5ELYA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a hydroxamate inhibitor jhu242
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
696
structure length
682
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Unprecedented Binding Mode of Hydroxamate-Based Inhibitors of Glutamate Carboxypeptidase II: Structural Characterization and Biological Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 252
structure length 682
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2015-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 5elyA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5elyA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5elyA02
3NA6A 4UIBA 4C8AA 4PPZA 2GLJA 2ZENA 2ZOFA 1IY7A 4NGNA 1YW6A 4NGQA 1JQGA 3PRTA 3PB8X 4R8FA 2AFMA 3DGVA 4P10A 2PJ1A 1ZG9A 3SJFA 2F8HA 5LRJA 4C9VA 3PEIA 3FX6A 3KHZA 4JYWA 2QVPA 1Z8LA 3B3VA 3CPXA 4O23A 3WC5A 2C6PA 2C6GA 3KL9A 4MMOA 2NYQA 2Q51A 4IAVA 5I4MA 1R43A 3IWWA 2QJ8A 5HVHA 3B3TA 1DTDA 2PIYA 3D67A 2I3CA 3H8EA 4Z65A 2JBJA 4NJQA 3FMCA 1VIXA 1BPNA 3QNVA 4C8FA 3T8WA 4ZYQA 4OC2A 3I74A 5K8NA 3BHXA 1Y7EA 2PJ9A 3NH4A 3IO1A 1LAMA 4RUHA 1ZLHA 3EIFA 5HXDA 3SI1A 3KQXA 4C9UA 2V8VA 2PVWA 2FVGA 4OC0A 4ZX9A 3BI1A 2ANPA 2GLFA 3HLPA 4A39A 4P4JA 4G1PA 3VH9A 3DLJA 3L2NA 1FT7A 4YN3A 3PBEA 3BXMA 1LOKA 3WABA 1NSAA 4ZY0A 4A94A 3PB7X 1BPMA 4EMEA 5THWA 5DS0A 2AFZA 1LCPA 1VHEA 3KGQA 4DYOA 1HDUA 2PIZA 2PJ3A 4NGRA 5LYLA 2BO9A 4NFRA 4CDJA 3KASA 3B3CA 4OKOA 4KNGE 2ZEHA 1IGBA 2C1CA 1TKFA 4ZY2A 1Q7LA 1CBXA 2V8DA 3S9LA 1CPSA 3GB0A 1XBUA 2BOAA 1ZG7A 3D68A 1YSJA 1EE3P 3IIBA 4AXVA 7CPAA 5LRGA 1BAVA 3WC7A 3ISZA 2DEAA 1TF8A 1XFOA 4TJXA 1HEEA 2PJBA 4P45A 3MN8A 2ZOGA 1LANA 5F09A 4W9YA 5LRKA 4C99A 2RB7A 4MHYA 4MCSA 4OP4A 3NH5A 3PFEA 2HC9A 3D4UA 4C86A 2F7VA 4H2KA 1QQ9A 3D7GA 1M4LA 2G9DA 1XF1A 4P4EA 1PCAA 1TKJA 3FVLA 4WJBA 4C8TA 2HB6A 2ZEMA 5LYIA 4P6YA 3NH8A 4CDKA 2IQ6A 1AMPA 4MRIA 2JEWA 2AFSA 4FUUA 4OC5A 3S9NA 2XEFA 1HDQA 4UEFA 4UIAA 3FECA 1CP6A 2ZEEA 4YU9A 3RAMA 2AFWA 4F8ZA 4A38A 3D7DA 4FAIA 1QMUA 3KI9A 3PB6X 4TJVA 2O4HA 3I6SA 3GLJA 2Q43A 4MHNA 4X8IA 2NSMA 4MHPA 2PJ6A 1DE4C 2EK9A 3LWUA 4MCQA 1TKHA 4MHZA 1YMEA 4P4BA 1CP7A 4OIWA 3PBBA 2PJAA 2WYRA 3KR4A 1YW4A 2OOTA 4UEZA 5JH9A 3JRUA 2PJ4A 4OMEA 3B35A 4ZX8A 4NJRA 2OR4A 1Y9ZA 1F2PA 2AFUA 3PB9X 1LAPA 4PXCA 4TNUA 3N5FA 4UEEA 4X2TA 3FJUA 1GYTA 1KWMA 3SI2A 2ZEDA 6CPAA 3B3SA 1Z2LA 1TF9A 2VL1A 2CF4A 3IFEA 4R76A 2IMOA 3MRUA 4FBEA 3KR5A 4IHMA 3VATA 2V8GA 3TC8A 5K8PA 1XMBA 2XEJA 2BCOA 1ZG8A 3SJGA 1Y0YA 3K9TA 1Z5RA 2O53A 4PXBA 3VTAA 1XRYA 4YWYA 3SJEA 2PE3A 4ZY1A 4ONWA 1TXRA 2V8HA 3BI0A 4NGSA 2XEGA 3FH4A 1BLLE 1ZLIA 1H8LA 5CBMA 4FWUA 2PVVA 5J1QA 4C9EA 2XEIA 3B7IA 4OC3A 2PJ0A 3ICUA 3I1UA 4C85A 1VHOA 1YLOA 2V77A 4C9AA 1ELLP 1FNOA 2JBKA 3H8FA 4P44A 5JGFA 8CPAA 5CPAA 2PJ7A 3KZWA 4K3NA 3HUVA 4DUKA 4GM5A 4OC1A 4IK2A 2WZNA 2ZELA 3PFOA 1PYTB 1WVMA 3IJ3A 3WC6A 4CPAA 2ZEFA 4C8PA 4A37A 4Q7AA 5D8NA 1ARLA 2CTCA 5IB9A 4DJLA 2IJZA 4NGTA 2PJCA 3PB4X 4R7MA 5LYDA 5HVFA 4BD9A 1R3NA 2CTBA 3IEHA 1XJOA 4PXEA 4JZ0A 5HVGA 4X3RA 4NGPA 1VGYA 4C8CA 2ABZA 4ZI6A 5D29A 2RFHA 1CG2A 2J9AA 2GREA 3ISXA 4EFDA 4F9UA 3KHXA 5ELYA 4MXUA 5K8MA 1RTQA 3NFZA 4OC4A 3SJXA 5K8OA 2QYVA 3FEEA 2ZEPA 2CIJA 3B3WA 3FF3A 3KQZA 4MCRA 2C6CA 5LYFA 1V6CA 3IC1A 4OIDA 4C84A 4R6TA 1OBRA 4NGMA 2GU2A 1UWYA 4PQAA 2EWBA 3GUXA 3CDXA 3CPAA 5JM6A 1CX8A 4EWTA 3V7ZA 3WT4A 4C9RA 3SI0A 4C8UA 1ELMP 2AFXA 4P4FA 3S9MA 2ZEGA 2PRQA 2PCUA 3B2YA 1ARMA 2AFOA 3H8GA 4P4IA 3CT9A 4UF4A 3VARA 4PXDA 2PJ8A 3TX8A 3D66A 1CPXA 1AYEA 1F2OA 1LFWA 4MCPA 3D7HA 4P4DA 2POKA 4F9VA 2PJ2A 3RBUA 2Q4ZA 3K2KA 4LQGA 2EK8A 4B6ZA 1F57A 4TWEA 2ZEOA 1Y0RA 3V38A 4WWVA 3RZAA 3LMSA 4KSIA 3FEDA 3D7FA 2PJ5A
chains in the Genus database with same CATH superfamily
1YR0A 3NA6A 3TO7A 4UIBA 5KTCA 2CNSA 2G0BA 2GFQA 4C8AA 4PPZA 2DPTA 2GLJA 2ZENA 2ZOFA 1IY7A 4BBHA 2D0OA 3FIXA 4NGNA 1YW6A 4CYQA 4NGQA 2R7HA 3VRRA 3TOAA 1JQGA 4MJXA 3PRTA 1PUAA 3PB8X 2HV2A 4KVME 4R8FA 2AFMA 1U6MA 3DGVA 4P10A 4C7IA 2HWGA 4M8DA 2PJ1A 1ZG9A 3SJFA 2F8HA 4A32A 1KUVA 5LRJA 4C9VA 1QSRA 1Z8WA 4Q38A 3PEIA 4H1HA 1MJBA 2Q4YA 1L0CA 2REEA 5DWMA 5ISVA 3FX6A 3KHZA 4JJXA 4COBA 4JYWA 2B4DB 2QVPA 4XPDB 1I12A 1Z8LA 2OH1A 3B3VA 2KCWA 2FL4A 3CPXA 4O23A 4CGMA 4BTFA 4ZGYB 3WC5A 2FM4A 2C6PA 4ORFA 4E8OA 1R57A 1FBVA 2C6GA 3KL9A 4MMOA 5AG6A 4MFJA 4BINA 4CAXA 2AUNA 4CO9A 2NYQA 2Q51A 2FSRA 5E96A 1M4GA 1IU8A 2Q04A 2R8VA 4IAVA 4B5PB 3R96A 5I4MA 3R9GA 1JDEA 2Q44A 2N3AB 2P6EA 5FVJA 1R43A 5FD8A 4CAWA 3IWWA 2YGWA 1R61A 2QJ8A 1CE8B 2X7BA 5HVHA 3LACA 3W6SA 2JDDA 4F6AA 3B3TA 1DTDA 1KZFA 1S3ZA 4BPUB 1XOVA 3TOBA 2I00A 2PIYA 2VZZA 3D67A 3GYAA 3TLAA 2I3CA 2ZW7A 2VZYA 3H8EA 4Z65A 2JBJA 1MK4A 3D3SA 3VGOA 3LODA 4NJQA 5EMIA 3FMCA 1X10A 2REFA 2X0SA 3D8PA 5HKZA 1VIXA 3TT2A 4U5YA 1BPNA 3I9SA 1VBHA 3QNVA 4I49A 1P4NA 4C8FA 3G3SA 3T8WA 2YNEA 4ZYQA 2ZPAA 4YGOA 3N7ZA 3T5MA 2D4OA 4OC2A 4RN7A 4CYOA 1YVHA 4MY0A 1S7KA 5BWAB 3I74A 1WVMA 3PP9A 5K8NA 3BHXA 1Y7EA 4HKFA 4UA3A 2PJ9A 3NH4A 4HNWB 4CS0B 3IO1A 1LAMA 4IUSA 4RUHA 1K4JA 1ZLHA 2K5TA 4OAEA 5HXDA 3SI1A 3EIFA 3KQXA 1Z4RA 4C9UA 4U9YA 2DLAA 1XMTA 4IIXA 3FXTA 2E28A 1Z4EA 2CNMA 2V8VA 5EBVA 4CAEA 4FD4A 2PVWA 1B6BA 1QSMA 1S7LA 2FVGA 4OC0A 2G3AA 2VBQA 4ZX9A 3BI1A 3EZEA 2EBJA 5F48A 2ANPA 2GLFA 3HLPA 4L8AA 4A39A 3PZJA 3IU2A 1JWQA 4P4JA 4G1PA 5JQ4A 3D2MA 3DLJA 3VH9A 3L2NA 4JXRA 1FT7A 1Y7RA 3NFQA 3PBEA 4YN3A 3BXMA 1LOKA 3WABA 3BUWB 2XPNA 1NSAA 2FIAA 4ZY0A 4A94A 3PB7X 3F0AA 1BPMA 3IWGA 1Z9UA 2EUIA 2Q0YA 4KOTA 2VEZA 4LX9A 5THWA 4EMEA 5F49A 1BXRB 3BUXB 2R82A 2Z0ZA 5F5XA 5DS0A 2AFZA 3TLGA 1LCPA 1VHEA 3KGQA 4MHDA 4DYOA 2C5QA 2IL4A 5HH1A 2FS5A 1X12A 1HDUA 4E2AA 2PIZA 2PJ3A 4NGRA 1WJTA 3DSBA 4JXQA 2B5GA 4A31A 5K99A 5LYLA 2BO9A 4NFRA 4CDJA 3KASA 1ZRSA 2P6FA 3B3CA 4OKOA 4KNGE 1VI4A 2ZEHA 1KUYA 1IGBA 2A4NA 1TKFA 3OP0A 2C1CA 1YK3A 2EVNA 2Z3NA 3VRQA 1Q7LA 3CXQA 4H6ZA 4PSXA 2ARHA 1BOBA 4UCPA 1CBXA 4PSWA 2V8DA 2FT0A 1C3OB 3F8KA 4BPXB 3S9LA 1CPSA 4DNCA 2Y1NA 3GB0A 2PC1A 1XBUA 4NCZA 1EO0A 2BOAA 3DDDA 4MFKA 1ZG7A 3G23A 3D68A 1CJWA 3VROA 1KUXA 1YSJA 4MFQA 5IX3A 3HMJG 1EE3P 3IIBA 4R9MA 4HNYB 4AXVA 7CPAA 3U1BA 1NE9A 4ZBGA 2Z10A 1A2ZA 1MJ9A 4KOUA 1WWZA 5LRGA 2RC4A 3QB8A 1B87A 1BAVA 1M44A 3ISZA 3WC7A 2JEVA 4A4BA 1IOFA 1TF8A 1XFOA 2DEAA 4QVTA 5G22A 5KTDA 4TJXA 1HEEA 2PJBA 1NBWA 3GY9A 4EYSA 3W6XA 3PLFB 4P45A 2YNCA 3MN8A 4PK2A 1GGOA 2ZOGA 4B5OA 1LANA 5F09A 2B4JC 4JLYA 3EXNA 4W9YA 4B5PA 5LRKA 1M6VB 4C99A 2RB7A 4MHYA 1YLEA 2QECA 4MCSA 4OP4A 3NH5A 3EO4A 3PFEA 2HC9A 3D4UA 2FCKA 2F7VA 4C86A 4H2KA 5G21A 4CZ1A 1QQ9A 3D7GA 1M4LA 2G9DA 1XF1A 4P4EA 1PCAA 1TKJA 3FVLA 3BJ7A 3G8WA 4WJBA 4C8TA 2HB6A 2ZEMA 2CNTA 5LYIA 3GJZA 4KOXA 4P6YA 1WK4A 3VRPA 3FRMA 3NH8A 4CDKA 5J3XA 1OZPA 2IQ6A 1AMPA 2JDCA 3NE8A 3FBUA 4NXYA 4LUAA 4C2XA 2PQ8A 2ZW4A 4MRIA 4UCMA 4KOSA 2JEWA 1S7FA 5F47A 4RS2A 3S6GA 3W91A 4A33A 2AFSA 4FUUA 4OC5A 3S9NA 5F46A 4R3LA 3H5ZA 3TFYA 2XEFA 1HDQA 4UEFA 2FXFA 4UIAA 4X5KA 2HQYA 4XNHC 3ZZIA 3FECA 1CP6A 2ZEEA 3DR8A 4YU9A 2AFWA 3RAMA 3VWEA 4F8ZA 1RXTA 4H89A 4HPSA 3TLYA 2BEIA 4A38A 1XIXA 3QAHA 3D7DA 2B4BA 3FYNA 2JLMA 4FAIA 1QMUA 4MI4A 2XPOA 3KI9A 4II9A 2PRBA 2FIWA 3PB6X 2OB0A 4TJVA 2Z3KA 4M3SA 4MFZA 2O4HA 2B3UA 5AG7A 3I6SA 3GLJA 2Q43A 4HNXB 3JVNA 4MHNA 5IR2A 5G1ZA 2B3VA 2NSMA 4MHPA 4X8IA 2EZCA 2PJ6A 1DE4C 2J8NA 2EK9A 3JTKA 3LWUA 5H84A 4MCQA 4CGPA 1TKHA 4MHZA 3RO0A 1YMEA 4P4BA 1CP7A 4OIWA 3PBBA 5JYBA 2PJAA 2WYRA 3KKWA 4KOWA 3UY5A 3KR4A 1J4JA 3TLZA 1YW4A 4ONUA 2OOTA 4UEZA 5JH9A 4R3KA 2Q7BA 4KS9A 3JRUA 2WPWA 4B14A 4KUAA 4UWJA 4OMEA 2PJ4A 2Y0MA 3B35A 3O8ZA 1BO4A 4A30A 4ZX8A 5A28A 1VKCA 4NJRA 4NF1A 2OR4A 1FY7A 3D2PA 4PK3A 4C2ZA 1EZAA 4EVYA 1Y9ZA 3CZXA 1F2PA 2B58A 2AFUA 1YREA 3PB9X 3PT1A 4UWIA 4BPWB 1LAPA 1C30B 2ODFA 1NXJA 4PXCA 3B8GA 2GANA 1IYLA 2O28A 4CGNA 4CRZB 4CRYB 5HKYA 1YGHA 4TNUA 3TO6A 5AXIA 3N5FA 2VI7A 4R57A 4UEEA 4X2TA 2UV8G 1Q2DA 2I79A 3FJUA 1GYTA 1KWMA 2VXKA 1Y9KA 3PGPA 2J8RA 3SI2A 2YJVA 1KBLA 1CM0A 2ZEDA 6CPAA 4CAVA 3B3SA 1Z2LA 2Q4VA 4Q36A 3IGRA 4A4CA 2HI6A 1M4IA 1TF9A 3SXNA 4QB9A 1P0HA 2VL1A 2CF4A 3IFEA 1ZYMA 4UCNA 2HUZA 4A95A 4R76A 3NOJA 5AG5A 2IMOA 4AVBA 3FNCA 3KRVA 3MRUA 1IOIA 4FBEA 4OADA 1M1DA 2GE3A 5J8FA 3KR5A 4M6IA 2QMLA 4IHMA 3VATA 2PR1A 2V8GA 4E94A 3TC8A 1YX0A 5K8PA 5G20A 1XMBA 3EZBA 2XEJA 2ATRA 2BCOA 1ZG8A 3SJGA 1Z8TA 3R9FA 3OB1B 4B12A 1Y0YA 3K9TA 1T36B 3VRNA 3TLEA 2J8MA 1Z5RA 2O53A 2PR8A 2DPSA 3OAKA 4MJ8A 4PXBA 3SHPA 5A27A 2D0PA 4XNHB 3VTAA 1XRYA 4YWYA 3SJEA 2PE3A 4CGLA 1S7NA 2GP4A 4ZY1A 4ONWA 1TXRA 4AVAA 2V8HA 3BI0A 4NGSA 4KVOE 2XEGA 4RR2B 1Q2YA 3E0KA 5CNPA 5C82A 1V0CA 3FH4A 1I21A 4KLVA 2Z3LA 4GPLB 1BLLE 1ZLIA 1PU9A 4YRHA 1H8LA 2OU2A 5CBMA 4FWUA 2ZXVA 4IIYA 4B13A 2PVVA 5J1QA 1QSOA 3T9YA 4C9EA 5IB0A 2XEIA 1XF8A 3B7IA 2XPPA 3ZNIA 2ZW5A 4NSQA 2YNDA 3GIUA 4OC3A 2PJ0A 2BL1A 3ICUA 2EO8A 1QSNA 1UFHA 4MFPA 4R87A 2B0AA 3T0TA 3I1UA 4C85A 1VHOA 1YLOA 3C26A 2ZW6A 4OLLA 3WR7A 5F13A 5AG4A 5KTAA 2V77A 1VBGA 4C9AA 1ELLP 3R1KA 1FNOA 3JUWA 1Y9WA 4AVCA 2JBKA 4Y49C 1M4DA 5I0CA 3BUNB 2MP0A 1ON0A 4P44A 3HPHE 3H8FA 5JGFA 4JVOA 8CPAA 2PDOA 5CPAA 3DR6A 2OZGA 4JWPA 5J8CA 2PJ7A 4QC6A 3TE4A 2AUMA 3KZWA 1IB1E 4K3NA 1IIDA 3HUVA 2OZHA 4IF5A 3ZJ0A 4DUKA 4INJA 1KEEB 4H6UA 4MI1A 4GM5A 5DWNA 4OC1A 2Z3OA 5IV0A 4YFJA 2C27A 1SQHA 4IK2A 1Q5XA 1ZO0A 2WZNA 2Y1MA 2BUEA 2ZELA 1RO5A 5C88A 4KSAA 2AE6A 4XPLA 3S6KA 3BUMB 4UBRA 5H86A 3HPGG 3FB3A 2FE7A 3CXPA 1PYTB 3EFAA 3PFOA 3IJ3A 5EC4A 3WC6A 4CPAA 1J3LA 4KOYA 3T90A 2QIRA 1XE4A 2ZEFA 3S6FA 1LRZA 4CGOA 2PCNA 4C8PA 4ZY2A 1N71A 3BJ8A 4A37A 2Z3MA 4Q7AA 5D8NA 4GS4A 1ARLA 2CTCA 3EC4A 3EY5A 4K30A 4MBUA 4AG9A 4CYNA 4DJLA 5IB9A 2IJZA 3SR3A 4NGTA 1YQEA 2PJCA 2WUUA 3PB4X 4GXHA 4R7MA 5HVFA 5LYDA 4B11A 2DXQA 1R3NA 4AG7A 2DF5A 3R95A 2CTBA 3DNSA 3IEHA 4MY3A 4QUSA 3TO9A 4F0YA 1XJOA 3PFVA 1VHSA 1A9XB 1GHEA 3BLNA 4BMHA 2HROA 4PXEA 4JZ0A 2CBLA 4M6GA 5HVGA 2YJTA 4X3RA 2G3TA 4NGPA 3RNZA 3T05A 3RYOA 1VGYA 3NE7A 2GIVA 3K4IA 4C8CA 2ABZA 4ZI6A 2CY2A 5D29A 2RFHA 1CG2A 4PV6A 2XPLA 1JDBC 2J9AA 2GREA 2Q7SA 1MJAA 1Z9EA 3ISXA 4EFDA 4F9UA 3KHXA 5HMNA 5ELYA 3U88C 1IYKA 3CXSA 3H4QA 4MXUA 2Z11A 1RTQA 4XPKA 5K8MA 3NFZA 4OC4A 4MFLA 3SJXA 4KSFA 4C2YA 4M6HA 4U9ZA 4A2ZA 4UFXA 4CYPA 2QYVA 5K8OA 3FEEA 2DIKA 2ZEPA 2CIJA 1ZL0A 5F1YA 3B3WA 2Z3PA 3LD2A 3FF3A 4BD9A 2EZAA 3GKRA 3MGDA 5JVLA 3T07A 3KQZA 4NEXA 2F5IA 3A9LA 3R9EA 4XPDC 1TIQA 5AGEA 4MCRA 3IWEA 1CS0B 2C6CA 5LYFA 2P0WA 1V6CA 3IC1A 4CAFA 3P2HA 4L89A 4OIDA 2D4PA 4C84A 4R6TA 2PSWA 2OLSA 3TYXA 1OBRA 4NGMA 1S5KA 4UFVA 1Z8XA 1UWYA 2GU2A 2YNCC 4KORA 3SXOA 1DIKA 1NMTA 4PQAA 2EWBA 3TCVA 4B10A 2CXAA 3GUXA 4FD6A 2WPXA 3CDXA 3CPAA 4M85A 3EZAA 1KC7A 5BY0A 5JM6A 3P2FA 5HKWA 2R1IA 1Q2CA 4F0XA 1CX8A 1YVOA 3TTHA 3V7ZA 4EWTA 4COGA 1AUGA 1B47A 3WT4A 4C9RA 4Y49B 3SI0A 4KOVA 4C68A 5F9MA 4C8UA 3C8OA 2AJ6A 1ELMP 2AFXA 1NSLA 4FD7A 4P4FA 3S9MA 2ZEGA 4KVXA 4E5SA 2PRQA 3K9UA 3OWCA 2PCUA 3B2YA 3S6HA 4RI1A 1ARMA 2AFOA 3H8GA 4QBJA 3V8IA 3TLCA 1EZBA 4P4IA 3CT9A 4JD6A 4AB7A 1YVKA 4UF4A 2NMTA 4PXDA 1I1DA 5GCNA 2PJ5A 3VARA 5JPHA 1QSTA 4FD5A 4J3GA 4UFWA 4LQ6A 2PJ8A 3TX8A 2BSWA 3D66A 1CPXA 3I3GA 4J0NA 2EZBA 1AYEA 1IICA 1F2OA 2R98A 2OZUA 3F5BA 1LFWA 2P6GA 3IU1A 4MCPA 3OB2B 3D7HA 4KUBA 2WSAA 3TLBA 4P4DA 2POKA 2VKZG 4C7HA 4F9VA 1S60A 3RBUA 2PJ2A 2Q4ZA 4E0AA 3TLGB 3K2KA 3BUOB 4KZTA 4LQGA 2EK8A 4B6ZA 1F57A 4TWEA 2ZEOA 1Y0RA 3V38A 4WWVA 1XEBA 3QAYA 2B5GB 3VWDA 3RZAA 3F9KC 2VQYA 2B4DA 3LMSA 4KSIA 3FEDA 4KLWA 3D7FA 2H5MA
chains in the Genus database with same CATH topology
3NA6A 4UIBA 4C8AA 4PPZA 2GLJA 2ZENA 2ZOFA 1IY7A 4NGNA 1YW6A 4NGQA 1JQGA 3PRTA 3PB8X 4R8FA 2AFMA 3DGVA 4P10A 2PJ1A 1ZG9A 3SJFA 2F8HA 5LRJA 4C9VA 3PEIA 3FX6A 3KHZA 4JYWA 2QVPA 1Z8LA 3B3VA 3CPXA 4O23A 3WC5A 2C6PA 2C6GA 3KL9A 4MMOA 2NYQA 2Q51A 4IAVA 5I4MA 1R43A 3IWWA 2QJ8A 5HVHA 3B3TA 1DTDA 2PIYA 3D67A 2I3CA 3H8EA 4Z65A 2JBJA 4NJQA 3FMCA 1VIXA 1BPNA 3QNVA 4C8FA 3T8WA 4ZYQA 4OC2A 3I74A 5K8NA 3BHXA 1Y7EA 2PJ9A 3NH4A 3IO1A 1LAMA 4RUHA 1ZLHA 3EIFA 5HXDA 3SI1A 3KQXA 4C9UA 2V8VA 2PVWA 2FVGA 4OC0A 4ZX9A 3BI1A 2ANPA 2GLFA 3HLPA 4A39A 4P4JA 4G1PA 3VH9A 3DLJA 3L2NA 1FT7A 4YN3A 3PBEA 3BXMA 1LOKA 3WABA 1NSAA 4ZY0A 4A94A 3PB7X 1BPMA 4EMEA 5THWA 5DS0A 2AFZA 1LCPA 1VHEA 3KGQA 4DYOA 2C5QA 1HDUA 2PIZA 2PJ3A 4NGRA 5LYLA 2BO9A 4NFRA 4CDJA 3KASA 3B3CA 4OKOA 4KNGE 2ZEHA 1IGBA 2C1CA 1TKFA 4ZY2A 1Q7LA 1CBXA 2V8DA 3S9LA 1CPSA 3GB0A 1XBUA 2BOAA 1ZG7A 3D68A 1YSJA 1EE3P 3IIBA 4AXVA 7CPAA 5LRGA 1BAVA 3WC7A 3ISZA 2DEAA 1TF8A 1XFOA 4TJXA 1HEEA 2PJBA 4P45A 3MN8A 2ZOGA 1LANA 5F09A 4W9YA 5LRKA 4C99A 2RB7A 4MHYA 4MCSA 4OP4A 3NH5A 3PFEA 2HC9A 3D4UA 4C86A 2F7VA 4H2KA 1QQ9A 3D7GA 1M4LA 2G9DA 1XF1A 4P4EA 1PCAA 1TKJA 3FVLA 4WJBA 4C8TA 2HB6A 2ZEMA 5LYIA 4P6YA 3NH8A 4CDKA 2IQ6A 1AMPA 4MRIA 2JEWA 2AFSA 4FUUA 4OC5A 3S9NA 2XEFA 1HDQA 4UEFA 4UIAA 3FECA 1CP6A 2ZEEA 4YU9A 3RAMA 2AFWA 4F8ZA 4A38A 3D7DA 4FAIA 1QMUA 3KI9A 3PB6X 4TJVA 2O4HA 3I6SA 3GLJA 2Q43A 4MHNA 5IR2A 4X8IA 2NSMA 4MHPA 2PJ6A 1DE4C 2EK9A 3LWUA 4MCQA 1TKHA 4MHZA 1YMEA 4P4BA 1CP7A 4OIWA 3PBBA 2PJAA 2WYRA 3KR4A 1YW4A 2OOTA 4UEZA 5JH9A 3JRUA 2PJ4A 4OMEA 3B35A 4ZX8A 4NJRA 2OR4A 1Y9ZA 1F2PA 2AFUA 3PB9X 1LAPA 4PXCA 4TNUA 3N5FA 4UEEA 4X2TA 3FJUA 1GYTA 1KWMA 3SI2A 2ZEDA 6CPAA 3B3SA 1Z2LA 1TF9A 2VL1A 2CF4A 3IFEA 4R76A 2IMOA 3MRUA 4FBEA 3KR5A 4IHMA 3VATA 2V8GA 3TC8A 5K8PA 1XMBA 2XEJA 2BCOA 1ZG8A 3SJGA 1Y0YA 3K9TA 1Z5RA 2O53A 4PXBA 3VTAA 1XRYA 4YWYA 3SJEA 2PE3A 2GP4A 4ZY1A 4ONWA 1TXRA 2V8HA 3BI0A 4NGSA 2XEGA 3FH4A 1BLLE 1ZLIA 1H8LA 5CBMA 4FWUA 2PVVA 5J1QA 4C9EA 2XEIA 3B7IA 4OC3A 2PJ0A 3ICUA 3I1UA 4C85A 1VHOA 1YLOA 2V77A 4C9AA 1ELLP 1FNOA 2JBKA 3H8FA 4P44A 5JGFA 8CPAA 5CPAA 2PJ7A 3KZWA 4K3NA 3HUVA 4DUKA 4GM5A 4OC1A 4IK2A 2WZNA 2ZELA 3PFOA 1PYTB 1WVMA 3IJ3A 3WC6A 4CPAA 2ZEFA 4C8PA 4A37A 4Q7AA 5D8NA 1ARLA 2CTCA 5IB9A 4DJLA 2IJZA 4NGTA 2PJCA 3PB4X 4R7MA 5LYDA 5HVFA 4BD9A 1R3NA 2CTBA 3IEHA 1XJOA 4PXEA 4JZ0A 5HVGA 4X3RA 4NGPA 1VGYA 4C8CA 2ABZA 4ZI6A 5D29A 2RFHA 1CG2A 2J9AA 2GREA 3ISXA 4EFDA 4F9UA 3KHXA 5ELYA 4MXUA 5K8MA 1RTQA 3NFZA 4OC4A 3SJXA 5K8OA 2QYVA 3FEEA 2ZEPA 2CIJA 3B3WA 3FF3A 3KQZA 4MCRA 2C6CA 5LYFA 1V6CA 3IC1A 4OIDA 4C84A 4R6TA 1OBRA 4NGMA 2GU2A 1UWYA 4PQAA 2EWBA 3GUXA 3CDXA 3CPAA 5JM6A 1CX8A 4EWTA 3V7ZA 3WT4A 4C9RA 3SI0A 4C8UA 1ELMP 2AFXA 4P4FA 3S9MA 2ZEGA 2PRQA 2PCUA 3B2YA 1ARMA 2AFOA 3H8GA 4P4IA 3CT9A 4UF4A 3VARA 4PXDA 2PJ8A 3TX8A 3D66A 1CPXA 1AYEA 1F2OA 1LFWA 4MCPA 3D7HA 4P4DA 2POKA 4F9VA 2PJ2A 3RBUA 2Q4ZA 3K2KA 4LQGA 2EK8A 4B6ZA 1F57A 4TWEA 2ZEOA 1Y0RA 3V38A 4WWVA 3RZAA 3LMSA 4KSIA 3FEDA 3D7FA 2PJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NA6 A;  4UIB A;  4C8A A;  4PPZ A;  2GLJ A;  2ZEN A;  2ZOF A;  1IY7 A;  4NGN A;  1YW6 A;  4NGQ A;  1JQG A;  3PRT A;  3PB8 X;  4R8F A;  2AFM A;  3DGV A;  4P10 A;  2PJ1 A;  1ZG9 A;  3SJF A;  2F8H A;  5LRJ A;  4C9V A;  3PEI A;  3FX6 A;  3KHZ A;  4JYW A;  2QVP A;  1Z8L A;  3B3V A;  3CPX A;  4O23 A;  3WC5 A;  2C6P A;  2C6G A;  3KL9 A;  4MMO A;  2NYQ A;  2Q51 A;  4IAV A;  5I4M A;  1R43 A;  3IWW A;  2QJ8 A;  5HVH A;  3B3T A;  1DTD A;  2PIY A;  3D67 A;  2I3C A;  3H8E A;  4Z65 A;  2JBJ A;  4NJQ A;  3FMC A;  1VIX A;  1BPN A;  3QNV A;  4C8F A;  3T8W A;  4ZYQ A;  4OC2 A;  3I74 A;  5K8N A;  3BHX A;  1Y7E A;  2PJ9 A;  3NH4 A;  3IO1 A;  1LAM A;  4RUH A;  1ZLH A;  3EIF A;  5HXD A;  3SI1 A;  3KQX A;  4C9U A;  2V8V A;  2PVW A;  2FVG A;  4OC0 A;  4ZX9 A;  3BI1 A;  2ANP A;  2GLF A;  3HLP A;  4A39 A;  4P4J A;  4G1P A;  3VH9 A;  3DLJ A;  3L2N A;  1FT7 A;  4YN3 A;  3PBE A;  3BXM A;  1LOK A;  3WAB A;  1NSA A;  4ZY0 A;  4A94 A;  3PB7 X;  1BPM A;  4EME A;  5THW A;  5DS0 A;  2AFZ A;  1LCP A;  1VHE A;  3KGQ A;  4DYO A;  1HDU A;  2PIZ A;  2PJ3 A;  4NGR A;  5LYL A;  2BO9 A;  4NFR A;  4CDJ A;  3KAS A;  3B3C A;  4OKO A;  4KNG E;  2ZEH A;  1IGB A;  2C1C A;  1TKF A;  4ZY2 A;  1Q7L A;  1CBX A;  2V8D A;  3S9L A;  1CPS A;  3GB0 A;  1XBU A;  2BOA A;  1ZG7 A;  3D68 A;  1YSJ A;  1EE3 P;  3IIB A;  4AXV A;  7CPA A;  5LRG A;  1BAV A;  3WC7 A;  3ISZ A;  2DEA A;  1TF8 A;  1XFO A;  4TJX A;  1HEE A;  2PJB A;  4P45 A;  3MN8 A;  2ZOG A;  1LAN A;  5F09 A;  4W9Y A;  5LRK A;  4C99 A;  2RB7 A;  4MHY A;  4MCS A;  4OP4 A;  3NH5 A;  3PFE A;  2HC9 A;  3D4U A;  4C86 A;  2F7V A;  4H2K A;  1QQ9 A;  3D7G A;  1M4L A;  2G9D A;  1XF1 A;  4P4E A;  1PCA A;  1TKJ A;  3FVL A;  4WJB A;  4C8T A;  2HB6 A;  2ZEM A;  5LYI A;  4P6Y A;  3NH8 A;  4CDK A;  2IQ6 A;  1AMP A;  4MRI A;  2JEW A;  2AFS A;  4FUU A;  4OC5 A;  3S9N A;  2XEF A;  1HDQ A;  4UEF A;  4UIA A;  3FEC A;  1CP6 A;  2ZEE A;  4YU9 A;  3RAM A;  2AFW A;  4F8Z A;  4A38 A;  3D7D A;  4FAI A;  1QMU A;  3KI9 A;  3PB6 X;  4TJV A;  2O4H A;  3I6S A;  3GLJ A;  2Q43 A;  4MHN A;  4X8I A;  2NSM A;  4MHP A;  2PJ6 A;  1DE4 C;  2EK9 A;  3LWU A;  4MCQ A;  1TKH A;  4MHZ A;  1YME A;  4P4B A;  1CP7 A;  4OIW A;  3PBB A;  2PJA A;  2WYR A;  3KR4 A;  1YW4 A;  2OOT A;  4UEZ A;  5JH9 A;  3JRU A;  2PJ4 A;  4OME A;  3B35 A;  4ZX8 A;  4NJR A;  2OR4 A;  1Y9Z A;  1F2P A;  2AFU A;  3PB9 X;  1LAP A;  4PXC A;  4TNU A;  3N5F A;  4UEE A;  4X2T A;  3FJU A;  1GYT A;  1KWM A;  3SI2 A;  2ZED A;  6CPA A;  3B3S A;  1Z2L A;  1TF9 A;  2VL1 A;  2CF4 A;  3IFE A;  4R76 A;  2IMO A;  3MRU A;  4FBE A;  3KR5 A;  4IHM A;  3VAT A;  2V8G A;  3TC8 A;  5K8P A;  1XMB A;  2XEJ A;  2BCO A;  1ZG8 A;  3SJG A;  1Y0Y A;  3K9T A;  1Z5R A;  2O53 A;  4PXB A;  3VTA A;  1XRY A;  4YWY A;  3SJE A;  2PE3 A;  4ZY1 A;  4ONW A;  1TXR A;  2V8H A;  3BI0 A;  4NGS A;  2XEG A;  3FH4 A;  1BLL E;  1ZLI A;  1H8L A;  5CBM A;  4FWU A;  2PVV A;  5J1Q A;  4C9E A;  2XEI A;  3B7I A;  4OC3 A;  2PJ0 A;  3ICU A;  3I1U A;  4C85 A;  1VHO A;  1YLO A;  2V77 A;  4C9A A;  1ELL P;  1FNO A;  2JBK A;  3H8F A;  4P44 A;  5JGF A;  8CPA A;  5CPA A;  2PJ7 A;  3KZW A;  4K3N A;  3HUV A;  4DUK A;  4GM5 A;  4OC1 A;  4IK2 A;  2WZN A;  2ZEL A;  3PFO A;  1PYT B;  1WVM A;  3IJ3 A;  3WC6 A;  4CPA A;  2ZEF A;  4C8P A;  4A37 A;  4Q7A A;  5D8N A;  1ARL A;  2CTC A;  5IB9 A;  4DJL A;  2IJZ A;  4NGT A;  2PJC A;  3PB4 X;  4R7M A;  5LYD A;  5HVF A;  4BD9 A;  1R3N A;  2CTB A;  3IEH A;  1XJO A;  4PXE A;  4JZ0 A;  5HVG A;  4X3R A;  4NGP A;  1VGY A;  4C8C A;  2ABZ A;  4ZI6 A;  5D29 A;  2RFH A;  1CG2 A;  2J9A A;  2GRE A;  3ISX A;  4EFD A;  4F9U A;  3KHX A;  5ELY A;  4MXU A;  5K8M A;  1RTQ A;  3NFZ A;  4OC4 A;  3SJX A;  5K8O A;  2QYV A;  3FEE A;  2ZEP A;  2CIJ A;  3B3W A;  3FF3 A;  3KQZ A;  4MCR A;  2C6C A;  5LYF A;  1V6C A;  3IC1 A;  4OID A;  4C84 A;  4R6T A;  1OBR A;  4NGM A;  2GU2 A;  1UWY A;  4PQA A;  2EWB A;  3GUX A;  3CDX A;  3CPA A;  5JM6 A;  1CX8 A;  4EWT A;  3V7Z A;  3WT4 A;  4C9R A;  3SI0 A;  4C8U A;  1ELM P;  2AFX A;  4P4F A;  3S9M A;  2ZEG A;  2PRQ A;  2PCU A;  3B2Y A;  1ARM A;  2AFO A;  3H8G A;  4P4I A;  3CT9 A;  4UF4 A;  3VAR A;  4PXD A;  2PJ8 A;  3TX8 A;  3D66 A;  1CPX A;  1AYE A;  1F2O A;  1LFW A;  4MCP A;  3D7H A;  4P4D A;  2POK A;  4F9V A;  2PJ2 A;  3RBU A;  2Q4Z A;  3K2K A;  4LQG A;  2EK8 A;  4B6Z A;  1F57 A;  4TWE A;  2ZEO A;  1Y0R A;  3V38 A;  4WWV A;  3RZA A;  3LMS A;  4KSI A;  3FED A;  3D7F A;  2PJ5 A; 
#chains in the Genus database with same CATH topology
 1YR0 A;  3NA6 A;  3TO7 A;  4UIB A;  5KTC A;  2CNS A;  2G0B A;  2GFQ A;  4C8A A;  4PPZ A;  2DPT A;  2GLJ A;  2ZEN A;  2ZOF A;  1IY7 A;  4BBH A;  2D0O A;  3FIX A;  4NGN A;  1YW6 A;  4CYQ A;  4NGQ A;  2R7H A;  3VRR A;  3TOA A;  1JQG A;  4MJX A;  3PRT A;  1PUA A;  3PB8 X;  2HV2 A;  4KVM E;  4R8F A;  2AFM A;  1U6M A;  3DGV A;  4P10 A;  4C7I A;  2HWG A;  4M8D A;  2PJ1 A;  1ZG9 A;  3SJF A;  2F8H A;  4A32 A;  1KUV A;  5LRJ A;  4C9V A;  1QSR A;  1Z8W A;  4Q38 A;  3PEI A;  4H1H A;  1MJB A;  2Q4Y A;  1L0C A;  2REE A;  5DWM A;  5ISV A;  3FX6 A;  3KHZ A;  4JJX A;  4COB A;  4JYW A;  2B4D B;  2QVP A;  4XPD B;  1I12 A;  1Z8L A;  2OH1 A;  3B3V A;  2KCW A;  2FL4 A;  3CPX A;  4O23 A;  4CGM A;  4BTF A;  4ZGY B;  3WC5 A;  2FM4 A;  2C6P A;  4ORF A;  4E8O A;  1R57 A;  1FBV A;  2C6G A;  3KL9 A;  4MMO A;  5AG6 A;  4MFJ A;  4BIN A;  4CAX A;  2AUN A;  4CO9 A;  2NYQ A;  2Q51 A;  2FSR A;  5E96 A;  1M4G A;  1IU8 A;  2Q04 A;  2R8V A;  4IAV A;  4B5P B;  3R96 A;  5I4M A;  3R9G A;  1JDE A;  2Q44 A;  2N3A B;  2P6E A;  5FVJ A;  1R43 A;  5FD8 A;  4CAW A;  3IWW A;  2YGW A;  1R61 A;  2QJ8 A;  1CE8 B;  2X7B A;  5HVH A;  3LAC A;  3W6S A;  2JDD A;  4F6A A;  3B3T A;  1DTD A;  1KZF A;  1S3Z A;  4BPU B;  1XOV A;  3TOB A;  2I00 A;  2PIY A;  2VZZ A;  3D67 A;  3GYA A;  3TLA A;  2I3C A;  2ZW7 A;  2VZY A;  3H8E A;  4Z65 A;  2JBJ A;  1MK4 A;  3D3S A;  3VGO A;  3LOD A;  4NJQ A;  5EMI A;  3FMC A;  1X10 A;  2REF A;  2X0S A;  3D8P A;  5HKZ A;  1VIX A;  3TT2 A;  4U5Y A;  1BPN A;  3I9S A;  1VBH A;  3QNV A;  4I49 A;  1P4N A;  4C8F A;  3G3S A;  3T8W A;  2YNE A;  4ZYQ A;  2ZPA A;  4YGO A;  3N7Z A;  3T5M A;  2D4O A;  4OC2 A;  4RN7 A;  4CYO A;  1YVH A;  4MY0 A;  1S7K A;  5BWA B;  3I74 A;  1WVM A;  3PP9 A;  5K8N A;  3BHX A;  1Y7E A;  4HKF A;  4UA3 A;  2PJ9 A;  3NH4 A;  4HNW B;  4CS0 B;  3IO1 A;  1LAM A;  4IUS A;  4RUH A;  1K4J A;  1ZLH A;  2K5T A;  4OAE A;  5HXD A;  3SI1 A;  3EIF A;  3KQX A;  1Z4R A;  4C9U A;  4U9Y A;  2DLA A;  1XMT A;  4IIX A;  3FXT A;  2E28 A;  1Z4E A;  2CNM A;  2V8V A;  5EBV A;  4CAE A;  4FD4 A;  2PVW A;  1B6B A;  1QSM A;  1S7L A;  2FVG A;  4OC0 A;  2G3A A;  2VBQ A;  4ZX9 A;  3BI1 A;  3EZE A;  2EBJ A;  5F48 A;  2ANP A;  2GLF A;  3HLP A;  4L8A A;  4A39 A;  3PZJ A;  3IU2 A;  1JWQ A;  4P4J A;  4G1P A;  5JQ4 A;  3D2M A;  3DLJ A;  3VH9 A;  3L2N A;  4JXR A;  1FT7 A;  1Y7R A;  3NFQ A;  3PBE A;  4YN3 A;  3BXM A;  1LOK A;  3WAB A;  3BUW B;  2XPN A;  1NSA A;  2FIA A;  4ZY0 A;  4A94 A;  3PB7 X;  3F0A A;  1BPM A;  3IWG A;  1Z9U A;  2EUI A;  2Q0Y A;  4KOT A;  2VEZ A;  4LX9 A;  5THW A;  4EME A;  5F49 A;  1BXR B;  3BUX B;  2R82 A;  2Z0Z A;  5F5X A;  5DS0 A;  2AFZ A;  3TLG A;  1LCP A;  1VHE A;  3KGQ A;  4MHD A;  4DYO A;  2C5Q A;  2IL4 A;  5HH1 A;  2FS5 A;  1X12 A;  1HDU A;  4E2A A;  2PIZ A;  2PJ3 A;  4NGR A;  1WJT A;  3DSB A;  4JXQ A;  2B5G A;  4A31 A;  5K99 A;  5LYL A;  2BO9 A;  4NFR A;  4CDJ A;  3KAS A;  1ZRS A;  2P6F A;  3B3C A;  4OKO A;  4KNG E;  1VI4 A;  2ZEH A;  1KUY A;  1IGB A;  2A4N A;  1TKF A;  3OP0 A;  2C1C A;  1YK3 A;  2EVN A;  2Z3N A;  3VRQ A;  1Q7L A;  3CXQ A;  4H6Z A;  4PSX A;  2ARH A;  1BOB A;  4UCP A;  1CBX A;  4PSW A;  2V8D A;  2FT0 A;  1C3O B;  3F8K A;  4BPX B;  3S9L A;  1CPS A;  4DNC A;  2Y1N A;  3GB0 A;  2PC1 A;  1XBU A;  4NCZ A;  1EO0 A;  2BOA A;  3DDD A;  4MFK A;  1ZG7 A;  3G23 A;  3D68 A;  1CJW A;  3VRO A;  1KUX A;  1YSJ A;  4MFQ A;  5IX3 A;  3HMJ G;  1EE3 P;  3IIB A;  4R9M A;  4HNY B;  4AXV A;  7CPA A;  3U1B A;  1NE9 A;  4ZBG A;  2Z10 A;  1A2Z A;  1MJ9 A;  4KOU A;  1WWZ A;  5LRG A;  2RC4 A;  3QB8 A;  1B87 A;  1BAV A;  1M44 A;  3ISZ A;  3WC7 A;  2JEV A;  4A4B A;  1IOF A;  1TF8 A;  1XFO A;  2DEA A;  4QVT A;  5G22 A;  5KTD A;  4TJX A;  1HEE A;  2PJB A;  1NBW A;  3GY9 A;  4EYS A;  3W6X A;  3PLF B;  4P45 A;  2YNC A;  3MN8 A;  4PK2 A;  1GGO A;  2ZOG A;  4B5O A;  1LAN A;  5F09 A;  2B4J C;  4JLY A;  3EXN A;  4W9Y A;  4B5P A;  5LRK A;  1M6V B;  4C99 A;  2RB7 A;  4MHY A;  1YLE A;  2QEC A;  4MCS A;  4OP4 A;  3NH5 A;  3EO4 A;  3PFE A;  2HC9 A;  3D4U A;  2FCK A;  2F7V A;  4C86 A;  4H2K A;  5G21 A;  4CZ1 A;  1QQ9 A;  3D7G A;  1M4L A;  2G9D A;  1XF1 A;  4P4E A;  1PCA A;  1TKJ A;  3FVL A;  3BJ7 A;  3G8W A;  4WJB A;  4C8T A;  2HB6 A;  2ZEM A;  2CNT A;  5LYI A;  3GJZ A;  4KOX A;  4P6Y A;  1WK4 A;  3VRP A;  3FRM A;  3NH8 A;  4CDK A;  5J3X A;  1OZP A;  2IQ6 A;  1AMP A;  2JDC A;  3NE8 A;  3FBU A;  4NXY A;  4LUA A;  4C2X A;  2PQ8 A;  2ZW4 A;  4MRI A;  4UCM A;  4KOS A;  2JEW A;  1S7F A;  5F47 A;  4RS2 A;  3S6G A;  3W91 A;  4A33 A;  2AFS A;  4FUU A;  4OC5 A;  3S9N A;  5F46 A;  4R3L A;  3H5Z A;  3TFY A;  2XEF A;  1HDQ A;  4UEF A;  2FXF A;  4UIA A;  4X5K A;  2HQY A;  4XNH C;  3ZZI A;  3FEC A;  1CP6 A;  2ZEE A;  3DR8 A;  4YU9 A;  2AFW A;  3RAM A;  3VWE A;  4F8Z A;  1RXT A;  4H89 A;  4HPS A;  3TLY A;  2BEI A;  4A38 A;  1XIX A;  3QAH A;  3D7D A;  2B4B A;  3FYN A;  2JLM A;  4FAI A;  1QMU A;  4MI4 A;  2XPO A;  3KI9 A;  4II9 A;  2PRB A;  2FIW A;  3PB6 X;  2OB0 A;  4TJV A;  2Z3K A;  4M3S A;  4MFZ A;  2O4H A;  2B3U A;  5AG7 A;  3I6S A;  3GLJ A;  2Q43 A;  4HNX B;  3JVN A;  4MHN A;  5IR2 A;  5G1Z A;  2B3V A;  2NSM A;  4MHP A;  4X8I A;  2EZC A;  2PJ6 A;  1DE4 C;  2J8N A;  2EK9 A;  3JTK A;  3LWU A;  5H84 A;  4MCQ A;  4CGP A;  1TKH A;  4MHZ A;  3RO0 A;  1YME A;  4P4B A;  1CP7 A;  4OIW A;  3PBB A;  5JYB A;  2PJA A;  2WYR A;  3KKW A;  4KOW A;  3UY5 A;  3KR4 A;  1J4J A;  3TLZ A;  1YW4 A;  4ONU A;  2OOT A;  4UEZ A;  5JH9 A;  4R3K A;  2Q7B A;  4KS9 A;  3JRU A;  2WPW A;  4B14 A;  4KUA A;  4UWJ A;  4OME A;  2PJ4 A;  2Y0M A;  3B35 A;  3O8Z A;  1BO4 A;  4A30 A;  4ZX8 A;  5A28 A;  1VKC A;  4NJR A;  4NF1 A;  2OR4 A;  1FY7 A;  3D2P A;  4PK3 A;  4C2Z A;  1EZA A;  4EVY A;  1Y9Z A;  3CZX A;  1F2P A;  2B58 A;  2AFU A;  1YRE A;  3PB9 X;  3PT1 A;  4UWI A;  4BPW B;  1LAP A;  1C30 B;  2ODF A;  1NXJ A;  4PXC A;  3B8G A;  2GAN A;  1IYL A;  2O28 A;  4CGN A;  4CRZ B;  4CRY B;  5HKY A;  1YGH A;  4TNU A;  3TO6 A;  5AXI A;  3N5F A;  2VI7 A;  4R57 A;  4UEE A;  4X2T A;  2UV8 G;  1Q2D A;  2I79 A;  3FJU A;  1GYT A;  1KWM A;  2VXK A;  1Y9K A;  3PGP A;  2J8R A;  3SI2 A;  2YJV A;  1KBL A;  1CM0 A;  2ZED A;  6CPA A;  4CAV A;  3B3S A;  1Z2L A;  2Q4V A;  4Q36 A;  3IGR A;  4A4C A;  2HI6 A;  1M4I A;  1TF9 A;  3SXN A;  4QB9 A;  1P0H A;  2VL1 A;  2CF4 A;  3IFE A;  1ZYM A;  4UCN A;  2HUZ A;  4A95 A;  4R76 A;  3NOJ A;  5AG5 A;  2IMO A;  4AVB A;  3FNC A;  3KRV A;  3MRU A;  1IOI A;  4FBE A;  4OAD A;  1M1D A;  2GE3 A;  5J8F A;  3KR5 A;  4M6I A;  2QML A;  4IHM A;  3VAT A;  2PR1 A;  2V8G A;  4E94 A;  3TC8 A;  1YX0 A;  5K8P A;  5G20 A;  1XMB A;  3EZB A;  2XEJ A;  2ATR A;  2BCO A;  1ZG8 A;  3SJG A;  1Z8T A;  3R9F A;  3OB1 B;  4B12 A;  1Y0Y A;  3K9T A;  1T36 B;  3VRN A;  3TLE A;  2J8M A;  1Z5R A;  2O53 A;  2PR8 A;  2DPS A;  3OAK A;  4MJ8 A;  4PXB A;  3SHP A;  5A27 A;  2D0P A;  4XNH B;  3VTA A;  1XRY A;  4YWY A;  3SJE A;  2PE3 A;  4CGL A;  1S7N A;  2GP4 A;  4ZY1 A;  4ONW A;  1TXR A;  4AVA A;  2V8H A;  3BI0 A;  4NGS A;  4KVO E;  2XEG A;  4RR2 B;  1Q2Y A;  3E0K A;  5CNP A;  5C82 A;  1V0C A;  3FH4 A;  1I21 A;  4KLV A;  2Z3L A;  4GPL B;  1BLL E;  1ZLI A;  1PU9 A;  4YRH A;  1H8L A;  2OU2 A;  5CBM A;  4FWU A;  2ZXV A;  4IIY A;  4B13 A;  2PVV A;  5J1Q A;  1QSO A;  3T9Y A;  4C9E A;  5IB0 A;  2XEI A;  1XF8 A;  3B7I A;  2XPP A;  3ZNI A;  2ZW5 A;  4NSQ A;  2YND A;  3GIU A;  4OC3 A;  2PJ0 A;  2BL1 A;  3ICU A;  2EO8 A;  1QSN A;  1UFH A;  4MFP A;  4R87 A;  2B0A A;  3T0T A;  3I1U A;  4C85 A;  1VHO A;  1YLO A;  3C26 A;  2ZW6 A;  4OLL A;  3WR7 A;  5F13 A;  5AG4 A;  5KTA A;  2V77 A;  1VBG A;  4C9A A;  1ELL P;  3R1K A;  1FNO A;  3JUW A;  1Y9W A;  4AVC A;  2JBK A;  4Y49 C;  1M4D A;  5I0C A;  3BUN B;  2MP0 A;  1ON0 A;  4P44 A;  3HPH E;  3H8F A;  5JGF A;  4JVO A;  8CPA A;  2PDO A;  5CPA A;  3DR6 A;  2OZG A;  4JWP A;  5J8C A;  2PJ7 A;  4QC6 A;  3TE4 A;  2AUM A;  3KZW A;  1IB1 E;  4K3N A;  1IID A;  3HUV A;  2OZH A;  4IF5 A;  3ZJ0 A;  4DUK A;  4INJ A;  1KEE B;  4H6U A;  4MI1 A;  4GM5 A;  5DWN A;  4OC1 A;  2Z3O A;  5IV0 A;  4YFJ A;  2C27 A;  1SQH A;  4IK2 A;  1Q5X A;  1ZO0 A;  2WZN A;  2Y1M A;  2BUE A;  2ZEL A;  1RO5 A;  5C88 A;  4KSA A;  2AE6 A;  4XPL A;  3S6K A;  3BUM B;  4UBR A;  5H86 A;  3HPG G;  3FB3 A;  2FE7 A;  3CXP A;  1PYT B;  3EFA A;  3PFO A;  3IJ3 A;  5EC4 A;  3WC6 A;  4CPA A;  1J3L A;  4KOY A;  3T90 A;  2QIR A;  1XE4 A;  2ZEF A;  3S6F A;  1LRZ A;  4CGO A;  2PCN A;  4C8P A;  4ZY2 A;  1N71 A;  3BJ8 A;  4A37 A;  2Z3M A;  4Q7A A;  5D8N A;  4GS4 A;  1ARL A;  2CTC A;  3EC4 A;  3EY5 A;  4K30 A;  4MBU A;  4AG9 A;  4CYN A;  4DJL A;  5IB9 A;  2IJZ A;  3SR3 A;  4NGT A;  1YQE A;  2PJC A;  2WUU A;  3PB4 X;  4GXH A;  4R7M A;  5HVF A;  5LYD A;  4B11 A;  2DXQ A;  1R3N A;  4AG7 A;  2DF5 A;  3R95 A;  2CTB A;  3DNS A;  3IEH A;  4MY3 A;  4QUS A;  3TO9 A;  4F0Y A;  1XJO A;  3PFV A;  1VHS A;  1A9X B;  1GHE A;  3BLN A;  4BMH A;  2HRO A;  4PXE A;  4JZ0 A;  2CBL A;  4M6G A;  5HVG A;  2YJT A;  4X3R A;  2G3T A;  4NGP A;  3RNZ A;  3T05 A;  3RYO A;  1VGY A;  3NE7 A;  2GIV A;  3K4I A;  4C8C A;  2ABZ A;  4ZI6 A;  2CY2 A;  5D29 A;  2RFH A;  1CG2 A;  4PV6 A;  2XPL A;  1JDB C;  2J9A A;  2GRE A;  2Q7S A;  1MJA A;  1Z9E A;  3ISX A;  4EFD A;  4F9U A;  3KHX A;  5HMN A;  5ELY A;  3U88 C;  1IYK A;  3CXS A;  3H4Q A;  4MXU A;  2Z11 A;  1RTQ A;  4XPK A;  5K8M A;  3NFZ A;  4OC4 A;  4MFL A;  3SJX A;  4KSF A;  4C2Y A;  4M6H A;  4U9Z A;  4A2Z A;  4UFX A;  4CYP A;  2QYV A;  5K8O A;  3FEE A;  2DIK A;  2ZEP A;  2CIJ A;  1ZL0 A;  5F1Y A;  3B3W A;  2Z3P A;  3LD2 A;  3FF3 A;  4BD9 A;  2EZA A;  3GKR A;  3MGD A;  5JVL A;  3T07 A;  3KQZ A;  4NEX A;  2F5I A;  3A9L A;  3R9E A;  4XPD C;  1TIQ A;  5AGE A;  4MCR A;  3IWE A;  1CS0 B;  2C6C A;  5LYF A;  2P0W A;  1V6C A;  3IC1 A;  4CAF A;  3P2H A;  4L89 A;  4OID A;  2D4P A;  4C84 A;  4R6T A;  2PSW A;  2OLS A;  3TYX A;  1OBR A;  4NGM A;  1S5K A;  4UFV A;  1Z8X A;  1UWY A;  2GU2 A;  2YNC C;  4KOR A;  3SXO A;  1DIK A;  1NMT A;  4PQA A;  2EWB A;  3TCV A;  4B10 A;  2CXA A;  3GUX A;  4FD6 A;  2WPX A;  3CDX A;  3CPA A;  4M85 A;  3EZA A;  1KC7 A;  5BY0 A;  5JM6 A;  3P2F A;  5HKW A;  2R1I A;  1Q2C A;  4F0X A;  1CX8 A;  1YVO A;  3TTH A;  3V7Z A;  4EWT A;  4COG A;  1AUG A;  1B47 A;  3WT4 A;  4C9R A;  4Y49 B;  3SI0 A;  4KOV A;  4C68 A;  5F9M A;  4C8U A;  3C8O A;  2AJ6 A;  1ELM P;  2AFX A;  1NSL A;  4FD7 A;  4P4F A;  3S9M A;  2ZEG A;  4KVX A;  4E5S A;  2PRQ A;  3K9U A;  3OWC A;  2PCU A;  3B2Y A;  3S6H A;  4RI1 A;  1ARM A;  2AFO A;  3H8G A;  4QBJ A;  3V8I A;  3TLC A;  1EZB A;  4P4I A;  3CT9 A;  4JD6 A;  4AB7 A;  1YVK A;  4UF4 A;  2NMT A;  4PXD A;  1I1D A;  5GCN A;  2PJ5 A;  3VAR A;  5JPH A;  1QST A;  4FD5 A;  4J3G A;  4UFW A;  4LQ6 A;  2PJ8 A;  3TX8 A;  2BSW A;  3D66 A;  1CPX A;  3I3G A;  4J0N A;  2EZB A;  1AYE A;  1IIC A;  1F2O A;  2R98 A;  2OZU A;  3F5B A;  1LFW A;  2P6G A;  3IU1 A;  4MCP A;  3OB2 B;  3D7H A;  4KUB A;  2WSA A;  3TLB A;  4P4D A;  2POK A;  2VKZ G;  4C7H A;  4F9V A;  1S60 A;  3RBU A;  2PJ2 A;  2Q4Z A;  4E0A A;  3TLG B;  3K2K A;  3BUO B;  4KZT A;  4LQG A;  2EK8 A;  4B6Z A;  1F57 A;  4TWE A;  2ZEO A;  1Y0R A;  3V38 A;  4WWV A;  1XEB A;  3QAY A;  2B5G B;  3VWD A;  3RZA A;  3F9K C;  2VQY A;  2B4D A;  3LMS A;  4KSI A;  3FED A;  4KLW A;  3D7F A;  2H5M A; 
#chains in the Genus database with same CATH homology
 3NA6 A;  4UIB A;  4C8A A;  4PPZ A;  2GLJ A;  2ZEN A;  2ZOF A;  1IY7 A;  4NGN A;  1YW6 A;  4NGQ A;  1JQG A;  3PRT A;  3PB8 X;  4R8F A;  2AFM A;  3DGV A;  4P10 A;  2PJ1 A;  1ZG9 A;  3SJF A;  2F8H A;  5LRJ A;  4C9V A;  3PEI A;  3FX6 A;  3KHZ A;  4JYW A;  2QVP A;  1Z8L A;  3B3V A;  3CPX A;  4O23 A;  3WC5 A;  2C6P A;  2C6G A;  3KL9 A;  4MMO A;  2NYQ A;  2Q51 A;  4IAV A;  5I4M A;  1R43 A;  3IWW A;  2QJ8 A;  5HVH A;  3B3T A;  1DTD A;  2PIY A;  3D67 A;  2I3C A;  3H8E A;  4Z65 A;  2JBJ A;  4NJQ A;  3FMC A;  1VIX A;  1BPN A;  3QNV A;  4C8F A;  3T8W A;  4ZYQ A;  4OC2 A;  3I74 A;  5K8N A;  3BHX A;  1Y7E A;  2PJ9 A;  3NH4 A;  3IO1 A;  1LAM A;  4RUH A;  1ZLH A;  3EIF A;  5HXD A;  3SI1 A;  3KQX A;  4C9U A;  2V8V A;  2PVW A;  2FVG A;  4OC0 A;  4ZX9 A;  3BI1 A;  2ANP A;  2GLF A;  3HLP A;  4A39 A;  4P4J A;  4G1P A;  3VH9 A;  3DLJ A;  3L2N A;  1FT7 A;  4YN3 A;  3PBE A;  3BXM A;  1LOK A;  3WAB A;  1NSA A;  4ZY0 A;  4A94 A;  3PB7 X;  1BPM A;  4EME A;  5THW A;  5DS0 A;  2AFZ A;  1LCP A;  1VHE A;  3KGQ A;  4DYO A;  2C5Q A;  1HDU A;  2PIZ A;  2PJ3 A;  4NGR A;  5LYL A;  2BO9 A;  4NFR A;  4CDJ A;  3KAS A;  3B3C A;  4OKO A;  4KNG E;  2ZEH A;  1IGB A;  2C1C A;  1TKF A;  4ZY2 A;  1Q7L A;  1CBX A;  2V8D A;  3S9L A;  1CPS A;  3GB0 A;  1XBU A;  2BOA A;  1ZG7 A;  3D68 A;  1YSJ A;  1EE3 P;  3IIB A;  4AXV A;  7CPA A;  5LRG A;  1BAV A;  3WC7 A;  3ISZ A;  2DEA A;  1TF8 A;  1XFO A;  4TJX A;  1HEE A;  2PJB A;  4P45 A;  3MN8 A;  2ZOG A;  1LAN A;  5F09 A;  4W9Y A;  5LRK A;  4C99 A;  2RB7 A;  4MHY A;  4MCS A;  4OP4 A;  3NH5 A;  3PFE A;  2HC9 A;  3D4U A;  4C86 A;  2F7V A;  4H2K A;  1QQ9 A;  3D7G A;  1M4L A;  2G9D A;  1XF1 A;  4P4E A;  1PCA A;  1TKJ A;  3FVL A;  4WJB A;  4C8T A;  2HB6 A;  2ZEM A;  5LYI A;  4P6Y A;  3NH8 A;  4CDK A;  2IQ6 A;  1AMP A;  4MRI A;  2JEW A;  2AFS A;  4FUU A;  4OC5 A;  3S9N A;  2XEF A;  1HDQ A;  4UEF A;  4UIA A;  3FEC A;  1CP6 A;  2ZEE A;  4YU9 A;  3RAM A;  2AFW A;  4F8Z A;  4A38 A;  3D7D A;  4FAI A;  1QMU A;  3KI9 A;  3PB6 X;  4TJV A;  2O4H A;  3I6S A;  3GLJ A;  2Q43 A;  4MHN A;  5IR2 A;  4X8I A;  2NSM A;  4MHP A;  2PJ6 A;  1DE4 C;  2EK9 A;  3LWU A;  4MCQ A;  1TKH A;  4MHZ A;  1YME A;  4P4B A;  1CP7 A;  4OIW A;  3PBB A;  2PJA A;  2WYR A;  3KR4 A;  1YW4 A;  2OOT A;  4UEZ A;  5JH9 A;  3JRU A;  2PJ4 A;  4OME A;  3B35 A;  4ZX8 A;  4NJR A;  2OR4 A;  1Y9Z A;  1F2P A;  2AFU A;  3PB9 X;  1LAP A;  4PXC A;  4TNU A;  3N5F A;  4UEE A;  4X2T A;  3FJU A;  1GYT A;  1KWM A;  3SI2 A;  2ZED A;  6CPA A;  3B3S A;  1Z2L A;  1TF9 A;  2VL1 A;  2CF4 A;  3IFE A;  4R76 A;  2IMO A;  3MRU A;  4FBE A;  3KR5 A;  4IHM A;  3VAT A;  2V8G A;  3TC8 A;  5K8P A;  1XMB A;  2XEJ A;  2BCO A;  1ZG8 A;  3SJG A;  1Y0Y A;  3K9T A;  1Z5R A;  2O53 A;  4PXB A;  3VTA A;  1XRY A;  4YWY A;  3SJE A;  2PE3 A;  2GP4 A;  4ZY1 A;  4ONW A;  1TXR A;  2V8H A;  3BI0 A;  4NGS A;  2XEG A;  3FH4 A;  1BLL E;  1ZLI A;  1H8L A;  5CBM A;  4FWU A;  2PVV A;  5J1Q A;  4C9E A;  2XEI A;  3B7I A;  4OC3 A;  2PJ0 A;  3ICU A;  3I1U A;  4C85 A;  1VHO A;  1YLO A;  2V77 A;  4C9A A;  1ELL P;  1FNO A;  2JBK A;  3H8F A;  4P44 A;  5JGF A;  8CPA A;  5CPA A;  2PJ7 A;  3KZW A;  4K3N A;  3HUV A;  4DUK A;  4GM5 A;  4OC1 A;  4IK2 A;  2WZN A;  2ZEL A;  3PFO A;  1PYT B;  1WVM A;  3IJ3 A;  3WC6 A;  4CPA A;  2ZEF A;  4C8P A;  4A37 A;  4Q7A A;  5D8N A;  1ARL A;  2CTC A;  5IB9 A;  4DJL A;  2IJZ A;  4NGT A;  2PJC A;  3PB4 X;  4R7M A;  5LYD A;  5HVF A;  4BD9 A;  1R3N A;  2CTB A;  3IEH A;  1XJO A;  4PXE A;  4JZ0 A;  5HVG A;  4X3R A;  4NGP A;  1VGY A;  4C8C A;  2ABZ A;  4ZI6 A;  5D29 A;  2RFH A;  1CG2 A;  2J9A A;  2GRE A;  3ISX A;  4EFD A;  4F9U A;  3KHX A;  5ELY A;  4MXU A;  5K8M A;  1RTQ A;  3NFZ A;  4OC4 A;  3SJX A;  5K8O A;  2QYV A;  3FEE A;  2ZEP A;  2CIJ A;  3B3W A;  3FF3 A;  3KQZ A;  4MCR A;  2C6C A;  5LYF A;  1V6C A;  3IC1 A;  4OID A;  4C84 A;  4R6T A;  1OBR A;  4NGM A;  2GU2 A;  1UWY A;  4PQA A;  2EWB A;  3GUX A;  3CDX A;  3CPA A;  5JM6 A;  1CX8 A;  4EWT A;  3V7Z A;  3WT4 A;  4C9R A;  3SI0 A;  4C8U A;  1ELM P;  2AFX A;  4P4F A;  3S9M A;  2ZEG A;  2PRQ A;  2PCU A;  3B2Y A;  1ARM A;  2AFO A;  3H8G A;  4P4I A;  3CT9 A;  4UF4 A;  3VAR A;  4PXD A;  2PJ8 A;  3TX8 A;  3D66 A;  1CPX A;  1AYE A;  1F2O A;  1LFW A;  4MCP A;  3D7H A;  4P4D A;  2POK A;  4F9V A;  2PJ2 A;  3RBU A;  2Q4Z A;  3K2K A;  4LQG A;  2EK8 A;  4B6Z A;  1F57 A;  4TWE A;  2ZEO A;  1Y0R A;  3V38 A;  4WWV A;  3RZA A;  3LMS A;  4KSI A;  3FED A;  3D7F A;  2PJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...