5ELYA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a hydroxamate inhibitor jhu242
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
696
structure length
682
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unprecedented Binding Mode of Hydroxamate-Based Inhibitors of Glutamate Carboxypeptidase II: Structural Characterization and Biological Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 252
structure length 682
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2015-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 5elyA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5elyA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 5elyA02
2ZEPA 4F9VA 4C9VA 4NGRA 3VH9A 3WC5A 3WC7A 1QQ9A 1BPNA 3H8GA 3LMSA 4IK2A 3PRTA 3FJUA 2OOTA 2Q51A 3I1UA 4TWEA 2F8HA 1LAPA 4A38A 1XF1A 5IB9A 2PIZA 4P45A 3FEDA 7CPAA 3FX6A 2QYVA 3FECA 3PBBA 4NGNA 4C8AA 4ZI6A 5HVFA 2BOAA 4ONWA 1M4LA 4EFDA 4ZX9A 4R76A 2AFXA 3S9MA 4A39A 4P4FA 3BHXA 2NSMA 2Q4ZA 1VHOA 1ELMP 4P44A 2BCOA 3NFZA 5LRJA 4ZX8A 1ZLIA 1HDQA 4O23A 2PJ6A 1CPXA 1JQGA 3CPXA 3RAMA 2EK9A 2XEFA 4B6ZA 3FF3A 3V38A 4EMEA 4KSIA 2V8GA 4P4DA 2V77A 3FH4A 2ZEHA 3BXMA 1XBUA 3IFEA 1OBRA 4OC3A 3PB9X 3GUXA 1RTQA 4F8ZA 3SJFA 1V6CA 3D7GA 2V8VA 4CPAA 4C9AA 4NJQA 2PJ8A 3PB6X 3KHZA 2VL1A 4MHYA 5K8OA 4C9UA 4C8FA 4ZY0A 3IEHA 4PXEA 3PB7X 3DLJA 2C6PA 3RZAA 1TF9A 1HEEA 2DEAA 2JBJA 4TNUA 1TKJA 3KZWA 3VATA 2PJ2A 1PCAA 3KL9A 3SI0A 5CPAA 2J9AA 2PE3A 5K8PA 5JH9A 4PQAA 3D4UA 2XEGA 3B35A 4NGSA 1XRYA 2V8DA 1KWMA 2ZEOA 3PFOA 1BAVA 3D7FA 3GB0A 2C6CA 1LANA 2AFSA 1ZLHA 3IO1A 3S9NA 3KASA 2PJ0A 3GLJA 3BI1A 5LRGA 1YLOA 2ZEMA 3K2KA 4C9EA 2JBKA 4UIAA 1Z8LA 1CG2A 2PJ4A 3MRUA 1GYTA 2GU2A 4OKOA 1TF8A 3RBUA 2PVWA 3NH5A 4ZY2A 4OP4A 3ISZA 4NFRA 4R7MA 1ARMA 2ZELA 2XEJA 1BPMA 3SI2A 4C8UA 2GREA 4MHNA 5K8NA 1FT7A 2PCUA 4YN3A 5LYLA 2GLJA 4TJVA 3SJXA 1VIXA 3WABA 3HUVA 2IMOA 5JGFA 4LQGA 4P4JA 5LYIA 2CIJA 3VTAA 3KI9A 3NH8A 3KHXA 4OC0A 3PB4X 4ZYQA 4MRIA 2CF4A 1HDUA 3NH4A 3V7ZA 4OC1A 3KR4A 3PBEA 5LYFA 2PJ1A 1R3NA 5D29A 2PJAA 6CPAA 2ANPA 3PEIA 2PVVA 1Q7LA 1FNOA 2BO9A 2NYQA 3D67A 3B7IA 1YSJA 1Z2LA 3H8EA 5HVGA 4C85A 3N5FA 1CBXA 2Q43A 3VARA 4P10A 4P6YA 1DE4C 2ZENA 2O53A 4MCSA 1NSAA 3FMCA 4IHMA 4MCRA 4OIDA 1LAMA 4C8PA 5DS0A 4DJLA 1AMPA 1F2PA 3BI0A 1TKHA 2PJCA 4W9YA 2WYRA 3WT4A 3T8WA 1CP6A 4OC5A 5LYDA 4BD9A 2PJ7A 1H8LA 3IC1A 3EIFA 4OC2A 2AFUA 4C99A 1Z5RA 4MHZA 4YWYA 4EWTA 1WVMA 3B2YA 3MN8A 2JEWA 3CDXA 3DGVA 3NA6A 3SJGA 2ZEDA 4C86A 3H8FA 1DTDA 5JM6A 3TC8A 2QVPA 1ZG8A 4X2TA 1ZG7A 3CT9A 4P4EA 4WJBA 2PJ5A 3KGQA 4PXCA 5THWA 5J1QA 3L2NA 2EWBA 1ARLA 1YW4A 1CPSA 1IGBA 4GM5A 2ZEFA 2AFWA 4A94A 4MCQA 4NGQA 4RUHA 2ZEEA 2O4HA 4JYWA 2HB6A 1XJOA 1VGYA 4G1PA 3D7HA 4OIWA 4MHPA 1Y0YA 3ISXA 3B3SA 5CBMA 4NJRA 2C6GA 2HC9A 3B3VA 3WC6A 2AFZA 8CPAA 1YW6A 4X8IA 1F57A 1BLLE 2XEIA 2PJ3A 4ZY1A 4CDJA 4P4BA 4NGMA 4UEEA 4F9UA 4UIBA 4KNGE 3TX8A 1EE3P 4Z65A 4NGPA 2PRQA 3I74A 2ZOGA 3B3CA 2WZNA 4AXVA 4PXBA 1XFOA 1YMEA 1VHEA 5K8MA 4X3RA 4PPZA 5HVHA 3ICUA 3SI1A 4H2KA 1TKFA 3IJ3A 1Y7EA 2PIYA 4FBEA 1ELLP 1ZG9A 2PJBA 2OR4A 4C8CA 4MXUA 2AFOA 1TXRA 2V8HA 3LWUA 1Y9ZA 2RB7A 3D68A 4R6TA 1UWYA 4C8TA 3KR5A 2IQ6A 4DUKA 3FEEA 3CPAA 3D66A 4TJXA 4UEZA 4MMOA 2ZEGA 3B3TA 2I3CA 4FAIA 4P4IA 2EK8A 4MCPA 3I6SA 1LOKA 3S9LA 1XMBA 2CTBA 3PFEA 1Y0RA 5HXDA 1QMUA 3QNVA 3B3WA 3IWWA 3FVLA 1CX8A 4C9RA 4OC4A 3D7DA 5D8NA 3K9TA 3SJEA 4UEFA 4JZ0A 2C1CA 4DYOA 1CP7A 4PXDA 1F2OA 2G9DA 4WWVA 2F7VA 2ZOFA 4YU9A 2ABZA 1PYTB 3IIBA 4CDKA 1AYEA 1IY7A 4A37A 4UF4A 3HLPA 4NGTA 3PB8X 2AFMA 2QJ8A 2CTCA 4OMEA 3KQXA 4C84A 5F09A 3KQZA 5I4MA 3JRUA 1R43A 2PJ9A 2RFHA 4FWUA 1LCPA 5ELYA 5LRKA 4IAVA 4FUUA 2IJZA 2POKA 4K3NA 1LFWA 2FVGA 4Q7AA 2GLFA 4R8FA
chains in the Genus database with same CATH superfamily
4L89A 3D8PA 4JD6A 2ZEPA 4PK3A 4F9VA 1ZYMA 4C9VA 2CBLA 4NGRA 3VH9A 3WC5A 2HQYA 3WC7A 3NOJA 4A4CA 1QQ9A 2GP4A 1BPNA 4M8DA 3H8GA 3LMSA 4IK2A 1XF8A 4FD7A 3PRTA 1QSRA 3FJUA 2OOTA 1IOIA 2Q51A 3I1UA 4TWEA 1ZL0A 2F8HA 1LAPA 4A38A 1XF1A 3EC4A 4E0AA 1BOBA 5IB9A 2PIZA 3S6KA 4GXHA 3VRRA 1IYLA 3CXSA 1L0CA 2PC1A 5C88A 4P45A 3TFYA 4LUAA 3FEDA 7CPAA 4UCMA 3FX6A 2QYVA 3FECA 5E96A 3PBBA 3V8IA 4NGNA 2B4DA 2G0BA 4UBRA 1R57A 4C8AA 2ARHA 1YVKA 4KVOE 4KSFA 4RN7A 5CNPA 4ZI6A 4QVTA 5HVFA 2BOAA 3SR3A 4R9MA 4A31A 4ONWA 2CXAA 2OZHA 4UWIA 2EZCA 1Z9UA 1M4LA 1QSNA 1XMTA 3GKRA 3I3GA 4EFDA 4YGOA 1C30B 2QMLA 4ZX9A 1S7FA 4R76A 4B13A 2AFXA 3GIUA 3S9MA 5JQ4A 4HNXB 4A39A 1CE8B 5ISVA 3TO6A 3IWGA 4P4FA 3BHXA 2ZW6A 5G22A 2YNEA 4YRHA 4BPXB 2NSMA 3LACA 2Q4ZA 1VHOA 3FB3A 1ELMP 4P44A 2BCOA 2ATRA 3NFZA 3PLFB 4Q38A 4ZX8A 5LRJA 5KTDA 1ZLIA 3T5MA 2AUMA 4R3LA 4F0YA 3D2MA 1HDQA 3EXNA 3HPGG 4KOSA 1MJ9A 2PJ6A 1CPXA 4O23A 1JQGA 3CPXA 3RAMA 5IV0A 1VI4A 1K4JA 2EK9A 2XEFA 4B6ZA 3TYXA 1KBLA 2DF5A 1MJAA 3FF3A 4JXRA 3V38A 4EMEA 4KSIA 1Q5XA 1A9XB 4C7IA 1V0CA 2V8GA 4HKFA 4P4DA 1NXJA 3TLEA 2V77A 3FH4A 2FXFA 3BXMA 1XBUA 2ZEHA 3DR6A 3IFEA 1OBRA 4OC3A 3OP0A 3PB9X 3GUXA 1NE9A 1NMTA 4U9ZA 4A2ZA 4YFJA 3ZZIA 1RTQA 4F8ZA 3EZEA 3TE4A 3SJFA 1V6CA 3D7GA 2V8VA 2KCWA 4MFPA 4CPAA 4C9AA 4NJQA 4CGLA 3SI1A 3OWCA 2PRBA 2PJ8A 3PB6X 4M6IA 3KHZA 2VL1A 1U6MA 4NEXA 5BWAB 1M4DA 4MHYA 5K8OA 3D2PA 4C9UA 2Q04A 4ZY0A 3IEHA 4C8FA 4PXEA 3PB7X 3DLJA 2C6PA 4AVBA 5F46A 3ZNIA 3DR8A 4UA3A 3OAKA 5BY0A 2Z11A 2P6GA 2B0AA 3RZAA 1VKCA 2GFQA 1TF9A 2Q44A 3I9SA 4AG7A 2B4JC 1HEEA 3A9LA 4NSQA 2DEAA 2JBJA 1VBHA 4TNUA 4CYQA 1TKJA 3KZWA 3VATA 4II9A 3U88C 2PJ2A 1PCAA 2Z3LA 2D4OA 3KL9A 3SI0A 4A37A 1EZBA 4CYNA 3IWEA 1ZO0A 5CPAA 2J9AA 3GJZA 2N3AB 2J8RA 2PE3A 5K8PA 5JH9A 1QSOA 4PQAA 4M6GA 3D4UA 2XEGA 4A32A 1M1DA 4NGSA 1XRYA 2VZZA 2AJ6A 2B3VA 2HUZA 3B35A 2V8DA 4XNHB 3K9UA 1KWMA 2ZEOA 2X7BA 1BAVA 3PFOA 4AG9A 3D7FA 2JEVA 3GB0A 2C6CA 3NE7A 1LANA 2VBQA 1IYKA 2AFSA 4C84A 1ZLHA 4QBJA 3IO1A 3S9NA 3KASA 4JVOA 1EO0A 1X12A 2NMTA 2PJ0A 3FYNA 3GLJA 3BI1A 2VXKA 4UFVA 3VGOA 5LRGA 1YLOA 2ZEMA 1IOFA 3K2KA 4CDKA 1B87A 4QB9A 3TLYA 4C9EA 2JBKA 1Z4RA 3S6FA 5K99A 4UIAA 1Z8LA 1KUYA 1CS0B 1CG2A 1R61A 4COGA 2PJ4A 1KC7A 3MRUA 2DPTA 1T36B 5FD8A 1GYTA 2GU2A 4OKOA 4Y49C 3G3SA 4A4BA 1TF8A 3BUOB 3RBUA 2PVWA 3NH5A 2Z3PA 4OP4A 3H5ZA 1P4NA 4ZY2A 2MP0A 4RR2B 3QAYA 1Z4EA 3ISZA 4NFRA 4UWJA 4R7MA 2YJVA 1ARMA 2ZELA 2XEJA 1B6BA 1BPMA 3SI2A 4AVCA 1GHEA 5J3XA 3EO4A 4C8UA 2GREA 1MK4A 5F48A 2YNDA 4MHNA 5K8NA 2ZW7A 1WJTA 3BLNA 1FT7A 3TLGB 3W6XA 1S60A 2PCUA 1YLEA 4XPDB 3EZAA 2B5GB 4QUSA 2CNTA 5LYLA 4YN3A 2GLJA 4TJVA 3SJXA 4Q36A 2O28A 3FIXA 4MI4A 2FIWA 3EY5A 2XPPA 1VIXA 2P6FA 4K30A 4BTFA 3WABA 5KTCA 3HUVA 4CAVA 4EYSA 4EVYA 2GE3A 3TOAA 2IMOA 5JGFA 4LQGA 4BBHA 1YR0A 4P4JA 4LX9A 5LYIA 2CIJA 4CS0B 4KZTA 3VTAA 1CM0A 3KKWA 3HPHE 3KI9A 4KUAA 3NH8A 3KHXA 5DWNA 4E5SA 2R1IA 2Q0YA 4OC0A 3PB4X 4ZYQA 4C68A 3T9YA 4MRIA 3TT2A 2CF4A 3VRNA 1M44A 3HMJG 1HDUA 1LRZA 3NH4A 2B3UA 3V7ZA 4CGOA 1C3OB 1IU8A 4OLLA 4OC1A 3KR4A 3PBEA 4A30A 4DNCA 4C2XA 5LYFA 2QECA 2VQYA 3TTHA 2PJ1A 4HNYB 1R3NA 4CAFA 5J8FA 2ODFA 4J3GA 5HMNA 5D29A 1JDEA 3D3SA 3O8ZA 2PJAA 6CPAA 5JPHA 3PGPA 2ANPA 3PEIA 5F13A 2PVVA 1Q7LA 3IU1A 4B11A 1J3LA 1FNOA 2BO9A 2C27A 2NYQA 3RNZA 3D67A 2BUEA 4R57A 3R95A 4B10A 3B7IA 4L8AA 4C2ZA 1M6VB 1S7LA 1YSJA 1Z2LA 2QIRA 1M4IA 1I12A 1YVOA 3F9KC 3BJ8A 3H8EA 5HVGA 1BXRB 4C85A 4KS9A 1QSMA 3N5FA 1CBXA 1YX0A 1YVHA 1Q2DA 1RXTA 3GYAA 2Q43A 2REEA 3ZJ0A 5JVLA 3VARA 3TO9A 4P10A 4P6YA 3RYOA 1DE4C 4XPLA 2ZENA 2O53A 4MCSA 1NSAA 3FMCA 3BUXB 2J8MA 2FM4A 4IHMA 3B8GA 4MCRA 4OIDA 3T07A 2GIVA 3JTKA 4MI1A 5A27A 1LAMA 3R9FA 2YNCC 1M4GA 3TO7A 4XPKA 3EZBA 4C8PA 4CYOA 2VZYA 4RS2A 5DS0A 5AG4A 4DJLA 4BINA 1AMPA 3N7ZA 1F2PA 3BI0A 1J4JA 1TKHA 2GANA 2PJCA 1OZPA 3P2HA 4W9YA 2Q4VA 4KSAA 2WYRA 3WT4A 4C2YA 4E2AA 3T8WA 5KTAA 1S5KA 3LD2A 2VEZA 2B4BA 1CP6A 4MFQA 3T0TA 4OC5A 5HKZA 2FCKA 5EC4A 2ZW5A 4KLWA 3BUMB 2H5MA 2PSWA 2D4PA 5LYDA 4BD9A 2PJ7A 1YGHA 1H8LA 5EMIA 3IC1A 3EIFA 4H1HA 4OAEA 4OC2A 2FL4A 2G3AA 3VRPA 1AUGA 2AFUA 2Q4YA 4C99A 5F9MA 3TLBA 3SXOA 2DIKA 2DXQA 3PZJA 1Z5RA 4MHZA 4YWYA 4EWTA 1WVMA 2XPNA 3JUWA 3B2YA 4PV6A 5G20A 3CXQA 3MN8A 2Z3KA 2JEWA 4M6HA 3CDXA 3DGVA 4H6UA 2PR8A 3NA6A 3SJGA 2ZEDA 4LQ6A 4C86A 2HI6A 1S3ZA 4KOVA 5AG5A 3TLAA 4E94A 3H8FA 4KUBA 1DTDA 1S7KA 5F47A 5JM6A 1YK3A 4UFXA 3TC8A 2QVPA 3IU2A 1KEEB 4JWPA 1ZG8A 3EFAA 4X2TA 1ZG7A 3PFVA 1S7NA 3F0AA 2FIAA 3JVNA 4HNWB 4KOYA 3CT9A 4P4EA 4WJBA 2B4DB 2PJ5A 2XPLA 3KGQA 3P2FA 4GS4A 2OU2A 4KOXA 4ZBGA 2VI7A 4PXCA 2DLAA 2ZW4A 3PP9A 5THWA 5AXIA 3L2NA 2YGWA 5J1QA 2EWBA 3U1BA 2AE6A 3C26A 4JJXA 1ARLA 3CXPA 4QC6A 1Z8TA 2FE7A 5G21A 1YW4A 5J8CA 4U9YA 3R1KA 2RC4A 1CPSA 1IGBA 2VKZG 4CYPA 1XEBA 3T05A 1N71A 4CGMA 1WK4A 2FSRA 4GM5A 4NXYA 2HWGA 4E8OA 4KOWA 2ZEFA 4B14A 2AFWA 2EVNA 4F6AA 4HPSA 4A94A 4MCQA 2OLSA 4NGQA 2UV8G 3PT1A 5JYBA 4RUHA 2ZXVA 2ZEEA 1XOVA 2FT0A 2O4HA 4JYWA 1I1DA 2HB6A 2OZGA 3TLGA 4MFLA 1XJOA 2EZBA 1GGOA 1YREA 4C7HA 1VGYA 2JDDA 4G1PA 4MHDA 3D7HA 4OIWA 4UCPA 1DIKA 2J8NA 4MHPA 1ON0A 3SHPA 1Y0YA 3ISXA 3B3SA 2R82A 3F5BA 1Y9WA 3C8OA 2EZAA 3BJ7A 4A33A 5AG7A 5CBMA 5IB0A 4NJRA 2C6GA 2HC9A 1Q2CA 2BSWA 3B3VA 4CRZB 4I49A 3WC6A 2AFZA 3UY5A 3WR7A 8CPAA 1YW6A 3BUWB 4X8IA 4B5PA 1F57A 4BPUB 1BLLE 3CZXA 4BMHA 2XEIA 2PJ3A 4OADA 4ZY1A 2A4NA 2EUIA 4CDJA 4P4BA 2R8VA 4NGMA 4UEEA 2Z3NA 1JWQA 2P6EA 4UIBA 4F9UA 4KNGE 3TX8A 1EE3P 4Z65A 4NGPA 3E0KA 4KOUA 2BL1A 2PRQA 3I74A 5A28A 2OH1A 2ZOGA 3B3CA 2CY2A 2WZNA 4AXVA 4PXBA 1XFOA 2PR1A 2Z3OA 1YMEA 1VHEA 5K8MA 4X3RA 5FVJA 1XE4A 4PPZA 3QB8A 3R9GA 4B5OA 1TIQA 2Q7SA 4XPDC 5HVHA 4MJXA 2G3TA 2D0PA 2WPWA 2P0WA 3ICUA 3FNCA 3IGRA 4H2KA 4ONUA 1TKFA 4M3SA 3IJ3A 5AG6A 2BEIA 2EBJA 4NF1A 3R96A 4MY3A 1I21A 4UFWA 1KUXA 1MJBA 2D0OA 1KUVA 5GCNA 1Y7EA 2PIYA 5G1ZA 4FBEA 5IR2A 2R98A 3VWEA 1ELLP 1ZG9A 2PJBA 5F5XA 4KLVA 4X5KA 5HKWA 5I0CA 2OR4A 1IB1E 1X10A 4KORA 4CGNA 5C82A 4JXQA 2AFOA 4MXUA 4IIXA 4C8CA 4KVME 2YJTA 1TXRA 4PSWA 4NCZA 2E28A 2V8HA 2ZPAA 3LWUA 4H89A 2CNMA 1Y9ZA 2RB7A 3GY9A 2PCNA 1Q2YA 4PK2A 3D68A 4R6TA 2DPSA 4CZ1A 1UWYA 4C8TA 3S6GA 3KR5A 3VWDA 2IQ6A 1CJWA 4DUKA 2AUNA 3FBUA 5HKYA 1PUAA 2OZUA 2CNSA 3FEEA 3CPAA 3OB1B 3D66A 2HV2A 2Y1NA 3QAHA 4UEZA 5H86A 2B5GA 3TOBA 4TJXA 4MMOA 2IL4A 4MJ8A 1EZAA 2ZEGA 2R7HA 2I3CA 3B3TA 5EBVA 4FAIA 2C5QA 4P4IA 1IICA 2X0SA 2PDOA 4XNHC 3TLCA 2XPOA 2I00A 3DDDA 4COBA 5F49A 4IF5A 4INJA 2EK8A 2Z0ZA 4MCPA 1ZRSA 4B5PB 3I6SA 3S6HA 1FY7A 1LOKA 2REFA 3S9LA 4UCNA 3VROA 1XMBA 3W91A 2CTBA 4ZGYB 3T90A 1Z8XA 3NE8A 2Z10A 2Z3MA 1KZFA 2FS5A 3PFEA 1Y0RA 3FRMA 1Y7RA 4CAWA 1QMUA 1NSLA 3QNVA 4AVAA 5HXDA 3B3WA 4U5YA 3IWWA 2WSAA 3FVLA 4FD4A 1CX8A 4MFJA 3R9EA 4C9RA 4B12A 4GPLB 4OC4A 3D7DA 3SXNA 3K4IA 4BPWB 5D8NA 1A2ZA 1FBVA 3SJEA 3K9TA 4FD5A 1QSTA 2WPXA 3H4QA 3KRVA 4UEFA 3TCVA 4JZ0A 2C1CA 3W6SA 4DYOA 1CP7A 4MFKA 4R3KA 4PXDA 4CAEA 2HROA 3G23A 1RO5A 3MGDA 2Q7BA 3RO0A 4CGPA 1F2OA 4H6ZA 4CO9A 1YQEA 2PQ8A 2G9DA 4A95A 4WWVA 4F0XA 1Z9EA 2F7VA 1JDBC 2ZOFA 1BO4A 4IUSA 4YU9A 2ABZA 3FXTA 1PYTB 3IIBA 4KOTA 1AYEA 1IY7A 2F5IA 2YNCA 3HLPA 4NGTA 3PB8X 2AFMA 2QJ8A 4UF4A 4FD6A 1IIDA 4Y49B 5IX3A 2K5TA 2CTCA 4OMEA 2B58A 3KQXA 4IIYA 5F09A 1WWZA 3KQZA 4MFZA 4MY0A 4M85A 5DWMA 1Y9KA 1PU9A 4PSXA 5AGEA 2I79A 3DSBA 4JLYA 5I4MA 4CRYB 3JRUA 1R43A 3LODA 2JLMA 2PJ9A 2RFHA 3DNSA 4CAXA 4FWUA 1P0HA 1LCPA 4MBUA 5H84A 1Z8WA 2OB0A 5ELYA 2JDCA 4J0NA 4KVXA 2Y1MA 5LRKA 4IAVA 4FUUA 2IJZA 2POKA 4K3NA 4RI1A 5HH1A 4ORFA 5F1YA 3BUNB 1XIXA 3NFQA 3F8KA 3VRQA 1LFWA 1VBGA 3OB2B 1NBWA 1B47A 2WUUA 4R87A 1SQHA 2FVGA 1VHSA 4Q7AA 3TLZA 1UFHA 2EO8A 2GLFA 4AB7A 2Y0MA 3G8WA 4R8FA
chains in the Genus database with same CATH topology
2ZEPA 4F9VA 4C9VA 4NGRA 3VH9A 3WC5A 3WC7A 1QQ9A 2GP4A 1BPNA 3H8GA 3LMSA 4IK2A 3PRTA 3FJUA 2OOTA 2Q51A 3I1UA 4TWEA 2F8HA 1LAPA 4A38A 1XF1A 5IB9A 2PIZA 4P45A 3FEDA 7CPAA 3FX6A 2QYVA 3FECA 3PBBA 4NGNA 4C8AA 4ZI6A 5HVFA 2BOAA 4ONWA 1M4LA 4EFDA 4ZX9A 4R76A 2AFXA 3S9MA 4A39A 4P4FA 3BHXA 2NSMA 2Q4ZA 1VHOA 1ELMP 4P44A 2BCOA 3NFZA 5LRJA 4ZX8A 1ZLIA 1HDQA 4O23A 2PJ6A 1CPXA 1JQGA 3CPXA 3RAMA 2EK9A 2XEFA 4B6ZA 3FF3A 3V38A 4EMEA 4KSIA 2V8GA 4P4DA 2V77A 3FH4A 2ZEHA 3BXMA 1XBUA 3IFEA 1OBRA 4OC3A 3PB9X 3GUXA 1RTQA 4F8ZA 3SJFA 1V6CA 3D7GA 2V8VA 4CPAA 4C9AA 4NJQA 2PJ8A 3PB6X 3KHZA 2VL1A 4MHYA 5K8OA 4C9UA 4C8FA 4ZY0A 3IEHA 4PXEA 3PB7X 3DLJA 2C6PA 3RZAA 1TF9A 1HEEA 2DEAA 2JBJA 4TNUA 1TKJA 3KZWA 3VATA 2PJ2A 1PCAA 3KL9A 3SI0A 5CPAA 2J9AA 2PE3A 5K8PA 5JH9A 4PQAA 3D4UA 2XEGA 3B35A 4NGSA 1XRYA 2V8DA 1KWMA 2ZEOA 3PFOA 1BAVA 3D7FA 3GB0A 2C6CA 1LANA 2AFSA 1ZLHA 3IO1A 3S9NA 3KASA 2PJ0A 3GLJA 3BI1A 5LRGA 1YLOA 2ZEMA 3K2KA 4C9EA 2JBKA 4UIAA 1Z8LA 1CG2A 2PJ4A 3MRUA 1GYTA 2GU2A 4OKOA 1TF8A 3RBUA 2PVWA 3NH5A 4ZY2A 4OP4A 3ISZA 4NFRA 4R7MA 1ARMA 2ZELA 2XEJA 1BPMA 3SI2A 4C8UA 2GREA 4MHNA 5K8NA 1FT7A 2PCUA 4YN3A 5LYLA 2GLJA 4TJVA 3SJXA 1VIXA 3WABA 3HUVA 2IMOA 5JGFA 4LQGA 4P4JA 5LYIA 2CIJA 3VTAA 3KI9A 3NH8A 3KHXA 4OC0A 3PB4X 4ZYQA 4MRIA 2CF4A 1HDUA 3NH4A 3V7ZA 4OC1A 3KR4A 3PBEA 5LYFA 2PJ1A 1R3NA 5D29A 2PJAA 6CPAA 2ANPA 3PEIA 2PVVA 1Q7LA 1FNOA 2BO9A 2NYQA 3D67A 3B7IA 1YSJA 1Z2LA 3H8EA 5HVGA 4C85A 3N5FA 1CBXA 2Q43A 3VARA 4P10A 4P6YA 1DE4C 2ZENA 2O53A 4MCSA 1NSAA 3FMCA 4IHMA 4MCRA 4OIDA 1LAMA 4C8PA 5DS0A 4DJLA 1AMPA 1F2PA 3BI0A 1TKHA 2PJCA 4W9YA 2WYRA 3WT4A 3T8WA 1CP6A 4OC5A 5LYDA 4BD9A 2PJ7A 1H8LA 3IC1A 3EIFA 4OC2A 2AFUA 4C99A 1Z5RA 4MHZA 4YWYA 4EWTA 1WVMA 3B2YA 3MN8A 2JEWA 3CDXA 3DGVA 3NA6A 3SJGA 2ZEDA 4C86A 3H8FA 1DTDA 5JM6A 3TC8A 2QVPA 1ZG8A 4X2TA 1ZG7A 3CT9A 4P4EA 4WJBA 2PJ5A 3KGQA 4PXCA 5THWA 5J1QA 3L2NA 2EWBA 1ARLA 1YW4A 1CPSA 1IGBA 4GM5A 2ZEFA 2AFWA 4A94A 4MCQA 4NGQA 4RUHA 2ZEEA 2O4HA 4JYWA 2HB6A 1XJOA 1VGYA 4G1PA 3D7HA 4OIWA 4MHPA 1Y0YA 3ISXA 3B3SA 5CBMA 4NJRA 2C6GA 2HC9A 3B3VA 3WC6A 2AFZA 8CPAA 1YW6A 4X8IA 1F57A 1BLLE 2XEIA 2PJ3A 4ZY1A 4CDJA 4P4BA 4NGMA 4UEEA 4F9UA 4UIBA 4KNGE 3TX8A 1EE3P 4Z65A 4NGPA 2PRQA 3I74A 2ZOGA 3B3CA 2WZNA 4AXVA 4PXBA 1XFOA 1YMEA 1VHEA 5K8MA 4X3RA 4PPZA 5HVHA 3ICUA 3SI1A 4H2KA 1TKFA 3IJ3A 1Y7EA 2PIYA 4FBEA 5IR2A 1ELLP 1ZG9A 2PJBA 2OR4A 4C8CA 4MXUA 2AFOA 1TXRA 2V8HA 3LWUA 1Y9ZA 2RB7A 3D68A 4R6TA 1UWYA 4C8TA 3KR5A 2IQ6A 4DUKA 3FEEA 3CPAA 3D66A 4TJXA 4UEZA 4MMOA 2ZEGA 3B3TA 2I3CA 4FAIA 2C5QA 4P4IA 2EK8A 4MCPA 3I6SA 1LOKA 3S9LA 1XMBA 2CTBA 3PFEA 1Y0RA 5HXDA 1QMUA 3QNVA 3B3WA 3IWWA 3FVLA 1CX8A 4C9RA 4OC4A 3D7DA 5D8NA 3K9TA 3SJEA 4UEFA 4JZ0A 2C1CA 4DYOA 1CP7A 4PXDA 1F2OA 2G9DA 4WWVA 2F7VA 2ZOFA 4YU9A 2ABZA 1PYTB 3IIBA 4CDKA 1AYEA 1IY7A 4A37A 4UF4A 3HLPA 4NGTA 3PB8X 2AFMA 2QJ8A 2CTCA 4OMEA 3KQXA 4C84A 5F09A 3KQZA 5I4MA 3JRUA 1R43A 2PJ9A 2RFHA 4FWUA 1LCPA 5ELYA 5LRKA 4IAVA 4FUUA 2IJZA 2POKA 4K3NA 1LFWA 2FVGA 4Q7AA 2GLFA 4R8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEP A;  4F9V A;  4C9V A;  4NGR A;  3VH9 A;  3WC5 A;  3WC7 A;  1QQ9 A;  1BPN A;  3H8G A;  3LMS A;  4IK2 A;  3PRT A;  3FJU A;  2OOT A;  2Q51 A;  3I1U A;  4TWE A;  2F8H A;  1LAP A;  4A38 A;  1XF1 A;  5IB9 A;  2PIZ A;  4P45 A;  3FED A;  7CPA A;  3FX6 A;  2QYV A;  3FEC A;  3PBB A;  4NGN A;  4C8A A;  4ZI6 A;  5HVF A;  2BOA A;  4ONW A;  1M4L A;  4EFD A;  4ZX9 A;  4R76 A;  2AFX A;  3S9M A;  4A39 A;  4P4F A;  3BHX A;  2NSM A;  2Q4Z A;  1VHO A;  1ELM P;  4P44 A;  2BCO A;  3NFZ A;  5LRJ A;  4ZX8 A;  1ZLI A;  1HDQ A;  4O23 A;  2PJ6 A;  1CPX A;  1JQG A;  3CPX A;  3RAM A;  2EK9 A;  2XEF A;  4B6Z A;  3FF3 A;  3V38 A;  4EME A;  4KSI A;  2V8G A;  4P4D A;  2V77 A;  3FH4 A;  2ZEH A;  3BXM A;  1XBU A;  3IFE A;  1OBR A;  4OC3 A;  3PB9 X;  3GUX A;  1RTQ A;  4F8Z A;  3SJF A;  1V6C A;  3D7G A;  2V8V A;  4CPA A;  4C9A A;  4NJQ A;  2PJ8 A;  3PB6 X;  3KHZ A;  2VL1 A;  4MHY A;  5K8O A;  4C9U A;  4C8F A;  4ZY0 A;  3IEH A;  4PXE A;  3PB7 X;  3DLJ A;  2C6P A;  3RZA A;  1TF9 A;  1HEE A;  2DEA A;  2JBJ A;  4TNU A;  1TKJ A;  3KZW A;  3VAT A;  2PJ2 A;  1PCA A;  3KL9 A;  3SI0 A;  5CPA A;  2J9A A;  2PE3 A;  5K8P A;  5JH9 A;  4PQA A;  3D4U A;  2XEG A;  3B35 A;  4NGS A;  1XRY A;  2V8D A;  1KWM A;  2ZEO A;  3PFO A;  1BAV A;  3D7F A;  3GB0 A;  2C6C A;  1LAN A;  2AFS A;  1ZLH A;  3IO1 A;  3S9N A;  3KAS A;  2PJ0 A;  3GLJ A;  3BI1 A;  5LRG A;  1YLO A;  2ZEM A;  3K2K A;  4C9E A;  2JBK A;  4UIA A;  1Z8L A;  1CG2 A;  2PJ4 A;  3MRU A;  1GYT A;  2GU2 A;  4OKO A;  1TF8 A;  3RBU A;  2PVW A;  3NH5 A;  4ZY2 A;  4OP4 A;  3ISZ A;  4NFR A;  4R7M A;  1ARM A;  2ZEL A;  2XEJ A;  1BPM A;  3SI2 A;  4C8U A;  2GRE A;  4MHN A;  5K8N A;  1FT7 A;  2PCU A;  4YN3 A;  5LYL A;  2GLJ A;  4TJV A;  3SJX A;  1VIX A;  3WAB A;  3HUV A;  2IMO A;  5JGF A;  4LQG A;  4P4J A;  5LYI A;  2CIJ A;  3VTA A;  3KI9 A;  3NH8 A;  3KHX A;  4OC0 A;  3PB4 X;  4ZYQ A;  4MRI A;  2CF4 A;  1HDU A;  3NH4 A;  3V7Z A;  4OC1 A;  3KR4 A;  3PBE A;  5LYF A;  2PJ1 A;  1R3N A;  5D29 A;  2PJA A;  6CPA A;  2ANP A;  3PEI A;  2PVV A;  1Q7L A;  1FNO A;  2BO9 A;  2NYQ A;  3D67 A;  3B7I A;  1YSJ A;  1Z2L A;  3H8E A;  5HVG A;  4C85 A;  3N5F A;  1CBX A;  2Q43 A;  3VAR A;  4P10 A;  4P6Y A;  1DE4 C;  2ZEN A;  2O53 A;  4MCS A;  1NSA A;  3FMC A;  4IHM A;  4MCR A;  4OID A;  1LAM A;  4C8P A;  5DS0 A;  4DJL A;  1AMP A;  1F2P A;  3BI0 A;  1TKH A;  2PJC A;  4W9Y A;  2WYR A;  3WT4 A;  3T8W A;  1CP6 A;  4OC5 A;  5LYD A;  4BD9 A;  2PJ7 A;  1H8L A;  3IC1 A;  3EIF A;  4OC2 A;  2AFU A;  4C99 A;  1Z5R A;  4MHZ A;  4YWY A;  4EWT A;  1WVM A;  3B2Y A;  3MN8 A;  2JEW A;  3CDX A;  3DGV A;  3NA6 A;  3SJG A;  2ZED A;  4C86 A;  3H8F A;  1DTD A;  5JM6 A;  3TC8 A;  2QVP A;  1ZG8 A;  4X2T A;  1ZG7 A;  3CT9 A;  4P4E A;  4WJB A;  2PJ5 A;  3KGQ A;  4PXC A;  5THW A;  5J1Q A;  3L2N A;  2EWB A;  1ARL A;  1YW4 A;  1CPS A;  1IGB A;  4GM5 A;  2ZEF A;  2AFW A;  4A94 A;  4MCQ A;  4NGQ A;  4RUH A;  2ZEE A;  2O4H A;  4JYW A;  2HB6 A;  1XJO A;  1VGY A;  4G1P A;  3D7H A;  4OIW A;  4MHP A;  1Y0Y A;  3ISX A;  3B3S A;  5CBM A;  4NJR A;  2C6G A;  2HC9 A;  3B3V A;  3WC6 A;  2AFZ A;  8CPA A;  1YW6 A;  4X8I A;  1F57 A;  1BLL E;  2XEI A;  2PJ3 A;  4ZY1 A;  4CDJ A;  4P4B A;  4NGM A;  4UEE A;  4F9U A;  4UIB A;  4KNG E;  3TX8 A;  1EE3 P;  4Z65 A;  4NGP A;  2PRQ A;  3I74 A;  2ZOG A;  3B3C A;  2WZN A;  4AXV A;  4PXB A;  1XFO A;  1YME A;  1VHE A;  5K8M A;  4X3R A;  4PPZ A;  5HVH A;  3ICU A;  3SI1 A;  4H2K A;  1TKF A;  3IJ3 A;  1Y7E A;  2PIY A;  4FBE A;  1ELL P;  1ZG9 A;  2PJB A;  2OR4 A;  4C8C A;  4MXU A;  2AFO A;  1TXR A;  2V8H A;  3LWU A;  1Y9Z A;  2RB7 A;  3D68 A;  4R6T A;  1UWY A;  4C8T A;  3KR5 A;  2IQ6 A;  4DUK A;  3FEE A;  3CPA A;  3D66 A;  4TJX A;  4UEZ A;  4MMO A;  2ZEG A;  3B3T A;  2I3C A;  4FAI A;  4P4I A;  2EK8 A;  4MCP A;  3I6S A;  1LOK A;  3S9L A;  1XMB A;  2CTB A;  3PFE A;  1Y0R A;  5HXD A;  1QMU A;  3QNV A;  3B3W A;  3IWW A;  3FVL A;  1CX8 A;  4C9R A;  4OC4 A;  3D7D A;  5D8N A;  3K9T A;  3SJE A;  4UEF A;  4JZ0 A;  2C1C A;  4DYO A;  1CP7 A;  4PXD A;  1F2O A;  2G9D A;  4WWV A;  2F7V A;  2ZOF A;  4YU9 A;  2ABZ A;  1PYT B;  3IIB A;  4CDK A;  1AYE A;  1IY7 A;  4A37 A;  4UF4 A;  3HLP A;  4NGT A;  3PB8 X;  2AFM A;  2QJ8 A;  2CTC A;  4OME A;  3KQX A;  4C84 A;  5F09 A;  3KQZ A;  5I4M A;  3JRU A;  1R43 A;  2PJ9 A;  2RFH A;  4FWU A;  1LCP A;  5ELY A;  5LRK A;  4IAV A;  4FUU A;  2IJZ A;  2POK A;  4K3N A;  1LFW A;  2FVG A;  4Q7A A;  2GLF A;  4R8F A; 
#chains in the Genus database with same CATH topology
 4L89 A;  3D8P A;  4JD6 A;  2ZEP A;  4PK3 A;  4F9V A;  1ZYM A;  4C9V A;  2CBL A;  4NGR A;  3VH9 A;  3WC5 A;  2HQY A;  3WC7 A;  3NOJ A;  4A4C A;  1QQ9 A;  2GP4 A;  1BPN A;  4M8D A;  3H8G A;  3LMS A;  4IK2 A;  1XF8 A;  4FD7 A;  3PRT A;  1QSR A;  3FJU A;  2OOT A;  1IOI A;  2Q51 A;  3I1U A;  4TWE A;  1ZL0 A;  2F8H A;  1LAP A;  4A38 A;  1XF1 A;  3EC4 A;  4E0A A;  1BOB A;  5IB9 A;  2PIZ A;  3S6K A;  4GXH A;  3VRR A;  1IYL A;  3CXS A;  1L0C A;  2PC1 A;  5C88 A;  4P45 A;  3TFY A;  4LUA A;  3FED A;  7CPA A;  4UCM A;  3FX6 A;  2QYV A;  3FEC A;  5E96 A;  3PBB A;  3V8I A;  4NGN A;  2B4D A;  2G0B A;  4UBR A;  1R57 A;  4C8A A;  2ARH A;  1YVK A;  4KVO E;  4KSF A;  4RN7 A;  5CNP A;  4ZI6 A;  4QVT A;  5HVF A;  2BOA A;  3SR3 A;  4R9M A;  4A31 A;  4ONW A;  2CXA A;  2OZH A;  4UWI A;  2EZC A;  1Z9U A;  1M4L A;  1QSN A;  1XMT A;  3GKR A;  3I3G A;  4EFD A;  4YGO A;  1C30 B;  2QML A;  4ZX9 A;  1S7F A;  4R76 A;  4B13 A;  2AFX A;  3GIU A;  3S9M A;  5JQ4 A;  4HNX B;  4A39 A;  1CE8 B;  5ISV A;  3TO6 A;  3IWG A;  4P4F A;  3BHX A;  2ZW6 A;  5G22 A;  2YNE A;  4YRH A;  4BPX B;  2NSM A;  3LAC A;  2Q4Z A;  1VHO A;  3FB3 A;  1ELM P;  4P44 A;  2BCO A;  2ATR A;  3NFZ A;  3PLF B;  4Q38 A;  4ZX8 A;  5LRJ A;  5KTD A;  1ZLI A;  3T5M A;  2AUM A;  4R3L A;  4F0Y A;  3D2M A;  1HDQ A;  3EXN A;  3HPG G;  4KOS A;  1MJ9 A;  2PJ6 A;  1CPX A;  4O23 A;  1JQG A;  3CPX A;  3RAM A;  5IV0 A;  1VI4 A;  1K4J A;  2EK9 A;  2XEF A;  4B6Z A;  3TYX A;  1KBL A;  2DF5 A;  1MJA A;  3FF3 A;  4JXR A;  3V38 A;  4EME A;  4KSI A;  1Q5X A;  1A9X B;  4C7I A;  1V0C A;  2V8G A;  4HKF A;  4P4D A;  1NXJ A;  3TLE A;  2V77 A;  3FH4 A;  2FXF A;  3BXM A;  1XBU A;  2ZEH A;  3DR6 A;  3IFE A;  1OBR A;  4OC3 A;  3OP0 A;  3PB9 X;  3GUX A;  1NE9 A;  1NMT A;  4U9Z A;  4A2Z A;  4YFJ A;  3ZZI A;  1RTQ A;  4F8Z A;  3EZE A;  3TE4 A;  3SJF A;  1V6C A;  3D7G A;  2V8V A;  2KCW A;  4MFP A;  4CPA A;  4C9A A;  4NJQ A;  4CGL A;  3SI1 A;  3OWC A;  2PRB A;  2PJ8 A;  3PB6 X;  4M6I A;  3KHZ A;  2VL1 A;  1U6M A;  4NEX A;  5BWA B;  1M4D A;  4MHY A;  5K8O A;  3D2P A;  4C9U A;  2Q04 A;  4ZY0 A;  3IEH A;  4C8F A;  4PXE A;  3PB7 X;  3DLJ A;  2C6P A;  4AVB A;  5F46 A;  3ZNI A;  3DR8 A;  4UA3 A;  3OAK A;  5BY0 A;  2Z11 A;  2P6G A;  2B0A A;  3RZA A;  1VKC A;  2GFQ A;  1TF9 A;  2Q44 A;  3I9S A;  4AG7 A;  2B4J C;  1HEE A;  3A9L A;  4NSQ A;  2DEA A;  2JBJ A;  1VBH A;  4TNU A;  4CYQ A;  1TKJ A;  3KZW A;  3VAT A;  4II9 A;  3U88 C;  2PJ2 A;  1PCA A;  2Z3L A;  2D4O A;  3KL9 A;  3SI0 A;  4A37 A;  1EZB A;  4CYN A;  3IWE A;  1ZO0 A;  5CPA A;  2J9A A;  3GJZ A;  2N3A B;  2J8R A;  2PE3 A;  5K8P A;  5JH9 A;  1QSO A;  4PQA A;  4M6G A;  3D4U A;  2XEG A;  4A32 A;  1M1D A;  4NGS A;  1XRY A;  2VZZ A;  2AJ6 A;  2B3V A;  2HUZ A;  3B35 A;  2V8D A;  4XNH B;  3K9U A;  1KWM A;  2ZEO A;  2X7B A;  1BAV A;  3PFO A;  4AG9 A;  3D7F A;  2JEV A;  3GB0 A;  2C6C A;  3NE7 A;  1LAN A;  2VBQ A;  1IYK A;  2AFS A;  4C84 A;  1ZLH A;  4QBJ A;  3IO1 A;  3S9N A;  3KAS A;  4JVO A;  1EO0 A;  1X12 A;  2NMT A;  2PJ0 A;  3FYN A;  3GLJ A;  3BI1 A;  2VXK A;  4UFV A;  3VGO A;  5LRG A;  1YLO A;  2ZEM A;  1IOF A;  3K2K A;  4CDK A;  1B87 A;  4QB9 A;  3TLY A;  4C9E A;  2JBK A;  1Z4R A;  3S6F A;  5K99 A;  4UIA A;  1Z8L A;  1KUY A;  1CS0 B;  1CG2 A;  1R61 A;  4COG A;  2PJ4 A;  1KC7 A;  3MRU A;  2DPT A;  1T36 B;  5FD8 A;  1GYT A;  2GU2 A;  4OKO A;  4Y49 C;  3G3S A;  4A4B A;  1TF8 A;  3BUO B;  3RBU A;  2PVW A;  3NH5 A;  2Z3P A;  4OP4 A;  3H5Z A;  1P4N A;  4ZY2 A;  2MP0 A;  4RR2 B;  3QAY A;  1Z4E A;  3ISZ A;  4NFR A;  4UWJ A;  4R7M A;  2YJV A;  1ARM A;  2ZEL A;  2XEJ A;  1B6B A;  1BPM A;  3SI2 A;  4AVC A;  1GHE A;  5J3X A;  3EO4 A;  4C8U A;  2GRE A;  1MK4 A;  5F48 A;  2YND A;  4MHN A;  5K8N A;  2ZW7 A;  1WJT A;  3BLN A;  1FT7 A;  3TLG B;  3W6X A;  1S60 A;  2PCU A;  1YLE A;  4XPD B;  3EZA A;  2B5G B;  4QUS A;  2CNT A;  5LYL A;  4YN3 A;  2GLJ A;  4TJV A;  3SJX A;  4Q36 A;  2O28 A;  3FIX A;  4MI4 A;  2FIW A;  3EY5 A;  2XPP A;  1VIX A;  2P6F A;  4K30 A;  4BTF A;  3WAB A;  5KTC A;  3HUV A;  4CAV A;  4EYS A;  4EVY A;  2GE3 A;  3TOA A;  2IMO A;  5JGF A;  4LQG A;  4BBH A;  1YR0 A;  4P4J A;  4LX9 A;  5LYI A;  2CIJ A;  4CS0 B;  4KZT A;  3VTA A;  1CM0 A;  3KKW A;  3HPH E;  3KI9 A;  4KUA A;  3NH8 A;  3KHX A;  5DWN A;  4E5S A;  2R1I A;  2Q0Y A;  4OC0 A;  3PB4 X;  4ZYQ A;  4C68 A;  3T9Y A;  4MRI A;  3TT2 A;  2CF4 A;  3VRN A;  1M44 A;  3HMJ G;  1HDU A;  1LRZ A;  3NH4 A;  2B3U A;  3V7Z A;  4CGO A;  1C3O B;  1IU8 A;  4OLL A;  4OC1 A;  3KR4 A;  3PBE A;  4A30 A;  4DNC A;  4C2X A;  5LYF A;  2QEC A;  2VQY A;  3TTH A;  2PJ1 A;  4HNY B;  1R3N A;  4CAF A;  5J8F A;  2ODF A;  4J3G A;  5HMN A;  5D29 A;  1JDE A;  3D3S A;  3O8Z A;  2PJA A;  6CPA A;  5JPH A;  3PGP A;  2ANP A;  3PEI A;  5F13 A;  2PVV A;  1Q7L A;  3IU1 A;  4B11 A;  1J3L A;  1FNO A;  2BO9 A;  2C27 A;  2NYQ A;  3RNZ A;  3D67 A;  2BUE A;  4R57 A;  3R95 A;  4B10 A;  3B7I A;  4L8A A;  4C2Z A;  1M6V B;  1S7L A;  1YSJ A;  1Z2L A;  2QIR A;  1M4I A;  1I12 A;  1YVO A;  3F9K C;  3BJ8 A;  3H8E A;  5HVG A;  1BXR B;  4C85 A;  4KS9 A;  1QSM A;  3N5F A;  1CBX A;  1YX0 A;  1YVH A;  1Q2D A;  1RXT A;  3GYA A;  2Q43 A;  2REE A;  3ZJ0 A;  5JVL A;  3VAR A;  3TO9 A;  4P10 A;  4P6Y A;  3RYO A;  1DE4 C;  4XPL A;  2ZEN A;  2O53 A;  4MCS A;  1NSA A;  3FMC A;  3BUX B;  2J8M A;  2FM4 A;  4IHM A;  3B8G A;  4MCR A;  4OID A;  3T07 A;  2GIV A;  3JTK A;  4MI1 A;  5A27 A;  1LAM A;  3R9F A;  2YNC C;  1M4G A;  3TO7 A;  4XPK A;  3EZB A;  4C8P A;  4CYO A;  2VZY A;  4RS2 A;  5DS0 A;  5AG4 A;  4DJL A;  4BIN A;  1AMP A;  3N7Z A;  1F2P A;  3BI0 A;  1J4J A;  1TKH A;  2GAN A;  2PJC A;  1OZP A;  3P2H A;  4W9Y A;  2Q4V A;  4KSA A;  2WYR A;  3WT4 A;  4C2Y A;  4E2A A;  3T8W A;  5KTA A;  1S5K A;  3LD2 A;  2VEZ A;  2B4B A;  1CP6 A;  4MFQ A;  3T0T A;  4OC5 A;  5HKZ A;  2FCK A;  5EC4 A;  2ZW5 A;  4KLW A;  3BUM B;  2H5M A;  2PSW A;  2D4P A;  5LYD A;  4BD9 A;  2PJ7 A;  1YGH A;  1H8L A;  5EMI A;  3IC1 A;  3EIF A;  4H1H A;  4OAE A;  4OC2 A;  2FL4 A;  2G3A A;  3VRP A;  1AUG A;  2AFU A;  2Q4Y A;  4C99 A;  5F9M A;  3TLB A;  3SXO A;  2DIK A;  2DXQ A;  3PZJ A;  1Z5R A;  4MHZ A;  4YWY A;  4EWT A;  1WVM A;  2XPN A;  3JUW A;  3B2Y A;  4PV6 A;  5G20 A;  3CXQ A;  3MN8 A;  2Z3K A;  2JEW A;  4M6H A;  3CDX A;  3DGV A;  4H6U A;  2PR8 A;  3NA6 A;  3SJG A;  2ZED A;  4LQ6 A;  4C86 A;  2HI6 A;  1S3Z A;  4KOV A;  5AG5 A;  3TLA A;  4E94 A;  3H8F A;  4KUB A;  1DTD A;  1S7K A;  5F47 A;  5JM6 A;  1YK3 A;  4UFX A;  3TC8 A;  2QVP A;  3IU2 A;  1KEE B;  4JWP A;  1ZG8 A;  3EFA A;  4X2T A;  1ZG7 A;  3PFV A;  1S7N A;  3F0A A;  2FIA A;  3JVN A;  4HNW B;  4KOY A;  3CT9 A;  4P4E A;  4WJB A;  2B4D B;  2PJ5 A;  2XPL A;  3KGQ A;  3P2F A;  4GS4 A;  2OU2 A;  4KOX A;  4ZBG A;  2VI7 A;  4PXC A;  2DLA A;  2ZW4 A;  3PP9 A;  5THW A;  5AXI A;  3L2N A;  2YGW A;  5J1Q A;  2EWB A;  3U1B A;  2AE6 A;  3C26 A;  4JJX A;  1ARL A;  3CXP A;  4QC6 A;  1Z8T A;  2FE7 A;  5G21 A;  1YW4 A;  5J8C A;  4U9Y A;  3R1K A;  2RC4 A;  1CPS A;  1IGB A;  2VKZ G;  4CYP A;  1XEB A;  3T05 A;  1N71 A;  4CGM A;  1WK4 A;  2FSR A;  4GM5 A;  4NXY A;  2HWG A;  4E8O A;  4KOW A;  2ZEF A;  4B14 A;  2AFW A;  2EVN A;  4F6A A;  4HPS A;  4A94 A;  4MCQ A;  2OLS A;  4NGQ A;  2UV8 G;  3PT1 A;  5JYB A;  4RUH A;  2ZXV A;  2ZEE A;  1XOV A;  2FT0 A;  2O4H A;  4JYW A;  1I1D A;  2HB6 A;  2OZG A;  3TLG A;  4MFL A;  1XJO A;  2EZB A;  1GGO A;  1YRE A;  4C7H A;  1VGY A;  2JDD A;  4G1P A;  4MHD A;  3D7H A;  4OIW A;  4UCP A;  1DIK A;  2J8N A;  4MHP A;  1ON0 A;  3SHP A;  1Y0Y A;  3ISX A;  3B3S A;  2R82 A;  3F5B A;  1Y9W A;  3C8O A;  2EZA A;  3BJ7 A;  4A33 A;  5AG7 A;  5CBM A;  5IB0 A;  4NJR A;  2C6G A;  2HC9 A;  1Q2C A;  2BSW A;  3B3V A;  4CRZ B;  4I49 A;  3WC6 A;  2AFZ A;  3UY5 A;  3WR7 A;  8CPA A;  1YW6 A;  3BUW B;  4X8I A;  4B5P A;  1F57 A;  4BPU B;  1BLL E;  3CZX A;  4BMH A;  2XEI A;  2PJ3 A;  4OAD A;  4ZY1 A;  2A4N A;  2EUI A;  4CDJ A;  4P4B A;  2R8V A;  4NGM A;  4UEE A;  2Z3N A;  1JWQ A;  2P6E A;  4UIB A;  4F9U A;  4KNG E;  3TX8 A;  1EE3 P;  4Z65 A;  4NGP A;  3E0K A;  4KOU A;  2BL1 A;  2PRQ A;  3I74 A;  5A28 A;  2OH1 A;  2ZOG A;  3B3C A;  2CY2 A;  2WZN A;  4AXV A;  4PXB A;  1XFO A;  2PR1 A;  2Z3O A;  1YME A;  1VHE A;  5K8M A;  4X3R A;  5FVJ A;  1XE4 A;  4PPZ A;  3QB8 A;  3R9G A;  4B5O A;  1TIQ A;  2Q7S A;  4XPD C;  5HVH A;  4MJX A;  2G3T A;  2D0P A;  2WPW A;  2P0W A;  3ICU A;  3FNC A;  3IGR A;  4H2K A;  4ONU A;  1TKF A;  4M3S A;  3IJ3 A;  5AG6 A;  2BEI A;  2EBJ A;  4NF1 A;  3R96 A;  4MY3 A;  1I21 A;  4UFW A;  1KUX A;  1MJB A;  2D0O A;  1KUV A;  5GCN A;  1Y7E A;  2PIY A;  5G1Z A;  4FBE A;  5IR2 A;  2R98 A;  3VWE A;  1ELL P;  1ZG9 A;  2PJB A;  5F5X A;  4KLV A;  4X5K A;  5HKW A;  5I0C A;  2OR4 A;  1IB1 E;  1X10 A;  4KOR A;  4CGN A;  5C82 A;  4JXQ A;  2AFO A;  4MXU A;  4IIX A;  4C8C A;  4KVM E;  2YJT A;  1TXR A;  4PSW A;  4NCZ A;  2E28 A;  2V8H A;  2ZPA A;  3LWU A;  4H89 A;  2CNM A;  1Y9Z A;  2RB7 A;  3GY9 A;  2PCN A;  1Q2Y A;  4PK2 A;  3D68 A;  4R6T A;  2DPS A;  4CZ1 A;  1UWY A;  4C8T A;  3S6G A;  3KR5 A;  3VWD A;  2IQ6 A;  1CJW A;  4DUK A;  2AUN A;  3FBU A;  5HKY A;  1PUA A;  2OZU A;  2CNS A;  3FEE A;  3CPA A;  3OB1 B;  3D66 A;  2HV2 A;  2Y1N A;  3QAH A;  4UEZ A;  5H86 A;  2B5G A;  3TOB A;  4TJX A;  4MMO A;  2IL4 A;  4MJ8 A;  1EZA A;  2ZEG A;  2R7H A;  2I3C A;  3B3T A;  5EBV A;  4FAI A;  2C5Q A;  4P4I A;  1IIC A;  2X0S A;  2PDO A;  4XNH C;  3TLC A;  2XPO A;  2I00 A;  3DDD A;  4COB A;  5F49 A;  4IF5 A;  4INJ A;  2EK8 A;  2Z0Z A;  4MCP A;  1ZRS A;  4B5P B;  3I6S A;  3S6H A;  1FY7 A;  1LOK A;  2REF A;  3S9L A;  4UCN A;  3VRO A;  1XMB A;  3W91 A;  2CTB A;  4ZGY B;  3T90 A;  1Z8X A;  3NE8 A;  2Z10 A;  2Z3M A;  1KZF A;  2FS5 A;  3PFE A;  1Y0R A;  3FRM A;  1Y7R A;  4CAW A;  1QMU A;  1NSL A;  3QNV A;  4AVA A;  5HXD A;  3B3W A;  4U5Y A;  3IWW A;  2WSA A;  3FVL A;  4FD4 A;  1CX8 A;  4MFJ A;  3R9E A;  4C9R A;  4B12 A;  4GPL B;  4OC4 A;  3D7D A;  3SXN A;  3K4I A;  4BPW B;  5D8N A;  1A2Z A;  1FBV A;  3SJE A;  3K9T A;  4FD5 A;  1QST A;  2WPX A;  3H4Q A;  3KRV A;  4UEF A;  3TCV A;  4JZ0 A;  2C1C A;  3W6S A;  4DYO A;  1CP7 A;  4MFK A;  4R3K A;  4PXD A;  4CAE A;  2HRO A;  3G23 A;  1RO5 A;  3MGD A;  2Q7B A;  3RO0 A;  4CGP A;  1F2O A;  4H6Z A;  4CO9 A;  1YQE A;  2PQ8 A;  2G9D A;  4A95 A;  4WWV A;  4F0X A;  1Z9E A;  2F7V A;  1JDB C;  2ZOF A;  1BO4 A;  4IUS A;  4YU9 A;  2ABZ A;  3FXT A;  1PYT B;  3IIB A;  4KOT A;  1AYE A;  1IY7 A;  2F5I A;  2YNC A;  3HLP A;  4NGT A;  3PB8 X;  2AFM A;  2QJ8 A;  4UF4 A;  4FD6 A;  1IID A;  4Y49 B;  5IX3 A;  2K5T A;  2CTC A;  4OME A;  2B58 A;  3KQX A;  4IIY A;  5F09 A;  1WWZ A;  3KQZ A;  4MFZ A;  4MY0 A;  4M85 A;  5DWM A;  1Y9K A;  1PU9 A;  4PSX A;  5AGE A;  2I79 A;  3DSB A;  4JLY A;  5I4M A;  4CRY B;  3JRU A;  1R43 A;  3LOD A;  2JLM A;  2PJ9 A;  2RFH A;  3DNS A;  4CAX A;  4FWU A;  1P0H A;  1LCP A;  4MBU A;  5H84 A;  1Z8W A;  2OB0 A;  5ELY A;  2JDC A;  4J0N A;  4KVX A;  2Y1M A;  5LRK A;  4IAV A;  4FUU A;  2IJZ A;  2POK A;  4K3N A;  4RI1 A;  5HH1 A;  4ORF A;  5F1Y A;  3BUN B;  1XIX A;  3NFQ A;  3F8K A;  3VRQ A;  1LFW A;  1VBG A;  3OB2 B;  1NBW A;  1B47 A;  2WUU A;  4R87 A;  1SQH A;  2FVG A;  1VHS A;  4Q7A A;  3TLZ A;  1UFH A;  2EO8 A;  2GLF A;  4AB7 A;  2Y0M A;  3G8W A;  4R8F A; 
#chains in the Genus database with same CATH homology
 2ZEP A;  4F9V A;  4C9V A;  4NGR A;  3VH9 A;  3WC5 A;  3WC7 A;  1QQ9 A;  2GP4 A;  1BPN A;  3H8G A;  3LMS A;  4IK2 A;  3PRT A;  3FJU A;  2OOT A;  2Q51 A;  3I1U A;  4TWE A;  2F8H A;  1LAP A;  4A38 A;  1XF1 A;  5IB9 A;  2PIZ A;  4P45 A;  3FED A;  7CPA A;  3FX6 A;  2QYV A;  3FEC A;  3PBB A;  4NGN A;  4C8A A;  4ZI6 A;  5HVF A;  2BOA A;  4ONW A;  1M4L A;  4EFD A;  4ZX9 A;  4R76 A;  2AFX A;  3S9M A;  4A39 A;  4P4F A;  3BHX A;  2NSM A;  2Q4Z A;  1VHO A;  1ELM P;  4P44 A;  2BCO A;  3NFZ A;  5LRJ A;  4ZX8 A;  1ZLI A;  1HDQ A;  4O23 A;  2PJ6 A;  1CPX A;  1JQG A;  3CPX A;  3RAM A;  2EK9 A;  2XEF A;  4B6Z A;  3FF3 A;  3V38 A;  4EME A;  4KSI A;  2V8G A;  4P4D A;  2V77 A;  3FH4 A;  2ZEH A;  3BXM A;  1XBU A;  3IFE A;  1OBR A;  4OC3 A;  3PB9 X;  3GUX A;  1RTQ A;  4F8Z A;  3SJF A;  1V6C A;  3D7G A;  2V8V A;  4CPA A;  4C9A A;  4NJQ A;  2PJ8 A;  3PB6 X;  3KHZ A;  2VL1 A;  4MHY A;  5K8O A;  4C9U A;  4C8F A;  4ZY0 A;  3IEH A;  4PXE A;  3PB7 X;  3DLJ A;  2C6P A;  3RZA A;  1TF9 A;  1HEE A;  2DEA A;  2JBJ A;  4TNU A;  1TKJ A;  3KZW A;  3VAT A;  2PJ2 A;  1PCA A;  3KL9 A;  3SI0 A;  5CPA A;  2J9A A;  2PE3 A;  5K8P A;  5JH9 A;  4PQA A;  3D4U A;  2XEG A;  3B35 A;  4NGS A;  1XRY A;  2V8D A;  1KWM A;  2ZEO A;  3PFO A;  1BAV A;  3D7F A;  3GB0 A;  2C6C A;  1LAN A;  2AFS A;  1ZLH A;  3IO1 A;  3S9N A;  3KAS A;  2PJ0 A;  3GLJ A;  3BI1 A;  5LRG A;  1YLO A;  2ZEM A;  3K2K A;  4C9E A;  2JBK A;  4UIA A;  1Z8L A;  1CG2 A;  2PJ4 A;  3MRU A;  1GYT A;  2GU2 A;  4OKO A;  1TF8 A;  3RBU A;  2PVW A;  3NH5 A;  4ZY2 A;  4OP4 A;  3ISZ A;  4NFR A;  4R7M A;  1ARM A;  2ZEL A;  2XEJ A;  1BPM A;  3SI2 A;  4C8U A;  2GRE A;  4MHN A;  5K8N A;  1FT7 A;  2PCU A;  4YN3 A;  5LYL A;  2GLJ A;  4TJV A;  3SJX A;  1VIX A;  3WAB A;  3HUV A;  2IMO A;  5JGF A;  4LQG A;  4P4J A;  5LYI A;  2CIJ A;  3VTA A;  3KI9 A;  3NH8 A;  3KHX A;  4OC0 A;  3PB4 X;  4ZYQ A;  4MRI A;  2CF4 A;  1HDU A;  3NH4 A;  3V7Z A;  4OC1 A;  3KR4 A;  3PBE A;  5LYF A;  2PJ1 A;  1R3N A;  5D29 A;  2PJA A;  6CPA A;  2ANP A;  3PEI A;  2PVV A;  1Q7L A;  1FNO A;  2BO9 A;  2NYQ A;  3D67 A;  3B7I A;  1YSJ A;  1Z2L A;  3H8E A;  5HVG A;  4C85 A;  3N5F A;  1CBX A;  2Q43 A;  3VAR A;  4P10 A;  4P6Y A;  1DE4 C;  2ZEN A;  2O53 A;  4MCS A;  1NSA A;  3FMC A;  4IHM A;  4MCR A;  4OID A;  1LAM A;  4C8P A;  5DS0 A;  4DJL A;  1AMP A;  1F2P A;  3BI0 A;  1TKH A;  2PJC A;  4W9Y A;  2WYR A;  3WT4 A;  3T8W A;  1CP6 A;  4OC5 A;  5LYD A;  4BD9 A;  2PJ7 A;  1H8L A;  3IC1 A;  3EIF A;  4OC2 A;  2AFU A;  4C99 A;  1Z5R A;  4MHZ A;  4YWY A;  4EWT A;  1WVM A;  3B2Y A;  3MN8 A;  2JEW A;  3CDX A;  3DGV A;  3NA6 A;  3SJG A;  2ZED A;  4C86 A;  3H8F A;  1DTD A;  5JM6 A;  3TC8 A;  2QVP A;  1ZG8 A;  4X2T A;  1ZG7 A;  3CT9 A;  4P4E A;  4WJB A;  2PJ5 A;  3KGQ A;  4PXC A;  5THW A;  5J1Q A;  3L2N A;  2EWB A;  1ARL A;  1YW4 A;  1CPS A;  1IGB A;  4GM5 A;  2ZEF A;  2AFW A;  4A94 A;  4MCQ A;  4NGQ A;  4RUH A;  2ZEE A;  2O4H A;  4JYW A;  2HB6 A;  1XJO A;  1VGY A;  4G1P A;  3D7H A;  4OIW A;  4MHP A;  1Y0Y A;  3ISX A;  3B3S A;  5CBM A;  4NJR A;  2C6G A;  2HC9 A;  3B3V A;  3WC6 A;  2AFZ A;  8CPA A;  1YW6 A;  4X8I A;  1F57 A;  1BLL E;  2XEI A;  2PJ3 A;  4ZY1 A;  4CDJ A;  4P4B A;  4NGM A;  4UEE A;  4F9U A;  4UIB A;  4KNG E;  3TX8 A;  1EE3 P;  4Z65 A;  4NGP A;  2PRQ A;  3I74 A;  2ZOG A;  3B3C A;  2WZN A;  4AXV A;  4PXB A;  1XFO A;  1YME A;  1VHE A;  5K8M A;  4X3R A;  4PPZ A;  5HVH A;  3ICU A;  3SI1 A;  4H2K A;  1TKF A;  3IJ3 A;  1Y7E A;  2PIY A;  4FBE A;  5IR2 A;  1ELL P;  1ZG9 A;  2PJB A;  2OR4 A;  4C8C A;  4MXU A;  2AFO A;  1TXR A;  2V8H A;  3LWU A;  1Y9Z A;  2RB7 A;  3D68 A;  4R6T A;  1UWY A;  4C8T A;  3KR5 A;  2IQ6 A;  4DUK A;  3FEE A;  3CPA A;  3D66 A;  4TJX A;  4UEZ A;  4MMO A;  2ZEG A;  3B3T A;  2I3C A;  4FAI A;  2C5Q A;  4P4I A;  2EK8 A;  4MCP A;  3I6S A;  1LOK A;  3S9L A;  1XMB A;  2CTB A;  3PFE A;  1Y0R A;  5HXD A;  1QMU A;  3QNV A;  3B3W A;  3IWW A;  3FVL A;  1CX8 A;  4C9R A;  4OC4 A;  3D7D A;  5D8N A;  3K9T A;  3SJE A;  4UEF A;  4JZ0 A;  2C1C A;  4DYO A;  1CP7 A;  4PXD A;  1F2O A;  2G9D A;  4WWV A;  2F7V A;  2ZOF A;  4YU9 A;  2ABZ A;  1PYT B;  3IIB A;  4CDK A;  1AYE A;  1IY7 A;  4A37 A;  4UF4 A;  3HLP A;  4NGT A;  3PB8 X;  2AFM A;  2QJ8 A;  2CTC A;  4OME A;  3KQX A;  4C84 A;  5F09 A;  3KQZ A;  5I4M A;  3JRU A;  1R43 A;  2PJ9 A;  2RFH A;  4FWU A;  1LCP A;  5ELY A;  5LRK A;  4IAV A;  4FUU A;  2IJZ A;  2POK A;  4K3N A;  1LFW A;  2FVG A;  4Q7A A;  2GLF A;  4R8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...