4P4DA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor mp1c
Total Genus 260
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
260
sequence length
696
structure length
687
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 260
structure length 687
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4dA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4dA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4dA02
1TXRA 3IFEA 3LMSA 3SI2A 4OC3A 2ZENA 3V7ZA 3FECA 3FX6A 3PFOA 2AFWA 4NFRA 3T8WA 1HEEA 3ISZA 4EFDA 2V8GA 4JZ0A 5JM6A 8CPAA 4TNUA 2VL1A 4OKOA 3BI0A 4OC4A 4R8FA 2PRQA 2Q4ZA 5D8NA 1LFWA 4UIBA 4UF4A 4NGSA 2ABZA 1ARMA 4NGQA 2XEFA 2ZEGA 4FWUA 1CPXA 3FJUA 3CPXA 5LRGA 3FEEA 3SI0A 5LYFA 1TKFA 3JRUA 2GLFA 2ZEHA 1ZLIA 2V8HA 3PBEA 2PVWA 3RBUA 2PIZA 2IMOA 2Q51A 3GB0A 1VGYA 3B3TA 3KI9A 3WT4A 1ZLHA 1Z8LA 4C8UA 1LCPA 3N5FA 5JGFA 1Y7EA 2PJ6A 5HVGA 4ZI6A 2BOAA 4MCSA 3SI1A 4PXDA 4P45A 5THWA 2EK8A 3IIBA 7CPAA 3I74A 4CPAA 4P4EA 5K8MA 1ZG7A 2PIYA 2ZELA 2JBJA 3D7DA 1BPMA 4OC5A 2NSMA 5K8OA 3NA6A 4ZX8A 4YN3A 2QYVA 5DS0A 4MMOA 2PE3A 1Z2LA 1NSAA 5JH9A 4ZY2A 2XEJA 1IGBA 3BI1A 3SJGA 4DJLA 1CPSA 3PBBA 1TF8A 2QVPA 4B6ZA 3CDXA 3D67A 1YW4A 5ELYA 2AFZA 1IY7A 2ZEEA 1QQ9A 1KWMA 2PJAA 2ZEMA 2PCUA 3VARA 4X3RA 4MHZA 2PVVA 4PXEA 2PJ2A 4F8ZA 3PFEA 2ZOFA 4C8CA 1LAPA 4NJRA 1Y0YA 1Z5RA 2V8DA 2PJ5A 3HUVA 3MN8A 3WC7A 4A94A 2XEIA 1DTDA 3IWWA 3CPAA 2NYQA 4ZYQA 2I3CA 1ZG8A 3PB8X 4P4DA 1ARLA 1JQGA 1BAVA 4ZY0A 3NH5A 5D29A 1LANA 3VTAA 4C9UA 4A39A 2AFOA 3K2KA 4PPZA 3ISXA 4P4BA 2CTBA 1PCAA 1VHOA 4MHNA 1CG2A 2RFHA 1LAMA 1ZG9A 2BO9A 2V77A 2IQ6A 3BHXA 3SJXA 3GUXA 3WC5A 5HVFA 2FVGA 3KL9A 1QMUA 4MXUA 4P4IA 1FT7A 1YSJA 3KGQA 3PB9X 1Q7LA 3HLPA 1XFOA 5K8PA 4R76A 3QNVA 3PB4X 4RUHA 4UEZA 2GREA 3SJFA 3KQZA 4C85A 3H8GA 1M4LA 1F2PA 4UEEA 2PJ0A 3B3VA 3FMCA 1OBRA 4H2KA 4G1PA 2ZOGA 2ZEOA 1XF1A 4F9UA 2JEWA 4X2TA 5CPAA 2C6PA 2RB7A 4OIDA 2F8HA 4C9AA 4MCPA 4WJBA 2O4HA 4OC0A 3KR4A 3LWUA 4EMEA 5LYDA 3FEDA 4OMEA 1RTQA 2C6CA 2ZEDA 3CT9A 3NH8A 3PB6X 2PJCA 2F7VA 2IJZA 4DUKA 5K8NA 4PXCA 3D7GA 1XRYA 2PJBA 2CF4A 1TKJA 4ZX9A 4MHPA 1EE3P 3VATA 4C8FA 4R7MA 1ELMP 4IAVA 4NGNA 3GLJA 3PB7X 1V6CA 3KQXA 4KNGE 3D7HA 4C99A 2PJ4A 1CP7A 3PRTA 4MCRA 3B2YA 2PJ1A 3B3SA 4F9VA 4PXBA 3B35A 2PJ3A 3RAMA 1ELLP 1DE4C 2G9DA 1F2OA 1XBUA 3L2NA 1PYTB 4TWEA 4P6YA 1FNOA 3ICUA 4CDKA 1XMBA 1R3NA 4PQAA 1AMPA 4AXVA 2EWBA 4GM5A 4WWVA 4BD9A 4FBEA 2QJ8A 4CDJA 1Y0RA 3MRUA 3B3CA 2CTCA 1CBXA 1TKHA 4MRIA 4ONWA 4FAIA 4NJQA 2J9AA 3TC8A 3IJ3A 4P44A 2O53A 3NFZA 2GU2A 1R43A 4C9EA 1YMEA 2XEGA 3KZWA 4C86A 4ZY1A 3S9MA 5HXDA 1VIXA 4EWTA 4FUUA 4DYOA 1YLOA 4O23A 4YWYA 2BCOA 3WC6A 4P10A 2OR4A 4YU9A 5LRKA 5J1QA 2PJ9A 1XJOA 3D66A 2Q43A 4UEFA 4KSIA 3BXMA 1AYEA 3KR5A 1UWYA 4TJXA 2AFSA 2C6GA 2POKA 4C8PA 1CX8A 4R6TA 5HVHA 5I4MA 4NGPA 4C8AA 4LQGA 2AFMA 3DLJA 1BLLE 4A37A 2ANPA 2OOTA 3KHXA 1CP6A 3IEHA 4Q7AA 1HDUA 2AFXA 5F09A 3B7IA 3D68A 1BPNA 2DEAA 3FH4A 2WZNA 4P4FA 4C9RA 3B3WA 3PEIA 2CIJA 1Y9ZA 3WABA 4IK2A 4K3NA 5IB9A 3D7FA 2AFUA 3I6SA 4A38A 2EK9A 2PJ8A 1F57A 2ZEFA 1YW6A 2WYRA 4X8IA 1H8LA 3V38A 3S9NA 1GYTA 4Z65A 3K9TA 3SJEA 5LYIA 2C1CA 3EIFA 4OC1A 3I1UA 3VH9A 1WVMA 4MCQA 1VHEA 1TF9A 4OC2A 2JBKA 3D4UA 3RZAA 4W9YA 4UIAA 3TX8A 4JYWA 4NGTA 3IC1A 1LOKA 3S9LA 3KASA 4C9VA 4C84A 4IHMA 5CBMA 2HC9A 3DGVA 3NH4A 5LYLA 2ZEPA 4NGMA 3IO1A 2GLJA 3FVLA 6CPAA 2PJ7A 4C8TA 4NGRA 3H8FA 4MHYA 4P4JA 3FF3A 4OIWA 2V8VA 3H8EA 4OP4A 3KHZA 2HB6A 5LRJA 1HDQA 4TJVA
chains in the Genus database with same CATH superfamily
4OADA 4KVOE 1TXRA 3IFEA 3LMSA 3NOJA 2PR1A 2Z3OA 3SI2A 1NSLA 3IWGA 1M6VB 2JDDA 2EVNA 4OC3A 2CNSA 2GIVA 2ZENA 3V7ZA 2WPWA 3TOBA 4UFXA 4AVBA 3FECA 3FX6A 3PFOA 2AFWA 4NFRA 4JXRA 2B5GB 2PCNA 3T8WA 1HEEA 2CY2A 3NFQA 4KORA 3ISZA 4EFDA 3GIUA 4KOXA 3PLFB 2V8GA 3HPGG 4JZ0A 1Q2DA 2Q4YA 4AG9A 5JM6A 3TLYA 8CPAA 3EO4A 4TNUA 3ZZIA 2VL1A 4LUAA 4OKOA 1VBGA 3T5MA 1S5KA 3BI0A 3TLEA 3ZJ0A 3QAHA 4M85A 4OC4A 4R8FA 2EUIA 2PRQA 2Q4ZA 4A4CA 3GY9A 3DSBA 5D8NA 5F49A 1KZFA 2CXAA 4C2XA 2OZUA 4H89A 1LFWA 4UIBA 3F0AA 1Z8TA 4UF4A 4NGSA 2ABZA 1ARMA 4NGQA 2XEFA 3SXOA 4IIYA 1EZBA 2ZEGA 3T9YA 4FWUA 1CPXA 3FJUA 3CPXA 3TE4A 1X10A 5J8CA 4MHDA 5LRGA 3F5BA 3F8KA 4C2ZA 3FEEA 1Y7RA 3SI0A 1QSMA 2FS5A 2VZZA 4HKFA 2A4NA 2YNDA 3U88C 2Z0ZA 5EMIA 1TKFA 3JRUA 2GLFA 2AJ6A 4KS9A 2FM4A 2ZEHA 1ZLIA 2V8HA 1BOBA 3PBEA 2PVWA 2HUZA 1V0CA 3RBUA 2Y0MA 4PV6A 1KEEB 1VI4A 2PIZA 1QSOA 2IMOA 2Q51A 4NF1A 4ORFA 3VGOA 1VGYA 3B3TA 3GB0A 3KI9A 3WT4A 2JEVA 3SR3A 1ZLHA 2J8MA 2Z3KA 4XPDB 1PU9A 4BBHA 1Z8LA 4CO9A 2G3AA 2FL4A 1YK3A 1YVOA 4C8UA 5HKWA 1LCPA 2QIRA 3N5FA 5IV0A 5JGFA 4C2YA 1Y7EA 4DNCA 1CE8B 5H86A 4BMHA 2PJ6A 4M6IA 5HVGA 1VBHA 1QSRA 4ZI6A 2BOAA 3T05A 1L0CA 1YVHA 4MCSA 1CM0A 3SI1A 5AG6A 1EZAA 4AB7A 2C5QA 4JVOA 4PXDA 3VROA 4JXQA 3BUOB 3FB3A 4P45A 3UY5A 2MP0A 4XNHB 5THWA 4QC6A 3SXNA 1BXRB 2EK8A 3IIBA 1RXTA 7CPAA 3I74A 4RN7A 2NMTA 4UCMA 4CPAA 4CS0B 1T36B 4P4EA 1S7LA 4U9ZA 1Y9WA 5K8MA 1ZG7A 2EBJA 2PIYA 2JBJA 3D7DA 2ZELA 1BPMA 4MI1A 3R96A 1PUAA 4NCZA 4OC5A 2P0WA 3GYAA 4JD6A 3W6SA 4MY0A 3C8OA 1GGOA 4QVTA 2NSMA 1M4GA 2CNTA 5K8OA 1Z8XA 2FCKA 2VQYA 3NA6A 4ZX8A 3OB2B 2QYVA 4HNXB 2AUMA 1TIQA 5DS0A 4YN3A 4MMOA 2PE3A 1Z2LA 1NSAA 5JH9A 4ZY2A 1NBWA 4A4BA 1Y9KA 2Z11A 4R9MA 2Z10A 2XEJA 3PZJA 4FD6A 5GCNA 2GE3A 3QAYA 1IGBA 1S60A 3BI1A 3SJGA 4DJLA 3K4IA 1CPSA 1XE4A 4CYQA 3HPHE 4NSQA 2OZGA 4CYOA 2VZYA 2HWGA 3PBBA 3RO0A 1IYKA 4E8OA 1TF8A 2QVPA 2QECA 2WUUA 4B6ZA 3CDXA 2DPTA 3D67A 2OB0A 1YW4A 5ELYA 2G3TA 2AFZA 4NEXA 2PQ8A 2ATRA 4CGMA 1IY7A 4H1HA 2EO8A 1P0HA 4ONUA 1ZL0A 5G22A 5KTDA 2ZEEA 1QQ9A 4CGOA 2Y1MA 2OLSA 1KWMA 3R9FA 1P4NA 2XPOA 3R9GA 3BUXB 2OU2A 2PJAA 2ZEMA 2BEIA 2PCUA 4F0XA 5JVLA 5AG5A 3VARA 4KVXA 3TYXA 4X3RA 2FE7A 4B12A 4E0AA 1ON0A 4MHZA 1KC7A 3S6KA 2PVVA 3OWCA 4PXEA 4A33A 4JLYA 3EY5A 2IL4A 3BUWB 3CXPA 1IU8A 1I21A 5AXIA 2PJ2A 5DWNA 5LYFA 4F8ZA 3PFEA 2ZOFA 4A30A 4C8CA 3CXSA 1LAPA 4NJRA 1ZRSA 4M6GA 1Y0YA 4UBRA 2J8NA 1Z5RA 2K5TA 3PFVA 1AUGA 2V8DA 2Q7SA 3EC4A 4MFZA 2DIKA 5BY0A 2PJ5A 3HUVA 1C30B 3MN8A 3WC7A 1MJ9A 4A94A 4HPSA 2XEIA 1QSTA 2RC4A 5BWAB 3FYNA 1DTDA 2YNCC 4J0NA 3IWWA 1A2ZA 3CXQA 3CPAA 2NYQA 4ZYQA 2FIWA 2I3CA 3VRPA 1ZG8A 3PB8X 1Z9UA 4P4DA 4MFPA 2CBLA 4AG7A 1ARLA 4MBUA 1JQGA 3U1BA 1BAVA 2BUEA 1IIDA 4ZY0A 2EZAA 3NH5A 2DXQA 4II9A 2WPXA 2HI6A 3EZAA 5D29A 5HH1A 1LANA 3VTAA 2O28A 2G0BA 4C9UA 3BUMB 1KBLA 4F6AA 4A39A 2AFOA 5IR2A 4QBJA 3K2KA 4KOUA 4PPZA 1FBVA 3ISXA 3SHPA 4P4BA 2CTBA 2BL1A 1PCAA 1YX0A 1VHOA 1CG2A 4KOWA 2RFHA 4MHNA 4K30A 4XPLA 1LAMA 2Z3PA 3TOAA 1ZG9A 2BO9A 2V77A 3S6HA 4CAFA 4CRZB 4E94A 2IQ6A 2YNEA 3BHXA 3SJXA 3TCVA 3GUXA 3WC5A 1WJTA 2ZW7A 3P2HA 5HVFA 4L8AA 2FVGA 2J8RA 3KL9A 1QMUA 4MXUA 4P4IA 2F5IA 2PDOA 1FT7A 1YSJA 3KGQA 3PB9X 4A31A 1Q7LA 2YJTA 1EO0A 3HLPA 4PK2A 4MFKA 1XFOA 2B3UA 4GXHA 4NXYA 5K8PA 2CNMA 3BJ7A 4R76A 3QNVA 4B5OA 3PB4X 4RUHA 2REEA 5F1YA 2Q04A 1B6BA 2GREA 4UEZA 2Q7BA 2B58A 3SJFA 3KQZA 2YGWA 4C85A 3H8GA 4KOTA 2X7BA 2R98A 3NE8A 1M4LA 4YFJA 1F2PA 4UEEA 5HKYA 1GHEA 1LRZA 3H5ZA 1S7NA 5F47A 3RYOA 2PR8A 1N71A 4A95A 4CGLA 2PJ0A 4ZGYB 3T07A 4C68A 1J4JA 3B3VA 3TTHA 3D3SA 3FMCA 1YREA 1OBRA 3HMJG 1IB1E 4H2KA 4G1PA 1UFHA 2ZOGA 3TO7A 2ZEOA 2QMLA 2R7HA 3IU1A 3TO6A 1XF1A 4F9UA 4X5KA 2JEWA 5A28A 5JPHA 4IIXA 4CRYB 4MY3A 5K99A 1S3ZA 3DR6A 4KSAA 2VBQA 2Z3MA 3B8GA 4X2TA 5CPAA 5AG7A 3WR7A 4KZTA 2HV2A 3ZNIA 3I3GA 3FNCA 3VWDA 2C6PA 2RB7A 3P2FA 2F8HA 4OIDA 4H6UA 4CAWA 1X12A 2YNCA 4C9AA 4MCPA 4WJBA 3LD2A 2ARHA 4M8DA 2O4HA 4OC0A 2PRBA 3KR4A 3LWUA 4R87A 4EMEA 4C7IA 5LYDA 3FEDA 4KLVA 4OMEA 1RTQA 2C6CA 4OAEA 2DLAA 2ZEDA 4H6ZA 3CT9A 3NH8A 4CGNA 3PB6X 5IB0A 2PJCA 2B0AA 2GFQA 2B4DA 1YR0A 4GPLB 2F7VA 3T0TA 2D4PA 2IJZA 2AUNA 4DUKA 3EXNA 3IU2A 4PXCA 2P6GA 5K8NA 3D7GA 1XRYA 2PJBA 2CF4A 2ZXVA 3KKWA 3EFAA 1TKJA 4FD7A 5AGEA 2N3AB 5CNPA 4ZX9A 4HNWB 3RNZA 2X0SA 1IYLA 4MHPA 4CAVA 2I00A 2Z3NA 3LACA 1EE3P 1YVKA 3VATA 1NXJA 1B47A 4R7MA 1ELMP 4U9YA 1I1DA 4IAVA 4Y49C 3EZBA 4NGNA 3GLJA 3PB7X 4MI4A 1C3OB 1V6CA 3KQXA 3KRVA 4KNGE 3W91A 4MFQA 3NE7A 4HNYB 2B3VA 4B5PA 1CS0B 1WWZA 3D7HA 3JUWA 4C99A 1IICA 4F0YA 1Q2CA 2PJ4A 1CP7A 4KUAA 3PRTA 4MCRA 4BINA 4KOVA 4M3SA 2Z3LA 1Q5XA 1YLEA 4CZ1A 4UFVA 2ZPAA 2PJ1A 3B2YA 3B3SA 4F9VA 1J3LA 2UV8G 4PXBA 4KOYA 4MJXA 3T90A 1XIXA 3A9LA 2PJ3A 3B35A 1Q2YA 1Z4EA 3DDDA 3RAMA 4B14A 1ELLP 3FIXA 1JWQA 1KUXA 4E5SA 1DE4C 4COBA 3O8ZA 1F2OA 1XBUA 2G9DA 3TLBA 4A2ZA 3L2NA 1PYTB 4INJA 4EYSA 4TWEA 1SQHA 3N7ZA 2JLMA 4XPKA 4P6YA 3FRMA 2OZHA 1YGHA 2P6FA 3S6FA 5J3XA 4AVAA 1FNOA 4B11A 2D0OA 2FIAA 3ICUA 4CDKA 4LX9A 5ISVA 1JDBC 4EVYA 3JVNA 2ODFA 2R82A 2P6EA 1XMBA 1R3NA 4CYNA 1KUYA 4Q36A 2OH1A 2R1IA 4PQAA 4AVCA 2HROA 4UFWA 2E28A 1AMPA 3H4QA 2EWBA 5G1ZA 3S6GA 4GM5A 4WWVA 4IUSA 4AXVA 4BD9A 4FBEA 2QJ8A 5F5XA 4PSXA 3G3SA 4OLLA 2Y1NA 4CDJA 1B87A 1Y0RA 3MRUA 5F9MA 1R57A 4UWIA 3PT1A 2FSRA 4U5YA 3B3CA 3TO9A 3OP0A 3D2PA 2CTCA 3CZXA 1TKHA 1CBXA 4MRIA 1ZO0A 4ONWA 4UCNA 3V8IA 4FAIA 4YRHA 5JYBA 4NJQA 2J9AA 5J8FA 1RO5A 3TC8A 3IJ3A 4MFLA 4P44A 2O53A 3NFZA 2VXKA 1NE9A 2GU2A 1R43A 3QB8A 4JJXA 3VRNA 3TLZA 4C9EA 1YMEA 2XEGA 3KZWA 1Z9EA 1M1DA 3S9MA 2FT0A 4BTFA 4ZY1A 4C86A 5HXDA 4C8FA 1VIXA 2B5GA 5EBVA 4GS4A 4EWTA 1CJWA 4UWJA 4FUUA 3R9EA 4DYOA 2Q44A 1YLOA 4O23A 4YGOA 4KLWA 4YWYA 1IOFA 4L89A 4UCPA 2BCOA 2VKZG 2HQYA 4KUBA 3WC6A 1XMTA 4P10A 3TLAA 3OB1B 1FY7A 2OR4A 2JDCA 4FD4A 4YU9A 4Y49B 5LRKA 5J1QA 3DNSA 4BPUB 3F9KC 2C27A 2XPLA 1XJOA 2PJ9A 2Q43A 3D66A 3I9SA 2PC1A 3MGDA 4UEFA 5F48A 4KSIA 3TFYA 2H5MA 4RI1A 3BXMA 2R8VA 1AYEA 1XF8A 3KR5A 1UWYA 4R3LA 2VI7A 4TJXA 1S7FA 2AFSA 2Q0YA 1MJBA 2C6GA 2POKA 1WK4A 4C8PA 1CX8A 2ZW5A 4R6TA 5HVHA 5I4MA 4NGPA 4C8AA 2XPNA 4B13A 5JQ4A 4LQGA 2AFMA 3DLJA 1BLLE 3JTKA 5FVJA 4R3KA 2Q4VA 1IOIA 3D2MA 2ZW6A 2ANPA 4A37A 2BSWA 2OOTA 3KHXA 3TLGA 1CP6A 1M4IA 4QUSA 3TLGB 3IEHA 4Q7AA 2FXFA 4LQ6A 4RS2A 2XPPA 1HDUA 2AFXA 5F09A 4CGPA 3VRRA 4A32A 3B7IA 3D68A 1BPNA 2DEAA 5HKZA 2WZNA 3FH4A 2GP4A 4P4FA 5AG4A 4C9RA 1K4JA 3B3WA 3PEIA 4M6HA 2CIJA 4JWPA 3TLCA 1DIKA 3WABA 3PGPA 3R1KA 4IK2A 4K3NA 1Y9ZA 4KOSA 1VHSA 5IB9A 3D7FA 2AFUA 5G20A 1XOVA 2KCWA 3G8WA 2D0PA 3TT2A 1I12A 5DWMA 5KTCA 3I6SA 1OZPA 2B4DB 5A27A 4A38A 5I0CA 2PSWA 2EK9A 2PJ8A 3IGRA 3LODA 1F57A 1M44A 1YW6A 2WYRA 2ZEFA 4X8IA 4PSWA 2B4JC 3PP9A 1H8LA 3GKRA 3V38A 3G23A 3S9NA 3K9UA 5F46A 1GYTA 1NMTA 4Z65A 1XEBA 2GANA 4Q38A 5FD8A 3OAKA 5H84A 5KTAA 3DR8A 1Z8WA 3K9TA 4J3GA 3SJEA 5LYIA 2C1CA 1YQEA 4QB9A 3IWEA 1Z4RA 4B10A 2EZCA 1A9XB 3EIFA 1MJAA 5G21A 3BUNB 4OC1A 2REFA 4B5PB 4E2AA 3E0KA 4MFJA 3I1UA 4KSFA 3D8PA 3VH9A 1WVMA 4MCQA 3VRQA 5IX3A 1VHEA 1R61A 4COGA 1TF9A 4UA3A 4OC2A 2JBKA 4CYPA 3D4UA 2DF5A 3RZAA 4W9YA 2AE6A 4PK3A 1QSNA 4CAXA 2WSAA 5C82A 3GJZA 4IF5A 4UIAA 5EC4A 3TX8A 3EZEA 2VEZA 4JYWA 1VKCA 4NGTA 3IC1A 1MK4A 4BPXB 1LOKA 2B4BA 3S9LA 3KASA 1BO4A 4CAEA 1ZYMA 2I79A 2EZBA 4IHMA 4C84A 4C9VA 4I49A 5CBMA 2HC9A 4KVME 4XPDC 3DGVA 4MJ8A 3NH4A 4RR2B 5C88A 5LYLA 3C26A 5E96A 4C7HA 4TJVA 2ZEPA 3BLNA 5F13A 4NGMA 3IO1A 2GLJA 3FVLA 3R95A 2YJVA 2D4OA 2ZW4A 6CPAA 2PJ7A 3FBUA 4NGRA 1JDEA 3W6XA 4C8TA 3H8FA 1U6MA 4MHYA 4P4JA 3FF3A 4FD5A 4OIWA 2V8VA 1M4DA 3H8EA 4OP4A 3KHZA 4XNHC 2HB6A 4R57A 1S7KA 4BPWB 2DPSA 4ZBGA 5LRJA 1KUVA 3VWEA 3BJ8A 3FXTA 1HDQA 5HMNA
chains in the Genus database with same CATH topology
1TXRA 3IFEA 3LMSA 3SI2A 4OC3A 2ZENA 3V7ZA 3FECA 3FX6A 3PFOA 2AFWA 4NFRA 3T8WA 1HEEA 3ISZA 4EFDA 2V8GA 4JZ0A 5JM6A 8CPAA 4TNUA 2VL1A 4OKOA 3BI0A 4OC4A 4R8FA 2PRQA 2Q4ZA 5D8NA 1LFWA 4UIBA 4UF4A 4NGSA 2ABZA 1ARMA 4NGQA 2XEFA 2ZEGA 4FWUA 1CPXA 3FJUA 3CPXA 5LRGA 3FEEA 3SI0A 5LYFA 1TKFA 3JRUA 2GLFA 2ZEHA 1ZLIA 2V8HA 3PBEA 2PVWA 3RBUA 2PIZA 2IMOA 2Q51A 3GB0A 1VGYA 3B3TA 3KI9A 3WT4A 1ZLHA 1Z8LA 4C8UA 1LCPA 3N5FA 5JGFA 1Y7EA 2PJ6A 5HVGA 4ZI6A 2BOAA 4MCSA 3SI1A 2C5QA 4PXDA 4P45A 5THWA 2EK8A 3IIBA 7CPAA 3I74A 4CPAA 4P4EA 5K8MA 1ZG7A 2PIYA 2ZELA 2JBJA 3D7DA 1BPMA 4OC5A 2NSMA 5K8OA 3NA6A 4ZX8A 4YN3A 2QYVA 5DS0A 4MMOA 2PE3A 1Z2LA 1NSAA 5JH9A 4ZY2A 2XEJA 1IGBA 3BI1A 3SJGA 4DJLA 1CPSA 3PBBA 1TF8A 2QVPA 4B6ZA 3CDXA 3D67A 1YW4A 5ELYA 2AFZA 1IY7A 2ZEEA 1QQ9A 1KWMA 2PJAA 2ZEMA 2PCUA 3VARA 4X3RA 4MHZA 2PVVA 4PXEA 2PJ2A 4F8ZA 3PFEA 2ZOFA 4C8CA 1LAPA 4NJRA 1Y0YA 1Z5RA 2V8DA 2PJ5A 3HUVA 3MN8A 3WC7A 4A94A 2XEIA 1DTDA 3IWWA 3CPAA 2NYQA 4ZYQA 2I3CA 1ZG8A 3PB8X 4P4DA 1ARLA 1JQGA 1BAVA 4ZY0A 3NH5A 5D29A 1LANA 3VTAA 4C9UA 4A39A 2AFOA 5IR2A 3K2KA 4PPZA 3ISXA 4P4BA 2CTBA 1PCAA 1VHOA 4MHNA 1CG2A 2RFHA 1LAMA 1ZG9A 2BO9A 2V77A 2IQ6A 3BHXA 3SJXA 3GUXA 3WC5A 5HVFA 2FVGA 3KL9A 1QMUA 4MXUA 4P4IA 1FT7A 1YSJA 3KGQA 3PB9X 1Q7LA 3HLPA 1XFOA 5K8PA 4R76A 3QNVA 3PB4X 4RUHA 4UEZA 2GREA 3SJFA 3KQZA 4C85A 3H8GA 1M4LA 1F2PA 4UEEA 2PJ0A 3B3VA 3FMCA 1OBRA 4H2KA 4G1PA 2ZOGA 2ZEOA 1XF1A 4F9UA 2JEWA 4X2TA 5CPAA 2C6PA 2RB7A 4OIDA 2F8HA 4C9AA 4MCPA 4WJBA 2O4HA 4OC0A 3KR4A 3LWUA 4EMEA 5LYDA 3FEDA 4OMEA 1RTQA 2C6CA 2ZEDA 3CT9A 3NH8A 3PB6X 2PJCA 2F7VA 2IJZA 4DUKA 5K8NA 4PXCA 3D7GA 1XRYA 2PJBA 2CF4A 1TKJA 4ZX9A 4MHPA 1EE3P 3VATA 4C8FA 4R7MA 1ELMP 4IAVA 4NGNA 3GLJA 3PB7X 1V6CA 3KQXA 4KNGE 3D7HA 4C99A 2PJ4A 1CP7A 3PRTA 4MCRA 3B2YA 2PJ1A 3B3SA 4F9VA 4PXBA 3B35A 2PJ3A 3RAMA 1ELLP 1DE4C 2G9DA 1F2OA 1XBUA 3L2NA 1PYTB 4TWEA 4P6YA 1FNOA 3ICUA 4CDKA 1XMBA 1R3NA 4PQAA 1AMPA 4AXVA 2EWBA 4GM5A 4WWVA 4BD9A 4FBEA 2QJ8A 4CDJA 1Y0RA 3MRUA 3B3CA 2CTCA 1CBXA 1TKHA 4MRIA 4ONWA 4FAIA 4NJQA 2J9AA 3TC8A 3IJ3A 4P44A 2O53A 3NFZA 2GU2A 1R43A 4C9EA 1YMEA 2XEGA 3KZWA 4C86A 4ZY1A 3S9MA 5HXDA 1VIXA 4EWTA 4FUUA 4DYOA 1YLOA 4O23A 4YWYA 2BCOA 3WC6A 4P10A 2OR4A 4YU9A 5LRKA 5J1QA 2PJ9A 1XJOA 3D66A 2Q43A 4UEFA 4KSIA 3BXMA 1AYEA 3KR5A 1UWYA 4TJXA 2AFSA 2C6GA 2POKA 4C8PA 1CX8A 4R6TA 5HVHA 5I4MA 4NGPA 4C8AA 4LQGA 2AFMA 3DLJA 1BLLE 4A37A 2ANPA 2OOTA 3KHXA 1CP6A 3IEHA 4Q7AA 1HDUA 2AFXA 5F09A 3B7IA 3D68A 1BPNA 2DEAA 3FH4A 2WZNA 2GP4A 4P4FA 4C9RA 3B3WA 3PEIA 2CIJA 1Y9ZA 3WABA 4IK2A 4K3NA 5IB9A 3D7FA 2AFUA 3I6SA 4A38A 2EK9A 2PJ8A 1F57A 2ZEFA 1YW6A 2WYRA 4X8IA 1H8LA 3V38A 3S9NA 1GYTA 4Z65A 3K9TA 3SJEA 5LYIA 2C1CA 3EIFA 4OC1A 3I1UA 3VH9A 1WVMA 4MCQA 1VHEA 1TF9A 4OC2A 2JBKA 3D4UA 3RZAA 4W9YA 4UIAA 3TX8A 4JYWA 4NGTA 3IC1A 1LOKA 3S9LA 3KASA 4C9VA 4C84A 4IHMA 5CBMA 2HC9A 3DGVA 3NH4A 5LYLA 2ZEPA 4NGMA 3IO1A 2GLJA 3FVLA 6CPAA 2PJ7A 4C8TA 4NGRA 3H8FA 4MHYA 4P4JA 3FF3A 4OIWA 2V8VA 3H8EA 4OP4A 3KHZA 2HB6A 5LRJA 1HDQA 4TJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXR A;  3IFE A;  3LMS A;  3SI2 A;  4OC3 A;  2ZEN A;  3V7Z A;  3FEC A;  3FX6 A;  3PFO A;  2AFW A;  4NFR A;  3T8W A;  1HEE A;  3ISZ A;  4EFD A;  2V8G A;  4JZ0 A;  5JM6 A;  8CPA A;  4TNU A;  2VL1 A;  4OKO A;  3BI0 A;  4OC4 A;  4R8F A;  2PRQ A;  2Q4Z A;  5D8N A;  1LFW A;  4UIB A;  4UF4 A;  4NGS A;  2ABZ A;  1ARM A;  4NGQ A;  2XEF A;  2ZEG A;  4FWU A;  1CPX A;  3FJU A;  3CPX A;  5LRG A;  3FEE A;  3SI0 A;  5LYF A;  1TKF A;  3JRU A;  2GLF A;  2ZEH A;  1ZLI A;  2V8H A;  3PBE A;  2PVW A;  3RBU A;  2PIZ A;  2IMO A;  2Q51 A;  3GB0 A;  1VGY A;  3B3T A;  3KI9 A;  3WT4 A;  1ZLH A;  1Z8L A;  4C8U A;  1LCP A;  3N5F A;  5JGF A;  1Y7E A;  2PJ6 A;  5HVG A;  4ZI6 A;  2BOA A;  4MCS A;  3SI1 A;  4PXD A;  4P45 A;  5THW A;  2EK8 A;  3IIB A;  7CPA A;  3I74 A;  4CPA A;  4P4E A;  5K8M A;  1ZG7 A;  2PIY A;  2ZEL A;  2JBJ A;  3D7D A;  1BPM A;  4OC5 A;  2NSM A;  5K8O A;  3NA6 A;  4ZX8 A;  4YN3 A;  2QYV A;  5DS0 A;  4MMO A;  2PE3 A;  1Z2L A;  1NSA A;  5JH9 A;  4ZY2 A;  2XEJ A;  1IGB A;  3BI1 A;  3SJG A;  4DJL A;  1CPS A;  3PBB A;  1TF8 A;  2QVP A;  4B6Z A;  3CDX A;  3D67 A;  1YW4 A;  5ELY A;  2AFZ A;  1IY7 A;  2ZEE A;  1QQ9 A;  1KWM A;  2PJA A;  2ZEM A;  2PCU A;  3VAR A;  4X3R A;  4MHZ A;  2PVV A;  4PXE A;  2PJ2 A;  4F8Z A;  3PFE A;  2ZOF A;  4C8C A;  1LAP A;  4NJR A;  1Y0Y A;  1Z5R A;  2V8D A;  2PJ5 A;  3HUV A;  3MN8 A;  3WC7 A;  4A94 A;  2XEI A;  1DTD A;  3IWW A;  3CPA A;  2NYQ A;  4ZYQ A;  2I3C A;  1ZG8 A;  3PB8 X;  4P4D A;  1ARL A;  1JQG A;  1BAV A;  4ZY0 A;  3NH5 A;  5D29 A;  1LAN A;  3VTA A;  4C9U A;  4A39 A;  2AFO A;  3K2K A;  4PPZ A;  3ISX A;  4P4B A;  2CTB A;  1PCA A;  1VHO A;  4MHN A;  1CG2 A;  2RFH A;  1LAM A;  1ZG9 A;  2BO9 A;  2V77 A;  2IQ6 A;  3BHX A;  3SJX A;  3GUX A;  3WC5 A;  5HVF A;  2FVG A;  3KL9 A;  1QMU A;  4MXU A;  4P4I A;  1FT7 A;  1YSJ A;  3KGQ A;  3PB9 X;  1Q7L A;  3HLP A;  1XFO A;  5K8P A;  4R76 A;  3QNV A;  3PB4 X;  4RUH A;  4UEZ A;  2GRE A;  3SJF A;  3KQZ A;  4C85 A;  3H8G A;  1M4L A;  1F2P A;  4UEE A;  2PJ0 A;  3B3V A;  3FMC A;  1OBR A;  4H2K A;  4G1P A;  2ZOG A;  2ZEO A;  1XF1 A;  4F9U A;  2JEW A;  4X2T A;  5CPA A;  2C6P A;  2RB7 A;  4OID A;  2F8H A;  4C9A A;  4MCP A;  4WJB A;  2O4H A;  4OC0 A;  3KR4 A;  3LWU A;  4EME A;  5LYD A;  3FED A;  4OME A;  1RTQ A;  2C6C A;  2ZED A;  3CT9 A;  3NH8 A;  3PB6 X;  2PJC A;  2F7V A;  2IJZ A;  4DUK A;  5K8N A;  4PXC A;  3D7G A;  1XRY A;  2PJB A;  2CF4 A;  1TKJ A;  4ZX9 A;  4MHP A;  1EE3 P;  3VAT A;  4C8F A;  4R7M A;  1ELM P;  4IAV A;  4NGN A;  3GLJ A;  3PB7 X;  1V6C A;  3KQX A;  4KNG E;  3D7H A;  4C99 A;  2PJ4 A;  1CP7 A;  3PRT A;  4MCR A;  3B2Y A;  2PJ1 A;  3B3S A;  4F9V A;  4PXB A;  3B35 A;  2PJ3 A;  3RAM A;  1ELL P;  1DE4 C;  2G9D A;  1F2O A;  1XBU A;  3L2N A;  1PYT B;  4TWE A;  4P6Y A;  1FNO A;  3ICU A;  4CDK A;  1XMB A;  1R3N A;  4PQA A;  1AMP A;  4AXV A;  2EWB A;  4GM5 A;  4WWV A;  4BD9 A;  4FBE A;  2QJ8 A;  4CDJ A;  1Y0R A;  3MRU A;  3B3C A;  2CTC A;  1CBX A;  1TKH A;  4MRI A;  4ONW A;  4FAI A;  4NJQ A;  2J9A A;  3TC8 A;  3IJ3 A;  4P44 A;  2O53 A;  3NFZ A;  2GU2 A;  1R43 A;  4C9E A;  1YME A;  2XEG A;  3KZW A;  4C86 A;  4ZY1 A;  3S9M A;  5HXD A;  1VIX A;  4EWT A;  4FUU A;  4DYO A;  1YLO A;  4O23 A;  4YWY A;  2BCO A;  3WC6 A;  4P10 A;  2OR4 A;  4YU9 A;  5LRK A;  5J1Q A;  2PJ9 A;  1XJO A;  3D66 A;  2Q43 A;  4UEF A;  4KSI A;  3BXM A;  1AYE A;  3KR5 A;  1UWY A;  4TJX A;  2AFS A;  2C6G A;  2POK A;  4C8P A;  1CX8 A;  4R6T A;  5HVH A;  5I4M A;  4NGP A;  4C8A A;  4LQG A;  2AFM A;  3DLJ A;  1BLL E;  4A37 A;  2ANP A;  2OOT A;  3KHX A;  1CP6 A;  3IEH A;  4Q7A A;  1HDU A;  2AFX A;  5F09 A;  3B7I A;  3D68 A;  1BPN A;  2DEA A;  3FH4 A;  2WZN A;  4P4F A;  4C9R A;  3B3W A;  3PEI A;  2CIJ A;  1Y9Z A;  3WAB A;  4IK2 A;  4K3N A;  5IB9 A;  3D7F A;  2AFU A;  3I6S A;  4A38 A;  2EK9 A;  2PJ8 A;  1F57 A;  2ZEF A;  1YW6 A;  2WYR A;  4X8I A;  1H8L A;  3V38 A;  3S9N A;  1GYT A;  4Z65 A;  3K9T A;  3SJE A;  5LYI A;  2C1C A;  3EIF A;  4OC1 A;  3I1U A;  3VH9 A;  1WVM A;  4MCQ A;  1VHE A;  1TF9 A;  4OC2 A;  2JBK A;  3D4U A;  3RZA A;  4W9Y A;  4UIA A;  3TX8 A;  4JYW A;  4NGT A;  3IC1 A;  1LOK A;  3S9L A;  3KAS A;  4C9V A;  4C84 A;  4IHM A;  5CBM A;  2HC9 A;  3DGV A;  3NH4 A;  5LYL A;  2ZEP A;  4NGM A;  3IO1 A;  2GLJ A;  3FVL A;  6CPA A;  2PJ7 A;  4C8T A;  4NGR A;  3H8F A;  4MHY A;  4P4J A;  3FF3 A;  4OIW A;  2V8V A;  3H8E A;  4OP4 A;  3KHZ A;  2HB6 A;  5LRJ A;  1HDQ A;  4TJV A; 
#chains in the Genus database with same CATH topology
 4OAD A;  4KVO E;  1TXR A;  3IFE A;  3LMS A;  3NOJ A;  2PR1 A;  2Z3O A;  3SI2 A;  1NSL A;  3IWG A;  1M6V B;  2JDD A;  2EVN A;  4OC3 A;  2CNS A;  2GIV A;  2ZEN A;  3V7Z A;  2WPW A;  3TOB A;  4UFX A;  4AVB A;  3FEC A;  3FX6 A;  3PFO A;  2AFW A;  4NFR A;  4JXR A;  2B5G B;  2PCN A;  3T8W A;  1HEE A;  2CY2 A;  3NFQ A;  4KOR A;  3ISZ A;  4EFD A;  3GIU A;  4KOX A;  3PLF B;  2V8G A;  3HPG G;  4JZ0 A;  1Q2D A;  2Q4Y A;  4AG9 A;  5JM6 A;  3TLY A;  8CPA A;  3EO4 A;  4TNU A;  3ZZI A;  2VL1 A;  4LUA A;  4OKO A;  1VBG A;  3T5M A;  1S5K A;  3BI0 A;  3TLE A;  3ZJ0 A;  3QAH A;  4M85 A;  4OC4 A;  4R8F A;  2EUI A;  2PRQ A;  2Q4Z A;  4A4C A;  3GY9 A;  3DSB A;  5D8N A;  5F49 A;  1KZF A;  2CXA A;  4C2X A;  2OZU A;  4H89 A;  1LFW A;  4UIB A;  3F0A A;  1Z8T A;  4UF4 A;  4NGS A;  2ABZ A;  1ARM A;  4NGQ A;  2XEF A;  3SXO A;  4IIY A;  1EZB A;  2ZEG A;  3T9Y A;  4FWU A;  1CPX A;  3FJU A;  3CPX A;  3TE4 A;  1X10 A;  5J8C A;  4MHD A;  5LRG A;  3F5B A;  3F8K A;  4C2Z A;  3FEE A;  1Y7R A;  3SI0 A;  1QSM A;  2FS5 A;  2VZZ A;  4HKF A;  2A4N A;  2YND A;  3U88 C;  2Z0Z A;  5EMI A;  1TKF A;  3JRU A;  2GLF A;  2AJ6 A;  4KS9 A;  2FM4 A;  2ZEH A;  1ZLI A;  2V8H A;  1BOB A;  3PBE A;  2PVW A;  2HUZ A;  1V0C A;  3RBU A;  2Y0M A;  4PV6 A;  1KEE B;  1VI4 A;  2PIZ A;  1QSO A;  2IMO A;  2Q51 A;  4NF1 A;  4ORF A;  3VGO A;  1VGY A;  3B3T A;  3GB0 A;  3KI9 A;  3WT4 A;  2JEV A;  3SR3 A;  1ZLH A;  2J8M A;  2Z3K A;  4XPD B;  1PU9 A;  4BBH A;  1Z8L A;  4CO9 A;  2G3A A;  2FL4 A;  1YK3 A;  1YVO A;  4C8U A;  5HKW A;  1LCP A;  2QIR A;  3N5F A;  5IV0 A;  5JGF A;  4C2Y A;  1Y7E A;  4DNC A;  1CE8 B;  5H86 A;  4BMH A;  2PJ6 A;  4M6I A;  5HVG A;  1VBH A;  1QSR A;  4ZI6 A;  2BOA A;  3T05 A;  1L0C A;  1YVH A;  4MCS A;  1CM0 A;  3SI1 A;  5AG6 A;  1EZA A;  4AB7 A;  2C5Q A;  4JVO A;  4PXD A;  3VRO A;  4JXQ A;  3BUO B;  3FB3 A;  4P45 A;  3UY5 A;  2MP0 A;  4XNH B;  5THW A;  4QC6 A;  3SXN A;  1BXR B;  2EK8 A;  3IIB A;  1RXT A;  7CPA A;  3I74 A;  4RN7 A;  2NMT A;  4UCM A;  4CPA A;  4CS0 B;  1T36 B;  4P4E A;  1S7L A;  4U9Z A;  1Y9W A;  5K8M A;  1ZG7 A;  2EBJ A;  2PIY A;  2JBJ A;  3D7D A;  2ZEL A;  1BPM A;  4MI1 A;  3R96 A;  1PUA A;  4NCZ A;  4OC5 A;  2P0W A;  3GYA A;  4JD6 A;  3W6S A;  4MY0 A;  3C8O A;  1GGO A;  4QVT A;  2NSM A;  1M4G A;  2CNT A;  5K8O A;  1Z8X A;  2FCK A;  2VQY A;  3NA6 A;  4ZX8 A;  3OB2 B;  2QYV A;  4HNX B;  2AUM A;  1TIQ A;  5DS0 A;  4YN3 A;  4MMO A;  2PE3 A;  1Z2L A;  1NSA A;  5JH9 A;  4ZY2 A;  1NBW A;  4A4B A;  1Y9K A;  2Z11 A;  4R9M A;  2Z10 A;  2XEJ A;  3PZJ A;  4FD6 A;  5GCN A;  2GE3 A;  3QAY A;  1IGB A;  1S60 A;  3BI1 A;  3SJG A;  4DJL A;  3K4I A;  1CPS A;  1XE4 A;  4CYQ A;  3HPH E;  4NSQ A;  2OZG A;  4CYO A;  2VZY A;  2HWG A;  3PBB A;  3RO0 A;  1IYK A;  4E8O A;  1TF8 A;  2QVP A;  2QEC A;  2WUU A;  4B6Z A;  3CDX A;  2DPT A;  3D67 A;  2OB0 A;  1YW4 A;  5ELY A;  2G3T A;  2AFZ A;  4NEX A;  2PQ8 A;  2ATR A;  4CGM A;  1IY7 A;  4H1H A;  2EO8 A;  1P0H A;  4ONU A;  1ZL0 A;  5G22 A;  5KTD A;  2ZEE A;  1QQ9 A;  4CGO A;  2Y1M A;  2OLS A;  1KWM A;  3R9F A;  1P4N A;  2XPO A;  3R9G A;  3BUX B;  2OU2 A;  2PJA A;  2ZEM A;  2BEI A;  2PCU A;  4F0X A;  5JVL A;  5AG5 A;  3VAR A;  4KVX A;  3TYX A;  4X3R A;  2FE7 A;  4B12 A;  4E0A A;  1ON0 A;  4MHZ A;  1KC7 A;  3S6K A;  2PVV A;  3OWC A;  4PXE A;  4A33 A;  4JLY A;  3EY5 A;  2IL4 A;  3BUW B;  3CXP A;  1IU8 A;  1I21 A;  5AXI A;  2PJ2 A;  5DWN A;  5LYF A;  4F8Z A;  3PFE A;  2ZOF A;  4A30 A;  4C8C A;  3CXS A;  1LAP A;  4NJR A;  1ZRS A;  4M6G A;  1Y0Y A;  4UBR A;  2J8N A;  1Z5R A;  2K5T A;  3PFV A;  1AUG A;  2V8D A;  2Q7S A;  3EC4 A;  4MFZ A;  2DIK A;  5BY0 A;  2PJ5 A;  3HUV A;  1C30 B;  3MN8 A;  3WC7 A;  1MJ9 A;  4A94 A;  4HPS A;  2XEI A;  1QST A;  2RC4 A;  5BWA B;  3FYN A;  1DTD A;  2YNC C;  4J0N A;  3IWW A;  1A2Z A;  3CXQ A;  3CPA A;  2NYQ A;  4ZYQ A;  2FIW A;  2I3C A;  3VRP A;  1ZG8 A;  3PB8 X;  1Z9U A;  4P4D A;  4MFP A;  2CBL A;  4AG7 A;  1ARL A;  4MBU A;  1JQG A;  3U1B A;  1BAV A;  2BUE A;  1IID A;  4ZY0 A;  2EZA A;  3NH5 A;  2DXQ A;  4II9 A;  2WPX A;  2HI6 A;  3EZA A;  5D29 A;  5HH1 A;  1LAN A;  3VTA A;  2O28 A;  2G0B A;  4C9U A;  3BUM B;  1KBL A;  4F6A A;  4A39 A;  2AFO A;  5IR2 A;  4QBJ A;  3K2K A;  4KOU A;  4PPZ A;  1FBV A;  3ISX A;  3SHP A;  4P4B A;  2CTB A;  2BL1 A;  1PCA A;  1YX0 A;  1VHO A;  1CG2 A;  4KOW A;  2RFH A;  4MHN A;  4K30 A;  4XPL A;  1LAM A;  2Z3P A;  3TOA A;  1ZG9 A;  2BO9 A;  2V77 A;  3S6H A;  4CAF A;  4CRZ B;  4E94 A;  2IQ6 A;  2YNE A;  3BHX A;  3SJX A;  3TCV A;  3GUX A;  3WC5 A;  1WJT A;  2ZW7 A;  3P2H A;  5HVF A;  4L8A A;  2FVG A;  2J8R A;  3KL9 A;  1QMU A;  4MXU A;  4P4I A;  2F5I A;  2PDO A;  1FT7 A;  1YSJ A;  3KGQ A;  3PB9 X;  4A31 A;  1Q7L A;  2YJT A;  1EO0 A;  3HLP A;  4PK2 A;  4MFK A;  1XFO A;  2B3U A;  4GXH A;  4NXY A;  5K8P A;  2CNM A;  3BJ7 A;  4R76 A;  3QNV A;  4B5O A;  3PB4 X;  4RUH A;  2REE A;  5F1Y A;  2Q04 A;  1B6B A;  2GRE A;  4UEZ A;  2Q7B A;  2B58 A;  3SJF A;  3KQZ A;  2YGW A;  4C85 A;  3H8G A;  4KOT A;  2X7B A;  2R98 A;  3NE8 A;  1M4L A;  4YFJ A;  1F2P A;  4UEE A;  5HKY A;  1GHE A;  1LRZ A;  3H5Z A;  1S7N A;  5F47 A;  3RYO A;  2PR8 A;  1N71 A;  4A95 A;  4CGL A;  2PJ0 A;  4ZGY B;  3T07 A;  4C68 A;  1J4J A;  3B3V A;  3TTH A;  3D3S A;  3FMC A;  1YRE A;  1OBR A;  3HMJ G;  1IB1 E;  4H2K A;  4G1P A;  1UFH A;  2ZOG A;  3TO7 A;  2ZEO A;  2QML A;  2R7H A;  3IU1 A;  3TO6 A;  1XF1 A;  4F9U A;  4X5K A;  2JEW A;  5A28 A;  5JPH A;  4IIX A;  4CRY B;  4MY3 A;  5K99 A;  1S3Z A;  3DR6 A;  4KSA A;  2VBQ A;  2Z3M A;  3B8G A;  4X2T A;  5CPA A;  5AG7 A;  3WR7 A;  4KZT A;  2HV2 A;  3ZNI A;  3I3G A;  3FNC A;  3VWD A;  2C6P A;  2RB7 A;  3P2F A;  2F8H A;  4OID A;  4H6U A;  4CAW A;  1X12 A;  2YNC A;  4C9A A;  4MCP A;  4WJB A;  3LD2 A;  2ARH A;  4M8D A;  2O4H A;  4OC0 A;  2PRB A;  3KR4 A;  3LWU A;  4R87 A;  4EME A;  4C7I A;  5LYD A;  3FED A;  4KLV A;  4OME A;  1RTQ A;  2C6C A;  4OAE A;  2DLA A;  2ZED A;  4H6Z A;  3CT9 A;  3NH8 A;  4CGN A;  3PB6 X;  5IB0 A;  2PJC A;  2B0A A;  2GFQ A;  2B4D A;  1YR0 A;  4GPL B;  2F7V A;  3T0T A;  2D4P A;  2IJZ A;  2AUN A;  4DUK A;  3EXN A;  3IU2 A;  4PXC A;  2P6G A;  5K8N A;  3D7G A;  1XRY A;  2PJB A;  2CF4 A;  2ZXV A;  3KKW A;  3EFA A;  1TKJ A;  4FD7 A;  5AGE A;  2N3A B;  5CNP A;  4ZX9 A;  4HNW B;  3RNZ A;  2X0S A;  1IYL A;  4MHP A;  4CAV A;  2I00 A;  2Z3N A;  3LAC A;  1EE3 P;  1YVK A;  3VAT A;  1NXJ A;  1B47 A;  4R7M A;  1ELM P;  4U9Y A;  1I1D A;  4IAV A;  4Y49 C;  3EZB A;  4NGN A;  3GLJ A;  3PB7 X;  4MI4 A;  1C3O B;  1V6C A;  3KQX A;  3KRV A;  4KNG E;  3W91 A;  4MFQ A;  3NE7 A;  4HNY B;  2B3V A;  4B5P A;  1CS0 B;  1WWZ A;  3D7H A;  3JUW A;  4C99 A;  1IIC A;  4F0Y A;  1Q2C A;  2PJ4 A;  1CP7 A;  4KUA A;  3PRT A;  4MCR A;  4BIN A;  4KOV A;  4M3S A;  2Z3L A;  1Q5X A;  1YLE A;  4CZ1 A;  4UFV A;  2ZPA A;  2PJ1 A;  3B2Y A;  3B3S A;  4F9V A;  1J3L A;  2UV8 G;  4PXB A;  4KOY A;  4MJX A;  3T90 A;  1XIX A;  3A9L A;  2PJ3 A;  3B35 A;  1Q2Y A;  1Z4E A;  3DDD A;  3RAM A;  4B14 A;  1ELL P;  3FIX A;  1JWQ A;  1KUX A;  4E5S A;  1DE4 C;  4COB A;  3O8Z A;  1F2O A;  1XBU A;  2G9D A;  3TLB A;  4A2Z A;  3L2N A;  1PYT B;  4INJ A;  4EYS A;  4TWE A;  1SQH A;  3N7Z A;  2JLM A;  4XPK A;  4P6Y A;  3FRM A;  2OZH A;  1YGH A;  2P6F A;  3S6F A;  5J3X A;  4AVA A;  1FNO A;  4B11 A;  2D0O A;  2FIA A;  3ICU A;  4CDK A;  4LX9 A;  5ISV A;  1JDB C;  4EVY A;  3JVN A;  2ODF A;  2R82 A;  2P6E A;  1XMB A;  1R3N A;  4CYN A;  1KUY A;  4Q36 A;  2OH1 A;  2R1I A;  4PQA A;  4AVC A;  2HRO A;  4UFW A;  2E28 A;  1AMP A;  3H4Q A;  2EWB A;  5G1Z A;  3S6G A;  4GM5 A;  4WWV A;  4IUS A;  4AXV A;  4BD9 A;  4FBE A;  2QJ8 A;  5F5X A;  4PSX A;  3G3S A;  4OLL A;  2Y1N A;  4CDJ A;  1B87 A;  1Y0R A;  3MRU A;  5F9M A;  1R57 A;  4UWI A;  3PT1 A;  2FSR A;  4U5Y A;  3B3C A;  3TO9 A;  3OP0 A;  3D2P A;  2CTC A;  3CZX A;  1TKH A;  1CBX A;  4MRI A;  1ZO0 A;  4ONW A;  4UCN A;  3V8I A;  4FAI A;  4YRH A;  5JYB A;  4NJQ A;  2J9A A;  5J8F A;  1RO5 A;  3TC8 A;  3IJ3 A;  4MFL A;  4P44 A;  2O53 A;  3NFZ A;  2VXK A;  1NE9 A;  2GU2 A;  1R43 A;  3QB8 A;  4JJX A;  3VRN A;  3TLZ A;  4C9E A;  1YME A;  2XEG A;  3KZW A;  1Z9E A;  1M1D A;  3S9M A;  2FT0 A;  4BTF A;  4ZY1 A;  4C86 A;  5HXD A;  4C8F A;  1VIX A;  2B5G A;  5EBV A;  4GS4 A;  4EWT A;  1CJW A;  4UWJ A;  4FUU A;  3R9E A;  4DYO A;  2Q44 A;  1YLO A;  4O23 A;  4YGO A;  4KLW A;  4YWY A;  1IOF A;  4L89 A;  4UCP A;  2BCO A;  2VKZ G;  2HQY A;  4KUB A;  3WC6 A;  1XMT A;  4P10 A;  3TLA A;  3OB1 B;  1FY7 A;  2OR4 A;  2JDC A;  4FD4 A;  4YU9 A;  4Y49 B;  5LRK A;  5J1Q A;  3DNS A;  4BPU B;  3F9K C;  2C27 A;  2XPL A;  1XJO A;  2PJ9 A;  2Q43 A;  3D66 A;  3I9S A;  2PC1 A;  3MGD A;  4UEF A;  5F48 A;  4KSI A;  3TFY A;  2H5M A;  4RI1 A;  3BXM A;  2R8V A;  1AYE A;  1XF8 A;  3KR5 A;  1UWY A;  4R3L A;  2VI7 A;  4TJX A;  1S7F A;  2AFS A;  2Q0Y A;  1MJB A;  2C6G A;  2POK A;  1WK4 A;  4C8P A;  1CX8 A;  2ZW5 A;  4R6T A;  5HVH A;  5I4M A;  4NGP A;  4C8A A;  2XPN A;  4B13 A;  5JQ4 A;  4LQG A;  2AFM A;  3DLJ A;  1BLL E;  3JTK A;  5FVJ A;  4R3K A;  2Q4V A;  1IOI A;  3D2M A;  2ZW6 A;  2ANP A;  4A37 A;  2BSW A;  2OOT A;  3KHX A;  3TLG A;  1CP6 A;  1M4I A;  4QUS A;  3TLG B;  3IEH A;  4Q7A A;  2FXF A;  4LQ6 A;  4RS2 A;  2XPP A;  1HDU A;  2AFX A;  5F09 A;  4CGP A;  3VRR A;  4A32 A;  3B7I A;  3D68 A;  1BPN A;  2DEA A;  5HKZ A;  2WZN A;  3FH4 A;  2GP4 A;  4P4F A;  5AG4 A;  4C9R A;  1K4J A;  3B3W A;  3PEI A;  4M6H A;  2CIJ A;  4JWP A;  3TLC A;  1DIK A;  3WAB A;  3PGP A;  3R1K A;  4IK2 A;  4K3N A;  1Y9Z A;  4KOS A;  1VHS A;  5IB9 A;  3D7F A;  2AFU A;  5G20 A;  1XOV A;  2KCW A;  3G8W A;  2D0P A;  3TT2 A;  1I12 A;  5DWM A;  5KTC A;  3I6S A;  1OZP A;  2B4D B;  5A27 A;  4A38 A;  5I0C A;  2PSW A;  2EK9 A;  2PJ8 A;  3IGR A;  3LOD A;  1F57 A;  1M44 A;  1YW6 A;  2WYR A;  2ZEF A;  4X8I A;  4PSW A;  2B4J C;  3PP9 A;  1H8L A;  3GKR A;  3V38 A;  3G23 A;  3S9N A;  3K9U A;  5F46 A;  1GYT A;  1NMT A;  4Z65 A;  1XEB A;  2GAN A;  4Q38 A;  5FD8 A;  3OAK A;  5H84 A;  5KTA A;  3DR8 A;  1Z8W A;  3K9T A;  4J3G A;  3SJE A;  5LYI A;  2C1C A;  1YQE A;  4QB9 A;  3IWE A;  1Z4R A;  4B10 A;  2EZC A;  1A9X B;  3EIF A;  1MJA A;  5G21 A;  3BUN B;  4OC1 A;  2REF A;  4B5P B;  4E2A A;  3E0K A;  4MFJ A;  3I1U A;  4KSF A;  3D8P A;  3VH9 A;  1WVM A;  4MCQ A;  3VRQ A;  5IX3 A;  1VHE A;  1R61 A;  4COG A;  1TF9 A;  4UA3 A;  4OC2 A;  2JBK A;  4CYP A;  3D4U A;  2DF5 A;  3RZA A;  4W9Y A;  2AE6 A;  4PK3 A;  1QSN A;  4CAX A;  2WSA A;  5C82 A;  3GJZ A;  4IF5 A;  4UIA A;  5EC4 A;  3TX8 A;  3EZE A;  2VEZ A;  4JYW A;  1VKC A;  4NGT A;  3IC1 A;  1MK4 A;  4BPX B;  1LOK A;  2B4B A;  3S9L A;  3KAS A;  1BO4 A;  4CAE A;  1ZYM A;  2I79 A;  2EZB A;  4IHM A;  4C84 A;  4C9V A;  4I49 A;  5CBM A;  2HC9 A;  4KVM E;  4XPD C;  3DGV A;  4MJ8 A;  3NH4 A;  4RR2 B;  5C88 A;  5LYL A;  3C26 A;  5E96 A;  4C7H A;  4TJV A;  2ZEP A;  3BLN A;  5F13 A;  4NGM A;  3IO1 A;  2GLJ A;  3FVL A;  3R95 A;  2YJV A;  2D4O A;  2ZW4 A;  6CPA A;  2PJ7 A;  3FBU A;  4NGR A;  1JDE A;  3W6X A;  4C8T A;  3H8F A;  1U6M A;  4MHY A;  4P4J A;  3FF3 A;  4FD5 A;  4OIW A;  2V8V A;  1M4D A;  3H8E A;  4OP4 A;  3KHZ A;  4XNH C;  2HB6 A;  4R57 A;  1S7K A;  4BPW B;  2DPS A;  4ZBG A;  5LRJ A;  1KUV A;  3VWE A;  3BJ8 A;  3FXT A;  1HDQ A;  5HMN A; 
#chains in the Genus database with same CATH homology
 1TXR A;  3IFE A;  3LMS A;  3SI2 A;  4OC3 A;  2ZEN A;  3V7Z A;  3FEC A;  3FX6 A;  3PFO A;  2AFW A;  4NFR A;  3T8W A;  1HEE A;  3ISZ A;  4EFD A;  2V8G A;  4JZ0 A;  5JM6 A;  8CPA A;  4TNU A;  2VL1 A;  4OKO A;  3BI0 A;  4OC4 A;  4R8F A;  2PRQ A;  2Q4Z A;  5D8N A;  1LFW A;  4UIB A;  4UF4 A;  4NGS A;  2ABZ A;  1ARM A;  4NGQ A;  2XEF A;  2ZEG A;  4FWU A;  1CPX A;  3FJU A;  3CPX A;  5LRG A;  3FEE A;  3SI0 A;  5LYF A;  1TKF A;  3JRU A;  2GLF A;  2ZEH A;  1ZLI A;  2V8H A;  3PBE A;  2PVW A;  3RBU A;  2PIZ A;  2IMO A;  2Q51 A;  3GB0 A;  1VGY A;  3B3T A;  3KI9 A;  3WT4 A;  1ZLH A;  1Z8L A;  4C8U A;  1LCP A;  3N5F A;  5JGF A;  1Y7E A;  2PJ6 A;  5HVG A;  4ZI6 A;  2BOA A;  4MCS A;  3SI1 A;  2C5Q A;  4PXD A;  4P45 A;  5THW A;  2EK8 A;  3IIB A;  7CPA A;  3I74 A;  4CPA A;  4P4E A;  5K8M A;  1ZG7 A;  2PIY A;  2ZEL A;  2JBJ A;  3D7D A;  1BPM A;  4OC5 A;  2NSM A;  5K8O A;  3NA6 A;  4ZX8 A;  4YN3 A;  2QYV A;  5DS0 A;  4MMO A;  2PE3 A;  1Z2L A;  1NSA A;  5JH9 A;  4ZY2 A;  2XEJ A;  1IGB A;  3BI1 A;  3SJG A;  4DJL A;  1CPS A;  3PBB A;  1TF8 A;  2QVP A;  4B6Z A;  3CDX A;  3D67 A;  1YW4 A;  5ELY A;  2AFZ A;  1IY7 A;  2ZEE A;  1QQ9 A;  1KWM A;  2PJA A;  2ZEM A;  2PCU A;  3VAR A;  4X3R A;  4MHZ A;  2PVV A;  4PXE A;  2PJ2 A;  4F8Z A;  3PFE A;  2ZOF A;  4C8C A;  1LAP A;  4NJR A;  1Y0Y A;  1Z5R A;  2V8D A;  2PJ5 A;  3HUV A;  3MN8 A;  3WC7 A;  4A94 A;  2XEI A;  1DTD A;  3IWW A;  3CPA A;  2NYQ A;  4ZYQ A;  2I3C A;  1ZG8 A;  3PB8 X;  4P4D A;  1ARL A;  1JQG A;  1BAV A;  4ZY0 A;  3NH5 A;  5D29 A;  1LAN A;  3VTA A;  4C9U A;  4A39 A;  2AFO A;  5IR2 A;  3K2K A;  4PPZ A;  3ISX A;  4P4B A;  2CTB A;  1PCA A;  1VHO A;  4MHN A;  1CG2 A;  2RFH A;  1LAM A;  1ZG9 A;  2BO9 A;  2V77 A;  2IQ6 A;  3BHX A;  3SJX A;  3GUX A;  3WC5 A;  5HVF A;  2FVG A;  3KL9 A;  1QMU A;  4MXU A;  4P4I A;  1FT7 A;  1YSJ A;  3KGQ A;  3PB9 X;  1Q7L A;  3HLP A;  1XFO A;  5K8P A;  4R76 A;  3QNV A;  3PB4 X;  4RUH A;  4UEZ A;  2GRE A;  3SJF A;  3KQZ A;  4C85 A;  3H8G A;  1M4L A;  1F2P A;  4UEE A;  2PJ0 A;  3B3V A;  3FMC A;  1OBR A;  4H2K A;  4G1P A;  2ZOG A;  2ZEO A;  1XF1 A;  4F9U A;  2JEW A;  4X2T A;  5CPA A;  2C6P A;  2RB7 A;  4OID A;  2F8H A;  4C9A A;  4MCP A;  4WJB A;  2O4H A;  4OC0 A;  3KR4 A;  3LWU A;  4EME A;  5LYD A;  3FED A;  4OME A;  1RTQ A;  2C6C A;  2ZED A;  3CT9 A;  3NH8 A;  3PB6 X;  2PJC A;  2F7V A;  2IJZ A;  4DUK A;  5K8N A;  4PXC A;  3D7G A;  1XRY A;  2PJB A;  2CF4 A;  1TKJ A;  4ZX9 A;  4MHP A;  1EE3 P;  3VAT A;  4C8F A;  4R7M A;  1ELM P;  4IAV A;  4NGN A;  3GLJ A;  3PB7 X;  1V6C A;  3KQX A;  4KNG E;  3D7H A;  4C99 A;  2PJ4 A;  1CP7 A;  3PRT A;  4MCR A;  3B2Y A;  2PJ1 A;  3B3S A;  4F9V A;  4PXB A;  3B35 A;  2PJ3 A;  3RAM A;  1ELL P;  1DE4 C;  2G9D A;  1F2O A;  1XBU A;  3L2N A;  1PYT B;  4TWE A;  4P6Y A;  1FNO A;  3ICU A;  4CDK A;  1XMB A;  1R3N A;  4PQA A;  1AMP A;  4AXV A;  2EWB A;  4GM5 A;  4WWV A;  4BD9 A;  4FBE A;  2QJ8 A;  4CDJ A;  1Y0R A;  3MRU A;  3B3C A;  2CTC A;  1CBX A;  1TKH A;  4MRI A;  4ONW A;  4FAI A;  4NJQ A;  2J9A A;  3TC8 A;  3IJ3 A;  4P44 A;  2O53 A;  3NFZ A;  2GU2 A;  1R43 A;  4C9E A;  1YME A;  2XEG A;  3KZW A;  4C86 A;  4ZY1 A;  3S9M A;  5HXD A;  1VIX A;  4EWT A;  4FUU A;  4DYO A;  1YLO A;  4O23 A;  4YWY A;  2BCO A;  3WC6 A;  4P10 A;  2OR4 A;  4YU9 A;  5LRK A;  5J1Q A;  2PJ9 A;  1XJO A;  3D66 A;  2Q43 A;  4UEF A;  4KSI A;  3BXM A;  1AYE A;  3KR5 A;  1UWY A;  4TJX A;  2AFS A;  2C6G A;  2POK A;  4C8P A;  1CX8 A;  4R6T A;  5HVH A;  5I4M A;  4NGP A;  4C8A A;  4LQG A;  2AFM A;  3DLJ A;  1BLL E;  4A37 A;  2ANP A;  2OOT A;  3KHX A;  1CP6 A;  3IEH A;  4Q7A A;  1HDU A;  2AFX A;  5F09 A;  3B7I A;  3D68 A;  1BPN A;  2DEA A;  3FH4 A;  2WZN A;  2GP4 A;  4P4F A;  4C9R A;  3B3W A;  3PEI A;  2CIJ A;  1Y9Z A;  3WAB A;  4IK2 A;  4K3N A;  5IB9 A;  3D7F A;  2AFU A;  3I6S A;  4A38 A;  2EK9 A;  2PJ8 A;  1F57 A;  2ZEF A;  1YW6 A;  2WYR A;  4X8I A;  1H8L A;  3V38 A;  3S9N A;  1GYT A;  4Z65 A;  3K9T A;  3SJE A;  5LYI A;  2C1C A;  3EIF A;  4OC1 A;  3I1U A;  3VH9 A;  1WVM A;  4MCQ A;  1VHE A;  1TF9 A;  4OC2 A;  2JBK A;  3D4U A;  3RZA A;  4W9Y A;  4UIA A;  3TX8 A;  4JYW A;  4NGT A;  3IC1 A;  1LOK A;  3S9L A;  3KAS A;  4C9V A;  4C84 A;  4IHM A;  5CBM A;  2HC9 A;  3DGV A;  3NH4 A;  5LYL A;  2ZEP A;  4NGM A;  3IO1 A;  2GLJ A;  3FVL A;  6CPA A;  2PJ7 A;  4C8T A;  4NGR A;  3H8F A;  4MHY A;  4P4J A;  3FF3 A;  4OIW A;  2V8V A;  3H8E A;  4OP4 A;  3KHZ A;  2HB6 A;  5LRJ A;  1HDQ A;  4TJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...