51 A;  1L0C A;  3CXP A;  4MFP A;  3IU1 A;  4Y49 B;  5LYI A;  1M4G A;  1XMB A;  3BJ8 A;  2YNE A;  4U9Y A;  4A2Z A;  1YW4 A;  4C9R A;  5JVL A;  1XF8 A;  2WUU A;  3IFE A;  2X0S A;  4XPD C;  1WJT A;  1K4J A;  1FBV A;  2FS5 A;  2ZEG A;  3FVL A;  4JXR A;  3GIU A;  2D4O A;  2AFX A;  5F09 A;  4B14 A;  4EFD A;  3NOJ A;  3S6F A;  4F9V A;  3D67 A; 
#chains in the Genus database with same CATH homology
 4P6Y A;  3BHX A;  1IGB A;  4EWT A;  4NGM A;  4MHZ A;  2ZEE A;  2C6G A;  2POK A;  3LMS A;  4OC3 A;  1JQG A;  1HDQ A;  3JRU A;  3GUX A;  2NSM A;  3KR4 A;  1R3N A;  2JBK A;  5JGF A;  3TC8 A;  4KNG E;  5K8M A;  1VHE A;  2Q4Z A;  3EIF A;  2C6P A;  3IC1 A;  1TKF A;  1Y9Z A;  5LYF A;  3RZA A;  4A94 A;  1ELM P;  3K2K A;  4NGN A;  4C85 A;  2OR4 A;  4C84 A;  5LRK A;  4C9V A;  3CDX A;  1Y0R A;  1Y0Y A;  4ZX8 A;  2PJ7 A;  1LAP A;  2XEG A;  3NFZ A;  2C5Q A;  2ZED A;  4P44 A;  4PXB A;  4P4J A;  1FT7 A;  4OC1 A;  1CBX A;  3PB4 X;  4OC4 A;  2PVW A;  4UIB A;  1DE4 C;  4MCR A;  1LFW A;  4OIW A;  4R8F A;  4X8I A;  4C86 A;  4IK2 A;  3WC7 A;  4A37 A;  3V38 A;  1EE3 P;  4ZY2 A;  4P4E A;  3IEH A;  2EK9 A;  4NGP A;  4UEE A;  3IO1 A;  3T8W A;  4TWE A;  3SI0 A;  4FAI A;  3I1U A;  4C8A A;  1ZG9 A;  5DS0 A;  4ONW A;  2PJ6 A;  4P4F A;  1LOK A;  1QQ9 A;  3VAT A;  4NGT A;  3H8F A;  2V8G A;  3KQZ A;  3FMC A;  1BPN A;  3PBB A;  1LAM A;  2PJ3 A;  3SI2 A;  4IAV A;  3NH4 A;  2PE3 A;  3PFO A;  5HVG A;  4R6T A;  4P4D A;  4G1P A;  3SJG A;  2PJA A;  3D66 A;  3VH9 A;  1ZLI A;  4YU9 A;  4JZ0 A;  2QYV A;  1XFO A;  4C99 A;  3WT4 A;  5ELY A;  3TX8 A;  3FH4 A;  3QNV A;  4X3R A;  4OC5 A;  4P4I A;  1PCA A;  3CT9 A;  3S9M A;  3S9L A;  4FUU A;  4EME A;  5LRG A;  2RB7 A;  2PRQ A;  2EWB A;  3ICU A;  1KWM A;  4C9A A;  3KL9 A;  2EK8 A;  2PJ1 A;  3B3W A;  3ISX A;  5K8N A;  4PPZ A;  4Z65 A;  4ZY0 A;  3NH5 A;  3B3S A;  4DJL A;  5LYL A;  3HLP A;  1F57 A;  1VHO A;  2CF4 A;  5I4M A;  2XEF A;  1TF9 A;  2PJ0 A;  2ZEM A;  3MN8 A;  2WZN A;  5K8O A;  4C8P A;  2AFW A;  2ZEN A;  5IB9 A;  4P45 A;  1M4L A;  2O53 A;  1GYT A;  4CDK A;  4A39 A;  4R7M A;  2PJ4 A;  2ZEH A;  2PIY A;  3S9N A;  5D8N A;  1Y7E A;  5LRJ A;  4Q7A A;  5CBM A;  1V6C A;  4ZYQ A;  3CPA A;  2HC9 A;  1IY7 A;  3GB0 A;  4MCP A;  4C9U A;  1F2O A;  2PIZ A;  1AYE A;  1CX8 A;  4A38 A;  2WYR A;  4UF4 A;  5THW A;  3VAR A;  4UIA A;  5IR2 A;  4IHM A;  2AFZ A;  2DEA A;  2BOA A;  1HEE A;  2AFO A;  6CPA A;  1QMU A;  3N5F A;  4KSI A;  4MCQ A;  1CG2 A;  3HUV A;  3IIB A;  2C6C A;  3PB8 X;  3MRU A;  4LQG A;  3FX6 A;  1LCP A;  1BPM A;  4P4B A;  4F8Z A;  3B3V A;  1CPX A;  4RUH A;  4K3N A;  4O23 A;  2ZEP A;  2AFM A;  1XBU A;  4YWY A;  4PXC A;  2GRE A;  2JBJ A;  2ZEF A;  3BI0 A;  2V8H A;  3PEI A;  3I6S A;  4NGQ A;  2PJB A;  5CPA A;  4C9E A;  2I3C A;  1ELL P;  1XF1 A;  2OOT A;  2F8H A;  4ZY1 A;  2GLF A;  3FF3 A;  2PJ2 A;  2ZEO A;  2BO9 A;  1ZLH A;  2RFH A;  3K9T A;  3KI9 A;  1CP6 A;  4TJX A;  4NJQ A;  2PCU A;  3PRT A;  7CPA A;  4DYO A;  1XJO A;  3DGV A;  2BCO A;  2IMO A;  2XEI A;  4PXE A;  5HVF A;  2XEJ A;  4P10 A;  3B3T A;  3D7D A;  4NFR A;  4OC0 A;  1ARL A;  1RTQ A;  3I74 A;  2O4H A;  3WC6 A;  4CDJ A;  2QVP A;  2IJZ A;  3PB7 X;  4UEF A;  4TJV A;  3NH8 A;  1F2P A;  2V77 A;  1NSA A;  4MHN A;  1TKH A;  3PBE A;  4FWU A;  4TNU A;  3RBU A;  4R76 A;  4H2K A;  1OBR A;  1CPS A;  4MXU A;  4OC2 A;  5JM6 A;  3IJ3 A;  4GM5 A;  3SJE A;  2CTC A;  4BD9 A;  5JH9 A;  3RAM A;  2AFS A;  5HXD A;  3D7G A;  2AFU A;  3B2Y A;  3D7F A;  1TKJ A;  5K8P A;  3VTA A;  3PFE A;  4C8C A;  3GLJ A;  3KHZ A;  3L2N A;  3FEE A;  3H8G A;  4ZX9 A;  3H8E A;  4DUK A;  4OP4 A;  1R43 A;  2QJ8 A;  3B7I A;  4MRI A;  1LAN A;  1HDU A;  4C8F A;  4CPA A;  1Z8L A;  5LYD A;  2ANP A;  2PJ5 A;  4UEZ A;  2NYQ A;  3SJX A;  1ARM A;  3B35 A;  2GP4 A;  2V8V A;  4B6Z A;  2F7V A;  1PYT B;  4PQA A;  4C8T A;  2J9A A;  2ZOF A;  3FJU A;  4MHP A;  1Q7L A;  2ABZ A;  3KAS A;  3PB9 X;  1YLO A;  4OME A;  1AMP A;  2PJ8 A;  1BLL E;  2ZOG A;  4X2T A;  1H8L A;  1ZG8 A;  1UWY A;  3KHX A;  4WJB A;  1TXR A;  3IWW A;  4YN3 A;  2G9D A;  3SI1 A;  5HVH A;  1ZG7 A;  4MCS A;  4OKO A;  3B3C A;  2VL1 A;  2FVG A;  4ZI6 A;  4OID A;  4F9U A;  3KZW A;  4JYW A;  2JEW A;  1FNO A;  2Q43 A;  2CIJ A;  1YW6 A;  5J1Q A;  4AXV A;  3WC5 A;  3D4U A;  4NJR A;  1BAV A;  3DLJ A;  4PXD A;  2C1C A;  4NGR A;  3LWU A;  4W9Y A;  3FEC A;  2PJ9 A;  3BXM A;  3D68 A;  3PB6 X;  3NA6 A;  2V8D A;  4FBE A;  8CPA A;  1WVM A;  4MHY A;  1VIX A;  1VGY A;  3SJF A;  2PVV A;  2ZEL A;  1XRY A;  3ISZ A;  3BI1 A;  2PJC A;  3KQX A;  3CPX A;  3D7H A;  1TF8 A;  3WAB A;  4NGS A;  3V7Z A;  1Z2L A;  1Z5R A;  2GLJ A;  3FED A;  2IQ6 A;  2HB6 A;  3KGQ A;  4C8U A;  1YME A;  4MMO A;  2CTB A;  3KR5 A;  1YSJ A;  1DTD A;  1CP7 A;  2GU2 A;  4WWV A;  5D29 A;  2Q51 A;  5LYI A;  1XMB A;  4C9R A;  1YW4 A;  3IFE A;  3FVL A;  2ZEG A;  2AFX A;  5F09 A;  4EFD A;  4F9V A;  3D67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...