4NGTA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 252
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngtA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngtA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngtA02
4C8FA 3WT4A 2PJ8A 2AFMA 4NGRA 3HUVA 4Q7AA 4DUKA 1ZLHA 3IJ3A 2PJ0A 3S9LA 2CF4A 4Z65A 4OC5A 4ZY0A 3FEEA 6CPAA 2G9DA 4OP4A 4YN3A 1UWYA 1Y0YA 5D8NA 2EK9A 2XEFA 3VH9A 4TNUA 1ZG8A 3HLPA 1TKJA 1WVMA 2ZEDA 3VARA 2ZENA 3PBBA 1CX8A 1EE3P 2ZEEA 1YLOA 3PFOA 5LRJA 4IAVA 3LMSA 2PIZA 3PBEA 2GREA 3RZAA 1VHEA 2PJ3A 2XEJA 2OR4A 4MCQA 4F8ZA 3K9TA 3FECA 1YSJA 3WC5A 7CPAA 4C86A 3PRTA 1NSAA 3GLJA 4P4IA 2ANPA 4OIWA 3FMCA 3BI0A 2ABZA 4DYOA 1VHOA 2ZELA 3FJUA 4OC0A 1M4LA 1ELLP 1BLLE 2CIJA 3D7FA 3KR4A 1CPSA 4NGMA 2QVPA 2CTBA 4MMOA 4LQGA 2JEWA 4CPAA 2PJBA 3ISZA 3IO1A 3PB7X 4C8UA 4R6TA 4JYWA 3B3TA 5LYFA 3NH4A 1CP7A 4DJLA 5J1QA 2PRQA 3DGVA 3L2NA 3I1UA 3B35A 2Q43A 4P10A 4P4BA 2ZEFA 3H8EA 8CPAA 2JBJA 3RAMA 3D66A 2ZEMA 4NGTA 1Z8LA 3FF3A 1H8LA 4FAIA 4ZX8A 4C8PA 5CPAA 1AMPA 2ZOGA 3CPXA 1CG2A 3V38A 1TF8A 3D7GA 2PJCA 3PB8X 2IMOA 2HB6A 2NYQA 2ZEHA 3KZWA 5LYDA 1XRYA 3WC6A 4A39A 4C9UA 4P4EA 3GB0A 5K8MA 4UF4A 2O53A 4P44A 1YMEA 2PJ5A 1IGBA 2EWBA 3CDXA 4C8TA 3PB4X 3D7DA 4R7MA 2PJ9A 1RTQA 2PCUA 3MRUA 4P45A 3TC8A 3IIBA 1FT7A 2C6PA 2RB7A 5F09A 2JBKA 3NH5A 1YW6A 2PVWA 3T8WA 2PJAA 3SJGA 3KGQA 1TXRA 4C9AA 4ONWA 2AFWA 3KR5A 4C84A 4TJVA 2PJ6A 4UIBA 3SJFA 3WC7A 3FH4A 1JQGA 4PXEA 2ZEPA 3H8GA 3KHXA 1ARMA 3FEDA 1VGYA 4NJQA 1V6CA 2AFZA 4AXVA 3N5FA 2GU2A 4O23A 3SI0A 2C6CA 4NGQA 5THWA 2AFOA 4OMEA 2FVGA 4C9VA 3NH8A 4EMEA 2PJ7A 3BHXA 4FUUA 2CTCA 2IQ6A 1ARLA 2RFHA 1R43A 4YWYA 3JRUA 1DTDA 3FX6A 4B6ZA 1Y9ZA 1AYEA 4F9VA 4BD9A 4NGSA 1ZLIA 3EIFA 1CP6A 4UEZA 3IFEA 4W9YA 2PIYA 4OC4A 3QNVA 1QMUA 4EWTA 3KL9A 4MCRA 1CBXA 3PB9X 2VL1A 2BOAA 3CT9A 3VATA 4H2KA 1IY7A 3IEHA 4TJXA 1F2PA 3B3CA 3SI1A 1TKFA 5K8PA 2BCOA 4UEEA 1BPMA 1LCPA 5JH9A 5ELYA 4A94A 2PVVA 4C9EA 3KHZA 5LRGA 3SI2A 4C99A 2BO9A 4OC1A 1LAPA 2Q51A 3KASA 5LRKA 3S9NA 3NA6A 1DE4C 3BI1A 2F7VA 1ZG9A 4ZYQA 4MHNA 4X2TA 4WWVA 5JM6A 2NSMA 3DLJA 1Y7EA 4UIAA 4ZI6A 2AFUA 3MN8A 3RBUA 1QQ9A 2POKA 4PXDA 4PXBA 3SJXA 4TWEA 4WJBA 3I6SA 3D4UA 3D68A 4NGPA 2PJ4A 2QJ8A 4R8FA 4P4FA 2HC9A 3ICUA 5LYIA 2V8HA 2J9AA 4OC3A 1LANA 4IK2A 1TKHA 5DS0A 1TF9A 5HVHA 3KQZA 4CDJA 1YW4A 1LAMA 1Q7LA 2V8DA 2C6GA 4OIDA 4ZY1A 2XEIA 4MCSA 4NFRA 1GYTA 2C1CA 1OBRA 2GLJA 3B3WA 1LFWA 4UEFA 1Y0RA 4FBEA 5K8NA 4PQAA 1FNOA 4MHPA 2V8GA 3LWUA 1XBUA 3NFZA 1XMBA 2WYRA 1HDQA 3CPAA 4C8CA 5HVGA 3B3VA 4ZY2A 1LOKA 1VIXA 2QYVA 1HDUA 3ISXA 3WABA 3I74A 2ZEGA 3KQXA 3D67A 4KSIA 3V7ZA 4ZX9A 4C8AA 4CDKA 2Q4ZA 3BXMA 5CBMA 4RUHA 5LYLA 4MXUA 4X8IA 2PJ1A 4A37A 4P4DA 2V8VA 3IC1A 2DEAA 3B7IA 2XEGA 1R3NA 2V77A 3VTAA 1BAVA 1F57A 5JGFA 4C9RA 1ELMP 5K8OA 2PE3A 4X3RA 4OKOA 4P6YA 4MHZA 4MHYA 2EK8A 3D7HA 5D29A 4GM5A 3TX8A 4IHMA 2OOTA 3PFEA 4G1PA 2O4HA 1PCAA 4K3NA 1BPNA 1XJOA 2IJZA 3IWWA 4JZ0A 4NJRA 1XFOA 5I4MA 3B3SA 1XF1A 4A38A 3S9MA 1PYTB 4MCPA 5IB9A 4C85A 1HEEA 3SJEA 3KI9A 4OC2A 2ZEOA 2GLFA 1F2OA 4PPZA 2F8HA 4R76A 4NGNA 4P4JA 3FVLA 3PB6X 4MRIA 5HVFA 2WZNA 1Z2LA 4FWUA 2I3CA 3GUXA 2PJ2A 4F9UA 4KNGE 3H8FA 1Z5RA 2AFXA 1KWMA 3K2KA 1ZG7A 4PXCA 1CPXA 4YU9A 4EFDA 3PEIA 2AFSA 2ZOFA 5HXDA 3B2YA
chains in the Genus database with same CATH superfamily
3E0KA 4C8FA 3EZEA 2YNEA 4E8OA 3WT4A 2PJ8A 4CGLA 4NCZA 2AFMA 3F5BA 4NGRA 4OLLA 5GCNA 1KZFA 3HUVA 4L8AA 4Q7AA 1Z4EA 2VQYA 4DUKA 4E94A 3PGPA 1ZLHA 3IJ3A 5EC4A 2PJ0A 4AVBA 3S9LA 1BOBA 4R57A 2CF4A 2ARHA 4Z65A 2D0OA 3R9EA 4OC5A 4ZY0A 3FEEA 6CPAA 2G9DA 2ATRA 1YREA 4OP4A 4YN3A 1XEBA 4CAFA 4UCNA 1UWYA 5J3XA 1Y0YA 2FM4A 5ISVA 5D8NA 2EK9A 2XEFA 4KOSA 1MJ9A 2OH1A 4XPDC 3VH9A 3VGOA 4TNUA 1YK3A 4PSXA 1P4NA 2XPLA 4KOYA 1ZG8A 3HLPA 1TKJA 4KUAA 1C3OB 1WVMA 2ZEDA 4XPDB 3VARA 1M1DA 2ZENA 1EO0A 3PBBA 1CX8A 3IU1A 1EE3P 2ZEEA 2VKZG 1YLOA 2QIRA 3PFOA 5LRJA 3EZAA 5IV0A 3K4IA 4OAEA 2Q7SA 1V0CA 2R98A 1YVKA 4IAVA 1IOFA 3LMSA 2PIZA 5JPHA 3TLYA 3T90A 4KUBA 3PBEA 4FD7A 2GREA 4BBHA 4MI4A 2B0AA 5KTAA 3R95A 1QSOA 3D2MA 3RZAA 1VHEA 4HKFA 2BEIA 2PJ3A 4H1HA 2R1IA 2XEJA 1RXTA 3TO9A 2OR4A 4MCQA 4UCMA 4F6AA 4F8ZA 2Q4VA 3K9TA 3FECA 3ZNIA 4K30A 1YLEA 4PSWA 1YSJA 4CYQA 3WC5A 4CAEA 5AG6A 7CPAA 4C86A 2QECA 5HKWA 3PRTA 5H84A 1NSAA 1S3ZA 1I21A 3GLJA 1XOVA 3PZJA 1I1DA 4P4IA 3NFQA 4ORFA 3W6SA 4M6HA 2ANPA 2BUEA 4UWJA 1IYKA 1IYLA 4OIWA 4U9ZA 3FMCA 3BI0A 4CS0B 2ABZA 4DYOA 1IIDA 1VHOA 2ZELA 3FJUA 4OC0A 3PT1A 3VRPA 1ELLP 1BLLE 1J4JA 1M4LA 3I3GA 2GP4A 5F9MA 2CIJA 4BPXB 1B6BA 1IU8A 3U1BA 3D7FA 3KR4A 1CPSA 2GIVA 5G22A 2G3TA 4C7HA 3HPGG 4NGMA 1QSRA 1YGHA 2C5QA 2QVPA 4L89A 2CTBA 3R1KA 4B13A 4MJ8A 4MMOA 4QB9A 3OB1B 2REEA 3G23A 2HI6A 4LQGA 2JEWA 3CXSA 4CPAA 4A33A 5J8FA 2PJBA 3ISZA 4UFVA 3IO1A 1RO5A 3PB7X 4M3SA 4AB7A 3U88C 4KOUA 4C8UA 2CBLA 2GANA 5G20A 4R6TA 4JYWA 4R3KA 4UWIA 3B3TA 3VROA 4JD6A 5LYFA 3NH4A 1CP7A 1I12A 1VHSA 4DJLA 2WPXA 5F47A 3OAKA 2Q44A 5J1QA 2PRQA 3DGVA 3L2NA 3I1UA 3SHPA 4C2YA 3B35A 4KVXA 2B4DA 2Q43A 4P10A 4PK2A 4P4BA 2FT0A 2FSRA 2I00A 2ZEFA 2Y1MA 3A9LA 3H8EA 5F13A 8CPAA 4PV6A 2JBJA 1JWQA 1QSMA 3RAMA 3D66A 4KLVA 4II9A 2ZEMA 4NGTA 1Z8LA 3FF3A 1Q2DA 2DF5A 1H8LA 4FAIA 1CS0B 4ZX8A 1UFHA 4B11A 2XPPA 2REFA 4C8PA 3UY5A 4KORA 5CPAA 4CAWA 2P6EA 5HMNA 1AMPA 2ZOGA 4M8DA 3FB3A 3DSBA 3IWEA 3TLZA 3QB8A 2H5MA 5JYBA 1S7FA 2DXQA 2I79A 1ON0A 2EUIA 2Z3LA 1CG2A 3CPXA 3T9YA 3V38A 4HPSA 1TF8A 2AE6A 3BUOB 4QBJA 3BUNB 3D7GA 2PJCA 2PR8A 2EBJA 2IMOA 3PB8X 3TLGA 1A9XB 2PC1A 2HB6A 2OB0A 4MFJA 2NYQA 2ZEHA 3KZWA 3JVNA 5LYDA 1XRYA 3WC6A 4A39A 3EY5A 4C9UA 2Z11A 4P4EA 3LD2A 4NXYA 3GB0A 5K8MA 4MFLA 4UF4A 2O53A 4A32A 4CGOA 4P44A 1YMEA 2PJ5A 2Z3OA 2ZW5A 3EO4A 4EYSA 1IGBA 5H86A 3VWEA 4F0YA 2PR1A 1EZBA 2QMLA 1ZYMA 2EWBA 4JXRA 3CDXA 1NXJA 4C8TA 4Y49C 1Y7RA 3PB4X 3D7DA 3DNSA 4R7MA 2ZW4A 4AG9A 2PJ9A 5BWAB 1RTQA 3DR6A 2PCUA 4IIXA 1NBWA 3MRUA 2WPWA 4P45A 3F9KC 1IICA 2YNCA 3IIBA 3TC8A 2HQYA 4A31A 1M4GA 2VZYA 2B5GB 1FT7A 2C6PA 2RB7A 4YRHA 4B12A 5AG7A 3DDDA 3GKRA 5F09A 2JBKA 3NH5A 4J3GA 4KS9A 1IB1E 2PVWA 4BPUB 1YW6A 2PJAA 4HNYB 4KOXA 3T8WA 2DPSA 1EZAA 2HWGA 1U6MA 2P0WA 3SJGA 3R96A 3I6SA 5FVJA 3KGQA 1TXRA 4C9AA 4XPKA 4ONWA 2FE7A 4H6ZA 2AFWA 4C2ZA 3KR5A 5C82A 4LX9A 2B3VA 3JTKA 1Y9KA 1AUGA 4TWEA 4C84A 3TYXA 3SR3A 2D4OA 4TJVA 2PJ6A 4UIBA 4J0NA 3SJFA 2PRBA 3VWDA 5F46A 3S6KA 3WC7A 3FH4A 4JLYA 3RO0A 4M6IA 1JQGA 2FIAA 2J8RA 2ZEPA 4ONUA 3H8GA 4NEXA 3KHXA 4PXEA 1WJTA 3TLEA 3P2FA 1ARMA 3FRMA 4CRZB 3FEDA 1VGYA 4NJQA 1V6CA 2AFZA 2CNSA 3FYNA 2FL4A 4AXVA 4BMHA 3N5FA 2GU2A 1S7NA 4O23A 2R8VA 3PFVA 2KCWA 2Q0YA 1NMTA 2FS5A 1VBHA 5G1ZA 3SI0A 2C6CA 3SXNA 5KTDA 3FXTA 2YGWA 5A27A 1ZRSA 2AUMA 4KSAA 2DIKA 1XE4A 2Q4YA 4NGQA 2F5IA 5THWA 2OU2A 2AFOA 4OMEA 2FVGA 1SQHA 3PP9A 5F5XA 2Z3PA 1BO4A 1Z8WA 4NSQA 2CNMA 3W6XA 4XNHB 1Q2CA 5AG4A 4C9VA 3NH8A 4GS4A 4RR2B 4EMEA 4UFXA 3P2HA 2PJ7A 3BHXA 2OZGA 2G0BA 3S6HA 1Z9EA 4JWPA 2CY2A 1NSLA 4UCPA 4FUUA 4KOVA 5IX3A 4COGA 2CTCA 4MY0A 3D2PA 2VI7A 1WWZA 3EZBA 1MJAA 1ARLA 2IQ6A 2RFHA 1Q2YA 3KKWA 4M6GA 5HKYA 1FY7A 1M4IA 1R43A 4KLWA 3JRUA 4RI1A 3BUXB 4YWYA 3ZJ0A 1A2ZA 1DTDA 4I49A 3FX6A 2XPNA 3JUWA 4B6ZA 4CYPA 1P0HA 1AYEA 4GPLB 1Y9ZA 4YGOA 4F9VA 4IF5A 2DPTA 2EZAA 3F0AA 5HH1A 2R82A 5IR2A 2B5GA 3S6GA 5HKZA 4BD9A 4A30A 4NGSA 1ZLIA 3BJ7A 3EIFA 1CP6A 1QSNA 3T07A 4MHDA 2JEVA 4UEZA 3IFEA 4A4CA 4F0XA 2FCKA 1M6VB 4H89A 4W9YA 2YJTA 2Z3NA 2HUZA 5EMIA 2EZBA 2PIYA 4OC4A 3QNVA 2O28A 4BPWB 1QMUA 2C27A 3CXPA 4CRYB 1YVHA 4EWTA 4E2AA 2OZHA 2VZZA 3KL9A 4MCRA 1CBXA 3PB9X 2VL1A 4JJXA 3LACA 2A4NA 2BOAA 3CT9A 4KOTA 3NOJA 3VATA 1YR0A 4ZBGA 2BL1A 4H2KA 1IY7A 1GHEA 1QSTA 1F2PA 3B3CA 3IEHA 4XNHC 3R9GA 1TKFA 3SI1A 5K8PA 4TJXA 2BCOA 2Q04A 3OP0A 1L0CA 1X10A 3CXQA 3FNCA 2CNTA 3G3SA 1BPMA 1LCPA 4MFKA 5JH9A 5ELYA 4A94A 1Z8XA 3TLAA 4B10A 2PVVA 2Z0ZA 4R3LA 4GXHA 1M4DA 2RC4A 2PQ8A 3SXOA 2AUNA 1Y9WA 4C9EA 3KHZA 5LRGA 3SI2A 5F49A 1K4JA 3RYOA 1JDBC 2B58A 2BO9A 4C99A 1R61A 4OC1A 1LAPA 1TIQA 3GJZA 2Q51A 3KASA 5E96A 1YQEA 5LRKA 2PSWA 3S9NA 3NE7A 4UFWA 4B14A 1S7KA 3NA6A 3EC4A 1VBGA 1DE4C 3BI1A 4AVCA 4CYOA 3TLBA 2F7VA 1ZG9A 4ZYQA 4MHNA 3FBUA 4X2TA 5EBVA 1BXRB 4WWVA 4CGNA 2E28A 5JM6A 3TLCA 2FXFA 2NSMA 2P6GA 4MFZA 2XPOA 3QAYA 3HMJG 1Y7EA 3DLJA 3TE4A 4UIAA 1B87A 4ZI6A 2AFUA 4MI1A 3QAHA 4CZ1A 2OLSA 2B4JC 4X5KA 3MN8A 4U9YA 2AJ6A 2VBQA 2B3UA 1Q5XA 2J8MA 3EFAA 3RBUA 2PCNA 1FBVA 4C7IA 3ZZIA 4JVOA 1KUVA 5FD8A 1QQ9A 2POKA 3BJ8A 2EVNA 3VRNA 2EO8A 4PXDA 3BUMB 3SJXA 3VRQA 2GE3A 2OZUA 2YNDA 3MGDA 4PXBA 2ZPAA 4QVTA 4MFQA 4C68A 4WJBA 4IIYA 1M44A 3KRVA 3H5ZA 4LUAA 1IOIA 1N71A 3BUWB 2WUUA 1PU9A 2ZW6A 3D4UA 1DIKA 3D68A 3GY9A 4NGPA 2NMTA 2PJ4A 4MY3A 4YFJA 2ZXVA 4INJA 1ZO0A 2QJ8A 4R8FA 4P4FA 3O8ZA 2HC9A 3ICUA 2B4DB 4CAXA 5LYIA 2V8HA 1X12A 2J9AA 3GIUA 4OC3A 1LANA 4IK2A 1TKHA 5DS0A 1TF9A 5HVHA 3KQZA 4M85A 4AVAA 4UBRA 4CDJA 3I9SA 1C30B 1YW4A 2JDDA 1LAMA 1Q7LA 3EXNA 5AXIA 2V8DA 3OWCA 5G21A 4B5PB 3T5MA 2C6GA 3LODA 4Y49B 1YX0A 4OIDA 3HPHE 1CM0A 1CE8B 4ZY1A 3T0TA 2XEIA 1Z8TA 1VKCA 4MCSA 5C88A 4NFRA 1S7LA 2Y1NA 1GYTA 2C1CA 2VEZA 1OBRA 2VXKA 1XIXA 2GLJA 3B3WA 1LFWA 3G8WA 4UEFA 1Y0RA 4FD6A 4FBEA 4ZGYB 4KVME 5K8NA 4PQAA 4B5PA 2HV2A 2HROA 1FNOA 2ODFA 4MHPA 2V8GA 3LWUA 1XBUA 2JDCA 1XMBA 3NFZA 2WYRA 1HDQA 3TO7A 2UV8G 3CPAA 4RN7A 2PDOA 4U5YA 1CJWA 3K9UA 4H6UA 1XF8A 2YNCC 4C8CA 5HVGA 3PLFB 1OZPA 3B3VA 4ZY2A 1LOKA 1VIXA 4AG7A 5JQ4A 3N7ZA 2QYVA 3B8GA 1HDUA 2X7BA 4UA3A 2JLMA 2D0PA 3ISXA 3WABA 5A28A 3IU2A 2ZEGA 1VI4A 3I74A 3D67A 2Y0MA 3KQXA 2IL4A 3IWGA 4KVOE 4KSIA 2X0SA 3V7ZA 4ZX9A 4R87A 4DNCA 4C8AA 3BLNA 4CGPA 4CDKA 2Q4ZA 3BXMA 2R7HA 5CBMA 4RUHA 5KTCA 4MBUA 5LYLA 4HNWB 4MXUA 4A4BA 3TFYA 2GFQA 3TLGB 2Z10A 3NE8A 4X8IA 2PJ1A 2D4PA 5K99A 1KUYA 4A37A 4JXQA 4P4DA 5DWNA 4MFPA 2V8VA 1XMTA 3IC1A 2DEAA 3B7IA 2XEGA 1R3NA 2V77A 3WR7A 5I0CA 5J8CA 3VTAA 1BAVA 1F57A 4CAVA 5JGFA 1ZL0A 1ELMP 4C9RA 5K8OA 2PE3A 4X3RA 4OKOA 2DLAA 4A2ZA 3RNZA 3TCVA 4P6YA 2N3AB 4MHZA 4MHYA 2EK8A 1KEEB 3GYAA 3D7HA 5D29A 4GM5A 4KOWA 3TX8A 1YVOA 1WK4A 1Z9UA 4IHMA 3IGRA 3TOAA 3C26A 2Q7BA 2OOTA 3PFEA 2ZW7A 4G1PA 3R9FA 2O4HA 1PCAA 1R57A 4K3NA 1BPNA 1XJOA 2IJZA 3IWWA 4HNXB 4JZ0A 4NJRA 1XFOA 3VRRA 3FIXA 5I4MA 3B3SA 1XF1A 4A38A 4BINA 4E0AA 3S9MA 5AG5A 2YJVA 1PYTB 4MCPA 4COBA 4KSFA 5IB9A 5IB0A 1GGOA 2G3AA 3TTHA 3V8IA 1B47A 1HEEA 4C85A 4FD4A 1Z4RA 2EZCA 4MJXA 4IUSA 4BTFA 3SJEA 3T05A 3KI9A 5F1YA 2P6FA 3D8PA 4B5OA 4XPLA 3TOBA 1T36B 3H4QA 4NF1A 1JDEA 4OC2A 4C2XA 4E5SA 1LRZA 2GLFA 2ZEOA 5DWMA 4UEEA 2Z3KA 1F2OA 4PPZA 2F8HA 4R76A 4NGNA 4P4JA 3FVLA 3PB6X 4MRIA 5HVFA 2WZNA 5AGEA 4RS2A 1MK4A 1KC7A 4QUSA 4QC6A 3OB2B 1Z2LA 4FWUA 2I3CA 5F48A 2K5TA 3GUXA 2BSWA 2PJ2A 4CO9A 4F9UA 5JVLA 4PK3A 4Q36A 3TO6A 1MJBA 4R9MA 3F8KA 2CXAA 1KUXA 1S5KA 2FIWA 4KNGE 3S6FA 3H8FA 1J3LA 4OADA 1Z5RA 4CGMA 2WSAA 4EVYA 4FD5A 5CNPA 2MP0A 2AFXA 1PUAA 1S60A 1NE9A 1KWMA 4KZTA 4A95A 3W91A 1KBLA 2J8NA 3C8OA 2Z3MA 3DR8A 3TT2A 3K2KA 4CYNA 4LQ6A 1ZG7A 2B4BA 4PXCA 1CPXA 4Q38A 4YU9A 5BY0A 4EFDA 3PEIA 2AFSA 2ZOFA 5HXDA 3CZXA 3B2YA 3D3SA
chains in the Genus database with same CATH topology
4C8FA 3WT4A 2PJ8A 2AFMA 4NGRA 3HUVA 4Q7AA 4DUKA 1ZLHA 3IJ3A 2PJ0A 3S9LA 2CF4A 4Z65A 4OC5A 4ZY0A 3FEEA 6CPAA 2G9DA 4OP4A 4YN3A 1UWYA 1Y0YA 5D8NA 2EK9A 2XEFA 3VH9A 4TNUA 1ZG8A 3HLPA 1TKJA 1WVMA 2ZEDA 3VARA 2ZENA 3PBBA 1CX8A 1EE3P 2ZEEA 1YLOA 3PFOA 5LRJA 4IAVA 3LMSA 2PIZA 3PBEA 2GREA 3RZAA 1VHEA 2PJ3A 2XEJA 2OR4A 4MCQA 4F8ZA 3K9TA 3FECA 1YSJA 3WC5A 7CPAA 4C86A 3PRTA 1NSAA 3GLJA 4P4IA 2ANPA 4OIWA 3FMCA 3BI0A 2ABZA 4DYOA 1VHOA 2ZELA 3FJUA 4OC0A 1M4LA 2GP4A 1ELLP 1BLLE 2CIJA 3D7FA 3KR4A 1CPSA 4NGMA 2C5QA 2QVPA 2CTBA 4MMOA 4LQGA 2JEWA 4CPAA 2PJBA 3ISZA 3IO1A 3PB7X 4C8UA 4R6TA 4JYWA 3B3TA 5LYFA 3NH4A 1CP7A 4DJLA 5J1QA 2PRQA 3DGVA 3L2NA 3I1UA 3B35A 2Q43A 4P10A 4P4BA 2ZEFA 3H8EA 8CPAA 2JBJA 3RAMA 3D66A 2ZEMA 4NGTA 1Z8LA 3FF3A 1H8LA 4FAIA 4ZX8A 4C8PA 5CPAA 1AMPA 2ZOGA 3CPXA 1CG2A 3V38A 1TF8A 3D7GA 2PJCA 3PB8X 2IMOA 2HB6A 2NYQA 2ZEHA 3KZWA 5LYDA 1XRYA 3WC6A 4A39A 4C9UA 4P4EA 3GB0A 5K8MA 4UF4A 2O53A 4P44A 1YMEA 2PJ5A 1IGBA 2EWBA 3CDXA 4C8TA 3PB4X 3D7DA 4R7MA 2PJ9A 1RTQA 2PCUA 3MRUA 4P45A 3TC8A 3IIBA 1FT7A 2C6PA 2RB7A 5F09A 2JBKA 3NH5A 1YW6A 2PVWA 3T8WA 2PJAA 3SJGA 3KGQA 1TXRA 4C9AA 4ONWA 2AFWA 3KR5A 4C84A 4TJVA 2PJ6A 4UIBA 3SJFA 3WC7A 3FH4A 1JQGA 4PXEA 2ZEPA 3H8GA 3KHXA 1ARMA 3FEDA 1VGYA 4NJQA 1V6CA 2AFZA 4AXVA 3N5FA 2GU2A 4O23A 3SI0A 2C6CA 4NGQA 5THWA 2AFOA 4OMEA 2FVGA 4C9VA 3NH8A 4EMEA 2PJ7A 3BHXA 4FUUA 2CTCA 2IQ6A 1ARLA 2RFHA 1R43A 4YWYA 3JRUA 1DTDA 3FX6A 4B6ZA 1Y9ZA 1AYEA 4F9VA 5IR2A 4BD9A 4NGSA 1ZLIA 3EIFA 1CP6A 4UEZA 3IFEA 4W9YA 2PIYA 4OC4A 3QNVA 1QMUA 4EWTA 3KL9A 4MCRA 1CBXA 3PB9X 2VL1A 2BOAA 3CT9A 3VATA 4H2KA 1IY7A 3IEHA 4TJXA 1F2PA 3B3CA 3SI1A 1TKFA 5K8PA 2BCOA 4UEEA 1BPMA 1LCPA 5JH9A 5ELYA 4A94A 2PVVA 4C9EA 3KHZA 5LRGA 3SI2A 4C99A 2BO9A 4OC1A 1LAPA 2Q51A 3KASA 5LRKA 3S9NA 3NA6A 1DE4C 3BI1A 2F7VA 1ZG9A 4ZYQA 4MHNA 4X2TA 4WWVA 5JM6A 2NSMA 3DLJA 1Y7EA 4UIAA 4ZI6A 2AFUA 3MN8A 3RBUA 1QQ9A 2POKA 4PXDA 4PXBA 3SJXA 4TWEA 4WJBA 3I6SA 3D4UA 3D68A 4NGPA 2PJ4A 2QJ8A 4R8FA 4P4FA 2HC9A 3ICUA 5LYIA 2V8HA 2J9AA 4OC3A 1LANA 4IK2A 1TKHA 5DS0A 1TF9A 5HVHA 3KQZA 4CDJA 1YW4A 1LAMA 1Q7LA 2V8DA 2C6GA 4OIDA 4ZY1A 2XEIA 4MCSA 4NFRA 1GYTA 2C1CA 1OBRA 2GLJA 3B3WA 1LFWA 4UEFA 1Y0RA 4FBEA 5K8NA 4PQAA 1FNOA 4MHPA 2V8GA 3LWUA 1XBUA 3NFZA 1XMBA 2WYRA 1HDQA 3CPAA 4C8CA 5HVGA 3B3VA 4ZY2A 1LOKA 1VIXA 2QYVA 1HDUA 3ISXA 3WABA 3I74A 2ZEGA 3KQXA 3D67A 4KSIA 3V7ZA 4ZX9A 4C8AA 4CDKA 2Q4ZA 3BXMA 5CBMA 4RUHA 5LYLA 4MXUA 4X8IA 2PJ1A 4A37A 4P4DA 2V8VA 3IC1A 2DEAA 3B7IA 2XEGA 1R3NA 2V77A 3VTAA 1BAVA 1F57A 5JGFA 4C9RA 1ELMP 5K8OA 2PE3A 4X3RA 4OKOA 4P6YA 4MHZA 4MHYA 2EK8A 3D7HA 5D29A 4GM5A 3TX8A 4IHMA 2OOTA 3PFEA 4G1PA 2O4HA 1PCAA 4K3NA 1BPNA 1XJOA 2IJZA 3IWWA 4JZ0A 4NJRA 1XFOA 5I4MA 3B3SA 1XF1A 4A38A 3S9MA 1PYTB 4MCPA 5IB9A 4C85A 1HEEA 3SJEA 3KI9A 4OC2A 2ZEOA 2GLFA 1F2OA 4PPZA 2F8HA 4R76A 4NGNA 4P4JA 3FVLA 3PB6X 4MRIA 5HVFA 2WZNA 1Z2LA 4FWUA 2I3CA 3GUXA 2PJ2A 4F9UA 4KNGE 3H8FA 1Z5RA 2AFXA 1KWMA 3K2KA 1ZG7A 4PXCA 1CPXA 4YU9A 4EFDA 3PEIA 2AFSA 2ZOFA 5HXDA 3B2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8F A;  3WT4 A;  2PJ8 A;  2AFM A;  4NGR A;  3HUV A;  4Q7A A;  4DUK A;  1ZLH A;  3IJ3 A;  2PJ0 A;  3S9L A;  2CF4 A;  4Z65 A;  4OC5 A;  4ZY0 A;  3FEE A;  6CPA A;  2G9D A;  4OP4 A;  4YN3 A;  1UWY A;  1Y0Y A;  5D8N A;  2EK9 A;  2XEF A;  3VH9 A;  4TNU A;  1ZG8 A;  3HLP A;  1TKJ A;  1WVM A;  2ZED A;  3VAR A;  2ZEN A;  3PBB A;  1CX8 A;  1EE3 P;  2ZEE A;  1YLO A;  3PFO A;  5LRJ A;  4IAV A;  3LMS A;  2PIZ A;  3PBE A;  2GRE A;  3RZA A;  1VHE A;  2PJ3 A;  2XEJ A;  2OR4 A;  4MCQ A;  4F8Z A;  3K9T A;  3FEC A;  1YSJ A;  3WC5 A;  7CPA A;  4C86 A;  3PRT A;  1NSA A;  3GLJ A;  4P4I A;  2ANP A;  4OIW A;  3FMC A;  3BI0 A;  2ABZ A;  4DYO A;  1VHO A;  2ZEL A;  3FJU A;  4OC0 A;  1M4L A;  1ELL P;  1BLL E;  2CIJ A;  3D7F A;  3KR4 A;  1CPS A;  4NGM A;  2QVP A;  2CTB A;  4MMO A;  4LQG A;  2JEW A;  4CPA A;  2PJB A;  3ISZ A;  3IO1 A;  3PB7 X;  4C8U A;  4R6T A;  4JYW A;  3B3T A;  5LYF A;  3NH4 A;  1CP7 A;  4DJL A;  5J1Q A;  2PRQ A;  3DGV A;  3L2N A;  3I1U A;  3B35 A;  2Q43 A;  4P10 A;  4P4B A;  2ZEF A;  3H8E A;  8CPA A;  2JBJ A;  3RAM A;  3D66 A;  2ZEM A;  4NGT A;  1Z8L A;  3FF3 A;  1H8L A;  4FAI A;  4ZX8 A;  4C8P A;  5CPA A;  1AMP A;  2ZOG A;  3CPX A;  1CG2 A;  3V38 A;  1TF8 A;  3D7G A;  2PJC A;  3PB8 X;  2IMO A;  2HB6 A;  2NYQ A;  2ZEH A;  3KZW A;  5LYD A;  1XRY A;  3WC6 A;  4A39 A;  4C9U A;  4P4E A;  3GB0 A;  5K8M A;  4UF4 A;  2O53 A;  4P44 A;  1YME A;  2PJ5 A;  1IGB A;  2EWB A;  3CDX A;  4C8T A;  3PB4 X;  3D7D A;  4R7M A;  2PJ9 A;  1RTQ A;  2PCU A;  3MRU A;  4P45 A;  3TC8 A;  3IIB A;  1FT7 A;  2C6P A;  2RB7 A;  5F09 A;  2JBK A;  3NH5 A;  1YW6 A;  2PVW A;  3T8W A;  2PJA A;  3SJG A;  3KGQ A;  1TXR A;  4C9A A;  4ONW A;  2AFW A;  3KR5 A;  4C84 A;  4TJV A;  2PJ6 A;  4UIB A;  3SJF A;  3WC7 A;  3FH4 A;  1JQG A;  4PXE A;  2ZEP A;  3H8G A;  3KHX A;  1ARM A;  3FED A;  1VGY A;  4NJQ A;  1V6C A;  2AFZ A;  4AXV A;  3N5F A;  2GU2 A;  4O23 A;  3SI0 A;  2C6C A;  4NGQ A;  5THW A;  2AFO A;  4OME A;  2FVG A;  4C9V A;  3NH8 A;  4EME A;  2PJ7 A;  3BHX A;  4FUU A;  2CTC A;  2IQ6 A;  1ARL A;  2RFH A;  1R43 A;  4YWY A;  3JRU A;  1DTD A;  3FX6 A;  4B6Z A;  1Y9Z A;  1AYE A;  4F9V A;  4BD9 A;  4NGS A;  1ZLI A;  3EIF A;  1CP6 A;  4UEZ A;  3IFE A;  4W9Y A;  2PIY A;  4OC4 A;  3QNV A;  1QMU A;  4EWT A;  3KL9 A;  4MCR A;  1CBX A;  3PB9 X;  2VL1 A;  2BOA A;  3CT9 A;  3VAT A;  4H2K A;  1IY7 A;  3IEH A;  4TJX A;  1F2P A;  3B3C A;  3SI1 A;  1TKF A;  5K8P A;  2BCO A;  4UEE A;  1BPM A;  1LCP A;  5JH9 A;  5ELY A;  4A94 A;  2PVV A;  4C9E A;  3KHZ A;  5LRG A;  3SI2 A;  4C99 A;  2BO9 A;  4OC1 A;  1LAP A;  2Q51 A;  3KAS A;  5LRK A;  3S9N A;  3NA6 A;  1DE4 C;  3BI1 A;  2F7V A;  1ZG9 A;  4ZYQ A;  4MHN A;  4X2T A;  4WWV A;  5JM6 A;  2NSM A;  3DLJ A;  1Y7E A;  4UIA A;  4ZI6 A;  2AFU A;  3MN8 A;  3RBU A;  1QQ9 A;  2POK A;  4PXD A;  4PXB A;  3SJX A;  4TWE A;  4WJB A;  3I6S A;  3D4U A;  3D68 A;  4NGP A;  2PJ4 A;  2QJ8 A;  4R8F A;  4P4F A;  2HC9 A;  3ICU A;  5LYI A;  2V8H A;  2J9A A;  4OC3 A;  1LAN A;  4IK2 A;  1TKH A;  5DS0 A;  1TF9 A;  5HVH A;  3KQZ A;  4CDJ A;  1YW4 A;  1LAM A;  1Q7L A;  2V8D A;  2C6G A;  4OID A;  4ZY1 A;  2XEI A;  4MCS A;  4NFR A;  1GYT A;  2C1C A;  1OBR A;  2GLJ A;  3B3W A;  1LFW A;  4UEF A;  1Y0R A;  4FBE A;  5K8N A;  4PQA A;  1FNO A;  4MHP A;  2V8G A;  3LWU A;  1XBU A;  3NFZ A;  1XMB A;  2WYR A;  1HDQ A;  3CPA A;  4C8C A;  5HVG A;  3B3V A;  4ZY2 A;  1LOK A;  1VIX A;  2QYV A;  1HDU A;  3ISX A;  3WAB A;  3I74 A;  2ZEG A;  3KQX A;  3D67 A;  4KSI A;  3V7Z A;  4ZX9 A;  4C8A A;  4CDK A;  2Q4Z A;  3BXM A;  5CBM A;  4RUH A;  5LYL A;  4MXU A;  4X8I A;  2PJ1 A;  4A37 A;  4P4D A;  2V8V A;  3IC1 A;  2DEA A;  3B7I A;  2XEG A;  1R3N A;  2V77 A;  3VTA A;  1BAV A;  1F57 A;  5JGF A;  4C9R A;  1ELM P;  5K8O A;  2PE3 A;  4X3R A;  4OKO A;  4P6Y A;  4MHZ A;  4MHY A;  2EK8 A;  3D7H A;  5D29 A;  4GM5 A;  3TX8 A;  4IHM A;  2OOT A;  3PFE A;  4G1P A;  2O4H A;  1PCA A;  4K3N A;  1BPN A;  1XJO A;  2IJZ A;  3IWW A;  4JZ0 A;  4NJR A;  1XFO A;  5I4M A;  3B3S A;  1XF1 A;  4A38 A;  3S9M A;  1PYT B;  4MCP A;  5IB9 A;  4C85 A;  1HEE A;  3SJE A;  3KI9 A;  4OC2 A;  2ZEO A;  2GLF A;  1F2O A;  4PPZ A;  2F8H A;  4R76 A;  4NGN A;  4P4J A;  3FVL A;  3PB6 X;  4MRI A;  5HVF A;  2WZN A;  1Z2L A;  4FWU A;  2I3C A;  3GUX A;  2PJ2 A;  4F9U A;  4KNG E;  3H8F A;  1Z5R A;  2AFX A;  1KWM A;  3K2K A;  1ZG7 A;  4PXC A;  1CPX A;  4YU9 A;  4EFD A;  3PEI A;  2AFS A;  2ZOF A;  5HXD A;  3B2Y A; 
#chains in the Genus database with same CATH topology
 3E0K A;  4C8F A;  3EZE A;  2YNE A;  4E8O A;  3WT4 A;  2PJ8 A;  4CGL A;  4NCZ A;  2AFM A;  3F5B A;  4NGR A;  4OLL A;  5GCN A;  1KZF A;  3HUV A;  4L8A A;  4Q7A A;  1Z4E A;  2VQY A;  4DUK A;  4E94 A;  3PGP A;  1ZLH A;  3IJ3 A;  5EC4 A;  2PJ0 A;  4AVB A;  3S9L A;  1BOB A;  4R57 A;  2CF4 A;  2ARH A;  4Z65 A;  2D0O A;  3R9E A;  4OC5 A;  4ZY0 A;  3FEE A;  6CPA A;  2G9D A;  2ATR A;  1YRE A;  4OP4 A;  4YN3 A;  1XEB A;  4CAF A;  4UCN A;  1UWY A;  5J3X A;  1Y0Y A;  2FM4 A;  5ISV A;  5D8N A;  2EK9 A;  2XEF A;  4KOS A;  1MJ9 A;  2OH1 A;  4XPD C;  3VH9 A;  3VGO A;  4TNU A;  1YK3 A;  4PSX A;  1P4N A;  2XPL A;  4KOY A;  1ZG8 A;  3HLP A;  1TKJ A;  4KUA A;  1C3O B;  1WVM A;  2ZED A;  4XPD B;  3VAR A;  1M1D A;  2ZEN A;  1EO0 A;  3PBB A;  1CX8 A;  3IU1 A;  1EE3 P;  2ZEE A;  2VKZ G;  1YLO A;  2QIR A;  3PFO A;  5LRJ A;  3EZA A;  5IV0 A;  3K4I A;  4OAE A;  2Q7S A;  1V0C A;  2R98 A;  1YVK A;  4IAV A;  1IOF A;  3LMS A;  2PIZ A;  5JPH A;  3TLY A;  3T90 A;  4KUB A;  3PBE A;  4FD7 A;  2GRE A;  4BBH A;  4MI4 A;  2B0A A;  5KTA A;  3R95 A;  1QSO A;  3D2M A;  3RZA A;  1VHE A;  4HKF A;  2BEI A;  2PJ3 A;  4H1H A;  2R1I A;  2XEJ A;  1RXT A;  3TO9 A;  2OR4 A;  4MCQ A;  4UCM A;  4F6A A;  4F8Z A;  2Q4V A;  3K9T A;  3FEC A;  3ZNI A;  4K30 A;  1YLE A;  4PSW A;  1YSJ A;  4CYQ A;  3WC5 A;  4CAE A;  5AG6 A;  7CPA A;  4C86 A;  2QEC A;  5HKW A;  3PRT A;  5H84 A;  1NSA A;  1S3Z A;  1I21 A;  3GLJ A;  1XOV A;  3PZJ A;  1I1D A;  4P4I A;  3NFQ A;  4ORF A;  3W6S A;  4M6H A;  2ANP A;  2BUE A;  4UWJ A;  1IYK A;  1IYL A;  4OIW A;  4U9Z A;  3FMC A;  3BI0 A;  4CS0 B;  2ABZ A;  4DYO A;  1IID A;  1VHO A;  2ZEL A;  3FJU A;  4OC0 A;  3PT1 A;  3VRP A;  1ELL P;  1BLL E;  1J4J A;  1M4L A;  3I3G A;  2GP4 A;  5F9M A;  2CIJ A;  4BPX B;  1B6B A;  1IU8 A;  3U1B A;  3D7F A;  3KR4 A;  1CPS A;  2GIV A;  5G22 A;  2G3T A;  4C7H A;  3HPG G;  4NGM A;  1QSR A;  1YGH A;  2C5Q A;  2QVP A;  4L89 A;  2CTB A;  3R1K A;  4B13 A;  4MJ8 A;  4MMO A;  4QB9 A;  3OB1 B;  2REE A;  3G23 A;  2HI6 A;  4LQG A;  2JEW A;  3CXS A;  4CPA A;  4A33 A;  5J8F A;  2PJB A;  3ISZ A;  4UFV A;  3IO1 A;  1RO5 A;  3PB7 X;  4M3S A;  4AB7 A;  3U88 C;  4KOU A;  4C8U A;  2CBL A;  2GAN A;  5G20 A;  4R6T A;  4JYW A;  4R3K A;  4UWI A;  3B3T A;  3VRO A;  4JD6 A;  5LYF A;  3NH4 A;  1CP7 A;  1I12 A;  1VHS A;  4DJL A;  2WPX A;  5F47 A;  3OAK A;  2Q44 A;  5J1Q A;  2PRQ A;  3DGV A;  3L2N A;  3I1U A;  3SHP A;  4C2Y A;  3B35 A;  4KVX A;  2B4D A;  2Q43 A;  4P10 A;  4PK2 A;  4P4B A;  2FT0 A;  2FSR A;  2I00 A;  2ZEF A;  2Y1M A;  3A9L A;  3H8E A;  5F13 A;  8CPA A;  4PV6 A;  2JBJ A;  1JWQ A;  1QSM A;  3RAM A;  3D66 A;  4KLV A;  4II9 A;  2ZEM A;  4NGT A;  1Z8L A;  3FF3 A;  1Q2D A;  2DF5 A;  1H8L A;  4FAI A;  1CS0 B;  4ZX8 A;  1UFH A;  4B11 A;  2XPP A;  2REF A;  4C8P A;  3UY5 A;  4KOR A;  5CPA A;  4CAW A;  2P6E A;  5HMN A;  1AMP A;  2ZOG A;  4M8D A;  3FB3 A;  3DSB A;  3IWE A;  3TLZ A;  3QB8 A;  2H5M A;  5JYB A;  1S7F A;  2DXQ A;  2I79 A;  1ON0 A;  2EUI A;  2Z3L A;  1CG2 A;  3CPX A;  3T9Y A;  3V38 A;  4HPS A;  1TF8 A;  2AE6 A;  3BUO B;  4QBJ A;  3BUN B;  3D7G A;  2PJC A;  2PR8 A;  2EBJ A;  2IMO A;  3PB8 X;  3TLG A;  1A9X B;  2PC1 A;  2HB6 A;  2OB0 A;  4MFJ A;  2NYQ A;  2ZEH A;  3KZW A;  3JVN A;  5LYD A;  1XRY A;  3WC6 A;  4A39 A;  3EY5 A;  4C9U A;  2Z11 A;  4P4E A;  3LD2 A;  4NXY A;  3GB0 A;  5K8M A;  4MFL A;  4UF4 A;  2O53 A;  4A32 A;  4CGO A;  4P44 A;  1YME A;  2PJ5 A;  2Z3O A;  2ZW5 A;  3EO4 A;  4EYS A;  1IGB A;  5H86 A;  3VWE A;  4F0Y A;  2PR1 A;  1EZB A;  2QML A;  1ZYM A;  2EWB A;  4JXR A;  3CDX A;  1NXJ A;  4C8T A;  4Y49 C;  1Y7R A;  3PB4 X;  3D7D A;  3DNS A;  4R7M A;  2ZW4 A;  4AG9 A;  2PJ9 A;  5BWA B;  1RTQ A;  3DR6 A;  2PCU A;  4IIX A;  1NBW A;  3MRU A;  2WPW A;  4P45 A;  3F9K C;  1IIC A;  2YNC A;  3IIB A;  3TC8 A;  2HQY A;  4A31 A;  1M4G A;  2VZY A;  2B5G B;  1FT7 A;  2C6P A;  2RB7 A;  4YRH A;  4B12 A;  5AG7 A;  3DDD A;  3GKR A;  5F09 A;  2JBK A;  3NH5 A;  4J3G A;  4KS9 A;  1IB1 E;  2PVW A;  4BPU B;  1YW6 A;  2PJA A;  4HNY B;  4KOX A;  3T8W A;  2DPS A;  1EZA A;  2HWG A;  1U6M A;  2P0W A;  3SJG A;  3R96 A;  3I6S A;  5FVJ A;  3KGQ A;  1TXR A;  4C9A A;  4XPK A;  4ONW A;  2FE7 A;  4H6Z A;  2AFW A;  4C2Z A;  3KR5 A;  5C82 A;  4LX9 A;  2B3V A;  3JTK A;  1Y9K A;  1AUG A;  4TWE A;  4C84 A;  3TYX A;  3SR3 A;  2D4O A;  4TJV A;  2PJ6 A;  4UIB A;  4J0N A;  3SJF A;  2PRB A;  3VWD A;  5F46 A;  3S6K A;  3WC7 A;  3FH4 A;  4JLY A;  3RO0 A;  4M6I A;  1JQG A;  2FIA A;  2J8R A;  2ZEP A;  4ONU A;  3H8G A;  4NEX A;  3KHX A;  4PXE A;  1WJT A;  3TLE A;  3P2F A;  1ARM A;  3FRM A;  4CRZ B;  3FED A;  1VGY A;  4NJQ A;  1V6C A;  2AFZ A;  2CNS A;  3FYN A;  2FL4 A;  4AXV A;  4BMH A;  3N5F A;  2GU2 A;  1S7N A;  4O23 A;  2R8V A;  3PFV A;  2KCW A;  2Q0Y A;  1NMT A;  2FS5 A;  1VBH A;  5G1Z A;  3SI0 A;  2C6C A;  3SXN A;  5KTD A;  3FXT A;  2YGW A;  5A27 A;  1ZRS A;  2AUM A;  4KSA A;  2DIK A;  1XE4 A;  2Q4Y A;  4NGQ A;  2F5I A;  5THW A;  2OU2 A;  2AFO A;  4OME A;  2FVG A;  1SQH A;  3PP9 A;  5F5X A;  2Z3P A;  1BO4 A;  1Z8W A;  4NSQ A;  2CNM A;  3W6X A;  4XNH B;  1Q2C A;  5AG4 A;  4C9V A;  3NH8 A;  4GS4 A;  4RR2 B;  4EME A;  4UFX A;  3P2H A;  2PJ7 A;  3BHX A;  2OZG A;  2G0B A;  3S6H A;  1Z9E A;  4JWP A;  2CY2 A;  1NSL A;  4UCP A;  4FUU A;  4KOV A;  5IX3 A;  4COG A;  2CTC A;  4MY0 A;  3D2P A;  2VI7 A;  1WWZ A;  3EZB A;  1MJA A;  1ARL A;  2IQ6 A;  2RFH A;  1Q2Y A;  3KKW A;  4M6G A;  5HKY A;  1FY7 A;  1M4I A;  1R43 A;  4KLW A;  3JRU A;  4RI1 A;  3BUX B;  4YWY A;  3ZJ0 A;  1A2Z A;  1DTD A;  4I49 A;  3FX6 A;  2XPN A;  3JUW A;  4B6Z A;  4CYP A;  1P0H A;  1AYE A;  4GPL B;  1Y9Z A;  4YGO A;  4F9V A;  4IF5 A;  2DPT A;  2EZA A;  3F0A A;  5HH1 A;  2R82 A;  5IR2 A;  2B5G A;  3S6G A;  5HKZ A;  4BD9 A;  4A30 A;  4NGS A;  1ZLI A;  3BJ7 A;  3EIF A;  1CP6 A;  1QSN A;  3T07 A;  4MHD A;  2JEV A;  4UEZ A;  3IFE A;  4A4C A;  4F0X A;  2FCK A;  1M6V B;  4H89 A;  4W9Y A;  2YJT A;  2Z3N A;  2HUZ A;  5EMI A;  2EZB A;  2PIY A;  4OC4 A;  3QNV A;  2O28 A;  4BPW B;  1QMU A;  2C27 A;  3CXP A;  4CRY B;  1YVH A;  4EWT A;  4E2A A;  2OZH A;  2VZZ A;  3KL9 A;  4MCR A;  1CBX A;  3PB9 X;  2VL1 A;  4JJX A;  3LAC A;  2A4N A;  2BOA A;  3CT9 A;  4KOT A;  3NOJ A;  3VAT A;  1YR0 A;  4ZBG A;  2BL1 A;  4H2K A;  1IY7 A;  1GHE A;  1QST A;  1F2P A;  3B3C A;  3IEH A;  4XNH C;  3R9G A;  1TKF A;  3SI1 A;  5K8P A;  4TJX A;  2BCO A;  2Q04 A;  3OP0 A;  1L0C A;  1X10 A;  3CXQ A;  3FNC A;  2CNT A;  3G3S A;  1BPM A;  1LCP A;  4MFK A;  5JH9 A;  5ELY A;  4A94 A;  1Z8X A;  3TLA A;  4B10 A;  2PVV A;  2Z0Z A;  4R3L A;  4GXH A;  1M4D A;  2RC4 A;  2PQ8 A;  3SXO A;  2AUN A;  1Y9W A;  4C9E A;  3KHZ A;  5LRG A;  3SI2 A;  5F49 A;  1K4J A;  3RYO A;  1JDB C;  2B58 A;  2BO9 A;  4C99 A;  1R61 A;  4OC1 A;  1LAP A;  1TIQ A;  3GJZ A;  2Q51 A;  3KAS A;  5E96 A;  1YQE A;  5LRK A;  2PSW A;  3S9N A;  3NE7 A;  4UFW A;  4B14 A;  1S7K A;  3NA6 A;  3EC4 A;  1VBG A;  1DE4 C;  3BI1 A;  4AVC A;  4CYO A;  3TLB A;  2F7V A;  1ZG9 A;  4ZYQ A;  4MHN A;  3FBU A;  4X2T A;  5EBV A;  1BXR B;  4WWV A;  4CGN A;  2E28 A;  5JM6 A;  3TLC A;  2FXF A;  2NSM A;  2P6G A;  4MFZ A;  2XPO A;  3QAY A;  3HMJ G;  1Y7E A;  3DLJ A;  3TE4 A;  4UIA A;  1B87 A;  4ZI6 A;  2AFU A;  4MI1 A;  3QAH A;  4CZ1 A;  2OLS A;  2B4J C;  4X5K A;  3MN8 A;  4U9Y A;  2AJ6 A;  2VBQ A;  2B3U A;  1Q5X A;  2J8M A;  3EFA A;  3RBU A;  2PCN A;  1FBV A;  4C7I A;  3ZZI A;  4JVO A;  1KUV A;  5FD8 A;  1QQ9 A;  2POK A;  3BJ8 A;  2EVN A;  3VRN A;  2EO8 A;  4PXD A;  3BUM B;  3SJX A;  3VRQ A;  2GE3 A;  2OZU A;  2YND A;  3MGD A;  4PXB A;  2ZPA A;  4QVT A;  4MFQ A;  4C68 A;  4WJB A;  4IIY A;  1M44 A;  3KRV A;  3H5Z A;  4LUA A;  1IOI A;  1N71 A;  3BUW B;  2WUU A;  1PU9 A;  2ZW6 A;  3D4U A;  1DIK A;  3D68 A;  3GY9 A;  4NGP A;  2NMT A;  2PJ4 A;  4MY3 A;  4YFJ A;  2ZXV A;  4INJ A;  1ZO0 A;  2QJ8 A;  4R8F A;  4P4F A;  3O8Z A;  2HC9 A;  3ICU A;  2B4D B;  4CAX A;  5LYI A;  2V8H A;  1X12 A;  2J9A A;  3GIU A;  4OC3 A;  1LAN A;  4IK2 A;  1TKH A;  5DS0 A;  1TF9 A;  5HVH A;  3KQZ A;  4M85 A;  4AVA A;  4UBR A;  4CDJ A;  3I9S A;  1C30 B;  1YW4 A;  2JDD A;  1LAM A;  1Q7L A;  3EXN A;  5AXI A;  2V8D A;  3OWC A;  5G21 A;  4B5P B;  3T5M A;  2C6G A;  3LOD A;  4Y49 B;  1YX0 A;  4OID A;  3HPH E;  1CM0 A;  1CE8 B;  4ZY1 A;  3T0T A;  2XEI A;  1Z8T A;  1VKC A;  4MCS A;  5C88 A;  4NFR A;  1S7L A;  2Y1N A;  1GYT A;  2C1C A;  2VEZ A;  1OBR A;  2VXK A;  1XIX A;  2GLJ A;  3B3W A;  1LFW A;  3G8W A;  4UEF A;  1Y0R A;  4FD6 A;  4FBE A;  4ZGY B;  4KVM E;  5K8N A;  4PQA A;  4B5P A;  2HV2 A;  2HRO A;  1FNO A;  2ODF A;  4MHP A;  2V8G A;  3LWU A;  1XBU A;  2JDC A;  1XMB A;  3NFZ A;  2WYR A;  1HDQ A;  3TO7 A;  2UV8 G;  3CPA A;  4RN7 A;  2PDO A;  4U5Y A;  1CJW A;  3K9U A;  4H6U A;  1XF8 A;  2YNC C;  4C8C A;  5HVG A;  3PLF B;  1OZP A;  3B3V A;  4ZY2 A;  1LOK A;  1VIX A;  4AG7 A;  5JQ4 A;  3N7Z A;  2QYV A;  3B8G A;  1HDU A;  2X7B A;  4UA3 A;  2JLM A;  2D0P A;  3ISX A;  3WAB A;  5A28 A;  3IU2 A;  2ZEG A;  1VI4 A;  3I74 A;  3D67 A;  2Y0M A;  3KQX A;  2IL4 A;  3IWG A;  4KVO E;  4KSI A;  2X0S A;  3V7Z A;  4ZX9 A;  4R87 A;  4DNC A;  4C8A A;  3BLN A;  4CGP A;  4CDK A;  2Q4Z A;  3BXM A;  2R7H A;  5CBM A;  4RUH A;  5KTC A;  4MBU A;  5LYL A;  4HNW B;  4MXU A;  4A4B A;  3TFY A;  2GFQ A;  3TLG B;  2Z10 A;  3NE8 A;  4X8I A;  2PJ1 A;  2D4P A;  5K99 A;  1KUY A;  4A37 A;  4JXQ A;  4P4D A;  5DWN A;  4MFP A;  2V8V A;  1XMT A;  3IC1 A;  2DEA A;  3B7I A;  2XEG A;  1R3N A;  2V77 A;  3WR7 A;  5I0C A;  5J8C A;  3VTA A;  1BAV A;  1F57 A;  4CAV A;  5JGF A;  1ZL0 A;  1ELM P;  4C9R A;  5K8O A;  2PE3 A;  4X3R A;  4OKO A;  2DLA A;  4A2Z A;  3RNZ A;  3TCV A;  4P6Y A;  2N3A B;  4MHZ A;  4MHY A;  2EK8 A;  1KEE B;  3GYA A;  3D7H A;  5D29 A;  4GM5 A;  4KOW A;  3TX8 A;  1YVO A;  1WK4 A;  1Z9U A;  4IHM A;  3IGR A;  3TOA A;  3C26 A;  2Q7B A;  2OOT A;  3PFE A;  2ZW7 A;  4G1P A;  3R9F A;  2O4H A;  1PCA A;  1R57 A;  4K3N A;  1BPN A;  1XJO A;  2IJZ A;  3IWW A;  4HNX B;  4JZ0 A;  4NJR A;  1XFO A;  3VRR A;  3FIX A;  5I4M A;  3B3S A;  1XF1 A;  4A38 A;  4BIN A;  4E0A A;  3S9M A;  5AG5 A;  2YJV A;  1PYT B;  4MCP A;  4COB A;  4KSF A;  5IB9 A;  5IB0 A;  1GGO A;  2G3A A;  3TTH A;  3V8I A;  1B47 A;  1HEE A;  4C85 A;  4FD4 A;  1Z4R A;  2EZC A;  4MJX A;  4IUS A;  4BTF A;  3SJE A;  3T05 A;  3KI9 A;  5F1Y A;  2P6F A;  3D8P A;  4B5O A;  4XPL A;  3TOB A;  1T36 B;  3H4Q A;  4NF1 A;  1JDE A;  4OC2 A;  4C2X A;  4E5S A;  1LRZ A;  2GLF A;  2ZEO A;  5DWM A;  4UEE A;  2Z3K A;  1F2O A;  4PPZ A;  2F8H A;  4R76 A;  4NGN A;  4P4J A;  3FVL A;  3PB6 X;  4MRI A;  5HVF A;  2WZN A;  5AGE A;  4RS2 A;  1MK4 A;  1KC7 A;  4QUS A;  4QC6 A;  3OB2 B;  1Z2L A;  4FWU A;  2I3C A;  5F48 A;  2K5T A;  3GUX A;  2BSW A;  2PJ2 A;  4CO9 A;  4F9U A;  5JVL A;  4PK3 A;  4Q36 A;  3TO6 A;  1MJB A;  4R9M A;  3F8K A;  2CXA A;  1KUX A;  1S5K A;  2FIW A;  4KNG E;  3S6F A;  3H8F A;  1J3L A;  4OAD A;  1Z5R A;  4CGM A;  2WSA A;  4EVY A;  4FD5 A;  5CNP A;  2MP0 A;  2AFX A;  1PUA A;  1S60 A;  1NE9 A;  1KWM A;  4KZT A;  4A95 A;  3W91 A;  1KBL A;  2J8N A;  3C8O A;  2Z3M A;  3DR8 A;  3TT2 A;  3K2K A;  4CYN A;  4LQ6 A;  1ZG7 A;  2B4B A;  4PXC A;  1CPX A;  4Q38 A;  4YU9 A;  5BY0 A;  4EFD A;  3PEI A;  2AFS A;  2ZOF A;  5HXD A;  3CZX A;  3B2Y A;  3D3S A; 
#chains in the Genus database with same CATH homology
 4C8F A;  3WT4 A;  2PJ8 A;  2AFM A;  4NGR A;  3HUV A;  4Q7A A;  4DUK A;  1ZLH A;  3IJ3 A;  2PJ0 A;  3S9L A;  2CF4 A;  4Z65 A;  4OC5 A;  4ZY0 A;  3FEE A;  6CPA A;  2G9D A;  4OP4 A;  4YN3 A;  1UWY A;  1Y0Y A;  5D8N A;  2EK9 A;  2XEF A;  3VH9 A;  4TNU A;  1ZG8 A;  3HLP A;  1TKJ A;  1WVM A;  2ZED A;  3VAR A;  2ZEN A;  3PBB A;  1CX8 A;  1EE3 P;  2ZEE A;  1YLO A;  3PFO A;  5LRJ A;  4IAV A;  3LMS A;  2PIZ A;  3PBE A;  2GRE A;  3RZA A;  1VHE A;  2PJ3 A;  2XEJ A;  2OR4 A;  4MCQ A;  4F8Z A;  3K9T A;  3FEC A;  1YSJ A;  3WC5 A;  7CPA A;  4C86 A;  3PRT A;  1NSA A;  3GLJ A;  4P4I A;  2ANP A;  4OIW A;  3FMC A;  3BI0 A;  2ABZ A;  4DYO A;  1VHO A;  2ZEL A;  3FJU A;  4OC0 A;  1M4L A;  2GP4 A;  1ELL P;  1BLL E;  2CIJ A;  3D7F A;  3KR4 A;  1CPS A;  4NGM A;  2C5Q A;  2QVP A;  2CTB A;  4MMO A;  4LQG A;  2JEW A;  4CPA A;  2PJB A;  3ISZ A;  3IO1 A;  3PB7 X;  4C8U A;  4R6T A;  4JYW A;  3B3T A;  5LYF A;  3NH4 A;  1CP7 A;  4DJL A;  5J1Q A;  2PRQ A;  3DGV A;  3L2N A;  3I1U A;  3B35 A;  2Q43 A;  4P10 A;  4P4B A;  2ZEF A;  3H8E A;  8CPA A;  2JBJ A;  3RAM A;  3D66 A;  2ZEM A;  4NGT A;  1Z8L A;  3FF3 A;  1H8L A;  4FAI A;  4ZX8 A;  4C8P A;  5CPA A;  1AMP A;  2ZOG A;  3CPX A;  1CG2 A;  3V38 A;  1TF8 A;  3D7G A;  2PJC A;  3PB8 X;  2IMO A;  2HB6 A;  2NYQ A;  2ZEH A;  3KZW A;  5LYD A;  1XRY A;  3WC6 A;  4A39 A;  4C9U A;  4P4E A;  3GB0 A;  5K8M A;  4UF4 A;  2O53 A;  4P44 A;  1YME A;  2PJ5 A;  1IGB A;  2EWB A;  3CDX A;  4C8T A;  3PB4 X;  3D7D A;  4R7M A;  2PJ9 A;  1RTQ A;  2PCU A;  3MRU A;  4P45 A;  3TC8 A;  3IIB A;  1FT7 A;  2C6P A;  2RB7 A;  5F09 A;  2JBK A;  3NH5 A;  1YW6 A;  2PVW A;  3T8W A;  2PJA A;  3SJG A;  3KGQ A;  1TXR A;  4C9A A;  4ONW A;  2AFW A;  3KR5 A;  4C84 A;  4TJV A;  2PJ6 A;  4UIB A;  3SJF A;  3WC7 A;  3FH4 A;  1JQG A;  4PXE A;  2ZEP A;  3H8G A;  3KHX A;  1ARM A;  3FED A;  1VGY A;  4NJQ A;  1V6C A;  2AFZ A;  4AXV A;  3N5F A;  2GU2 A;  4O23 A;  3SI0 A;  2C6C A;  4NGQ A;  5THW A;  2AFO A;  4OME A;  2FVG A;  4C9V A;  3NH8 A;  4EME A;  2PJ7 A;  3BHX A;  4FUU A;  2CTC A;  2IQ6 A;  1ARL A;  2RFH A;  1R43 A;  4YWY A;  3JRU A;  1DTD A;  3FX6 A;  4B6Z A;  1Y9Z A;  1AYE A;  4F9V A;  5IR2 A;  4BD9 A;  4NGS A;  1ZLI A;  3EIF A;  1CP6 A;  4UEZ A;  3IFE A;  4W9Y A;  2PIY A;  4OC4 A;  3QNV A;  1QMU A;  4EWT A;  3KL9 A;  4MCR A;  1CBX A;  3PB9 X;  2VL1 A;  2BOA A;  3CT9 A;  3VAT A;  4H2K A;  1IY7 A;  3IEH A;  4TJX A;  1F2P A;  3B3C A;  3SI1 A;  1TKF A;  5K8P A;  2BCO A;  4UEE A;  1BPM A;  1LCP A;  5JH9 A;  5ELY A;  4A94 A;  2PVV A;  4C9E A;  3KHZ A;  5LRG A;  3SI2 A;  4C99 A;  2BO9 A;  4OC1 A;  1LAP A;  2Q51 A;  3KAS A;  5LRK A;  3S9N A;  3NA6 A;  1DE4 C;  3BI1 A;  2F7V A;  1ZG9 A;  4ZYQ A;  4MHN A;  4X2T A;  4WWV A;  5JM6 A;  2NSM A;  3DLJ A;  1Y7E A;  4UIA A;  4ZI6 A;  2AFU A;  3MN8 A;  3RBU A;  1QQ9 A;  2POK A;  4PXD A;  4PXB A;  3SJX A;  4TWE A;  4WJB A;  3I6S A;  3D4U A;  3D68 A;  4NGP A;  2PJ4 A;  2QJ8 A;  4R8F A;  4P4F A;  2HC9 A;  3ICU A;  5LYI A;  2V8H A;  2J9A A;  4OC3 A;  1LAN A;  4IK2 A;  1TKH A;  5DS0 A;  1TF9 A;  5HVH A;  3KQZ A;  4CDJ A;  1YW4 A;  1LAM A;  1Q7L A;  2V8D A;  2C6G A;  4OID A;  4ZY1 A;  2XEI A;  4MCS A;  4NFR A;  1GYT A;  2C1C A;  1OBR A;  2GLJ A;  3B3W A;  1LFW A;  4UEF A;  1Y0R A;  4FBE A;  5K8N A;  4PQA A;  1FNO A;  4MHP A;  2V8G A;  3LWU A;  1XBU A;  3NFZ A;  1XMB A;  2WYR A;  1HDQ A;  3CPA A;  4C8C A;  5HVG A;  3B3V A;  4ZY2 A;  1LOK A;  1VIX A;  2QYV A;  1HDU A;  3ISX A;  3WAB A;  3I74 A;  2ZEG A;  3KQX A;  3D67 A;  4KSI A;  3V7Z A;  4ZX9 A;  4C8A A;  4CDK A;  2Q4Z A;  3BXM A;  5CBM A;  4RUH A;  5LYL A;  4MXU A;  4X8I A;  2PJ1 A;  4A37 A;  4P4D A;  2V8V A;  3IC1 A;  2DEA A;  3B7I A;  2XEG A;  1R3N A;  2V77 A;  3VTA A;  1BAV A;  1F57 A;  5JGF A;  4C9R A;  1ELM P;  5K8O A;  2PE3 A;  4X3R A;  4OKO A;  4P6Y A;  4MHZ A;  4MHY A;  2EK8 A;  3D7H A;  5D29 A;  4GM5 A;  3TX8 A;  4IHM A;  2OOT A;  3PFE A;  4G1P A;  2O4H A;  1PCA A;  4K3N A;  1BPN A;  1XJO A;  2IJZ A;  3IWW A;  4JZ0 A;  4NJR A;  1XFO A;  5I4M A;  3B3S A;  1XF1 A;  4A38 A;  3S9M A;  1PYT B;  4MCP A;  5IB9 A;  4C85 A;  1HEE A;  3SJE A;  3KI9 A;  4OC2 A;  2ZEO A;  2GLF A;  1F2O A;  4PPZ A;  2F8H A;  4R76 A;  4NGN A;  4P4J A;  3FVL A;  3PB6 X;  4MRI A;  5HVF A;  2WZN A;  1Z2L A;  4FWU A;  2I3C A;  3GUX A;  2PJ2 A;  4F9U A;  4KNG E;  3H8F A;  1Z5R A;  2AFX A;  1KWM A;  3K2K A;  1ZG7 A;  4PXC A;  1CPX A;  4YU9 A;  4EFD A;  3PEI A;  2AFS A;  2ZOF A;  5HXD A;  3B2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...