4NGTA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
696
structure length
692
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 252
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngtA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngtA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngtA02
3SI2A 5D8NA 2J9AA 3FJUA 3KQXA 1Y7EA 2NYQA 3PBBA 4CDJA 3D4UA 2GLJA 1YW4A 5K8PA 5CBMA 1PYTB 2ZEDA 3B35A 3GB0A 1HDQA 2AFMA 1PCAA 4P6YA 4B6ZA 4EFDA 4F8ZA 5LYFA 2IMOA 2ZOGA 5F09A 4IAVA 2CTBA 2CIJA 1VGYA 1IGBA 1Y9ZA 4UIBA 2AFXA 1CG2A 4NGRA 5HVGA 4A39A 3PB9X 4OIWA 4BD9A 2AFSA 1ELLP 2PJBA 6CPAA 1R3NA 4P4IA 2ZEGA 4Z65A 2PJCA 2ZEMA 2FVGA 2V77A 4WJBA 3WT4A 4CPAA 3NA6A 3SJFA 1RTQA 3RZAA 1CPSA 1TXRA 4PXEA 2BO9A 5LYIA 1ZG9A 3I6SA 3B3SA 4P44A 1BPMA 4ZY0A 4UEEA 1TKFA 1XJOA 2V8GA 5CPAA 2Q51A 1Q7LA 4K3NA 5HVFA 1VHOA 1FT7A 3I74A 3D66A 3LMSA 1WVMA 1ZG7A 1VHEA 2ZOFA 3IO1A 3WC6A 3KQZA 2AFUA 3NH4A 1BAVA 4MCQA 4R76A 3TX8A 4EWTA 4ZYQA 4PXDA 4TJVA 4ZY2A 4FBEA 3RAMA 3SI1A 2HC9A 3JRUA 3I1UA 4C9VA 4G1PA 3FH4A 4MHYA 2PVWA 4NGSA 2JEWA 4P4EA 5K8MA 3D7DA 3ISZA 3KASA 3PB8X 1OBRA 4TWEA 3ISXA 2XEJA 2C6PA 1NSAA 2RFHA 2OR4A 2ZEOA 4A37A 2O4HA 2RB7A 3L2NA 4OC1A 2O53A 1XMBA 2AFWA 4TNUA 3K9TA 5HXDA 3FX6A 1V6CA 4P4DA 2BCOA 2C6CA 2JBJA 2PJ5A 2PJ6A 2GU2A 3EIFA 3TC8A 7CPAA 5HVHA 3D7FA 1Z2LA 3PFEA 3B3CA 3KGQA 4OP4A 4FWUA 4PQAA 3VATA 2Q4ZA 4C86A 1Y0YA 4C8TA 2V8DA 4C9RA 2PJ0A 3IFEA 3WC7A 1XF1A 4AXVA 4LQGA 3IIBA 1DE4C 4P4BA 5J1QA 3SJXA 4RUHA 1HEEA 3BI1A 1YW6A 3KL9A 3K2KA 4A38A 1ARLA 2ZEFA 4MHNA 2QJ8A 4ZX9A 4ZX8A 2AFOA 1TKHA 2ANPA 1HDUA 4DJLA 1ZLIA 4YWYA 4CDKA 3RBUA 4F9UA 4OMEA 1YLOA 3D67A 4PXBA 4A94A 2XEFA 3T8WA 4R8FA 3IC1A 5JH9A 1QMUA 5LRJA 2BOAA 2PJ4A 3MRUA 2EK8A 2CF4A 3FMCA 4FAIA 3FVLA 4ZI6A 3IWWA 1AMPA 3WC5A 3PRTA 2XEGA 3CDXA 4WWVA 2ZELA 3KHZA 3LWUA 2PJAA 4KSIA 2PJ8A 4IK2A 1LAMA 2PIYA 3FF3A 4X8IA 3KZWA 4MHPA 4KNGE 4C84A 3HLPA 2NSMA 4C8PA 1CP6A 3BXMA 2ABZA 4MMOA 2CTCA 4MCPA 1F2PA 4X2TA 3DGVA 3D7GA 5LYLA 4C9EA 4Q7AA 4F9VA 3SJGA 3KI9A 4OC2A 4C8CA 2IQ6A 2ZEPA 4ONWA 3CPXA 4P45A 4P4JA 3D68A 2VL1A 3WABA 3KR5A 3PB6X 5K8NA 4OC5A 4PPZA 2OOTA 4P10A 3FEDA 4OKOA 1LANA 4C8FA 2WZNA 5ELYA 3CPAA 2PIZA 2C6GA 5LRKA 3PBEA 5JM6A 2C1CA 4JZ0A 4MHZA 3PFOA 2V8HA 1ELMP 3B3VA 2PCUA 3H8GA 2EWBA 4OIDA 3HUVA 5LYDA 1H8LA 1CX8A 2AFZA 1YSJA 2G9DA 3PEIA 1CPXA 2HB6A 1R43A 4C8AA 4X3RA 1TF8A 2PJ1A 2V8VA 5LRGA 1QQ9A 4UIAA 2JBKA 3DLJA 1FNOA 1Z8LA 4NJQA 2I3CA 2PRQA 4O23A 2F8HA 3VARA 2QYVA 2IJZA 1EE3P 2XEIA 3S9NA 4NJRA 5THWA 1CBXA 2PVVA 4TJXA 1ARMA 3NH8A 3CT9A 3B2YA 4P4FA 3PB7X 5K8OA 4OC0A 4UEFA 2PJ9A 2QVPA 4JYWA 1F57A 1BLLE 1JQGA 2Q43A 3H8EA 5DS0A 3NFZA 3IJ3A 2PE3A 3KR4A 4FUUA 3H8FA 4MXUA 3ICUA 1DTDA 2PJ7A 4YN3A 4R7MA 4MCRA 2GLFA 2ZENA 1LOKA 3NH5A 1F2OA 5IB9A 8CPAA 4R6TA 4MCSA 4UEZA 1TKJA 4OC3A 3GLJA 4YU9A 1KWMA 4NGTA 1TF9A 3BI0A 1GYTA 3B3WA 3D7HA 1AYEA 3N5FA 4IHMA 3VTAA 1ZG8A 3V7ZA 5JGFA 1Y0RA 1BPNA 4NGQA 3B3TA 2WYRA 1CP7A 2POKA 3FECA 1IY7A 4UF4A 2ZEHA 1VIXA 2EK9A 3S9LA 3BHXA 3SJEA 4H2KA 4C85A 4NGPA 3QNVA 1XFOA 3KHXA 4NGMA 4C9UA 1YMEA 2PJ3A 2F7VA 4W9YA 4DUKA 4NFRA 4EMEA 4PXCA 2GREA 3IEHA 3GUXA 2DEAA 3B7IA 3MN8A 2ZEEA 1LAPA 5D29A 1M4LA 3V38A 4DYOA 3PB4X 4C99A 4C8UA 3VH9A 1XBUA 4NGNA 4GM5A 4MRIA 1XRYA 1LFWA 3S9MA 3SI0A 3FEEA 4OC4A 1LCPA 5I4MA 1UWYA 4ZY1A 4C9AA 1ZLHA 2PJ2A 1Z5RA
chains in the Genus database with same CATH superfamily
3A9LA 2K5TA 5D8NA 2J9AA 2B5GA 3SI2A 3FJUA 4Q36A 2B4JC 4FD6A 4MBUA 3KQXA 1Y7EA 3EY5A 4LQ6A 3S6HA 2NYQA 4COBA 1EZBA 3PBBA 4CDJA 3D4UA 2CNMA 2CNSA 2GLJA 1YW4A 5K8PA 2ZPAA 3BUNB 5CBMA 1PYTB 4C2YA 4XPKA 2ZEDA 3V8IA 2ZXVA 3B35A 4UCNA 3DDDA 3GB0A 4J0NA 1HDQA 1J4JA 2AFMA 5HKWA 1XMTA 2G3AA 2Z10A 1PCAA 3R1KA 4L8AA 1I1DA 3I9SA 3NFQA 2P6EA 3VRQA 3UY5A 3BUWB 4P6YA 5AG7A 3W6SA 4B6ZA 4EFDA 4F8ZA 5LYFA 2IMOA 4PK2A 4UFVA 4CYOA 4MFJA 4CYNA 2ZOGA 5F09A 2HQYA 4IAVA 5HMNA 2CTBA 5F47A 2CIJA 1VGYA 1Q2CA 3SHPA 4CYPA 1IGBA 4AVCA 1Y9ZA 3FBUA 5JYBA 2Q44A 4C68A 4UIBA 2AFXA 1CG2A 4NGRA 4UFWA 5HVGA 4CRYB 3EZBA 4A39A 3CZXA 2DIKA 3PB9X 4OIWA 1IB1E 4KLVA 4BD9A 2AFSA 1ELLP 3DR8A 2PJBA 4JXRA 3VWDA 4C2XA 6CPAA 1R3NA 4P4IA 3DR6A 3H4QA 4HPSA 3PFVA 1XOVA 2ZEGA 4MFPA 4Z65A 2PJCA 2ZEMA 2FVGA 2REEA 1I21A 4UWJA 2V77A 4KSAA 4A30A 4OLLA 5DWMA 2B3VA 4WJBA 4B14A 2PR8A 2FT0A 4E8OA 2QIRA 3I3GA 4BMHA 3RNZA 5CNPA 5HH1A 3WT4A 2FL4A 4XNHB 1QSRA 1KUYA 4CPAA 1BOBA 1ON0A 2PQ8A 4LUAA 3HMJG 2Q4VA 4U5YA 3NA6A 1CS0B 4XPDC 1R61A 4GPLB 2YJVA 2OU2A 5C88A 4H89A 3SJFA 2HROA 1RTQA 3RZAA 1S5KA 1Y9WA 3FIXA 4A32A 2C5QA 1CPSA 4PSXA 1V0CA 1M6VB 1TXRA 3IGRA 4PXEA 2R98A 2BO9A 2GANA 4M6GA 2IL4A 3KRVA 5LYIA 1MJAA 1ZG9A 2B0AA 3I6SA 2OZHA 2OB0A 4LX9A 4QUSA 1M44A 3B3SA 2EO8A 5EMIA 2Y0MA 4P44A 1BPMA 2FIWA 4ZY0A 4UEEA 1TKFA 1XJOA 2V8GA 3LD2A 5J8CA 2HI6A 5CPAA 2JDCA 1GHEA 1Q7LA 2Q51A 4K3NA 1S7LA 3MGDA 3TOBA 1M4GA 5HVFA 1VHOA 1FT7A 2ZW7A 4AG7A 2Z11A 2Z3NA 3I74A 3D66A 2QMLA 4ZGYB 3LMSA 5FD8A 2FE7A 1WVMA 1ZG7A 3D2MA 3TE4A 4UCMA 1VHEA 3VRNA 2PDOA 2R1IA 2YGWA 2ZOFA 2UV8G 1Z8XA 1YLEA 5A27A 3W6XA 2ATRA 1S7KA 4A95A 3IO1A 3WC6A 3KQZA 2AFUA 3NH4A 4ONUA 4F6AA 1VBGA 2GFQA 3EZAA 3QAYA 1BAVA 4MCQA 4R76A 3TX8A 4EWTA 4ZYQA 4PXDA 4H6UA 4TJVA 4ZY2A 4MI4A 4FBEA 2P0WA 3RAMA 3U88C 1IU8A 3SI1A 2VXKA 2Q7BA 5AG4A 2HC9A 4FD7A 3JRUA 3I1UA 2R82A 4C9VA 4G1PA 1MJ9A 1PUAA 2F5IA 3FH4A 4CGNA 1WK4A 3TLEA 4MHYA 3FXTA 2PVWA 4NGSA 2J8MA 3T05A 1QSTA 3TLGA 2JEWA 3GKRA 4A2ZA 2R7HA 5F1YA 4P4EA 5K8MA 4MI1A 3D7DA 2BL1A 3QAHA 3ISZA 3KASA 3PB8X 1OBRA 4TWEA 5AG6A 1ZL0A 3T07A 3ISXA 3PZJA 3B8GA 2XEJA 2FCKA 2C6PA 4JXQA 5F9MA 2ARHA 2EBJA 1YREA 1NSAA 3N7ZA 4AVAA 2RFHA 2R8VA 4KVXA 3D3SA 3TFYA 2OR4A 2ZEOA 1NSLA 5A28A 1NBWA 4M3SA 2DPTA 4A37A 2O4HA 2RB7A 3L2NA 4OC1A 2O53A 1XMBA 4ZI6A 1KUXA 4H6ZA 2EZAA 2AFWA 3OAKA 1M4DA 4TNUA 4KOSA 3K9TA 5HXDA 4XPDB 4B13A 3FX6A 3QB8A 4BPWB 1VKCA 4P4DA 1KZFA 2BCOA 3JVNA 1V6CA 2C6CA 2JBJA 2PJ5A 2PJ6A 2GU2A 1RO5A 2REFA 1XEBA 3EIFA 3TC8A 7CPAA 5HVHA 1Z4RA 4E94A 1CJWA 1B47A 2P6GA 4C7HA 5JVLA 3D7FA 1Z2LA 4JVOA 4YFJA 3PFEA 3B3CA 4CYQA 3KGQA 4NXYA 4OP4A 2D0PA 4FWUA 2FS5A 4MJXA 1S7NA 1X12A 4PQAA 3VATA 2Q4ZA 3GYAA 4C86A 4U9YA 2ZW5A 3K9UA 1Y0YA 2OZUA 4CRZB 5G20A 2V8DA 2Y1NA 4XPLA 2PJ0A 4KSFA 4C8TA 1B87A 4C9RA 2Q0YA 1JDEA 1VI4A 1YX0A 3IFEA 3WC7A 3ZNIA 1XF1A 4JLYA 4AXVA 2DPSA 2J8RA 2JEVA 4LQGA 2P6FA 4B5PA 3IIBA 1DE4C 4P4BA 1TIQA 5J1QA 3SJXA 3TO6A 5J3XA 1A9XB 3U1BA 1MJBA 4AB7A 3OP0A 4UA3A 2NMTA 1HEEA 4RUHA 3R95A 5E96A 3BI1A 1YW6A 4KOXA 3KL9A 4RS2A 3K2KA 4A38A 1ARLA 2N3AB 3C26A 2ZEFA 4MHNA 1B6BA 4INJA 3O8ZA 3FB3A 2QJ8A 2JLMA 4GXHA 2E28A 4ZX9A 4ZX8A 2AFOA 1P0HA 1TKHA 2ANPA 1HDUA 4DJLA 5JPHA 1ZLIA 4YWYA 4CDKA 4C7IA 3DNSA 3F8KA 3RBUA 4F9UA 4OMEA 1YLOA 4CGOA 4B10A 3D67A 4E0AA 4PXBA 2FXFA 4UFXA 3KKWA 3IWGA 1FY7A 4M85A 1YR0A 3VRPA 2XEFA 5HKZA 2PR1A 4A94A 4BPUB 3EXNA 4MJ8A 3T8WA 4R8FA 3FYNA 1YK3A 4A33A 3IC1A 5JH9A 4RR2B 3H5ZA 1QMUA 2AUMA 5LRJA 2BOAA 2WPXA 4YRHA 1VHSA 2WUUA 3S6GA 3ZJ0A 4NCZA 1YVOA 3PT1A 2QECA 2PJ4A 2Z3KA 3BJ8A 4QC6A 3MRUA 5AGEA 3R9FA 2MP0A 2EK8A 3RYOA 1DIKA 1R57A 4IUSA 2CF4A 2VI7A 4A31A 5H86A 3FMCA 4CAFA 1K4JA 2DF5A 3HPHE 4UWIA 4FAIA 3D8PA 3FVLA 4MY0A 3IWWA 3BUMB 1AMPA 2G0BA 2YNEA 3PRTA 5AG5A 2JDDA 2XEGA 2EUIA 4JJXA 3WC5A 3CDXA 4WWVA 2ZELA 5HKYA 3KHZA 3LWUA 2PJAA 4KSIA 1WJTA 3EC4A 4NEXA 3VRRA 2HV2A 4M6IA 2PJ8A 4IK2A 1LAMA 2PIYA 4Q38A 3FF3A 4J3GA 3KZWA 4MHPA 4X8IA 4C2ZA 2HWGA 3GIUA 4KNGE 4C84A 3HLPA 2NSMA 2B5GB 2FM4A 3JUWA 1PU9A 4K30A 5KTAA 4C8PA 1CP6A 4R9MA 3ZZIA 3BXMA 5KTCA 5G22A 2ABZA 4MMOA 3GJZA 4UBRA 2OH1A 2VKZG 2GP4A 4CGLA 4R87A 2KCWA 4MHDA 4DNCA 2B4DB 3G23A 4EYSA 2CTCA 4MCPA 4RN7A 3R9EA 1F2PA 2B4BA 4X2TA 4KLWA 3F0AA 3DGVA 3D7GA 3FRMA 1EZAA 1GGOA 4Y49C 4KS9A 2XPPA 3EFAA 4PV6A 5LYLA 4CAXA 2C27A 4RI1A 4CO9A 2J8NA 4C9EA 4Q7AA 1KEEB 3VGOA 2XPOA 1OZPA 1T36B 4F9VA 3EZEA 3SJGA 3KI9A 2EVNA 3TLAA 3TTHA 4R3KA 4OC2A 2H5MA 4C8CA 2XPLA 4EVYA 2IQ6A 4F0YA 2Z3PA 1Y9KA 1QSOA 1Z8TA 2B3UA 2ZEPA 4ONWA 3CPXA 4P45A 2PC1A 2YNCC 4P4JA 2Z3MA 3D68A 2VL1A 3WABA 1BXRB 3KR5A 4IIXA 3HPGG 3PB6X 4NSQA 4B12A 5K8NA 4JD6A 5IR2A 4OC5A 1FBVA 2Z0ZA 2D4PA 3P2FA 1U6MA 4F0XA 2HUZA 3IU2A 4PPZA 4JWPA 2OOTA 4P10A 3FEDA 1XE4A 2EZCA 4OKOA 1IYLA 4CGPA 1LANA 1KUVA 4KUAA 4C8FA 4COGA 2FSRA 4E5SA 3R9GA 2WZNA 1KBLA 4BPXB 3SR3A 5ELYA 4A4BA 2PIZA 3CPAA 2C6GA 3RO0A 5LRKA 3PBEA 5JM6A 2C1CA 4JZ0A 1WWZA 4MHZA 4PSWA 3PFOA 1SQHA 3CXPA 1CM0A 3NE7A 4R57A 2V8HA 1ZYMA 1Z9UA 1ELMP 3B3VA 3F5BA 3NOJA 2I00A 4MY3A 2PRBA 3F9KC 2PCUA 4CAWA 2X0SA 4YGOA 2AJ6A 5C82A 3H8GA 5EC4A 2EWBA 3LACA 2X7BA 1BO4A 3TCVA 3W91A 5IV0A 3BLNA 1L0CA 3HUVA 4OIDA 3PLFB 5LYDA 3T0TA 3DSBA 4MFLA 2VQYA 1H8LA 1CX8A 1NE9A 2ZW6A 2AFZA 3IU1A 1S60A 1YSJA 3T9YA 2G9DA 3PEIA 3TLBA 1CPXA 2HB6A 3JTKA 1R43A 3P2HA 4QVTA 2GIVA 1N71A 3S6KA 4H1HA 4C8AA 1M1DA 4FD4A 2B4DA 1Z9EA 4X3RA 1TF8A 2PJ1A 2V8VA 4I49A 5EBVA 3SXNA 5LRGA 2Q04A 4NF1A 1QQ9A 4MFKA 4UIAA 3TO7A 4YN3A 2JBKA 4CAVA 3DLJA 2GE3A 1FNOA 1NMTA 1Z8LA 2YNDA 5BY0A 3VWEA 4NJQA 4B5OA 3NE8A 1Z4EA 1RXTA 3TOAA 1S3ZA 2BUEA 2I3CA 2PRQA 4O23A 2F8HA 2CBLA 4OADA 2QYVA 4GS4A 3VARA 4UCPA 2IJZA 4KVOE 1EE3P 1VBHA 3PP9A 4MFQA 4U9ZA 5K99A 4OAEA 4KUBA 1CE8B 2XEIA 2BSWA 1IIDA 2VZYA 1X10A 1Q2YA 3S9NA 2Y1MA 4NJRA 2G3TA 5THWA 1CBXA 2PVVA 3FNCA 5H84A 1ARMA 3NH8A 4KVME 3SXOA 3CXSA 4TJXA 3CT9A 3B2YA 4P4FA 3PB7X 5K8OA 4FD5A 4QB9A 4Y49B 4E2AA 1M4IA 1Q2DA 5F49A 3LODA 5F46A 3TLCA 4OC0A 4UEFA 2PCNA 4CS0B 2PJ9A 2QVPA 2WSAA 5J8FA 2BEIA 3EO4A 4JYWA 1F57A 1I12A 1BLLE 1JQGA 2Q43A 4HNXB 1JWQA 1IYKA 3H8EA 1XF8A 5G1ZA 1IOIA 3BUXB 3GY9A 5DS0A 3NFZA 5KTDA 3IJ3A 1YVKA 3CXQA 4CAEA 2PE3A 3KR4A 4FUUA 3H8FA 4MXUA 3ICUA 2OLSA 4BTFA 1DTDA 2PJ7A 2Q4YA 3S6FA 2ZW4A 3TO9A 4R7MA 1Q5XA 4MCRA 5GCNA 3TLGB 2YJTA 2GLFA 1IOFA 2ZENA 1QSNA 3E0KA 1LOKA 1Y7RA 1YQEA 1C30B 2PSWA 3NH5A 4M6HA 1F2OA 3BJ7A 5IB9A 8CPAA 4R6TA 4MCSA 5F13A 2CY2A 4UEZA 2VEZA 5BWAB 1TKJA 4PK3A 5AXIA 4OC3A 4AVBA 3GLJA 4YU9A 4KOYA 1KWMA 4NGTA 2AE6A 1JDBC 3TT2A 4QBJA 1TF9A 3BI0A 4CGMA 1GYTA 1MK4A 2A4NA 3D7HA 3B3WA 1Z8WA 4KOVA 1AYEA 2WPWA 2CXAA 3N5FA 2Q7SA 4IHMA 3VTAA 1ZG8A 3TLYA 2XPNA 3V7ZA 4IIYA 3BUOB 3G8WA 2DLAA 1Y0RA 5JGFA 1BPNA 2RC4A 1YGHA 3OB1B 3G3SA 3WR7A 1J3LA 2VZZA 3TLZA 4NGQA 3B3TA 4HKFA 2WYRA 1CP7A 1AUGA 2POKA 3FECA 3T5MA 2O28A 1IY7A 1KC7A 4AG9A 1A2ZA 4II9A 4UF4A 2ZEHA 4KOTA 1LRZA 1VIXA 4IF5A 3OB2B 2EK9A 2DXQA 3S9LA 3BHXA 3SJEA 1EO0A 2Z3LA 4B11A 4H2KA 5I0CA 4NGPA 4C85A 4L89A 4MFZA 3QNVA 1XFOA 2CNTA 4NGMA 3KHXA 1YMEA 5F5XA 4C9UA 2PJ3A 2F7VA 5ISVA 4W9YA 4ORFA 4KOUA 3T90A 5IX3A 4DUKA 2ODFA 1YVHA 3R96A 2FIAA 4NFRA 1S7FA 4EMEA 2Z3OA 3OWCA 1P4NA 2GREA 4PXCA 4HNYB 4XNHC 3IEHA 2EZBA 3GUXA 4HNWB 1NXJA 3TYXA 5JQ4A 2DEAA 3PGPA 1UFHA 2I79A 1QSMA 5F48A 3B7IA 4R3LA 4B5PB 3MN8A 2VBQA 2ZEEA 1LAPA 5D29A 1M4LA 4ZBGA 3V38A 4DYOA 3PB4X 4KORA 4C99A 3D2PA 3IWEA 4C8UA 1C3OB 2YNCA 4KZTA 1XBUA 3VH9A 2AUNA 5FVJA 4CZ1A 2D4OA 4BINA 5IB0A 1ZRSA 4NGNA 4GM5A 4MRIA 1XRYA 2D0OA 1LFWA 2OZGA 3S9MA 1XIXA 1ZO0A 4KOWA 5G21A 3SI0A 4BBHA 2B58A 3K4IA 4A4CA 1IICA 3FEEA 4OC4A 1LCPA 5I4MA 4M8DA 1UWYA 4ZY1A 4C9AA 3C8OA 5DWNA 3VROA 1ZLHA 2PJ2A 1Z5RA 4X5KA
chains in the Genus database with same CATH topology
3SI2A 5D8NA 2J9AA 3FJUA 3KQXA 1Y7EA 2NYQA 3PBBA 4CDJA 3D4UA 2GLJA 1YW4A 5K8PA 5CBMA 1PYTB 2ZEDA 3B35A 3GB0A 1HDQA 2AFMA 1PCAA 4P6YA 4B6ZA 4EFDA 4F8ZA 5LYFA 2IMOA 2ZOGA 5F09A 4IAVA 2CTBA 2CIJA 1VGYA 1IGBA 1Y9ZA 4UIBA 2AFXA 1CG2A 4NGRA 5HVGA 4A39A 3PB9X 4OIWA 4BD9A 2AFSA 1ELLP 2PJBA 6CPAA 1R3NA 4P4IA 2ZEGA 4Z65A 2PJCA 2ZEMA 2FVGA 2V77A 4WJBA 3WT4A 4CPAA 3NA6A 3SJFA 1RTQA 3RZAA 2C5QA 1CPSA 1TXRA 4PXEA 2BO9A 5LYIA 1ZG9A 3I6SA 3B3SA 4P44A 1BPMA 4ZY0A 4UEEA 1TKFA 1XJOA 2V8GA 5CPAA 2Q51A 1Q7LA 4K3NA 5HVFA 1VHOA 1FT7A 3I74A 3D66A 3LMSA 1WVMA 1ZG7A 1VHEA 2ZOFA 3IO1A 3WC6A 3KQZA 2AFUA 3NH4A 1BAVA 4MCQA 4R76A 3TX8A 4EWTA 4ZYQA 4PXDA 4TJVA 4ZY2A 4FBEA 3RAMA 3SI1A 2HC9A 3JRUA 3I1UA 4C9VA 4G1PA 3FH4A 4MHYA 2PVWA 4NGSA 2JEWA 4P4EA 5K8MA 3D7DA 3ISZA 3KASA 3PB8X 1OBRA 4TWEA 3ISXA 2XEJA 2C6PA 1NSAA 2RFHA 2OR4A 2ZEOA 4A37A 2O4HA 2RB7A 3L2NA 4OC1A 2O53A 1XMBA 2AFWA 4TNUA 3K9TA 5HXDA 3FX6A 1V6CA 4P4DA 2BCOA 2C6CA 2JBJA 2PJ5A 2PJ6A 2GU2A 3EIFA 3TC8A 7CPAA 5HVHA 3D7FA 1Z2LA 3PFEA 3B3CA 3KGQA 4OP4A 4FWUA 4PQAA 3VATA 2Q4ZA 4C86A 1Y0YA 4C8TA 2V8DA 4C9RA 2PJ0A 3IFEA 3WC7A 1XF1A 4AXVA 4LQGA 3IIBA 1DE4C 4P4BA 5J1QA 3SJXA 4RUHA 1HEEA 3BI1A 1YW6A 3KL9A 3K2KA 4A38A 1ARLA 2ZEFA 4MHNA 2QJ8A 4ZX9A 4ZX8A 2AFOA 1TKHA 2ANPA 1HDUA 4DJLA 1ZLIA 4YWYA 4CDKA 3RBUA 4F9UA 4OMEA 1YLOA 3D67A 4PXBA 4A94A 2XEFA 3T8WA 4R8FA 3IC1A 5JH9A 1QMUA 5LRJA 2BOAA 2PJ4A 3MRUA 2EK8A 2CF4A 3FMCA 4FAIA 3FVLA 4ZI6A 3IWWA 1AMPA 3WC5A 3PRTA 2XEGA 3CDXA 4WWVA 2ZELA 3KHZA 3LWUA 2PJAA 4KSIA 2PJ8A 4IK2A 1LAMA 2PIYA 3FF3A 4X8IA 3KZWA 4MHPA 4KNGE 4C84A 3HLPA 2NSMA 4C8PA 1CP6A 3BXMA 2ABZA 4MMOA 2GP4A 2CTCA 4MCPA 1F2PA 4X2TA 3DGVA 3D7GA 5LYLA 4C9EA 4Q7AA 4F9VA 3SJGA 3KI9A 4OC2A 4C8CA 2IQ6A 2ZEPA 4ONWA 3CPXA 4P45A 4P4JA 3D68A 2VL1A 3WABA 3KR5A 3PB6X 5IR2A 5K8NA 4OC5A 4PPZA 2OOTA 4P10A 3FEDA 4OKOA 1LANA 4C8FA 2WZNA 5ELYA 3CPAA 2PIZA 2C6GA 5LRKA 3PBEA 5JM6A 2C1CA 4JZ0A 4MHZA 3PFOA 2V8HA 1ELMP 3B3VA 2PCUA 3H8GA 2EWBA 4OIDA 3HUVA 5LYDA 1H8LA 1CX8A 2AFZA 1YSJA 2G9DA 3PEIA 1CPXA 2HB6A 1R43A 4C8AA 4X3RA 1TF8A 2PJ1A 2V8VA 5LRGA 1QQ9A 4UIAA 2JBKA 3DLJA 1FNOA 1Z8LA 4NJQA 2I3CA 2PRQA 4O23A 2F8HA 3VARA 2QYVA 2IJZA 1EE3P 2XEIA 3S9NA 4NJRA 5THWA 1CBXA 2PVVA 4TJXA 1ARMA 3NH8A 3CT9A 3B2YA 4P4FA 3PB7X 5K8OA 4OC0A 4UEFA 2PJ9A 2QVPA 4JYWA 1F57A 1BLLE 1JQGA 2Q43A 3H8EA 5DS0A 3NFZA 3IJ3A 2PE3A 3KR4A 4FUUA 3H8FA 4MXUA 3ICUA 1DTDA 2PJ7A 4YN3A 4R7MA 4MCRA 2GLFA 2ZENA 1LOKA 3NH5A 1F2OA 5IB9A 8CPAA 4R6TA 4MCSA 4UEZA 1TKJA 4OC3A 3GLJA 4YU9A 1KWMA 4NGTA 1TF9A 3BI0A 1GYTA 3B3WA 3D7HA 1AYEA 3N5FA 4IHMA 3VTAA 1ZG8A 3V7ZA 5JGFA 1Y0RA 1BPNA 4NGQA 3B3TA 2WYRA 1CP7A 2POKA 3FECA 1IY7A 4UF4A 2ZEHA 1VIXA 2EK9A 3S9LA 3BHXA 3SJEA 4H2KA 4C85A 4NGPA 3QNVA 1XFOA 3KHXA 4NGMA 4C9UA 1YMEA 2PJ3A 2F7VA 4W9YA 4DUKA 4NFRA 4EMEA 4PXCA 2GREA 3IEHA 3GUXA 2DEAA 3B7IA 3MN8A 2ZEEA 1LAPA 5D29A 1M4LA 3V38A 4DYOA 3PB4X 4C99A 4C8UA 3VH9A 1XBUA 4NGNA 4GM5A 4MRIA 1XRYA 1LFWA 3S9MA 3SI0A 3FEEA 4OC4A 1LCPA 5I4MA 1UWYA 4ZY1A 4C9AA 1ZLHA 2PJ2A 1Z5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SI2 A;  5D8N A;  2J9A A;  3FJU A;  3KQX A;  1Y7E A;  2NYQ A;  3PBB A;  4CDJ A;  3D4U A;  2GLJ A;  1YW4 A;  5K8P A;  5CBM A;  1PYT B;  2ZED A;  3B35 A;  3GB0 A;  1HDQ A;  2AFM A;  1PCA A;  4P6Y A;  4B6Z A;  4EFD A;  4F8Z A;  5LYF A;  2IMO A;  2ZOG A;  5F09 A;  4IAV A;  2CTB A;  2CIJ A;  1VGY A;  1IGB A;  1Y9Z A;  4UIB A;  2AFX A;  1CG2 A;  4NGR A;  5HVG A;  4A39 A;  3PB9 X;  4OIW A;  4BD9 A;  2AFS A;  1ELL P;  2PJB A;  6CPA A;  1R3N A;  4P4I A;  2ZEG A;  4Z65 A;  2PJC A;  2ZEM A;  2FVG A;  2V77 A;  4WJB A;  3WT4 A;  4CPA A;  3NA6 A;  3SJF A;  1RTQ A;  3RZA A;  1CPS A;  1TXR A;  4PXE A;  2BO9 A;  5LYI A;  1ZG9 A;  3I6S A;  3B3S A;  4P44 A;  1BPM A;  4ZY0 A;  4UEE A;  1TKF A;  1XJO A;  2V8G A;  5CPA A;  2Q51 A;  1Q7L A;  4K3N A;  5HVF A;  1VHO A;  1FT7 A;  3I74 A;  3D66 A;  3LMS A;  1WVM A;  1ZG7 A;  1VHE A;  2ZOF A;  3IO1 A;  3WC6 A;  3KQZ A;  2AFU A;  3NH4 A;  1BAV A;  4MCQ A;  4R76 A;  3TX8 A;  4EWT A;  4ZYQ A;  4PXD A;  4TJV A;  4ZY2 A;  4FBE A;  3RAM A;  3SI1 A;  2HC9 A;  3JRU A;  3I1U A;  4C9V A;  4G1P A;  3FH4 A;  4MHY A;  2PVW A;  4NGS A;  2JEW A;  4P4E A;  5K8M A;  3D7D A;  3ISZ A;  3KAS A;  3PB8 X;  1OBR A;  4TWE A;  3ISX A;  2XEJ A;  2C6P A;  1NSA A;  2RFH A;  2OR4 A;  2ZEO A;  4A37 A;  2O4H A;  2RB7 A;  3L2N A;  4OC1 A;  2O53 A;  1XMB A;  2AFW A;  4TNU A;  3K9T A;  5HXD A;  3FX6 A;  1V6C A;  4P4D A;  2BCO A;  2C6C A;  2JBJ A;  2PJ5 A;  2PJ6 A;  2GU2 A;  3EIF A;  3TC8 A;  7CPA A;  5HVH A;  3D7F A;  1Z2L A;  3PFE A;  3B3C A;  3KGQ A;  4OP4 A;  4FWU A;  4PQA A;  3VAT A;  2Q4Z A;  4C86 A;  1Y0Y A;  4C8T A;  2V8D A;  4C9R A;  2PJ0 A;  3IFE A;  3WC7 A;  1XF1 A;  4AXV A;  4LQG A;  3IIB A;  1DE4 C;  4P4B A;  5J1Q A;  3SJX A;  4RUH A;  1HEE A;  3BI1 A;  1YW6 A;  3KL9 A;  3K2K A;  4A38 A;  1ARL A;  2ZEF A;  4MHN A;  2QJ8 A;  4ZX9 A;  4ZX8 A;  2AFO A;  1TKH A;  2ANP A;  1HDU A;  4DJL A;  1ZLI A;  4YWY A;  4CDK A;  3RBU A;  4F9U A;  4OME A;  1YLO A;  3D67 A;  4PXB A;  4A94 A;  2XEF A;  3T8W A;  4R8F A;  3IC1 A;  5JH9 A;  1QMU A;  5LRJ A;  2BOA A;  2PJ4 A;  3MRU A;  2EK8 A;  2CF4 A;  3FMC A;  4FAI A;  3FVL A;  4ZI6 A;  3IWW A;  1AMP A;  3WC5 A;  3PRT A;  2XEG A;  3CDX A;  4WWV A;  2ZEL A;  3KHZ A;  3LWU A;  2PJA A;  4KSI A;  2PJ8 A;  4IK2 A;  1LAM A;  2PIY A;  3FF3 A;  4X8I A;  3KZW A;  4MHP A;  4KNG E;  4C84 A;  3HLP A;  2NSM A;  4C8P A;  1CP6 A;  3BXM A;  2ABZ A;  4MMO A;  2CTC A;  4MCP A;  1F2P A;  4X2T A;  3DGV A;  3D7G A;  5LYL A;  4C9E A;  4Q7A A;  4F9V A;  3SJG A;  3KI9 A;  4OC2 A;  4C8C A;  2IQ6 A;  2ZEP A;  4ONW A;  3CPX A;  4P45 A;  4P4J A;  3D68 A;  2VL1 A;  3WAB A;  3KR5 A;  3PB6 X;  5K8N A;  4OC5 A;  4PPZ A;  2OOT A;  4P10 A;  3FED A;  4OKO A;  1LAN A;  4C8F A;  2WZN A;  5ELY A;  3CPA A;  2PIZ A;  2C6G A;  5LRK A;  3PBE A;  5JM6 A;  2C1C A;  4JZ0 A;  4MHZ A;  3PFO A;  2V8H A;  1ELM P;  3B3V A;  2PCU A;  3H8G A;  2EWB A;  4OID A;  3HUV A;  5LYD A;  1H8L A;  1CX8 A;  2AFZ A;  1YSJ A;  2G9D A;  3PEI A;  1CPX A;  2HB6 A;  1R43 A;  4C8A A;  4X3R A;  1TF8 A;  2PJ1 A;  2V8V A;  5LRG A;  1QQ9 A;  4UIA A;  2JBK A;  3DLJ A;  1FNO A;  1Z8L A;  4NJQ A;  2I3C A;  2PRQ A;  4O23 A;  2F8H A;  3VAR A;  2QYV A;  2IJZ A;  1EE3 P;  2XEI A;  3S9N A;  4NJR A;  5THW A;  1CBX A;  2PVV A;  4TJX A;  1ARM A;  3NH8 A;  3CT9 A;  3B2Y A;  4P4F A;  3PB7 X;  5K8O A;  4OC0 A;  4UEF A;  2PJ9 A;  2QVP A;  4JYW A;  1F57 A;  1BLL E;  1JQG A;  2Q43 A;  3H8E A;  5DS0 A;  3NFZ A;  3IJ3 A;  2PE3 A;  3KR4 A;  4FUU A;  3H8F A;  4MXU A;  3ICU A;  1DTD A;  2PJ7 A;  4YN3 A;  4R7M A;  4MCR A;  2GLF A;  2ZEN A;  1LOK A;  3NH5 A;  1F2O A;  5IB9 A;  8CPA A;  4R6T A;  4MCS A;  4UEZ A;  1TKJ A;  4OC3 A;  3GLJ A;  4YU9 A;  1KWM A;  4NGT A;  1TF9 A;  3BI0 A;  1GYT A;  3B3W A;  3D7H A;  1AYE A;  3N5F A;  4IHM A;  3VTA A;  1ZG8 A;  3V7Z A;  5JGF A;  1Y0R A;  1BPN A;  4NGQ A;  3B3T A;  2WYR A;  1CP7 A;  2POK A;  3FEC A;  1IY7 A;  4UF4 A;  2ZEH A;  1VIX A;  2EK9 A;  3S9L A;  3BHX A;  3SJE A;  4H2K A;  4C85 A;  4NGP A;  3QNV A;  1XFO A;  3KHX A;  4NGM A;  4C9U A;  1YME A;  2PJ3 A;  2F7V A;  4W9Y A;  4DUK A;  4NFR A;  4EME A;  4PXC A;  2GRE A;  3IEH A;  3GUX A;  2DEA A;  3B7I A;  3MN8 A;  2ZEE A;  1LAP A;  5D29 A;  1M4L A;  3V38 A;  4DYO A;  3PB4 X;  4C99 A;  4C8U A;  3VH9 A;  1XBU A;  4NGN A;  4GM5 A;  4MRI A;  1XRY A;  1LFW A;  3S9M A;  3SI0 A;  3FEE A;  4OC4 A;  1LCP A;  5I4M A;  1UWY A;  4ZY1 A;  4C9A A;  1ZLH A;  2PJ2 A;  1Z5R A; 
#chains in the Genus database with same CATH topology
 3A9L A;  2K5T A;  5D8N A;  2J9A A;  2B5G A;  3SI2 A;  3FJU A;  4Q36 A;  2B4J C;  4FD6 A;  4MBU A;  3KQX A;  1Y7E A;  3EY5 A;  4LQ6 A;  3S6H A;  2NYQ A;  4COB A;  1EZB A;  3PBB A;  4CDJ A;  3D4U A;  2CNM A;  2CNS A;  2GLJ A;  1YW4 A;  5K8P A;  2ZPA A;  3BUN B;  5CBM A;  1PYT B;  4C2Y A;  4XPK A;  2ZED A;  3V8I A;  2ZXV A;  3B35 A;  4UCN A;  3DDD A;  3GB0 A;  4J0N A;  1HDQ A;  1J4J A;  2AFM A;  5HKW A;  1XMT A;  2G3A A;  2Z10 A;  1PCA A;  3R1K A;  4L8A A;  1I1D A;  3I9S A;  3NFQ A;  2P6E A;  3VRQ A;  3UY5 A;  3BUW B;  4P6Y A;  5AG7 A;  3W6S A;  4B6Z A;  4EFD A;  4F8Z A;  5LYF A;  2IMO A;  4PK2 A;  4UFV A;  4CYO A;  4MFJ A;  4CYN A;  2ZOG A;  5F09 A;  2HQY A;  4IAV A;  5HMN A;  2CTB A;  5F47 A;  2CIJ A;  1VGY A;  1Q2C A;  3SHP A;  4CYP A;  1IGB A;  4AVC A;  1Y9Z A;  3FBU A;  5JYB A;  2Q44 A;  4C68 A;  4UIB A;  2AFX A;  1CG2 A;  4NGR A;  4UFW A;  5HVG A;  4CRY B;  3EZB A;  4A39 A;  3CZX A;  2DIK A;  3PB9 X;  4OIW A;  1IB1 E;  4KLV A;  4BD9 A;  2AFS A;  1ELL P;  3DR8 A;  2PJB A;  4JXR A;  3VWD A;  4C2X A;  6CPA A;  1R3N A;  4P4I A;  3DR6 A;  3H4Q A;  4HPS A;  3PFV A;  1XOV A;  2ZEG A;  4MFP A;  4Z65 A;  2PJC A;  2ZEM A;  2FVG A;  2REE A;  1I21 A;  4UWJ A;  2V77 A;  4KSA A;  4A30 A;  4OLL A;  5DWM A;  2B3V A;  4WJB A;  4B14 A;  2PR8 A;  2FT0 A;  4E8O A;  2QIR A;  3I3G A;  4BMH A;  3RNZ A;  5CNP A;  5HH1 A;  3WT4 A;  2FL4 A;  4XNH B;  1QSR A;  1KUY A;  4CPA A;  1BOB A;  1ON0 A;  2PQ8 A;  4LUA A;  3HMJ G;  2Q4V A;  4U5Y A;  3NA6 A;  1CS0 B;  4XPD C;  1R61 A;  4GPL B;  2YJV A;  2OU2 A;  5C88 A;  4H89 A;  3SJF A;  2HRO A;  1RTQ A;  3RZA A;  1S5K A;  1Y9W A;  3FIX A;  4A32 A;  2C5Q A;  1CPS A;  4PSX A;  1V0C A;  1M6V B;  1TXR A;  3IGR A;  4PXE A;  2R98 A;  2BO9 A;  2GAN A;  4M6G A;  2IL4 A;  3KRV A;  5LYI A;  1MJA A;  1ZG9 A;  2B0A A;  3I6S A;  2OZH A;  2OB0 A;  4LX9 A;  4QUS A;  1M44 A;  3B3S A;  2EO8 A;  5EMI A;  2Y0M A;  4P44 A;  1BPM A;  2FIW A;  4ZY0 A;  4UEE A;  1TKF A;  1XJO A;  2V8G A;  3LD2 A;  5J8C A;  2HI6 A;  5CPA A;  2JDC A;  1GHE A;  1Q7L A;  2Q51 A;  4K3N A;  1S7L A;  3MGD A;  3TOB A;  1M4G A;  5HVF A;  1VHO A;  1FT7 A;  2ZW7 A;  4AG7 A;  2Z11 A;  2Z3N A;  3I74 A;  3D66 A;  2QML A;  4ZGY B;  3LMS A;  5FD8 A;  2FE7 A;  1WVM A;  1ZG7 A;  3D2M A;  3TE4 A;  4UCM A;  1VHE A;  3VRN A;  2PDO A;  2R1I A;  2YGW A;  2ZOF A;  2UV8 G;  1Z8X A;  1YLE A;  5A27 A;  3W6X A;  2ATR A;  1S7K A;  4A95 A;  3IO1 A;  3WC6 A;  3KQZ A;  2AFU A;  3NH4 A;  4ONU A;  4F6A A;  1VBG A;  2GFQ A;  3EZA A;  3QAY A;  1BAV A;  4MCQ A;  4R76 A;  3TX8 A;  4EWT A;  4ZYQ A;  4PXD A;  4H6U A;  4TJV A;  4ZY2 A;  4MI4 A;  4FBE A;  2P0W A;  3RAM A;  3U88 C;  1IU8 A;  3SI1 A;  2VXK A;  2Q7B A;  5AG4 A;  2HC9 A;  4FD7 A;  3JRU A;  3I1U A;  2R82 A;  4C9V A;  4G1P A;  1MJ9 A;  1PUA A;  2F5I A;  3FH4 A;  4CGN A;  1WK4 A;  3TLE A;  4MHY A;  3FXT A;  2PVW A;  4NGS A;  2J8M A;  3T05 A;  1QST A;  3TLG A;  2JEW A;  3GKR A;  4A2Z A;  2R7H A;  5F1Y A;  4P4E A;  5K8M A;  4MI1 A;  3D7D A;  2BL1 A;  3QAH A;  3ISZ A;  3KAS A;  3PB8 X;  1OBR A;  4TWE A;  5AG6 A;  1ZL0 A;  3T07 A;  3ISX A;  3PZJ A;  3B8G A;  2XEJ A;  2FCK A;  2C6P A;  4JXQ A;  5F9M A;  2ARH A;  2EBJ A;  1YRE A;  1NSA A;  3N7Z A;  4AVA A;  2RFH A;  2R8V A;  4KVX A;  3D3S A;  3TFY A;  2OR4 A;  2ZEO A;  1NSL A;  5A28 A;  1NBW A;  4M3S A;  2DPT A;  4A37 A;  2O4H A;  2RB7 A;  3L2N A;  4OC1 A;  2O53 A;  1XMB A;  4ZI6 A;  1KUX A;  4H6Z A;  2EZA A;  2AFW A;  3OAK A;  1M4D A;  4TNU A;  4KOS A;  3K9T A;  5HXD A;  4XPD B;  4B13 A;  3FX6 A;  3QB8 A;  4BPW B;  1VKC A;  4P4D A;  1KZF A;  2BCO A;  3JVN A;  1V6C A;  2C6C A;  2JBJ A;  2PJ5 A;  2PJ6 A;  2GU2 A;  1RO5 A;  2REF A;  1XEB A;  3EIF A;  3TC8 A;  7CPA A;  5HVH A;  1Z4R A;  4E94 A;  1CJW A;  1B47 A;  2P6G A;  4C7H A;  5JVL A;  3D7F A;  1Z2L A;  4JVO A;  4YFJ A;  3PFE A;  3B3C A;  4CYQ A;  3KGQ A;  4NXY A;  4OP4 A;  2D0P A;  4FWU A;  2FS5 A;  4MJX A;  1S7N A;  1X12 A;  4PQA A;  3VAT A;  2Q4Z A;  3GYA A;  4C86 A;  4U9Y A;  2ZW5 A;  3K9U A;  1Y0Y A;  2OZU A;  4CRZ B;  5G20 A;  2V8D A;  2Y1N A;  4XPL A;  2PJ0 A;  4KSF A;  4C8T A;  1B87 A;  4C9R A;  2Q0Y A;  1JDE A;  1VI4 A;  1YX0 A;  3IFE A;  3WC7 A;  3ZNI A;  1XF1 A;  4JLY A;  4AXV A;  2DPS A;  2J8R A;  2JEV A;  4LQG A;  2P6F A;  4B5P A;  3IIB A;  1DE4 C;  4P4B A;  1TIQ A;  5J1Q A;  3SJX A;  3TO6 A;  5J3X A;  1A9X B;  3U1B A;  1MJB A;  4AB7 A;  3OP0 A;  4UA3 A;  2NMT A;  1HEE A;  4RUH A;  3R95 A;  5E96 A;  3BI1 A;  1YW6 A;  4KOX A;  3KL9 A;  4RS2 A;  3K2K A;  4A38 A;  1ARL A;  2N3A B;  3C26 A;  2ZEF A;  4MHN A;  1B6B A;  4INJ A;  3O8Z A;  3FB3 A;  2QJ8 A;  2JLM A;  4GXH A;  2E28 A;  4ZX9 A;  4ZX8 A;  2AFO A;  1P0H A;  1TKH A;  2ANP A;  1HDU A;  4DJL A;  5JPH A;  1ZLI A;  4YWY A;  4CDK A;  4C7I A;  3DNS A;  3F8K A;  3RBU A;  4F9U A;  4OME A;  1YLO A;  4CGO A;  4B10 A;  3D67 A;  4E0A A;  4PXB A;  2FXF A;  4UFX A;  3KKW A;  3IWG A;  1FY7 A;  4M85 A;  1YR0 A;  3VRP A;  2XEF A;  5HKZ A;  2PR1 A;  4A94 A;  4BPU B;  3EXN A;  4MJ8 A;  3T8W A;  4R8F A;  3FYN A;  1YK3 A;  4A33 A;  3IC1 A;  5JH9 A;  4RR2 B;  3H5Z A;  1QMU A;  2AUM A;  5LRJ A;  2BOA A;  2WPX A;  4YRH A;  1VHS A;  2WUU A;  3S6G A;  3ZJ0 A;  4NCZ A;  1YVO A;  3PT1 A;  2QEC A;  2PJ4 A;  2Z3K A;  3BJ8 A;  4QC6 A;  3MRU A;  5AGE A;  3R9F A;  2MP0 A;  2EK8 A;  3RYO A;  1DIK A;  1R57 A;  4IUS A;  2CF4 A;  2VI7 A;  4A31 A;  5H86 A;  3FMC A;  4CAF A;  1K4J A;  2DF5 A;  3HPH E;  4UWI A;  4FAI A;  3D8P A;  3FVL A;  4MY0 A;  3IWW A;  3BUM B;  1AMP A;  2G0B A;  2YNE A;  3PRT A;  5AG5 A;  2JDD A;  2XEG A;  2EUI A;  4JJX A;  3WC5 A;  3CDX A;  4WWV A;  2ZEL A;  5HKY A;  3KHZ A;  3LWU A;  2PJA A;  4KSI A;  1WJT A;  3EC4 A;  4NEX A;  3VRR A;  2HV2 A;  4M6I A;  2PJ8 A;  4IK2 A;  1LAM A;  2PIY A;  4Q38 A;  3FF3 A;  4J3G A;  3KZW A;  4MHP A;  4X8I A;  4C2Z A;  2HWG A;  3GIU A;  4KNG E;  4C84 A;  3HLP A;  2NSM A;  2B5G B;  2FM4 A;  3JUW A;  1PU9 A;  4K30 A;  5KTA A;  4C8P A;  1CP6 A;  4R9M A;  3ZZI A;  3BXM A;  5KTC A;  5G22 A;  2ABZ A;  4MMO A;  3GJZ A;  4UBR A;  2OH1 A;  2VKZ G;  2GP4 A;  4CGL A;  4R87 A;  2KCW A;  4MHD A;  4DNC A;  2B4D B;  3G23 A;  4EYS A;  2CTC A;  4MCP A;  4RN7 A;  3R9E A;  1F2P A;  2B4B A;  4X2T A;  4KLW A;  3F0A A;  3DGV A;  3D7G A;  3FRM A;  1EZA A;  1GGO A;  4Y49 C;  4KS9 A;  2XPP A;  3EFA A;  4PV6 A;  5LYL A;  4CAX A;  2C27 A;  4RI1 A;  4CO9 A;  2J8N A;  4C9E A;  4Q7A A;  1KEE B;  3VGO A;  2XPO A;  1OZP A;  1T36 B;  4F9V A;  3EZE A;  3SJG A;  3KI9 A;  2EVN A;  3TLA A;  3TTH A;  4R3K A;  4OC2 A;  2H5M A;  4C8C A;  2XPL A;  4EVY A;  2IQ6 A;  4F0Y A;  2Z3P A;  1Y9K A;  1QSO A;  1Z8T A;  2B3U A;  2ZEP A;  4ONW A;  3CPX A;  4P45 A;  2PC1 A;  2YNC C;  4P4J A;  2Z3M A;  3D68 A;  2VL1 A;  3WAB A;  1BXR B;  3KR5 A;  4IIX A;  3HPG G;  3PB6 X;  4NSQ A;  4B12 A;  5K8N A;  4JD6 A;  5IR2 A;  4OC5 A;  1FBV A;  2Z0Z A;  2D4P A;  3P2F A;  1U6M A;  4F0X A;  2HUZ A;  3IU2 A;  4PPZ A;  4JWP A;  2OOT A;  4P10 A;  3FED A;  1XE4 A;  2EZC A;  4OKO A;  1IYL A;  4CGP A;  1LAN A;  1KUV A;  4KUA A;  4C8F A;  4COG A;  2FSR A;  4E5S A;  3R9G A;  2WZN A;  1KBL A;  4BPX B;  3SR3 A;  5ELY A;  4A4B A;  2PIZ A;  3CPA A;  2C6G A;  3RO0 A;  5LRK A;  3PBE A;  5JM6 A;  2C1C A;  4JZ0 A;  1WWZ A;  4MHZ A;  4PSW A;  3PFO A;  1SQH A;  3CXP A;  1CM0 A;  3NE7 A;  4R57 A;  2V8H A;  1ZYM A;  1Z9U A;  1ELM P;  3B3V A;  3F5B A;  3NOJ A;  2I00 A;  4MY3 A;  2PRB A;  3F9K C;  2PCU A;  4CAW A;  2X0S A;  4YGO A;  2AJ6 A;  5C82 A;  3H8G A;  5EC4 A;  2EWB A;  3LAC A;  2X7B A;  1BO4 A;  3TCV A;  3W91 A;  5IV0 A;  3BLN A;  1L0C A;  3HUV A;  4OID A;  3PLF B;  5LYD A;  3T0T A;  3DSB A;  4MFL A;  2VQY A;  1H8L A;  1CX8 A;  1NE9 A;  2ZW6 A;  2AFZ A;  3IU1 A;  1S60 A;  1YSJ A;  3T9Y A;  2G9D A;  3PEI A;  3TLB A;  1CPX A;  2HB6 A;  3JTK A;  1R43 A;  3P2H A;  4QVT A;  2GIV A;  1N71 A;  3S6K A;  4H1H A;  4C8A A;  1M1D A;  4FD4 A;  2B4D A;  1Z9E A;  4X3R A;  1TF8 A;  2PJ1 A;  2V8V A;  4I49 A;  5EBV A;  3SXN A;  5LRG A;  2Q04 A;  4NF1 A;  1QQ9 A;  4MFK A;  4UIA A;  3TO7 A;  4YN3 A;  2JBK A;  4CAV A;  3DLJ A;  2GE3 A;  1FNO A;  1NMT A;  1Z8L A;  2YND A;  5BY0 A;  3VWE A;  4NJQ A;  4B5O A;  3NE8 A;  1Z4E A;  1RXT A;  3TOA A;  1S3Z A;  2BUE A;  2I3C A;  2PRQ A;  4O23 A;  2F8H A;  2CBL A;  4OAD A;  2QYV A;  4GS4 A;  3VAR A;  4UCP A;  2IJZ A;  4KVO E;  1EE3 P;  1VBH A;  3PP9 A;  4MFQ A;  4U9Z A;  5K99 A;  4OAE A;  4KUB A;  1CE8 B;  2XEI A;  2BSW A;  1IID A;  2VZY A;  1X10 A;  1Q2Y A;  3S9N A;  2Y1M A;  4NJR A;  2G3T A;  5THW A;  1CBX A;  2PVV A;  3FNC A;  5H84 A;  1ARM A;  3NH8 A;  4KVM E;  3SXO A;  3CXS A;  4TJX A;  3CT9 A;  3B2Y A;  4P4F A;  3PB7 X;  5K8O A;  4FD5 A;  4QB9 A;  4Y49 B;  4E2A A;  1M4I A;  1Q2D A;  5F49 A;  3LOD A;  5F46 A;  3TLC A;  4OC0 A;  4UEF A;  2PCN A;  4CS0 B;  2PJ9 A;  2QVP A;  2WSA A;  5J8F A;  2BEI A;  3EO4 A;  4JYW A;  1F57 A;  1I12 A;  1BLL E;  1JQG A;  2Q43 A;  4HNX B;  1JWQ A;  1IYK A;  3H8E A;  1XF8 A;  5G1Z A;  1IOI A;  3BUX B;  3GY9 A;  5DS0 A;  3NFZ A;  5KTD A;  3IJ3 A;  1YVK A;  3CXQ A;  4CAE A;  2PE3 A;  3KR4 A;  4FUU A;  3H8F A;  4MXU A;  3ICU A;  2OLS A;  4BTF A;  1DTD A;  2PJ7 A;  2Q4Y A;  3S6F A;  2ZW4 A;  3TO9 A;  4R7M A;  1Q5X A;  4MCR A;  5GCN A;  3TLG B;  2YJT A;  2GLF A;  1IOF A;  2ZEN A;  1QSN A;  3E0K A;  1LOK A;  1Y7R A;  1YQE A;  1C30 B;  2PSW A;  3NH5 A;  4M6H A;  1F2O A;  3BJ7 A;  5IB9 A;  8CPA A;  4R6T A;  4MCS A;  5F13 A;  2CY2 A;  4UEZ A;  2VEZ A;  5BWA B;  1TKJ A;  4PK3 A;  5AXI A;  4OC3 A;  4AVB A;  3GLJ A;  4YU9 A;  4KOY A;  1KWM A;  4NGT A;  2AE6 A;  1JDB C;  3TT2 A;  4QBJ A;  1TF9 A;  3BI0 A;  4CGM A;  1GYT A;  1MK4 A;  2A4N A;  3D7H A;  3B3W A;  1Z8W A;  4KOV A;  1AYE A;  2WPW A;  2CXA A;  3N5F A;  2Q7S A;  4IHM A;  3VTA A;  1ZG8 A;  3TLY A;  2XPN A;  3V7Z A;  4IIY A;  3BUO B;  3G8W A;  2DLA A;  1Y0R A;  5JGF A;  1BPN A;  2RC4 A;  1YGH A;  3OB1 B;  3G3S A;  3WR7 A;  1J3L A;  2VZZ A;  3TLZ A;  4NGQ A;  3B3T A;  4HKF A;  2WYR A;  1CP7 A;  1AUG A;  2POK A;  3FEC A;  3T5M A;  2O28 A;  1IY7 A;  1KC7 A;  4AG9 A;  1A2Z A;  4II9 A;  4UF4 A;  2ZEH A;  4KOT A;  1LRZ A;  1VIX A;  4IF5 A;  3OB2 B;  2EK9 A;  2DXQ A;  3S9L A;  3BHX A;  3SJE A;  1EO0 A;  2Z3L A;  4B11 A;  4H2K A;  5I0C A;  4NGP A;  4C85 A;  4L89 A;  4MFZ A;  3QNV A;  1XFO A;  2CNT A;  4NGM A;  3KHX A;  1YME A;  5F5X A;  4C9U A;  2PJ3 A;  2F7V A;  5ISV A;  4W9Y A;  4ORF A;  4KOU A;  3T90 A;  5IX3 A;  4DUK A;  2ODF A;  1YVH A;  3R96 A;  2FIA A;  4NFR A;  1S7F A;  4EME A;  2Z3O A;  3OWC A;  1P4N A;  2GRE A;  4PXC A;  4HNY B;  4XNH C;  3IEH A;  2EZB A;  3GUX A;  4HNW B;  1NXJ A;  3TYX A;  5JQ4 A;  2DEA A;  3PGP A;  1UFH A;  2I79 A;  1QSM A;  5F48 A;  3B7I A;  4R3L A;  4B5P B;  3MN8 A;  2VBQ A;  2ZEE A;  1LAP A;  5D29 A;  1M4L A;  4ZBG A;  3V38 A;  4DYO A;  3PB4 X;  4KOR A;  4C99 A;  3D2P A;  3IWE A;  4C8U A;  1C3O B;  2YNC A;  4KZT A;  1XBU A;  3VH9 A;  2AUN A;  5FVJ A;  4CZ1 A;  2D4O A;  4BIN A;  5IB0 A;  1ZRS A;  4NGN A;  4GM5 A;  4MRI A;  1XRY A;  2D0O A;  1LFW A;  2OZG A;  3S9M A;  1XIX A;  1ZO0 A;  4KOW A;  5G21 A;  3SI0 A;  4BBH A;  2B58 A;  3K4I A;  4A4C A;  1IIC A;  3FEE A;  4OC4 A;  1LCP A;  5I4M A;  4M8D A;  1UWY A;  4ZY1 A;  4C9A A;  3C8O A;  5DWN A;  3VRO A;  1ZLH A;  2PJ2 A;  1Z5R A;  4X5K A; 
#chains in the Genus database with same CATH homology
 3SI2 A;  5D8N A;  2J9A A;  3FJU A;  3KQX A;  1Y7E A;  2NYQ A;  3PBB A;  4CDJ A;  3D4U A;  2GLJ A;  1YW4 A;  5K8P A;  5CBM A;  1PYT B;  2ZED A;  3B35 A;  3GB0 A;  1HDQ A;  2AFM A;  1PCA A;  4P6Y A;  4B6Z A;  4EFD A;  4F8Z A;  5LYF A;  2IMO A;  2ZOG A;  5F09 A;  4IAV A;  2CTB A;  2CIJ A;  1VGY A;  1IGB A;  1Y9Z A;  4UIB A;  2AFX A;  1CG2 A;  4NGR A;  5HVG A;  4A39 A;  3PB9 X;  4OIW A;  4BD9 A;  2AFS A;  1ELL P;  2PJB A;  6CPA A;  1R3N A;  4P4I A;  2ZEG A;  4Z65 A;  2PJC A;  2ZEM A;  2FVG A;  2V77 A;  4WJB A;  3WT4 A;  4CPA A;  3NA6 A;  3SJF A;  1RTQ A;  3RZA A;  2C5Q A;  1CPS A;  1TXR A;  4PXE A;  2BO9 A;  5LYI A;  1ZG9 A;  3I6S A;  3B3S A;  4P44 A;  1BPM A;  4ZY0 A;  4UEE A;  1TKF A;  1XJO A;  2V8G A;  5CPA A;  2Q51 A;  1Q7L A;  4K3N A;  5HVF A;  1VHO A;  1FT7 A;  3I74 A;  3D66 A;  3LMS A;  1WVM A;  1ZG7 A;  1VHE A;  2ZOF A;  3IO1 A;  3WC6 A;  3KQZ A;  2AFU A;  3NH4 A;  1BAV A;  4MCQ A;  4R76 A;  3TX8 A;  4EWT A;  4ZYQ A;  4PXD A;  4TJV A;  4ZY2 A;  4FBE A;  3RAM A;  3SI1 A;  2HC9 A;  3JRU A;  3I1U A;  4C9V A;  4G1P A;  3FH4 A;  4MHY A;  2PVW A;  4NGS A;  2JEW A;  4P4E A;  5K8M A;  3D7D A;  3ISZ A;  3KAS A;  3PB8 X;  1OBR A;  4TWE A;  3ISX A;  2XEJ A;  2C6P A;  1NSA A;  2RFH A;  2OR4 A;  2ZEO A;  4A37 A;  2O4H A;  2RB7 A;  3L2N A;  4OC1 A;  2O53 A;  1XMB A;  2AFW A;  4TNU A;  3K9T A;  5HXD A;  3FX6 A;  1V6C A;  4P4D A;  2BCO A;  2C6C A;  2JBJ A;  2PJ5 A;  2PJ6 A;  2GU2 A;  3EIF A;  3TC8 A;  7CPA A;  5HVH A;  3D7F A;  1Z2L A;  3PFE A;  3B3C A;  3KGQ A;  4OP4 A;  4FWU A;  4PQA A;  3VAT A;  2Q4Z A;  4C86 A;  1Y0Y A;  4C8T A;  2V8D A;  4C9R A;  2PJ0 A;  3IFE A;  3WC7 A;  1XF1 A;  4AXV A;  4LQG A;  3IIB A;  1DE4 C;  4P4B A;  5J1Q A;  3SJX A;  4RUH A;  1HEE A;  3BI1 A;  1YW6 A;  3KL9 A;  3K2K A;  4A38 A;  1ARL A;  2ZEF A;  4MHN A;  2QJ8 A;  4ZX9 A;  4ZX8 A;  2AFO A;  1TKH A;  2ANP A;  1HDU A;  4DJL A;  1ZLI A;  4YWY A;  4CDK A;  3RBU A;  4F9U A;  4OME A;  1YLO A;  3D67 A;  4PXB A;  4A94 A;  2XEF A;  3T8W A;  4R8F A;  3IC1 A;  5JH9 A;  1QMU A;  5LRJ A;  2BOA A;  2PJ4 A;  3MRU A;  2EK8 A;  2CF4 A;  3FMC A;  4FAI A;  3FVL A;  4ZI6 A;  3IWW A;  1AMP A;  3WC5 A;  3PRT A;  2XEG A;  3CDX A;  4WWV A;  2ZEL A;  3KHZ A;  3LWU A;  2PJA A;  4KSI A;  2PJ8 A;  4IK2 A;  1LAM A;  2PIY A;  3FF3 A;  4X8I A;  3KZW A;  4MHP A;  4KNG E;  4C84 A;  3HLP A;  2NSM A;  4C8P A;  1CP6 A;  3BXM A;  2ABZ A;  4MMO A;  2GP4 A;  2CTC A;  4MCP A;  1F2P A;  4X2T A;  3DGV A;  3D7G A;  5LYL A;  4C9E A;  4Q7A A;  4F9V A;  3SJG A;  3KI9 A;  4OC2 A;  4C8C A;  2IQ6 A;  2ZEP A;  4ONW A;  3CPX A;  4P45 A;  4P4J A;  3D68 A;  2VL1 A;  3WAB A;  3KR5 A;  3PB6 X;  5IR2 A;  5K8N A;  4OC5 A;  4PPZ A;  2OOT A;  4P10 A;  3FED A;  4OKO A;  1LAN A;  4C8F A;  2WZN A;  5ELY A;  3CPA A;  2PIZ A;  2C6G A;  5LRK A;  3PBE A;  5JM6 A;  2C1C A;  4JZ0 A;  4MHZ A;  3PFO A;  2V8H A;  1ELM P;  3B3V A;  2PCU A;  3H8G A;  2EWB A;  4OID A;  3HUV A;  5LYD A;  1H8L A;  1CX8 A;  2AFZ A;  1YSJ A;  2G9D A;  3PEI A;  1CPX A;  2HB6 A;  1R43 A;  4C8A A;  4X3R A;  1TF8 A;  2PJ1 A;  2V8V A;  5LRG A;  1QQ9 A;  4UIA A;  2JBK A;  3DLJ A;  1FNO A;  1Z8L A;  4NJQ A;  2I3C A;  2PRQ A;  4O23 A;  2F8H A;  3VAR A;  2QYV A;  2IJZ A;  1EE3 P;  2XEI A;  3S9N A;  4NJR A;  5THW A;  1CBX A;  2PVV A;  4TJX A;  1ARM A;  3NH8 A;  3CT9 A;  3B2Y A;  4P4F A;  3PB7 X;  5K8O A;  4OC0 A;  4UEF A;  2PJ9 A;  2QVP A;  4JYW A;  1F57 A;  1BLL E;  1JQG A;  2Q43 A;  3H8E A;  5DS0 A;  3NFZ A;  3IJ3 A;  2PE3 A;  3KR4 A;  4FUU A;  3H8F A;  4MXU A;  3ICU A;  1DTD A;  2PJ7 A;  4YN3 A;  4R7M A;  4MCR A;  2GLF A;  2ZEN A;  1LOK A;  3NH5 A;  1F2O A;  5IB9 A;  8CPA A;  4R6T A;  4MCS A;  4UEZ A;  1TKJ A;  4OC3 A;  3GLJ A;  4YU9 A;  1KWM A;  4NGT A;  1TF9 A;  3BI0 A;  1GYT A;  3B3W A;  3D7H A;  1AYE A;  3N5F A;  4IHM A;  3VTA A;  1ZG8 A;  3V7Z A;  5JGF A;  1Y0R A;  1BPN A;  4NGQ A;  3B3T A;  2WYR A;  1CP7 A;  2POK A;  3FEC A;  1IY7 A;  4UF4 A;  2ZEH A;  1VIX A;  2EK9 A;  3S9L A;  3BHX A;  3SJE A;  4H2K A;  4C85 A;  4NGP A;  3QNV A;  1XFO A;  3KHX A;  4NGM A;  4C9U A;  1YME A;  2PJ3 A;  2F7V A;  4W9Y A;  4DUK A;  4NFR A;  4EME A;  4PXC A;  2GRE A;  3IEH A;  3GUX A;  2DEA A;  3B7I A;  3MN8 A;  2ZEE A;  1LAP A;  5D29 A;  1M4L A;  3V38 A;  4DYO A;  3PB4 X;  4C99 A;  4C8U A;  3VH9 A;  1XBU A;  4NGN A;  4GM5 A;  4MRI A;  1XRY A;  1LFW A;  3S9M A;  3SI0 A;  3FEE A;  4OC4 A;  1LCP A;  5I4M A;  1UWY A;  4ZY1 A;  4C9A A;  1ZLH A;  2PJ2 A;  1Z5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...