5ELYA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a hydroxamate inhibitor jhu242
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
696
structure length
682
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Unprecedented Binding Mode of Hydroxamate-Based Inhibitors of Glutamate Carboxypeptidase II: Structural Characterization and Biological Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 252
structure length 682
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2015-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 5elyA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5elyA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5elyA02
1CBXA 1LFWA 4OC1A 1CPXA 2GLJA 1Y0RA 2V8GA 3RAMA 2PJ6A 4PXBA 4P44A 4UIAA 4P10A 3GB0A 4YU9A 3WC7A 1BAVA 4PQAA 4TJXA 3SI2A 4W9YA 5ELYA 1Z2LA 2NYQA 3EIFA 5LYLA 4X2TA 1Z5RA 2WZNA 3SJEA 1DTDA 4FAIA 3T8WA 4EWTA 4C9RA 5K8NA 2PVWA 4KSIA 3BI0A 1XFOA 4R8FA 4C8UA 2ZOFA 1VHEA 3BHXA 3FX6A 3L2NA 4MCSA 2AFMA 3D68A 2RB7A 4O23A 6CPAA 1F57A 3TC8A 3FJUA 3SI0A 7CPAA 2F7VA 2QVPA 4A39A 2C1CA 3D67A 1F2OA 2PJ7A 1HDUA 1UWYA 5K8OA 1R43A 1LCPA 1HDQA 1PYTB 4UEEA 3QNVA 2PJ8A 1VIXA 1KWMA 4DUKA 5LYFA 4PPZA 5JGFA 3SI1A 2JBJA 3VTAA 3BI1A 4C8PA 3VATA 4P6YA 4IK2A 2EK8A 2C6PA 3D7HA 4C9EA 2FVGA 3H8GA 4R76A 2PJ1A 3RBUA 3CDXA 4Z65A 5LYDA 2PJ9A 5CPAA 5LYIA 3B3TA 5LRGA 2ZEMA 1GYTA 4UF4A 3IWWA 3GUXA 4F9UA 2OOTA 4ZY0A 5D8NA 4OKOA 1YLOA 2XEGA 5HVHA 3IO1A 2ZEHA 3KQXA 4JZ0A 3BXMA 3FEDA 1Z8LA 1CX8A 3FH4A 3LWUA 4ZY2A 3GLJA 3B3CA 1AMPA 1ZG8A 5K8MA 1Q7LA 1LAPA 2ZELA 4H2KA 3DGVA 1WVMA 3KI9A 3PB4X 4WWVA 5JH9A 2JEWA 2PIYA 2ANPA 2EK9A 3H8EA 1QMUA 3PB9X 1FT7A 3B35A 4JYWA 2ZEDA 1HEEA 1TKFA 2AFOA 3KR5A 3KL9A 3ISZA 4MXUA 4A94A 1BLLE 2Q51A 3D7DA 1IY7A 4TJVA 5LRKA 3KR4A 1R3NA 2CTBA 3PBBA 3PFEA 4R6TA 3PB7X 4NJRA 4C8FA 3NH4A 3WC6A 2NSMA 2AFWA 4PXDA 3LMSA 4AXVA 2RFHA 3I74A 4P45A 1YW6A 4P4DA 2CTCA 2PJ0A 3K2KA 4EFDA 1JQGA 3CPXA 3KASA 2PJAA 2ZEPA 1XF1A 4G1PA 1AYEA 2XEJA 2HB6A 3CPAA 3S9NA 1XJOA 3PEIA 4ZI6A 2V8VA 4MCQA 4MHZA 1ZG9A 2AFUA 2V8HA 4R7MA 3D7FA 4DJLA 3NA6A 3I6SA 4NGNA 2BO9A 2PRQA 3ISXA 2PJ5A 3JRUA 2ZENA 1EE3P 4UEZA 2ZEFA 3FECA 2PJ4A 2BCOA 2I3CA 4MCRA 4IAVA 2XEFA 1PCAA 3PFOA 4FWUA 4NGMA 4NGSA 1H8LA 3WT4A 4K3NA 3ICUA 2V8DA 2ZOGA 4FUUA 3I1UA 4UEFA 2CIJA 5JM6A 4ONWA 4P4FA 1XRYA 2PJBA 4OC4A 2PCUA 3IJ3A 3V38A 1XBUA 4P4BA 3RZAA 4C9UA 2AFSA 2F8HA 3D66A 4C8CA 4PXCA 4PXEA 1V6CA 4YN3A 3KQZA 2ZEEA 2AFXA 1IGBA 4C9VA 2JBKA 2OR4A 4OIWA 1LAMA 3B3VA 5LRJA 1FNOA 3IEHA 1RTQA 5K8PA 2V77A 4TWEA 4CDJA 5I4MA 5D29A 2DEAA 1BPMA 1Y7EA 5THWA 4OC0A 3PRTA 2PJCA 1LANA 3KZWA 4C85A 3PB8X 2EWBA 4YWYA 4FBEA 4C86A 1CG2A 2POKA 2G9DA 4X8IA 2O4HA 3NH8A 4WJBA 4KNGE 2IJZA 4C9AA 4MCPA 1CP6A 3H8FA 3FEEA 1YW4A 1ZG7A 3MN8A 5HVGA 1ELMP 4IHMA 4OP4A 3NFZA 3D4UA 4P4IA 4MHNA 2XEIA 1TF8A 4MHPA 3WC5A 4NGPA 2AFZA 4ZX9A 5CBMA 5J1QA 3FF3A 1Y0YA 4RUHA 4OIDA 4UIBA 2C6GA 3PB6X 1QQ9A 4F9VA 2IQ6A 3S9MA 2PJ3A 3B3SA 3B2YA 3SJFA 4C8TA 1NSAA 1M4LA 1XMBA 1TXRA 4MHYA 4MMOA 1TKHA 1ARMA 3NH5A 4OC2A 2IMOA 3KHXA 4ZY1A 4BD9A 2PE3A 1VGYA 5HXDA 3VH9A 2Q4ZA 4OMEA 4C8AA 2J9AA 2BOAA 4ZYQA 4OC3A 5F09A 1YSJA 4NGQA 4NGRA 3N5FA 3V7ZA 4F8ZA 3KGQA 2Q43A 2QJ8A 2O53A 4NFRA 4P4EA 3S9LA 2ABZA 5IB9A 1ZLIA 4CPAA 3HLPA 4P4JA 1ARLA 3SJXA 4A37A 2CF4A 2PIZA 4C99A 2PJ2A 4Q7AA 4CDKA 1CP7A 3B3WA 3CT9A 2GREA 4NJQA 1TKJA 1F2PA 3KHZA 1VHOA 3D7GA 3PBEA 4DYOA 3SJGA 3IFEA 1DE4C 2GU2A 3FMCA 3DLJA 4MRIA 2ZEOA 3FVLA 3IIBA 4TNUA 4NGTA 3TX8A 2VL1A 1BPNA 1ELLP 4A38A 3IC1A 5HVFA 2WYRA 1ZLHA 1TF9A 4X3RA 2HC9A 1Y9ZA 3HUVA 4EMEA 3B7IA 1LOKA 3VARA 4ZX8A 5DS0A 2GLFA 3WABA 4OC5A 1OBRA 1YMEA 2QYVA 4GM5A 4C84A 2PVVA 2C6CA 4LQGA 1CPSA 3MRUA 4B6ZA 2ZEGA 8CPAA 3K9TA
chains in the Genus database with same CATH superfamily
3TOBA 1CBXA 2Z3NA 1LFWA 3F5BA 2R82A 4CO9A 2F5IA 4OC1A 2Z0ZA 1CPXA 2GLJA 5HH1A 1Y0RA 2V8GA 4JXQA 3R1KA 3RAMA 5C88A 4EVYA 2PJ6A 1A2ZA 4PXBA 4UFWA 4P44A 2EBJA 2DPTA 2PC1A 4P10A 4UIAA 4CYQA 5JH9A 1PUAA 4KOWA 3GB0A 4ONUA 3D2MA 1IU8A 4JLYA 4YU9A 3WC7A 3GIUA 4XPDB 1BAVA 4KZTA 4PQAA 4TJXA 2YNCC 5H86A 3SI2A 4W9YA 3R9GA 4UCMA 1J3LA 5ELYA 2IL4A 5JVLA 3D2PA 4UFXA 1Z2LA 4ZBGA 2FSRA 1YVKA 3R9EA 2NYQA 2X7BA 3EIFA 1T36B 5LYLA 4X2TA 1Z5RA 3V8IA 4C2XA 2D0OA 5AG7A 2R1IA 2WZNA 4M6IA 3SJEA 1DTDA 1GHEA 2GE3A 3LD2A 4MFZA 3T8WA 4FAIA 3D8PA 4EWTA 1EZBA 4C9RA 4MFLA 3NE8A 1CS0B 5K8NA 2PVWA 1DIKA 3KKWA 4MBUA 4JVOA 1IB1E 1YR0A 2B3UA 2P6GA 2ATRA 4KSIA 3BI0A 1ZO0A 1XFOA 4R8FA 1C30B 4C8UA 1QSRA 2KCWA 2ZOFA 4NCZA 3RYOA 1VHEA 3BHXA 3FX6A 4BINA 1KC7A 3L2NA 4MCSA 2AFMA 2WPWA 4F6AA 5A27A 3ZNIA 3D68A 2R7HA 2RB7A 3HMJG 1VHSA 4MFKA 4O23A 4KOVA 1F57A 6CPAA 3TC8A 1VBHA 4XPLA 3TO6A 5DWNA 2H5MA 2ZW6A 3FJUA 3SI0A 7CPAA 2F7VA 2QVPA 4A39A 1XOVA 2C1CA 1X10A 3D67A 3OP0A 4HNYB 2PQ8A 1F2OA 5F46A 2PJ7A 1IIDA 3K9UA 3BUNB 1HDUA 2P6EA 3DNSA 4X5KA 1UWYA 5K8OA 2VXKA 4H6ZA 4R57A 3FNCA 1R43A 4NSQA 4AVAA 2E28A 1LCPA 2MP0A 2UV8G 1HDQA 1PYTB 4UEEA 3QNVA 5JPHA 3T07A 2PJ8A 1VIXA 2ZPAA 1KWMA 4DUKA 1X12A 3VROA 4KLVA 5IB0A 4PPZA 5LYFA 4COBA 3U1BA 4PK2A 3T9YA 1QSMA 4YFJA 5JGFA 3I9SA 5HKZA 3W91A 3H5ZA 2JBJA 3SI1A 3VTAA 3EO4A 2DIKA 3BI1A 4FD4A 4CRZB 3VATA 2ARHA 5BWAB 4P6YA 3S6GA 1Q2CA 4IK2A 5IX3A 2EK8A 2C6PA 4R87A 3D7HA 5J8CA 5FVJA 4C9EA 2FVGA 3H8GA 2GIVA 2I79A 4CYOA 4R76A 5HMNA 4OAEA 4CYNA 3PP9A 4RR2B 3BUOB 1YVOA 2PJ1A 2AE6A 3RBUA 2HUZA 3CDXA 4H6UA 4Z65A 5AG5A 1KUVA 3JVNA 1KUYA 2FXFA 2Z3LA 3FB3A 1A9XB 4C2ZA 5G1ZA 5LYDA 2PJ9A 5CPAA 4B12A 3BUMB 2HV2A 4CAFA 3PLFB 3GJZA 2J8NA 2R8VA 5LYIA 5F13A 4Y49C 2QMLA 3ZZIA 3B3TA 4E94A 3TLYA 5LRGA 4MY0A 2ZEMA 1GYTA 4UF4A 3IWWA 4B11A 5G21A 5ISVA 3GUXA 1VKCA 4KLWA 4F9UA 2OOTA 4ZY0A 3BUXB 5D8NA 4MHDA 3HPGG 1YLOA 4OKOA 2XEGA 2AJ6A 4KOUA 2XPLA 4MFJA 3PT1A 3IGRA 5HVHA 3IO1A 4UFVA 4UWJA 2VI7A 2JLMA 2ZEHA 3KQXA 4JZ0A 4AVBA 1KZFA 4B5PB 2AUMA 1WK4A 3DR8A 3BXMA 3FEDA 3PZJA 2Q4YA 1Z8LA 2D4OA 1VI4A 1CX8A 3FH4A 2Z10A 3CXQA 3LWUA 3GLJA 4ZY2A 2FT0A 3TLAA 3B3CA 4KOYA 3U88C 1MJ9A 1AMPA 4CGNA 1ZG8A 5K8MA 1M44A 1QSTA 3IU2A 4UWIA 1Q7LA 1LAPA 2ZELA 3EY5A 3DGVA 1YVHA 1MK4A 3C26A 2WSAA 4H2KA 4B5OA 1WVMA 2YJTA 3SR3A 5JQ4A 3KI9A 3MGDA 3PB4X 1XIXA 4KOSA 4RI1A 2JEWA 2PIYA 4WWVA 2ANPA 2EK9A 3H8EA 1QMUA 2BSWA 2VEZA 1CE8B 3WR7A 1SQHA 3GY9A 3PB9X 4XNHC 4CS0B 1WWZA 1FT7A 3B35A 4INJA 4MI4A 4JYWA 2ZEDA 5E96A 1HEEA 1B47A 3ZJ0A 1TKFA 3FIXA 2AFOA 2BEIA 2R98A 3KR5A 4GXHA 1EO0A 3KL9A 3ISZA 4MXUA 4A94A 4J3GA 1BLLE 4MJ8A 1VBGA 2XPNA 2Y1NA 4A4CA 1YGHA 5F49A 2Q51A 3D7DA 1IY7A 2VZZA 4TJVA 5LRKA 3KR4A 1XMTA 4PV6A 1R3NA 2CTBA 3PBBA 3PFEA 3TT2A 3EZEA 4R6TA 3PB7X 4NJRA 4C8FA 4QVTA 5GCNA 1Z4EA 4A33A 3N7ZA 2B3VA 3NH4A 1N71A 3WC6A 4PSXA 4CRYB 2NSMA 2D4PA 5AXIA 2CY2A 3TO7A 3TLGA 1Z9UA 4IIYA 2AFWA 4L89A 3LMSA 4PXDA 4AXVA 3FXTA 2RFHA 2JEVA 4RS2A 3I74A 4P45A 1S7LA 1YW6A 3VWEA 4JD6A 1IOFA 4P4DA 1IYKA 4KUBA 1M4GA 4NF1A 5C82A 3S6KA 2CTCA 2J8MA 1I21A 2PJ0A 2WUUA 4R9MA 2JDDA 3I3GA 3K2KA 4KSAA 1I12A 1QSOA 2EUIA 4EFDA 3A9LA 1JQGA 4MFPA 1NXJA 5AG4A 1GGOA 3CPXA 3KASA 1FBVA 2FS5A 4KORA 4LQ6A 2PJAA 4OADA 1UFHA 4EYSA 2ZEPA 1XF1A 1M1DA 2EVNA 1AYEA 2XEJA 4G1PA 4A2ZA 5FD8A 2HB6A 2VBQA 3CPAA 3S9NA 1XJOA 3PEIA 3S6FA 4A95A 4ZI6A 2CNMA 2EZBA 2V8VA 3T05A 4MCQA 3EFAA 3IWGA 4MHZA 5G20A 2CNSA 1KEEB 1R61A 1ZG9A 3T90A 3G3SA 4MI1A 2PSWA 2OZHA 4NXYA 2AFUA 4XPKA 4CGOA 2V8HA 5J3XA 1Z8TA 3GYAA 4R7MA 2B4JC 3TLEA 3D7FA 5AG6A 1RO5A 4DJLA 3NA6A 4AB7A 3PFVA 3I6SA 4CGLA 3R9FA 1ON0A 5K99A 3H4QA 5JYBA 5F1YA 4NGNA 2BO9A 2PRQA 3F0AA 1J4JA 4CAEA 4C84A 4KVOE 4KOTA 3ISXA 2PJ5A 2Q7SA 1EE3P 2YNCA 2Z3KA 2ZENA 3B8GA 3JRUA 3NFQA 4HKFA 5F48A 1Y7RA 2OLSA 2BL1A 2Z3MA 4C2YA 4UEZA 4J0NA 2ZEFA 3VRQA 2ZW4A 3BLNA 1KUXA 5KTDA 1NBWA 3FECA 3BJ8A 4JXRA 4CAVA 4L8AA 3T0TA 2PJ4A 2BCOA 2I3CA 4MCRA 3DR6A 2XEFA 4IAVA 1PCAA 3PFOA 2YGWA 4FWUA 4PK3A 4NGMA 1S5KA 4NGSA 2Y1MA 1H8LA 3TYXA 3WT4A 2DXQA 4K3NA 3ICUA 2V8DA 2ZOGA 4B14A 2DF5A 5F9MA 4M85A 1R57A 4OLLA 5EC4A 4FUUA 3I1UA 4UEFA 2CIJA 5JM6A 1S7NA 4JJXA 4ONWA 4P4FA 4B10A 1XRYA 2PJBA 4OC4A 5EBVA 2PCUA 3IJ3A 3OAKA 5G22A 3V38A 3P2HA 1XBUA 4P4BA 2B58A 3R95A 3RZAA 4C9UA 4E8OA 1S3ZA 4XPDC 4BBHA 2AFSA 5F5XA 2F8HA 1IYLA 3D66A 3G8WA 4KUAA 3QB8A 2BUEA 4JWPA 4CGPA 2AUNA 4C8CA 5BY0A 4PXCA 1M4IA 4PXEA 1V6CA 3C8OA 4YN3A 3KQZA 2ZEEA 1TIQA 2AFXA 3EC4A 1M4DA 1IGBA 4C9VA 2C27A 2JBKA 2OR4A 4OIWA 1OZPA 4UCNA 2QECA 1LAMA 3B3VA 5LRJA 2Q7BA 3TCVA 3TLCA 1FNOA 1NMTA 3BJ7A 3IEHA 4IUSA 3S6HA 4CAWA 2FIWA 1Z4RA 1MJAA 5J8FA 1RTQA 5K8PA 1B6BA 2V77A 4TWEA 4CDJA 5HKWA 5I4MA 2DLAA 5D29A 3F9KC 4A30A 4FD5A 2DEAA 4R3KA 1BPMA 2Z11A 1Y7EA 4R3LA 4U5YA 5THWA 4OC0A 5CNPA 1ZYMA 3CXPA 3QAHA 2PRBA 3PRTA 1L0CA 2PJCA 3DDDA 4H1HA 3TE4A 3R96A 1LANA 3KZWA 4C85A 2HROA 3PB8X 2EWBA 4YWYA 4FBEA 2ZW5A 3NOJA 1B87A 2B5GA 3TLBA 4C86A 2B0AA 1CG2A 2POKA 2G9DA 4X8IA 1Z9EA 1FY7A 3VRPA 2Z3OA 3FRMA 2O4HA 1Q5XA 3NH8A 4WJBA 2D0PA 3KRVA 4KNGE 2GP4A 2WPXA 1EZAA 2IJZA 2FCKA 4C9AA 1NE9A 4MCPA 1CP6A 1K4JA 3H8FA 4M6GA 3W6XA 3FEEA 3OB1B 2Z3PA 1YW4A 3CXSA 3TTHA 1ZG7A 3MN8A 5HVGA 1ELMP 4E0AA 3E0KA 4IHMA 2A4NA 4OP4A 1JDEA 3K4IA 1P0HA 2HI6A 3NFZA 1PU9A 4HNXB 3VRRA 4LX9A 2PDOA 4AG7A 3D4UA 3TLGB 4P4IA 2VQYA 4MHNA 4NEXA 2XEIA 1TF8A 4MHPA 1I1DA 3WC5A 4NGPA 4M3SA 2EZAA 4DNCA 5DWMA 4KS9A 2AFZA 4Y49B 4FD6A 4BMHA 4YGOA 1Y9KA 2OU2A 4ZX9A 4E2AA 5CBMA 4AVCA 3FF3A 5J1QA 4H89A 1Y0YA 1JDBC 4U9ZA 1AUGA 2OB0A 4OIDA 1XE4A 4RUHA 2EZCA 4UIBA 2C6GA 1M6VB 1YLEA 5KTAA 1BXRB 1MJBA 3PB6X 2FE7A 1QQ9A 4F9VA 2Q04A 4C7HA 2IQ6A 1C3OB 2OH1A 2P0WA 1BOBA 3S9MA 4C68A 2N3AB 2PJ3A 2Q44A 1YQEA 3D3SA 3TLZA 3B3SA 4MY3A 2FM4A 3B2YA 3SJFA 2GANA 1CJWA 5EMIA 4BTFA 1NSAA 3SHPA 4C8TA 4QB9A 3IU1A 2REEA 1M4LA 1LRZA 1XMBA 2K5TA 3HPHE 1YK3A 1TXRA 4MHYA 4MMOA 3BUWB 4BPWB 1ARMA 1TKHA 3NH5A 4OC2A 2YNDA 4UA3A 2B4BA 5A28A 2IMOA 5IR2A 4U9YA 3KHXA 4AG9A 4ZY1A 4BD9A 3QAYA 1NSLA 2G3AA 3TOAA 2G0BA 2J8RA 1Z8WA 2PE3A 1VGYA 4XNHB 1P4NA 1S60A 3VH9A 5HXDA 5KTCA 2Q4ZA 4OMEA 3TO9A 2HQYA 4C8AA 2YJVA 2EO8A 2NMTA 1Z8XA 2J9AA 2BOAA 4ZYQA 4OC3A 2I00A 3FYNA 5F09A 4E5SA 1IOIA 1YSJA 2PCNA 4NGQA 4NGRA 2ODFA 3N5FA 4KVXA 3G23A 3V7ZA 4F8ZA 1RXTA 3KGQA 4KOXA 3GKRA 1YX0A 4HPSA 2Q43A 2FL4A 2QJ8A 2O53A 4NFRA 4QUSA 4P4EA 3S9LA 3JUWA 1Y9WA 5H84A 2ABZA 5IB9A 1Q2DA 1ZLIA 4MFQA 3IWEA 4CPAA 3HLPA 4P4JA 4ORFA 3T5MA 4HNWB 2RC4A 1BO4A 2YNEA 3JTKA 4I49A 1CM0A 1ARLA 4F0YA 5IV0A 4K30A 1ZRSA 3SJXA 4A37A 2Y0MA 2CF4A 2PIZA 4A32A 4C99A 4COGA 2O28A 2PJ2A 4Q7AA 3SXNA 3LODA 2Q4VA 4FD7A 4CDKA 1CP7A 3B3WA 3CT9A 1WJTA 2GREA 4C8PA 4NJQA 1KBLA 1TKJA 1F2PA 2QIRA 3VRNA 2OZUA 1VHOA 3KHZA 3NE7A 4KVME 3VWDA 3D7GA 4Q38A 3PGPA 3PBEA 4RN7A 1V0CA 4A4BA 4DYOA 2FIAA 5I0CA 3SJGA 3EZBA 3IFEA 1DE4C 2ZXVA 4MJXA 3CZXA 2GU2A 2OZGA 3VGOA 1YREA 4YRHA 4CYPA 3OB2B 2C5QA 5AGEA 5F47A 2PR8A 3FMCA 3RNZA 3OWCA 3DLJA 4II9A 2PR1A 4MRIA 3SXOA 4CAXA 2ZEOA 2VKZG 4QBJA 4KSFA 1JWQA 3FVLA 4UBRA 4UCPA 2CBLA 3LACA 2JDCA 3IIBA 4TNUA 3F8KA 4M6HA 2ZW7A 1Q2YA 4M8DA 4NGTA 2VZYA 2Q0YA 3TX8A 2B4DB 1QSNA 1BPNA 1ELLP 2VL1A 3W6SA 3IC1A 4A38A 1ZL0A 2CXAA 1U6MA 4BPUB 5HVFA 4IIXA 2B4DA 1S7KA 2X0SA 4ZGYB 2XPOA 4C7IA 3UY5A 4F0XA 2WYRA 4CGMA 3EXNA 1ZLHA 2CNTA 1TF9A 3P2FA 4X3RA 2HC9A 1Y9ZA 4GS4A 3HUVA 2B5GB 1IICA 4CZ1A 3O8ZA 4BPXB 3DSBA 4GPLB 3RO0A 4Q36A 4EMEA 3B7IA 3EZAA 1LOKA 4LUAA 1XF8A 4ZX8A 3VARA 5DS0A 2HWGA 2GLFA 4B5PA 3WABA 2DPSA 4OC5A 1OBRA 1XEBA 1YMEA 2QYVA 4GM5A 4QC6A 2G3TA 4PSWA 2PVVA 1S7FA 2XPPA 2C6CA 4B13A 4LQGA 1CPSA 3FBUA 2REFA 3MRUA 4B6ZA 2GFQA 4IF5A 2P6FA 2ZEGA 8CPAA 4A31A 3TFYA 3K9TA 5HKYA
chains in the Genus database with same CATH topology
1CBXA 1LFWA 4OC1A 1CPXA 2GLJA 1Y0RA 2V8GA 3RAMA 2PJ6A 4PXBA 4P44A 4UIAA 4P10A 3GB0A 4YU9A 3WC7A 1BAVA 4PQAA 4TJXA 3SI2A 4W9YA 5ELYA 1Z2LA 2NYQA 3EIFA 5LYLA 4X2TA 1Z5RA 2WZNA 3SJEA 1DTDA 4FAIA 3T8WA 4EWTA 4C9RA 5K8NA 2PVWA 4KSIA 3BI0A 1XFOA 4R8FA 4C8UA 2ZOFA 1VHEA 3BHXA 3FX6A 3L2NA 4MCSA 2AFMA 3D68A 2RB7A 4O23A 6CPAA 1F57A 3TC8A 3FJUA 3SI0A 7CPAA 2F7VA 2QVPA 4A39A 2C1CA 3D67A 1F2OA 2PJ7A 1HDUA 1UWYA 5K8OA 1R43A 1LCPA 1HDQA 1PYTB 4UEEA 3QNVA 2PJ8A 1VIXA 1KWMA 4DUKA 5LYFA 4PPZA 5JGFA 3SI1A 2JBJA 3VTAA 3BI1A 4C8PA 3VATA 4P6YA 4IK2A 2EK8A 2C6PA 3D7HA 4C9EA 2FVGA 3H8GA 4R76A 2PJ1A 3RBUA 3CDXA 4Z65A 5LYDA 2PJ9A 5CPAA 5LYIA 3B3TA 5LRGA 2ZEMA 1GYTA 4UF4A 3IWWA 3GUXA 4F9UA 2OOTA 4ZY0A 5D8NA 4OKOA 1YLOA 2XEGA 5HVHA 3IO1A 2ZEHA 3KQXA 4JZ0A 3BXMA 3FEDA 1Z8LA 1CX8A 3FH4A 3LWUA 4ZY2A 3GLJA 3B3CA 1AMPA 1ZG8A 5K8MA 1Q7LA 1LAPA 2ZELA 4H2KA 3DGVA 1WVMA 3KI9A 3PB4X 4WWVA 5JH9A 2JEWA 2PIYA 2ANPA 2EK9A 3H8EA 1QMUA 3PB9X 1FT7A 3B35A 4JYWA 2ZEDA 1HEEA 1TKFA 2AFOA 3KR5A 3KL9A 3ISZA 4MXUA 4A94A 1BLLE 2Q51A 3D7DA 1IY7A 4TJVA 5LRKA 3KR4A 1R3NA 2CTBA 3PBBA 3PFEA 4R6TA 3PB7X 4NJRA 4C8FA 3NH4A 3WC6A 2NSMA 2AFWA 4PXDA 3LMSA 4AXVA 2RFHA 3I74A 4P45A 1YW6A 4P4DA 2CTCA 2PJ0A 3K2KA 4EFDA 1JQGA 3CPXA 3KASA 2PJAA 2ZEPA 1XF1A 4G1PA 1AYEA 2XEJA 2HB6A 3CPAA 3S9NA 1XJOA 3PEIA 4ZI6A 2V8VA 4MCQA 4MHZA 1ZG9A 2AFUA 2V8HA 4R7MA 3D7FA 4DJLA 3NA6A 3I6SA 4NGNA 2BO9A 2PRQA 3ISXA 2PJ5A 3JRUA 2ZENA 1EE3P 4UEZA 2ZEFA 3FECA 2PJ4A 2BCOA 2I3CA 4MCRA 4IAVA 2XEFA 1PCAA 3PFOA 4FWUA 4NGMA 4NGSA 1H8LA 3WT4A 4K3NA 3ICUA 2V8DA 2ZOGA 4FUUA 3I1UA 4UEFA 2CIJA 5JM6A 4ONWA 4P4FA 1XRYA 2PJBA 4OC4A 2PCUA 3IJ3A 3V38A 1XBUA 4P4BA 3RZAA 4C9UA 2AFSA 2F8HA 3D66A 4C8CA 4PXCA 4PXEA 1V6CA 4YN3A 3KQZA 2ZEEA 2AFXA 1IGBA 4C9VA 2JBKA 2OR4A 4OIWA 1LAMA 3B3VA 5LRJA 1FNOA 3IEHA 1RTQA 5K8PA 2V77A 4TWEA 4CDJA 5I4MA 5D29A 2DEAA 1BPMA 1Y7EA 5THWA 4OC0A 3PRTA 2PJCA 1LANA 3KZWA 4C85A 3PB8X 2EWBA 4YWYA 4FBEA 4C86A 1CG2A 2POKA 2G9DA 4X8IA 2O4HA 3NH8A 4WJBA 4KNGE 2GP4A 2IJZA 4C9AA 4MCPA 1CP6A 3H8FA 3FEEA 1YW4A 1ZG7A 3MN8A 5HVGA 1ELMP 4IHMA 4OP4A 3NFZA 3D4UA 4P4IA 4MHNA 2XEIA 1TF8A 4MHPA 3WC5A 4NGPA 2AFZA 4ZX9A 5CBMA 5J1QA 3FF3A 1Y0YA 4RUHA 4OIDA 4UIBA 2C6GA 3PB6X 1QQ9A 4F9VA 2IQ6A 3S9MA 2PJ3A 3B3SA 3B2YA 3SJFA 4C8TA 1NSAA 1M4LA 1XMBA 1TXRA 4MHYA 4MMOA 1TKHA 1ARMA 3NH5A 4OC2A 2IMOA 5IR2A 3KHXA 4ZY1A 4BD9A 2PE3A 1VGYA 5HXDA 3VH9A 2Q4ZA 4OMEA 4C8AA 2J9AA 2BOAA 4ZYQA 4OC3A 5F09A 1YSJA 4NGQA 4NGRA 3N5FA 3V7ZA 4F8ZA 3KGQA 2Q43A 2QJ8A 2O53A 4NFRA 4P4EA 3S9LA 2ABZA 5IB9A 1ZLIA 4CPAA 3HLPA 4P4JA 1ARLA 3SJXA 4A37A 2CF4A 2PIZA 4C99A 2PJ2A 4Q7AA 4CDKA 1CP7A 3B3WA 3CT9A 2GREA 4NJQA 1TKJA 1F2PA 3KHZA 1VHOA 3D7GA 3PBEA 4DYOA 3SJGA 3IFEA 1DE4C 2GU2A 2C5QA 3FMCA 3DLJA 4MRIA 2ZEOA 3FVLA 3IIBA 4TNUA 4NGTA 3TX8A 2VL1A 1BPNA 1ELLP 4A38A 3IC1A 5HVFA 2WYRA 1ZLHA 1TF9A 4X3RA 2HC9A 1Y9ZA 3HUVA 4EMEA 3B7IA 1LOKA 3VARA 4ZX8A 5DS0A 2GLFA 3WABA 4OC5A 1OBRA 1YMEA 2QYVA 4GM5A 4C84A 2PVVA 2C6CA 4LQGA 1CPSA 3MRUA 4B6ZA 2ZEGA 8CPAA 3K9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CBX A;  1LFW A;  4OC1 A;  1CPX A;  2GLJ A;  1Y0R A;  2V8G A;  3RAM A;  2PJ6 A;  4PXB A;  4P44 A;  4UIA A;  4P10 A;  3GB0 A;  4YU9 A;  3WC7 A;  1BAV A;  4PQA A;  4TJX A;  3SI2 A;  4W9Y A;  5ELY A;  1Z2L A;  2NYQ A;  3EIF A;  5LYL A;  4X2T A;  1Z5R A;  2WZN A;  3SJE A;  1DTD A;  4FAI A;  3T8W A;  4EWT A;  4C9R A;  5K8N A;  2PVW A;  4KSI A;  3BI0 A;  1XFO A;  4R8F A;  4C8U A;  2ZOF A;  1VHE A;  3BHX A;  3FX6 A;  3L2N A;  4MCS A;  2AFM A;  3D68 A;  2RB7 A;  4O23 A;  6CPA A;  1F57 A;  3TC8 A;  3FJU A;  3SI0 A;  7CPA A;  2F7V A;  2QVP A;  4A39 A;  2C1C A;  3D67 A;  1F2O A;  2PJ7 A;  1HDU A;  1UWY A;  5K8O A;  1R43 A;  1LCP A;  1HDQ A;  1PYT B;  4UEE A;  3QNV A;  2PJ8 A;  1VIX A;  1KWM A;  4DUK A;  5LYF A;  4PPZ A;  5JGF A;  3SI1 A;  2JBJ A;  3VTA A;  3BI1 A;  4C8P A;  3VAT A;  4P6Y A;  4IK2 A;  2EK8 A;  2C6P A;  3D7H A;  4C9E A;  2FVG A;  3H8G A;  4R76 A;  2PJ1 A;  3RBU A;  3CDX A;  4Z65 A;  5LYD A;  2PJ9 A;  5CPA A;  5LYI A;  3B3T A;  5LRG A;  2ZEM A;  1GYT A;  4UF4 A;  3IWW A;  3GUX A;  4F9U A;  2OOT A;  4ZY0 A;  5D8N A;  4OKO A;  1YLO A;  2XEG A;  5HVH A;  3IO1 A;  2ZEH A;  3KQX A;  4JZ0 A;  3BXM A;  3FED A;  1Z8L A;  1CX8 A;  3FH4 A;  3LWU A;  4ZY2 A;  3GLJ A;  3B3C A;  1AMP A;  1ZG8 A;  5K8M A;  1Q7L A;  1LAP A;  2ZEL A;  4H2K A;  3DGV A;  1WVM A;  3KI9 A;  3PB4 X;  4WWV A;  5JH9 A;  2JEW A;  2PIY A;  2ANP A;  2EK9 A;  3H8E A;  1QMU A;  3PB9 X;  1FT7 A;  3B35 A;  4JYW A;  2ZED A;  1HEE A;  1TKF A;  2AFO A;  3KR5 A;  3KL9 A;  3ISZ A;  4MXU A;  4A94 A;  1BLL E;  2Q51 A;  3D7D A;  1IY7 A;  4TJV A;  5LRK A;  3KR4 A;  1R3N A;  2CTB A;  3PBB A;  3PFE A;  4R6T A;  3PB7 X;  4NJR A;  4C8F A;  3NH4 A;  3WC6 A;  2NSM A;  2AFW A;  4PXD A;  3LMS A;  4AXV A;  2RFH A;  3I74 A;  4P45 A;  1YW6 A;  4P4D A;  2CTC A;  2PJ0 A;  3K2K A;  4EFD A;  1JQG A;  3CPX A;  3KAS A;  2PJA A;  2ZEP A;  1XF1 A;  4G1P A;  1AYE A;  2XEJ A;  2HB6 A;  3CPA A;  3S9N A;  1XJO A;  3PEI A;  4ZI6 A;  2V8V A;  4MCQ A;  4MHZ A;  1ZG9 A;  2AFU A;  2V8H A;  4R7M A;  3D7F A;  4DJL A;  3NA6 A;  3I6S A;  4NGN A;  2BO9 A;  2PRQ A;  3ISX A;  2PJ5 A;  3JRU A;  2ZEN A;  1EE3 P;  4UEZ A;  2ZEF A;  3FEC A;  2PJ4 A;  2BCO A;  2I3C A;  4MCR A;  4IAV A;  2XEF A;  1PCA A;  3PFO A;  4FWU A;  4NGM A;  4NGS A;  1H8L A;  3WT4 A;  4K3N A;  3ICU A;  2V8D A;  2ZOG A;  4FUU A;  3I1U A;  4UEF A;  2CIJ A;  5JM6 A;  4ONW A;  4P4F A;  1XRY A;  2PJB A;  4OC4 A;  2PCU A;  3IJ3 A;  3V38 A;  1XBU A;  4P4B A;  3RZA A;  4C9U A;  2AFS A;  2F8H A;  3D66 A;  4C8C A;  4PXC A;  4PXE A;  1V6C A;  4YN3 A;  3KQZ A;  2ZEE A;  2AFX A;  1IGB A;  4C9V A;  2JBK A;  2OR4 A;  4OIW A;  1LAM A;  3B3V A;  5LRJ A;  1FNO A;  3IEH A;  1RTQ A;  5K8P A;  2V77 A;  4TWE A;  4CDJ A;  5I4M A;  5D29 A;  2DEA A;  1BPM A;  1Y7E A;  5THW A;  4OC0 A;  3PRT A;  2PJC A;  1LAN A;  3KZW A;  4C85 A;  3PB8 X;  2EWB A;  4YWY A;  4FBE A;  4C86 A;  1CG2 A;  2POK A;  2G9D A;  4X8I A;  2O4H A;  3NH8 A;  4WJB A;  4KNG E;  2IJZ A;  4C9A A;  4MCP A;  1CP6 A;  3H8F A;  3FEE A;  1YW4 A;  1ZG7 A;  3MN8 A;  5HVG A;  1ELM P;  4IHM A;  4OP4 A;  3NFZ A;  3D4U A;  4P4I A;  4MHN A;  2XEI A;  1TF8 A;  4MHP A;  3WC5 A;  4NGP A;  2AFZ A;  4ZX9 A;  5CBM A;  5J1Q A;  3FF3 A;  1Y0Y A;  4RUH A;  4OID A;  4UIB A;  2C6G A;  3PB6 X;  1QQ9 A;  4F9V A;  2IQ6 A;  3S9M A;  2PJ3 A;  3B3S A;  3B2Y A;  3SJF A;  4C8T A;  1NSA A;  1M4L A;  1XMB A;  1TXR A;  4MHY A;  4MMO A;  1TKH A;  1ARM A;  3NH5 A;  4OC2 A;  2IMO A;  3KHX A;  4ZY1 A;  4BD9 A;  2PE3 A;  1VGY A;  5HXD A;  3VH9 A;  2Q4Z A;  4OME A;  4C8A A;  2J9A A;  2BOA A;  4ZYQ A;  4OC3 A;  5F09 A;  1YSJ A;  4NGQ A;  4NGR A;  3N5F A;  3V7Z A;  4F8Z A;  3KGQ A;  2Q43 A;  2QJ8 A;  2O53 A;  4NFR A;  4P4E A;  3S9L A;  2ABZ A;  5IB9 A;  1ZLI A;  4CPA A;  3HLP A;  4P4J A;  1ARL A;  3SJX A;  4A37 A;  2CF4 A;  2PIZ A;  4C99 A;  2PJ2 A;  4Q7A A;  4CDK A;  1CP7 A;  3B3W A;  3CT9 A;  2GRE A;  4NJQ A;  1TKJ A;  1F2P A;  3KHZ A;  1VHO A;  3D7G A;  3PBE A;  4DYO A;  3SJG A;  3IFE A;  1DE4 C;  2GU2 A;  3FMC A;  3DLJ A;  4MRI A;  2ZEO A;  3FVL A;  3IIB A;  4TNU A;  4NGT A;  3TX8 A;  2VL1 A;  1BPN A;  1ELL P;  4A38 A;  3IC1 A;  5HVF A;  2WYR A;  1ZLH A;  1TF9 A;  4X3R A;  2HC9 A;  1Y9Z A;  3HUV A;  4EME A;  3B7I A;  1LOK A;  3VAR A;  4ZX8 A;  5DS0 A;  2GLF A;  3WAB A;  4OC5 A;  1OBR A;  1YME A;  2QYV A;  4GM5 A;  4C84 A;  2PVV A;  2C6C A;  4LQG A;  1CPS A;  3MRU A;  4B6Z A;  2ZEG A;  8CPA A;  3K9T A; 
#chains in the Genus database with same CATH topology
 3TOB A;  1CBX A;  2Z3N A;  1LFW A;  3F5B A;  2R82 A;  4CO9 A;  2F5I A;  4OC1 A;  2Z0Z A;  1CPX A;  2GLJ A;  5HH1 A;  1Y0R A;  2V8G A;  4JXQ A;  3R1K A;  3RAM A;  5C88 A;  4EVY A;  2PJ6 A;  1A2Z A;  4PXB A;  4UFW A;  4P44 A;  2EBJ A;  2DPT A;  2PC1 A;  4P10 A;  4UIA A;  4CYQ A;  5JH9 A;  1PUA A;  4KOW A;  3GB0 A;  4ONU A;  3D2M A;  1IU8 A;  4JLY A;  4YU9 A;  3WC7 A;  3GIU A;  4XPD B;  1BAV A;  4KZT A;  4PQA A;  4TJX A;  2YNC C;  5H86 A;  3SI2 A;  4W9Y A;  3R9G A;  4UCM A;  1J3L A;  5ELY A;  2IL4 A;  5JVL A;  3D2P A;  4UFX A;  1Z2L A;  4ZBG A;  2FSR A;  1YVK A;  3R9E A;  2NYQ A;  2X7B A;  3EIF A;  1T36 B;  5LYL A;  4X2T A;  1Z5R A;  3V8I A;  4C2X A;  2D0O A;  5AG7 A;  2R1I A;  2WZN A;  4M6I A;  3SJE A;  1DTD A;  1GHE A;  2GE3 A;  3LD2 A;  4MFZ A;  3T8W A;  4FAI A;  3D8P A;  4EWT A;  1EZB A;  4C9R A;  4MFL A;  3NE8 A;  1CS0 B;  5K8N A;  2PVW A;  1DIK A;  3KKW A;  4MBU A;  4JVO A;  1IB1 E;  1YR0 A;  2B3U A;  2P6G A;  2ATR A;  4KSI A;  3BI0 A;  1ZO0 A;  1XFO A;  4R8F A;  1C30 B;  4C8U A;  1QSR A;  2KCW A;  2ZOF A;  4NCZ A;  3RYO A;  1VHE A;  3BHX A;  3FX6 A;  4BIN A;  1KC7 A;  3L2N A;  4MCS A;  2AFM A;  2WPW A;  4F6A A;  5A27 A;  3ZNI A;  3D68 A;  2R7H A;  2RB7 A;  3HMJ G;  1VHS A;  4MFK A;  4O23 A;  4KOV A;  1F57 A;  6CPA A;  3TC8 A;  1VBH A;  4XPL A;  3TO6 A;  5DWN A;  2H5M A;  2ZW6 A;  3FJU A;  3SI0 A;  7CPA A;  2F7V A;  2QVP A;  4A39 A;  1XOV A;  2C1C A;  1X10 A;  3D67 A;  3OP0 A;  4HNY B;  2PQ8 A;  1F2O A;  5F46 A;  2PJ7 A;  1IID A;  3K9U A;  3BUN B;  1HDU A;  2P6E A;  3DNS A;  4X5K A;  1UWY A;  5K8O A;  2VXK A;  4H6Z A;  4R57 A;  3FNC A;  1R43 A;  4NSQ A;  4AVA A;  2E28 A;  1LCP A;  2MP0 A;  2UV8 G;  1HDQ A;  1PYT B;  4UEE A;  3QNV A;  5JPH A;  3T07 A;  2PJ8 A;  1VIX A;  2ZPA A;  1KWM A;  4DUK A;  1X12 A;  3VRO A;  4KLV A;  5IB0 A;  4PPZ A;  5LYF A;  4COB A;  3U1B A;  4PK2 A;  3T9Y A;  1QSM A;  4YFJ A;  5JGF A;  3I9S A;  5HKZ A;  3W91 A;  3H5Z A;  2JBJ A;  3SI1 A;  3VTA A;  3EO4 A;  2DIK A;  3BI1 A;  4FD4 A;  4CRZ B;  3VAT A;  2ARH A;  5BWA B;  4P6Y A;  3S6G A;  1Q2C A;  4IK2 A;  5IX3 A;  2EK8 A;  2C6P A;  4R87 A;  3D7H A;  5J8C A;  5FVJ A;  4C9E A;  2FVG A;  3H8G A;  2GIV A;  2I79 A;  4CYO A;  4R76 A;  5HMN A;  4OAE A;  4CYN A;  3PP9 A;  4RR2 B;  3BUO B;  1YVO A;  2PJ1 A;  2AE6 A;  3RBU A;  2HUZ A;  3CDX A;  4H6U A;  4Z65 A;  5AG5 A;  1KUV A;  3JVN A;  1KUY A;  2FXF A;  2Z3L A;  3FB3 A;  1A9X B;  4C2Z A;  5G1Z A;  5LYD A;  2PJ9 A;  5CPA A;  4B12 A;  3BUM B;  2HV2 A;  4CAF A;  3PLF B;  3GJZ A;  2J8N A;  2R8V A;  5LYI A;  5F13 A;  4Y49 C;  2QML A;  3ZZI A;  3B3T A;  4E94 A;  3TLY A;  5LRG A;  4MY0 A;  2ZEM A;  1GYT A;  4UF4 A;  3IWW A;  4B11 A;  5G21 A;  5ISV A;  3GUX A;  1VKC A;  4KLW A;  4F9U A;  2OOT A;  4ZY0 A;  3BUX B;  5D8N A;  4MHD A;  3HPG G;  1YLO A;  4OKO A;  2XEG A;  2AJ6 A;  4KOU A;  2XPL A;  4MFJ A;  3PT1 A;  3IGR A;  5HVH A;  3IO1 A;  4UFV A;  4UWJ A;  2VI7 A;  2JLM A;  2ZEH A;  3KQX A;  4JZ0 A;  4AVB A;  1KZF A;  4B5P B;  2AUM A;  1WK4 A;  3DR8 A;  3BXM A;  3FED A;  3PZJ A;  2Q4Y A;  1Z8L A;  2D4O A;  1VI4 A;  1CX8 A;  3FH4 A;  2Z10 A;  3CXQ A;  3LWU A;  3GLJ A;  4ZY2 A;  2FT0 A;  3TLA A;  3B3C A;  4KOY A;  3U88 C;  1MJ9 A;  1AMP A;  4CGN A;  1ZG8 A;  5K8M A;  1M44 A;  1QST A;  3IU2 A;  4UWI A;  1Q7L A;  1LAP A;  2ZEL A;  3EY5 A;  3DGV A;  1YVH A;  1MK4 A;  3C26 A;  2WSA A;  4H2K A;  4B5O A;  1WVM A;  2YJT A;  3SR3 A;  5JQ4 A;  3KI9 A;  3MGD A;  3PB4 X;  1XIX A;  4KOS A;  4RI1 A;  2JEW A;  2PIY A;  4WWV A;  2ANP A;  2EK9 A;  3H8E A;  1QMU A;  2BSW A;  2VEZ A;  1CE8 B;  3WR7 A;  1SQH A;  3GY9 A;  3PB9 X;  4XNH C;  4CS0 B;  1WWZ A;  1FT7 A;  3B35 A;  4INJ A;  4MI4 A;  4JYW A;  2ZED A;  5E96 A;  1HEE A;  1B47 A;  3ZJ0 A;  1TKF A;  3FIX A;  2AFO A;  2BEI A;  2R98 A;  3KR5 A;  4GXH A;  1EO0 A;  3KL9 A;  3ISZ A;  4MXU A;  4A94 A;  4J3G A;  1BLL E;  4MJ8 A;  1VBG A;  2XPN A;  2Y1N A;  4A4C A;  1YGH A;  5F49 A;  2Q51 A;  3D7D A;  1IY7 A;  2VZZ A;  4TJV A;  5LRK A;  3KR4 A;  1XMT A;  4PV6 A;  1R3N A;  2CTB A;  3PBB A;  3PFE A;  3TT2 A;  3EZE A;  4R6T A;  3PB7 X;  4NJR A;  4C8F A;  4QVT A;  5GCN A;  1Z4E A;  4A33 A;  3N7Z A;  2B3V A;  3NH4 A;  1N71 A;  3WC6 A;  4PSX A;  4CRY B;  2NSM A;  2D4P A;  5AXI A;  2CY2 A;  3TO7 A;  3TLG A;  1Z9U A;  4IIY A;  2AFW A;  4L89 A;  3LMS A;  4PXD A;  4AXV A;  3FXT A;  2RFH A;  2JEV A;  4RS2 A;  3I74 A;  4P45 A;  1S7L A;  1YW6 A;  3VWE A;  4JD6 A;  1IOF A;  4P4D A;  1IYK A;  4KUB A;  1M4G A;  4NF1 A;  5C82 A;  3S6K A;  2CTC A;  2J8M A;  1I21 A;  2PJ0 A;  2WUU A;  4R9M A;  2JDD A;  3I3G A;  3K2K A;  4KSA A;  1I12 A;  1QSO A;  2EUI A;  4EFD A;  3A9L A;  1JQG A;  4MFP A;  1NXJ A;  5AG4 A;  1GGO A;  3CPX A;  3KAS A;  1FBV A;  2FS5 A;  4KOR A;  4LQ6 A;  2PJA A;  4OAD A;  1UFH A;  4EYS A;  2ZEP A;  1XF1 A;  1M1D A;  2EVN A;  1AYE A;  2XEJ A;  4G1P A;  4A2Z A;  5FD8 A;  2HB6 A;  2VBQ A;  3CPA A;  3S9N A;  1XJO A;  3PEI A;  3S6F A;  4A95 A;  4ZI6 A;  2CNM A;  2EZB A;  2V8V A;  3T05 A;  4MCQ A;  3EFA A;  3IWG A;  4MHZ A;  5G20 A;  2CNS A;  1KEE B;  1R61 A;  1ZG9 A;  3T90 A;  3G3S A;  4MI1 A;  2PSW A;  2OZH A;  4NXY A;  2AFU A;  4XPK A;  4CGO A;  2V8H A;  5J3X A;  1Z8T A;  3GYA A;  4R7M A;  2B4J C;  3TLE A;  3D7F A;  5AG6 A;  1RO5 A;  4DJL A;  3NA6 A;  4AB7 A;  3PFV A;  3I6S A;  4CGL A;  3R9F A;  1ON0 A;  5K99 A;  3H4Q A;  5JYB A;  5F1Y A;  4NGN A;  2BO9 A;  2PRQ A;  3F0A A;  1J4J A;  4CAE A;  4C84 A;  4KVO E;  4KOT A;  3ISX A;  2PJ5 A;  2Q7S A;  1EE3 P;  2YNC A;  2Z3K A;  2ZEN A;  3B8G A;  3JRU A;  3NFQ A;  4HKF A;  5F48 A;  1Y7R A;  2OLS A;  2BL1 A;  2Z3M A;  4C2Y A;  4UEZ A;  4J0N A;  2ZEF A;  3VRQ A;  2ZW4 A;  3BLN A;  1KUX A;  5KTD A;  1NBW A;  3FEC A;  3BJ8 A;  4JXR A;  4CAV A;  4L8A A;  3T0T A;  2PJ4 A;  2BCO A;  2I3C A;  4MCR A;  3DR6 A;  2XEF A;  4IAV A;  1PCA A;  3PFO A;  2YGW A;  4FWU A;  4PK3 A;  4NGM A;  1S5K A;  4NGS A;  2Y1M A;  1H8L A;  3TYX A;  3WT4 A;  2DXQ A;  4K3N A;  3ICU A;  2V8D A;  2ZOG A;  4B14 A;  2DF5 A;  5F9M A;  4M85 A;  1R57 A;  4OLL A;  5EC4 A;  4FUU A;  3I1U A;  4UEF A;  2CIJ A;  5JM6 A;  1S7N A;  4JJX A;  4ONW A;  4P4F A;  4B10 A;  1XRY A;  2PJB A;  4OC4 A;  5EBV A;  2PCU A;  3IJ3 A;  3OAK A;  5G22 A;  3V38 A;  3P2H A;  1XBU A;  4P4B A;  2B58 A;  3R95 A;  3RZA A;  4C9U A;  4E8O A;  1S3Z A;  4XPD C;  4BBH A;  2AFS A;  5F5X A;  2F8H A;  1IYL A;  3D66 A;  3G8W A;  4KUA A;  3QB8 A;  2BUE A;  4JWP A;  4CGP A;  2AUN A;  4C8C A;  5BY0 A;  4PXC A;  1M4I A;  4PXE A;  1V6C A;  3C8O A;  4YN3 A;  3KQZ A;  2ZEE A;  1TIQ A;  2AFX A;  3EC4 A;  1M4D A;  1IGB A;  4C9V A;  2C27 A;  2JBK A;  2OR4 A;  4OIW A;  1OZP A;  4UCN A;  2QEC A;  1LAM A;  3B3V A;  5LRJ A;  2Q7B A;  3TCV A;  3TLC A;  1FNO A;  1NMT A;  3BJ7 A;  3IEH A;  4IUS A;  3S6H A;  4CAW A;  2FIW A;  1Z4R A;  1MJA A;  5J8F A;  1RTQ A;  5K8P A;  1B6B A;  2V77 A;  4TWE A;  4CDJ A;  5HKW A;  5I4M A;  2DLA A;  5D29 A;  3F9K C;  4A30 A;  4FD5 A;  2DEA A;  4R3K A;  1BPM A;  2Z11 A;  1Y7E A;  4R3L A;  4U5Y A;  5THW A;  4OC0 A;  5CNP A;  1ZYM A;  3CXP A;  3QAH A;  2PRB A;  3PRT A;  1L0C A;  2PJC A;  3DDD A;  4H1H A;  3TE4 A;  3R96 A;  1LAN A;  3KZW A;  4C85 A;  2HRO A;  3PB8 X;  2EWB A;  4YWY A;  4FBE A;  2ZW5 A;  3NOJ A;  1B87 A;  2B5G A;  3TLB A;  4C86 A;  2B0A A;  1CG2 A;  2POK A;  2G9D A;  4X8I A;  1Z9E A;  1FY7 A;  3VRP A;  2Z3O A;  3FRM A;  2O4H A;  1Q5X A;  3NH8 A;  4WJB A;  2D0P A;  3KRV A;  4KNG E;  2GP4 A;  2WPX A;  1EZA A;  2IJZ A;  2FCK A;  4C9A A;  1NE9 A;  4MCP A;  1CP6 A;  1K4J A;  3H8F A;  4M6G A;  3W6X A;  3FEE A;  3OB1 B;  2Z3P A;  1YW4 A;  3CXS A;  3TTH A;  1ZG7 A;  3MN8 A;  5HVG A;  1ELM P;  4E0A A;  3E0K A;  4IHM A;  2A4N A;  4OP4 A;  1JDE A;  3K4I A;  1P0H A;  2HI6 A;  3NFZ A;  1PU9 A;  4HNX B;  3VRR A;  4LX9 A;  2PDO A;  4AG7 A;  3D4U A;  3TLG B;  4P4I A;  2VQY A;  4MHN A;  4NEX A;  2XEI A;  1TF8 A;  4MHP A;  1I1D A;  3WC5 A;  4NGP A;  4M3S A;  2EZA A;  4DNC A;  5DWM A;  4KS9 A;  2AFZ A;  4Y49 B;  4FD6 A;  4BMH A;  4YGO A;  1Y9K A;  2OU2 A;  4ZX9 A;  4E2A A;  5CBM A;  4AVC A;  3FF3 A;  5J1Q A;  4H89 A;  1Y0Y A;  1JDB C;  4U9Z A;  1AUG A;  2OB0 A;  4OID A;  1XE4 A;  4RUH A;  2EZC A;  4UIB A;  2C6G A;  1M6V B;  1YLE A;  5KTA A;  1BXR B;  1MJB A;  3PB6 X;  2FE7 A;  1QQ9 A;  4F9V A;  2Q04 A;  4C7H A;  2IQ6 A;  1C3O B;  2OH1 A;  2P0W A;  1BOB A;  3S9M A;  4C68 A;  2N3A B;  2PJ3 A;  2Q44 A;  1YQE A;  3D3S A;  3TLZ A;  3B3S A;  4MY3 A;  2FM4 A;  3B2Y A;  3SJF A;  2GAN A;  1CJW A;  5EMI A;  4BTF A;  1NSA A;  3SHP A;  4C8T A;  4QB9 A;  3IU1 A;  2REE A;  1M4L A;  1LRZ A;  1XMB A;  2K5T A;  3HPH E;  1YK3 A;  1TXR A;  4MHY A;  4MMO A;  3BUW B;  4BPW B;  1ARM A;  1TKH A;  3NH5 A;  4OC2 A;  2YND A;  4UA3 A;  2B4B A;  5A28 A;  2IMO A;  5IR2 A;  4U9Y A;  3KHX A;  4AG9 A;  4ZY1 A;  4BD9 A;  3QAY A;  1NSL A;  2G3A A;  3TOA A;  2G0B A;  2J8R A;  1Z8W A;  2PE3 A;  1VGY A;  4XNH B;  1P4N A;  1S60 A;  3VH9 A;  5HXD A;  5KTC A;  2Q4Z A;  4OME A;  3TO9 A;  2HQY A;  4C8A A;  2YJV A;  2EO8 A;  2NMT A;  1Z8X A;  2J9A A;  2BOA A;  4ZYQ A;  4OC3 A;  2I00 A;  3FYN A;  5F09 A;  4E5S A;  1IOI A;  1YSJ A;  2PCN A;  4NGQ A;  4NGR A;  2ODF A;  3N5F A;  4KVX A;  3G23 A;  3V7Z A;  4F8Z A;  1RXT A;  3KGQ A;  4KOX A;  3GKR A;  1YX0 A;  4HPS A;  2Q43 A;  2FL4 A;  2QJ8 A;  2O53 A;  4NFR A;  4QUS A;  4P4E A;  3S9L A;  3JUW A;  1Y9W A;  5H84 A;  2ABZ A;  5IB9 A;  1Q2D A;  1ZLI A;  4MFQ A;  3IWE A;  4CPA A;  3HLP A;  4P4J A;  4ORF A;  3T5M A;  4HNW B;  2RC4 A;  1BO4 A;  2YNE A;  3JTK A;  4I49 A;  1CM0 A;  1ARL A;  4F0Y A;  5IV0 A;  4K30 A;  1ZRS A;  3SJX A;  4A37 A;  2Y0M A;  2CF4 A;  2PIZ A;  4A32 A;  4C99 A;  4COG A;  2O28 A;  2PJ2 A;  4Q7A A;  3SXN A;  3LOD A;  2Q4V A;  4FD7 A;  4CDK A;  1CP7 A;  3B3W A;  3CT9 A;  1WJT A;  2GRE A;  4C8P A;  4NJQ A;  1KBL A;  1TKJ A;  1F2P A;  2QIR A;  3VRN A;  2OZU A;  1VHO A;  3KHZ A;  3NE7 A;  4KVM E;  3VWD A;  3D7G A;  4Q38 A;  3PGP A;  3PBE A;  4RN7 A;  1V0C A;  4A4B A;  4DYO A;  2FIA A;  5I0C A;  3SJG A;  3EZB A;  3IFE A;  1DE4 C;  2ZXV A;  4MJX A;  3CZX A;  2GU2 A;  2OZG A;  3VGO A;  1YRE A;  4YRH A;  4CYP A;  3OB2 B;  2C5Q A;  5AGE A;  5F47 A;  2PR8 A;  3FMC A;  3RNZ A;  3OWC A;  3DLJ A;  4II9 A;  2PR1 A;  4MRI A;  3SXO A;  4CAX A;  2ZEO A;  2VKZ G;  4QBJ A;  4KSF A;  1JWQ A;  3FVL A;  4UBR A;  4UCP A;  2CBL A;  3LAC A;  2JDC A;  3IIB A;  4TNU A;  3F8K A;  4M6H A;  2ZW7 A;  1Q2Y A;  4M8D A;  4NGT A;  2VZY A;  2Q0Y A;  3TX8 A;  2B4D B;  1QSN A;  1BPN A;  1ELL P;  2VL1 A;  3W6S A;  3IC1 A;  4A38 A;  1ZL0 A;  2CXA A;  1U6M A;  4BPU B;  5HVF A;  4IIX A;  2B4D A;  1S7K A;  2X0S A;  4ZGY B;  2XPO A;  4C7I A;  3UY5 A;  4F0X A;  2WYR A;  4CGM A;  3EXN A;  1ZLH A;  2CNT A;  1TF9 A;  3P2F A;  4X3R A;  2HC9 A;  1Y9Z A;  4GS4 A;  3HUV A;  2B5G B;  1IIC A;  4CZ1 A;  3O8Z A;  4BPX B;  3DSB A;  4GPL B;  3RO0 A;  4Q36 A;  4EME A;  3B7I A;  3EZA A;  1LOK A;  4LUA A;  1XF8 A;  4ZX8 A;  3VAR A;  5DS0 A;  2HWG A;  2GLF A;  4B5P A;  3WAB A;  2DPS A;  4OC5 A;  1OBR A;  1XEB A;  1YME A;  2QYV A;  4GM5 A;  4QC6 A;  2G3T A;  4PSW A;  2PVV A;  1S7F A;  2XPP A;  2C6C A;  4B13 A;  4LQG A;  1CPS A;  3FBU A;  2REF A;  3MRU A;  4B6Z A;  2GFQ A;  4IF5 A;  2P6F A;  2ZEG A;  8CPA A;  4A31 A;  3TFY A;  3K9T A;  5HKY A; 
#chains in the Genus database with same CATH homology
 1CBX A;  1LFW A;  4OC1 A;  1CPX A;  2GLJ A;  1Y0R A;  2V8G A;  3RAM A;  2PJ6 A;  4PXB A;  4P44 A;  4UIA A;  4P10 A;  3GB0 A;  4YU9 A;  3WC7 A;  1BAV A;  4PQA A;  4TJX A;  3SI2 A;  4W9Y A;  5ELY A;  1Z2L A;  2NYQ A;  3EIF A;  5LYL A;  4X2T A;  1Z5R A;  2WZN A;  3SJE A;  1DTD A;  4FAI A;  3T8W A;  4EWT A;  4C9R A;  5K8N A;  2PVW A;  4KSI A;  3BI0 A;  1XFO A;  4R8F A;  4C8U A;  2ZOF A;  1VHE A;  3BHX A;  3FX6 A;  3L2N A;  4MCS A;  2AFM A;  3D68 A;  2RB7 A;  4O23 A;  6CPA A;  1F57 A;  3TC8 A;  3FJU A;  3SI0 A;  7CPA A;  2F7V A;  2QVP A;  4A39 A;  2C1C A;  3D67 A;  1F2O A;  2PJ7 A;  1HDU A;  1UWY A;  5K8O A;  1R43 A;  1LCP A;  1HDQ A;  1PYT B;  4UEE A;  3QNV A;  2PJ8 A;  1VIX A;  1KWM A;  4DUK A;  5LYF A;  4PPZ A;  5JGF A;  3SI1 A;  2JBJ A;  3VTA A;  3BI1 A;  4C8P A;  3VAT A;  4P6Y A;  4IK2 A;  2EK8 A;  2C6P A;  3D7H A;  4C9E A;  2FVG A;  3H8G A;  4R76 A;  2PJ1 A;  3RBU A;  3CDX A;  4Z65 A;  5LYD A;  2PJ9 A;  5CPA A;  5LYI A;  3B3T A;  5LRG A;  2ZEM A;  1GYT A;  4UF4 A;  3IWW A;  3GUX A;  4F9U A;  2OOT A;  4ZY0 A;  5D8N A;  4OKO A;  1YLO A;  2XEG A;  5HVH A;  3IO1 A;  2ZEH A;  3KQX A;  4JZ0 A;  3BXM A;  3FED A;  1Z8L A;  1CX8 A;  3FH4 A;  3LWU A;  4ZY2 A;  3GLJ A;  3B3C A;  1AMP A;  1ZG8 A;  5K8M A;  1Q7L A;  1LAP A;  2ZEL A;  4H2K A;  3DGV A;  1WVM A;  3KI9 A;  3PB4 X;  4WWV A;  5JH9 A;  2JEW A;  2PIY A;  2ANP A;  2EK9 A;  3H8E A;  1QMU A;  3PB9 X;  1FT7 A;  3B35 A;  4JYW A;  2ZED A;  1HEE A;  1TKF A;  2AFO A;  3KR5 A;  3KL9 A;  3ISZ A;  4MXU A;  4A94 A;  1BLL E;  2Q51 A;  3D7D A;  1IY7 A;  4TJV A;  5LRK A;  3KR4 A;  1R3N A;  2CTB A;  3PBB A;  3PFE A;  4R6T A;  3PB7 X;  4NJR A;  4C8F A;  3NH4 A;  3WC6 A;  2NSM A;  2AFW A;  4PXD A;  3LMS A;  4AXV A;  2RFH A;  3I74 A;  4P45 A;  1YW6 A;  4P4D A;  2CTC A;  2PJ0 A;  3K2K A;  4EFD A;  1JQG A;  3CPX A;  3KAS A;  2PJA A;  2ZEP A;  1XF1 A;  4G1P A;  1AYE A;  2XEJ A;  2HB6 A;  3CPA A;  3S9N A;  1XJO A;  3PEI A;  4ZI6 A;  2V8V A;  4MCQ A;  4MHZ A;  1ZG9 A;  2AFU A;  2V8H A;  4R7M A;  3D7F A;  4DJL A;  3NA6 A;  3I6S A;  4NGN A;  2BO9 A;  2PRQ A;  3ISX A;  2PJ5 A;  3JRU A;  2ZEN A;  1EE3 P;  4UEZ A;  2ZEF A;  3FEC A;  2PJ4 A;  2BCO A;  2I3C A;  4MCR A;  4IAV A;  2XEF A;  1PCA A;  3PFO A;  4FWU A;  4NGM A;  4NGS A;  1H8L A;  3WT4 A;  4K3N A;  3ICU A;  2V8D A;  2ZOG A;  4FUU A;  3I1U A;  4UEF A;  2CIJ A;  5JM6 A;  4ONW A;  4P4F A;  1XRY A;  2PJB A;  4OC4 A;  2PCU A;  3IJ3 A;  3V38 A;  1XBU A;  4P4B A;  3RZA A;  4C9U A;  2AFS A;  2F8H A;  3D66 A;  4C8C A;  4PXC A;  4PXE A;  1V6C A;  4YN3 A;  3KQZ A;  2ZEE A;  2AFX A;  1IGB A;  4C9V A;  2JBK A;  2OR4 A;  4OIW A;  1LAM A;  3B3V A;  5LRJ A;  1FNO A;  3IEH A;  1RTQ A;  5K8P A;  2V77 A;  4TWE A;  4CDJ A;  5I4M A;  5D29 A;  2DEA A;  1BPM A;  1Y7E A;  5THW A;  4OC0 A;  3PRT A;  2PJC A;  1LAN A;  3KZW A;  4C85 A;  3PB8 X;  2EWB A;  4YWY A;  4FBE A;  4C86 A;  1CG2 A;  2POK A;  2G9D A;  4X8I A;  2O4H A;  3NH8 A;  4WJB A;  4KNG E;  2GP4 A;  2IJZ A;  4C9A A;  4MCP A;  1CP6 A;  3H8F A;  3FEE A;  1YW4 A;  1ZG7 A;  3MN8 A;  5HVG A;  1ELM P;  4IHM A;  4OP4 A;  3NFZ A;  3D4U A;  4P4I A;  4MHN A;  2XEI A;  1TF8 A;  4MHP A;  3WC5 A;  4NGP A;  2AFZ A;  4ZX9 A;  5CBM A;  5J1Q A;  3FF3 A;  1Y0Y A;  4RUH A;  4OID A;  4UIB A;  2C6G A;  3PB6 X;  1QQ9 A;  4F9V A;  2IQ6 A;  3S9M A;  2PJ3 A;  3B3S A;  3B2Y A;  3SJF A;  4C8T A;  1NSA A;  1M4L A;  1XMB A;  1TXR A;  4MHY A;  4MMO A;  1TKH A;  1ARM A;  3NH5 A;  4OC2 A;  2IMO A;  5IR2 A;  3KHX A;  4ZY1 A;  4BD9 A;  2PE3 A;  1VGY A;  5HXD A;  3VH9 A;  2Q4Z A;  4OME A;  4C8A A;  2J9A A;  2BOA A;  4ZYQ A;  4OC3 A;  5F09 A;  1YSJ A;  4NGQ A;  4NGR A;  3N5F A;  3V7Z A;  4F8Z A;  3KGQ A;  2Q43 A;  2QJ8 A;  2O53 A;  4NFR A;  4P4E A;  3S9L A;  2ABZ A;  5IB9 A;  1ZLI A;  4CPA A;  3HLP A;  4P4J A;  1ARL A;  3SJX A;  4A37 A;  2CF4 A;  2PIZ A;  4C99 A;  2PJ2 A;  4Q7A A;  4CDK A;  1CP7 A;  3B3W A;  3CT9 A;  2GRE A;  4NJQ A;  1TKJ A;  1F2P A;  3KHZ A;  1VHO A;  3D7G A;  3PBE A;  4DYO A;  3SJG A;  3IFE A;  1DE4 C;  2GU2 A;  2C5Q A;  3FMC A;  3DLJ A;  4MRI A;  2ZEO A;  3FVL A;  3IIB A;  4TNU A;  4NGT A;  3TX8 A;  2VL1 A;  1BPN A;  1ELL P;  4A38 A;  3IC1 A;  5HVF A;  2WYR A;  1ZLH A;  1TF9 A;  4X3R A;  2HC9 A;  1Y9Z A;  3HUV A;  4EME A;  3B7I A;  1LOK A;  3VAR A;  4ZX8 A;  5DS0 A;  2GLF A;  3WAB A;  4OC5 A;  1OBR A;  1YME A;  2QYV A;  4GM5 A;  4C84 A;  2PVV A;  2C6C A;  4LQG A;  1CPS A;  3MRU A;  4B6Z A;  2ZEG A;  8CPA A;  3K9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...