4P4DA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor mp1c
Total Genus 260
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
260
sequence length
696
structure length
687
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 260
structure length 687
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4dA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4dA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4dA02
3BXMA 2CIJA 3N5FA 3D7HA 4YN3A 3S9NA 4MMOA 4FAIA 2AFMA 4A94A 2DEAA 2GREA 3FX6A 2V8VA 2FVGA 3KZWA 3IIBA 3ISXA 1LANA 2PE3A 5LYIA 4TJVA 2GLJA 1XF1A 2ZEGA 3TC8A 4UF4A 2XEGA 3KL9A 3DLJA 3NH4A 3B3TA 4DUKA 4P4JA 4P4BA 1VGYA 3D68A 3HLPA 1Z8LA 3SJXA 3D66A 3PB9X 3BI1A 4PPZA 4C86A 4MXUA 3WABA 2ANPA 4O23A 1F57A 1XJOA 4PXCA 5LRJA 2BOAA 1HEEA 2AFUA 4A38A 2AFWA 1XMBA 1TKJA 4C84A 3BHXA 3IO1A 2C6PA 4EFDA 1CPXA 1V6CA 2PJ1A 1F2OA 5HXDA 3FF3A 1IGBA 4B6ZA 2BCOA 3K9TA 2IJZA 3GLJA 5LRKA 3PRTA 2G9DA 3ISZA 4C9EA 4UEZA 3RZAA 4DJLA 1BPNA 1M4LA 1BAVA 3B3WA 4P10A 3KQXA 1LOKA 4UIBA 4X3RA 2ZEFA 4K3NA 5LYDA 2JEWA 3KHXA 2IMOA 2PRQA 3I6SA 4MHYA 1NSAA 2PIZA 2PJ6A 4MCPA 1XRYA 3PB4X 4OIDA 5LYFA 7CPAA 4W9YA 1VHOA 4CPAA 1H8LA 4NFRA 4OC2A 4ONWA 4A39A 4IK2A 2WZNA 4OMEA 2XEIA 3D7DA 3B35A 2V8DA 4GM5A 3IC1A 3HUVA 3IJ3A 5JH9A 1Y0RA 2AFOA 3KGQA 2O4HA 3DGVA 4BD9A 1AMPA 4FWUA 4JZ0A 1Z5RA 1VIXA 2ZEHA 2F8HA 3FVLA 3MN8A 2VL1A 2HB6A 1YMEA 3SJEA 4ZY0A 5ELYA 3KR5A 3NFZA 3IWWA 5JGFA 1FT7A 2AFZA 1EE3P 3B3VA 2ZEOA 2ABZA 4R76A 2PJ3A 3H8FA 4MHNA 5K8NA 3V7ZA 2AFXA 4NGQA 4X2TA 1LCPA 4OC0A 3IEHA 4NGTA 4NJQA 2BO9A 3JRUA 4P4EA 3PB6X 2OR4A 1QQ9A 4C8PA 3B7IA 5F09A 2CTBA 3D7FA 4OP4A 4ZX8A 1CP6A 5CBMA 4G1PA 2EK9A 5K8OA 2EK8A 1TF8A 1VHEA 1AYEA 1CX8A 2ZEMA 3D7GA 2GU2A 2PJ2A 3I74A 4MCQA 4P4IA 4P44A 3KI9A 2ZOGA 1IY7A 4YU9A 3WC5A 4MRIA 4EMEA 4R7MA 2Q51A 3FH4A 4C8FA 3TX8A 3PB7X 3KHZA 8CPAA 4PXBA 2RFHA 1RTQA 3KQZA 1HDQA 2GLFA 4OC4A 4Z65A 4UEFA 2JBKA 4OC1A 2PJ8A 4WJBA 4C8UA 1WVMA 5D8NA 4PXDA 4UIAA 3B3CA 1TXRA 5HVFA 5J1QA 3LMSA 5JM6A 1ZLHA 3D4UA 3QNVA 3VH9A 3NA6A 2ZELA 3BI0A 4JYWA 3SI2A 4PQAA 2PJ7A 1DTDA 1OBRA 3IFEA 2Q43A 1CBXA 5K8MA 2HC9A 4X8IA 2CF4A 2WYRA 3WC6A 2J9AA 5HVHA 4RUHA 2PJ9A 3SJFA 2QYVA 4FBEA 1R43A 1ELMP 4C9RA 1ARMA 3MRUA 1Q7LA 1TF9A 4PXEA 4MCRA 4F8ZA 1QMUA 1HDUA 4ZY2A 2PJ4A 2PIYA 2OOTA 1JQGA 4MHPA 2IQ6A 4C8TA 4TNUA 1ARLA 4WWVA 4OKOA 1ZG8A 3H8EA 3LWUA 4A37A 4C9VA 4F9UA 2PJAA 2C6CA 4C85A 3L2NA 4P4FA 4NJRA 3FEDA 2ZENA 2C6GA 1CP7A 2NSMA 3V38A 4FUUA 2QVPA 3CPXA 4MCSA 2QJ8A 5DS0A 3VARA 4OC3A 5IB9A 1DE4C 2PJBA 5D29A 4Q7AA 1Y0YA 4ZY1A 3WT4A 1UWYA 4C99A 3PB8X 4C8AA 2O53A 2ZEDA 5HVGA 1Z2LA 3PBEA 4C8CA 3GUXA 4NGNA 4KSIA 1YSJA 3FMCA 2ZEPA 4IHMA 2JBJA 1XBUA 3VTAA 1KWMA 2NYQA 4TJXA 5LYLA 4IAVA 5THWA 4NGRA 1ZG7A 1F2PA 3NH5A 3B2YA 1R3NA 5CPAA 1XFOA 2POKA 2V77A 1TKHA 4P4DA 4R8FA 1BPMA 2I3CA 5I4MA 2XEFA 3EIFA 3PEIA 4UEEA 3NH8A 4YWYA 3T8WA 3K2KA 4H2KA 4ZX9A 2XEJA 2PVVA 3FEEA 1TKFA 4C9AA 3S9LA 3I1UA 1CPSA 3CDXA 4LQGA 1YW6A 2ZEEA 3SJGA 2V8HA 3CT9A 1ZG9A 4TWEA 6CPAA 3SI0A 4NGSA 2CTCA 3VATA 1ELLP 2PJ5A 2ZOFA 3FECA 1ZLIA 4ZYQA 1LAPA 3WC7A 3H8GA 2PJCA 3B3SA 4NGMA 4C9UA 4OC5A 2PCUA 1YLOA 1BLLE 4ZI6A 2RB7A 4CDJA 1PCAA 4MHZA 3RAMA 4CDKA 3RBUA 1CG2A 1GYTA 1YW4A 3PFOA 2EWBA 2AFSA 3KR4A 4EWTA 4NGPA 4AXVA 3S9MA 2C1CA 1Y7EA 4KNGE 4DYOA 3GB0A 1FNOA 3D67A 3SI1A 4P6YA 4OIWA 4F9VA 2PJ0A 3PBBA 3ICUA 1Y9ZA 4P45A 3PFEA 5K8PA 2V8GA 1LFWA 5LRGA 1LAMA 3KASA 2F7VA 2PVWA 3CPAA 3FJUA 1PYTB 4R6TA 2Q4ZA
chains in the Genus database with same CATH superfamily
3LD2A 3BXMA 2CIJA 4MFPA 3N5FA 3SHPA 3D7HA 4MI4A 1J3LA 4XNHB 1AUGA 4YN3A 3VGOA 2ZW7A 3S9NA 4MMOA 3O8ZA 4FAIA 4EYSA 2ZW5A 2OU2A 5E96A 1WJTA 5C82A 4R9MA 2AFMA 1IB1E 4A94A 1QSTA 2DEAA 2GREA 3FX6A 4B12A 2V8VA 2FVGA 4IF5A 1PUAA 3KZWA 2REEA 3R9EA 5BY0A 2Q44A 3IIBA 1LANA 2PE3A 3ISXA 3RYOA 5LYIA 4BPWB 3PP9A 2BUEA 1K4JA 2GLJA 4BINA 2Z3OA 1XF1A 4TJVA 2ZEGA 3TC8A 4UF4A 4E0AA 1IYLA 2Q4YA 2XEGA 2B5GB 2FIAA 3KL9A 3T07A 1Z9UA 4LQ6A 5JQ4A 4AG7A 3DLJA 3TT2A 3NH4A 3B3TA 4DUKA 2WPXA 2GFQA 4P4JA 2D0PA 4P4BA 4KOYA 1VGYA 5AG4A 3W6XA 3D68A 3HLPA 4KVXA 1Z8LA 4FD5A 3SJXA 5HKYA 4MJXA 5GCNA 3TLBA 3D66A 1IYKA 3PB9X 3BI1A 1SQHA 4UCNA 3TLCA 4PPZA 4C86A 4COBA 2QECA 4MXUA 2VI7A 2Z3NA 3C26A 3WABA 4KOXA 2ANPA 4O23A 1CJWA 1F57A 1KUVA 1XJOA 4PXCA 2BOAA 3G8WA 2Z0ZA 4KLWA 5DWMA 5LRJA 1HEEA 4KUBA 3P2FA 2Z3MA 4BTFA 2AFUA 5CNPA 2AFWA 4A38A 1XMBA 5H86A 1TKJA 1RO5A 2YNEA 5FD8A 4C84A 5F13A 3VRRA 1I12A 2C5QA 2EUIA 3BHXA 3DNSA 4RN7A 3S6HA 1XMTA 3IO1A 2C6PA 4MFKA 1YVOA 4MI1A 4EFDA 4UCPA 1N71A 4A30A 1CPXA 1B47A 1V6CA 2D0OA 4M6IA 4KUAA 1P0HA 2PJ1A 1F2OA 1YR0A 5HXDA 3FF3A 1IGBA 4B6ZA 2BCOA 4HNYB 1IOFA 3K9TA 2IJZA 4UCMA 5J8CA 1X10A 4A2ZA 5K99A 5IB0A 3GLJA 5LRKA 1UFHA 1Z8XA 3D2PA 3VWEA 3PRTA 2E28A 2G9DA 2Z11A 1MJAA 2MP0A 2PC1A 3ISZA 4XPKA 4C9EA 2Q4VA 2YGWA 4UEZA 1Z4EA 3RZAA 4KORA 4DJLA 1KEEB 3RO0A 1BPNA 1B6BA 1M4LA 1BAVA 1Q2DA 2QMLA 3DR6A 4OLLA 4IIYA 3B3WA 4P10A 3KQXA 3T90A 1LOKA 4UIBA 5G21A 1NXJA 4NEXA 4X3RA 2ZEFA 1I1DA 2B58A 4K3NA 5LYDA 4R3KA 3TCVA 4F0XA 1VBHA 4CRZB 2JEWA 2Q7SA 2IMOA 2G3AA 2PRQA 2VZYA 3KHXA 5AXIA 3TO7A 3I6SA 4MHYA 3OB2B 1NSAA 2PIZA 4A32A 2FE7A 5H84A 5F46A 3T5MA 2PJ6A 3MGDA 4MCPA 1XRYA 1Z8TA 3PB4X 4OIDA 5LYFA 3UY5A 1KBLA 2P0WA 2B4JC 1WWZA 2FSRA 2FXFA 7CPAA 1S7KA 4W9YA 3S6GA 1CS0B 1VHOA 2D4OA 3CXQA 2PQ8A 2VZZA 4CYPA 2A4NA 1S7NA 2OZUA 5J8FA 2AUNA 4Y49C 4E94A 4KLVA 4CPAA 5F47A 3D8PA 4ZGYB 4J3GA 3OB1B 1H8LA 2EZAA 4NFRA 4OC2A 4A31A 1TIQA 3G3SA 3BJ8A 3GKRA 3GIUA 4ONWA 4IK2A 4A39A 2WZNA 4CS0B 4OMEA 2XEIA 3D7DA 1IOIA 3B35A 2V8DA 4GM5A 2Y1MA 3BJ7A 2AE6A 1YVKA 1T36B 3F8KA 3GYAA 3HUVA 3IC1A 2J8NA 2EBJA 1ZRSA 4X5KA 3SXNA 3VROA 3VRNA 3IJ3A 1Y0RA 5JH9A 4KOTA 2AFOA 3KGQA 3TTHA 2O4HA 3DGVA 4L8AA 2Y1NA 4UBRA 3ZNIA 4BD9A 1AMPA 2JLMA 4HNXB 1IICA 4FWUA 5EBVA 2ZPAA 4JZ0A 1Z5RA 4CAWA 4BBHA 4JVOA 4BPUB 4AVAA 1VIXA 2ZEHA 1IU8A 3H4QA 4INJA 2F8HA 3FVLA 4NSQA 2PSWA 3MN8A 2BL1A 1MK4A 2VL1A 3PZJA 3OWCA 1I21A 2HB6A 3PFVA 1YMEA 3SR3A 3SJEA 1NE9A 2CY2A 4LUAA 5ELYA 4M3SA 3KR5A 4ZY0A 3NFZA 4H6ZA 3IWWA 2VQYA 5JGFA 3GY9A 2FCKA 4MHDA 2IL4A 1FT7A 1Z9EA 4F6AA 2EZBA 3U1BA 2AFZA 5HMNA 2DLAA 1S3ZA 2ZW4A 3D2MA 3T05A 1EE3P 1NMTA 2OZGA 3B3VA 3V8IA 1S60A 1NBWA 5IR2A 2ZEOA 5J3XA 1ZL0A 4PSWA 3JTKA 3IU2A 4XPLA 3N7ZA 4KZTA 2ABZA 4R76A 2PJ3A 2B4BA 3H8FA 4MHNA 3FBUA 1ZYMA 2F5IA 1VKCA 4H89A 5K8NA 5JYBA 3V7ZA 4AB7A 2AFXA 4NGQA 4QUSA 1LCPA 4X2TA 5ISVA 4MY0A 3EZAA 4OC0A 2PDOA 3DR8A 2PCNA 3IEHA 4PK2A 4NGTA 4NJQA 4UWIA 4LX9A 2BO9A 3JRUA 4QB9A 4P4EA 3CXSA 5A28A 3PB6X 2OR4A 4PV6A 4R57A 1Z8WA 4CRYB 1BXRB 1QQ9A 4B5PA 2Q7BA 3B7IA 5F09A 2CTBA 4C8PA 3D7FA 3ZZIA 4CYQA 4OP4A 1PU9A 2O28A 4ZX8A 1CP6A 4FD6A 1EO0A 2H5MA 4G1PA 5CBMA 2OLSA 2EK9A 5K8OA 4HPSA 1U6MA 2EK8A 4QC6A 1YVHA 3F5BA 1TF8A 1VHEA 3I3GA 1AYEA 1CX8A 3R9GA 2ZEMA 3D7GA 4DNCA 3TFYA 3K4IA 3TLZA 4H6UA 2GU2A 2PJ2A 3I74A 4KS9A 4JLYA 4MCQA 1X12A 2GANA 1QSRA 4U5YA 2N3AB 4P44A 4P4IA 4A4CA 3KI9A 2ZOGA 1IY7A 4HNWB 4YU9A 3T9YA 3WC5A 4C2XA 4YFJA 1YGHA 4MRIA 4EMEA 4MFLA 1M4GA 4R7MA 1YX0A 2ZXVA 3R1KA 5KTDA 1L0CA 1QSOA 2Q51A 3FIXA 3FH4A 5I0CA 1CE8B 4C8FA 4CGMA 2R98A 3TX8A 3EO4A 1CM0A 3QAHA 2Z3KA 3PB7X 3IWGA 3KHZA 8CPAA 4PXBA 2RFHA 4JXQA 5IV0A 1RTQA 3KQZA 2HI6A 1HDQA 4CYOA 3EZBA 2GLFA 2DXQA 3TLEA 2P6GA 3D3SA 1V0CA 4YRHA 4KSFA 3BUMB 4OC4A 4C2YA 2HV2A 4JD6A 4PSXA 4MY3A 2B0AA 5F9MA 4Z65A 4UEFA 2JBKA 4OC1A 2PJ8A 2P6EA 4WJBA 1M6VB 5AGEA 2X0SA 1Y9WA 4CAEA 4C8UA 3TO6A 4NF1A 5D8NA 4PXDA 1WVMA 2HROA 4UIAA 3B3CA 2P6FA 2QIRA 4K30A 5F48A 3QAYA 1TXRA 3K9UA 5HVFA 1LRZA 2YNDA 1WK4A 1M4DA 4B5OA 1GGOA 5J1QA 3LMSA 3TLGB 1S5KA 5JM6A 1ZLHA 3TYXA 1JWQA 2OH1A 2DPTA 1C3OB 3VRPA 2HWGA 1VHSA 1FBVA 2Z3PA 4CGLA 3D4UA 4HKFA 2C27A 1BOBA 4KVME 1R57A 2VEZA 3NE8A 4B13A 4C2ZA 3QNVA 1A9XB 1Y9KA 2FT0A 3EC4A 3FB3A 3H5ZA 3NA6A 2EO8A 2ZELA 3VH9A 1M44A 3BI0A 4JYWA 3LODA 3SI2A 2Y0MA 4PQAA 3PGPA 1B87A 4Y49B 2PJ7A 2Q0YA 2ATRA 1DTDA 1OBRA 3IFEA 3BUWB 2ARHA 4ORFA 4XPDC 3GJZA 2Q43A 1CBXA 4C7IA 2AJ6A 4E5SA 2OZHA 2HC9A 5K8MA 3R96A 4X8IA 4RR2B 2CF4A 3R9FA 2WYRA 3WC6A 2J9AA 4PK3A 5HVHA 4RUHA 5KTAA 2PJ9A 1NSLA 3TOAA 2B4DA 4M85A 3EXNA 3P2HA 4KSAA 3SJFA 2QYVA 4FBEA 1R43A 2VBQA 1ELMP 4CO9A 3OP0A 3PLFB 4BPXB 4C9RA 1YLEA 1ARMA 1Q5XA 3MRUA 1Q7LA 2YJTA 3CZXA 1TF9A 4PXEA 4MCRA 5A27A 4F8ZA 1QMUA 3HPHE 1HDUA 1C30B 4ZY2A 4H1HA 3FXTA 2PJ4A 2PIYA 4R3LA 4NCZA 1MJBA 2PR1A 4M6GA 5JPHA 3C8OA 3G23A 3FYNA 2OOTA 1JQGA 3T0TA 4MHPA 2IQ6A 4CGPA 4C8TA 2REFA 2HQYA 4MFZA 1P4NA 4L89A 1ARLA 4NXYA 3BUOB 4OKOA 4TNUA 3LACA 2DPSA 4Q36A 4WWVA 4YGOA 2FIWA 1ZG8A 4A4BA 3H8EA 3LWUA 5EC4A 4A37A 4U9ZA 4C9VA 4QVTA 4XNHC 4F9UA 2PJAA 2C6CA 2YNCA 2R1IA 4C85A 1A2ZA 3L2NA 1Q2CA 1XIXA 4U9YA 5F49A 1R61A 4P4FA 4B14A 4NJRA 3FEDA 1KUYA 2C6GA 1J4JA 1IIDA 2ZENA 3IU1A 4R87A 3I9SA 3R95A 1CP7A 2NSMA 3NE7A 3V38A 4AG9A 4FUUA 3HMJG 2CBLA 5AG7A 2XPLA 4KVOE 4UFXA 2FS5A 2WPWA 2WSAA 2QVPA 2B5GA 3CPXA 4MCSA 2QJ8A 5DS0A 4RI1A 3VARA 4OC3A 5IB9A 1DE4C 4GPLB 2NMTA 2PJBA 3OAKA 2I00A 2ZW6A 4ONUA 4CAVA 2VKZG 5D29A 1XOVA 4B5PB 4Q7AA 1Y0YA 3WR7A 1XF8A 4ZY1A 3WT4A 1UWYA 4C99A 2VXKA 2XPOA 3PB8X 4II9A 4C8AA 2O53A 4I49A 2ZEDA 2G0BA 2CNMA 2OB0A 4UA3A 5HVGA 1Z2LA 1GHEA 2JEVA 3GUXA 3PBEA 4Q38A 2UV8G 4UFVA 4C8CA 1YQEA 4A95A 1JDBC 4NGNA 3FRMA 4KSIA 5F1YA 1YSJA 3EFAA 2RC4A 2CNSA 3FMCA 3IWEA 2GE3A 1Q2YA 3TE4A 2ZEPA 5AG5A 1VBGA 2YJVA 3FNCA 3S6FA 1M1DA 2JBJA 4IHMA 4JWPA 1XBUA 3NOJA 3KRVA 3VTAA 1KWMA 4CGOA 2NYQA 1EZAA 4TJXA 3TOBA 1KC7A 5LYLA 2ODFA 4KOWA 3VWDA 2BSWA 3PT1A 4IAVA 5THWA 4NGRA 1ZG7A 2R8VA 5EMIA 4BMHA 1F2PA 3B8GA 3EZEA 4CZ1A 2WUUA 2DIKA 4OADA 3NH5A 2I79A 5JVLA 3NFQA 3B2YA 4KOSA 1XEBA 2FM4A 4AVCA 2R82A 4E8OA 1R3NA 5G20A 2Q04A 3JUWA 5CPAA 1YREA 4JXRA 3ZJ0A 4IUSA 4CAXA 3BUXB 4RS2A 1XFOA 2POKA 2V77A 4E2AA 2EZCA 4QBJA 5F5XA 1TKHA 2HUZA 3JVNA 4P4DA 4KOVA 1BPMA 2I3CA 4R8FA 2XEFA 2K5TA 5I4MA 3PEIA 1FY7A 3EIFA 4IIXA 2GIVA 1ON0A 4UEEA 2CNTA 3NH8A 4YWYA 3T8WA 3SXOA 1JDEA 3K2KA 4H2KA 4J0NA 2B3UA 3A9LA 3BLNA 4ZX9A 2XEJA 2PVVA 3RNZA 1OZPA 3KKWA 3FEEA 3QB8A 1TKFA 4C9AA 4CAFA 2R7HA 2EVNA 4M6HA 4MFJA 4OAEA 5HH1A 3E0KA 3S9LA 3I1UA 1CPSA 3CDXA 4COGA 5AG6A 4LQGA 2D4PA 5IX3A 2GP4A 3HPGG 1YW6A 3TLYA 2ZEEA 1Z4RA 3F0AA 3SJGA 2V8HA 3CT9A 1ZG9A 4TWEA 4CGNA 6CPAA 3SI0A 4NGSA 2CTCA 3S6KA 4FD7A 3VATA 3W91A 3TLGA 1ELLP 2PJ5A 2ZOFA 4C7HA 3FECA 1ZLIA 2B3VA 5DWNA 4ZYQA 1LAPA 3TLAA 3WC7A 2AUMA 3H8GA 2PJCA 1EZBA 2XPNA 2PRBA 3B3SA 2PR8A 3BUNB 4C68A 5HKZA 4NGMA 1DIKA 4C9UA 4OC5A 4MJ8A 4B11A 2Z10A 2PCUA 1YLOA 1BLLE 4AVBA 4ZI6A 3F9KC 1QSNA 4UFWA 4XPDB 3CXPA 5FVJA 2RB7A 4CDJA 4A33A 4JJXA 3U88C 1PCAA 2X7BA 4MHZA 1QSMA 1RXTA 4MFQA 5G22A 3RAMA 4CDKA 3RBUA 4FD4A 2J8RA 5BWAB 2CXAA 2XPPA 1CG2A 1GYTA 4F0YA 5HKWA 1YW4A 2Z3LA 2B4DB 3PFOA 4M8DA 2EWBA 3DSBA 2AFSA 1VI4A 4GXHA 3VRQA 3KR4A 4MBUA 2BEIA 3TO9A 4EWTA 4NGPA 5G1ZA 4ZBGA 4AXVA 3S9MA 2G3TA 2C1CA 3EY5A 4KOUA 1Y7RA 1XE4A 1Y7EA 4KNGE 1MJ9A 3GB0A 4DYOA 1FNOA 5C88A 3D67A 4UWJA 3SI1A 4P6YA 2DF5A 4GS4A 2FL4A 3IGRA 4OIWA 4F9VA 1KZFA 2PJ0A 3PBBA 4CYNA 1KUXA 1S7LA 3W6SA 1Y9ZA 1M4IA 4P45A 3PFEA 3ICUA 5K8PA 2V8GA 1LFWA 5LRGA 2J8MA 1LAMA 3KASA 1BO4A 2PVWA 2F7VA 1YK3A 2JDDA 1S7FA 3CPAA 3FJUA 1PYTB 4R6TA 3DDDA 4B10A 4EVYA 2JDCA 5KTCA 2KCWA 1ZO0A 2Q4ZA 2YNCC
chains in the Genus database with same CATH topology
3BXMA 2CIJA 3N5FA 3D7HA 4YN3A 3S9NA 4MMOA 4FAIA 2AFMA 4A94A 2DEAA 2GREA 3FX6A 2V8VA 2FVGA 3KZWA 3IIBA 3ISXA 1LANA 2PE3A 5LYIA 4TJVA 2GLJA 1XF1A 2ZEGA 3TC8A 4UF4A 2XEGA 3KL9A 3DLJA 3NH4A 3B3TA 4DUKA 4P4JA 4P4BA 1VGYA 3D68A 3HLPA 1Z8LA 3SJXA 3D66A 3PB9X 3BI1A 4PPZA 4C86A 4MXUA 3WABA 2ANPA 4O23A 1F57A 1XJOA 4PXCA 5LRJA 2BOAA 1HEEA 2AFUA 4A38A 2AFWA 1XMBA 1TKJA 4C84A 2C5QA 3BHXA 3IO1A 2C6PA 4EFDA 1CPXA 1V6CA 2PJ1A 1F2OA 5HXDA 3FF3A 1IGBA 4B6ZA 2BCOA 3K9TA 2IJZA 3GLJA 5LRKA 3PRTA 2G9DA 3ISZA 4C9EA 4UEZA 3RZAA 4DJLA 1BPNA 1M4LA 1BAVA 3B3WA 4P10A 3KQXA 1LOKA 4UIBA 4X3RA 2ZEFA 4K3NA 5LYDA 2JEWA 3KHXA 2IMOA 2PRQA 3I6SA 4MHYA 1NSAA 2PIZA 2PJ6A 4MCPA 1XRYA 3PB4X 4OIDA 5LYFA 7CPAA 4W9YA 1VHOA 4CPAA 1H8LA 4NFRA 4OC2A 4ONWA 4A39A 4IK2A 2WZNA 4OMEA 2XEIA 3D7DA 3B35A 2V8DA 4GM5A 3IC1A 3HUVA 3IJ3A 5JH9A 1Y0RA 2AFOA 3KGQA 2O4HA 3DGVA 4BD9A 1AMPA 4FWUA 4JZ0A 1Z5RA 1VIXA 2ZEHA 2F8HA 3FVLA 3MN8A 2VL1A 2HB6A 1YMEA 3SJEA 4ZY0A 5ELYA 3KR5A 3NFZA 3IWWA 5JGFA 1FT7A 2AFZA 1EE3P 3B3VA 5IR2A 2ZEOA 2ABZA 4R76A 2PJ3A 3H8FA 4MHNA 5K8NA 3V7ZA 2AFXA 4NGQA 4X2TA 1LCPA 4OC0A 3IEHA 4NGTA 4NJQA 2BO9A 3JRUA 4P4EA 3PB6X 2OR4A 1QQ9A 4C8PA 3B7IA 5F09A 2CTBA 3D7FA 4OP4A 4ZX8A 1CP6A 5CBMA 4G1PA 2EK9A 5K8OA 2EK8A 1TF8A 1VHEA 1AYEA 1CX8A 2ZEMA 3D7GA 2GU2A 2PJ2A 3I74A 4MCQA 4P4IA 4P44A 3KI9A 2ZOGA 1IY7A 4YU9A 3WC5A 4MRIA 4EMEA 4R7MA 2Q51A 3FH4A 4C8FA 3TX8A 3PB7X 3KHZA 8CPAA 4PXBA 2RFHA 1RTQA 3KQZA 1HDQA 2GLFA 4OC4A 4Z65A 4UEFA 2JBKA 4OC1A 2PJ8A 4WJBA 4C8UA 1WVMA 5D8NA 4PXDA 4UIAA 3B3CA 1TXRA 5HVFA 5J1QA 3LMSA 5JM6A 1ZLHA 3D4UA 3QNVA 3VH9A 3NA6A 2ZELA 3BI0A 4JYWA 3SI2A 4PQAA 2PJ7A 1DTDA 1OBRA 3IFEA 2Q43A 1CBXA 5K8MA 2HC9A 4X8IA 2CF4A 2WYRA 3WC6A 2J9AA 5HVHA 4RUHA 2PJ9A 3SJFA 2QYVA 4FBEA 1R43A 1ELMP 4C9RA 1ARMA 3MRUA 1Q7LA 1TF9A 4PXEA 4MCRA 4F8ZA 1QMUA 1HDUA 4ZY2A 2PJ4A 2PIYA 2OOTA 1JQGA 4MHPA 2IQ6A 4C8TA 4TNUA 1ARLA 4WWVA 4OKOA 1ZG8A 3H8EA 3LWUA 4A37A 4C9VA 4F9UA 2PJAA 2C6CA 4C85A 3L2NA 4P4FA 4NJRA 3FEDA 2ZENA 2C6GA 1CP7A 2NSMA 3V38A 4FUUA 2QVPA 3CPXA 4MCSA 2QJ8A 5DS0A 3VARA 4OC3A 5IB9A 1DE4C 2PJBA 5D29A 4Q7AA 1Y0YA 4ZY1A 3WT4A 1UWYA 4C99A 3PB8X 4C8AA 2O53A 2ZEDA 5HVGA 1Z2LA 3PBEA 4C8CA 3GUXA 4NGNA 4KSIA 1YSJA 3FMCA 2ZEPA 4IHMA 2JBJA 1XBUA 3VTAA 1KWMA 2NYQA 4TJXA 5LYLA 4IAVA 5THWA 4NGRA 1ZG7A 1F2PA 3NH5A 3B2YA 1R3NA 5CPAA 1XFOA 2POKA 2V77A 1TKHA 4P4DA 4R8FA 1BPMA 2I3CA 5I4MA 2XEFA 3EIFA 3PEIA 4UEEA 3NH8A 4YWYA 3T8WA 3K2KA 4H2KA 4ZX9A 2XEJA 2PVVA 3FEEA 1TKFA 4C9AA 3S9LA 3I1UA 1CPSA 3CDXA 2GP4A 4LQGA 1YW6A 2ZEEA 3SJGA 2V8HA 3CT9A 1ZG9A 4TWEA 6CPAA 3SI0A 4NGSA 2CTCA 3VATA 1ELLP 2PJ5A 2ZOFA 3FECA 1ZLIA 4ZYQA 1LAPA 3WC7A 3H8GA 2PJCA 3B3SA 4NGMA 4C9UA 4OC5A 2PCUA 1YLOA 1BLLE 4ZI6A 2RB7A 4CDJA 1PCAA 4MHZA 3RAMA 4CDKA 3RBUA 1CG2A 1GYTA 1YW4A 3PFOA 2EWBA 2AFSA 3KR4A 4EWTA 4NGPA 4AXVA 3S9MA 2C1CA 1Y7EA 4KNGE 4DYOA 3GB0A 1FNOA 3D67A 3SI1A 4P6YA 4OIWA 4F9VA 2PJ0A 3PBBA 3ICUA 1Y9ZA 4P45A 3PFEA 5K8PA 2V8GA 1LFWA 5LRGA 1LAMA 3KASA 2F7VA 2PVWA 3CPAA 3FJUA 1PYTB 4R6TA 2Q4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXM A;  2CIJ A;  3N5F A;  3D7H A;  4YN3 A;  3S9N A;  4MMO A;  4FAI A;  2AFM A;  4A94 A;  2DEA A;  2GRE A;  3FX6 A;  2V8V A;  2FVG A;  3KZW A;  3IIB A;  3ISX A;  1LAN A;  2PE3 A;  5LYI A;  4TJV A;  2GLJ A;  1XF1 A;  2ZEG A;  3TC8 A;  4UF4 A;  2XEG A;  3KL9 A;  3DLJ A;  3NH4 A;  3B3T A;  4DUK A;  4P4J A;  4P4B A;  1VGY A;  3D68 A;  3HLP A;  1Z8L A;  3SJX A;  3D66 A;  3PB9 X;  3BI1 A;  4PPZ A;  4C86 A;  4MXU A;  3WAB A;  2ANP A;  4O23 A;  1F57 A;  1XJO A;  4PXC A;  5LRJ A;  2BOA A;  1HEE A;  2AFU A;  4A38 A;  2AFW A;  1XMB A;  1TKJ A;  4C84 A;  3BHX A;  3IO1 A;  2C6P A;  4EFD A;  1CPX A;  1V6C A;  2PJ1 A;  1F2O A;  5HXD A;  3FF3 A;  1IGB A;  4B6Z A;  2BCO A;  3K9T A;  2IJZ A;  3GLJ A;  5LRK A;  3PRT A;  2G9D A;  3ISZ A;  4C9E A;  4UEZ A;  3RZA A;  4DJL A;  1BPN A;  1M4L A;  1BAV A;  3B3W A;  4P10 A;  3KQX A;  1LOK A;  4UIB A;  4X3R A;  2ZEF A;  4K3N A;  5LYD A;  2JEW A;  3KHX A;  2IMO A;  2PRQ A;  3I6S A;  4MHY A;  1NSA A;  2PIZ A;  2PJ6 A;  4MCP A;  1XRY A;  3PB4 X;  4OID A;  5LYF A;  7CPA A;  4W9Y A;  1VHO A;  4CPA A;  1H8L A;  4NFR A;  4OC2 A;  4ONW A;  4A39 A;  4IK2 A;  2WZN A;  4OME A;  2XEI A;  3D7D A;  3B35 A;  2V8D A;  4GM5 A;  3IC1 A;  3HUV A;  3IJ3 A;  5JH9 A;  1Y0R A;  2AFO A;  3KGQ A;  2O4H A;  3DGV A;  4BD9 A;  1AMP A;  4FWU A;  4JZ0 A;  1Z5R A;  1VIX A;  2ZEH A;  2F8H A;  3FVL A;  3MN8 A;  2VL1 A;  2HB6 A;  1YME A;  3SJE A;  4ZY0 A;  5ELY A;  3KR5 A;  3NFZ A;  3IWW A;  5JGF A;  1FT7 A;  2AFZ A;  1EE3 P;  3B3V A;  2ZEO A;  2ABZ A;  4R76 A;  2PJ3 A;  3H8F A;  4MHN A;  5K8N A;  3V7Z A;  2AFX A;  4NGQ A;  4X2T A;  1LCP A;  4OC0 A;  3IEH A;  4NGT A;  4NJQ A;  2BO9 A;  3JRU A;  4P4E A;  3PB6 X;  2OR4 A;  1QQ9 A;  4C8P A;  3B7I A;  5F09 A;  2CTB A;  3D7F A;  4OP4 A;  4ZX8 A;  1CP6 A;  5CBM A;  4G1P A;  2EK9 A;  5K8O A;  2EK8 A;  1TF8 A;  1VHE A;  1AYE A;  1CX8 A;  2ZEM A;  3D7G A;  2GU2 A;  2PJ2 A;  3I74 A;  4MCQ A;  4P4I A;  4P44 A;  3KI9 A;  2ZOG A;  1IY7 A;  4YU9 A;  3WC5 A;  4MRI A;  4EME A;  4R7M A;  2Q51 A;  3FH4 A;  4C8F A;  3TX8 A;  3PB7 X;  3KHZ A;  8CPA A;  4PXB A;  2RFH A;  1RTQ A;  3KQZ A;  1HDQ A;  2GLF A;  4OC4 A;  4Z65 A;  4UEF A;  2JBK A;  4OC1 A;  2PJ8 A;  4WJB A;  4C8U A;  1WVM A;  5D8N A;  4PXD A;  4UIA A;  3B3C A;  1TXR A;  5HVF A;  5J1Q A;  3LMS A;  5JM6 A;  1ZLH A;  3D4U A;  3QNV A;  3VH9 A;  3NA6 A;  2ZEL A;  3BI0 A;  4JYW A;  3SI2 A;  4PQA A;  2PJ7 A;  1DTD A;  1OBR A;  3IFE A;  2Q43 A;  1CBX A;  5K8M A;  2HC9 A;  4X8I A;  2CF4 A;  2WYR A;  3WC6 A;  2J9A A;  5HVH A;  4RUH A;  2PJ9 A;  3SJF A;  2QYV A;  4FBE A;  1R43 A;  1ELM P;  4C9R A;  1ARM A;  3MRU A;  1Q7L A;  1TF9 A;  4PXE A;  4MCR A;  4F8Z A;  1QMU A;  1HDU A;  4ZY2 A;  2PJ4 A;  2PIY A;  2OOT A;  1JQG A;  4MHP A;  2IQ6 A;  4C8T A;  4TNU A;  1ARL A;  4WWV A;  4OKO A;  1ZG8 A;  3H8E A;  3LWU A;  4A37 A;  4C9V A;  4F9U A;  2PJA A;  2C6C A;  4C85 A;  3L2N A;  4P4F A;  4NJR A;  3FED A;  2ZEN A;  2C6G A;  1CP7 A;  2NSM A;  3V38 A;  4FUU A;  2QVP A;  3CPX A;  4MCS A;  2QJ8 A;  5DS0 A;  3VAR A;  4OC3 A;  5IB9 A;  1DE4 C;  2PJB A;  5D29 A;  4Q7A A;  1Y0Y A;  4ZY1 A;  3WT4 A;  1UWY A;  4C99 A;  3PB8 X;  4C8A A;  2O53 A;  2ZED A;  5HVG A;  1Z2L A;  3PBE A;  4C8C A;  3GUX A;  4NGN A;  4KSI A;  1YSJ A;  3FMC A;  2ZEP A;  4IHM A;  2JBJ A;  1XBU A;  3VTA A;  1KWM A;  2NYQ A;  4TJX A;  5LYL A;  4IAV A;  5THW A;  4NGR A;  1ZG7 A;  1F2P A;  3NH5 A;  3B2Y A;  1R3N A;  5CPA A;  1XFO A;  2POK A;  2V77 A;  1TKH A;  4P4D A;  4R8F A;  1BPM A;  2I3C A;  5I4M A;  2XEF A;  3EIF A;  3PEI A;  4UEE A;  3NH8 A;  4YWY A;  3T8W A;  3K2K A;  4H2K A;  4ZX9 A;  2XEJ A;  2PVV A;  3FEE A;  1TKF A;  4C9A A;  3S9L A;  3I1U A;  1CPS A;  3CDX A;  4LQG A;  1YW6 A;  2ZEE A;  3SJG A;  2V8H A;  3CT9 A;  1ZG9 A;  4TWE A;  6CPA A;  3SI0 A;  4NGS A;  2CTC A;  3VAT A;  1ELL P;  2PJ5 A;  2ZOF A;  3FEC A;  1ZLI A;  4ZYQ A;  1LAP A;  3WC7 A;  3H8G A;  2PJC A;  3B3S A;  4NGM A;  4C9U A;  4OC5 A;  2PCU A;  1YLO A;  1BLL E;  4ZI6 A;  2RB7 A;  4CDJ A;  1PCA A;  4MHZ A;  3RAM A;  4CDK A;  3RBU A;  1CG2 A;  1GYT A;  1YW4 A;  3PFO A;  2EWB A;  2AFS A;  3KR4 A;  4EWT A;  4NGP A;  4AXV A;  3S9M A;  2C1C A;  1Y7E A;  4KNG E;  4DYO A;  3GB0 A;  1FNO A;  3D67 A;  3SI1 A;  4P6Y A;  4OIW A;  4F9V A;  2PJ0 A;  3PBB A;  3ICU A;  1Y9Z A;  4P45 A;  3PFE A;  5K8P A;  2V8G A;  1LFW A;  5LRG A;  1LAM A;  3KAS A;  2F7V A;  2PVW A;  3CPA A;  3FJU A;  1PYT B;  4R6T A;  2Q4Z A; 
#chains in the Genus database with same CATH topology
 3LD2 A;  3BXM A;  2CIJ A;  4MFP A;  3N5F A;  3SHP A;  3D7H A;  4MI4 A;  1J3L A;  4XNH B;  1AUG A;  4YN3 A;  3VGO A;  2ZW7 A;  3S9N A;  4MMO A;  3O8Z A;  4FAI A;  4EYS A;  2ZW5 A;  2OU2 A;  5E96 A;  1WJT A;  5C82 A;  4R9M A;  2AFM A;  1IB1 E;  4A94 A;  1QST A;  2DEA A;  2GRE A;  3FX6 A;  4B12 A;  2V8V A;  2FVG A;  4IF5 A;  1PUA A;  3KZW A;  2REE A;  3R9E A;  5BY0 A;  2Q44 A;  3IIB A;  1LAN A;  2PE3 A;  3ISX A;  3RYO A;  5LYI A;  4BPW B;  3PP9 A;  2BUE A;  1K4J A;  2GLJ A;  4BIN A;  2Z3O A;  1XF1 A;  4TJV A;  2ZEG A;  3TC8 A;  4UF4 A;  4E0A A;  1IYL A;  2Q4Y A;  2XEG A;  2B5G B;  2FIA A;  3KL9 A;  3T07 A;  1Z9U A;  4LQ6 A;  5JQ4 A;  4AG7 A;  3DLJ A;  3TT2 A;  3NH4 A;  3B3T A;  4DUK A;  2WPX A;  2GFQ A;  4P4J A;  2D0P A;  4P4B A;  4KOY A;  1VGY A;  5AG4 A;  3W6X A;  3D68 A;  3HLP A;  4KVX A;  1Z8L A;  4FD5 A;  3SJX A;  5HKY A;  4MJX A;  5GCN A;  3TLB A;  3D66 A;  1IYK A;  3PB9 X;  3BI1 A;  1SQH A;  4UCN A;  3TLC A;  4PPZ A;  4C86 A;  4COB A;  2QEC A;  4MXU A;  2VI7 A;  2Z3N A;  3C26 A;  3WAB A;  4KOX A;  2ANP A;  4O23 A;  1CJW A;  1F57 A;  1KUV A;  1XJO A;  4PXC A;  2BOA A;  3G8W A;  2Z0Z A;  4KLW A;  5DWM A;  5LRJ A;  1HEE A;  4KUB A;  3P2F A;  2Z3M A;  4BTF A;  2AFU A;  5CNP A;  2AFW A;  4A38 A;  1XMB A;  5H86 A;  1TKJ A;  1RO5 A;  2YNE A;  5FD8 A;  4C84 A;  5F13 A;  3VRR A;  1I12 A;  2C5Q A;  2EUI A;  3BHX A;  3DNS A;  4RN7 A;  3S6H A;  1XMT A;  3IO1 A;  2C6P A;  4MFK A;  1YVO A;  4MI1 A;  4EFD A;  4UCP A;  1N71 A;  4A30 A;  1CPX A;  1B47 A;  1V6C A;  2D0O A;  4M6I A;  4KUA A;  1P0H A;  2PJ1 A;  1F2O A;  1YR0 A;  5HXD A;  3FF3 A;  1IGB A;  4B6Z A;  2BCO A;  4HNY B;  1IOF A;  3K9T A;  2IJZ A;  4UCM A;  5J8C A;  1X10 A;  4A2Z A;  5K99 A;  5IB0 A;  3GLJ A;  5LRK A;  1UFH A;  1Z8X A;  3D2P A;  3VWE A;  3PRT A;  2E28 A;  2G9D A;  2Z11 A;  1MJA A;  2MP0 A;  2PC1 A;  3ISZ A;  4XPK A;  4C9E A;  2Q4V A;  2YGW A;  4UEZ A;  1Z4E A;  3RZA A;  4KOR A;  4DJL A;  1KEE B;  3RO0 A;  1BPN A;  1B6B A;  1M4L A;  1BAV A;  1Q2D A;  2QML A;  3DR6 A;  4OLL A;  4IIY A;  3B3W A;  4P10 A;  3KQX A;  3T90 A;  1LOK A;  4UIB A;  5G21 A;  1NXJ A;  4NEX A;  4X3R A;  2ZEF A;  1I1D A;  2B58 A;  4K3N A;  5LYD A;  4R3K A;  3TCV A;  4F0X A;  1VBH A;  4CRZ B;  2JEW A;  2Q7S A;  2IMO A;  2G3A A;  2PRQ A;  2VZY A;  3KHX A;  5AXI A;  3TO7 A;  3I6S A;  4MHY A;  3OB2 B;  1NSA A;  2PIZ A;  4A32 A;  2FE7 A;  5H84 A;  5F46 A;  3T5M A;  2PJ6 A;  3MGD A;  4MCP A;  1XRY A;  1Z8T A;  3PB4 X;  4OID A;  5LYF A;  3UY5 A;  1KBL A;  2P0W A;  2B4J C;  1WWZ A;  2FSR A;  2FXF A;  7CPA A;  1S7K A;  4W9Y A;  3S6G A;  1CS0 B;  1VHO A;  2D4O A;  3CXQ A;  2PQ8 A;  2VZZ A;  4CYP A;  2A4N A;  1S7N A;  2OZU A;  5J8F A;  2AUN A;  4Y49 C;  4E94 A;  4KLV A;  4CPA A;  5F47 A;  3D8P A;  4ZGY B;  4J3G A;  3OB1 B;  1H8L A;  2EZA A;  4NFR A;  4OC2 A;  4A31 A;  1TIQ A;  3G3S A;  3BJ8 A;  3GKR A;  3GIU A;  4ONW A;  4IK2 A;  4A39 A;  2WZN A;  4CS0 B;  4OME A;  2XEI A;  3D7D A;  1IOI A;  3B35 A;  2V8D A;  4GM5 A;  2Y1M A;  3BJ7 A;  2AE6 A;  1YVK A;  1T36 B;  3F8K A;  3GYA A;  3HUV A;  3IC1 A;  2J8N A;  2EBJ A;  1ZRS A;  4X5K A;  3SXN A;  3VRO A;  3VRN A;  3IJ3 A;  1Y0R A;  5JH9 A;  4KOT A;  2AFO A;  3KGQ A;  3TTH A;  2O4H A;  3DGV A;  4L8A A;  2Y1N A;  4UBR A;  3ZNI A;  4BD9 A;  1AMP A;  2JLM A;  4HNX B;  1IIC A;  4FWU A;  5EBV A;  2ZPA A;  4JZ0 A;  1Z5R A;  4CAW A;  4BBH A;  4JVO A;  4BPU B;  4AVA A;  1VIX A;  2ZEH A;  1IU8 A;  3H4Q A;  4INJ A;  2F8H A;  3FVL A;  4NSQ A;  2PSW A;  3MN8 A;  2BL1 A;  1MK4 A;  2VL1 A;  3PZJ A;  3OWC A;  1I21 A;  2HB6 A;  3PFV A;  1YME A;  3SR3 A;  3SJE A;  1NE9 A;  2CY2 A;  4LUA A;  5ELY A;  4M3S A;  3KR5 A;  4ZY0 A;  3NFZ A;  4H6Z A;  3IWW A;  2VQY A;  5JGF A;  3GY9 A;  2FCK A;  4MHD A;  2IL4 A;  1FT7 A;  1Z9E A;  4F6A A;  2EZB A;  3U1B A;  2AFZ A;  5HMN A;  2DLA A;  1S3Z A;  2ZW4 A;  3D2M A;  3T05 A;  1EE3 P;  1NMT A;  2OZG A;  3B3V A;  3V8I A;  1S60 A;  1NBW A;  5IR2 A;  2ZEO A;  5J3X A;  1ZL0 A;  4PSW A;  3JTK A;  3IU2 A;  4XPL A;  3N7Z A;  4KZT A;  2ABZ A;  4R76 A;  2PJ3 A;  2B4B A;  3H8F A;  4MHN A;  3FBU A;  1ZYM A;  2F5I A;  1VKC A;  4H89 A;  5K8N A;  5JYB A;  3V7Z A;  4AB7 A;  2AFX A;  4NGQ A;  4QUS A;  1LCP A;  4X2T A;  5ISV A;  4MY0 A;  3EZA A;  4OC0 A;  2PDO A;  3DR8 A;  2PCN A;  3IEH A;  4PK2 A;  4NGT A;  4NJQ A;  4UWI A;  4LX9 A;  2BO9 A;  3JRU A;  4QB9 A;  4P4E A;  3CXS A;  5A28 A;  3PB6 X;  2OR4 A;  4PV6 A;  4R57 A;  1Z8W A;  4CRY B;  1BXR B;  1QQ9 A;  4B5P A;  2Q7B A;  3B7I A;  5F09 A;  2CTB A;  4C8P A;  3D7F A;  3ZZI A;  4CYQ A;  4OP4 A;  1PU9 A;  2O28 A;  4ZX8 A;  1CP6 A;  4FD6 A;  1EO0 A;  2H5M A;  4G1P A;  5CBM A;  2OLS A;  2EK9 A;  5K8O A;  4HPS A;  1U6M A;  2EK8 A;  4QC6 A;  1YVH A;  3F5B A;  1TF8 A;  1VHE A;  3I3G A;  1AYE A;  1CX8 A;  3R9G A;  2ZEM A;  3D7G A;  4DNC A;  3TFY A;  3K4I A;  3TLZ A;  4H6U A;  2GU2 A;  2PJ2 A;  3I74 A;  4KS9 A;  4JLY A;  4MCQ A;  1X12 A;  2GAN A;  1QSR A;  4U5Y A;  2N3A B;  4P44 A;  4P4I A;  4A4C A;  3KI9 A;  2ZOG A;  1IY7 A;  4HNW B;  4YU9 A;  3T9Y A;  3WC5 A;  4C2X A;  4YFJ A;  1YGH A;  4MRI A;  4EME A;  4MFL A;  1M4G A;  4R7M A;  1YX0 A;  2ZXV A;  3R1K A;  5KTD A;  1L0C A;  1QSO A;  2Q51 A;  3FIX A;  3FH4 A;  5I0C A;  1CE8 B;  4C8F A;  4CGM A;  2R98 A;  3TX8 A;  3EO4 A;  1CM0 A;  3QAH A;  2Z3K A;  3PB7 X;  3IWG A;  3KHZ A;  8CPA A;  4PXB A;  2RFH A;  4JXQ A;  5IV0 A;  1RTQ A;  3KQZ A;  2HI6 A;  1HDQ A;  4CYO A;  3EZB A;  2GLF A;  2DXQ A;  3TLE A;  2P6G A;  3D3S A;  1V0C A;  4YRH A;  4KSF A;  3BUM B;  4OC4 A;  4C2Y A;  2HV2 A;  4JD6 A;  4PSX A;  4MY3 A;  2B0A A;  5F9M A;  4Z65 A;  4UEF A;  2JBK A;  4OC1 A;  2PJ8 A;  2P6E A;  4WJB A;  1M6V B;  5AGE A;  2X0S A;  1Y9W A;  4CAE A;  4C8U A;  3TO6 A;  4NF1 A;  5D8N A;  4PXD A;  1WVM A;  2HRO A;  4UIA A;  3B3C A;  2P6F A;  2QIR A;  4K30 A;  5F48 A;  3QAY A;  1TXR A;  3K9U A;  5HVF A;  1LRZ A;  2YND A;  1WK4 A;  1M4D A;  4B5O A;  1GGO A;  5J1Q A;  3LMS A;  3TLG B;  1S5K A;  5JM6 A;  1ZLH A;  3TYX A;  1JWQ A;  2OH1 A;  2DPT A;  1C3O B;  3VRP A;  2HWG A;  1VHS A;  1FBV A;  2Z3P A;  4CGL A;  3D4U A;  4HKF A;  2C27 A;  1BOB A;  4KVM E;  1R57 A;  2VEZ A;  3NE8 A;  4B13 A;  4C2Z A;  3QNV A;  1A9X B;  1Y9K A;  2FT0 A;  3EC4 A;  3FB3 A;  3H5Z A;  3NA6 A;  2EO8 A;  2ZEL A;  3VH9 A;  1M44 A;  3BI0 A;  4JYW A;  3LOD A;  3SI2 A;  2Y0M A;  4PQA A;  3PGP A;  1B87 A;  4Y49 B;  2PJ7 A;  2Q0Y A;  2ATR A;  1DTD A;  1OBR A;  3IFE A;  3BUW B;  2ARH A;  4ORF A;  4XPD C;  3GJZ A;  2Q43 A;  1CBX A;  4C7I A;  2AJ6 A;  4E5S A;  2OZH A;  2HC9 A;  5K8M A;  3R96 A;  4X8I A;  4RR2 B;  2CF4 A;  3R9F A;  2WYR A;  3WC6 A;  2J9A A;  4PK3 A;  5HVH A;  4RUH A;  5KTA A;  2PJ9 A;  1NSL A;  3TOA A;  2B4D A;  4M85 A;  3EXN A;  3P2H A;  4KSA A;  3SJF A;  2QYV A;  4FBE A;  1R43 A;  2VBQ A;  1ELM P;  4CO9 A;  3OP0 A;  3PLF B;  4BPX B;  4C9R A;  1YLE A;  1ARM A;  1Q5X A;  3MRU A;  1Q7L A;  2YJT A;  3CZX A;  1TF9 A;  4PXE A;  4MCR A;  5A27 A;  4F8Z A;  1QMU A;  3HPH E;  1HDU A;  1C30 B;  4ZY2 A;  4H1H A;  3FXT A;  2PJ4 A;  2PIY A;  4R3L A;  4NCZ A;  1MJB A;  2PR1 A;  4M6G A;  5JPH A;  3C8O A;  3G23 A;  3FYN A;  2OOT A;  1JQG A;  3T0T A;  4MHP A;  2IQ6 A;  4CGP A;  4C8T A;  2REF A;  2HQY A;  4MFZ A;  1P4N A;  4L89 A;  1ARL A;  4NXY A;  3BUO B;  4OKO A;  4TNU A;  3LAC A;  2DPS A;  4Q36 A;  4WWV A;  4YGO A;  2FIW A;  1ZG8 A;  4A4B A;  3H8E A;  3LWU A;  5EC4 A;  4A37 A;  4U9Z A;  4C9V A;  4QVT A;  4XNH C;  4F9U A;  2PJA A;  2C6C A;  2YNC A;  2R1I A;  4C85 A;  1A2Z A;  3L2N A;  1Q2C A;  1XIX A;  4U9Y A;  5F49 A;  1R61 A;  4P4F A;  4B14 A;  4NJR A;  3FED A;  1KUY A;  2C6G A;  1J4J A;  1IID A;  2ZEN A;  3IU1 A;  4R87 A;  3I9S A;  3R95 A;  1CP7 A;  2NSM A;  3NE7 A;  3V38 A;  4AG9 A;  4FUU A;  3HMJ G;  2CBL A;  5AG7 A;  2XPL A;  4KVO E;  4UFX A;  2FS5 A;  2WPW A;  2WSA A;  2QVP A;  2B5G A;  3CPX A;  4MCS A;  2QJ8 A;  5DS0 A;  4RI1 A;  3VAR A;  4OC3 A;  5IB9 A;  1DE4 C;  4GPL B;  2NMT A;  2PJB A;  3OAK A;  2I00 A;  2ZW6 A;  4ONU A;  4CAV A;  2VKZ G;  5D29 A;  1XOV A;  4B5P B;  4Q7A A;  1Y0Y A;  3WR7 A;  1XF8 A;  4ZY1 A;  3WT4 A;  1UWY A;  4C99 A;  2VXK A;  2XPO A;  3PB8 X;  4II9 A;  4C8A A;  2O53 A;  4I49 A;  2ZED A;  2G0B A;  2CNM A;  2OB0 A;  4UA3 A;  5HVG A;  1Z2L A;  1GHE A;  2JEV A;  3GUX A;  3PBE A;  4Q38 A;  2UV8 G;  4UFV A;  4C8C A;  1YQE A;  4A95 A;  1JDB C;  4NGN A;  3FRM A;  4KSI A;  5F1Y A;  1YSJ A;  3EFA A;  2RC4 A;  2CNS A;  3FMC A;  3IWE A;  2GE3 A;  1Q2Y A;  3TE4 A;  2ZEP A;  5AG5 A;  1VBG A;  2YJV A;  3FNC A;  3S6F A;  1M1D A;  2JBJ A;  4IHM A;  4JWP A;  1XBU A;  3NOJ A;  3KRV A;  3VTA A;  1KWM A;  4CGO A;  2NYQ A;  1EZA A;  4TJX A;  3TOB A;  1KC7 A;  5LYL A;  2ODF A;  4KOW A;  3VWD A;  2BSW A;  3PT1 A;  4IAV A;  5THW A;  4NGR A;  1ZG7 A;  2R8V A;  5EMI A;  4BMH A;  1F2P A;  3B8G A;  3EZE A;  4CZ1 A;  2WUU A;  2DIK A;  4OAD A;  3NH5 A;  2I79 A;  5JVL A;  3NFQ A;  3B2Y A;  4KOS A;  1XEB A;  2FM4 A;  4AVC A;  2R82 A;  4E8O A;  1R3N A;  5G20 A;  2Q04 A;  3JUW A;  5CPA A;  1YRE A;  4JXR A;  3ZJ0 A;  4IUS A;  4CAX A;  3BUX B;  4RS2 A;  1XFO A;  2POK A;  2V77 A;  4E2A A;  2EZC A;  4QBJ A;  5F5X A;  1TKH A;  2HUZ A;  3JVN A;  4P4D A;  4KOV A;  1BPM A;  2I3C A;  4R8F A;  2XEF A;  2K5T A;  5I4M A;  3PEI A;  1FY7 A;  3EIF A;  4IIX A;  2GIV A;  1ON0 A;  4UEE A;  2CNT A;  3NH8 A;  4YWY A;  3T8W A;  3SXO A;  1JDE A;  3K2K A;  4H2K A;  4J0N A;  2B3U A;  3A9L A;  3BLN A;  4ZX9 A;  2XEJ A;  2PVV A;  3RNZ A;  1OZP A;  3KKW A;  3FEE A;  3QB8 A;  1TKF A;  4C9A A;  4CAF A;  2R7H A;  2EVN A;  4M6H A;  4MFJ A;  4OAE A;  5HH1 A;  3E0K A;  3S9L A;  3I1U A;  1CPS A;  3CDX A;  4COG A;  5AG6 A;  4LQG A;  2D4P A;  5IX3 A;  2GP4 A;  3HPG G;  1YW6 A;  3TLY A;  2ZEE A;  1Z4R A;  3F0A A;  3SJG A;  2V8H A;  3CT9 A;  1ZG9 A;  4TWE A;  4CGN A;  6CPA A;  3SI0 A;  4NGS A;  2CTC A;  3S6K A;  4FD7 A;  3VAT A;  3W91 A;  3TLG A;  1ELL P;  2PJ5 A;  2ZOF A;  4C7H A;  3FEC A;  1ZLI A;  2B3V A;  5DWN A;  4ZYQ A;  1LAP A;  3TLA A;  3WC7 A;  2AUM A;  3H8G A;  2PJC A;  1EZB A;  2XPN A;  2PRB A;  3B3S A;  2PR8 A;  3BUN B;  4C68 A;  5HKZ A;  4NGM A;  1DIK A;  4C9U A;  4OC5 A;  4MJ8 A;  4B11 A;  2Z10 A;  2PCU A;  1YLO A;  1BLL E;  4AVB A;  4ZI6 A;  3F9K C;  1QSN A;  4UFW A;  4XPD B;  3CXP A;  5FVJ A;  2RB7 A;  4CDJ A;  4A33 A;  4JJX A;  3U88 C;  1PCA A;  2X7B A;  4MHZ A;  1QSM A;  1RXT A;  4MFQ A;  5G22 A;  3RAM A;  4CDK A;  3RBU A;  4FD4 A;  2J8R A;  5BWA B;  2CXA A;  2XPP A;  1CG2 A;  1GYT A;  4F0Y A;  5HKW A;  1YW4 A;  2Z3L A;  2B4D B;  3PFO A;  4M8D A;  2EWB A;  3DSB A;  2AFS A;  1VI4 A;  4GXH A;  3VRQ A;  3KR4 A;  4MBU A;  2BEI A;  3TO9 A;  4EWT A;  4NGP A;  5G1Z A;  4ZBG A;  4AXV A;  3S9M A;  2G3T A;  2C1C A;  3EY5 A;  4KOU A;  1Y7R A;  1XE4 A;  1Y7E A;  4KNG E;  1MJ9 A;  3GB0 A;  4DYO A;  1FNO A;  5C88 A;  3D67 A;  4UWJ A;  3SI1 A;  4P6Y A;  2DF5 A;  4GS4 A;  2FL4 A;  3IGR A;  4OIW A;  4F9V A;  1KZF A;  2PJ0 A;  3PBB A;  4CYN A;  1KUX A;  1S7L A;  3W6S A;  1Y9Z A;  1M4I A;  4P45 A;  3PFE A;  3ICU A;  5K8P A;  2V8G A;  1LFW A;  5LRG A;  2J8M A;  1LAM A;  3KAS A;  1BO4 A;  2PVW A;  2F7V A;  1YK3 A;  2JDD A;  1S7F A;  3CPA A;  3FJU A;  1PYT B;  4R6T A;  3DDD A;  4B10 A;  4EVY A;  2JDC A;  5KTC A;  2KCW A;  1ZO0 A;  2Q4Z A;  2YNC C; 
#chains in the Genus database with same CATH homology
 3BXM A;  2CIJ A;  3N5F A;  3D7H A;  4YN3 A;  3S9N A;  4MMO A;  4FAI A;  2AFM A;  4A94 A;  2DEA A;  2GRE A;  3FX6 A;  2V8V A;  2FVG A;  3KZW A;  3IIB A;  3ISX A;  1LAN A;  2PE3 A;  5LYI A;  4TJV A;  2GLJ A;  1XF1 A;  2ZEG A;  3TC8 A;  4UF4 A;  2XEG A;  3KL9 A;  3DLJ A;  3NH4 A;  3B3T A;  4DUK A;  4P4J A;  4P4B A;  1VGY A;  3D68 A;  3HLP A;  1Z8L A;  3SJX A;  3D66 A;  3PB9 X;  3BI1 A;  4PPZ A;  4C86 A;  4MXU A;  3WAB A;  2ANP A;  4O23 A;  1F57 A;  1XJO A;  4PXC A;  5LRJ A;  2BOA A;  1HEE A;  2AFU A;  4A38 A;  2AFW A;  1XMB A;  1TKJ A;  4C84 A;  2C5Q A;  3BHX A;  3IO1 A;  2C6P A;  4EFD A;  1CPX A;  1V6C A;  2PJ1 A;  1F2O A;  5HXD A;  3FF3 A;  1IGB A;  4B6Z A;  2BCO A;  3K9T A;  2IJZ A;  3GLJ A;  5LRK A;  3PRT A;  2G9D A;  3ISZ A;  4C9E A;  4UEZ A;  3RZA A;  4DJL A;  1BPN A;  1M4L A;  1BAV A;  3B3W A;  4P10 A;  3KQX A;  1LOK A;  4UIB A;  4X3R A;  2ZEF A;  4K3N A;  5LYD A;  2JEW A;  3KHX A;  2IMO A;  2PRQ A;  3I6S A;  4MHY A;  1NSA A;  2PIZ A;  2PJ6 A;  4MCP A;  1XRY A;  3PB4 X;  4OID A;  5LYF A;  7CPA A;  4W9Y A;  1VHO A;  4CPA A;  1H8L A;  4NFR A;  4OC2 A;  4ONW A;  4A39 A;  4IK2 A;  2WZN A;  4OME A;  2XEI A;  3D7D A;  3B35 A;  2V8D A;  4GM5 A;  3IC1 A;  3HUV A;  3IJ3 A;  5JH9 A;  1Y0R A;  2AFO A;  3KGQ A;  2O4H A;  3DGV A;  4BD9 A;  1AMP A;  4FWU A;  4JZ0 A;  1Z5R A;  1VIX A;  2ZEH A;  2F8H A;  3FVL A;  3MN8 A;  2VL1 A;  2HB6 A;  1YME A;  3SJE A;  4ZY0 A;  5ELY A;  3KR5 A;  3NFZ A;  3IWW A;  5JGF A;  1FT7 A;  2AFZ A;  1EE3 P;  3B3V A;  5IR2 A;  2ZEO A;  2ABZ A;  4R76 A;  2PJ3 A;  3H8F A;  4MHN A;  5K8N A;  3V7Z A;  2AFX A;  4NGQ A;  4X2T A;  1LCP A;  4OC0 A;  3IEH A;  4NGT A;  4NJQ A;  2BO9 A;  3JRU A;  4P4E A;  3PB6 X;  2OR4 A;  1QQ9 A;  4C8P A;  3B7I A;  5F09 A;  2CTB A;  3D7F A;  4OP4 A;  4ZX8 A;  1CP6 A;  5CBM A;  4G1P A;  2EK9 A;  5K8O A;  2EK8 A;  1TF8 A;  1VHE A;  1AYE A;  1CX8 A;  2ZEM A;  3D7G A;  2GU2 A;  2PJ2 A;  3I74 A;  4MCQ A;  4P4I A;  4P44 A;  3KI9 A;  2ZOG A;  1IY7 A;  4YU9 A;  3WC5 A;  4MRI A;  4EME A;  4R7M A;  2Q51 A;  3FH4 A;  4C8F A;  3TX8 A;  3PB7 X;  3KHZ A;  8CPA A;  4PXB A;  2RFH A;  1RTQ A;  3KQZ A;  1HDQ A;  2GLF A;  4OC4 A;  4Z65 A;  4UEF A;  2JBK A;  4OC1 A;  2PJ8 A;  4WJB A;  4C8U A;  1WVM A;  5D8N A;  4PXD A;  4UIA A;  3B3C A;  1TXR A;  5HVF A;  5J1Q A;  3LMS A;  5JM6 A;  1ZLH A;  3D4U A;  3QNV A;  3VH9 A;  3NA6 A;  2ZEL A;  3BI0 A;  4JYW A;  3SI2 A;  4PQA A;  2PJ7 A;  1DTD A;  1OBR A;  3IFE A;  2Q43 A;  1CBX A;  5K8M A;  2HC9 A;  4X8I A;  2CF4 A;  2WYR A;  3WC6 A;  2J9A A;  5HVH A;  4RUH A;  2PJ9 A;  3SJF A;  2QYV A;  4FBE A;  1R43 A;  1ELM P;  4C9R A;  1ARM A;  3MRU A;  1Q7L A;  1TF9 A;  4PXE A;  4MCR A;  4F8Z A;  1QMU A;  1HDU A;  4ZY2 A;  2PJ4 A;  2PIY A;  2OOT A;  1JQG A;  4MHP A;  2IQ6 A;  4C8T A;  4TNU A;  1ARL A;  4WWV A;  4OKO A;  1ZG8 A;  3H8E A;  3LWU A;  4A37 A;  4C9V A;  4F9U A;  2PJA A;  2C6C A;  4C85 A;  3L2N A;  4P4F A;  4NJR A;  3FED A;  2ZEN A;  2C6G A;  1CP7 A;  2NSM A;  3V38 A;  4FUU A;  2QVP A;  3CPX A;  4MCS A;  2QJ8 A;  5DS0 A;  3VAR A;  4OC3 A;  5IB9 A;  1DE4 C;  2PJB A;  5D29 A;  4Q7A A;  1Y0Y A;  4ZY1 A;  3WT4 A;  1UWY A;  4C99 A;  3PB8 X;  4C8A A;  2O53 A;  2ZED A;  5HVG A;  1Z2L A;  3PBE A;  4C8C A;  3GUX A;  4NGN A;  4KSI A;  1YSJ A;  3FMC A;  2ZEP A;  4IHM A;  2JBJ A;  1XBU A;  3VTA A;  1KWM A;  2NYQ A;  4TJX A;  5LYL A;  4IAV A;  5THW A;  4NGR A;  1ZG7 A;  1F2P A;  3NH5 A;  3B2Y A;  1R3N A;  5CPA A;  1XFO A;  2POK A;  2V77 A;  1TKH A;  4P4D A;  4R8F A;  1BPM A;  2I3C A;  5I4M A;  2XEF A;  3EIF A;  3PEI A;  4UEE A;  3NH8 A;  4YWY A;  3T8W A;  3K2K A;  4H2K A;  4ZX9 A;  2XEJ A;  2PVV A;  3FEE A;  1TKF A;  4C9A A;  3S9L A;  3I1U A;  1CPS A;  3CDX A;  2GP4 A;  4LQG A;  1YW6 A;  2ZEE A;  3SJG A;  2V8H A;  3CT9 A;  1ZG9 A;  4TWE A;  6CPA A;  3SI0 A;  4NGS A;  2CTC A;  3VAT A;  1ELL P;  2PJ5 A;  2ZOF A;  3FEC A;  1ZLI A;  4ZYQ A;  1LAP A;  3WC7 A;  3H8G A;  2PJC A;  3B3S A;  4NGM A;  4C9U A;  4OC5 A;  2PCU A;  1YLO A;  1BLL E;  4ZI6 A;  2RB7 A;  4CDJ A;  1PCA A;  4MHZ A;  3RAM A;  4CDK A;  3RBU A;  1CG2 A;  1GYT A;  1YW4 A;  3PFO A;  2EWB A;  2AFS A;  3KR4 A;  4EWT A;  4NGP A;  4AXV A;  3S9M A;  2C1C A;  1Y7E A;  4KNG E;  4DYO A;  3GB0 A;  1FNO A;  3D67 A;  3SI1 A;  4P6Y A;  4OIW A;  4F9V A;  2PJ0 A;  3PBB A;  3ICU A;  1Y9Z A;  4P45 A;  3PFE A;  5K8P A;  2V8G A;  1LFW A;  5LRG A;  1LAM A;  3KAS A;  2F7V A;  2PVW A;  3CPA A;  3FJU A;  1PYT B;  4R6T A;  2Q4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...