4P4DA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor mp1c
Total Genus 260
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
260
sequence length
696
structure length
687
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 260
structure length 687
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4dA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4dA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4dA02
4PXCA 4K3NA 3D7FA 5HVGA 5THWA 2I3CA 4PXEA 3MN8A 4OIWA 2PJ3A 4LQGA 5HXDA 3KI9A 4WWVA 4X3RA 2PJBA 1CP6A 4IHMA 5LRJA 1ELMP 1LOKA 4FUUA 3KZWA 4P4FA 3WC6A 2GU2A 2J9AA 3K2KA 4BD9A 3H8EA 1YMEA 4P4IA 2JBJA 2PJ2A 3NA6A 4C9EA 4EMEA 1F2OA 4MCRA 3WABA 3BI0A 1UWYA 3NH8A 1KWMA 4MHZA 2ZEMA 5D8NA 2V8GA 4OC3A 4F8ZA 4CDKA 3KASA 4ZYQA 2V8DA 4P4JA 3VH9A 3FF3A 2AFZA 4F9UA 1JQGA 3DGVA 4JZ0A 5LYIA 4R7MA 4A94A 1ZG8A 4C9AA 1LANA 1ZLHA 3D67A 4X2TA 3S9NA 4YWYA 4NGPA 4PXBA 4R76A 3KL9A 3IEHA 2CTBA 4P4DA 1VHOA 4F9VA 4CDJA 4P45A 2ZOFA 1ZG7A 3I6SA 5LYFA 2V77A 3B3TA 1FNOA 3N5FA 3MRUA 2ZOGA 2PJ5A 3B35A 2O4HA 4ZI6A 4MHNA 2ZENA 1HEEA 5LYDA 4ZX8A 3GB0A 5HVHA 2Q4ZA 2EWBA 2EK8A 2IQ6A 1HDUA 4UF4A 4MMOA 2AFUA 2XEGA 2CTCA 3FX6A 3QNVA 3IC1A 5ELYA 4YN3A 4PXDA 2ZEPA 4P4BA 2AFXA 1YSJA 4UIAA 4G1PA 2BO9A 3PBEA 3PB4X 4UIBA 5DS0A 5F09A 4C8PA 3SJGA 4C85A 2ZEFA 3BHXA 3PB6X 4JYWA 1XJOA 4EFDA 2AFMA 8CPAA 4OP4A 4ZY2A 2NSMA 4C8FA 4P4EA 2JEWA 4FAIA 5JH9A 2ZEGA 1TKFA 2XEIA 2VL1A 4OC2A 4MRIA 3PFOA 3TC8A 4IAVA 4OC1A 1LAPA 2AFWA 4WJBA 3FJUA 1YW6A 3D7DA 1PCAA 2POKA 3I74A 3SI1A 4A38A 4EWTA 2ANPA 3SJXA 1ARLA 1GYTA 3LMSA 1QMUA 4OC5A 1YLOA 4H2KA 4NGNA 3V7ZA 4MCSA 2F7VA 1VGYA 3T8WA 4TJVA 2ZEHA 3FEDA 1LAMA 1OBRA 4OC0A 2AFOA 1Z8LA 2Q43A 3SI2A 5CBMA 2PVWA 2PIZA 3FVLA 4MCQA 1ARMA 4W9YA 1BLLE 1TKHA 3PRTA 1QQ9A 3EIFA 3K9TA 5K8PA 4DJLA 3FEEA 4UEEA 2PJAA 4OMEA 4MHPA 1PYTB 4MXUA 3B3SA 4DUKA 1Y7EA 3D4UA 5IB9A 2PCUA 6CPAA 1Y0RA 3CPAA 2GLJA 3B3CA 4PPZA 4C8AA 3HLPA 3PB8X 1TKJA 4R8FA 4ONWA 3VARA 1VIXA 3CDXA 3SJEA 2PIYA 4TNUA 4B6ZA 3GUXA 1Y9ZA 1XRYA 3LWUA 3S9LA 4C8TA 5CPAA 1EE3P 3IO1A 1BAVA 1RTQA 3PBBA 3H8FA 1TXRA 3DLJA 4P44A 3FMCA 1ELLP 1ZLIA 2EK9A 5J1QA 2RFHA 2PJ0A 4C9RA 1VHEA 1DE4C 4NFRA 4YU9A 3JRUA 3IIBA 1ZG9A 5LRGA 4KNGE 1XMBA 3B7IA 4NGMA 4FBEA 4RUHA 2ZELA 3FECA 2CF4A 4NGRA 3L2NA 3HUVA 2FVGA 7CPAA 3I1UA 1F2PA 3SJFA 1IGBA 3D7HA 5JM6A 4NJRA 4ZY1A 1TF9A 1Z2LA 1BPMA 4TWEA 1CP7A 4C86A 4P6YA 2XEJA 4C84A 2PJ8A 3ISXA 4ZY0A 2QYVA 1F57A 2PJ1A 4C99A 2OOTA 4NGTA 1FT7A 1NSAA 4UEZA 1V6CA 2PE3A 2BOAA 5LYLA 1XF1A 4Q7AA 4C9VA 4Z65A 4TJXA 1TF8A 2NYQA 3PB7X 3PFEA 5LRKA 1IY7A 3PEIA 2PRQA 5K8NA 5I4MA 4MHYA 4GM5A 5K8OA 3RZAA 4MCPA 4UEFA 2WZNA 2GLFA 3WC5A 1XFOA 1AMPA 5K8MA 4OC4A 4KSIA 3GLJA 3H8GA 3KGQA 3BI1A 3RBUA 2QVPA 3IWWA 1WVMA 1CPXA 1Z5RA 4AXVA 4IK2A 3S9MA 2CIJA 3PB9X 2G9DA 3B2YA 1HDQA 4C9UA 3IFEA 2PJ6A 3ISZA 3WC7A 3KHZA 3NH5A 4C8CA 2JBKA 4A37A 5HVFA 1LFWA 2DEAA 1R43A 4R6TA 3D66A 1H8LA 1M4LA 2V8VA 1CPSA 2HB6A 1Q7LA 3CPXA 2C6CA 4NGSA 4DYOA 2PVVA 3ICUA 2PJ4A 2ZEEA 4OKOA 3SI0A 4NJQA 2HC9A 1Y0YA 2ABZA 2V8HA 2XEFA 3TX8A 2BCOA 4O23A 1CBXA 2C6GA 2C1CA 3D68A 1LCPA 5D29A 1BPNA 2GREA 3KHXA 2RB7A 3B3WA 3KQZA 4FWUA 2O53A 4ZX9A 1R3NA 2PJ7A 1CX8A 3VTAA 2ZEDA 1DTDA 4CPAA 2WYRA 3KR4A 3B3VA 2AFSA 3KR5A 2PJCA 1AYEA 3IJ3A 2ZEOA 2F8HA 2OR4A 3NFZA 4A39A 1YW4A 2Q51A 3VATA 3KQXA 2IMOA 3FH4A 4C8UA 3D7GA 3BXMA 2IJZA 2QJ8A 4X8IA 1CG2A 4PQAA 3V38A 4P10A 3RAMA 3WT4A 3CT9A 3NH4A 2C6PA 2PJ9A 1XBUA 5JGFA 4NGQA 4OIDA
chains in the Genus database with same CATH superfamily
2B5GA 2Y1NA 4PXCA 1MJ9A 3D7FA 4K3NA 1KUYA 5THWA 5HVGA 2EZCA 2I3CA 3GYAA 4PXEA 3I9SA 3D8PA 1YX0A 5CNPA 1NXJA 3MN8A 4OIWA 1NE9A 4XNHC 1QSRA 2PJ3A 3MGDA 2Q7BA 4LQGA 2ZW5A 2Q4VA 3W91A 5HXDA 3LODA 5G1ZA 1XEBA 3KI9A 1B6BA 4QC6A 3ZZIA 2ZW6A 3SR3A 3BUMB 4NF1A 2DIKA 2R98A 4WWVA 4X3RA 2PJBA 4MI4A 1CP6A 1A9XB 1BXRB 4HNYB 5HKYA 1XMTA 4KLWA 5C82A 4R87A 3RO0A 3BUNB 4IHMA 5LRJA 1ELMP 2FM4A 1LOKA 2FIWA 4JWPA 3BUWB 4FUUA 3KZWA 4P4FA 2G0BA 4M8DA 2OLSA 3FBUA 3VRQA 3PT1A 2H5MA 5G20A 5KTAA 3BLNA 1A2ZA 4B5OA 3WC6A 2GU2A 2J9AA 4QBJA 2FXFA 5JQ4A 4UBRA 4A30A 3K2KA 4QUSA 4FD6A 4BD9A 1M4DA 4BMHA 2FE7A 3NE7A 5G22A 3H8EA 2OB0A 4PSXA 1YMEA 1YLEA 4P4IA 2UV8G 3FB3A 1VBGA 5F1YA 1Z4RA 2FT0A 2Z3PA 1IYLA 4RN7A 3R1KA 2JBJA 1X10A 4IUSA 4NCZA 2PJ2A 3NA6A 5F9MA 3GIUA 4C9EA 4KLVA 2VI7A 3TFYA 4EMEA 4B11A 4B5PB 3TLYA 3B8GA 4CAEA 4JVOA 1ZL0A 3QAHA 3RNZA 1F2OA 4MCRA 2EZAA 3WABA 3BI0A 4MFPA 1IU8A 1UWYA 3VRRA 3EO4A 3NH8A 1KWMA 4MHZA 2ZEMA 5D8NA 2V8GA 3FIXA 3EZAA 4OC3A 3BJ8A 2VZZA 4EYSA 3KKWA 5J8FA 4F8ZA 5AG6A 3D3SA 3KASA 4ZYQA 2V8DA 4CDKA 4P4JA 2O28A 2AFZA 3FF3A 3BUOB 3VH9A 4F9UA 1JQGA 5FVJA 2VZYA 1C30B 3G23A 3DGVA 4JZ0A 1Y9KA 2B4JC 3PFVA 1ZG8A 3VRPA 5AXIA 1BO4A 1LANA 1ZLHA 2ODFA 3S9NA 3CZXA 3D67A 4JXRA 4X2TA 4YWYA 3IU1A 4NGPA 1YQEA 4PXBA 4R76A 4AG7A 3TLGA 3TLCA 1KUVA 3EZBA 4BPUB 3KL9A 2OZHA 2R7HA 2J8RA 3IEHA 4YFJA 1MJAA 3OP0A 2CTBA 2PCNA 5IV0A 4P4DA 1VHOA 4F9VA 1EO0A 3TYXA 1IB1E 2YJTA 3LACA 4A4CA 4Y49C 4P45A 4CDJA 2DF5A 2ZOFA 3R9EA 1JDEA 1ZG7A 2R1IA 4KZTA 5E96A 1I12A 3I6SA 1I21A 2V77A 5LYFA 3B3TA 1FNOA 1QSNA 3N5FA 3MRUA 3EY5A 2CXAA 3UY5A 2ZOGA 4KOUA 4A32A 2PJ5A 3B35A 2O4HA 2JDDA 4ZI6A 4MHNA 2BSWA 2ZENA 1HEEA 1ON0A 4PV6A 3TLBA 4UFVA 5LYDA 2B3UA 1DIKA 4COBA 4R3KA 4ZX8A 3G3SA 4CGMA 4CGPA 3GB0A 2GP4A 4FD4A 3KRVA 5HVHA 1PUAA 2A4NA 2Q4ZA 4EVYA 1NMTA 2EWBA 2EK8A 4HKFA 4E0AA 2IQ6A 3R95A 4PSWA 1J4JA 2VBQA 1YR0A 2HQYA 1HDUA 1Q2YA 2PQ8A 4MMOA 4UF4A 1KEEB 2AFUA 4R3LA 2XEGA 4XNHB 2CTCA 3FX6A 4XPKA 2PR8A 2I00A 2REFA 3QNVA 2ZW4A 2WPWA 2DPTA 4PK2A 1Q2DA 3DR8A 5ELYA 3IC1A 4Q38A 2DLAA 1TIQA 4AB7A 2XPPA 4KOTA 4B14A 4UFWA 1Z8WA 2Q44A 1IOFA 4PXDA 3QAYA 3S6GA 2ZEPA 3BUXB 3JTKA 4ZGYB 1KC7A 4P4BA 2AFXA 4CAWA 1YSJA 2P0WA 4UIAA 1RO5A 4G1PA 3DNSA 1X12A 2BO9A 4KVME 3W6XA 3PBEA 2FIAA 3PB4X 3PZJA 4UIBA 5DS0A 1VI4A 4CO9A 5F09A 2B3VA 4C8PA 1WJTA 1Z8XA 3SJGA 1XOVA 5F49A 3TCVA 4C85A 2ZEFA 3BHXA 4C7HA 1QSTA 3EFAA 1XF8A 3PB6X 4JYWA 4HPSA 1QSMA 1XJOA 4KSFA 3R96A 4EFDA 1Y9WA 3SXNA 4UCMA 1Y7RA 2J8MA 2AFMA 4JXQA 2AE6A 3E0KA 3ZJ0A 8CPAA 1B87A 5A27A 4UCNA 1L0CA 4OP4A 4ZY2A 1M4GA 2NSMA 1GGOA 4C8FA 2RC4A 4P4EA 2JEWA 4FD7A 4FAIA 1J3LA 2EBJA 5JH9A 2ZEGA 3C8OA 3WR7A 1TKFA 2XEIA 2VL1A 4OC2A 3P2HA 4MFLA 2Q0YA 1WK4A 4MRIA 3PFOA 3TC8A 5F5XA 4IAVA 3IGRA 2B5GB 4OC1A 2R8VA 1LAPA 5HKWA 2AFWA 3VWEA 2ZXVA 4UCPA 2JLMA 2J8NA 3FJUA 1YW6A 4WJBA 3D7DA 4BTFA 2CNMA 1WWZA 3W6SA 4CS0B 1PCAA 3H4QA 2POKA 5EC4A 3I74A 1I1DA 4BPWB 4HNWB 3SI1A 4A38A 4EWTA 2ANPA 4F0YA 3SJXA 1ARLA 1GYTA 3A9LA 3PGPA 3LMSA 4YN3A 2Z3OA 3P2FA 1QMUA 4JJXA 4OC5A 1Z9UA 1YLOA 4H2KA 4QVTA 4NGNA 4MY3A 3V7ZA 3NOJA 4A95A 4MCSA 2F7VA 2VKZG 1JWQA 2CNSA 2JEVA 5JPHA 1VGYA 4MFJA 2Z11A 3TLAA 3T8WA 2GIVA 5H84A 4B13A 4TJVA 1S60A 3FEDA 2ZEHA 1S7FA 1LAMA 4OLLA 1OBRA 1UFHA 4OC0A 1P0HA 1Z8LA 2AFOA 2C27A 2Q43A 4KUBA 3HPGG 3SI2A 4KSAA 5CBMA 1CJWA 4Q36A 1M6VB 2GE3A 4MY0A 4NSQA 2CNTA 1IICA 3R9FA 2VQYA 2PVWA 1ZO0A 2PIZA 2D0OA 3FVLA 4MCQA 3GY9A 2EZBA 3T07A 1ARMA 4ONUA 4W9YA 1BLLE 1TKHA 3PRTA 1QQ9A 4C68A 1JDBC 3EIFA 1CM0A 3K9TA 3HPHE 4DJLA 5K8PA 1YGHA 4INJA 5FD8A 3FEEA 3TE4A 4UEEA 2C5QA 2PJAA 4OMEA 4YRHA 4IF5A 2QECA 4MHPA 2FSRA 4B10A 3IWGA 5F13A 4H6UA 4KUAA 2YNCC 4E5SA 3QB8A 1PYTB 4MXUA 1M4IA 3B3SA 2AUMA 3T9YA 4DUKA 1S7NA 3S6KA 2X7BA 3VGOA 2ATRA 1Y7EA 3U88C 2YGWA 2P6FA 3TT2A 3D4UA 5IB9A 2PCUA 1GHEA 4M6GA 5BY0A 5AGEA 3OWCA 6CPAA 2QMLA 1YVKA 3FYNA 1EZAA 1Y0RA 3CPAA 1N71A 4OADA 3BJ7A 2GLJA 1R57A 3B3CA 4PPZA 4CGLA 4C8AA 4C2ZA 3HLPA 4RS2A 4A33A 2E28A 2PSWA 4XPDB 3PB8X 1TKJA 4R8FA 4ONWA 1YK3A 3VARA 1VIXA 3CDXA 2WUUA 2JDCA 3SJEA 4J0NA 4COGA 2PIYA 5AG5A 3I3GA 1M1DA 4TNUA 5EMIA 1B47A 1MK4A 3GUXA 4MBUA 4B6ZA 2EO8A 2Z3MA 4F0XA 1XRYA 3LWUA 2N3AB 3S9LA 4C8TA 5CPAA 2HUZA 1EE3P 3IO1A 3TTHA 2B4DB 1BAVA 2BUEA 1RTQA 3ZNIA 1IOIA 3PBBA 5F46A 4I49A 4RR2B 5DWMA 3H8FA 2AUNA 2HI6A 5DWNA 1TXRA 3DLJA 4L8AA 4P44A 3FMCA 2X0SA 5JYBA 4BINA 1ELLP 1QSOA 1ZLIA 1Q5XA 2EK9A 4M3SA 5J1QA 2RFHA 1NBWA 4MJXA 2PJ0A 3FRMA 4C9RA 1VHEA 1DE4C 4NFRA 4NXYA 2KCWA 3JRUA 3PLFB 3F0AA 4YU9A 4E8OA 3IIBA 1ZG9A 4GS4A 5LRGA 4KNGE 1PU9A 1XMBA 4LQ6A 3B7IA 4PK3A 4H1HA 4KVXA 2YJVA 4NGMA 4M6HA 4FBEA 4RUHA 3F5BA 2MP0A 2ZELA 3FECA 4KORA 4BBHA 1IIDA 3F8KA 2CF4A 1P4NA 4NGRA 2D4OA 3D2PA 5I0CA 2PDOA 3L2NA 3HUVA 3VWDA 2FVGA 4CAVA 3EXNA 3V8IA 7CPAA 5HH1A 3I1UA 4FD5A 4X5KA 1F2PA 3NFQA 3SJFA 2VXKA 5F47A 5LYIA 2DPSA 3OB2B 3D7HA 1IGBA 5JM6A 4KOXA 1S5KA 5HKZA 2Z0ZA 4NJRA 2Z3NA 4AVAA 1XE4A 4ZY1A 3TLZA 2B58A 4CYOA 1TF9A 4J3GA 4U9ZA 1Z2LA 1S3ZA 1BPMA 4QB9A 1CP7A 4TWEA 4AG9A 1OZPA 2FS5A 4C86A 3SHPA 2OH1A 2WPXA 4P6YA 2HROA 2XEJA 3DDDA 2PJ8A 4C9AA 3ISXA 4C84A 1XIXA 4ZY0A 4AVBA 3FXTA 2QYVA 3VRNA 2GFQA 1F57A 1M44A 1U6MA 2EUIA 4UA3A 3TLEA 3T05A 4CAXA 3OB1B 2PJ1A 4C99A 2OOTA 4NGTA 1FT7A 3K9UA 1NSAA 3CXQA 4UEZA 1V6CA 1NSLA 1T36B 2PE3A 2BOAA 4ORFA 1FY7A 5LYLA 1XF1A 4JD6A 4KOSA 3D2MA 4Q7AA 3TOAA 5KTCA 4C9VA 4M6IA 4Z65A 2Z3LA 4TJXA 1TF8A 2YNEA 5EBVA 3T90A 1YREA 1KZFA 4GXHA 2NYQA 3PB7X 4CYQA 1ZYMA 3PFEA 5LRKA 1Z8TA 1S7KA 1IY7A 2XPNA 2Y0MA 3PEIA 2PRQA 3HMJG 4KOVA 4U5YA 4MHYA 3SXOA 3R9GA 4GM5A 5I4MA 5K8NA 5KTDA 1VBHA 5K8OA 3U1BA 4H6ZA 2EVNA 3RZAA 4MCPA 2XPLA 3DSBA 4UEFA 2CY2A 4HNXB 1SQHA 2GLFA 1IYKA 2WZNA 1CE8B 4UWIA 3WC5A 1XFOA 1AMPA 3TO9A 5K8MA 4KOYA 1R61A 3JUWA 4CAFA 3G8WA 4OC4A 3GKRA 4KSIA 1YVHA 2QIRA 4MI1A 3GLJA 3H8GA 3KGQA 3BI1A 2HWGA 4IIYA 3T5MA 2K5TA 4E2AA 2HV2A 4R7MA 4UFXA 5IB0A 2B0AA 3JVNA 3RBUA 4MJ8A 2OZUA 4CYNA 1Z4EA 4LUAA 4A4BA 2F5IA 2QVPA 3IWWA 2ARHA 2FCKA 2NMTA 4MFKA 2P6GA 4XPDC 1WVMA 1BOBA 2D4PA 1CPXA 1Z5RA 3TLGB 4KVOE 4MHDA 2PC1A 4AXVA 4GPLB 4IK2A 5GCNA 3S9MA 2CIJA 2I79A 2Q7SA 3PP9A 2PRBA 3PB9X 2Z10A 2B4DA 2XPOA 2G9DA 3CXPA 4AVCA 2B4BA 1HDQA 1YVOA 3B2YA 3IFEA 5AG4A 4C9UA 4ZBGA 5H86A 3TOBA 2GANA 5ISVA 2P6EA 2PJ6A 3ISZA 3WC7A 3KHZA 3NH5A 4C8CA 2OZGA 4IIXA 4C7IA 2Z3KA 2R82A 2JBKA 2Q04A 3IWEA 3F9KC 4A37A 5HVFA 3O8ZA 1Z9EA 1C3OB 1LFWA 1CS0B 3S6HA 2DEAA 1R43A 4R6TA 5J8CA 4II9A 4M85A 2REEA 1KBLA 5BWAB 4NEXA 3D66A 3EC4A 1H8LA 1M4LA 1Q2CA 2OU2A 1CPSA 2HB6A 1Q7LA 2V8VA 4UWJA 4Y49B 2DXQA 3CPXA 4B5PA 2C6CA 4NGSA 4DYOA 2PVVA 3ICUA 2PJ4A 4KOWA 3TO6A 1RXTA 2ZEEA 3LD2A 1FBVA 4L89A 4OKOA 3SI0A 4CGNA 4E94A 4JLYA 4NJQA 4XPLA 2CBLA 5C88A 1V0CA 2HC9A 1Y0YA 1Y9ZA 2ABZA 2V8HA 3FNCA 2D0PA 2BL1A 4C2XA 2XEFA 5IR2A 2Q4YA 5A28A 3TX8A 2BEIA 4R57A 3NE8A 2BCOA 4O23A 5AG7A 4A31A 1CBXA 2C6GA 2C1CA 2PR1A 3D68A 4F6AA 1LCPA 4U9YA 4KS9A 2YNCA 2Y1MA 3DR6A 1EZBA 1K4JA 5D29A 1AUGA 2G3TA 1BPNA 4RI1A 4BPXB 5F48A 2GREA 1S7LA 2FL4A 2RB7A 5J3XA 1LRZA 3B3WA 3KHXA 3KQZA 4FWUA 1VKCA 2O53A 1MJBA 4ZX9A 5K99A 1KUXA 3CXSA 1R3NA 2ZW7A 2PJ7A 1CX8A 4CRZB 4CZ1A 1ZRSA 5IX3A 3VTAA 2ZEDA 1DTDA 4CPAA 2WYRA 4DNCA 5HMNA 3KR4A 2AJ6A 3B3VA 5G21A 2AFSA 4CGOA 3GJZA 3KR5A 2PJCA 1AYEA 3S6FA 3IJ3A 2ZEOA 2F8HA 2OR4A 3NFZA 4CYPA 4A94A 3H5ZA 4A39A 1YW4A 3OAKA 2Q51A 3VATA 3VROA 2IMOA 3KQXA 3C26A 3FH4A 4K30A 4C2YA 3K4IA 3D7GA 3N7ZA 4MFQA 4R9MA 3RYOA 4C8UA 2IL4A 3EZEA 4MFZA 3BXMA 2IJZA 2QJ8A 4X8IA 1CG2A 2WSAA 2YNDA 4CRYB 4PQAA 3V38A 4A2ZA 4B12A 4P10A 3TO7A 3RAMA 4OAEA 4LX9A 3CT9A 3NH4A 3WT4A 5JVLA 2C6PA 2PJ9A 2VEZA 1XBUA 1VHSA 2G3AA 3IU2A 5JGFA 4NGQA 4OIDA 4H89A 4YGOA 3T0TA 2ZPAA
chains in the Genus database with same CATH topology
4PXCA 4K3NA 3D7FA 5HVGA 5THWA 2I3CA 4PXEA 3MN8A 4OIWA 2PJ3A 4LQGA 5HXDA 3KI9A 4WWVA 4X3RA 2PJBA 1CP6A 4IHMA 5LRJA 1ELMP 1LOKA 4FUUA 3KZWA 4P4FA 3WC6A 2GU2A 2J9AA 3K2KA 4BD9A 3H8EA 1YMEA 4P4IA 2JBJA 2PJ2A 3NA6A 4C9EA 4EMEA 1F2OA 4MCRA 3WABA 3BI0A 1UWYA 3NH8A 1KWMA 4MHZA 2ZEMA 5D8NA 2V8GA 4OC3A 4F8ZA 4CDKA 3KASA 4ZYQA 2V8DA 4P4JA 3VH9A 3FF3A 2AFZA 4F9UA 1JQGA 3DGVA 4JZ0A 5LYIA 4R7MA 4A94A 1ZG8A 4C9AA 1LANA 1ZLHA 3D67A 4X2TA 3S9NA 4YWYA 4NGPA 4PXBA 4R76A 3KL9A 3IEHA 2CTBA 4P4DA 1VHOA 4F9VA 4CDJA 4P45A 2ZOFA 1ZG7A 3I6SA 5LYFA 2V77A 3B3TA 1FNOA 3N5FA 3MRUA 2ZOGA 2PJ5A 3B35A 2O4HA 4ZI6A 4MHNA 2ZENA 1HEEA 5LYDA 4ZX8A 3GB0A 2GP4A 5HVHA 2Q4ZA 2EWBA 2EK8A 2IQ6A 1HDUA 4UF4A 4MMOA 2AFUA 2XEGA 2CTCA 3FX6A 3QNVA 3IC1A 5ELYA 4YN3A 4PXDA 2ZEPA 4P4BA 2AFXA 1YSJA 4UIAA 4G1PA 2BO9A 3PBEA 3PB4X 4UIBA 5DS0A 5F09A 4C8PA 3SJGA 4C85A 2ZEFA 3BHXA 3PB6X 4JYWA 1XJOA 4EFDA 2AFMA 8CPAA 4OP4A 4ZY2A 2NSMA 4C8FA 4P4EA 2JEWA 4FAIA 5JH9A 2ZEGA 1TKFA 2XEIA 2VL1A 4OC2A 4MRIA 3PFOA 3TC8A 4IAVA 4OC1A 1LAPA 2AFWA 4WJBA 3FJUA 1YW6A 3D7DA 1PCAA 2POKA 3I74A 3SI1A 4A38A 4EWTA 2ANPA 3SJXA 1ARLA 1GYTA 3LMSA 1QMUA 4OC5A 1YLOA 4H2KA 4NGNA 3V7ZA 4MCSA 2F7VA 1VGYA 3T8WA 4TJVA 2ZEHA 3FEDA 1LAMA 1OBRA 4OC0A 2AFOA 1Z8LA 2Q43A 3SI2A 5CBMA 2PVWA 2PIZA 3FVLA 4MCQA 1ARMA 4W9YA 1BLLE 1TKHA 3PRTA 1QQ9A 3EIFA 3K9TA 5K8PA 4DJLA 3FEEA 4UEEA 2C5QA 2PJAA 4OMEA 4MHPA 1PYTB 4MXUA 3B3SA 4DUKA 1Y7EA 3D4UA 5IB9A 2PCUA 6CPAA 1Y0RA 3CPAA 2GLJA 3B3CA 4PPZA 4C8AA 3HLPA 3PB8X 1TKJA 4R8FA 4ONWA 3VARA 1VIXA 3CDXA 3SJEA 2PIYA 4TNUA 4B6ZA 3GUXA 1Y9ZA 1XRYA 3LWUA 3S9LA 4C8TA 5CPAA 1EE3P 3IO1A 1BAVA 1RTQA 3PBBA 3H8FA 1TXRA 3DLJA 4P44A 3FMCA 1ELLP 1ZLIA 2EK9A 5J1QA 2RFHA 2PJ0A 4C9RA 1VHEA 1DE4C 4NFRA 4YU9A 3JRUA 3IIBA 1ZG9A 5LRGA 4KNGE 1XMBA 3B7IA 4NGMA 4FBEA 4RUHA 2ZELA 3FECA 2CF4A 4NGRA 3L2NA 3HUVA 2FVGA 7CPAA 3I1UA 1F2PA 3SJFA 1IGBA 3D7HA 5JM6A 4NJRA 4ZY1A 1TF9A 1Z2LA 1BPMA 4TWEA 1CP7A 4C86A 4P6YA 2XEJA 4C84A 2PJ8A 3ISXA 4ZY0A 2QYVA 1F57A 2PJ1A 4C99A 2OOTA 4NGTA 1FT7A 1NSAA 4UEZA 1V6CA 2PE3A 2BOAA 5LYLA 1XF1A 4Q7AA 4C9VA 4Z65A 4TJXA 1TF8A 2NYQA 3PB7X 3PFEA 5LRKA 1IY7A 3PEIA 2PRQA 5K8NA 5I4MA 4MHYA 4GM5A 5K8OA 3RZAA 4MCPA 4UEFA 2WZNA 2GLFA 3WC5A 1XFOA 1AMPA 5K8MA 4OC4A 4KSIA 3GLJA 3H8GA 3KGQA 3BI1A 3RBUA 2QVPA 3IWWA 1WVMA 1CPXA 1Z5RA 4AXVA 4IK2A 3S9MA 2CIJA 3PB9X 2G9DA 3B2YA 1HDQA 4C9UA 3IFEA 2PJ6A 3ISZA 3WC7A 3KHZA 3NH5A 4C8CA 2JBKA 4A37A 5HVFA 1LFWA 2DEAA 1R43A 4R6TA 3D66A 1H8LA 1M4LA 2V8VA 1CPSA 2HB6A 1Q7LA 3CPXA 2C6CA 4NGSA 4DYOA 2PVVA 3ICUA 2PJ4A 2ZEEA 4OKOA 3SI0A 4NJQA 2HC9A 1Y0YA 2ABZA 2V8HA 2XEFA 5IR2A 3TX8A 2BCOA 4O23A 1CBXA 2C6GA 2C1CA 3D68A 1LCPA 5D29A 1BPNA 2GREA 3KHXA 2RB7A 3B3WA 3KQZA 4FWUA 2O53A 4ZX9A 1R3NA 2PJ7A 1CX8A 3VTAA 2ZEDA 1DTDA 4CPAA 2WYRA 3KR4A 3B3VA 2AFSA 3KR5A 2PJCA 1AYEA 3IJ3A 2ZEOA 2F8HA 2OR4A 3NFZA 4A39A 1YW4A 2Q51A 3VATA 3KQXA 2IMOA 3FH4A 4C8UA 3D7GA 3BXMA 2IJZA 2QJ8A 4X8IA 1CG2A 4PQAA 3V38A 4P10A 3RAMA 3WT4A 3CT9A 3NH4A 2C6PA 2PJ9A 1XBUA 5JGFA 4NGQA 4OIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXC A;  4K3N A;  3D7F A;  5HVG A;  5THW A;  2I3C A;  4PXE A;  3MN8 A;  4OIW A;  2PJ3 A;  4LQG A;  5HXD A;  3KI9 A;  4WWV A;  4X3R A;  2PJB A;  1CP6 A;  4IHM A;  5LRJ A;  1ELM P;  1LOK A;  4FUU A;  3KZW A;  4P4F A;  3WC6 A;  2GU2 A;  2J9A A;  3K2K A;  4BD9 A;  3H8E A;  1YME A;  4P4I A;  2JBJ A;  2PJ2 A;  3NA6 A;  4C9E A;  4EME A;  1F2O A;  4MCR A;  3WAB A;  3BI0 A;  1UWY A;  3NH8 A;  1KWM A;  4MHZ A;  2ZEM A;  5D8N A;  2V8G A;  4OC3 A;  4F8Z A;  4CDK A;  3KAS A;  4ZYQ A;  2V8D A;  4P4J A;  3VH9 A;  3FF3 A;  2AFZ A;  4F9U A;  1JQG A;  3DGV A;  4JZ0 A;  5LYI A;  4R7M A;  4A94 A;  1ZG8 A;  4C9A A;  1LAN A;  1ZLH A;  3D67 A;  4X2T A;  3S9N A;  4YWY A;  4NGP A;  4PXB A;  4R76 A;  3KL9 A;  3IEH A;  2CTB A;  4P4D A;  1VHO A;  4F9V A;  4CDJ A;  4P45 A;  2ZOF A;  1ZG7 A;  3I6S A;  5LYF A;  2V77 A;  3B3T A;  1FNO A;  3N5F A;  3MRU A;  2ZOG A;  2PJ5 A;  3B35 A;  2O4H A;  4ZI6 A;  4MHN A;  2ZEN A;  1HEE A;  5LYD A;  4ZX8 A;  3GB0 A;  5HVH A;  2Q4Z A;  2EWB A;  2EK8 A;  2IQ6 A;  1HDU A;  4UF4 A;  4MMO A;  2AFU A;  2XEG A;  2CTC A;  3FX6 A;  3QNV A;  3IC1 A;  5ELY A;  4YN3 A;  4PXD A;  2ZEP A;  4P4B A;  2AFX A;  1YSJ A;  4UIA A;  4G1P A;  2BO9 A;  3PBE A;  3PB4 X;  4UIB A;  5DS0 A;  5F09 A;  4C8P A;  3SJG A;  4C85 A;  2ZEF A;  3BHX A;  3PB6 X;  4JYW A;  1XJO A;  4EFD A;  2AFM A;  8CPA A;  4OP4 A;  4ZY2 A;  2NSM A;  4C8F A;  4P4E A;  2JEW A;  4FAI A;  5JH9 A;  2ZEG A;  1TKF A;  2XEI A;  2VL1 A;  4OC2 A;  4MRI A;  3PFO A;  3TC8 A;  4IAV A;  4OC1 A;  1LAP A;  2AFW A;  4WJB A;  3FJU A;  1YW6 A;  3D7D A;  1PCA A;  2POK A;  3I74 A;  3SI1 A;  4A38 A;  4EWT A;  2ANP A;  3SJX A;  1ARL A;  1GYT A;  3LMS A;  1QMU A;  4OC5 A;  1YLO A;  4H2K A;  4NGN A;  3V7Z A;  4MCS A;  2F7V A;  1VGY A;  3T8W A;  4TJV A;  2ZEH A;  3FED A;  1LAM A;  1OBR A;  4OC0 A;  2AFO A;  1Z8L A;  2Q43 A;  3SI2 A;  5CBM A;  2PVW A;  2PIZ A;  3FVL A;  4MCQ A;  1ARM A;  4W9Y A;  1BLL E;  1TKH A;  3PRT A;  1QQ9 A;  3EIF A;  3K9T A;  5K8P A;  4DJL A;  3FEE A;  4UEE A;  2PJA A;  4OME A;  4MHP A;  1PYT B;  4MXU A;  3B3S A;  4DUK A;  1Y7E A;  3D4U A;  5IB9 A;  2PCU A;  6CPA A;  1Y0R A;  3CPA A;  2GLJ A;  3B3C A;  4PPZ A;  4C8A A;  3HLP A;  3PB8 X;  1TKJ A;  4R8F A;  4ONW A;  3VAR A;  1VIX A;  3CDX A;  3SJE A;  2PIY A;  4TNU A;  4B6Z A;  3GUX A;  1Y9Z A;  1XRY A;  3LWU A;  3S9L A;  4C8T A;  5CPA A;  1EE3 P;  3IO1 A;  1BAV A;  1RTQ A;  3PBB A;  3H8F A;  1TXR A;  3DLJ A;  4P44 A;  3FMC A;  1ELL P;  1ZLI A;  2EK9 A;  5J1Q A;  2RFH A;  2PJ0 A;  4C9R A;  1VHE A;  1DE4 C;  4NFR A;  4YU9 A;  3JRU A;  3IIB A;  1ZG9 A;  5LRG A;  4KNG E;  1XMB A;  3B7I A;  4NGM A;  4FBE A;  4RUH A;  2ZEL A;  3FEC A;  2CF4 A;  4NGR A;  3L2N A;  3HUV A;  2FVG A;  7CPA A;  3I1U A;  1F2P A;  3SJF A;  1IGB A;  3D7H A;  5JM6 A;  4NJR A;  4ZY1 A;  1TF9 A;  1Z2L A;  1BPM A;  4TWE A;  1CP7 A;  4C86 A;  4P6Y A;  2XEJ A;  4C84 A;  2PJ8 A;  3ISX A;  4ZY0 A;  2QYV A;  1F57 A;  2PJ1 A;  4C99 A;  2OOT A;  4NGT A;  1FT7 A;  1NSA A;  4UEZ A;  1V6C A;  2PE3 A;  2BOA A;  5LYL A;  1XF1 A;  4Q7A A;  4C9V A;  4Z65 A;  4TJX A;  1TF8 A;  2NYQ A;  3PB7 X;  3PFE A;  5LRK A;  1IY7 A;  3PEI A;  2PRQ A;  5K8N A;  5I4M A;  4MHY A;  4GM5 A;  5K8O A;  3RZA A;  4MCP A;  4UEF A;  2WZN A;  2GLF A;  3WC5 A;  1XFO A;  1AMP A;  5K8M A;  4OC4 A;  4KSI A;  3GLJ A;  3H8G A;  3KGQ A;  3BI1 A;  3RBU A;  2QVP A;  3IWW A;  1WVM A;  1CPX A;  1Z5R A;  4AXV A;  4IK2 A;  3S9M A;  2CIJ A;  3PB9 X;  2G9D A;  3B2Y A;  1HDQ A;  4C9U A;  3IFE A;  2PJ6 A;  3ISZ A;  3WC7 A;  3KHZ A;  3NH5 A;  4C8C A;  2JBK A;  4A37 A;  5HVF A;  1LFW A;  2DEA A;  1R43 A;  4R6T A;  3D66 A;  1H8L A;  1M4L A;  2V8V A;  1CPS A;  2HB6 A;  1Q7L A;  3CPX A;  2C6C A;  4NGS A;  4DYO A;  2PVV A;  3ICU A;  2PJ4 A;  2ZEE A;  4OKO A;  3SI0 A;  4NJQ A;  2HC9 A;  1Y0Y A;  2ABZ A;  2V8H A;  2XEF A;  3TX8 A;  2BCO A;  4O23 A;  1CBX A;  2C6G A;  2C1C A;  3D68 A;  1LCP A;  5D29 A;  1BPN A;  2GRE A;  3KHX A;  2RB7 A;  3B3W A;  3KQZ A;  4FWU A;  2O53 A;  4ZX9 A;  1R3N A;  2PJ7 A;  1CX8 A;  3VTA A;  2ZED A;  1DTD A;  4CPA A;  2WYR A;  3KR4 A;  3B3V A;  2AFS A;  3KR5 A;  2PJC A;  1AYE A;  3IJ3 A;  2ZEO A;  2F8H A;  2OR4 A;  3NFZ A;  4A39 A;  1YW4 A;  2Q51 A;  3VAT A;  3KQX A;  2IMO A;  3FH4 A;  4C8U A;  3D7G A;  3BXM A;  2IJZ A;  2QJ8 A;  4X8I A;  1CG2 A;  4PQA A;  3V38 A;  4P10 A;  3RAM A;  3WT4 A;  3CT9 A;  3NH4 A;  2C6P A;  2PJ9 A;  1XBU A;  5JGF A;  4NGQ A;  4OID A; 
#chains in the Genus database with same CATH topology
 2B5G A;  2Y1N A;  4PXC A;  1MJ9 A;  3D7F A;  4K3N A;  1KUY A;  5THW A;  5HVG A;  2EZC A;  2I3C A;  3GYA A;  4PXE A;  3I9S A;  3D8P A;  1YX0 A;  5CNP A;  1NXJ A;  3MN8 A;  4OIW A;  1NE9 A;  4XNH C;  1QSR A;  2PJ3 A;  3MGD A;  2Q7B A;  4LQG A;  2ZW5 A;  2Q4V A;  3W91 A;  5HXD A;  3LOD A;  5G1Z A;  1XEB A;  3KI9 A;  1B6B A;  4QC6 A;  3ZZI A;  2ZW6 A;  3SR3 A;  3BUM B;  4NF1 A;  2DIK A;  2R98 A;  4WWV A;  4X3R A;  2PJB A;  4MI4 A;  1CP6 A;  1A9X B;  1BXR B;  4HNY B;  5HKY A;  1XMT A;  4KLW A;  5C82 A;  4R87 A;  3RO0 A;  3BUN B;  4IHM A;  5LRJ A;  1ELM P;  2FM4 A;  1LOK A;  2FIW A;  4JWP A;  3BUW B;  4FUU A;  3KZW A;  4P4F A;  2G0B A;  4M8D A;  2OLS A;  3FBU A;  3VRQ A;  3PT1 A;  2H5M A;  5G20 A;  5KTA A;  3BLN A;  1A2Z A;  4B5O A;  3WC6 A;  2GU2 A;  2J9A A;  4QBJ A;  2FXF A;  5JQ4 A;  4UBR A;  4A30 A;  3K2K A;  4QUS A;  4FD6 A;  4BD9 A;  1M4D A;  4BMH A;  2FE7 A;  3NE7 A;  5G22 A;  3H8E A;  2OB0 A;  4PSX A;  1YME A;  1YLE A;  4P4I A;  2UV8 G;  3FB3 A;  1VBG A;  5F1Y A;  1Z4R A;  2FT0 A;  2Z3P A;  1IYL A;  4RN7 A;  3R1K A;  2JBJ A;  1X10 A;  4IUS A;  4NCZ A;  2PJ2 A;  3NA6 A;  5F9M A;  3GIU A;  4C9E A;  4KLV A;  2VI7 A;  3TFY A;  4EME A;  4B11 A;  4B5P B;  3TLY A;  3B8G A;  4CAE A;  4JVO A;  1ZL0 A;  3QAH A;  3RNZ A;  1F2O A;  4MCR A;  2EZA A;  3WAB A;  3BI0 A;  4MFP A;  1IU8 A;  1UWY A;  3VRR A;  3EO4 A;  3NH8 A;  1KWM A;  4MHZ A;  2ZEM A;  5D8N A;  2V8G A;  3FIX A;  3EZA A;  4OC3 A;  3BJ8 A;  2VZZ A;  4EYS A;  3KKW A;  5J8F A;  4F8Z A;  5AG6 A;  3D3S A;  3KAS A;  4ZYQ A;  2V8D A;  4CDK A;  4P4J A;  2O28 A;  2AFZ A;  3FF3 A;  3BUO B;  3VH9 A;  4F9U A;  1JQG A;  5FVJ A;  2VZY A;  1C30 B;  3G23 A;  3DGV A;  4JZ0 A;  1Y9K A;  2B4J C;  3PFV A;  1ZG8 A;  3VRP A;  5AXI A;  1BO4 A;  1LAN A;  1ZLH A;  2ODF A;  3S9N A;  3CZX A;  3D67 A;  4JXR A;  4X2T A;  4YWY A;  3IU1 A;  4NGP A;  1YQE A;  4PXB A;  4R76 A;  4AG7 A;  3TLG A;  3TLC A;  1KUV A;  3EZB A;  4BPU B;  3KL9 A;  2OZH A;  2R7H A;  2J8R A;  3IEH A;  4YFJ A;  1MJA A;  3OP0 A;  2CTB A;  2PCN A;  5IV0 A;  4P4D A;  1VHO A;  4F9V A;  1EO0 A;  3TYX A;  1IB1 E;  2YJT A;  3LAC A;  4A4C A;  4Y49 C;  4P45 A;  4CDJ A;  2DF5 A;  2ZOF A;  3R9E A;  1JDE A;  1ZG7 A;  2R1I A;  4KZT A;  5E96 A;  1I12 A;  3I6S A;  1I21 A;  2V77 A;  5LYF A;  3B3T A;  1FNO A;  1QSN A;  3N5F A;  3MRU A;  3EY5 A;  2CXA A;  3UY5 A;  2ZOG A;  4KOU A;  4A32 A;  2PJ5 A;  3B35 A;  2O4H A;  2JDD A;  4ZI6 A;  4MHN A;  2BSW A;  2ZEN A;  1HEE A;  1ON0 A;  4PV6 A;  3TLB A;  4UFV A;  5LYD A;  2B3U A;  1DIK A;  4COB A;  4R3K A;  4ZX8 A;  3G3S A;  4CGM A;  4CGP A;  3GB0 A;  2GP4 A;  4FD4 A;  3KRV A;  5HVH A;  1PUA A;  2A4N A;  2Q4Z A;  4EVY A;  1NMT A;  2EWB A;  2EK8 A;  4HKF A;  4E0A A;  2IQ6 A;  3R95 A;  4PSW A;  1J4J A;  2VBQ A;  1YR0 A;  2HQY A;  1HDU A;  1Q2Y A;  2PQ8 A;  4MMO A;  4UF4 A;  1KEE B;  2AFU A;  4R3L A;  2XEG A;  4XNH B;  2CTC A;  3FX6 A;  4XPK A;  2PR8 A;  2I00 A;  2REF A;  3QNV A;  2ZW4 A;  2WPW A;  2DPT A;  4PK2 A;  1Q2D A;  3DR8 A;  5ELY A;  3IC1 A;  4Q38 A;  2DLA A;  1TIQ A;  4AB7 A;  2XPP A;  4KOT A;  4B14 A;  4UFW A;  1Z8W A;  2Q44 A;  1IOF A;  4PXD A;  3QAY A;  3S6G A;  2ZEP A;  3BUX B;  3JTK A;  4ZGY B;  1KC7 A;  4P4B A;  2AFX A;  4CAW A;  1YSJ A;  2P0W A;  4UIA A;  1RO5 A;  4G1P A;  3DNS A;  1X12 A;  2BO9 A;  4KVM E;  3W6X A;  3PBE A;  2FIA A;  3PB4 X;  3PZJ A;  4UIB A;  5DS0 A;  1VI4 A;  4CO9 A;  5F09 A;  2B3V A;  4C8P A;  1WJT A;  1Z8X A;  3SJG A;  1XOV A;  5F49 A;  3TCV A;  4C85 A;  2ZEF A;  3BHX A;  4C7H A;  1QST A;  3EFA A;  1XF8 A;  3PB6 X;  4JYW A;  4HPS A;  1QSM A;  1XJO A;  4KSF A;  3R96 A;  4EFD A;  1Y9W A;  3SXN A;  4UCM A;  1Y7R A;  2J8M A;  2AFM A;  4JXQ A;  2AE6 A;  3E0K A;  3ZJ0 A;  8CPA A;  1B87 A;  5A27 A;  4UCN A;  1L0C A;  4OP4 A;  4ZY2 A;  1M4G A;  2NSM A;  1GGO A;  4C8F A;  2RC4 A;  4P4E A;  2JEW A;  4FD7 A;  4FAI A;  1J3L A;  2EBJ A;  5JH9 A;  2ZEG A;  3C8O A;  3WR7 A;  1TKF A;  2XEI A;  2VL1 A;  4OC2 A;  3P2H A;  4MFL A;  2Q0Y A;  1WK4 A;  4MRI A;  3PFO A;  3TC8 A;  5F5X A;  4IAV A;  3IGR A;  2B5G B;  4OC1 A;  2R8V A;  1LAP A;  5HKW A;  2AFW A;  3VWE A;  2ZXV A;  4UCP A;  2JLM A;  2J8N A;  3FJU A;  1YW6 A;  4WJB A;  3D7D A;  4BTF A;  2CNM A;  1WWZ A;  3W6S A;  4CS0 B;  1PCA A;  3H4Q A;  2POK A;  5EC4 A;  3I74 A;  1I1D A;  4BPW B;  4HNW B;  3SI1 A;  4A38 A;  4EWT A;  2ANP A;  4F0Y A;  3SJX A;  1ARL A;  1GYT A;  3A9L A;  3PGP A;  3LMS A;  4YN3 A;  2Z3O A;  3P2F A;  1QMU A;  4JJX A;  4OC5 A;  1Z9U A;  1YLO A;  4H2K A;  4QVT A;  4NGN A;  4MY3 A;  3V7Z A;  3NOJ A;  4A95 A;  4MCS A;  2F7V A;  2VKZ G;  1JWQ A;  2CNS A;  2JEV A;  5JPH A;  1VGY A;  4MFJ A;  2Z11 A;  3TLA A;  3T8W A;  2GIV A;  5H84 A;  4B13 A;  4TJV A;  1S60 A;  3FED A;  2ZEH A;  1S7F A;  1LAM A;  4OLL A;  1OBR A;  1UFH A;  4OC0 A;  1P0H A;  1Z8L A;  2AFO A;  2C27 A;  2Q43 A;  4KUB A;  3HPG G;  3SI2 A;  4KSA A;  5CBM A;  1CJW A;  4Q36 A;  1M6V B;  2GE3 A;  4MY0 A;  4NSQ A;  2CNT A;  1IIC A;  3R9F A;  2VQY A;  2PVW A;  1ZO0 A;  2PIZ A;  2D0O A;  3FVL A;  4MCQ A;  3GY9 A;  2EZB A;  3T07 A;  1ARM A;  4ONU A;  4W9Y A;  1BLL E;  1TKH A;  3PRT A;  1QQ9 A;  4C68 A;  1JDB C;  3EIF A;  1CM0 A;  3K9T A;  3HPH E;  4DJL A;  5K8P A;  1YGH A;  4INJ A;  5FD8 A;  3FEE A;  3TE4 A;  4UEE A;  2C5Q A;  2PJA A;  4OME A;  4YRH A;  4IF5 A;  2QEC A;  4MHP A;  2FSR A;  4B10 A;  3IWG A;  5F13 A;  4H6U A;  4KUA A;  2YNC C;  4E5S A;  3QB8 A;  1PYT B;  4MXU A;  1M4I A;  3B3S A;  2AUM A;  3T9Y A;  4DUK A;  1S7N A;  3S6K A;  2X7B A;  3VGO A;  2ATR A;  1Y7E A;  3U88 C;  2YGW A;  2P6F A;  3TT2 A;  3D4U A;  5IB9 A;  2PCU A;  1GHE A;  4M6G A;  5BY0 A;  5AGE A;  3OWC A;  6CPA A;  2QML A;  1YVK A;  3FYN A;  1EZA A;  1Y0R A;  3CPA A;  1N71 A;  4OAD A;  3BJ7 A;  2GLJ A;  1R57 A;  3B3C A;  4PPZ A;  4CGL A;  4C8A A;  4C2Z A;  3HLP A;  4RS2 A;  4A33 A;  2E28 A;  2PSW A;  4XPD B;  3PB8 X;  1TKJ A;  4R8F A;  4ONW A;  1YK3 A;  3VAR A;  1VIX A;  3CDX A;  2WUU A;  2JDC A;  3SJE A;  4J0N A;  4COG A;  2PIY A;  5AG5 A;  3I3G A;  1M1D A;  4TNU A;  5EMI A;  1B47 A;  1MK4 A;  3GUX A;  4MBU A;  4B6Z A;  2EO8 A;  2Z3M A;  4F0X A;  1XRY A;  3LWU A;  2N3A B;  3S9L A;  4C8T A;  5CPA A;  2HUZ A;  1EE3 P;  3IO1 A;  3TTH A;  2B4D B;  1BAV A;  2BUE A;  1RTQ A;  3ZNI A;  1IOI A;  3PBB A;  5F46 A;  4I49 A;  4RR2 B;  5DWM A;  3H8F A;  2AUN A;  2HI6 A;  5DWN A;  1TXR A;  3DLJ A;  4L8A A;  4P44 A;  3FMC A;  2X0S A;  5JYB A;  4BIN A;  1ELL P;  1QSO A;  1ZLI A;  1Q5X A;  2EK9 A;  4M3S A;  5J1Q A;  2RFH A;  1NBW A;  4MJX A;  2PJ0 A;  3FRM A;  4C9R A;  1VHE A;  1DE4 C;  4NFR A;  4NXY A;  2KCW A;  3JRU A;  3PLF B;  3F0A A;  4YU9 A;  4E8O A;  3IIB A;  1ZG9 A;  4GS4 A;  5LRG A;  4KNG E;  1PU9 A;  1XMB A;  4LQ6 A;  3B7I A;  4PK3 A;  4H1H A;  4KVX A;  2YJV A;  4NGM A;  4M6H A;  4FBE A;  4RUH A;  3F5B A;  2MP0 A;  2ZEL A;  3FEC A;  4KOR A;  4BBH A;  1IID A;  3F8K A;  2CF4 A;  1P4N A;  4NGR A;  2D4O A;  3D2P A;  5I0C A;  2PDO A;  3L2N A;  3HUV A;  3VWD A;  2FVG A;  4CAV A;  3EXN A;  3V8I A;  7CPA A;  5HH1 A;  3I1U A;  4FD5 A;  4X5K A;  1F2P A;  3NFQ A;  3SJF A;  2VXK A;  5F47 A;  5LYI A;  2DPS A;  3OB2 B;  3D7H A;  1IGB A;  5JM6 A;  4KOX A;  1S5K A;  5HKZ A;  2Z0Z A;  4NJR A;  2Z3N A;  4AVA A;  1XE4 A;  4ZY1 A;  3TLZ A;  2B58 A;  4CYO A;  1TF9 A;  4J3G A;  4U9Z A;  1Z2L A;  1S3Z A;  1BPM A;  4QB9 A;  1CP7 A;  4TWE A;  4AG9 A;  1OZP A;  2FS5 A;  4C86 A;  3SHP A;  2OH1 A;  2WPX A;  4P6Y A;  2HRO A;  2XEJ A;  3DDD A;  2PJ8 A;  4C9A A;  3ISX A;  4C84 A;  1XIX A;  4ZY0 A;  4AVB A;  3FXT A;  2QYV A;  3VRN A;  2GFQ A;  1F57 A;  1M44 A;  1U6M A;  2EUI A;  4UA3 A;  3TLE A;  3T05 A;  4CAX A;  3OB1 B;  2PJ1 A;  4C99 A;  2OOT A;  4NGT A;  1FT7 A;  3K9U A;  1NSA A;  3CXQ A;  4UEZ A;  1V6C A;  1NSL A;  1T36 B;  2PE3 A;  2BOA A;  4ORF A;  1FY7 A;  5LYL A;  1XF1 A;  4JD6 A;  4KOS A;  3D2M A;  4Q7A A;  3TOA A;  5KTC A;  4C9V A;  4M6I A;  4Z65 A;  2Z3L A;  4TJX A;  1TF8 A;  2YNE A;  5EBV A;  3T90 A;  1YRE A;  1KZF A;  4GXH A;  2NYQ A;  3PB7 X;  4CYQ A;  1ZYM A;  3PFE A;  5LRK A;  1Z8T A;  1S7K A;  1IY7 A;  2XPN A;  2Y0M A;  3PEI A;  2PRQ A;  3HMJ G;  4KOV A;  4U5Y A;  4MHY A;  3SXO A;  3R9G A;  4GM5 A;  5I4M A;  5K8N A;  5KTD A;  1VBH A;  5K8O A;  3U1B A;  4H6Z A;  2EVN A;  3RZA A;  4MCP A;  2XPL A;  3DSB A;  4UEF A;  2CY2 A;  4HNX B;  1SQH A;  2GLF A;  1IYK A;  2WZN A;  1CE8 B;  4UWI A;  3WC5 A;  1XFO A;  1AMP A;  3TO9 A;  5K8M A;  4KOY A;  1R61 A;  3JUW A;  4CAF A;  3G8W A;  4OC4 A;  3GKR A;  4KSI A;  1YVH A;  2QIR A;  4MI1 A;  3GLJ A;  3H8G A;  3KGQ A;  3BI1 A;  2HWG A;  4IIY A;  3T5M A;  2K5T A;  4E2A A;  2HV2 A;  4R7M A;  4UFX A;  5IB0 A;  2B0A A;  3JVN A;  3RBU A;  4MJ8 A;  2OZU A;  4CYN A;  1Z4E A;  4LUA A;  4A4B A;  2F5I A;  2QVP A;  3IWW A;  2ARH A;  2FCK A;  2NMT A;  4MFK A;  2P6G A;  4XPD C;  1WVM A;  1BOB A;  2D4P A;  1CPX A;  1Z5R A;  3TLG B;  4KVO E;  4MHD A;  2PC1 A;  4AXV A;  4GPL B;  4IK2 A;  5GCN A;  3S9M A;  2CIJ A;  2I79 A;  2Q7S A;  3PP9 A;  2PRB A;  3PB9 X;  2Z10 A;  2B4D A;  2XPO A;  2G9D A;  3CXP A;  4AVC A;  2B4B A;  1HDQ A;  1YVO A;  3B2Y A;  3IFE A;  5AG4 A;  4C9U A;  4ZBG A;  5H86 A;  3TOB A;  2GAN A;  5ISV A;  2P6E A;  2PJ6 A;  3ISZ A;  3WC7 A;  3KHZ A;  3NH5 A;  4C8C A;  2OZG A;  4IIX A;  4C7I A;  2Z3K A;  2R82 A;  2JBK A;  2Q04 A;  3IWE A;  3F9K C;  4A37 A;  5HVF A;  3O8Z A;  1Z9E A;  1C3O B;  1LFW A;  1CS0 B;  3S6H A;  2DEA A;  1R43 A;  4R6T A;  5J8C A;  4II9 A;  4M85 A;  2REE A;  1KBL A;  5BWA B;  4NEX A;  3D66 A;  3EC4 A;  1H8L A;  1M4L A;  1Q2C A;  2OU2 A;  1CPS A;  2HB6 A;  1Q7L A;  2V8V A;  4UWJ A;  4Y49 B;  2DXQ A;  3CPX A;  4B5P A;  2C6C A;  4NGS A;  4DYO A;  2PVV A;  3ICU A;  2PJ4 A;  4KOW A;  3TO6 A;  1RXT A;  2ZEE A;  3LD2 A;  1FBV A;  4L89 A;  4OKO A;  3SI0 A;  4CGN A;  4E94 A;  4JLY A;  4NJQ A;  4XPL A;  2CBL A;  5C88 A;  1V0C A;  2HC9 A;  1Y0Y A;  1Y9Z A;  2ABZ A;  2V8H A;  3FNC A;  2D0P A;  2BL1 A;  4C2X A;  2XEF A;  5IR2 A;  2Q4Y A;  5A28 A;  3TX8 A;  2BEI A;  4R57 A;  3NE8 A;  2BCO A;  4O23 A;  5AG7 A;  4A31 A;  1CBX A;  2C6G A;  2C1C A;  2PR1 A;  3D68 A;  4F6A A;  1LCP A;  4U9Y A;  4KS9 A;  2YNC A;  2Y1M A;  3DR6 A;  1EZB A;  1K4J A;  5D29 A;  1AUG A;  2G3T A;  1BPN A;  4RI1 A;  4BPX B;  5F48 A;  2GRE A;  1S7L A;  2FL4 A;  2RB7 A;  5J3X A;  1LRZ A;  3B3W A;  3KHX A;  3KQZ A;  4FWU A;  1VKC A;  2O53 A;  1MJB A;  4ZX9 A;  5K99 A;  1KUX A;  3CXS A;  1R3N A;  2ZW7 A;  2PJ7 A;  1CX8 A;  4CRZ B;  4CZ1 A;  1ZRS A;  5IX3 A;  3VTA A;  2ZED A;  1DTD A;  4CPA A;  2WYR A;  4DNC A;  5HMN A;  3KR4 A;  2AJ6 A;  3B3V A;  5G21 A;  2AFS A;  4CGO A;  3GJZ A;  3KR5 A;  2PJC A;  1AYE A;  3S6F A;  3IJ3 A;  2ZEO A;  2F8H A;  2OR4 A;  3NFZ A;  4CYP A;  4A94 A;  3H5Z A;  4A39 A;  1YW4 A;  3OAK A;  2Q51 A;  3VAT A;  3VRO A;  2IMO A;  3KQX A;  3C26 A;  3FH4 A;  4K30 A;  4C2Y A;  3K4I A;  3D7G A;  3N7Z A;  4MFQ A;  4R9M A;  3RYO A;  4C8U A;  2IL4 A;  3EZE A;  4MFZ A;  3BXM A;  2IJZ A;  2QJ8 A;  4X8I A;  1CG2 A;  2WSA A;  2YND A;  4CRY B;  4PQA A;  3V38 A;  4A2Z A;  4B12 A;  4P10 A;  3TO7 A;  3RAM A;  4OAE A;  4LX9 A;  3CT9 A;  3NH4 A;  3WT4 A;  5JVL A;  2C6P A;  2PJ9 A;  2VEZ A;  1XBU A;  1VHS A;  2G3A A;  3IU2 A;  5JGF A;  4NGQ A;  4OID A;  4H89 A;  4YGO A;  3T0T A;  2ZPA A; 
#chains in the Genus database with same CATH homology
 4PXC A;  4K3N A;  3D7F A;  5HVG A;  5THW A;  2I3C A;  4PXE A;  3MN8 A;  4OIW A;  2PJ3 A;  4LQG A;  5HXD A;  3KI9 A;  4WWV A;  4X3R A;  2PJB A;  1CP6 A;  4IHM A;  5LRJ A;  1ELM P;  1LOK A;  4FUU A;  3KZW A;  4P4F A;  3WC6 A;  2GU2 A;  2J9A A;  3K2K A;  4BD9 A;  3H8E A;  1YME A;  4P4I A;  2JBJ A;  2PJ2 A;  3NA6 A;  4C9E A;  4EME A;  1F2O A;  4MCR A;  3WAB A;  3BI0 A;  1UWY A;  3NH8 A;  1KWM A;  4MHZ A;  2ZEM A;  5D8N A;  2V8G A;  4OC3 A;  4F8Z A;  4CDK A;  3KAS A;  4ZYQ A;  2V8D A;  4P4J A;  3VH9 A;  3FF3 A;  2AFZ A;  4F9U A;  1JQG A;  3DGV A;  4JZ0 A;  5LYI A;  4R7M A;  4A94 A;  1ZG8 A;  4C9A A;  1LAN A;  1ZLH A;  3D67 A;  4X2T A;  3S9N A;  4YWY A;  4NGP A;  4PXB A;  4R76 A;  3KL9 A;  3IEH A;  2CTB A;  4P4D A;  1VHO A;  4F9V A;  4CDJ A;  4P45 A;  2ZOF A;  1ZG7 A;  3I6S A;  5LYF A;  2V77 A;  3B3T A;  1FNO A;  3N5F A;  3MRU A;  2ZOG A;  2PJ5 A;  3B35 A;  2O4H A;  4ZI6 A;  4MHN A;  2ZEN A;  1HEE A;  5LYD A;  4ZX8 A;  3GB0 A;  2GP4 A;  5HVH A;  2Q4Z A;  2EWB A;  2EK8 A;  2IQ6 A;  1HDU A;  4UF4 A;  4MMO A;  2AFU A;  2XEG A;  2CTC A;  3FX6 A;  3QNV A;  3IC1 A;  5ELY A;  4YN3 A;  4PXD A;  2ZEP A;  4P4B A;  2AFX A;  1YSJ A;  4UIA A;  4G1P A;  2BO9 A;  3PBE A;  3PB4 X;  4UIB A;  5DS0 A;  5F09 A;  4C8P A;  3SJG A;  4C85 A;  2ZEF A;  3BHX A;  3PB6 X;  4JYW A;  1XJO A;  4EFD A;  2AFM A;  8CPA A;  4OP4 A;  4ZY2 A;  2NSM A;  4C8F A;  4P4E A;  2JEW A;  4FAI A;  5JH9 A;  2ZEG A;  1TKF A;  2XEI A;  2VL1 A;  4OC2 A;  4MRI A;  3PFO A;  3TC8 A;  4IAV A;  4OC1 A;  1LAP A;  2AFW A;  4WJB A;  3FJU A;  1YW6 A;  3D7D A;  1PCA A;  2POK A;  3I74 A;  3SI1 A;  4A38 A;  4EWT A;  2ANP A;  3SJX A;  1ARL A;  1GYT A;  3LMS A;  1QMU A;  4OC5 A;  1YLO A;  4H2K A;  4NGN A;  3V7Z A;  4MCS A;  2F7V A;  1VGY A;  3T8W A;  4TJV A;  2ZEH A;  3FED A;  1LAM A;  1OBR A;  4OC0 A;  2AFO A;  1Z8L A;  2Q43 A;  3SI2 A;  5CBM A;  2PVW A;  2PIZ A;  3FVL A;  4MCQ A;  1ARM A;  4W9Y A;  1BLL E;  1TKH A;  3PRT A;  1QQ9 A;  3EIF A;  3K9T A;  5K8P A;  4DJL A;  3FEE A;  4UEE A;  2C5Q A;  2PJA A;  4OME A;  4MHP A;  1PYT B;  4MXU A;  3B3S A;  4DUK A;  1Y7E A;  3D4U A;  5IB9 A;  2PCU A;  6CPA A;  1Y0R A;  3CPA A;  2GLJ A;  3B3C A;  4PPZ A;  4C8A A;  3HLP A;  3PB8 X;  1TKJ A;  4R8F A;  4ONW A;  3VAR A;  1VIX A;  3CDX A;  3SJE A;  2PIY A;  4TNU A;  4B6Z A;  3GUX A;  1Y9Z A;  1XRY A;  3LWU A;  3S9L A;  4C8T A;  5CPA A;  1EE3 P;  3IO1 A;  1BAV A;  1RTQ A;  3PBB A;  3H8F A;  1TXR A;  3DLJ A;  4P44 A;  3FMC A;  1ELL P;  1ZLI A;  2EK9 A;  5J1Q A;  2RFH A;  2PJ0 A;  4C9R A;  1VHE A;  1DE4 C;  4NFR A;  4YU9 A;  3JRU A;  3IIB A;  1ZG9 A;  5LRG A;  4KNG E;  1XMB A;  3B7I A;  4NGM A;  4FBE A;  4RUH A;  2ZEL A;  3FEC A;  2CF4 A;  4NGR A;  3L2N A;  3HUV A;  2FVG A;  7CPA A;  3I1U A;  1F2P A;  3SJF A;  1IGB A;  3D7H A;  5JM6 A;  4NJR A;  4ZY1 A;  1TF9 A;  1Z2L A;  1BPM A;  4TWE A;  1CP7 A;  4C86 A;  4P6Y A;  2XEJ A;  4C84 A;  2PJ8 A;  3ISX A;  4ZY0 A;  2QYV A;  1F57 A;  2PJ1 A;  4C99 A;  2OOT A;  4NGT A;  1FT7 A;  1NSA A;  4UEZ A;  1V6C A;  2PE3 A;  2BOA A;  5LYL A;  1XF1 A;  4Q7A A;  4C9V A;  4Z65 A;  4TJX A;  1TF8 A;  2NYQ A;  3PB7 X;  3PFE A;  5LRK A;  1IY7 A;  3PEI A;  2PRQ A;  5K8N A;  5I4M A;  4MHY A;  4GM5 A;  5K8O A;  3RZA A;  4MCP A;  4UEF A;  2WZN A;  2GLF A;  3WC5 A;  1XFO A;  1AMP A;  5K8M A;  4OC4 A;  4KSI A;  3GLJ A;  3H8G A;  3KGQ A;  3BI1 A;  3RBU A;  2QVP A;  3IWW A;  1WVM A;  1CPX A;  1Z5R A;  4AXV A;  4IK2 A;  3S9M A;  2CIJ A;  3PB9 X;  2G9D A;  3B2Y A;  1HDQ A;  4C9U A;  3IFE A;  2PJ6 A;  3ISZ A;  3WC7 A;  3KHZ A;  3NH5 A;  4C8C A;  2JBK A;  4A37 A;  5HVF A;  1LFW A;  2DEA A;  1R43 A;  4R6T A;  3D66 A;  1H8L A;  1M4L A;  2V8V A;  1CPS A;  2HB6 A;  1Q7L A;  3CPX A;  2C6C A;  4NGS A;  4DYO A;  2PVV A;  3ICU A;  2PJ4 A;  2ZEE A;  4OKO A;  3SI0 A;  4NJQ A;  2HC9 A;  1Y0Y A;  2ABZ A;  2V8H A;  2XEF A;  5IR2 A;  3TX8 A;  2BCO A;  4O23 A;  1CBX A;  2C6G A;  2C1C A;  3D68 A;  1LCP A;  5D29 A;  1BPN A;  2GRE A;  3KHX A;  2RB7 A;  3B3W A;  3KQZ A;  4FWU A;  2O53 A;  4ZX9 A;  1R3N A;  2PJ7 A;  1CX8 A;  3VTA A;  2ZED A;  1DTD A;  4CPA A;  2WYR A;  3KR4 A;  3B3V A;  2AFS A;  3KR5 A;  2PJC A;  1AYE A;  3IJ3 A;  2ZEO A;  2F8H A;  2OR4 A;  3NFZ A;  4A39 A;  1YW4 A;  2Q51 A;  3VAT A;  3KQX A;  2IMO A;  3FH4 A;  4C8U A;  3D7G A;  3BXM A;  2IJZ A;  2QJ8 A;  4X8I A;  1CG2 A;  4PQA A;  3V38 A;  4P10 A;  3RAM A;  3WT4 A;  3CT9 A;  3NH4 A;  2C6P A;  2PJ9 A;  1XBU A;  5JGF A;  4NGQ A;  4OID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...