4P4DA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor mp1c
Total Genus 260
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
260
sequence length
696
structure length
687
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
total genus 260
structure length 687
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4dA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4dA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4dA02
4ZY0A 3SJEA 5LRGA 2JEWA 2PIYA 5HVFA 3IO1A 2G9DA 3RZAA 2V8VA 2AFMA 3GUXA 4C9UA 4WJBA 5K8NA 4R76A 4C8AA 2PJ5A 5HVGA 4MXUA 5I4MA 3NFZA 3KL9A 4YWYA 1CG2A 1BPNA 4NGQA 2ZEGA 2F8HA 2CTCA 3BHXA 4OC1A 4P10A 3FMCA 1XBUA 4A37A 2ZEHA 4ZX8A 4NGPA 5D29A 2CF4A 3I1UA 4MHYA 1OBRA 3FEDA 1WVMA 4OIDA 3VARA 1JQGA 2V8DA 4ZI6A 4MHPA 4C85A 2AFUA 3KHXA 4JZ0A 4MHNA 4NGSA 3S9LA 1YW4A 1Z2LA 3I74A 4C99A 2ZOGA 4OC3A 2PJ8A 5THWA 1VHOA 1ZG9A 3SI0A 2BO9A 4CDJA 5LRJA 1Y0YA 3K9TA 3S9NA 4NFRA 2RB7A 3LMSA 1Q7LA 1QQ9A 4TNUA 3SJFA 4G1PA 4EMEA 3IIBA 2PVWA 3CT9A 4KSIA 1Y7EA 1LOKA 4KNGE 3SJGA 3JRUA 4LQGA 4F9VA 3FJUA 5LYFA 2QVPA 4EWTA 3PB6X 4NJQA 4C8FA 2OR4A 4OP4A 4MRIA 4OKOA 1XRYA 2PJ2A 5JH9A 2ABZA 4A39A 3D7GA 1CBXA 4FBEA 4MCPA 1Y9ZA 2PJ3A 2PJBA 4YU9A 4NJRA 4P4EA 3V38A 3PB7X 3BI1A 4UEZA 1PYTB 1ZLHA 2C6CA 3MRUA 3NH8A 5K8PA 4BD9A 1GYTA 2ANPA 3RBUA 1VHEA 3FX6A 2GREA 1YW6A 2IMOA 2QJ8A 4A38A 2PJAA 1R43A 2NYQA 3LWUA 3WC5A 1PCAA 3T8WA 8CPAA 4C9VA 3V7ZA 5K8OA 1CPXA 1CP7A 3BXMA 3D68A 3KQXA 4TWEA 1F2OA 1YSJA 1AYEA 1ZLIA 2C6PA 3KQZA 3CPAA 3TC8A 2J9AA 1VGYA 3KZWA 1LFWA 3L2NA 2BCOA 4C9AA 3WC6A 4OC4A 2PJ6A 2Q43A 1TKHA 1F2PA 2ZEDA 5HXDA 4UIAA 1FNOA 3EIFA 2OOTA 3SJXA 1HDUA 3FH4A 4UIBA 2PRQA 2QYVA 4OC0A 4O23A 2CIJA 2O53A 4DJLA 3B7IA 5DS0A 3SI2A 4X2TA 5CPAA 2ZEOA 3H8EA 2Q51A 3GLJA 4P4JA 4ZYQA 2JBJA 4ONWA 1LCPA 4R8FA 4P44A 4W9YA 3PBEA 2HC9A 1UWYA 2EK9A 2ZELA 1ZG8A 1XMBA 2V77A 3HUVA 3WC7A 4FWUA 2CTBA 4C8PA 3ISXA 3FF3A 1F57A 3D7DA 4P4BA 5D8NA 3ISZA 1ZG7A 1V6CA 2WZNA 4X8IA 4MHZA 4NGTA 3MN8A 4PXBA 2AFZA 4DYOA 3CPXA 3PB4X 3TX8A 1BAVA 3IFEA 5ELYA 4TJXA 5J1QA 1FT7A 3IJ3A 1BLLE 2F7VA 4C8UA 1LAMA 1TF8A 4ZX9A 2PJ7A 3FECA 4P4FA 2I3CA 2Q4ZA 4CPAA 3QNVA 1TKFA 1BPMA 3B3SA 3GB0A 2C1CA 1TF9A 1HDQA 3BI0A 4IAVA 4PQAA 2XEJA 4JYWA 4DUKA 1TXRA 2ZEPA 4B6ZA 5JM6A 2AFSA 2VL1A 3HLPA 5HVHA 2PJ0A 2BOAA 4FUUA 1R3NA 2PCUA 4Z65A 3KGQA 2ZEMA 2V8HA 2XEFA 3PEIA 4UF4A 2PE3A 4PXDA 1ARMA 2ZOFA 4P4DA 2NSMA 4P4IA 2ZENA 4GM5A 4MMOA 4X3RA 3SI1A 1DE4C 2XEIA 2ZEEA 3PRTA 1HEEA 4IHMA 4PXCA 4F9UA 5K8MA 4K3NA 4NGRA 2RFHA 4R7MA 3D7FA 3IC1A 1AMPA 2IQ6A 2POKA 4OC5A 3CDXA 3DGVA 5LYIA 3N5FA 6CPAA 3B35A 4OMEA 3FVLA 1Z8LA 5LYDA 1Y0RA 3ICUA 2XEGA 1RTQA 4MCRA 3VATA 2IJZA 4C9RA 1KWMA 3H8GA 1YLOA 3VH9A 3D7HA 1QMUA 2PIZA 1XFOA 3WABA 3NH5A 4C9EA 4CDKA 5F09A 2GLJA 1EE3P 4RUHA 4C8CA 3K2KA 4MCQA 3H8FA 3FEEA 3D67A 1M4LA 4PXEA 2PVVA 4P6YA 2AFWA 2GU2A 3PBBA 3D66A 2GLFA 3B2YA 2AFOA 4EFDA 5LRKA 1Z5RA 4H2KA 4F8ZA 3IEHA 2ZEFA 4TJVA 1CP6A 4ZY2A 1ELLP 4YN3A 4PPZA 1ARLA 3KHZA 7CPAA 3NA6A 3RAMA 3I6SA 4WWVA 1LANA 1NSAA 2AFXA 3VTAA 4C8TA 2C6GA 3NH4A 3DLJA 3PB8X 2EK8A 2HB6A 2WYRA 1LAPA 3B3TA 2PJCA 4C86A 1ELMP 4C84A 3D4UA 1TKJA 2FVGA 4OIWA 3PB9X 4ZY1A 2V8GA 4MCSA 2PJ9A 1H8LA 1DTDA 5LYLA 3IWWA 4P45A 1VIXA 3B3WA 4AXVA 1IY7A 2PJ4A 1CX8A 1XJOA 2JBKA 3PFOA 1IGBA 1YMEA 2DEAA 4R6TA 5IB9A 5JGFA 4IK2A 3B3VA 2PJ1A 4NGNA 2O4HA 4UEFA 2EWBA 3KR4A 1CPSA 4Q7AA 4UEEA 3S9MA 3KR5A 1XF1A 5CBMA 4FAIA 3KI9A 3B3CA 3KASA 4A94A 4OC2A 3WT4A 3PFEA 4NGMA
chains in the Genus database with same CATH superfamily
4ZY0A 4C68A 3SJEA 1IB1E 2VZYA 3PFVA 2JEWA 5LRGA 4CGNA 2PIYA 5HVFA 5JVLA 3IO1A 2G9DA 2Z3MA 3RZAA 2FT0A 2V8VA 1YR0A 4HNYB 5KTCA 2AFMA 2OB0A 3EY5A 3GUXA 4Q38A 3EZAA 4C9UA 3S6GA 4WJBA 3CXQA 4CS0B 4B5PB 5K8NA 4R76A 4CGLA 1Z8XA 1YVHA 2PJ5A 2C5QA 4C8AA 5HVGA 2KCWA 2Z3PA 2Y1NA 4MXUA 2B5GA 5I4MA 3NFZA 3KL9A 2FM4A 4YWYA 1S7FA 1CG2A 1BPNA 4NGQA 4OADA 4HNXB 3WR7A 2ZEGA 1S3ZA 2BSWA 2F8HA 1M4DA 3MGDA 2CTCA 4UA3A 3LACA 5JQ4A 1LRZA 4IUSA 3BHXA 4OC1A 2G3TA 5A27A 4P10A 3FMCA 1XBUA 2EBJA 4M6GA 4A37A 2ZEHA 4ZX8A 4NGPA 3VRRA 2O28A 2YNDA 5D29A 2R7HA 1VI4A 1OZPA 2B4DA 2CF4A 5BWAB 3T5MA 3TTHA 3I1UA 2E28A 4MHYA 1MJBA 4CYNA 1YK3A 1OBRA 3FEDA 2HWGA 2J8NA 2WUUA 1FBVA 4OIDA 4PV6A 4F6AA 1WVMA 3VARA 1JQGA 2V8DA 4ZI6A 3BUWB 4MHPA 4C85A 5F49A 3TLCA 1Z8TA 2AFUA 3KHXA 4UBRA 1KEEB 1S5KA 4UFVA 4BPUB 5ISVA 4IIYA 4JZ0A 4MHNA 3VRPA 4NGSA 4E2AA 4YGOA 5IX3A 2I79A 3OWCA 4NF1A 3GJZA 4XPDC 3TLGA 3S9LA 1YW4A 1Z2LA 3I74A 3TLEA 4A4CA 3C8OA 5IB0A 3W6XA 3D8PA 4C99A 1WK4A 2ZOGA 3I3GA 5AGEA 4OC3A 2PJ8A 5THWA 5G22A 1VHOA 1ZG9A 3SI0A 2BO9A 4CDJA 5LRJA 3G23A 1Y0YA 3K9TA 3S9NA 2CY2A 1CS0B 4NFRA 2RB7A 3TLBA 3VRQA 1UFHA 3KKWA 4NEXA 1MK4A 3LMSA 1QSRA 1BOBA 1IIDA 5FVJA 4C7IA 4CAFA 1YX0A 1Q7LA 1QQ9A 4TNUA 3SJFA 2Y0MA 4G1PA 2ZW5A 4QVTA 2DXQA 4EMEA 5C82A 5IV0A 2HROA 2A4NA 3IIBA 2PVWA 3FB3A 3R9GA 3TO9A 2BL1A 1KUYA 2FL4A 3CT9A 2PDOA 1KZFA 4KSIA 4H6UA 4R57A 1Y7EA 5E96A 4B5PA 2B3UA 1LOKA 3GKRA 3SJGA 3JRUA 4NSQA 3ZJ0A 1CE8B 4KNGE 4LQGA 2CNTA 1X10A 4GXHA 4F9VA 4MY0A 2ZW7A 3EXNA 3FJUA 5LYFA 3G8WA 1XOVA 2AUNA 1VBHA 2QVPA 5BY0A 1ON0A 4EWTA 2GP4A 3PB6X 4NJQA 1Q5XA 2RC4A 4C8FA 2OR4A 1MJ9A 2DPSA 3IWGA 4OP4A 4MRIA 4OKOA 3S6HA 3T9YA 5HKZA 1XRYA 2PJ2A 5JH9A 2B4BA 2Y1MA 4M6HA 1PU9A 4DNCA 1DIKA 2ABZA 4UCMA 4A39A 2EUIA 2P6EA 3D7GA 1CBXA 3D3SA 4FBEA 4LQ6A 4MCPA 1Y9ZA 2PJ3A 1KBLA 2PJBA 3FXTA 1MJAA 1Z4EA 1AUGA 4AVBA 5AG6A 4YU9A 4CYOA 4J3GA 1M6VB 4NJRA 3W6SA 2Z3KA 2YJVA 4BPXB 3RNZA 2OH1A 4ORFA 3SXOA 4CRYB 2B4JC 4P4EA 2QIRA 2VEZA 3V38A 3OP0A 3PB7X 4BBHA 1GGOA 1XE4A 3F0AA 3BI1A 3EZBA 2R98A 4UEZA 1PYTB 1YVOA 4H1HA 1KC7A 1ZLHA 1A2ZA 3SXNA 2C6CA 3MRUA 3HPGG 3NH8A 3JVNA 5K8PA 4BD9A 4YFJA 1ZRSA 1GYTA 1WWZA 2ANPA 4ONUA 3RBUA 2HUZA 2REFA 1VHEA 5CNPA 2D0PA 3FX6A 2Z3LA 1P4NA 1Q2DA 4C2ZA 4KUBA 1NE9A 2GREA 1YW6A 2IMOA 2QJ8A 3QB8A 1Q2YA 4E94A 3GIUA 4A38A 2PJAA 5DWMA 1R43A 2NYQA 2GIVA 3CXPA 2R8VA 3LWUA 3DR6A 4KOSA 3WC5A 1PCAA 1RXTA 4U5YA 2GANA 4AG9A 4II9A 1V0CA 3TE4A 3T8WA 8CPAA 2ZXVA 4C9VA 3V7ZA 5K8OA 3TOAA 1CPXA 4C2YA 1CP7A 3BXMA 3F8KA 2XPPA 4UCNA 2G0BA 3D68A 3KQXA 2Q4YA 4XNHC 3R95A 4A95A 4TWEA 4KOUA 1F2OA 5H86A 5IR2A 4ZGYB 1YSJA 2D4PA 1AYEA 1ZLIA 4OAEA 1B87A 2MP0A 1M4IA 1M4GA 2C6PA 2P6GA 3E0KA 3KQZA 3CPAA 3TC8A 4KVME 2J8RA 2EZCA 2J9AA 4KOWA 1VGYA 4A33A 4QB9A 3VRNA 3TYXA 1I21A 3KZWA 1LFWA 2DLAA 3L2NA 4IF5A 3T90A 2BCOA 4C2XA 3WC6A 4B10A 1YLEA 4C9AA 4OC4A 2PJ6A 4CGOA 2Q43A 4UWIA 1ZO0A 4PSWA 1S60A 5HMNA 5DWNA 1TKHA 1XIXA 1F2PA 2YJTA 4KZTA 4KLWA 3S6FA 2ZEDA 3DNSA 4PK2A 4BPWB 2Z3OA 4MFKA 1Z9UA 4MHDA 5HXDA 2PCNA 4UIAA 1FNOA 2Z10A 3EIFA 4UWJA 2OOTA 4AG7A 3ZZIA 4HPSA 2Q4VA 2VQYA 2IL4A 3SJXA 2ODFA 1HDUA 3FH4A 2NMTA 2ATRA 4UIBA 3VWEA 3IU2A 5C88A 3PT1A 2YNCA 3FIXA 5KTDA 4CGMA 2PRQA 2QYVA 4OC0A 3PZJA 1WJTA 4UCPA 5JYBA 1SQHA 4O23A 3ZNIA 2JDCA 2EZBA 5F1YA 2CIJA 2O53A 4DJLA 4MJXA 4JXQA 2UV8G 1M1DA 1U6MA 3B7IA 4UFXA 4X5KA 5DS0A 1EZAA 3SI2A 4X2TA 2PSWA 5CPAA 4MJ8A 2ZEOA 3LD2A 3H8EA 2Q51A 1CJWA 1KUVA 3GLJA 4L89A 2HV2A 4PSXA 5EC4A 4P4JA 1JWQA 2QECA 4ZYQA 2JBJA 4XPDB 2WSAA 4ONWA 1LCPA 5A28A 3T07A 1TIQA 4R8FA 4P44A 2AE6A 4W9YA 2ZW4A 3PBEA 2HC9A 1UWYA 4MFPA 2EK9A 2ZELA 1GHEA 1ZG8A 1XMBA 2V77A 5HH1A 3HUVA 3DR8A 3WC7A 4FWUA 2CTBA 4C8PA 5HKWA 3ISXA 3OB2B 5F13A 3FF3A 1S7LA 1F57A 3D7DA 4P4BA 5D8NA 3W91A 4GS4A 3ISZA 1ZG7A 4M6IA 1M44A 1IICA 1YGHA 1V6CA 2WZNA 2R82A 4X8IA 3EZEA 1JDEA 1VKCA 1CM0A 4NGTA 4MHZA 4MY3A 1NXJA 3P2HA 3MN8A 4JJXA 3GYAA 4PXBA 2AFZA 4AVCA 4DYOA 4H89A 3FBUA 5AG7A 2D4OA 2REEA 3CPXA 3PB4X 1XMTA 1Z8WA 3TX8A 3VGOA 1BAVA 3EC4A 3IFEA 5ELYA 1IU8A 4TJXA 2EO8A 5J1QA 4KSFA 1FT7A 3IJ3A 1BLLE 2F7VA 3BUMB 4C8UA 4JLYA 1NSLA 3P2FA 1EZBA 1ZYMA 2OZHA 1LAMA 3CZXA 4R9MA 1JDBC 4RR2B 1TF8A 4ZX9A 4KSAA 1B47A 2PQ8A 4A30A 2PJ7A 3FECA 4E8OA 4P4FA 2I3CA 2Q4ZA 4CPAA 3QNVA 4K30A 1TKFA 1BPMA 3A9LA 2WPWA 3B3SA 2B58A 4I49A 3PGPA 2B5GB 3GB0A 4AVAA 4B5OA 2FE7A 2C1CA 1TF9A 1VBGA 4JVOA 4B13A 1HDQA 1BO4A 3BI0A 3EO4A 4IAVA 4PQAA 4RS2A 4QBJA 3F5BA 5AG5A 2CNSA 1J3LA 2Q04A 2JLMA 2XEJA 1BXRB 1Z4RA 4JYWA 4MFZA 1TXRA 2ZEPA 3JUWA 4RN7A 4CYQA 4B6ZA 4CYPA 4DUKA 5JM6A 1R61A 2AFSA 2VL1A 3HLPA 5HVHA 3VROA 1S7KA 2VXKA 2PJ0A 4QC6A 1S7NA 2BOAA 4KLVA 1IYLA 1R3NA 2Z11A 4FUUA 4CZ1A 1QSTA 2PCUA 2P0WA 2N3AB 3KGQA 4Z65A 3U1BA 2ZEMA 2V8HA 5FD8A 2XEFA 2BUEA 2C27A 4FD7A 3PEIA 4R87A 1PUAA 2HQYA 4UF4A 2PE3A 4PXDA 1ARMA 4FD4A 3PFOA 3D2MA 2ZOFA 4P4DA 4MBUA 5GCNA 4R3LA 3CXSA 5F47A 2NSMA 4P4IA 1Q2CA 2ZENA 4GM5A 4MMOA 4XPLA 5EBVA 2B0AA 3TLGB 3RYOA 3GY9A 4U9YA 4X3RA 3TT2A 2CNMA 4OLLA 1T36B 1YQEA 3SI1A 2XPLA 4XNHB 1DE4C 1Y9WA 3R96A 2XEIA 2ZEEA 2OZUA 1HEEA 3PRTA 4IHMA 4PXCA 3S6KA 4F9UA 3R9EA 5AG4A 4K3NA 4NGRA 4UFWA 5K8MA 4JXRA 2RFHA 3NOJA 3I9SA 4CAVA 3R9FA 4Q36A 5F48A 3TCVA 4R7MA 1N71A 3RO0A 3D7FA 5F46A 4CAXA 5F5XA 3IC1A 2EZAA 4INJA 1VHSA 1YVKA 4JWPA 4KS9A 2Q7BA 2Q44A 1AMPA 2IQ6A 5J8CA 2POKA 2I00A 4OC5A 3CDXA 3DGVA 5LYIA 3N5FA 1RO5A 6CPAA 3B35A 3IU1A 1EO0A 4HKFA 4E5SA 4OMEA 3FVLA 1FY7A 1Z8LA 2VZZA 3BUOB 2PC1A 1Y0RA 4NCZA 3NFQA 2B3VA 2Q0YA 1Y7RA 4Y49C 5LYDA 3VWDA 3HPHE 3ICUA 2XEGA 1L0CA 2ARHA 3TLZA 4Y49B 2VBQA 1RTQA 4MCRA 4BINA 4GPLB 2IJZA 2WPXA 3VATA 4IIXA 1KWMA 2YGWA 3KRVA 4C9RA 4MFQA 4CO9A 4EYSA 3LODA 4RI1A 1YLOA 3H8GA 3TLAA 3DSBA 2XPNA 3D7HA 3NE7A 3R1KA 4KUAA 1QMUA 2PIZA 2X7BA 3VH9A 4B12A 5JPHA 4FD5A 1XFOA 1ZL0A 3WABA 3NH5A 3D2PA 3TO6A 1R57A 3QAYA 4C9EA 4MI4A 1C30B 4CDKA 5F09A 2R1IA 2K5TA 1XF8A 2GLJA 1XEBA 4QUSA 2FIWA 1EE3P 4M3SA 5I0CA 5AXIA 4RUHA 2EVNA 2Z0ZA 2Z3NA 2JEVA 3FRMA 2CXAA 3K2KA 4C8CA 3OAKA 4MCQA 3H8FA 3FEEA 3TLYA 3D67A 4M85A 4A2ZA 4BMHA 3IWEA 3QAHA 1M4LA 4J0NA 1QSOA 1K4JA 4PXEA 3BJ8A 3TOBA 3BJ7A 3SHPA 2PVVA 4P6YA 1IYKA 2AFWA 4CGPA 2GU2A 3PBBA 3D66A 4HNWB 3BUNB 2GLFA 3B2YA 2AFOA 4EFDA 5LRKA 1Z5RA 4H2KA 4E0AA 2X0SA 3PLFB 4F8ZA 3IEHA 4A31A 5K99A 2ZEFA 4TJVA 2OZGA 3G3SA 1CP6A 4ZY2A 3K9UA 1ELLP 2DF5A 2PR1A 4YN3A 1Z9EA 3FNCA 3IGRA 2P6FA 2AUMA 4MFLA 1ARLA 3KHZA 4PPZA 4KVOE 4LUAA 4BTFA 7CPAA 3NA6A 3RAMA 1I12A 3I6SA 4WWVA 3H4QA 1LANA 1NSAA 2AFXA 4AB7A 3VTAA 4C8TA 2C6GA 3V8IA 4CAWA 5G20A 2QMLA 2J8MA 3OB1B 3NH4A 2BEIA 2FIAA 3DDDA 3DLJA 3PB8X 2Q7SA 3K4IA 3TO7A 2EK8A 2XPOA 2PRBA 2FSRA 2YNEA 2HB6A 1IOFA 1LAPA 2WYRA 2FXFA 3B3TA 3C26A 4F0XA 3O8ZA 1YREA 2PJCA 4C86A 1ELMP 4C84A 4YRHA 4KVXA 2OU2A 3D4UA 1TKJA 4LX9A 4CAEA 5G1ZA 3TFYA 4MFJA 3BUXB 4B11A 1KUXA 4MI1A 4KOVA 2FVGA 5KTAA 3FYNA 4OIWA 2GFQA 3PB9X 2AJ6A 5HKYA 5J8FA 1P0HA 1Y9KA 3HMJG 1I1DA 5H84A 4ZY1A 4B14A 1J4JA 1NBWA 5J3XA 1A9XB 4COBA 2D0OA 2V8GA 4FD6A 4MCSA 1QSNA 2PJ9A 1H8LA 3EFAA 3U88C 1DTDA 5LYLA 3IWWA 4P45A 3B8GA 3BLNA 4KOXA 1VIXA 4KOYA 2HI6A 3B3WA 4A4BA 1C3OB 1X12A 4AXVA 4CRZB 1IOIA 1IY7A 2PJ4A 5G21A 1CX8A 3T05A 1XJOA 2JBKA 2G3AA 2GE3A 2PR8A 1IGBA 1YMEA 2B4DB 2VI7A 2YNCC 3JTKA 2DEAA 3PP9A 4R6TA 5EMIA 5IB9A 4NXYA 3N7ZA 4ZBGA 4L8AA 5JGFA 4COGA 3NE8A 4U9ZA 4IK2A 3B3VA 2PJ1A 4NGNA 2F5IA 2O4HA 5F9MA 4UEFA 4F0YA 2EWBA 2DIKA 3KR4A 2H5MA 4R3KA 1QSMA 1CPSA 4H6ZA 2FCKA 1NMTA 4Q7AA 4UEEA 3S9MA 3KR5A 4M8DA 1B6BA 1XF1A 5CBMA 4FAIA 2FS5A 3KI9A 4A32A 2OLSA 4KOTA 3T0TA 4JD6A 4C7HA 2ZW6A 3B3CA 3KASA 4A94A 4OC2A 2VKZG 2JDDA 3WT4A 3SR3A 3PFEA 3F9KC 3UY5A 4EVYA 4NGMA 2ZPAA 4KORA 2CBLA 4XPKA 4PK3A 3H5ZA 2DPTA
chains in the Genus database with same CATH topology
4ZY0A 3SJEA 5LRGA 2JEWA 2PIYA 5HVFA 3IO1A 2G9DA 3RZAA 2V8VA 2AFMA 3GUXA 4C9UA 4WJBA 5K8NA 4R76A 4C8AA 2PJ5A 2C5QA 5HVGA 4MXUA 5I4MA 3NFZA 3KL9A 4YWYA 1CG2A 1BPNA 4NGQA 2ZEGA 2F8HA 2CTCA 3BHXA 4OC1A 4P10A 3FMCA 1XBUA 4A37A 2ZEHA 4ZX8A 4NGPA 5D29A 2CF4A 3I1UA 4MHYA 1OBRA 3FEDA 1WVMA 4OIDA 3VARA 1JQGA 2V8DA 4ZI6A 4MHPA 4C85A 2AFUA 3KHXA 4JZ0A 4MHNA 4NGSA 3S9LA 1YW4A 1Z2LA 3I74A 4C99A 2ZOGA 4OC3A 2PJ8A 5THWA 1VHOA 1ZG9A 3SI0A 2BO9A 4CDJA 5LRJA 1Y0YA 3K9TA 3S9NA 4NFRA 2RB7A 3LMSA 1Q7LA 1QQ9A 4TNUA 3SJFA 4G1PA 4EMEA 3IIBA 2PVWA 3CT9A 4KSIA 1Y7EA 1LOKA 4KNGE 3SJGA 3JRUA 4LQGA 4F9VA 3FJUA 5LYFA 2QVPA 4EWTA 2GP4A 3PB6X 4NJQA 4C8FA 2OR4A 4OP4A 4MRIA 4OKOA 1XRYA 2PJ2A 5JH9A 2ABZA 4A39A 3D7GA 1CBXA 4FBEA 4MCPA 1Y9ZA 2PJ3A 2PJBA 4YU9A 4NJRA 4P4EA 3V38A 3PB7X 3BI1A 4UEZA 1PYTB 1ZLHA 2C6CA 3MRUA 3NH8A 5K8PA 4BD9A 1GYTA 2ANPA 3RBUA 1VHEA 3FX6A 2GREA 1YW6A 2IMOA 2QJ8A 4A38A 2PJAA 1R43A 2NYQA 3LWUA 3WC5A 1PCAA 3T8WA 8CPAA 4C9VA 3V7ZA 5K8OA 1CPXA 1CP7A 3BXMA 3D68A 3KQXA 4TWEA 1F2OA 5IR2A 1YSJA 1AYEA 1ZLIA 2C6PA 3KQZA 3CPAA 3TC8A 2J9AA 1VGYA 3KZWA 1LFWA 3L2NA 2BCOA 4C9AA 3WC6A 4OC4A 2PJ6A 2Q43A 1TKHA 1F2PA 2ZEDA 5HXDA 4UIAA 1FNOA 3EIFA 2OOTA 3SJXA 1HDUA 3FH4A 4UIBA 2PRQA 2QYVA 4OC0A 4O23A 2CIJA 2O53A 4DJLA 3B7IA 5DS0A 3SI2A 4X2TA 5CPAA 2ZEOA 3H8EA 2Q51A 3GLJA 4P4JA 4ZYQA 2JBJA 4ONWA 1LCPA 4R8FA 4P44A 4W9YA 3PBEA 2HC9A 1UWYA 2EK9A 2ZELA 1ZG8A 1XMBA 2V77A 3HUVA 3WC7A 4FWUA 2CTBA 4C8PA 3ISXA 3FF3A 1F57A 3D7DA 4P4BA 5D8NA 3ISZA 1ZG7A 1V6CA 2WZNA 4X8IA 4MHZA 4NGTA 3MN8A 4PXBA 2AFZA 4DYOA 3CPXA 3PB4X 3TX8A 1BAVA 3IFEA 5ELYA 4TJXA 5J1QA 1FT7A 3IJ3A 1BLLE 2F7VA 4C8UA 1LAMA 1TF8A 4ZX9A 2PJ7A 3FECA 4P4FA 2I3CA 2Q4ZA 4CPAA 3QNVA 1TKFA 1BPMA 3B3SA 3GB0A 2C1CA 1TF9A 1HDQA 3BI0A 4IAVA 4PQAA 2XEJA 4JYWA 4DUKA 1TXRA 2ZEPA 4B6ZA 5JM6A 2AFSA 2VL1A 3HLPA 5HVHA 2PJ0A 2BOAA 4FUUA 1R3NA 2PCUA 4Z65A 3KGQA 2ZEMA 2V8HA 2XEFA 3PEIA 4UF4A 2PE3A 4PXDA 1ARMA 2ZOFA 4P4DA 2NSMA 4P4IA 2ZENA 4GM5A 4MMOA 4X3RA 3SI1A 1DE4C 2XEIA 2ZEEA 3PRTA 1HEEA 4IHMA 4PXCA 4F9UA 5K8MA 4K3NA 4NGRA 2RFHA 4R7MA 3D7FA 3IC1A 1AMPA 2IQ6A 2POKA 4OC5A 3CDXA 3DGVA 5LYIA 3N5FA 6CPAA 3B35A 4OMEA 3FVLA 1Z8LA 5LYDA 1Y0RA 3ICUA 2XEGA 1RTQA 4MCRA 3VATA 2IJZA 4C9RA 1KWMA 3H8GA 1YLOA 3VH9A 3D7HA 1QMUA 2PIZA 1XFOA 3WABA 3NH5A 4C9EA 4CDKA 5F09A 2GLJA 1EE3P 4RUHA 4C8CA 3K2KA 4MCQA 3H8FA 3FEEA 3D67A 1M4LA 4PXEA 2PVVA 4P6YA 2AFWA 2GU2A 3PBBA 3D66A 2GLFA 3B2YA 2AFOA 4EFDA 5LRKA 1Z5RA 4H2KA 4F8ZA 3IEHA 2ZEFA 4TJVA 1CP6A 4ZY2A 1ELLP 4YN3A 4PPZA 1ARLA 3KHZA 7CPAA 3NA6A 3RAMA 3I6SA 4WWVA 1LANA 1NSAA 2AFXA 3VTAA 4C8TA 2C6GA 3NH4A 3DLJA 3PB8X 2EK8A 2HB6A 2WYRA 1LAPA 3B3TA 2PJCA 4C86A 1ELMP 4C84A 3D4UA 1TKJA 2FVGA 4OIWA 3PB9X 4ZY1A 2V8GA 4MCSA 2PJ9A 1H8LA 1DTDA 5LYLA 3IWWA 4P45A 1VIXA 3B3WA 4AXVA 1IY7A 2PJ4A 1CX8A 1XJOA 2JBKA 3PFOA 1IGBA 1YMEA 2DEAA 4R6TA 5IB9A 5JGFA 4IK2A 3B3VA 2PJ1A 4NGNA 2O4HA 4UEFA 2EWBA 3KR4A 1CPSA 4Q7AA 4UEEA 3S9MA 3KR5A 1XF1A 5CBMA 4FAIA 3KI9A 3B3CA 3KASA 4A94A 4OC2A 3WT4A 3PFEA 4NGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZY0 A;  3SJE A;  5LRG A;  2JEW A;  2PIY A;  5HVF A;  3IO1 A;  2G9D A;  3RZA A;  2V8V A;  2AFM A;  3GUX A;  4C9U A;  4WJB A;  5K8N A;  4R76 A;  4C8A A;  2PJ5 A;  5HVG A;  4MXU A;  5I4M A;  3NFZ A;  3KL9 A;  4YWY A;  1CG2 A;  1BPN A;  4NGQ A;  2ZEG A;  2F8H A;  2CTC A;  3BHX A;  4OC1 A;  4P10 A;  3FMC A;  1XBU A;  4A37 A;  2ZEH A;  4ZX8 A;  4NGP A;  5D29 A;  2CF4 A;  3I1U A;  4MHY A;  1OBR A;  3FED A;  1WVM A;  4OID A;  3VAR A;  1JQG A;  2V8D A;  4ZI6 A;  4MHP A;  4C85 A;  2AFU A;  3KHX A;  4JZ0 A;  4MHN A;  4NGS A;  3S9L A;  1YW4 A;  1Z2L A;  3I74 A;  4C99 A;  2ZOG A;  4OC3 A;  2PJ8 A;  5THW A;  1VHO A;  1ZG9 A;  3SI0 A;  2BO9 A;  4CDJ A;  5LRJ A;  1Y0Y A;  3K9T A;  3S9N A;  4NFR A;  2RB7 A;  3LMS A;  1Q7L A;  1QQ9 A;  4TNU A;  3SJF A;  4G1P A;  4EME A;  3IIB A;  2PVW A;  3CT9 A;  4KSI A;  1Y7E A;  1LOK A;  4KNG E;  3SJG A;  3JRU A;  4LQG A;  4F9V A;  3FJU A;  5LYF A;  2QVP A;  4EWT A;  3PB6 X;  4NJQ A;  4C8F A;  2OR4 A;  4OP4 A;  4MRI A;  4OKO A;  1XRY A;  2PJ2 A;  5JH9 A;  2ABZ A;  4A39 A;  3D7G A;  1CBX A;  4FBE A;  4MCP A;  1Y9Z A;  2PJ3 A;  2PJB A;  4YU9 A;  4NJR A;  4P4E A;  3V38 A;  3PB7 X;  3BI1 A;  4UEZ A;  1PYT B;  1ZLH A;  2C6C A;  3MRU A;  3NH8 A;  5K8P A;  4BD9 A;  1GYT A;  2ANP A;  3RBU A;  1VHE A;  3FX6 A;  2GRE A;  1YW6 A;  2IMO A;  2QJ8 A;  4A38 A;  2PJA A;  1R43 A;  2NYQ A;  3LWU A;  3WC5 A;  1PCA A;  3T8W A;  8CPA A;  4C9V A;  3V7Z A;  5K8O A;  1CPX A;  1CP7 A;  3BXM A;  3D68 A;  3KQX A;  4TWE A;  1F2O A;  1YSJ A;  1AYE A;  1ZLI A;  2C6P A;  3KQZ A;  3CPA A;  3TC8 A;  2J9A A;  1VGY A;  3KZW A;  1LFW A;  3L2N A;  2BCO A;  4C9A A;  3WC6 A;  4OC4 A;  2PJ6 A;  2Q43 A;  1TKH A;  1F2P A;  2ZED A;  5HXD A;  4UIA A;  1FNO A;  3EIF A;  2OOT A;  3SJX A;  1HDU A;  3FH4 A;  4UIB A;  2PRQ A;  2QYV A;  4OC0 A;  4O23 A;  2CIJ A;  2O53 A;  4DJL A;  3B7I A;  5DS0 A;  3SI2 A;  4X2T A;  5CPA A;  2ZEO A;  3H8E A;  2Q51 A;  3GLJ A;  4P4J A;  4ZYQ A;  2JBJ A;  4ONW A;  1LCP A;  4R8F A;  4P44 A;  4W9Y A;  3PBE A;  2HC9 A;  1UWY A;  2EK9 A;  2ZEL A;  1ZG8 A;  1XMB A;  2V77 A;  3HUV A;  3WC7 A;  4FWU A;  2CTB A;  4C8P A;  3ISX A;  3FF3 A;  1F57 A;  3D7D A;  4P4B A;  5D8N A;  3ISZ A;  1ZG7 A;  1V6C A;  2WZN A;  4X8I A;  4MHZ A;  4NGT A;  3MN8 A;  4PXB A;  2AFZ A;  4DYO A;  3CPX A;  3PB4 X;  3TX8 A;  1BAV A;  3IFE A;  5ELY A;  4TJX A;  5J1Q A;  1FT7 A;  3IJ3 A;  1BLL E;  2F7V A;  4C8U A;  1LAM A;  1TF8 A;  4ZX9 A;  2PJ7 A;  3FEC A;  4P4F A;  2I3C A;  2Q4Z A;  4CPA A;  3QNV A;  1TKF A;  1BPM A;  3B3S A;  3GB0 A;  2C1C A;  1TF9 A;  1HDQ A;  3BI0 A;  4IAV A;  4PQA A;  2XEJ A;  4JYW A;  4DUK A;  1TXR A;  2ZEP A;  4B6Z A;  5JM6 A;  2AFS A;  2VL1 A;  3HLP A;  5HVH A;  2PJ0 A;  2BOA A;  4FUU A;  1R3N A;  2PCU A;  4Z65 A;  3KGQ A;  2ZEM A;  2V8H A;  2XEF A;  3PEI A;  4UF4 A;  2PE3 A;  4PXD A;  1ARM A;  2ZOF A;  4P4D A;  2NSM A;  4P4I A;  2ZEN A;  4GM5 A;  4MMO A;  4X3R A;  3SI1 A;  1DE4 C;  2XEI A;  2ZEE A;  3PRT A;  1HEE A;  4IHM A;  4PXC A;  4F9U A;  5K8M A;  4K3N A;  4NGR A;  2RFH A;  4R7M A;  3D7F A;  3IC1 A;  1AMP A;  2IQ6 A;  2POK A;  4OC5 A;  3CDX A;  3DGV A;  5LYI A;  3N5F A;  6CPA A;  3B35 A;  4OME A;  3FVL A;  1Z8L A;  5LYD A;  1Y0R A;  3ICU A;  2XEG A;  1RTQ A;  4MCR A;  3VAT A;  2IJZ A;  4C9R A;  1KWM A;  3H8G A;  1YLO A;  3VH9 A;  3D7H A;  1QMU A;  2PIZ A;  1XFO A;  3WAB A;  3NH5 A;  4C9E A;  4CDK A;  5F09 A;  2GLJ A;  1EE3 P;  4RUH A;  4C8C A;  3K2K A;  4MCQ A;  3H8F A;  3FEE A;  3D67 A;  1M4L A;  4PXE A;  2PVV A;  4P6Y A;  2AFW A;  2GU2 A;  3PBB A;  3D66 A;  2GLF A;  3B2Y A;  2AFO A;  4EFD A;  5LRK A;  1Z5R A;  4H2K A;  4F8Z A;  3IEH A;  2ZEF A;  4TJV A;  1CP6 A;  4ZY2 A;  1ELL P;  4YN3 A;  4PPZ A;  1ARL A;  3KHZ A;  7CPA A;  3NA6 A;  3RAM A;  3I6S A;  4WWV A;  1LAN A;  1NSA A;  2AFX A;  3VTA A;  4C8T A;  2C6G A;  3NH4 A;  3DLJ A;  3PB8 X;  2EK8 A;  2HB6 A;  2WYR A;  1LAP A;  3B3T A;  2PJC A;  4C86 A;  1ELM P;  4C84 A;  3D4U A;  1TKJ A;  2FVG A;  4OIW A;  3PB9 X;  4ZY1 A;  2V8G A;  4MCS A;  2PJ9 A;  1H8L A;  1DTD A;  5LYL A;  3IWW A;  4P45 A;  1VIX A;  3B3W A;  4AXV A;  1IY7 A;  2PJ4 A;  1CX8 A;  1XJO A;  2JBK A;  3PFO A;  1IGB A;  1YME A;  2DEA A;  4R6T A;  5IB9 A;  5JGF A;  4IK2 A;  3B3V A;  2PJ1 A;  4NGN A;  2O4H A;  4UEF A;  2EWB A;  3KR4 A;  1CPS A;  4Q7A A;  4UEE A;  3S9M A;  3KR5 A;  1XF1 A;  5CBM A;  4FAI A;  3KI9 A;  3B3C A;  3KAS A;  4A94 A;  4OC2 A;  3WT4 A;  3PFE A;  4NGM A; 
#chains in the Genus database with same CATH topology
 4ZY0 A;  4C68 A;  3SJE A;  1IB1 E;  2VZY A;  3PFV A;  2JEW A;  5LRG A;  4CGN A;  2PIY A;  5HVF A;  5JVL A;  3IO1 A;  2G9D A;  2Z3M A;  3RZA A;  2FT0 A;  2V8V A;  1YR0 A;  4HNY B;  5KTC A;  2AFM A;  2OB0 A;  3EY5 A;  3GUX A;  4Q38 A;  3EZA A;  4C9U A;  3S6G A;  4WJB A;  3CXQ A;  4CS0 B;  4B5P B;  5K8N A;  4R76 A;  4CGL A;  1Z8X A;  1YVH A;  2PJ5 A;  2C5Q A;  4C8A A;  5HVG A;  2KCW A;  2Z3P A;  2Y1N A;  4MXU A;  2B5G A;  5I4M A;  3NFZ A;  3KL9 A;  2FM4 A;  4YWY A;  1S7F A;  1CG2 A;  1BPN A;  4NGQ A;  4OAD A;  4HNX B;  3WR7 A;  2ZEG A;  1S3Z A;  2BSW A;  2F8H A;  1M4D A;  3MGD A;  2CTC A;  4UA3 A;  3LAC A;  5JQ4 A;  1LRZ A;  4IUS A;  3BHX A;  4OC1 A;  2G3T A;  5A27 A;  4P10 A;  3FMC A;  1XBU A;  2EBJ A;  4M6G A;  4A37 A;  2ZEH A;  4ZX8 A;  4NGP A;  3VRR A;  2O28 A;  2YND A;  5D29 A;  2R7H A;  1VI4 A;  1OZP A;  2B4D A;  2CF4 A;  5BWA B;  3T5M A;  3TTH A;  3I1U A;  2E28 A;  4MHY A;  1MJB A;  4CYN A;  1YK3 A;  1OBR A;  3FED A;  2HWG A;  2J8N A;  2WUU A;  1FBV A;  4OID A;  4PV6 A;  4F6A A;  1WVM A;  3VAR A;  1JQG A;  2V8D A;  4ZI6 A;  3BUW B;  4MHP A;  4C85 A;  5F49 A;  3TLC A;  1Z8T A;  2AFU A;  3KHX A;  4UBR A;  1KEE B;  1S5K A;  4UFV A;  4BPU B;  5ISV A;  4IIY A;  4JZ0 A;  4MHN A;  3VRP A;  4NGS A;  4E2A A;  4YGO A;  5IX3 A;  2I79 A;  3OWC A;  4NF1 A;  3GJZ A;  4XPD C;  3TLG A;  3S9L A;  1YW4 A;  1Z2L A;  3I74 A;  3TLE A;  4A4C A;  3C8O A;  5IB0 A;  3W6X A;  3D8P A;  4C99 A;  1WK4 A;  2ZOG A;  3I3G A;  5AGE A;  4OC3 A;  2PJ8 A;  5THW A;  5G22 A;  1VHO A;  1ZG9 A;  3SI0 A;  2BO9 A;  4CDJ A;  5LRJ A;  3G23 A;  1Y0Y A;  3K9T A;  3S9N A;  2CY2 A;  1CS0 B;  4NFR A;  2RB7 A;  3TLB A;  3VRQ A;  1UFH A;  3KKW A;  4NEX A;  1MK4 A;  3LMS A;  1QSR A;  1BOB A;  1IID A;  5FVJ A;  4C7I A;  4CAF A;  1YX0 A;  1Q7L A;  1QQ9 A;  4TNU A;  3SJF A;  2Y0M A;  4G1P A;  2ZW5 A;  4QVT A;  2DXQ A;  4EME A;  5C82 A;  5IV0 A;  2HRO A;  2A4N A;  3IIB A;  2PVW A;  3FB3 A;  3R9G A;  3TO9 A;  2BL1 A;  1KUY A;  2FL4 A;  3CT9 A;  2PDO A;  1KZF A;  4KSI A;  4H6U A;  4R57 A;  1Y7E A;  5E96 A;  4B5P A;  2B3U A;  1LOK A;  3GKR A;  3SJG A;  3JRU A;  4NSQ A;  3ZJ0 A;  1CE8 B;  4KNG E;  4LQG A;  2CNT A;  1X10 A;  4GXH A;  4F9V A;  4MY0 A;  2ZW7 A;  3EXN A;  3FJU A;  5LYF A;  3G8W A;  1XOV A;  2AUN A;  1VBH A;  2QVP A;  5BY0 A;  1ON0 A;  4EWT A;  2GP4 A;  3PB6 X;  4NJQ A;  1Q5X A;  2RC4 A;  4C8F A;  2OR4 A;  1MJ9 A;  2DPS A;  3IWG A;  4OP4 A;  4MRI A;  4OKO A;  3S6H A;  3T9Y A;  5HKZ A;  1XRY A;  2PJ2 A;  5JH9 A;  2B4B A;  2Y1M A;  4M6H A;  1PU9 A;  4DNC A;  1DIK A;  2ABZ A;  4UCM A;  4A39 A;  2EUI A;  2P6E A;  3D7G A;  1CBX A;  3D3S A;  4FBE A;  4LQ6 A;  4MCP A;  1Y9Z A;  2PJ3 A;  1KBL A;  2PJB A;  3FXT A;  1MJA A;  1Z4E A;  1AUG A;  4AVB A;  5AG6 A;  4YU9 A;  4CYO A;  4J3G A;  1M6V B;  4NJR A;  3W6S A;  2Z3K A;  2YJV A;  4BPX B;  3RNZ A;  2OH1 A;  4ORF A;  3SXO A;  4CRY B;  2B4J C;  4P4E A;  2QIR A;  2VEZ A;  3V38 A;  3OP0 A;  3PB7 X;  4BBH A;  1GGO A;  1XE4 A;  3F0A A;  3BI1 A;  3EZB A;  2R98 A;  4UEZ A;  1PYT B;  1YVO A;  4H1H A;  1KC7 A;  1ZLH A;  1A2Z A;  3SXN A;  2C6C A;  3MRU A;  3HPG G;  3NH8 A;  3JVN A;  5K8P A;  4BD9 A;  4YFJ A;  1ZRS A;  1GYT A;  1WWZ A;  2ANP A;  4ONU A;  3RBU A;  2HUZ A;  2REF A;  1VHE A;  5CNP A;  2D0P A;  3FX6 A;  2Z3L A;  1P4N A;  1Q2D A;  4C2Z A;  4KUB A;  1NE9 A;  2GRE A;  1YW6 A;  2IMO A;  2QJ8 A;  3QB8 A;  1Q2Y A;  4E94 A;  3GIU A;  4A38 A;  2PJA A;  5DWM A;  1R43 A;  2NYQ A;  2GIV A;  3CXP A;  2R8V A;  3LWU A;  3DR6 A;  4KOS A;  3WC5 A;  1PCA A;  1RXT A;  4U5Y A;  2GAN A;  4AG9 A;  4II9 A;  1V0C A;  3TE4 A;  3T8W A;  8CPA A;  2ZXV A;  4C9V A;  3V7Z A;  5K8O A;  3TOA A;  1CPX A;  4C2Y A;  1CP7 A;  3BXM A;  3F8K A;  2XPP A;  4UCN A;  2G0B A;  3D68 A;  3KQX A;  2Q4Y A;  4XNH C;  3R95 A;  4A95 A;  4TWE A;  4KOU A;  1F2O A;  5H86 A;  5IR2 A;  4ZGY B;  1YSJ A;  2D4P A;  1AYE A;  1ZLI A;  4OAE A;  1B87 A;  2MP0 A;  1M4I A;  1M4G A;  2C6P A;  2P6G A;  3E0K A;  3KQZ A;  3CPA A;  3TC8 A;  4KVM E;  2J8R A;  2EZC A;  2J9A A;  4KOW A;  1VGY A;  4A33 A;  4QB9 A;  3VRN A;  3TYX A;  1I21 A;  3KZW A;  1LFW A;  2DLA A;  3L2N A;  4IF5 A;  3T90 A;  2BCO A;  4C2X A;  3WC6 A;  4B10 A;  1YLE A;  4C9A A;  4OC4 A;  2PJ6 A;  4CGO A;  2Q43 A;  4UWI A;  1ZO0 A;  4PSW A;  1S60 A;  5HMN A;  5DWN A;  1TKH A;  1XIX A;  1F2P A;  2YJT A;  4KZT A;  4KLW A;  3S6F A;  2ZED A;  3DNS A;  4PK2 A;  4BPW B;  2Z3O A;  4MFK A;  1Z9U A;  4MHD A;  5HXD A;  2PCN A;  4UIA A;  1FNO A;  2Z10 A;  3EIF A;  4UWJ A;  2OOT A;  4AG7 A;  3ZZI A;  4HPS A;  2Q4V A;  2VQY A;  2IL4 A;  3SJX A;  2ODF A;  1HDU A;  3FH4 A;  2NMT A;  2ATR A;  4UIB A;  3VWE A;  3IU2 A;  5C88 A;  3PT1 A;  2YNC A;  3FIX A;  5KTD A;  4CGM A;  2PRQ A;  2QYV A;  4OC0 A;  3PZJ A;  1WJT A;  4UCP A;  5JYB A;  1SQH A;  4O23 A;  3ZNI A;  2JDC A;  2EZB A;  5F1Y A;  2CIJ A;  2O53 A;  4DJL A;  4MJX A;  4JXQ A;  2UV8 G;  1M1D A;  1U6M A;  3B7I A;  4UFX A;  4X5K A;  5DS0 A;  1EZA A;  3SI2 A;  4X2T A;  2PSW A;  5CPA A;  4MJ8 A;  2ZEO A;  3LD2 A;  3H8E A;  2Q51 A;  1CJW A;  1KUV A;  3GLJ A;  4L89 A;  2HV2 A;  4PSX A;  5EC4 A;  4P4J A;  1JWQ A;  2QEC A;  4ZYQ A;  2JBJ A;  4XPD B;  2WSA A;  4ONW A;  1LCP A;  5A28 A;  3T07 A;  1TIQ A;  4R8F A;  4P44 A;  2AE6 A;  4W9Y A;  2ZW4 A;  3PBE A;  2HC9 A;  1UWY A;  4MFP A;  2EK9 A;  2ZEL A;  1GHE A;  1ZG8 A;  1XMB A;  2V77 A;  5HH1 A;  3HUV A;  3DR8 A;  3WC7 A;  4FWU A;  2CTB A;  4C8P A;  5HKW A;  3ISX A;  3OB2 B;  5F13 A;  3FF3 A;  1S7L A;  1F57 A;  3D7D A;  4P4B A;  5D8N A;  3W91 A;  4GS4 A;  3ISZ A;  1ZG7 A;  4M6I A;  1M44 A;  1IIC A;  1YGH A;  1V6C A;  2WZN A;  2R82 A;  4X8I A;  3EZE A;  1JDE A;  1VKC A;  1CM0 A;  4NGT A;  4MHZ A;  4MY3 A;  1NXJ A;  3P2H A;  3MN8 A;  4JJX A;  3GYA A;  4PXB A;  2AFZ A;  4AVC A;  4DYO A;  4H89 A;  3FBU A;  5AG7 A;  2D4O A;  2REE A;  3CPX A;  3PB4 X;  1XMT A;  1Z8W A;  3TX8 A;  3VGO A;  1BAV A;  3EC4 A;  3IFE A;  5ELY A;  1IU8 A;  4TJX A;  2EO8 A;  5J1Q A;  4KSF A;  1FT7 A;  3IJ3 A;  1BLL E;  2F7V A;  3BUM B;  4C8U A;  4JLY A;  1NSL A;  3P2F A;  1EZB A;  1ZYM A;  2OZH A;  1LAM A;  3CZX A;  4R9M A;  1JDB C;  4RR2 B;  1TF8 A;  4ZX9 A;  4KSA A;  1B47 A;  2PQ8 A;  4A30 A;  2PJ7 A;  3FEC A;  4E8O A;  4P4F A;  2I3C A;  2Q4Z A;  4CPA A;  3QNV A;  4K30 A;  1TKF A;  1BPM A;  3A9L A;  2WPW A;  3B3S A;  2B58 A;  4I49 A;  3PGP A;  2B5G B;  3GB0 A;  4AVA A;  4B5O A;  2FE7 A;  2C1C A;  1TF9 A;  1VBG A;  4JVO A;  4B13 A;  1HDQ A;  1BO4 A;  3BI0 A;  3EO4 A;  4IAV A;  4PQA A;  4RS2 A;  4QBJ A;  3F5B A;  5AG5 A;  2CNS A;  1J3L A;  2Q04 A;  2JLM A;  2XEJ A;  1BXR B;  1Z4R A;  4JYW A;  4MFZ A;  1TXR A;  2ZEP A;  3JUW A;  4RN7 A;  4CYQ A;  4B6Z A;  4CYP A;  4DUK A;  5JM6 A;  1R61 A;  2AFS A;  2VL1 A;  3HLP A;  5HVH A;  3VRO A;  1S7K A;  2VXK A;  2PJ0 A;  4QC6 A;  1S7N A;  2BOA A;  4KLV A;  1IYL A;  1R3N A;  2Z11 A;  4FUU A;  4CZ1 A;  1QST A;  2PCU A;  2P0W A;  2N3A B;  3KGQ A;  4Z65 A;  3U1B A;  2ZEM A;  2V8H A;  5FD8 A;  2XEF A;  2BUE A;  2C27 A;  4FD7 A;  3PEI A;  4R87 A;  1PUA A;  2HQY A;  4UF4 A;  2PE3 A;  4PXD A;  1ARM A;  4FD4 A;  3PFO A;  3D2M A;  2ZOF A;  4P4D A;  4MBU A;  5GCN A;  4R3L A;  3CXS A;  5F47 A;  2NSM A;  4P4I A;  1Q2C A;  2ZEN A;  4GM5 A;  4MMO A;  4XPL A;  5EBV A;  2B0A A;  3TLG B;  3RYO A;  3GY9 A;  4U9Y A;  4X3R A;  3TT2 A;  2CNM A;  4OLL A;  1T36 B;  1YQE A;  3SI1 A;  2XPL A;  4XNH B;  1DE4 C;  1Y9W A;  3R96 A;  2XEI A;  2ZEE A;  2OZU A;  1HEE A;  3PRT A;  4IHM A;  4PXC A;  3S6K A;  4F9U A;  3R9E A;  5AG4 A;  4K3N A;  4NGR A;  4UFW A;  5K8M A;  4JXR A;  2RFH A;  3NOJ A;  3I9S A;  4CAV A;  3R9F A;  4Q36 A;  5F48 A;  3TCV A;  4R7M A;  1N71 A;  3RO0 A;  3D7F A;  5F46 A;  4CAX A;  5F5X A;  3IC1 A;  2EZA A;  4INJ A;  1VHS A;  1YVK A;  4JWP A;  4KS9 A;  2Q7B A;  2Q44 A;  1AMP A;  2IQ6 A;  5J8C A;  2POK A;  2I00 A;  4OC5 A;  3CDX A;  3DGV A;  5LYI A;  3N5F A;  1RO5 A;  6CPA A;  3B35 A;  3IU1 A;  1EO0 A;  4HKF A;  4E5S A;  4OME A;  3FVL A;  1FY7 A;  1Z8L A;  2VZZ A;  3BUO B;  2PC1 A;  1Y0R A;  4NCZ A;  3NFQ A;  2B3V A;  2Q0Y A;  1Y7R A;  4Y49 C;  5LYD A;  3VWD A;  3HPH E;  3ICU A;  2XEG A;  1L0C A;  2ARH A;  3TLZ A;  4Y49 B;  2VBQ A;  1RTQ A;  4MCR A;  4BIN A;  4GPL B;  2IJZ A;  2WPX A;  3VAT A;  4IIX A;  1KWM A;  2YGW A;  3KRV A;  4C9R A;  4MFQ A;  4CO9 A;  4EYS A;  3LOD A;  4RI1 A;  1YLO A;  3H8G A;  3TLA A;  3DSB A;  2XPN A;  3D7H A;  3NE7 A;  3R1K A;  4KUA A;  1QMU A;  2PIZ A;  2X7B A;  3VH9 A;  4B12 A;  5JPH A;  4FD5 A;  1XFO A;  1ZL0 A;  3WAB A;  3NH5 A;  3D2P A;  3TO6 A;  1R57 A;  3QAY A;  4C9E A;  4MI4 A;  1C30 B;  4CDK A;  5F09 A;  2R1I A;  2K5T A;  1XF8 A;  2GLJ A;  1XEB A;  4QUS A;  2FIW A;  1EE3 P;  4M3S A;  5I0C A;  5AXI A;  4RUH A;  2EVN A;  2Z0Z A;  2Z3N A;  2JEV A;  3FRM A;  2CXA A;  3K2K A;  4C8C A;  3OAK A;  4MCQ A;  3H8F A;  3FEE A;  3TLY A;  3D67 A;  4M85 A;  4A2Z A;  4BMH A;  3IWE A;  3QAH A;  1M4L A;  4J0N A;  1QSO A;  1K4J A;  4PXE A;  3BJ8 A;  3TOB A;  3BJ7 A;  3SHP A;  2PVV A;  4P6Y A;  1IYK A;  2AFW A;  4CGP A;  2GU2 A;  3PBB A;  3D66 A;  4HNW B;  3BUN B;  2GLF A;  3B2Y A;  2AFO A;  4EFD A;  5LRK A;  1Z5R A;  4H2K A;  4E0A A;  2X0S A;  3PLF B;  4F8Z A;  3IEH A;  4A31 A;  5K99 A;  2ZEF A;  4TJV A;  2OZG A;  3G3S A;  1CP6 A;  4ZY2 A;  3K9U A;  1ELL P;  2DF5 A;  2PR1 A;  4YN3 A;  1Z9E A;  3FNC A;  3IGR A;  2P6F A;  2AUM A;  4MFL A;  1ARL A;  3KHZ A;  4PPZ A;  4KVO E;  4LUA A;  4BTF A;  7CPA A;  3NA6 A;  3RAM A;  1I12 A;  3I6S A;  4WWV A;  3H4Q A;  1LAN A;  1NSA A;  2AFX A;  4AB7 A;  3VTA A;  4C8T A;  2C6G A;  3V8I A;  4CAW A;  5G20 A;  2QML A;  2J8M A;  3OB1 B;  3NH4 A;  2BEI A;  2FIA A;  3DDD A;  3DLJ A;  3PB8 X;  2Q7S A;  3K4I A;  3TO7 A;  2EK8 A;  2XPO A;  2PRB A;  2FSR A;  2YNE A;  2HB6 A;  1IOF A;  1LAP A;  2WYR A;  2FXF A;  3B3T A;  3C26 A;  4F0X A;  3O8Z A;  1YRE A;  2PJC A;  4C86 A;  1ELM P;  4C84 A;  4YRH A;  4KVX A;  2OU2 A;  3D4U A;  1TKJ A;  4LX9 A;  4CAE A;  5G1Z A;  3TFY A;  4MFJ A;  3BUX B;  4B11 A;  1KUX A;  4MI1 A;  4KOV A;  2FVG A;  5KTA A;  3FYN A;  4OIW A;  2GFQ A;  3PB9 X;  2AJ6 A;  5HKY A;  5J8F A;  1P0H A;  1Y9K A;  3HMJ G;  1I1D A;  5H84 A;  4ZY1 A;  4B14 A;  1J4J A;  1NBW A;  5J3X A;  1A9X B;  4COB A;  2D0O A;  2V8G A;  4FD6 A;  4MCS A;  1QSN A;  2PJ9 A;  1H8L A;  3EFA A;  3U88 C;  1DTD A;  5LYL A;  3IWW A;  4P45 A;  3B8G A;  3BLN A;  4KOX A;  1VIX A;  4KOY A;  2HI6 A;  3B3W A;  4A4B A;  1C3O B;  1X12 A;  4AXV A;  4CRZ B;  1IOI A;  1IY7 A;  2PJ4 A;  5G21 A;  1CX8 A;  3T05 A;  1XJO A;  2JBK A;  2G3A A;  2GE3 A;  2PR8 A;  1IGB A;  1YME A;  2B4D B;  2VI7 A;  2YNC C;  3JTK A;  2DEA A;  3PP9 A;  4R6T A;  5EMI A;  5IB9 A;  4NXY A;  3N7Z A;  4ZBG A;  4L8A A;  5JGF A;  4COG A;  3NE8 A;  4U9Z A;  4IK2 A;  3B3V A;  2PJ1 A;  4NGN A;  2F5I A;  2O4H A;  5F9M A;  4UEF A;  4F0Y A;  2EWB A;  2DIK A;  3KR4 A;  2H5M A;  4R3K A;  1QSM A;  1CPS A;  4H6Z A;  2FCK A;  1NMT A;  4Q7A A;  4UEE A;  3S9M A;  3KR5 A;  4M8D A;  1B6B A;  1XF1 A;  5CBM A;  4FAI A;  2FS5 A;  3KI9 A;  4A32 A;  2OLS A;  4KOT A;  3T0T A;  4JD6 A;  4C7H A;  2ZW6 A;  3B3C A;  3KAS A;  4A94 A;  4OC2 A;  2VKZ G;  2JDD A;  3WT4 A;  3SR3 A;  3PFE A;  3F9K C;  3UY5 A;  4EVY A;  4NGM A;  2ZPA A;  4KOR A;  2CBL A;  4XPK A;  4PK3 A;  3H5Z A;  2DPT A; 
#chains in the Genus database with same CATH homology
 4ZY0 A;  3SJE A;  5LRG A;  2JEW A;  2PIY A;  5HVF A;  3IO1 A;  2G9D A;  3RZA A;  2V8V A;  2AFM A;  3GUX A;  4C9U A;  4WJB A;  5K8N A;  4R76 A;  4C8A A;  2PJ5 A;  2C5Q A;  5HVG A;  4MXU A;  5I4M A;  3NFZ A;  3KL9 A;  4YWY A;  1CG2 A;  1BPN A;  4NGQ A;  2ZEG A;  2F8H A;  2CTC A;  3BHX A;  4OC1 A;  4P10 A;  3FMC A;  1XBU A;  4A37 A;  2ZEH A;  4ZX8 A;  4NGP A;  5D29 A;  2CF4 A;  3I1U A;  4MHY A;  1OBR A;  3FED A;  1WVM A;  4OID A;  3VAR A;  1JQG A;  2V8D A;  4ZI6 A;  4MHP A;  4C85 A;  2AFU A;  3KHX A;  4JZ0 A;  4MHN A;  4NGS A;  3S9L A;  1YW4 A;  1Z2L A;  3I74 A;  4C99 A;  2ZOG A;  4OC3 A;  2PJ8 A;  5THW A;  1VHO A;  1ZG9 A;  3SI0 A;  2BO9 A;  4CDJ A;  5LRJ A;  1Y0Y A;  3K9T A;  3S9N A;  4NFR A;  2RB7 A;  3LMS A;  1Q7L A;  1QQ9 A;  4TNU A;  3SJF A;  4G1P A;  4EME A;  3IIB A;  2PVW A;  3CT9 A;  4KSI A;  1Y7E A;  1LOK A;  4KNG E;  3SJG A;  3JRU A;  4LQG A;  4F9V A;  3FJU A;  5LYF A;  2QVP A;  4EWT A;  2GP4 A;  3PB6 X;  4NJQ A;  4C8F A;  2OR4 A;  4OP4 A;  4MRI A;  4OKO A;  1XRY A;  2PJ2 A;  5JH9 A;  2ABZ A;  4A39 A;  3D7G A;  1CBX A;  4FBE A;  4MCP A;  1Y9Z A;  2PJ3 A;  2PJB A;  4YU9 A;  4NJR A;  4P4E A;  3V38 A;  3PB7 X;  3BI1 A;  4UEZ A;  1PYT B;  1ZLH A;  2C6C A;  3MRU A;  3NH8 A;  5K8P A;  4BD9 A;  1GYT A;  2ANP A;  3RBU A;  1VHE A;  3FX6 A;  2GRE A;  1YW6 A;  2IMO A;  2QJ8 A;  4A38 A;  2PJA A;  1R43 A;  2NYQ A;  3LWU A;  3WC5 A;  1PCA A;  3T8W A;  8CPA A;  4C9V A;  3V7Z A;  5K8O A;  1CPX A;  1CP7 A;  3BXM A;  3D68 A;  3KQX A;  4TWE A;  1F2O A;  5IR2 A;  1YSJ A;  1AYE A;  1ZLI A;  2C6P A;  3KQZ A;  3CPA A;  3TC8 A;  2J9A A;  1VGY A;  3KZW A;  1LFW A;  3L2N A;  2BCO A;  4C9A A;  3WC6 A;  4OC4 A;  2PJ6 A;  2Q43 A;  1TKH A;  1F2P A;  2ZED A;  5HXD A;  4UIA A;  1FNO A;  3EIF A;  2OOT A;  3SJX A;  1HDU A;  3FH4 A;  4UIB A;  2PRQ A;  2QYV A;  4OC0 A;  4O23 A;  2CIJ A;  2O53 A;  4DJL A;  3B7I A;  5DS0 A;  3SI2 A;  4X2T A;  5CPA A;  2ZEO A;  3H8E A;  2Q51 A;  3GLJ A;  4P4J A;  4ZYQ A;  2JBJ A;  4ONW A;  1LCP A;  4R8F A;  4P44 A;  4W9Y A;  3PBE A;  2HC9 A;  1UWY A;  2EK9 A;  2ZEL A;  1ZG8 A;  1XMB A;  2V77 A;  3HUV A;  3WC7 A;  4FWU A;  2CTB A;  4C8P A;  3ISX A;  3FF3 A;  1F57 A;  3D7D A;  4P4B A;  5D8N A;  3ISZ A;  1ZG7 A;  1V6C A;  2WZN A;  4X8I A;  4MHZ A;  4NGT A;  3MN8 A;  4PXB A;  2AFZ A;  4DYO A;  3CPX A;  3PB4 X;  3TX8 A;  1BAV A;  3IFE A;  5ELY A;  4TJX A;  5J1Q A;  1FT7 A;  3IJ3 A;  1BLL E;  2F7V A;  4C8U A;  1LAM A;  1TF8 A;  4ZX9 A;  2PJ7 A;  3FEC A;  4P4F A;  2I3C A;  2Q4Z A;  4CPA A;  3QNV A;  1TKF A;  1BPM A;  3B3S A;  3GB0 A;  2C1C A;  1TF9 A;  1HDQ A;  3BI0 A;  4IAV A;  4PQA A;  2XEJ A;  4JYW A;  4DUK A;  1TXR A;  2ZEP A;  4B6Z A;  5JM6 A;  2AFS A;  2VL1 A;  3HLP A;  5HVH A;  2PJ0 A;  2BOA A;  4FUU A;  1R3N A;  2PCU A;  4Z65 A;  3KGQ A;  2ZEM A;  2V8H A;  2XEF A;  3PEI A;  4UF4 A;  2PE3 A;  4PXD A;  1ARM A;  2ZOF A;  4P4D A;  2NSM A;  4P4I A;  2ZEN A;  4GM5 A;  4MMO A;  4X3R A;  3SI1 A;  1DE4 C;  2XEI A;  2ZEE A;  3PRT A;  1HEE A;  4IHM A;  4PXC A;  4F9U A;  5K8M A;  4K3N A;  4NGR A;  2RFH A;  4R7M A;  3D7F A;  3IC1 A;  1AMP A;  2IQ6 A;  2POK A;  4OC5 A;  3CDX A;  3DGV A;  5LYI A;  3N5F A;  6CPA A;  3B35 A;  4OME A;  3FVL A;  1Z8L A;  5LYD A;  1Y0R A;  3ICU A;  2XEG A;  1RTQ A;  4MCR A;  3VAT A;  2IJZ A;  4C9R A;  1KWM A;  3H8G A;  1YLO A;  3VH9 A;  3D7H A;  1QMU A;  2PIZ A;  1XFO A;  3WAB A;  3NH5 A;  4C9E A;  4CDK A;  5F09 A;  2GLJ A;  1EE3 P;  4RUH A;  4C8C A;  3K2K A;  4MCQ A;  3H8F A;  3FEE A;  3D67 A;  1M4L A;  4PXE A;  2PVV A;  4P6Y A;  2AFW A;  2GU2 A;  3PBB A;  3D66 A;  2GLF A;  3B2Y A;  2AFO A;  4EFD A;  5LRK A;  1Z5R A;  4H2K A;  4F8Z A;  3IEH A;  2ZEF A;  4TJV A;  1CP6 A;  4ZY2 A;  1ELL P;  4YN3 A;  4PPZ A;  1ARL A;  3KHZ A;  7CPA A;  3NA6 A;  3RAM A;  3I6S A;  4WWV A;  1LAN A;  1NSA A;  2AFX A;  3VTA A;  4C8T A;  2C6G A;  3NH4 A;  3DLJ A;  3PB8 X;  2EK8 A;  2HB6 A;  2WYR A;  1LAP A;  3B3T A;  2PJC A;  4C86 A;  1ELM P;  4C84 A;  3D4U A;  1TKJ A;  2FVG A;  4OIW A;  3PB9 X;  4ZY1 A;  2V8G A;  4MCS A;  2PJ9 A;  1H8L A;  1DTD A;  5LYL A;  3IWW A;  4P45 A;  1VIX A;  3B3W A;  4AXV A;  1IY7 A;  2PJ4 A;  1CX8 A;  1XJO A;  2JBK A;  3PFO A;  1IGB A;  1YME A;  2DEA A;  4R6T A;  5IB9 A;  5JGF A;  4IK2 A;  3B3V A;  2PJ1 A;  4NGN A;  2O4H A;  4UEF A;  2EWB A;  3KR4 A;  1CPS A;  4Q7A A;  4UEE A;  3S9M A;  3KR5 A;  1XF1 A;  5CBM A;  4FAI A;  3KI9 A;  3B3C A;  3KAS A;  4A94 A;  4OC2 A;  3WT4 A;  3PFE A;  4NGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...