4P4DA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor mp1c
Total Genus 260
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
260
sequence length
696
structure length
687
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 260
structure length 687
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4dA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4dA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4dA02
2GLJA 3KQXA 4WJBA 4F9UA 4ZI6A 1QMUA 1CBXA 3PB4X 1LANA 4DYOA 3RAMA 2PVWA 3S9NA 3RZAA 2NYQA 3FEDA 1DTDA 2F8HA 1CX8A 4C99A 3NH5A 4FAIA 3D7HA 3WT4A 3WABA 4NGQA 4YWYA 4NJQA 5LYIA 2J9AA 1DE4C 4JYWA 3KQZA 2ZEFA 3NFZA 4DJLA 1ARMA 2AFZA 4R8FA 4IK2A 2G9DA 1Q7LA 3PEIA 4C8TA 4OIDA 2V8HA 4B6ZA 1V6CA 4NGRA 1BPNA 1H8LA 1FT7A 1CPXA 4C86A 3FEEA 1LCPA 4OC1A 3KHXA 3D66A 4UF4A 4UEZA 1ZG7A 3PRTA 4X3RA 2ANPA 3IIBA 2FVGA 3GLJA 4TJVA 4ZX8A 1Y7EA 4IHMA 4LQGA 2PVVA 3D68A 3KZWA 5HVGA 3FVLA 1TKHA 1IGBA 4RUHA 2GREA 1ZG9A 1M4LA 4NJRA 1YSJA 2ABZA 1Y0RA 1FNOA 2ZEPA 4C84A 4X8IA 2I3CA 4G1PA 4P4FA 4KNGE 4FBEA 4K3NA 2ZENA 4OC0A 4P4JA 5F09A 3SI2A 3V38A 1CP7A 4UIBA 4C9AA 2AFXA 4O23A 4OKOA 5I4MA 2CTCA 3RBUA 1VHOA 2BCOA 3BI0A 3JRUA 2Q43A 3IEHA 5K8PA 2PJ8A 1HDQA 1ZLIA 3D7GA 3TC8A 1BPMA 4OC2A 3H8FA 3IFEA 1LAMA 1YW6A 4C9VA 1TKFA 3SI1A 3ICUA 1XBUA 1ZG8A 5HVHA 2WYRA 4ZY2A 4ONWA 3B3WA 4YN3A 2V77A 5JM6A 4OIWA 3PBEA 4X2TA 3EIFA 1F2OA 4MCRA 3B3SA 1VGYA 1AYEA 1EE3P 5K8MA 3D4UA 1PCAA 4TJXA 5J1QA 2PCUA 2ZEHA 4P4BA 2PIZA 1ARLA 1ZLHA 4NGPA 3H8EA 2PJCA 3NH4A 3D67A 3CT9A 3WC6A 2JBJA 4ZY1A 4JZ0A 6CPAA 2AFSA 2JEWA 2POKA 4WWVA 2XEGA 1XFOA 1Y0YA 4R76A 1PYTB 2BOAA 2Q51A 3HUVA 4C8UA 5LRJA 3B2YA 4MCPA 5CBMA 2GLFA 4P44A 3GB0A 2QYVA 3MRUA 1LFWA 3PB7X 1IY7A 4CDKA 5LRGA 3I6SA 4C9RA 4P4DA 2O53A 3HLPA 3KR5A 3IJ3A 1CPSA 5D29A 4MXUA 4C85A 5HXDA 1R3NA 5JGFA 4NGTA 2EK8A 3IO1A 3L2NA 5K8OA 4KSIA 2ZEOA 2EWBA 2PE3A 4FWUA 2RFHA 5LRKA 1XF1A 2NSMA 1XMBA 4MCQA 5CPAA 3SJXA 7CPAA 1VHEA 2JBKA 4A37A 1TXRA 4F9VA 4UEFA 2PJ9A 2PJ3A 4A38A 1F57A 2PJ1A 4EFDA 3FMCA 3CPAA 4NGSA 3GUXA 3PFOA 4ZYQA 1TF9A 4FUUA 5D8NA 1BLLE 3H8GA 1AMPA 2PJ7A 4DUKA 2ZEGA 1VIXA 4OC3A 4H2KA 3T8WA 4MHYA 2Q4ZA 1YMEA 4MRIA 1NSAA 2IQ6A 4EMEA 3PB8X 2PJ6A 3PB6X 2AFMA 4TNUA 4MHPA 2PJ2A 4UIAA 2XEJA 3VARA 1LOKA 2ZEDA 4W9YA 1Z2LA 3VATA 2ZOFA 3QNVA 1Z5RA 2CTBA 3ISXA 3D7DA 1KWMA 2O4HA 3PB9X 5THWA 3NH8A 2C6GA 2AFUA 4NGMA 4P6YA 2PJBA 4MHZA 4OMEA 3SI0A 2C6PA 4PXDA 1ELMP 1YLOA 3MN8A 1YW4A 1HEEA 4Q7AA 5HVFA 2XEFA 2DEAA 5LYLA 1XRYA 2HB6A 3PFEA 2PIYA 1CP6A 4C8AA 2XEIA 4PXCA 3I74A 1WVMA 4R7MA 2C1CA 2IMOA 3CDXA 1QQ9A 5JH9A 3KL9A 4ZY0A 5LYDA 4C8FA 3SJFA 5ELYA 4C9UA 3KASA 2RB7A 5IB9A 2QVPA 2PJ4A 3VH9A 4UEEA 4P10A 4C9EA 1R43A 4PXBA 4R6TA 4EWTA 2OOTA 3FF3A 2HC9A 1JQGA 3S9LA 2ZELA 4Z65A 1CG2A 3K2KA 3WC5A 2QJ8A 4NFRA 4CDJA 4C8PA 3B3CA 1GYTA 3K9TA 3S9MA 4C8CA 4MHNA 4OC5A 1RTQA 4GM5A 3KR4A 2OR4A 2PJ5A 3BI1A 3PBBA 4MCSA 4YU9A 1OBRA 5DS0A 2CIJA 3DLJA 3FX6A 3KI9A 1ELLP 1Y9ZA 3B7IA 1UWYA 1BAVA 2EK9A 3FECA 3B3TA 2V8DA 1Z8LA 5K8NA 3D7FA 4AXVA 2VL1A 3CPXA 4PQAA 3B3VA 4ZX9A 3TX8A 4PPZA 3BHXA 4P4EA 3VTAA 4BD9A 2C6CA 3IC1A 3I1UA 4P4IA 3WC7A 4F8ZA 4P45A 1TKJA 3KHZA 3IWWA 1TF8A 3NA6A 4TWEA 2AFWA 4IAVA 2IJZA 3FH4A 2F7VA 4NGNA 3LMSA 3KGQA 4OC4A 2ZEMA 4PXEA 4CPAA 2WZNA 3B35A 2ZEEA 8CPAA 2BO9A 2CF4A 3V7ZA 3SJEA 2PRQA 3DGVA 3LWUA 4A39A 3SJGA 2ZOGA 4A94A 2V8VA 1LAPA 1XJOA 5LYFA 2PJAA 2GU2A 4OP4A 2V8GA 3N5FA 2AFOA 2PJ0A 3FJUA 3BXMA 4MMOA 1F2PA 3ISZA 1HDUA
chains in the Genus database with same CATH superfamily
4A95A 2OH1A 2B5GB 2GLJA 3KQXA 4KORA 4WJBA 4LUAA 2EZCA 4F9UA 2DXQA 4MJ8A 2CNMA 4E8OA 4ZI6A 1QMUA 2XPOA 1CBXA 2D4PA 3JUWA 3PB4X 2AUMA 5FD8A 3B8GA 1LANA 4Y49B 2WSAA 5JYBA 1Q5XA 5K99A 2B0AA 2FXFA 4KUBA 4AG7A 1R57A 1RO5A 4DYOA 5HMNA 1A2ZA 5AG5A 2D0OA 4B12A 3FXTA 4CYOA 3TLZA 3RAMA 2PVWA 3S9NA 3DDDA 3RZAA 2WPXA 4UBRA 2PRBA 4A33A 3F9KC 3EC4A 3SXNA 2NYQA 4GPLB 3FEDA 1DTDA 5DWNA 2PQ8A 2F8HA 4BINA 3H5ZA 2D0PA 1CX8A 3I3GA 3NH5A 4C99A 4GS4A 3S6FA 4FAIA 4KLWA 3D7HA 4CRZB 2DPTA 1BO4A 4U5YA 3FYNA 4KOYA 3WT4A 4LQ6A 1CE8B 3LD2A 3F5BA 3D2PA 2P6EA 3WABA 4NGQA 3R95A 3KRVA 4UCNA 4YWYA 4E5SA 4NJQA 3OB2B 5LYIA 2J9AA 1DE4C 3CXPA 4JYWA 3KQZA 1XE4A 2ZEFA 4H89A 4MY0A 3JTKA 3NFZA 4C7HA 1ARMA 2AFZA 4R8FA 4DJLA 4IK2A 1UFHA 2G9DA 4XNHC 1Q7LA 4U9ZA 2EO8A 3PEIA 4C8TA 2ZPAA 1WJTA 4OIDA 4XPDB 2OLSA 3BUWB 2X7BA 1XEBA 2V8HA 3DR6A 4B6ZA 1V6CA 4NGRA 2I00A 2R98A 4B13A 3S6KA 1BPNA 2VEZA 4YFJA 5BY0A 1H8LA 1FT7A 1CPXA 2NMTA 4C86A 3FEEA 1LCPA 4OC1A 4FD6A 3KHXA 3P2FA 4RN7A 5EBVA 4KOUA 3TYXA 3D66A 2BSWA 4UF4A 4UEZA 1ZG7A 3RO0A 3PRTA 4X3RA 1SQHA 2ANPA 3GY9A 3IIBA 4MFQA 4CS0B 2E28A 5F13A 2FVGA 3GLJA 2DIKA 1IU8A 4TJVA 1IICA 2ZW7A 4UWIA 4ZX8A 3BJ8A 1Y7EA 4E0AA 4IHMA 4LQGA 2CNSA 2PVVA 3D68A 1QSOA 2Z3LA 2B4JC 3KZWA 5HVGA 3FVLA 4JXRA 1TKHA 1IGBA 1NMTA 2B3UA 3G3SA 4RUHA 2GREA 1ZG9A 4AVAA 1M4LA 4NJRA 1YSJA 1FY7A 2OB0A 4UCPA 2ABZA 4AG9A 4CRYB 1Y0RA 2PCNA 2BUEA 3CZXA 1FNOA 4ZGYB 2HWGA 1P4NA 2ZEPA 4C84A 4M85A 2ARHA 4X8IA 4F0YA 2I3CA 3KKWA 2GE3A 1NXJA 5A27A 4GXHA 3R1KA 4G1PA 4CAXA 4P4FA 4L89A 1YLEA 4C68A 4KNGE 5DWMA 4CAEA 3CXQA 4C7IA 1KEEB 4DNCA 4FBEA 4K3NA 2ZENA 2BL1A 4U9YA 2XPPA 4KVXA 4OC0A 2H5MA 1YX0A 2Z3OA 4P4JA 5F09A 3SI2A 2B4DB 3IWGA 1Z9EA 3V38A 1CP7A 3E0KA 4UIBA 4H6ZA 4C2ZA 4C9AA 4UFVA 4OADA 2P6FA 2AFXA 3IU1A 4F0XA 3TLAA 3TFYA 4O23A 4OKOA 3VGOA 3ZJ0A 1BXRB 4CGMA 5I4MA 2B58A 2CTCA 1RXTA 3RBUA 1M6VB 3VRRA 1VHOA 2JDCA 1BOBA 3A9LA 3U88C 2BCOA 3BI0A 3NFQA 3OB1B 3WR7A 4II9A 5AGEA 3JRUA 2Q43A 4NSQA 1J3LA 3EZEA 1S60A 3IEHA 5K8PA 2FM4A 4NCZA 2PJ8A 2EVNA 5IR2A 1HDQA 1ZLIA 3RNZA 5BWAB 3D7GA 3TC8A 1BPMA 4OC2A 1XMTA 3H8FA 3IFEA 4Q38A 4BBHA 1LAMA 3GJZA 4MFKA 2R82A 2UV8G 1YW6A 1KBLA 3T05A 3TLGB 1Z4RA 4PK2A 1S5KA 2YGWA 1YGHA 3TCVA 4C9VA 2A4NA 1NE9A 4JLYA 3VRQA 1JWQA 1TKFA 4RS2A 3SI1A 3ICUA 1I21A 1XBUA 3VRNA 2YNDA 2B3VA 2VQYA 1ZG8A 1Y7RA 1S7LA 2OZUA 3PGPA 2WYRA 3IWEA 4ONWA 4ZY2A 3QAHA 5HVHA 1GGOA 4RI1A 4QBJA 3B3WA 1WWZA 2Q7SA 3GYAA 3I9SA 2V77A 4MFJA 4AVBA 5JM6A 4CAWA 1EZAA 4YN3A 3QB8A 4OIWA 5G1ZA 3PBEA 4MFZA 4X2TA 3EO4A 4XPKA 3V8IA 1PUAA 3GKRA 3EIFA 1F2OA 1J4JA 2FSRA 2REEA 4MCRA 3B3SA 1VGYA 2ZW6A 2Q4YA 5F1YA 1AYEA 1EE3P 3NE7A 2I79A 3S6GA 2XPLA 3PP9A 5CNPA 5K8MA 3D4UA 2YJTA 1PCAA 4TJXA 2B4BA 2O28A 5J1QA 2PCUA 4FD7A 3EZBA 2Z11A 5C82A 3PT1A 2ZEHA 4INJA 1KC7A 2Z3PA 4P4BA 1Z8WA 2PIZA 3EY5A 4Q36A 1ARLA 1M4GA 4MI1A 1ZLHA 4NGPA 4CYPA 3H8EA 1PU9A 2PJCA 4KOVA 3NH4A 5IB0A 1YR0A 1VKCA 4B5PA 3D67A 3CT9A 3MGDA 3WC6A 2JBJA 4ZY1A 4JZ0A 6CPAA 2AFSA 3ZZIA 5J8FA 2JEWA 1XOVA 2POKA 4KVOE 3D8PA 1U6MA 1YVOA 4WWVA 2XEGA 1XFOA 1Y0YA 4R76A 1PYTB 1JDBC 2BOAA 2Q51A 3HUVA 4KSAA 2C27A 4FD5A 4R9MA 1QSTA 5LRJA 3TT2A 4C8UA 5G20A 3B2YA 4MCPA 5CBMA 2GLFA 4MJXA 4P44A 2G3AA 3BLNA 2QECA 3GB0A 4COGA 4ORFA 4JVOA 1S3ZA 3BUNB 2QYVA 1LFWA 3MRUA 3PB7X 3R9EA 5F9MA 1IY7A 4A2ZA 4CDKA 5LRGA 4A31A 3TLYA 1IOFA 3I6SA 2P6GA 4UFWA 4C9RA 1KZFA 4P4DA 1Q2CA 2O53A 3HLPA 3KR5A 3IJ3A 1YK3A 4QVTA 1CPSA 4A32A 5D29A 4MXUA 3G23A 2WPWA 3OWCA 5IX3A 1XF8A 4M6IA 4JWPA 4A4BA 4C85A 4A30A 1R3NA 5HXDA 3DNSA 4FD4A 5JGFA 1VBGA 3TLEA 4NGTA 2AJ6A 5KTDA 2EK8A 3IO1A 3L2NA 5K8OA 2FL4A 1MJAA 4KSIA 2ZEOA 2EWBA 4HNYB 1C3OB 2DF5A 2VZYA 2PE3A 1QSRA 4K30A 5KTAA 3N7ZA 4FWUA 1Q2DA 2RFHA 5LRKA 3R9FA 5J8CA 3VWDA 1XF1A 2NSMA 1XMBA 5H86A 2Z3MA 4MCQA 5CPAA 2Y1NA 1VHSA 3SJXA 7CPAA 1VHEA 2JBKA 1YREA 4YGOA 4A37A 1TXRA 3O8ZA 4F9VA 4HPSA 4UEFA 2Y1MA 2PJ9A 2PJ3A 5HKYA 4A38A 1F57A 4R3LA 2PJ1A 4EFDA 3DR8A 4BPXB 3FMCA 4F6AA 2EBJA 3CPAA 4OLLA 4NGSA 1L0CA 2R1IA 3EZAA 3T07A 4BTFA 3GUXA 3PFOA 3FB3A 1M44A 1M4IA 4ZYQA 4J0NA 1TF9A 4FUUA 4HNXB 5D8NA 4AVCA 2OZGA 1BLLE 2CBLA 3H8GA 2VXKA 4MHDA 1AMPA 2Z0ZA 5AG4A 3W6SA 4CAVA 2PJ7A 2HROA 4C2YA 1MJBA 2Q04A 2Z3KA 4DUKA 3C26A 3T90A 2ZEGA 3SXOA 1EO0A 1VIXA 4OC3A 2CY2A 4H2KA 3LODA 3T8WA 3BUOB 2ATRA 2Q4ZA 1YMEA 4MHYA 4MRIA 1NSAA 2IQ6A 1Z8TA 1K4JA 3PB8X 5AG6A 4KUAA 1X10A 2PJ6A 1N71A 4EMEA 3D2MA 3PB6X 3PLFB 2AFMA 4R87A 4CYNA 4TNUA 2VZZA 1MK4A 4MHPA 4EVYA 2PJ2A 4UIAA 2XEJA 3VARA 1LOKA 2ZEDA 4W9YA 4PV6A 3T0TA 1Z2LA 2GANA 3VATA 2FIAA 3LACA 2OU2A 2HV2A 3HPGG 2ZOFA 4J3GA 3SHPA 3QNVA 5JVLA 1T36B 1Z5RA 2CTBA 3ISXA 3D7DA 1KWMA 2O4HA 3F8KA 3PB9X 4IF5A 4UWJA 5THWA 3EXNA 3PFVA 4XPLA 2DPSA 2J8RA 4UFXA 3PZJA 3NH8A 2VI7A 2AE6A 4B5PB 5F5XA 3W6XA 2C6GA 1ON0A 2AFUA 4NGMA 4UA3A 4P6YA 3TOBA 4CGLA 3W91A 4CGPA 2XPNA 4CZ1A 2GP4A 1IYLA 2PJBA 4MHZA 4OMEA 2ODFA 3TO9A 4C2XA 3TO6A 3SI0A 2C6PA 1VI4A 4PXDA 4AB7A 4BMHA 2KCWA 1CJWA 1ELMP 2R8VA 3IU2A 1YLOA 3K4IA 2Q44A 4A4CA 2BEIA 2QIRA 4X5KA 5F47A 4KOWA 3MN8A 1YW4A 4MFLA 3T9YA 1I12A 5IV0A 5JPHA 3FRMA 1LRZA 1HEEA 2QMLA 4Q7AA 2EUIA 2XEFA 2IL4A 2J8MA 2Z3NA 1S7FA 5HVFA 3K9UA 4CGOA 1M4DA 2DEAA 2G0BA 5FVJA 1B87A 4B5OA 5LYLA 1XRYA 2HB6A 5KTCA 3PFEA 4I49A 4KS9A 1S7KA 2PIYA 2MP0A 2VBQA 4PSXA 3FIXA 2Q7BA 2Q4VA 2B4DA 1CP6A 2FE7A 3C8OA 4L8AA 4C8AA 2XEIA 2DLAA 4PXCA 1V0CA 3I74A 1WVMA 1Z9UA 4R7MA 5EMIA 4KOXA 2C1CA 4M6GA 2CNTA 1MJ9A 5ISVA 2IMOA 3JVNA 3CDXA 1QQ9A 4QC6A 2ZW5A 5F48A 5JH9A 4QB9A 4COBA 3KL9A 4ZY0A 4KSFA 5LYDA 4C8FA 3SJFA 5ELYA 3EFAA 1NSLA 4MBUA 4Y49C 4M8DA 4NF1A 5F49A 3P2HA 3KASA 1B47A 2RB7A 3VWEA 5IB9A 4XNHB 4C9UA 2QVPA 2PJ4A 3R96A 3VH9A 2HI6A 3QAYA 1KUYA 4MFPA 4MI4A 4UEEA 4RR2B 2J8NA 4P10A 4C9EA 3VROA 1R43A 4PK3A 2ZW4A 4PXBA 4R6TA 4EWTA 2OOTA 3TLGA 3FF3A 2RC4A 4CYQA 2HC9A 5H84A 1JQGA 2ZXVA 4KVME 3S9LA 5F46A 4EYSA 2ZELA 4NEXA 5HKZA 4Z65A 1CG2A 1IIDA 3K2KA 5HH1A 5AXIA 3WC5A 2QJ8A 4NFRA 4B11A 4CDJA 4C8PA 2F5IA 3B3CA 1GYTA 2GFQA 3TOAA 1Z8XA 2B5GA 3NE8A 3K9TA 4M6HA 2C5QA 5E96A 3TLBA 4R3KA 2K5TA 4ZBGA 2FCKA 3F0AA 3S9MA 4C8CA 4JXQA 4MHNA 4JJXA 2JDDA 2X0SA 3TO7A 4OC5A 2PR1A 1RTQA 4GM5A 3KR4A 2OR4A 2PJ5A 3BI1A 4KOTA 1ZL0A 1WK4A 5G21A 4BPUB 1IYKA 3PBBA 1B6BA 2G3TA 3IGRA 4XPDC 4CGNA 5I0CA 4IIXA 4MCSA 1TIQA 1OBRA 4R57A 1Z4EA 4YU9A 1VBHA 4JD6A 5DS0A 4HKFA 1DIKA 2CIJA 4M3SA 1NBWA 3CXSA 3BUXB 1ZRSA 2FS5A 3DLJA 3HPHE 3FX6A 1R61A 3KI9A 2Y0MA 3S6HA 2REFA 3FNCA 1ELLP 4IIYA 4QUSA 1IB1E 1A9XB 1Y9ZA 3B7IA 3UY5A 3R9GA 4BPWB 4NXYA 1CM0A 2HUZA 1UWYA 4CAFA 1BAVA 1P0HA 4YRHA 2EK9A 3FECA 3B3TA 5AG7A 3T5MA 5C88A 2V8DA 3G8WA 1KUXA 1Z8LA 5K8NA 5JQ4A 3D7FA 4AXVA 3TE4A 3OAKA 2VL1A 3CPXA 4PQAA 3TTHA 1KUVA 3B3VA 1YVKA 4ZX9A 3TX8A 1I1DA 4PPZA 3BHXA 4P4EA 3VTAA 4OAEA 2AUNA 4BD9A 2PDOA 2R7HA 2C6CA 5J3XA 5GCNA 1Q2YA 3IC1A 3I1UA 4P4IA 4MY3A 3WC7A 1OZPA 4F8ZA 4P45A 1TKJA 1X12A 2JEVA 3KHZA 3IWWA 2N3AB 1TF8A 3NA6A 4TWEA 4E94A 2P0WA 3DSBA 1S7NA 2AFWA 4B14A 4IAVA 1YVHA 2WUUA 3NOJA 2IJZA 4CO9A 4E2AA 2PC1A 3FH4A 2FIWA 3ZNIA 4LX9A 2PR8A 2F7VA 4NGNA 2Q0YA 2YNCC 1EZBA 4KZTA 3LMSA 5HKWA 1YQEA 2EZAA 1QSMA 4UCMA 4PSWA 5EC4A 3KGQA 2YNEA 4OC4A 2ZEMA 4PXEA 1Y9WA 2PSWA 1XIXA 2WZNA 2Z10A 1IOIA 4B10A 4CPAA 3TLCA 3RYOA 3D3SA 2FT0A 2JLMA 1M1DA 1C30B 3B35A 1AUGA 2ZEEA 3VRPA 2HQYA 2BO9A 2CF4A 3V7ZA 8CPAA 3SJEA 3HMJG 3SR3A 2PRQA 4H6UA 4ONUA 1FBVA 1ZO0A 2GIVA 4H1HA 4KOSA 3DGVA 1GHEA 3LWUA 4A39A 3FBUA 1JDEA 3SJGA 1QSNA 2ZOGA 4A94A 3OP0A 2V8VA 2EZBA 1LAPA 1XJOA 5LYFA 3BUMB 2PJAA 2GU2A 1CS0B 3U1BA 4OP4A 4KLVA 1Y9KA 2YNCA 2CXAA 2V8GA 5A28A 2OZHA 4HNWB 3N5FA 2AFOA 3H4QA 3GIUA 1ZYMA 2PJ0A 4IUSA 3BJ7A 3FJUA 2VKZG 5G22A 3BXMA 2YJVA 4MMOA 1F2PA 3ISZA 2D4OA 1HDUA
chains in the Genus database with same CATH topology
2GLJA 3KQXA 4WJBA 4F9UA 4ZI6A 1QMUA 1CBXA 3PB4X 1LANA 4DYOA 3RAMA 2PVWA 3S9NA 3RZAA 2NYQA 3FEDA 1DTDA 2F8HA 1CX8A 4C99A 3NH5A 4FAIA 3D7HA 3WT4A 3WABA 4NGQA 4YWYA 4NJQA 5LYIA 2J9AA 1DE4C 4JYWA 3KQZA 2ZEFA 3NFZA 4DJLA 1ARMA 2AFZA 4R8FA 4IK2A 2G9DA 1Q7LA 3PEIA 4C8TA 4OIDA 2V8HA 4B6ZA 1V6CA 4NGRA 1BPNA 1H8LA 1FT7A 1CPXA 4C86A 3FEEA 1LCPA 4OC1A 3KHXA 3D66A 4UF4A 4UEZA 1ZG7A 3PRTA 4X3RA 2ANPA 3IIBA 2FVGA 3GLJA 4TJVA 4ZX8A 1Y7EA 4IHMA 4LQGA 2PVVA 3D68A 3KZWA 5HVGA 3FVLA 1TKHA 1IGBA 4RUHA 2GREA 1ZG9A 1M4LA 4NJRA 1YSJA 2ABZA 1Y0RA 1FNOA 2ZEPA 4C84A 4X8IA 2I3CA 4G1PA 4P4FA 4KNGE 4FBEA 4K3NA 2ZENA 4OC0A 4P4JA 5F09A 3SI2A 3V38A 1CP7A 4UIBA 4C9AA 2AFXA 4O23A 4OKOA 5I4MA 2CTCA 3RBUA 1VHOA 2BCOA 3BI0A 3JRUA 2Q43A 3IEHA 5K8PA 2PJ8A 5IR2A 1HDQA 1ZLIA 3D7GA 3TC8A 1BPMA 4OC2A 3H8FA 3IFEA 1LAMA 1YW6A 4C9VA 1TKFA 3SI1A 3ICUA 1XBUA 1ZG8A 5HVHA 2WYRA 4ZY2A 4ONWA 3B3WA 4YN3A 2V77A 5JM6A 4OIWA 3PBEA 4X2TA 3EIFA 1F2OA 4MCRA 3B3SA 1VGYA 1AYEA 1EE3P 5K8MA 3D4UA 1PCAA 4TJXA 5J1QA 2PCUA 2ZEHA 4P4BA 2PIZA 1ARLA 1ZLHA 4NGPA 3H8EA 2PJCA 3NH4A 3D67A 3CT9A 3WC6A 2JBJA 4ZY1A 4JZ0A 6CPAA 2AFSA 2JEWA 2POKA 4WWVA 2XEGA 1XFOA 1Y0YA 4R76A 1PYTB 2BOAA 2Q51A 3HUVA 4C8UA 5LRJA 3B2YA 4MCPA 5CBMA 2GLFA 4P44A 3GB0A 2QYVA 3MRUA 1LFWA 3PB7X 1IY7A 4CDKA 5LRGA 3I6SA 4C9RA 4P4DA 2O53A 3HLPA 3KR5A 3IJ3A 1CPSA 5D29A 4MXUA 4C85A 5HXDA 1R3NA 5JGFA 4NGTA 2EK8A 3IO1A 3L2NA 5K8OA 4KSIA 2ZEOA 2EWBA 2PE3A 4FWUA 2RFHA 5LRKA 1XF1A 2NSMA 1XMBA 4MCQA 5CPAA 3SJXA 7CPAA 1VHEA 2JBKA 4A37A 1TXRA 4F9VA 4UEFA 2PJ9A 2PJ3A 4A38A 1F57A 2PJ1A 4EFDA 3FMCA 3CPAA 4NGSA 3GUXA 3PFOA 4ZYQA 1TF9A 4FUUA 5D8NA 1BLLE 3H8GA 1AMPA 2PJ7A 4DUKA 2ZEGA 1VIXA 4OC3A 4H2KA 3T8WA 4MHYA 2Q4ZA 1YMEA 4MRIA 1NSAA 2IQ6A 4EMEA 3PB8X 2PJ6A 3PB6X 2AFMA 4TNUA 4MHPA 2PJ2A 4UIAA 2XEJA 3VARA 1LOKA 2ZEDA 4W9YA 1Z2LA 3VATA 2ZOFA 3QNVA 1Z5RA 2CTBA 3ISXA 3D7DA 1KWMA 2O4HA 3PB9X 5THWA 3NH8A 2C6GA 2AFUA 4NGMA 4P6YA 2GP4A 2PJBA 4MHZA 4OMEA 3SI0A 2C6PA 4PXDA 1ELMP 1YLOA 3MN8A 1YW4A 1HEEA 4Q7AA 5HVFA 2XEFA 2DEAA 5LYLA 1XRYA 2HB6A 3PFEA 2PIYA 1CP6A 4C8AA 2XEIA 4PXCA 3I74A 1WVMA 4R7MA 2C1CA 2IMOA 3CDXA 1QQ9A 5JH9A 3KL9A 4ZY0A 5LYDA 4C8FA 3SJFA 5ELYA 4C9UA 3KASA 2RB7A 5IB9A 2QVPA 2PJ4A 3VH9A 4UEEA 4P10A 4C9EA 1R43A 4PXBA 4R6TA 4EWTA 2OOTA 3FF3A 2HC9A 1JQGA 3S9LA 2ZELA 4Z65A 1CG2A 3K2KA 3WC5A 2QJ8A 4NFRA 4CDJA 4C8PA 3B3CA 1GYTA 3K9TA 2C5QA 3S9MA 4C8CA 4MHNA 4OC5A 1RTQA 4GM5A 3KR4A 2OR4A 2PJ5A 3BI1A 3PBBA 4MCSA 4YU9A 1OBRA 5DS0A 2CIJA 3DLJA 3FX6A 3KI9A 1ELLP 1Y9ZA 3B7IA 1UWYA 1BAVA 2EK9A 3FECA 3B3TA 2V8DA 1Z8LA 5K8NA 3D7FA 4AXVA 2VL1A 3CPXA 4PQAA 3B3VA 4ZX9A 3TX8A 4PPZA 3BHXA 4P4EA 3VTAA 4BD9A 2C6CA 3IC1A 3I1UA 4P4IA 3WC7A 4F8ZA 4P45A 1TKJA 3KHZA 3IWWA 1TF8A 3NA6A 4TWEA 2AFWA 4IAVA 2IJZA 3FH4A 2F7VA 4NGNA 3LMSA 3KGQA 4OC4A 2ZEMA 4PXEA 4CPAA 2WZNA 3B35A 2ZEEA 8CPAA 2BO9A 2CF4A 3V7ZA 3SJEA 2PRQA 3DGVA 3LWUA 4A39A 3SJGA 2ZOGA 4A94A 2V8VA 1LAPA 1XJOA 5LYFA 2PJAA 2GU2A 4OP4A 2V8GA 3N5FA 2AFOA 2PJ0A 3FJUA 3BXMA 4MMOA 1F2PA 3ISZA 1HDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLJ A;  3KQX A;  4WJB A;  4F9U A;  4ZI6 A;  1QMU A;  1CBX A;  3PB4 X;  1LAN A;  4DYO A;  3RAM A;  2PVW A;  3S9N A;  3RZA A;  2NYQ A;  3FED A;  1DTD A;  2F8H A;  1CX8 A;  4C99 A;  3NH5 A;  4FAI A;  3D7H A;  3WT4 A;  3WAB A;  4NGQ A;  4YWY A;  4NJQ A;  5LYI A;  2J9A A;  1DE4 C;  4JYW A;  3KQZ A;  2ZEF A;  3NFZ A;  4DJL A;  1ARM A;  2AFZ A;  4R8F A;  4IK2 A;  2G9D A;  1Q7L A;  3PEI A;  4C8T A;  4OID A;  2V8H A;  4B6Z A;  1V6C A;  4NGR A;  1BPN A;  1H8L A;  1FT7 A;  1CPX A;  4C86 A;  3FEE A;  1LCP A;  4OC1 A;  3KHX A;  3D66 A;  4UF4 A;  4UEZ A;  1ZG7 A;  3PRT A;  4X3R A;  2ANP A;  3IIB A;  2FVG A;  3GLJ A;  4TJV A;  4ZX8 A;  1Y7E A;  4IHM A;  4LQG A;  2PVV A;  3D68 A;  3KZW A;  5HVG A;  3FVL A;  1TKH A;  1IGB A;  4RUH A;  2GRE A;  1ZG9 A;  1M4L A;  4NJR A;  1YSJ A;  2ABZ A;  1Y0R A;  1FNO A;  2ZEP A;  4C84 A;  4X8I A;  2I3C A;  4G1P A;  4P4F A;  4KNG E;  4FBE A;  4K3N A;  2ZEN A;  4OC0 A;  4P4J A;  5F09 A;  3SI2 A;  3V38 A;  1CP7 A;  4UIB A;  4C9A A;  2AFX A;  4O23 A;  4OKO A;  5I4M A;  2CTC A;  3RBU A;  1VHO A;  2BCO A;  3BI0 A;  3JRU A;  2Q43 A;  3IEH A;  5K8P A;  2PJ8 A;  1HDQ A;  1ZLI A;  3D7G A;  3TC8 A;  1BPM A;  4OC2 A;  3H8F A;  3IFE A;  1LAM A;  1YW6 A;  4C9V A;  1TKF A;  3SI1 A;  3ICU A;  1XBU A;  1ZG8 A;  5HVH A;  2WYR A;  4ZY2 A;  4ONW A;  3B3W A;  4YN3 A;  2V77 A;  5JM6 A;  4OIW A;  3PBE A;  4X2T A;  3EIF A;  1F2O A;  4MCR A;  3B3S A;  1VGY A;  1AYE A;  1EE3 P;  5K8M A;  3D4U A;  1PCA A;  4TJX A;  5J1Q A;  2PCU A;  2ZEH A;  4P4B A;  2PIZ A;  1ARL A;  1ZLH A;  4NGP A;  3H8E A;  2PJC A;  3NH4 A;  3D67 A;  3CT9 A;  3WC6 A;  2JBJ A;  4ZY1 A;  4JZ0 A;  6CPA A;  2AFS A;  2JEW A;  2POK A;  4WWV A;  2XEG A;  1XFO A;  1Y0Y A;  4R76 A;  1PYT B;  2BOA A;  2Q51 A;  3HUV A;  4C8U A;  5LRJ A;  3B2Y A;  4MCP A;  5CBM A;  2GLF A;  4P44 A;  3GB0 A;  2QYV A;  3MRU A;  1LFW A;  3PB7 X;  1IY7 A;  4CDK A;  5LRG A;  3I6S A;  4C9R A;  4P4D A;  2O53 A;  3HLP A;  3KR5 A;  3IJ3 A;  1CPS A;  5D29 A;  4MXU A;  4C85 A;  5HXD A;  1R3N A;  5JGF A;  4NGT A;  2EK8 A;  3IO1 A;  3L2N A;  5K8O A;  4KSI A;  2ZEO A;  2EWB A;  2PE3 A;  4FWU A;  2RFH A;  5LRK A;  1XF1 A;  2NSM A;  1XMB A;  4MCQ A;  5CPA A;  3SJX A;  7CPA A;  1VHE A;  2JBK A;  4A37 A;  1TXR A;  4F9V A;  4UEF A;  2PJ9 A;  2PJ3 A;  4A38 A;  1F57 A;  2PJ1 A;  4EFD A;  3FMC A;  3CPA A;  4NGS A;  3GUX A;  3PFO A;  4ZYQ A;  1TF9 A;  4FUU A;  5D8N A;  1BLL E;  3H8G A;  1AMP A;  2PJ7 A;  4DUK A;  2ZEG A;  1VIX A;  4OC3 A;  4H2K A;  3T8W A;  4MHY A;  2Q4Z A;  1YME A;  4MRI A;  1NSA A;  2IQ6 A;  4EME A;  3PB8 X;  2PJ6 A;  3PB6 X;  2AFM A;  4TNU A;  4MHP A;  2PJ2 A;  4UIA A;  2XEJ A;  3VAR A;  1LOK A;  2ZED A;  4W9Y A;  1Z2L A;  3VAT A;  2ZOF A;  3QNV A;  1Z5R A;  2CTB A;  3ISX A;  3D7D A;  1KWM A;  2O4H A;  3PB9 X;  5THW A;  3NH8 A;  2C6G A;  2AFU A;  4NGM A;  4P6Y A;  2PJB A;  4MHZ A;  4OME A;  3SI0 A;  2C6P A;  4PXD A;  1ELM P;  1YLO A;  3MN8 A;  1YW4 A;  1HEE A;  4Q7A A;  5HVF A;  2XEF A;  2DEA A;  5LYL A;  1XRY A;  2HB6 A;  3PFE A;  2PIY A;  1CP6 A;  4C8A A;  2XEI A;  4PXC A;  3I74 A;  1WVM A;  4R7M A;  2C1C A;  2IMO A;  3CDX A;  1QQ9 A;  5JH9 A;  3KL9 A;  4ZY0 A;  5LYD A;  4C8F A;  3SJF A;  5ELY A;  4C9U A;  3KAS A;  2RB7 A;  5IB9 A;  2QVP A;  2PJ4 A;  3VH9 A;  4UEE A;  4P10 A;  4C9E A;  1R43 A;  4PXB A;  4R6T A;  4EWT A;  2OOT A;  3FF3 A;  2HC9 A;  1JQG A;  3S9L A;  2ZEL A;  4Z65 A;  1CG2 A;  3K2K A;  3WC5 A;  2QJ8 A;  4NFR A;  4CDJ A;  4C8P A;  3B3C A;  1GYT A;  3K9T A;  3S9M A;  4C8C A;  4MHN A;  4OC5 A;  1RTQ A;  4GM5 A;  3KR4 A;  2OR4 A;  2PJ5 A;  3BI1 A;  3PBB A;  4MCS A;  4YU9 A;  1OBR A;  5DS0 A;  2CIJ A;  3DLJ A;  3FX6 A;  3KI9 A;  1ELL P;  1Y9Z A;  3B7I A;  1UWY A;  1BAV A;  2EK9 A;  3FEC A;  3B3T A;  2V8D A;  1Z8L A;  5K8N A;  3D7F A;  4AXV A;  2VL1 A;  3CPX A;  4PQA A;  3B3V A;  4ZX9 A;  3TX8 A;  4PPZ A;  3BHX A;  4P4E A;  3VTA A;  4BD9 A;  2C6C A;  3IC1 A;  3I1U A;  4P4I A;  3WC7 A;  4F8Z A;  4P45 A;  1TKJ A;  3KHZ A;  3IWW A;  1TF8 A;  3NA6 A;  4TWE A;  2AFW A;  4IAV A;  2IJZ A;  3FH4 A;  2F7V A;  4NGN A;  3LMS A;  3KGQ A;  4OC4 A;  2ZEM A;  4PXE A;  4CPA A;  2WZN A;  3B35 A;  2ZEE A;  8CPA A;  2BO9 A;  2CF4 A;  3V7Z A;  3SJE A;  2PRQ A;  3DGV A;  3LWU A;  4A39 A;  3SJG A;  2ZOG A;  4A94 A;  2V8V A;  1LAP A;  1XJO A;  5LYF A;  2PJA A;  2GU2 A;  4OP4 A;  2V8G A;  3N5F A;  2AFO A;  2PJ0 A;  3FJU A;  3BXM A;  4MMO A;  1F2P A;  3ISZ A;  1HDU A; 
#chains in the Genus database with same CATH topology
 4A95 A;  2OH1 A;  2B5G B;  2GLJ A;  3KQX A;  4KOR A;  4WJB A;  4LUA A;  2EZC A;  4F9U A;  2DXQ A;  4MJ8 A;  2CNM A;  4E8O A;  4ZI6 A;  1QMU A;  2XPO A;  1CBX A;  2D4P A;  3JUW A;  3PB4 X;  2AUM A;  5FD8 A;  3B8G A;  1LAN A;  4Y49 B;  2WSA A;  5JYB A;  1Q5X A;  5K99 A;  2B0A A;  2FXF A;  4KUB A;  4AG7 A;  1R57 A;  1RO5 A;  4DYO A;  5HMN A;  1A2Z A;  5AG5 A;  2D0O A;  4B12 A;  3FXT A;  4CYO A;  3TLZ A;  3RAM A;  2PVW A;  3S9N A;  3DDD A;  3RZA A;  2WPX A;  4UBR A;  2PRB A;  4A33 A;  3F9K C;  3EC4 A;  3SXN A;  2NYQ A;  4GPL B;  3FED A;  1DTD A;  5DWN A;  2PQ8 A;  2F8H A;  4BIN A;  3H5Z A;  2D0P A;  1CX8 A;  3I3G A;  3NH5 A;  4C99 A;  4GS4 A;  3S6F A;  4FAI A;  4KLW A;  3D7H A;  4CRZ B;  2DPT A;  1BO4 A;  4U5Y A;  3FYN A;  4KOY A;  3WT4 A;  4LQ6 A;  1CE8 B;  3LD2 A;  3F5B A;  3D2P A;  2P6E A;  3WAB A;  4NGQ A;  3R95 A;  3KRV A;  4UCN A;  4YWY A;  4E5S A;  4NJQ A;  3OB2 B;  5LYI A;  2J9A A;  1DE4 C;  3CXP A;  4JYW A;  3KQZ A;  1XE4 A;  2ZEF A;  4H89 A;  4MY0 A;  3JTK A;  3NFZ A;  4C7H A;  1ARM A;  2AFZ A;  4R8F A;  4DJL A;  4IK2 A;  1UFH A;  2G9D A;  4XNH C;  1Q7L A;  4U9Z A;  2EO8 A;  3PEI A;  4C8T A;  2ZPA A;  1WJT A;  4OID A;  4XPD B;  2OLS A;  3BUW B;  2X7B A;  1XEB A;  2V8H A;  3DR6 A;  4B6Z A;  1V6C A;  4NGR A;  2I00 A;  2R98 A;  4B13 A;  3S6K A;  1BPN A;  2VEZ A;  4YFJ A;  5BY0 A;  1H8L A;  1FT7 A;  1CPX A;  2NMT A;  4C86 A;  3FEE A;  1LCP A;  4OC1 A;  4FD6 A;  3KHX A;  3P2F A;  4RN7 A;  5EBV A;  4KOU A;  3TYX A;  3D66 A;  2BSW A;  4UF4 A;  4UEZ A;  1ZG7 A;  3RO0 A;  3PRT A;  4X3R A;  1SQH A;  2ANP A;  3GY9 A;  3IIB A;  4MFQ A;  4CS0 B;  2E28 A;  5F13 A;  2FVG A;  3GLJ A;  2DIK A;  1IU8 A;  4TJV A;  1IIC A;  2ZW7 A;  4UWI A;  4ZX8 A;  3BJ8 A;  1Y7E A;  4E0A A;  4IHM A;  4LQG A;  2CNS A;  2PVV A;  3D68 A;  1QSO A;  2Z3L A;  2B4J C;  3KZW A;  5HVG A;  3FVL A;  4JXR A;  1TKH A;  1IGB A;  1NMT A;  2B3U A;  3G3S A;  4RUH A;  2GRE A;  1ZG9 A;  4AVA A;  1M4L A;  4NJR A;  1YSJ A;  1FY7 A;  2OB0 A;  4UCP A;  2ABZ A;  4AG9 A;  4CRY B;  1Y0R A;  2PCN A;  2BUE A;  3CZX A;  1FNO A;  4ZGY B;  2HWG A;  1P4N A;  2ZEP A;  4C84 A;  4M85 A;  2ARH A;  4X8I A;  4F0Y A;  2I3C A;  3KKW A;  2GE3 A;  1NXJ A;  5A27 A;  4GXH A;  3R1K A;  4G1P A;  4CAX A;  4P4F A;  4L89 A;  1YLE A;  4C68 A;  4KNG E;  5DWM A;  4CAE A;  3CXQ A;  4C7I A;  1KEE B;  4DNC A;  4FBE A;  4K3N A;  2ZEN A;  2BL1 A;  4U9Y A;  2XPP A;  4KVX A;  4OC0 A;  2H5M A;  1YX0 A;  2Z3O A;  4P4J A;  5F09 A;  3SI2 A;  2B4D B;  3IWG A;  1Z9E A;  3V38 A;  1CP7 A;  3E0K A;  4UIB A;  4H6Z A;  4C2Z A;  4C9A A;  4UFV A;  4OAD A;  2P6F A;  2AFX A;  3IU1 A;  4F0X A;  3TLA A;  3TFY A;  4O23 A;  4OKO A;  3VGO A;  3ZJ0 A;  1BXR B;  4CGM A;  5I4M A;  2B58 A;  2CTC A;  1RXT A;  3RBU A;  1M6V B;  3VRR A;  1VHO A;  2JDC A;  1BOB A;  3A9L A;  3U88 C;  2BCO A;  3BI0 A;  3NFQ A;  3OB1 B;  3WR7 A;  4II9 A;  5AGE A;  3JRU A;  2Q43 A;  4NSQ A;  1J3L A;  3EZE A;  1S60 A;  3IEH A;  5K8P A;  2FM4 A;  4NCZ A;  2PJ8 A;  2EVN A;  5IR2 A;  1HDQ A;  1ZLI A;  3RNZ A;  5BWA B;  3D7G A;  3TC8 A;  1BPM A;  4OC2 A;  1XMT A;  3H8F A;  3IFE A;  4Q38 A;  4BBH A;  1LAM A;  3GJZ A;  4MFK A;  2R82 A;  2UV8 G;  1YW6 A;  1KBL A;  3T05 A;  3TLG B;  1Z4R A;  4PK2 A;  1S5K A;  2YGW A;  1YGH A;  3TCV A;  4C9V A;  2A4N A;  1NE9 A;  4JLY A;  3VRQ A;  1JWQ A;  1TKF A;  4RS2 A;  3SI1 A;  3ICU A;  1I21 A;  1XBU A;  3VRN A;  2YND A;  2B3V A;  2VQY A;  1ZG8 A;  1Y7R A;  1S7L A;  2OZU A;  3PGP A;  2WYR A;  3IWE A;  4ONW A;  4ZY2 A;  3QAH A;  5HVH A;  1GGO A;  4RI1 A;  4QBJ A;  3B3W A;  1WWZ A;  2Q7S A;  3GYA A;  3I9S A;  2V77 A;  4MFJ A;  4AVB A;  5JM6 A;  4CAW A;  1EZA A;  4YN3 A;  3QB8 A;  4OIW A;  5G1Z A;  3PBE A;  4MFZ A;  4X2T A;  3EO4 A;  4XPK A;  3V8I A;  1PUA A;  3GKR A;  3EIF A;  1F2O A;  1J4J A;  2FSR A;  2REE A;  4MCR A;  3B3S A;  1VGY A;  2ZW6 A;  2Q4Y A;  5F1Y A;  1AYE A;  1EE3 P;  3NE7 A;  2I79 A;  3S6G A;  2XPL A;  3PP9 A;  5CNP A;  5K8M A;  3D4U A;  2YJT A;  1PCA A;  4TJX A;  2B4B A;  2O28 A;  5J1Q A;  2PCU A;  4FD7 A;  3EZB A;  2Z11 A;  5C82 A;  3PT1 A;  2ZEH A;  4INJ A;  1KC7 A;  2Z3P A;  4P4B A;  1Z8W A;  2PIZ A;  3EY5 A;  4Q36 A;  1ARL A;  1M4G A;  4MI1 A;  1ZLH A;  4NGP A;  4CYP A;  3H8E A;  1PU9 A;  2PJC A;  4KOV A;  3NH4 A;  5IB0 A;  1YR0 A;  1VKC A;  4B5P A;  3D67 A;  3CT9 A;  3MGD A;  3WC6 A;  2JBJ A;  4ZY1 A;  4JZ0 A;  6CPA A;  2AFS A;  3ZZI A;  5J8F A;  2JEW A;  1XOV A;  2POK A;  4KVO E;  3D8P A;  1U6M A;  1YVO A;  4WWV A;  2XEG A;  1XFO A;  1Y0Y A;  4R76 A;  1PYT B;  1JDB C;  2BOA A;  2Q51 A;  3HUV A;  4KSA A;  2C27 A;  4FD5 A;  4R9M A;  1QST A;  5LRJ A;  3TT2 A;  4C8U A;  5G20 A;  3B2Y A;  4MCP A;  5CBM A;  2GLF A;  4MJX A;  4P44 A;  2G3A A;  3BLN A;  2QEC A;  3GB0 A;  4COG A;  4ORF A;  4JVO A;  1S3Z A;  3BUN B;  2QYV A;  1LFW A;  3MRU A;  3PB7 X;  3R9E A;  5F9M A;  1IY7 A;  4A2Z A;  4CDK A;  5LRG A;  4A31 A;  3TLY A;  1IOF A;  3I6S A;  2P6G A;  4UFW A;  4C9R A;  1KZF A;  4P4D A;  1Q2C A;  2O53 A;  3HLP A;  3KR5 A;  3IJ3 A;  1YK3 A;  4QVT A;  1CPS A;  4A32 A;  5D29 A;  4MXU A;  3G23 A;  2WPW A;  3OWC A;  5IX3 A;  1XF8 A;  4M6I A;  4JWP A;  4A4B A;  4C85 A;  4A30 A;  1R3N A;  5HXD A;  3DNS A;  4FD4 A;  5JGF A;  1VBG A;  3TLE A;  4NGT A;  2AJ6 A;  5KTD A;  2EK8 A;  3IO1 A;  3L2N A;  5K8O A;  2FL4 A;  1MJA A;  4KSI A;  2ZEO A;  2EWB A;  4HNY B;  1C3O B;  2DF5 A;  2VZY A;  2PE3 A;  1QSR A;  4K30 A;  5KTA A;  3N7Z A;  4FWU A;  1Q2D A;  2RFH A;  5LRK A;  3R9F A;  5J8C A;  3VWD A;  1XF1 A;  2NSM A;  1XMB A;  5H86 A;  2Z3M A;  4MCQ A;  5CPA A;  2Y1N A;  1VHS A;  3SJX A;  7CPA A;  1VHE A;  2JBK A;  1YRE A;  4YGO A;  4A37 A;  1TXR A;  3O8Z A;  4F9V A;  4HPS A;  4UEF A;  2Y1M A;  2PJ9 A;  2PJ3 A;  5HKY A;  4A38 A;  1F57 A;  4R3L A;  2PJ1 A;  4EFD A;  3DR8 A;  4BPX B;  3FMC A;  4F6A A;  2EBJ A;  3CPA A;  4OLL A;  4NGS A;  1L0C A;  2R1I A;  3EZA A;  3T07 A;  4BTF A;  3GUX A;  3PFO A;  3FB3 A;  1M44 A;  1M4I A;  4ZYQ A;  4J0N A;  1TF9 A;  4FUU A;  4HNX B;  5D8N A;  4AVC A;  2OZG A;  1BLL E;  2CBL A;  3H8G A;  2VXK A;  4MHD A;  1AMP A;  2Z0Z A;  5AG4 A;  3W6S A;  4CAV A;  2PJ7 A;  2HRO A;  4C2Y A;  1MJB A;  2Q04 A;  2Z3K A;  4DUK A;  3C26 A;  3T90 A;  2ZEG A;  3SXO A;  1EO0 A;  1VIX A;  4OC3 A;  2CY2 A;  4H2K A;  3LOD A;  3T8W A;  3BUO B;  2ATR A;  2Q4Z A;  1YME A;  4MHY A;  4MRI A;  1NSA A;  2IQ6 A;  1Z8T A;  1K4J A;  3PB8 X;  5AG6 A;  4KUA A;  1X10 A;  2PJ6 A;  1N71 A;  4EME A;  3D2M A;  3PB6 X;  3PLF B;  2AFM A;  4R87 A;  4CYN A;  4TNU A;  2VZZ A;  1MK4 A;  4MHP A;  4EVY A;  2PJ2 A;  4UIA A;  2XEJ A;  3VAR A;  1LOK A;  2ZED A;  4W9Y A;  4PV6 A;  3T0T A;  1Z2L A;  2GAN A;  3VAT A;  2FIA A;  3LAC A;  2OU2 A;  2HV2 A;  3HPG G;  2ZOF A;  4J3G A;  3SHP A;  3QNV A;  5JVL A;  1T36 B;  1Z5R A;  2CTB A;  3ISX A;  3D7D A;  1KWM A;  2O4H A;  3F8K A;  3PB9 X;  4IF5 A;  4UWJ A;  5THW A;  3EXN A;  3PFV A;  4XPL A;  2DPS A;  2J8R A;  4UFX A;  3PZJ A;  3NH8 A;  2VI7 A;  2AE6 A;  4B5P B;  5F5X A;  3W6X A;  2C6G A;  1ON0 A;  2AFU A;  4NGM A;  4UA3 A;  4P6Y A;  3TOB A;  4CGL A;  3W91 A;  4CGP A;  2XPN A;  4CZ1 A;  2GP4 A;  1IYL A;  2PJB A;  4MHZ A;  4OME A;  2ODF A;  3TO9 A;  4C2X A;  3TO6 A;  3SI0 A;  2C6P A;  1VI4 A;  4PXD A;  4AB7 A;  4BMH A;  2KCW A;  1CJW A;  1ELM P;  2R8V A;  3IU2 A;  1YLO A;  3K4I A;  2Q44 A;  4A4C A;  2BEI A;  2QIR A;  4X5K A;  5F47 A;  4KOW A;  3MN8 A;  1YW4 A;  4MFL A;  3T9Y A;  1I12 A;  5IV0 A;  5JPH A;  3FRM A;  1LRZ A;  1HEE A;  2QML A;  4Q7A A;  2EUI A;  2XEF A;  2IL4 A;  2J8M A;  2Z3N A;  1S7F A;  5HVF A;  3K9U A;  4CGO A;  1M4D A;  2DEA A;  2G0B A;  5FVJ A;  1B87 A;  4B5O A;  5LYL A;  1XRY A;  2HB6 A;  5KTC A;  3PFE A;  4I49 A;  4KS9 A;  1S7K A;  2PIY A;  2MP0 A;  2VBQ A;  4PSX A;  3FIX A;  2Q7B A;  2Q4V A;  2B4D A;  1CP6 A;  2FE7 A;  3C8O A;  4L8A A;  4C8A A;  2XEI A;  2DLA A;  4PXC A;  1V0C A;  3I74 A;  1WVM A;  1Z9U A;  4R7M A;  5EMI A;  4KOX A;  2C1C A;  4M6G A;  2CNT A;  1MJ9 A;  5ISV A;  2IMO A;  3JVN A;  3CDX A;  1QQ9 A;  4QC6 A;  2ZW5 A;  5F48 A;  5JH9 A;  4QB9 A;  4COB A;  3KL9 A;  4ZY0 A;  4KSF A;  5LYD A;  4C8F A;  3SJF A;  5ELY A;  3EFA A;  1NSL A;  4MBU A;  4Y49 C;  4M8D A;  4NF1 A;  5F49 A;  3P2H A;  3KAS A;  1B47 A;  2RB7 A;  3VWE A;  5IB9 A;  4XNH B;  4C9U A;  2QVP A;  2PJ4 A;  3R96 A;  3VH9 A;  2HI6 A;  3QAY A;  1KUY A;  4MFP A;  4MI4 A;  4UEE A;  4RR2 B;  2J8N A;  4P10 A;  4C9E A;  3VRO A;  1R43 A;  4PK3 A;  2ZW4 A;  4PXB A;  4R6T A;  4EWT A;  2OOT A;  3TLG A;  3FF3 A;  2RC4 A;  4CYQ A;  2HC9 A;  5H84 A;  1JQG A;  2ZXV A;  4KVM E;  3S9L A;  5F46 A;  4EYS A;  2ZEL A;  4NEX A;  5HKZ A;  4Z65 A;  1CG2 A;  1IID A;  3K2K A;  5HH1 A;  5AXI A;  3WC5 A;  2QJ8 A;  4NFR A;  4B11 A;  4CDJ A;  4C8P A;  2F5I A;  3B3C A;  1GYT A;  2GFQ A;  3TOA A;  1Z8X A;  2B5G A;  3NE8 A;  3K9T A;  4M6H A;  2C5Q A;  5E96 A;  3TLB A;  4R3K A;  2K5T A;  4ZBG A;  2FCK A;  3F0A A;  3S9M A;  4C8C A;  4JXQ A;  4MHN A;  4JJX A;  2JDD A;  2X0S A;  3TO7 A;  4OC5 A;  2PR1 A;  1RTQ A;  4GM5 A;  3KR4 A;  2OR4 A;  2PJ5 A;  3BI1 A;  4KOT A;  1ZL0 A;  1WK4 A;  5G21 A;  4BPU B;  1IYK A;  3PBB A;  1B6B A;  2G3T A;  3IGR A;  4XPD C;  4CGN A;  5I0C A;  4IIX A;  4MCS A;  1TIQ A;  1OBR A;  4R57 A;  1Z4E A;  4YU9 A;  1VBH A;  4JD6 A;  5DS0 A;  4HKF A;  1DIK A;  2CIJ A;  4M3S A;  1NBW A;  3CXS A;  3BUX B;  1ZRS A;  2FS5 A;  3DLJ A;  3HPH E;  3FX6 A;  1R61 A;  3KI9 A;  2Y0M A;  3S6H A;  2REF A;  3FNC A;  1ELL P;  4IIY A;  4QUS A;  1IB1 E;  1A9X B;  1Y9Z A;  3B7I A;  3UY5 A;  3R9G A;  4BPW B;  4NXY A;  1CM0 A;  2HUZ A;  1UWY A;  4CAF A;  1BAV A;  1P0H A;  4YRH A;  2EK9 A;  3FEC A;  3B3T A;  5AG7 A;  3T5M A;  5C88 A;  2V8D A;  3G8W A;  1KUX A;  1Z8L A;  5K8N A;  5JQ4 A;  3D7F A;  4AXV A;  3TE4 A;  3OAK A;  2VL1 A;  3CPX A;  4PQA A;  3TTH A;  1KUV A;  3B3V A;  1YVK A;  4ZX9 A;  3TX8 A;  1I1D A;  4PPZ A;  3BHX A;  4P4E A;  3VTA A;  4OAE A;  2AUN A;  4BD9 A;  2PDO A;  2R7H A;  2C6C A;  5J3X A;  5GCN A;  1Q2Y A;  3IC1 A;  3I1U A;  4P4I A;  4MY3 A;  3WC7 A;  1OZP A;  4F8Z A;  4P45 A;  1TKJ A;  1X12 A;  2JEV A;  3KHZ A;  3IWW A;  2N3A B;  1TF8 A;  3NA6 A;  4TWE A;  4E94 A;  2P0W A;  3DSB A;  1S7N A;  2AFW A;  4B14 A;  4IAV A;  1YVH A;  2WUU A;  3NOJ A;  2IJZ A;  4CO9 A;  4E2A A;  2PC1 A;  3FH4 A;  2FIW A;  3ZNI A;  4LX9 A;  2PR8 A;  2F7V A;  4NGN A;  2Q0Y A;  2YNC C;  1EZB A;  4KZT A;  3LMS A;  5HKW A;  1YQE A;  2EZA A;  1QSM A;  4UCM A;  4PSW A;  5EC4 A;  3KGQ A;  2YNE A;  4OC4 A;  2ZEM A;  4PXE A;  1Y9W A;  2PSW A;  1XIX A;  2WZN A;  2Z10 A;  1IOI A;  4B10 A;  4CPA A;  3TLC A;  3RYO A;  3D3S A;  2FT0 A;  2JLM A;  1M1D A;  1C30 B;  3B35 A;  1AUG A;  2ZEE A;  3VRP A;  2HQY A;  2BO9 A;  2CF4 A;  3V7Z A;  8CPA A;  3SJE A;  3HMJ G;  3SR3 A;  2PRQ A;  4H6U A;  4ONU A;  1FBV A;  1ZO0 A;  2GIV A;  4H1H A;  4KOS A;  3DGV A;  1GHE A;  3LWU A;  4A39 A;  3FBU A;  1JDE A;  3SJG A;  1QSN A;  2ZOG A;  4A94 A;  3OP0 A;  2V8V A;  2EZB A;  1LAP A;  1XJO A;  5LYF A;  3BUM B;  2PJA A;  2GU2 A;  1CS0 B;  3U1B A;  4OP4 A;  4KLV A;  1Y9K A;  2YNC A;  2CXA A;  2V8G A;  5A28 A;  2OZH A;  4HNW B;  3N5F A;  2AFO A;  3H4Q A;  3GIU A;  1ZYM A;  2PJ0 A;  4IUS A;  3BJ7 A;  3FJU A;  2VKZ G;  5G22 A;  3BXM A;  2YJV A;  4MMO A;  1F2P A;  3ISZ A;  2D4O A;  1HDU A; 
#chains in the Genus database with same CATH homology
 2GLJ A;  3KQX A;  4WJB A;  4F9U A;  4ZI6 A;  1QMU A;  1CBX A;  3PB4 X;  1LAN A;  4DYO A;  3RAM A;  2PVW A;  3S9N A;  3RZA A;  2NYQ A;  3FED A;  1DTD A;  2F8H A;  1CX8 A;  4C99 A;  3NH5 A;  4FAI A;  3D7H A;  3WT4 A;  3WAB A;  4NGQ A;  4YWY A;  4NJQ A;  5LYI A;  2J9A A;  1DE4 C;  4JYW A;  3KQZ A;  2ZEF A;  3NFZ A;  4DJL A;  1ARM A;  2AFZ A;  4R8F A;  4IK2 A;  2G9D A;  1Q7L A;  3PEI A;  4C8T A;  4OID A;  2V8H A;  4B6Z A;  1V6C A;  4NGR A;  1BPN A;  1H8L A;  1FT7 A;  1CPX A;  4C86 A;  3FEE A;  1LCP A;  4OC1 A;  3KHX A;  3D66 A;  4UF4 A;  4UEZ A;  1ZG7 A;  3PRT A;  4X3R A;  2ANP A;  3IIB A;  2FVG A;  3GLJ A;  4TJV A;  4ZX8 A;  1Y7E A;  4IHM A;  4LQG A;  2PVV A;  3D68 A;  3KZW A;  5HVG A;  3FVL A;  1TKH A;  1IGB A;  4RUH A;  2GRE A;  1ZG9 A;  1M4L A;  4NJR A;  1YSJ A;  2ABZ A;  1Y0R A;  1FNO A;  2ZEP A;  4C84 A;  4X8I A;  2I3C A;  4G1P A;  4P4F A;  4KNG E;  4FBE A;  4K3N A;  2ZEN A;  4OC0 A;  4P4J A;  5F09 A;  3SI2 A;  3V38 A;  1CP7 A;  4UIB A;  4C9A A;  2AFX A;  4O23 A;  4OKO A;  5I4M A;  2CTC A;  3RBU A;  1VHO A;  2BCO A;  3BI0 A;  3JRU A;  2Q43 A;  3IEH A;  5K8P A;  2PJ8 A;  5IR2 A;  1HDQ A;  1ZLI A;  3D7G A;  3TC8 A;  1BPM A;  4OC2 A;  3H8F A;  3IFE A;  1LAM A;  1YW6 A;  4C9V A;  1TKF A;  3SI1 A;  3ICU A;  1XBU A;  1ZG8 A;  5HVH A;  2WYR A;  4ZY2 A;  4ONW A;  3B3W A;  4YN3 A;  2V77 A;  5JM6 A;  4OIW A;  3PBE A;  4X2T A;  3EIF A;  1F2O A;  4MCR A;  3B3S A;  1VGY A;  1AYE A;  1EE3 P;  5K8M A;  3D4U A;  1PCA A;  4TJX A;  5J1Q A;  2PCU A;  2ZEH A;  4P4B A;  2PIZ A;  1ARL A;  1ZLH A;  4NGP A;  3H8E A;  2PJC A;  3NH4 A;  3D67 A;  3CT9 A;  3WC6 A;  2JBJ A;  4ZY1 A;  4JZ0 A;  6CPA A;  2AFS A;  2JEW A;  2POK A;  4WWV A;  2XEG A;  1XFO A;  1Y0Y A;  4R76 A;  1PYT B;  2BOA A;  2Q51 A;  3HUV A;  4C8U A;  5LRJ A;  3B2Y A;  4MCP A;  5CBM A;  2GLF A;  4P44 A;  3GB0 A;  2QYV A;  3MRU A;  1LFW A;  3PB7 X;  1IY7 A;  4CDK A;  5LRG A;  3I6S A;  4C9R A;  4P4D A;  2O53 A;  3HLP A;  3KR5 A;  3IJ3 A;  1CPS A;  5D29 A;  4MXU A;  4C85 A;  5HXD A;  1R3N A;  5JGF A;  4NGT A;  2EK8 A;  3IO1 A;  3L2N A;  5K8O A;  4KSI A;  2ZEO A;  2EWB A;  2PE3 A;  4FWU A;  2RFH A;  5LRK A;  1XF1 A;  2NSM A;  1XMB A;  4MCQ A;  5CPA A;  3SJX A;  7CPA A;  1VHE A;  2JBK A;  4A37 A;  1TXR A;  4F9V A;  4UEF A;  2PJ9 A;  2PJ3 A;  4A38 A;  1F57 A;  2PJ1 A;  4EFD A;  3FMC A;  3CPA A;  4NGS A;  3GUX A;  3PFO A;  4ZYQ A;  1TF9 A;  4FUU A;  5D8N A;  1BLL E;  3H8G A;  1AMP A;  2PJ7 A;  4DUK A;  2ZEG A;  1VIX A;  4OC3 A;  4H2K A;  3T8W A;  4MHY A;  2Q4Z A;  1YME A;  4MRI A;  1NSA A;  2IQ6 A;  4EME A;  3PB8 X;  2PJ6 A;  3PB6 X;  2AFM A;  4TNU A;  4MHP A;  2PJ2 A;  4UIA A;  2XEJ A;  3VAR A;  1LOK A;  2ZED A;  4W9Y A;  1Z2L A;  3VAT A;  2ZOF A;  3QNV A;  1Z5R A;  2CTB A;  3ISX A;  3D7D A;  1KWM A;  2O4H A;  3PB9 X;  5THW A;  3NH8 A;  2C6G A;  2AFU A;  4NGM A;  4P6Y A;  2GP4 A;  2PJB A;  4MHZ A;  4OME A;  3SI0 A;  2C6P A;  4PXD A;  1ELM P;  1YLO A;  3MN8 A;  1YW4 A;  1HEE A;  4Q7A A;  5HVF A;  2XEF A;  2DEA A;  5LYL A;  1XRY A;  2HB6 A;  3PFE A;  2PIY A;  1CP6 A;  4C8A A;  2XEI A;  4PXC A;  3I74 A;  1WVM A;  4R7M A;  2C1C A;  2IMO A;  3CDX A;  1QQ9 A;  5JH9 A;  3KL9 A;  4ZY0 A;  5LYD A;  4C8F A;  3SJF A;  5ELY A;  4C9U A;  3KAS A;  2RB7 A;  5IB9 A;  2QVP A;  2PJ4 A;  3VH9 A;  4UEE A;  4P10 A;  4C9E A;  1R43 A;  4PXB A;  4R6T A;  4EWT A;  2OOT A;  3FF3 A;  2HC9 A;  1JQG A;  3S9L A;  2ZEL A;  4Z65 A;  1CG2 A;  3K2K A;  3WC5 A;  2QJ8 A;  4NFR A;  4CDJ A;  4C8P A;  3B3C A;  1GYT A;  3K9T A;  2C5Q A;  3S9M A;  4C8C A;  4MHN A;  4OC5 A;  1RTQ A;  4GM5 A;  3KR4 A;  2OR4 A;  2PJ5 A;  3BI1 A;  3PBB A;  4MCS A;  4YU9 A;  1OBR A;  5DS0 A;  2CIJ A;  3DLJ A;  3FX6 A;  3KI9 A;  1ELL P;  1Y9Z A;  3B7I A;  1UWY A;  1BAV A;  2EK9 A;  3FEC A;  3B3T A;  2V8D A;  1Z8L A;  5K8N A;  3D7F A;  4AXV A;  2VL1 A;  3CPX A;  4PQA A;  3B3V A;  4ZX9 A;  3TX8 A;  4PPZ A;  3BHX A;  4P4E A;  3VTA A;  4BD9 A;  2C6C A;  3IC1 A;  3I1U A;  4P4I A;  3WC7 A;  4F8Z A;  4P45 A;  1TKJ A;  3KHZ A;  3IWW A;  1TF8 A;  3NA6 A;  4TWE A;  2AFW A;  4IAV A;  2IJZ A;  3FH4 A;  2F7V A;  4NGN A;  3LMS A;  3KGQ A;  4OC4 A;  2ZEM A;  4PXE A;  4CPA A;  2WZN A;  3B35 A;  2ZEE A;  8CPA A;  2BO9 A;  2CF4 A;  3V7Z A;  3SJE A;  2PRQ A;  3DGV A;  3LWU A;  4A39 A;  3SJG A;  2ZOG A;  4A94 A;  2V8V A;  1LAP A;  1XJO A;  5LYF A;  2PJA A;  2GU2 A;  4OP4 A;  2V8G A;  3N5F A;  2AFO A;  2PJ0 A;  3FJU A;  3BXM A;  4MMO A;  1F2P A;  3ISZ A;  1HDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...