4X3RA

Avi-gcpii structure in complex with fitc-conjugated gcpii-specific inhibitor
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
690
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Design of highly potent urea-based, exosite-binding inhibitors selective for glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 261
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4x3rA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x3rA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4x3rA02
3RAMA 3SI1A 2ZEGA 2JEWA 3TC8A 2PVVA 2PVWA 3H8FA 1QMUA 1BPNA 3L2NA 2CIJA 1YW4A 1GYTA 3IC1A 8CPAA 3ISZA 4TWEA 1F57A 4EFDA 4C8UA 3NH5A 4MHZA 2CTBA 4MHYA 2XEIA 2C6CA 1AYEA 3K2KA 4P4DA 2PJBA 3MRUA 3SJGA 1ZG8A 2BOAA 4ZY2A 4JYWA 1ZG7A 4UEFA 4UF4A 1ZLIA 3B3VA 1Y7EA 4G1PA 3VH9A 3HLPA 2PJ5A 3NH4A 3S9MA 4RUHA 3FF3A 1WVMA 4X8IA 5HVFA 4YN3A 2OR4A 4Z65A 3VARA 4WJBA 4TNUA 2PJ3A 2OOTA 2PE3A 3B2YA 5LYDA 4TJXA 4P4EA 2HC9A 4OC0A 2POKA 2AFMA 4C85A 3IIBA 3PFEA 4FWUA 5JH9A 1CG2A 2ANPA 3HUVA 3S9LA 1XF1A 4X3RA 5D29A 3BXMA 1FT7A 4P10A 4JZ0A 4OC3A 2GLFA 4NGNA 5K8MA 1AMPA 2G9DA 1PYTB 4C84A 2ZEOA 1BAVA 1TXRA 4ZYQA 1R3NA 2RFHA 3SI0A 4CDKA 3D7FA 4NGTA 3VATA 4F8ZA 3KGQA 3B3SA 3D68A 3KR4A 5LYLA 7CPAA 1XBUA 4C9EA 2IQ6A 3KASA 3PB6X 2V77A 1Z2LA 2C1CA 1ZLHA 2J9AA 4ZY1A 3IWWA 2GREA 4ONWA 1YLOA 3LWUA 2PJ1A 2ABZA 4LQGA 4NGPA 1QQ9A 4OKOA 3RBUA 2PJ9A 6CPAA 1VGYA 1Y9ZA 3I6SA 2GLJA 2JBKA 3I1UA 2ZEFA 2HB6A 5DS0A 2ZEDA 3H8GA 3BI1A 3NFZA 3KI9A 4R7MA 4CPAA 3D7HA 2AFUA 3PBBA 4NJQA 1CPSA 1TF9A 1DTDA 1Y0YA 3KR5A 3FMCA 3FX6A 1HDQA 1NSAA 1UWYA 4C8FA 4DYOA 3SJFA 1ELMP 4PXDA 1TF8A 3N5FA 4TJVA 4OP4A 4K3NA 5JGFA 5K8PA 2PJ2A 4R76A 2QYVA 1HDUA 1F2PA 3B7IA 3D67A 2EK9A 4FAIA 3BI0A 4EMEA 1LAPA 4H2KA 3ISXA 1CP7A 3SI2A 3FEEA 2RB7A 2ZEEA 2V8VA 4MMOA 4YWYA 1Z5RA 4PXBA 5HXDA 4MCQA 4A94A 5LRJA 2AFWA 4MCRA 5K8OA 2O53A 3PEIA 3PB7X 2EWBA 1YMEA 5HVHA 2AFXA 4O23A 4NGSA 1PCAA 1Q7LA 1LFWA 4NFRA 4AXVA 4X2TA 4DJLA 3B3TA 5LYFA 2CTCA 3V38A 4A38A 2GU2A 5LRGA 3KQZA 1YW6A 3B35A 3CDXA 4OC2A 4C9RA 5J1QA 2XEGA 2PJ8A 2ZEMA 1DE4C 3IJ3A 1VIXA 3CT9A 2WZNA 2IJZA 2PCUA 1RTQA 1IGBA 1XRYA 3WC6A 2FVGA 4OIWA 1Y0RA 1V6CA 3SJEA 2Q43A 4OC5A 4A39A 4GM5A 5ELYA 4MHNA 4F9VA 4P6YA 3PB9X 4C8PA 3PFOA 2AFZA 3CPXA 5HVGA 4Q7AA 4CDJA 1VHEA 4ZX8A 4P44A 3K9TA 3LMSA 4NJRA 1BPMA 2AFSA 2ZOFA 4R8FA 3PB4X 1CX8A 4IK2A 4C9VA 4R6TA 3FEDA 2PJ4A 5K8NA 3GUXA 1EE3P 4FUUA 3D7GA 3IFEA 3H8EA 3WABA 1H8LA 2VL1A 1R43A 3CPAA 1TKJA 2PJCA 2PIZA 4FBEA 2F7VA 4P45A 4MRIA 2EK8A 4IAVA 4OMEA 1VHOA 3GLJA 2ZENA 3KZWA 2XEJA 3FECA 3SJXA 3JRUA 1YSJA 2NSMA 2BO9A 3MN8A 4PXCA 3V7ZA 3KHZA 2V8HA 4PXEA 4A37A 2PRQA 4WWVA 2V8GA 3D66A 1BLLE 2WYRA 3WT4A 4ZY0A 2JBJA 4YU9A 2F8HA 3S9NA 1LANA 2PJAA 4C99A 4UEEA 5LRKA 1CPXA 1TKFA 5F09A 1ARLA 2O4HA 2PJ7A 4PPZA 5I4MA 2C6PA 1FNOA 3QNVA 3B3CA 3T8WA 1ELLP 1LOKA 4EWTA 4BD9A 3NH8A 3KL9A 4OIDA 3FVLA 3ICUA 3PBEA 4UIBA 3IO1A 4ZI6A 1KWMA 4IHMA 2ZEPA 4C86A 5THWA 4NGMA 3I74A 3RZAA 1Z8LA 2V8DA 3BHXA 5CPAA 4NGRA 2ZEHA 4MCSA 2NYQA 2QVPA 3FH4A 1LCPA 1JQGA 3KHXA 4C9AA 4P4JA 2Q4ZA 4MCPA 3D4UA 3DGVA 2ZOGA 3WC7A 2XEFA 1OBRA 1TKHA 2ZELA 4C8AA 4MHPA 1XFOA 3WC5A 3KQXA 3EIFA 4KSIA 2PJ6A 2Q51A 3NA6A 4W9YA 2AFOA 5IB9A 5D8NA 5JM6A 1XJOA 4UIAA 2PIYA 1IY7A 2QJ8A 1XMBA 4OC1A 1ZG9A 1ARMA 1M4LA 2BCOA 1HEEA 2C6GA 5CBMA 5LYIA 2I3CA 4MXUA 2CF4A 4P4BA 4P4FA 4C8CA 1F2OA 4B6ZA 3VTAA 3DLJA 4F9UA 4NGQA 4ZX9A 1LAMA 4PQAA 4C9UA 1CP6A 3GB0A 3TX8A 3FJUA 1CBXA 3D7DA 2PJ0A 4C8TA 4DUKA 4UEZA 3B3WA 2DEAA 3IEHA 4P4IA 2IMOA 3PRTA 4KNGE 3PB8X 4OC4A
chains in the Genus database with same CATH superfamily
5KTAA 3RAMA 3SI1A 2ZEGA 4JD6A 4ZGYB 4FD6A 5G1ZA 2CNTA 1S7FA 3HMJG 2JEWA 3TC8A 2PVVA 2PVWA 4A4CA 4CAVA 3H8FA 1QMUA 4OADA 1XEBA 1BPNA 2CXAA 4UFWA 3L2NA 2CIJA 3HPHE 3FBUA 4KLVA 2EZAA 2X0SA 1YW4A 1K4JA 1GYTA 2FT0A 5F49A 3IC1A 4RR2B 8CPAA 3ISZA 4TWEA 4KOWA 4R87A 1F57A 3I9SA 4CAEA 4EFDA 2D0PA 4C8UA 3NH5A 4MHZA 3V8IA 1NMTA 2CTBA 4MHYA 2XEIA 2C6CA 4C7IA 1AYEA 3K2KA 1WJTA 4P4DA 2PJBA 3MRUA 4C7HA 3SJGA 1S3ZA 1ZG8A 2BOAA 4CGNA 4MY0A 4ZY2A 4COBA 4XPKA 4JYWA 1ZG7A 4UEFA 4UF4A 1ZLIA 3B3VA 1Y7EA 5AGEA 3VRQA 2XPOA 1S5KA 4G1PA 3VH9A 3HLPA 2PJ5A 2QIRA 3BUWB 3S9MA 2B5GA 3G8WA 3NH4A 5GCNA 4RUHA 2YJVA 1PU9A 3FF3A 2D0OA 1WVMA 1SQHA 5F48A 4X8IA 2Z3OA 3IGRA 2G0BA 5HVFA 2P0WA 4YN3A 2OR4A 4F6AA 2J8MA 4JXQA 4Z65A 3VARA 3SXNA 4WJBA 3EZEA 4TNUA 1VI4A 4R3KA 2PJ3A 4OAEA 1JDEA 2OOTA 2PE3A 5F47A 3B2YA 5LYDA 4TJXA 4MFQA 4P4EA 4MFJA 2E28A 2HC9A 4OC0A 2C5QA 4COGA 4JXRA 2POKA 3LD2A 4A95A 2G3AA 2YGWA 4QBJA 2AFMA 3GYAA 4CGOA 4EVYA 3FXTA 4C85A 3IIBA 3PFEA 4XPDC 5IB0A 3F5BA 2F5IA 2R7HA 5KTCA 2PRBA 4FWUA 4AG7A 4YFJA 4NEXA 1CG2A 2ANPA 3BJ7A 3S9LA 3HUVA 4X3RA 5JH9A 1XF1A 5D29A 3BXMA 4C2YA 1FT7A 5F9MA 4P10A 4JZ0A 4OC3A 2GLFA 4NGNA 5K8MA 3ZNIA 1AMPA 1Z4EA 2G9DA 1Z9EA 4PSXA 1PYTB 1KUXA 4R9MA 4C84A 2PDOA 2ZEOA 1BAVA 2VZZA 1TXRA 4ZYQA 4HNWB 4JVOA 4CGPA 3PP9A 5CNPA 1R3NA 3D3SA 3CZXA 2H5MA 4KOXA 2EO8A 3TLYA 2RFHA 3SI0A 4E0AA 2O28A 1C30B 3BJ8A 4CDKA 2B4DA 2PQ8A 3D7FA 3IU2A 4NGTA 4CYNA 5J8CA 3VATA 1QSTA 4F8ZA 3BUOB 3KGQA 3NE7A 5JQ4A 2ATRA 3B3SA 3D68A 4BINA 1CE8B 3KR4A 5LYLA 3TLZA 4RN7A 2Q4YA 4MFPA 4Y49C 7CPAA 5F1YA 5H86A 1XBUA 4B10A 2YJTA 4C9EA 3TLCA 3EXNA 2CBLA 4CRYB 2IL4A 3KASA 1Y7RA 2IQ6A 3PB6X 3R96A 2V77A 1Z2LA 2JDDA 1XIXA 4CGMA 4M85A 2C1CA 3TO6A 1ZLHA 2J9AA 4ZY1A 3IWWA 1N71A 2GREA 5BY0A 2GANA 4ONWA 1YLOA 3TO9A 4CAXA 2D4PA 1IOFA 3LWUA 3UY5A 2PJ1A 2ABZA 2BEIA 4XPLA 4ONUA 4E8OA 4M8DA 4LQGA 2B4JC 4NGPA 4GS4A 4QC6A 1QQ9A 1YX0A 4CS0B 4OKOA 1NE9A 3RBUA 2PJ9A 4CYPA 1P0HA 4AG9A 3CXPA 2P6GA 1VGYA 6CPAA 1Y9ZA 2EZBA 2HROA 5K99A 3I6SA 2PCNA 2PR1A 2Z3KA 1M4IA 2GLJA 3OB1B 2JBKA 3I1UA 1YK3A 4M3SA 4KOVA 3TLBA 2ZXVA 2ZEFA 2HB6A 5AG7A 5DS0A 2ZEDA 3H8GA 1NXJA 4H1HA 3BI1A 2VKZG 3NFZA 3KI9A 2OZUA 4PSWA 3TLEA 2QMLA 4J3GA 4R7MA 4CPAA 2WSAA 3D7HA 1V0CA 2AFUA 3PBBA 4NJQA 3RNZA 2R82A 1CPSA 1TF9A 1YGHA 1J4JA 1AUGA 1DTDA 1Y0YA 4KUBA 2Q7BA 3R9EA 4BTFA 4MFLA 2B4DB 3KR5A 2Q4VA 3FMCA 3FX6A 5HMNA 1Q5XA 1R61A 1HDQA 3TFYA 3G3SA 4B12A 1NSAA 3BUMB 3FNCA 1UWYA 5A27A 4C8FA 4DYOA 4IF5A 4CRZB 3JVNA 3FRMA 2PC1A 3C26A 4A33A 3K4IA 3SJFA 1ELMP 1S7NA 4PXDA 1TF8A 2DPTA 2OZGA 3PT1A 3N5FA 5HKZA 1NSLA 4TJVA 4OP4A 4K3NA 3P2HA 5HKWA 3WR7A 4A31A 5JGFA 5K8PA 2PJ2A 4R76A 1J3LA 2QYVA 4AVCA 3PFVA 1HDUA 1F2PA 3B7IA 3D67A 2ZW5A 2EK9A 2REFA 4FAIA 4KOTA 3BI0A 5DWNA 4UWJA 4EMEA 1LAPA 3TE4A 4H2KA 3ISXA 1CP7A 3NOJA 3SI2A 1S7KA 3FEEA 2RB7A 2ZEEA 1GHEA 2V8VA 4MMOA 3ZZIA 5KTDA 5J3XA 3LODA 4YWYA 1JDBC 2HI6A 4L8AA 1Z5RA 2K5TA 4PXBA 5HH1A 5HXDA 1DIKA 5JYBA 3T5MA 4MCQA 4A94A 1Y9KA 2AFWA 4MCRA 3CXQA 4KOSA 2O53A 1TIQA 5LRJA 5K8OA 2J8RA 1MK4A 3PEIA 1QSMA 1S7LA 3PB7X 2EWBA 1YMEA 4LQ6A 4MI4A 2AFXA 4NF1A 2BL1A 4O23A 5HVHA 2GP4A 4NGSA 1PCAA 3DR8A 3VGOA 2EZCA 1Q7LA 1CS0B 4Q38A 2I00A 4F0YA 1Q2DA 4H6ZA 1LFWA 4CAFA 4NFRA 4GXHA 4AXVA 2VQYA 4X2TA 4DJLA 3B3TA 3EC4A 4E94A 3QAHA 5LYFA 3TOAA 1NBWA 2CTCA 3V38A 1ZO0A 4A38A 2GU2A 5LRGA 4DNCA 2REEA 3KQZA 2YNEA 5ISVA 3KRVA 1YW6A 3B35A 1RXTA 2VZYA 3CDXA 4OC2A 3ZJ0A 4C9RA 4BPUB 2FE7A 5J1QA 4E5SA 2XEGA 2J8NA 1R57A 4M6IA 2FCKA 2EBJA 4CGLA 2PJ8A 4NCZA 2ZEMA 1DE4C 1L0CA 1Z8TA 2HQYA 1VIXA 3IJ3A 3CT9A 4FD7A 4MFKA 4J0NA 3IWEA 2WZNA 2CNSA 4B13A 1YVHA 2IJZA 2PCUA 1RTQA 3C8OA 1IGBA 1MJBA 1XRYA 2FVGA 3S6HA 3WC6A 4OIWA 4KOYA 1Y0RA 2Z10A 1V6CA 2XPNA 2RC4A 3JUWA 3SJEA 3OWCA 4R57A 4A2ZA 3U1BA 2Q43A 4OC5A 4BPWB 3T0TA 5G22A 4A39A 4C68A 3GIUA 4MY3A 3TO7A 2YNCA 4GM5A 5ELYA 4MHNA 2WPXA 5AXIA 4F9VA 1VKCA 3PB9X 4KVOE 4P6YA 5C88A 4A4BA 4PV6A 3B8GA 4C8PA 3PFOA 1ZL0A 3TTHA 2AFZA 3U88C 3CPXA 5HVGA 2Y1NA 1RO5A 2DLAA 4Q7AA 4CDJA 4C2ZA 1VHEA 4ZX8A 3G23A 1KEEB 1IB1E 3BUXB 5JPHA 4P44A 4UCMA 2Z3PA 3K9TA 3I3GA 3LMSA 4PK3A 5G20A 4NJRA 4R3LA 1EO0A 2OH1A 2JLMA 1BPMA 5BWAB 4K30A 3QB8A 2AFSA 2ZOFA 4NSQA 4R8FA 2NMTA 3PB4X 1FBVA 2WPWA 4INJA 1P4NA 1CX8A 2ZW6A 4IK2A 1XE4A 1YVOA 2Z11A 4OLLA 4R6TA 4C9VA 3OAKA 1I21A 1Z8WA 1XMTA 3FEDA 2PJ4A 5K8NA 2VI7A 4KSFA 3GUXA 1GGOA 2AUNA 2UV8G 3RO0A 1EE3P 2B4BA 3A9LA 4FUUA 1Z8XA 3D7GA 2Z3LA 4U5YA 3IFEA 3W91A 1B47A 3H8EA 3K9UA 3WABA 4X5KA 5EBVA 2VXKA 3PZJA 4GPLB 1H8LA 2VL1A 1R43A 2VEZA 4PK2A 1KC7A 2Z3NA 3RYOA 3CPAA 4XPDB 1TKJA 3GKRA 4KZTA 1EZAA 3GJZA 2PJCA 1CM0A 1EZBA 3T90A 2BUEA 3EZBA 2R98A 2ODFA 2PIZA 2CY2A 4FBEA 4MJXA 2F7VA 2N3AB 4P45A 3R1KA 3NE8A 4JJXA 2ARHA 4MRIA 2Y0MA 4ORFA 3W6SA 4C2XA 5JVLA 2EK8A 2VBQA 2EUIA 3QAYA 4OMEA 4IAVA 3TOBA 1VHOA 3H4QA 3GLJA 4B14A 2JEVA 5EMIA 2ZENA 3KZWA 2XEJA 3FECA 2OZHA 3E0KA 1QSNA 3SJXA 3VROA 1YSJA 3JRUA 3IU1A 4UWIA 4LX9A 1B6BA 1MJ9A 3T07A 1M4GA 3DNSA 5C82A 3EY5A 3EFAA 4HNXB 2Y1MA 2EVNA 4IUSA 2FM4A 1KBLA 3OB2B 1JWQA 1PUAA 2NSMA 3R9GA 2BO9A 3MN8A 4PXCA 3SHPA 3V7ZA 2DIKA 3KHZA 2DXQA 1FY7A 2B3VA 2FS5A 4Q36A 3DDDA 3R9FA 4B5PA 4H89A 1IYKA 2V8HA 4PXEA 4A37A 4B5OA 1Z9UA 2PRQA 5IR2A 1QSOA 4HKFA 1YLEA 3VRRA 2GIVA 2V8GA 3D66A 3EO4A 4KS9A 4WWVA 1BLLE 2WYRA 3WT4A 1ZYMA 2OLSA 4ZY0A 5G21A 2JBJA 1B87A 4XNHB 5FVJA 4YU9A 2C27A 2F8HA 3S9NA 4U9ZA 5AG6A 1LANA 3T9YA 2Z0ZA 2PJAA 4KUAA 4I49A 4MJ8A 2KCWA 5F13A 4C99A 4UEEA 1M4DA 4ZBGA 4KLWA 5LRKA 1CPXA 4UFXA 4A30A 1TKFA 3TCVA 5F09A 1ARLA 2O4HA 2PJ7A 4PPZA 4E2AA 3VRPA 1YR0A 5I4MA 4BPXB 2C6PA 4KOUA 1FNOA 4L89A 1VBGA 2XPPA 3QNVA 4HNYB 1IOIA 3B3CA 3DR6A 1Q2CA 3JTKA 1ELLP 1Y9WA 1LOKA 4UCNA 1X12A 3T8WA 2ZW4A 5I0CA 1QSRA 1Z4RA 3TT2A 4EWTA 4BD9A 3NH8A 4QVTA 4F0XA 3KL9A 5AG4A 3EZAA 2OU2A 4OIDA 3W6XA 3FVLA 3ICUA 1M6VB 4FD4A 1Q2YA 2GFQA 5AG5A 5H84A 1T36B 3PBEA 4BMHA 4UIBA 2AJ6A 4B11A 3H5ZA 3IO1A 4UA3A 3CXSA 4ZI6A 2HUZA 1KWMA 3D2MA 4FD5A 4QUSA 2HV2A 4IHMA 4UFVA 1A9XB 3TLGA 2ZEPA 4M6HA 4C86A 3TLAA 5THWA 4NGMA 3D8PA 4II9A 3I74A 3RZAA 1Z8LA 4KVME 2V8DA 2MP0A 3BHXA 2R8VA 2WUUA 4JLYA 3VWDA 4B5PB 5CPAA 3SXOA 4NGRA 1XF8A 1BO4A 4U9YA 2ZEHA 4KVXA 4MCSA 1U6MA 2FL4A 1M44A 4UBRA 2HWGA 2NYQA 2XPLA 3OP0A 2QVPA 4H6UA 4AB7A 2ZPAA 3FH4A 2YNCC 1LCPA 4MFZA 1JQGA 3NFQA 2BSWA 2X7BA 1VHSA 2OB0A 3KHXA 1ON0A 3R95A 4P4JA 4C9AA 4KSAA 2Q4ZA 4CYOA 4MCPA 1YREA 3D2PA 3D4UA 3DGVA 4CZ1A 2ZOGA 2ZW7A 3IWGA 1CJWA 1M1DA 1WWZA 2FIAA 3WC7A 1MJAA 4JWPA 3MGDA 1YVKA 2XEFA 1OBRA 1TKHA 2ZELA 3PGPA 1C3OB 3S6FA 5DWMA 3O8ZA 4C8AA 3BLNA 5HKYA 4MHPA 2B0AA 3PLFB 3GY9A 1XFOA 2DF5A 3WC5A 3KQXA 4YGOA 5A28A 4CYQA 3EIFA 1X10A 1IICA 4AVBA 4KSIA 2PJ6A 3F8KA 1S60A 5F46A 2Q51A 3NA6A 4W9YA 1YQEA 2AFOA 3FYNA 3N7ZA 4QB9A 3HPGG 2FSRA 5D8NA 2DPSA 5IB9A 2B5GB 5IV0A 5JM6A 4BBHA 1KZFA 1XJOA 5FD8A 4UIAA 4UCPA 2PIYA 3S6GA 3F0AA 3DSBA 4MBUA 1IY7A 2QJ8A 1XMBA 4OC1A 3T05A 2P6EA 4CAWA 1ZG9A 2AUMA 2D4OA 1ARMA 2YNDA 1M4LA 4KORA 2BCOA 3TLGB 1KUYA 1BOBA 4RS2A 1HEEA 2C6GA 2PR8A 4MHDA 5CBMA 4M6GA 3SR3A 1I1DA 2I79A 5LYIA 3LACA 2PSWA 2I3CA 4MXUA 2CNMA 3P2FA 2B3UA 5IX3A 2CF4A 1UFHA 3BUNB 4P4BA 1LRZA 4XNHC 2Q04A 2Q7SA 2A4NA 4HPSA 4P4FA 4RI1A 4AVAA 1F2OA 4C8CA 5EC4A 4B6ZA 3VTAA 1WK4A 3DLJA 4F9UA 1KUVA 4YRHA 1ZRSA 5J8FA 2JDCA 2FIWA 1BXRB 4IIXA 3VRNA 4NGQA 2GE3A 2B58A 2AE6A 4ZX9A 4NXYA 1IYLA 1LAMA 1A2ZA 3FIXA 4PQAA 4C9UA 3F9KC 1CP6A 1IIDA 1OZPA 3GB0A 3TX8A 4A32A 4IIYA 2Q44A 3FJUA 1CBXA 2QECA 3KKWA 3TYXA 4EYSA 3D7DA 2PJ0A 4LUAA 4C8TA 4DUKA 1XOVA 4UEZA 2FXFA 3B3WA 2Q0YA 2R1IA 1I12A 2DEAA 1IU8A 2G3TA 2P6FA 2Z3MA 3S6KA 5E96A 3FB3A 3IEHA 3VWEA 4P4IA 4MI1A 1VBHA 5F5XA 4CO9A 4Y49B 2IMOA 3PRTA 4KNGE 3PB8X 4OC4A
chains in the Genus database with same CATH topology
3RAMA 3SI1A 2ZEGA 2JEWA 3TC8A 2PVVA 2PVWA 3H8FA 1QMUA 1BPNA 3L2NA 2CIJA 1YW4A 1GYTA 3IC1A 8CPAA 3ISZA 4TWEA 1F57A 4EFDA 4C8UA 3NH5A 4MHZA 2CTBA 4MHYA 2XEIA 2C6CA 1AYEA 3K2KA 4P4DA 2PJBA 3MRUA 3SJGA 1ZG8A 2BOAA 4ZY2A 4JYWA 1ZG7A 4UEFA 4UF4A 1ZLIA 3B3VA 1Y7EA 4G1PA 3VH9A 3HLPA 2PJ5A 3NH4A 3S9MA 4RUHA 3FF3A 1WVMA 4X8IA 5HVFA 4YN3A 2OR4A 4Z65A 3VARA 4WJBA 4TNUA 2PJ3A 2OOTA 2PE3A 3B2YA 5LYDA 4TJXA 4P4EA 2HC9A 4OC0A 2C5QA 2POKA 2AFMA 4C85A 3IIBA 3PFEA 4FWUA 5JH9A 1CG2A 2ANPA 3HUVA 3S9LA 1XF1A 4X3RA 5D29A 3BXMA 1FT7A 4P10A 4JZ0A 4OC3A 2GLFA 4NGNA 5K8MA 1AMPA 2G9DA 1PYTB 4C84A 2ZEOA 1BAVA 1TXRA 4ZYQA 1R3NA 2RFHA 3SI0A 4CDKA 3D7FA 4NGTA 3VATA 4F8ZA 3KGQA 3B3SA 3D68A 3KR4A 5LYLA 7CPAA 1XBUA 4C9EA 2IQ6A 3KASA 3PB6X 2V77A 1Z2LA 2C1CA 1ZLHA 2J9AA 4ZY1A 3IWWA 2GREA 4ONWA 1YLOA 3LWUA 2PJ1A 2ABZA 4LQGA 4NGPA 1QQ9A 4OKOA 3RBUA 2PJ9A 6CPAA 1VGYA 1Y9ZA 3I6SA 2GLJA 2JBKA 3I1UA 2ZEFA 2HB6A 5DS0A 2ZEDA 3H8GA 3BI1A 3NFZA 3KI9A 4R7MA 4CPAA 3D7HA 2AFUA 3PBBA 4NJQA 1CPSA 1TF9A 1DTDA 1Y0YA 3KR5A 3FMCA 3FX6A 1HDQA 1NSAA 1UWYA 4C8FA 4DYOA 3SJFA 1ELMP 4PXDA 1TF8A 3N5FA 4TJVA 4OP4A 4K3NA 5JGFA 5K8PA 2PJ2A 4R76A 2QYVA 1HDUA 1F2PA 3B7IA 3D67A 2EK9A 4FAIA 3BI0A 4EMEA 1LAPA 4H2KA 3ISXA 1CP7A 3SI2A 3FEEA 2RB7A 2ZEEA 2V8VA 4MMOA 4YWYA 1Z5RA 4PXBA 5HXDA 4MCQA 4A94A 5LRJA 2AFWA 4MCRA 5K8OA 2O53A 3PEIA 3PB7X 2EWBA 1YMEA 5HVHA 2AFXA 2GP4A 4O23A 4NGSA 1PCAA 1Q7LA 1LFWA 4NFRA 4AXVA 4X2TA 4DJLA 3B3TA 5LYFA 2CTCA 3V38A 4A38A 2GU2A 5LRGA 3KQZA 1YW6A 3B35A 3CDXA 4OC2A 4C9RA 5J1QA 2XEGA 2PJ8A 2ZEMA 1DE4C 3IJ3A 1VIXA 3CT9A 2WZNA 2IJZA 2PCUA 1RTQA 1IGBA 1XRYA 3WC6A 2FVGA 4OIWA 1Y0RA 1V6CA 3SJEA 2Q43A 4OC5A 4A39A 4GM5A 5ELYA 4MHNA 4F9VA 4P6YA 3PB9X 4C8PA 3PFOA 2AFZA 3CPXA 5HVGA 4Q7AA 4CDJA 1VHEA 4ZX8A 4P44A 3K9TA 3LMSA 4NJRA 1BPMA 2AFSA 2ZOFA 4R8FA 3PB4X 1CX8A 4IK2A 4C9VA 4R6TA 3FEDA 2PJ4A 5K8NA 3GUXA 1EE3P 4FUUA 3D7GA 3IFEA 3H8EA 3WABA 1H8LA 2VL1A 1R43A 3CPAA 1TKJA 2PJCA 2PIZA 4FBEA 2F7VA 4P45A 4MRIA 2EK8A 4IAVA 4OMEA 1VHOA 3GLJA 2ZENA 3KZWA 2XEJA 3FECA 3SJXA 3JRUA 1YSJA 2NSMA 2BO9A 3MN8A 4PXCA 3V7ZA 3KHZA 2V8HA 4PXEA 4A37A 2PRQA 5IR2A 4WWVA 2V8GA 3D66A 1BLLE 2WYRA 3WT4A 4ZY0A 2JBJA 4YU9A 2F8HA 3S9NA 1LANA 2PJAA 4C99A 4UEEA 5LRKA 1CPXA 1TKFA 5F09A 1ARLA 2O4HA 2PJ7A 4PPZA 5I4MA 2C6PA 1FNOA 3QNVA 3B3CA 3T8WA 1ELLP 1LOKA 4EWTA 4BD9A 3NH8A 3KL9A 4OIDA 3FVLA 3ICUA 3PBEA 4UIBA 3IO1A 4ZI6A 1KWMA 4IHMA 2ZEPA 4C86A 5THWA 4NGMA 3I74A 3RZAA 1Z8LA 2V8DA 3BHXA 5CPAA 4NGRA 2ZEHA 4MCSA 2NYQA 2QVPA 3FH4A 1LCPA 1JQGA 3KHXA 4C9AA 4P4JA 2Q4ZA 4MCPA 3D4UA 3DGVA 2ZOGA 3WC7A 2XEFA 1OBRA 1TKHA 2ZELA 4C8AA 4MHPA 1XFOA 3WC5A 3KQXA 3EIFA 4KSIA 2PJ6A 2Q51A 3NA6A 4W9YA 2AFOA 5IB9A 5D8NA 5JM6A 1XJOA 4UIAA 2PIYA 1IY7A 2QJ8A 1XMBA 4OC1A 1ZG9A 1ARMA 1M4LA 2BCOA 1HEEA 2C6GA 5CBMA 5LYIA 2I3CA 4MXUA 2CF4A 4P4BA 4P4FA 4C8CA 1F2OA 4B6ZA 3VTAA 3DLJA 4F9UA 4NGQA 4ZX9A 1LAMA 4PQAA 4C9UA 1CP6A 3GB0A 3TX8A 3FJUA 1CBXA 3D7DA 2PJ0A 4C8TA 4DUKA 4UEZA 3B3WA 2DEAA 3IEHA 4P4IA 2IMOA 3PRTA 4KNGE 3PB8X 4OC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RAM A;  3SI1 A;  2ZEG A;  2JEW A;  3TC8 A;  2PVV A;  2PVW A;  3H8F A;  1QMU A;  1BPN A;  3L2N A;  2CIJ A;  1YW4 A;  1GYT A;  3IC1 A;  8CPA A;  3ISZ A;  4TWE A;  1F57 A;  4EFD A;  4C8U A;  3NH5 A;  4MHZ A;  2CTB A;  4MHY A;  2XEI A;  2C6C A;  1AYE A;  3K2K A;  4P4D A;  2PJB A;  3MRU A;  3SJG A;  1ZG8 A;  2BOA A;  4ZY2 A;  4JYW A;  1ZG7 A;  4UEF A;  4UF4 A;  1ZLI A;  3B3V A;  1Y7E A;  4G1P A;  3VH9 A;  3HLP A;  2PJ5 A;  3NH4 A;  3S9M A;  4RUH A;  3FF3 A;  1WVM A;  4X8I A;  5HVF A;  4YN3 A;  2OR4 A;  4Z65 A;  3VAR A;  4WJB A;  4TNU A;  2PJ3 A;  2OOT A;  2PE3 A;  3B2Y A;  5LYD A;  4TJX A;  4P4E A;  2HC9 A;  4OC0 A;  2POK A;  2AFM A;  4C85 A;  3IIB A;  3PFE A;  4FWU A;  5JH9 A;  1CG2 A;  2ANP A;  3HUV A;  3S9L A;  1XF1 A;  4X3R A;  5D29 A;  3BXM A;  1FT7 A;  4P10 A;  4JZ0 A;  4OC3 A;  2GLF A;  4NGN A;  5K8M A;  1AMP A;  2G9D A;  1PYT B;  4C84 A;  2ZEO A;  1BAV A;  1TXR A;  4ZYQ A;  1R3N A;  2RFH A;  3SI0 A;  4CDK A;  3D7F A;  4NGT A;  3VAT A;  4F8Z A;  3KGQ A;  3B3S A;  3D68 A;  3KR4 A;  5LYL A;  7CPA A;  1XBU A;  4C9E A;  2IQ6 A;  3KAS A;  3PB6 X;  2V77 A;  1Z2L A;  2C1C A;  1ZLH A;  2J9A A;  4ZY1 A;  3IWW A;  2GRE A;  4ONW A;  1YLO A;  3LWU A;  2PJ1 A;  2ABZ A;  4LQG A;  4NGP A;  1QQ9 A;  4OKO A;  3RBU A;  2PJ9 A;  6CPA A;  1VGY A;  1Y9Z A;  3I6S A;  2GLJ A;  2JBK A;  3I1U A;  2ZEF A;  2HB6 A;  5DS0 A;  2ZED A;  3H8G A;  3BI1 A;  3NFZ A;  3KI9 A;  4R7M A;  4CPA A;  3D7H A;  2AFU A;  3PBB A;  4NJQ A;  1CPS A;  1TF9 A;  1DTD A;  1Y0Y A;  3KR5 A;  3FMC A;  3FX6 A;  1HDQ A;  1NSA A;  1UWY A;  4C8F A;  4DYO A;  3SJF A;  1ELM P;  4PXD A;  1TF8 A;  3N5F A;  4TJV A;  4OP4 A;  4K3N A;  5JGF A;  5K8P A;  2PJ2 A;  4R76 A;  2QYV A;  1HDU A;  1F2P A;  3B7I A;  3D67 A;  2EK9 A;  4FAI A;  3BI0 A;  4EME A;  1LAP A;  4H2K A;  3ISX A;  1CP7 A;  3SI2 A;  3FEE A;  2RB7 A;  2ZEE A;  2V8V A;  4MMO A;  4YWY A;  1Z5R A;  4PXB A;  5HXD A;  4MCQ A;  4A94 A;  5LRJ A;  2AFW A;  4MCR A;  5K8O A;  2O53 A;  3PEI A;  3PB7 X;  2EWB A;  1YME A;  5HVH A;  2AFX A;  4O23 A;  4NGS A;  1PCA A;  1Q7L A;  1LFW A;  4NFR A;  4AXV A;  4X2T A;  4DJL A;  3B3T A;  5LYF A;  2CTC A;  3V38 A;  4A38 A;  2GU2 A;  5LRG A;  3KQZ A;  1YW6 A;  3B35 A;  3CDX A;  4OC2 A;  4C9R A;  5J1Q A;  2XEG A;  2PJ8 A;  2ZEM A;  1DE4 C;  3IJ3 A;  1VIX A;  3CT9 A;  2WZN A;  2IJZ A;  2PCU A;  1RTQ A;  1IGB A;  1XRY A;  3WC6 A;  2FVG A;  4OIW A;  1Y0R A;  1V6C A;  3SJE A;  2Q43 A;  4OC5 A;  4A39 A;  4GM5 A;  5ELY A;  4MHN A;  4F9V A;  4P6Y A;  3PB9 X;  4C8P A;  3PFO A;  2AFZ A;  3CPX A;  5HVG A;  4Q7A A;  4CDJ A;  1VHE A;  4ZX8 A;  4P44 A;  3K9T A;  3LMS A;  4NJR A;  1BPM A;  2AFS A;  2ZOF A;  4R8F A;  3PB4 X;  1CX8 A;  4IK2 A;  4C9V A;  4R6T A;  3FED A;  2PJ4 A;  5K8N A;  3GUX A;  1EE3 P;  4FUU A;  3D7G A;  3IFE A;  3H8E A;  3WAB A;  1H8L A;  2VL1 A;  1R43 A;  3CPA A;  1TKJ A;  2PJC A;  2PIZ A;  4FBE A;  2F7V A;  4P45 A;  4MRI A;  2EK8 A;  4IAV A;  4OME A;  1VHO A;  3GLJ A;  2ZEN A;  3KZW A;  2XEJ A;  3FEC A;  3SJX A;  3JRU A;  1YSJ A;  2NSM A;  2BO9 A;  3MN8 A;  4PXC A;  3V7Z A;  3KHZ A;  2V8H A;  4PXE A;  4A37 A;  2PRQ A;  4WWV A;  2V8G A;  3D66 A;  1BLL E;  2WYR A;  3WT4 A;  4ZY0 A;  2JBJ A;  4YU9 A;  2F8H A;  3S9N A;  1LAN A;  2PJA A;  4C99 A;  4UEE A;  5LRK A;  1CPX A;  1TKF A;  5F09 A;  1ARL A;  2O4H A;  2PJ7 A;  4PPZ A;  5I4M A;  2C6P A;  1FNO A;  3QNV A;  3B3C A;  3T8W A;  1ELL P;  1LOK A;  4EWT A;  4BD9 A;  3NH8 A;  3KL9 A;  4OID A;  3FVL A;  3ICU A;  3PBE A;  4UIB A;  3IO1 A;  4ZI6 A;  1KWM A;  4IHM A;  2ZEP A;  4C86 A;  5THW A;  4NGM A;  3I74 A;  3RZA A;  1Z8L A;  2V8D A;  3BHX A;  5CPA A;  4NGR A;  2ZEH A;  4MCS A;  2NYQ A;  2QVP A;  3FH4 A;  1LCP A;  1JQG A;  3KHX A;  4C9A A;  4P4J A;  2Q4Z A;  4MCP A;  3D4U A;  3DGV A;  2ZOG A;  3WC7 A;  2XEF A;  1OBR A;  1TKH A;  2ZEL A;  4C8A A;  4MHP A;  1XFO A;  3WC5 A;  3KQX A;  3EIF A;  4KSI A;  2PJ6 A;  2Q51 A;  3NA6 A;  4W9Y A;  2AFO A;  5IB9 A;  5D8N A;  5JM6 A;  1XJO A;  4UIA A;  2PIY A;  1IY7 A;  2QJ8 A;  1XMB A;  4OC1 A;  1ZG9 A;  1ARM A;  1M4L A;  2BCO A;  1HEE A;  2C6G A;  5CBM A;  5LYI A;  2I3C A;  4MXU A;  2CF4 A;  4P4B A;  4P4F A;  4C8C A;  1F2O A;  4B6Z A;  3VTA A;  3DLJ A;  4F9U A;  4NGQ A;  4ZX9 A;  1LAM A;  4PQA A;  4C9U A;  1CP6 A;  3GB0 A;  3TX8 A;  3FJU A;  1CBX A;  3D7D A;  2PJ0 A;  4C8T A;  4DUK A;  4UEZ A;  3B3W A;  2DEA A;  3IEH A;  4P4I A;  2IMO A;  3PRT A;  4KNG E;  3PB8 X;  4OC4 A; 
#chains in the Genus database with same CATH topology
 5KTA A;  3RAM A;  3SI1 A;  2ZEG A;  4JD6 A;  4ZGY B;  4FD6 A;  5G1Z A;  2CNT A;  1S7F A;  3HMJ G;  2JEW A;  3TC8 A;  2PVV A;  2PVW A;  4A4C A;  4CAV A;  3H8F A;  1QMU A;  4OAD A;  1XEB A;  1BPN A;  2CXA A;  4UFW A;  3L2N A;  2CIJ A;  3HPH E;  3FBU A;  4KLV A;  2EZA A;  2X0S A;  1YW4 A;  1K4J A;  1GYT A;  2FT0 A;  5F49 A;  3IC1 A;  4RR2 B;  8CPA A;  3ISZ A;  4TWE A;  4KOW A;  4R87 A;  1F57 A;  3I9S A;  4CAE A;  4EFD A;  2D0P A;  4C8U A;  3NH5 A;  4MHZ A;  3V8I A;  1NMT A;  2CTB A;  4MHY A;  2XEI A;  2C6C A;  4C7I A;  1AYE A;  3K2K A;  1WJT A;  4P4D A;  2PJB A;  3MRU A;  4C7H A;  3SJG A;  1S3Z A;  1ZG8 A;  2BOA A;  4CGN A;  4MY0 A;  4ZY2 A;  4COB A;  4XPK A;  4JYW A;  1ZG7 A;  4UEF A;  4UF4 A;  1ZLI A;  3B3V A;  1Y7E A;  5AGE A;  3VRQ A;  2XPO A;  1S5K A;  4G1P A;  3VH9 A;  3HLP A;  2PJ5 A;  2QIR A;  3BUW B;  3S9M A;  2B5G A;  3G8W A;  3NH4 A;  5GCN A;  4RUH A;  2YJV A;  1PU9 A;  3FF3 A;  2D0O A;  1WVM A;  1SQH A;  5F48 A;  4X8I A;  2Z3O A;  3IGR A;  2G0B A;  5HVF A;  2P0W A;  4YN3 A;  2OR4 A;  4F6A A;  2J8M A;  4JXQ A;  4Z65 A;  3VAR A;  3SXN A;  4WJB A;  3EZE A;  4TNU A;  1VI4 A;  4R3K A;  2PJ3 A;  4OAE A;  1JDE A;  2OOT A;  2PE3 A;  5F47 A;  3B2Y A;  5LYD A;  4TJX A;  4MFQ A;  4P4E A;  4MFJ A;  2E28 A;  2HC9 A;  4OC0 A;  2C5Q A;  4COG A;  4JXR A;  2POK A;  3LD2 A;  4A95 A;  2G3A A;  2YGW A;  4QBJ A;  2AFM A;  3GYA A;  4CGO A;  4EVY A;  3FXT A;  4C85 A;  3IIB A;  3PFE A;  4XPD C;  5IB0 A;  3F5B A;  2F5I A;  2R7H A;  5KTC A;  2PRB A;  4FWU A;  4AG7 A;  4YFJ A;  4NEX A;  1CG2 A;  2ANP A;  3BJ7 A;  3S9L A;  3HUV A;  4X3R A;  5JH9 A;  1XF1 A;  5D29 A;  3BXM A;  4C2Y A;  1FT7 A;  5F9M A;  4P10 A;  4JZ0 A;  4OC3 A;  2GLF A;  4NGN A;  5K8M A;  3ZNI A;  1AMP A;  1Z4E A;  2G9D A;  1Z9E A;  4PSX A;  1PYT B;  1KUX A;  4R9M A;  4C84 A;  2PDO A;  2ZEO A;  1BAV A;  2VZZ A;  1TXR A;  4ZYQ A;  4HNW B;  4JVO A;  4CGP A;  3PP9 A;  5CNP A;  1R3N A;  3D3S A;  3CZX A;  2H5M A;  4KOX A;  2EO8 A;  3TLY A;  2RFH A;  3SI0 A;  4E0A A;  2O28 A;  1C30 B;  3BJ8 A;  4CDK A;  2B4D A;  2PQ8 A;  3D7F A;  3IU2 A;  4NGT A;  4CYN A;  5J8C A;  3VAT A;  1QST A;  4F8Z A;  3BUO B;  3KGQ A;  3NE7 A;  5JQ4 A;  2ATR A;  3B3S A;  3D68 A;  4BIN A;  1CE8 B;  3KR4 A;  5LYL A;  3TLZ A;  4RN7 A;  2Q4Y A;  4MFP A;  4Y49 C;  7CPA A;  5F1Y A;  5H86 A;  1XBU A;  4B10 A;  2YJT A;  4C9E A;  3TLC A;  3EXN A;  2CBL A;  4CRY B;  2IL4 A;  3KAS A;  1Y7R A;  2IQ6 A;  3PB6 X;  3R96 A;  2V77 A;  1Z2L A;  2JDD A;  1XIX A;  4CGM A;  4M85 A;  2C1C A;  3TO6 A;  1ZLH A;  2J9A A;  4ZY1 A;  3IWW A;  1N71 A;  2GRE A;  5BY0 A;  2GAN A;  4ONW A;  1YLO A;  3TO9 A;  4CAX A;  2D4P A;  1IOF A;  3LWU A;  3UY5 A;  2PJ1 A;  2ABZ A;  2BEI A;  4XPL A;  4ONU A;  4E8O A;  4M8D A;  4LQG A;  2B4J C;  4NGP A;  4GS4 A;  4QC6 A;  1QQ9 A;  1YX0 A;  4CS0 B;  4OKO A;  1NE9 A;  3RBU A;  2PJ9 A;  4CYP A;  1P0H A;  4AG9 A;  3CXP A;  2P6G A;  1VGY A;  6CPA A;  1Y9Z A;  2EZB A;  2HRO A;  5K99 A;  3I6S A;  2PCN A;  2PR1 A;  2Z3K A;  1M4I A;  2GLJ A;  3OB1 B;  2JBK A;  3I1U A;  1YK3 A;  4M3S A;  4KOV A;  3TLB A;  2ZXV A;  2ZEF A;  2HB6 A;  5AG7 A;  5DS0 A;  2ZED A;  3H8G A;  1NXJ A;  4H1H A;  3BI1 A;  2VKZ G;  3NFZ A;  3KI9 A;  2OZU A;  4PSW A;  3TLE A;  2QML A;  4J3G A;  4R7M A;  4CPA A;  2WSA A;  3D7H A;  1V0C A;  2AFU A;  3PBB A;  4NJQ A;  3RNZ A;  2R82 A;  1CPS A;  1TF9 A;  1YGH A;  1J4J A;  1AUG A;  1DTD A;  1Y0Y A;  4KUB A;  2Q7B A;  3R9E A;  4BTF A;  4MFL A;  2B4D B;  3KR5 A;  2Q4V A;  3FMC A;  3FX6 A;  5HMN A;  1Q5X A;  1R61 A;  1HDQ A;  3TFY A;  3G3S A;  4B12 A;  1NSA A;  3BUM B;  3FNC A;  1UWY A;  5A27 A;  4C8F A;  4DYO A;  4IF5 A;  4CRZ B;  3JVN A;  3FRM A;  2PC1 A;  3C26 A;  4A33 A;  3K4I A;  3SJF A;  1ELM P;  1S7N A;  4PXD A;  1TF8 A;  2DPT A;  2OZG A;  3PT1 A;  3N5F A;  5HKZ A;  1NSL A;  4TJV A;  4OP4 A;  4K3N A;  3P2H A;  5HKW A;  3WR7 A;  4A31 A;  5JGF A;  5K8P A;  2PJ2 A;  4R76 A;  1J3L A;  2QYV A;  4AVC A;  3PFV A;  1HDU A;  1F2P A;  3B7I A;  3D67 A;  2ZW5 A;  2EK9 A;  2REF A;  4FAI A;  4KOT A;  3BI0 A;  5DWN A;  4UWJ A;  4EME A;  1LAP A;  3TE4 A;  4H2K A;  3ISX A;  1CP7 A;  3NOJ A;  3SI2 A;  1S7K A;  3FEE A;  2RB7 A;  2ZEE A;  1GHE A;  2V8V A;  4MMO A;  3ZZI A;  5KTD A;  5J3X A;  3LOD A;  4YWY A;  1JDB C;  2HI6 A;  4L8A A;  1Z5R A;  2K5T A;  4PXB A;  5HH1 A;  5HXD A;  1DIK A;  5JYB A;  3T5M A;  4MCQ A;  4A94 A;  1Y9K A;  2AFW A;  4MCR A;  3CXQ A;  4KOS A;  2O53 A;  1TIQ A;  5LRJ A;  5K8O A;  2J8R A;  1MK4 A;  3PEI A;  1QSM A;  1S7L A;  3PB7 X;  2EWB A;  1YME A;  4LQ6 A;  4MI4 A;  2AFX A;  4NF1 A;  2BL1 A;  4O23 A;  5HVH A;  2GP4 A;  4NGS A;  1PCA A;  3DR8 A;  3VGO A;  2EZC A;  1Q7L A;  1CS0 B;  4Q38 A;  2I00 A;  4F0Y A;  1Q2D A;  4H6Z A;  1LFW A;  4CAF A;  4NFR A;  4GXH A;  4AXV A;  2VQY A;  4X2T A;  4DJL A;  3B3T A;  3EC4 A;  4E94 A;  3QAH A;  5LYF A;  3TOA A;  1NBW A;  2CTC A;  3V38 A;  1ZO0 A;  4A38 A;  2GU2 A;  5LRG A;  4DNC A;  2REE A;  3KQZ A;  2YNE A;  5ISV A;  3KRV A;  1YW6 A;  3B35 A;  1RXT A;  2VZY A;  3CDX A;  4OC2 A;  3ZJ0 A;  4C9R A;  4BPU B;  2FE7 A;  5J1Q A;  4E5S A;  2XEG A;  2J8N A;  1R57 A;  4M6I A;  2FCK A;  2EBJ A;  4CGL A;  2PJ8 A;  4NCZ A;  2ZEM A;  1DE4 C;  1L0C A;  1Z8T A;  2HQY A;  1VIX A;  3IJ3 A;  3CT9 A;  4FD7 A;  4MFK A;  4J0N A;  3IWE A;  2WZN A;  2CNS A;  4B13 A;  1YVH A;  2IJZ A;  2PCU A;  1RTQ A;  3C8O A;  1IGB A;  1MJB A;  1XRY A;  2FVG A;  3S6H A;  3WC6 A;  4OIW A;  4KOY A;  1Y0R A;  2Z10 A;  1V6C A;  2XPN A;  2RC4 A;  3JUW A;  3SJE A;  3OWC A;  4R57 A;  4A2Z A;  3U1B A;  2Q43 A;  4OC5 A;  4BPW B;  3T0T A;  5G22 A;  4A39 A;  4C68 A;  3GIU A;  4MY3 A;  3TO7 A;  2YNC A;  4GM5 A;  5ELY A;  4MHN A;  2WPX A;  5AXI A;  4F9V A;  1VKC A;  3PB9 X;  4KVO E;  4P6Y A;  5C88 A;  4A4B A;  4PV6 A;  3B8G A;  4C8P A;  3PFO A;  1ZL0 A;  3TTH A;  2AFZ A;  3U88 C;  3CPX A;  5HVG A;  2Y1N A;  1RO5 A;  2DLA A;  4Q7A A;  4CDJ A;  4C2Z A;  1VHE A;  4ZX8 A;  3G23 A;  1KEE B;  1IB1 E;  3BUX B;  5JPH A;  4P44 A;  4UCM A;  2Z3P A;  3K9T A;  3I3G A;  3LMS A;  4PK3 A;  5G20 A;  4NJR A;  4R3L A;  1EO0 A;  2OH1 A;  2JLM A;  1BPM A;  5BWA B;  4K30 A;  3QB8 A;  2AFS A;  2ZOF A;  4NSQ A;  4R8F A;  2NMT A;  3PB4 X;  1FBV A;  2WPW A;  4INJ A;  1P4N A;  1CX8 A;  2ZW6 A;  4IK2 A;  1XE4 A;  1YVO A;  2Z11 A;  4OLL A;  4R6T A;  4C9V A;  3OAK A;  1I21 A;  1Z8W A;  1XMT A;  3FED A;  2PJ4 A;  5K8N A;  2VI7 A;  4KSF A;  3GUX A;  1GGO A;  2AUN A;  2UV8 G;  3RO0 A;  1EE3 P;  2B4B A;  3A9L A;  4FUU A;  1Z8X A;  3D7G A;  2Z3L A;  4U5Y A;  3IFE A;  3W91 A;  1B47 A;  3H8E A;  3K9U A;  3WAB A;  4X5K A;  5EBV A;  2VXK A;  3PZJ A;  4GPL B;  1H8L A;  2VL1 A;  1R43 A;  2VEZ A;  4PK2 A;  1KC7 A;  2Z3N A;  3RYO A;  3CPA A;  4XPD B;  1TKJ A;  3GKR A;  4KZT A;  1EZA A;  3GJZ A;  2PJC A;  1CM0 A;  1EZB A;  3T90 A;  2BUE A;  3EZB A;  2R98 A;  2ODF A;  2PIZ A;  2CY2 A;  4FBE A;  4MJX A;  2F7V A;  2N3A B;  4P45 A;  3R1K A;  3NE8 A;  4JJX A;  2ARH A;  4MRI A;  2Y0M A;  4ORF A;  3W6S A;  4C2X A;  5JVL A;  2EK8 A;  2VBQ A;  2EUI A;  3QAY A;  4OME A;  4IAV A;  3TOB A;  1VHO A;  3H4Q A;  3GLJ A;  4B14 A;  2JEV A;  5EMI A;  2ZEN A;  3KZW A;  2XEJ A;  3FEC A;  2OZH A;  3E0K A;  1QSN A;  3SJX A;  3VRO A;  1YSJ A;  3JRU A;  3IU1 A;  4UWI A;  4LX9 A;  1B6B A;  1MJ9 A;  3T07 A;  1M4G A;  3DNS A;  5C82 A;  3EY5 A;  3EFA A;  4HNX B;  2Y1M A;  2EVN A;  4IUS A;  2FM4 A;  1KBL A;  3OB2 B;  1JWQ A;  1PUA A;  2NSM A;  3R9G A;  2BO9 A;  3MN8 A;  4PXC A;  3SHP A;  3V7Z A;  2DIK A;  3KHZ A;  2DXQ A;  1FY7 A;  2B3V A;  2FS5 A;  4Q36 A;  3DDD A;  3R9F A;  4B5P A;  4H89 A;  1IYK A;  2V8H A;  4PXE A;  4A37 A;  4B5O A;  1Z9U A;  2PRQ A;  5IR2 A;  1QSO A;  4HKF A;  1YLE A;  3VRR A;  2GIV A;  2V8G A;  3D66 A;  3EO4 A;  4KS9 A;  4WWV A;  1BLL E;  2WYR A;  3WT4 A;  1ZYM A;  2OLS A;  4ZY0 A;  5G21 A;  2JBJ A;  1B87 A;  4XNH B;  5FVJ A;  4YU9 A;  2C27 A;  2F8H A;  3S9N A;  4U9Z A;  5AG6 A;  1LAN A;  3T9Y A;  2Z0Z A;  2PJA A;  4KUA A;  4I49 A;  4MJ8 A;  2KCW A;  5F13 A;  4C99 A;  4UEE A;  1M4D A;  4ZBG A;  4KLW A;  5LRK A;  1CPX A;  4UFX A;  4A30 A;  1TKF A;  3TCV A;  5F09 A;  1ARL A;  2O4H A;  2PJ7 A;  4PPZ A;  4E2A A;  3VRP A;  1YR0 A;  5I4M A;  4BPX B;  2C6P A;  4KOU A;  1FNO A;  4L89 A;  1VBG A;  2XPP A;  3QNV A;  4HNY B;  1IOI A;  3B3C A;  3DR6 A;  1Q2C A;  3JTK A;  1ELL P;  1Y9W A;  1LOK A;  4UCN A;  1X12 A;  3T8W A;  2ZW4 A;  5I0C A;  1QSR A;  1Z4R A;  3TT2 A;  4EWT A;  4BD9 A;  3NH8 A;  4QVT A;  4F0X A;  3KL9 A;  5AG4 A;  3EZA A;  2OU2 A;  4OID A;  3W6X A;  3FVL A;  3ICU A;  1M6V B;  4FD4 A;  1Q2Y A;  2GFQ A;  5AG5 A;  5H84 A;  1T36 B;  3PBE A;  4BMH A;  4UIB A;  2AJ6 A;  4B11 A;  3H5Z A;  3IO1 A;  4UA3 A;  3CXS A;  4ZI6 A;  2HUZ A;  1KWM A;  3D2M A;  4FD5 A;  4QUS A;  2HV2 A;  4IHM A;  4UFV A;  1A9X B;  3TLG A;  2ZEP A;  4M6H A;  4C86 A;  3TLA A;  5THW A;  4NGM A;  3D8P A;  4II9 A;  3I74 A;  3RZA A;  1Z8L A;  4KVM E;  2V8D A;  2MP0 A;  3BHX A;  2R8V A;  2WUU A;  4JLY A;  3VWD A;  4B5P B;  5CPA A;  3SXO A;  4NGR A;  1XF8 A;  1BO4 A;  4U9Y A;  2ZEH A;  4KVX A;  4MCS A;  1U6M A;  2FL4 A;  1M44 A;  4UBR A;  2HWG A;  2NYQ A;  2XPL A;  3OP0 A;  2QVP A;  4H6U A;  4AB7 A;  2ZPA A;  3FH4 A;  2YNC C;  1LCP A;  4MFZ A;  1JQG A;  3NFQ A;  2BSW A;  2X7B A;  1VHS A;  2OB0 A;  3KHX A;  1ON0 A;  3R95 A;  4P4J A;  4C9A A;  4KSA A;  2Q4Z A;  4CYO A;  4MCP A;  1YRE A;  3D2P A;  3D4U A;  3DGV A;  4CZ1 A;  2ZOG A;  2ZW7 A;  3IWG A;  1CJW A;  1M1D A;  1WWZ A;  2FIA A;  3WC7 A;  1MJA A;  4JWP A;  3MGD A;  1YVK A;  2XEF A;  1OBR A;  1TKH A;  2ZEL A;  3PGP A;  1C3O B;  3S6F A;  5DWM A;  3O8Z A;  4C8A A;  3BLN A;  5HKY A;  4MHP A;  2B0A A;  3PLF B;  3GY9 A;  1XFO A;  2DF5 A;  3WC5 A;  3KQX A;  4YGO A;  5A28 A;  4CYQ A;  3EIF A;  1X10 A;  1IIC A;  4AVB A;  4KSI A;  2PJ6 A;  3F8K A;  1S60 A;  5F46 A;  2Q51 A;  3NA6 A;  4W9Y A;  1YQE A;  2AFO A;  3FYN A;  3N7Z A;  4QB9 A;  3HPG G;  2FSR A;  5D8N A;  2DPS A;  5IB9 A;  2B5G B;  5IV0 A;  5JM6 A;  4BBH A;  1KZF A;  1XJO A;  5FD8 A;  4UIA A;  4UCP A;  2PIY A;  3S6G A;  3F0A A;  3DSB A;  4MBU A;  1IY7 A;  2QJ8 A;  1XMB A;  4OC1 A;  3T05 A;  2P6E A;  4CAW A;  1ZG9 A;  2AUM A;  2D4O A;  1ARM A;  2YND A;  1M4L A;  4KOR A;  2BCO A;  3TLG B;  1KUY A;  1BOB A;  4RS2 A;  1HEE A;  2C6G A;  2PR8 A;  4MHD A;  5CBM A;  4M6G A;  3SR3 A;  1I1D A;  2I79 A;  5LYI A;  3LAC A;  2PSW A;  2I3C A;  4MXU A;  2CNM A;  3P2F A;  2B3U A;  5IX3 A;  2CF4 A;  1UFH A;  3BUN B;  4P4B A;  1LRZ A;  4XNH C;  2Q04 A;  2Q7S A;  2A4N A;  4HPS A;  4P4F A;  4RI1 A;  4AVA A;  1F2O A;  4C8C A;  5EC4 A;  4B6Z A;  3VTA A;  1WK4 A;  3DLJ A;  4F9U A;  1KUV A;  4YRH A;  1ZRS A;  5J8F A;  2JDC A;  2FIW A;  1BXR B;  4IIX A;  3VRN A;  4NGQ A;  2GE3 A;  2B58 A;  2AE6 A;  4ZX9 A;  4NXY A;  1IYL A;  1LAM A;  1A2Z A;  3FIX A;  4PQA A;  4C9U A;  3F9K C;  1CP6 A;  1IID A;  1OZP A;  3GB0 A;  3TX8 A;  4A32 A;  4IIY A;  2Q44 A;  3FJU A;  1CBX A;  2QEC A;  3KKW A;  3TYX A;  4EYS A;  3D7D A;  2PJ0 A;  4LUA A;  4C8T A;  4DUK A;  1XOV A;  4UEZ A;  2FXF A;  3B3W A;  2Q0Y A;  2R1I A;  1I12 A;  2DEA A;  1IU8 A;  2G3T A;  2P6F A;  2Z3M A;  3S6K A;  5E96 A;  3FB3 A;  3IEH A;  3VWE A;  4P4I A;  4MI1 A;  1VBH A;  5F5X A;  4CO9 A;  4Y49 B;  2IMO A;  3PRT A;  4KNG E;  3PB8 X;  4OC4 A; 
#chains in the Genus database with same CATH homology
 3RAM A;  3SI1 A;  2ZEG A;  2JEW A;  3TC8 A;  2PVV A;  2PVW A;  3H8F A;  1QMU A;  1BPN A;  3L2N A;  2CIJ A;  1YW4 A;  1GYT A;  3IC1 A;  8CPA A;  3ISZ A;  4TWE A;  1F57 A;  4EFD A;  4C8U A;  3NH5 A;  4MHZ A;  2CTB A;  4MHY A;  2XEI A;  2C6C A;  1AYE A;  3K2K A;  4P4D A;  2PJB A;  3MRU A;  3SJG A;  1ZG8 A;  2BOA A;  4ZY2 A;  4JYW A;  1ZG7 A;  4UEF A;  4UF4 A;  1ZLI A;  3B3V A;  1Y7E A;  4G1P A;  3VH9 A;  3HLP A;  2PJ5 A;  3NH4 A;  3S9M A;  4RUH A;  3FF3 A;  1WVM A;  4X8I A;  5HVF A;  4YN3 A;  2OR4 A;  4Z65 A;  3VAR A;  4WJB A;  4TNU A;  2PJ3 A;  2OOT A;  2PE3 A;  3B2Y A;  5LYD A;  4TJX A;  4P4E A;  2HC9 A;  4OC0 A;  2C5Q A;  2POK A;  2AFM A;  4C85 A;  3IIB A;  3PFE A;  4FWU A;  5JH9 A;  1CG2 A;  2ANP A;  3HUV A;  3S9L A;  1XF1 A;  4X3R A;  5D29 A;  3BXM A;  1FT7 A;  4P10 A;  4JZ0 A;  4OC3 A;  2GLF A;  4NGN A;  5K8M A;  1AMP A;  2G9D A;  1PYT B;  4C84 A;  2ZEO A;  1BAV A;  1TXR A;  4ZYQ A;  1R3N A;  2RFH A;  3SI0 A;  4CDK A;  3D7F A;  4NGT A;  3VAT A;  4F8Z A;  3KGQ A;  3B3S A;  3D68 A;  3KR4 A;  5LYL A;  7CPA A;  1XBU A;  4C9E A;  2IQ6 A;  3KAS A;  3PB6 X;  2V77 A;  1Z2L A;  2C1C A;  1ZLH A;  2J9A A;  4ZY1 A;  3IWW A;  2GRE A;  4ONW A;  1YLO A;  3LWU A;  2PJ1 A;  2ABZ A;  4LQG A;  4NGP A;  1QQ9 A;  4OKO A;  3RBU A;  2PJ9 A;  6CPA A;  1VGY A;  1Y9Z A;  3I6S A;  2GLJ A;  2JBK A;  3I1U A;  2ZEF A;  2HB6 A;  5DS0 A;  2ZED A;  3H8G A;  3BI1 A;  3NFZ A;  3KI9 A;  4R7M A;  4CPA A;  3D7H A;  2AFU A;  3PBB A;  4NJQ A;  1CPS A;  1TF9 A;  1DTD A;  1Y0Y A;  3KR5 A;  3FMC A;  3FX6 A;  1HDQ A;  1NSA A;  1UWY A;  4C8F A;  4DYO A;  3SJF A;  1ELM P;  4PXD A;  1TF8 A;  3N5F A;  4TJV A;  4OP4 A;  4K3N A;  5JGF A;  5K8P A;  2PJ2 A;  4R76 A;  2QYV A;  1HDU A;  1F2P A;  3B7I A;  3D67 A;  2EK9 A;  4FAI A;  3BI0 A;  4EME A;  1LAP A;  4H2K A;  3ISX A;  1CP7 A;  3SI2 A;  3FEE A;  2RB7 A;  2ZEE A;  2V8V A;  4MMO A;  4YWY A;  1Z5R A;  4PXB A;  5HXD A;  4MCQ A;  4A94 A;  5LRJ A;  2AFW A;  4MCR A;  5K8O A;  2O53 A;  3PEI A;  3PB7 X;  2EWB A;  1YME A;  5HVH A;  2AFX A;  2GP4 A;  4O23 A;  4NGS A;  1PCA A;  1Q7L A;  1LFW A;  4NFR A;  4AXV A;  4X2T A;  4DJL A;  3B3T A;  5LYF A;  2CTC A;  3V38 A;  4A38 A;  2GU2 A;  5LRG A;  3KQZ A;  1YW6 A;  3B35 A;  3CDX A;  4OC2 A;  4C9R A;  5J1Q A;  2XEG A;  2PJ8 A;  2ZEM A;  1DE4 C;  3IJ3 A;  1VIX A;  3CT9 A;  2WZN A;  2IJZ A;  2PCU A;  1RTQ A;  1IGB A;  1XRY A;  3WC6 A;  2FVG A;  4OIW A;  1Y0R A;  1V6C A;  3SJE A;  2Q43 A;  4OC5 A;  4A39 A;  4GM5 A;  5ELY A;  4MHN A;  4F9V A;  4P6Y A;  3PB9 X;  4C8P A;  3PFO A;  2AFZ A;  3CPX A;  5HVG A;  4Q7A A;  4CDJ A;  1VHE A;  4ZX8 A;  4P44 A;  3K9T A;  3LMS A;  4NJR A;  1BPM A;  2AFS A;  2ZOF A;  4R8F A;  3PB4 X;  1CX8 A;  4IK2 A;  4C9V A;  4R6T A;  3FED A;  2PJ4 A;  5K8N A;  3GUX A;  1EE3 P;  4FUU A;  3D7G A;  3IFE A;  3H8E A;  3WAB A;  1H8L A;  2VL1 A;  1R43 A;  3CPA A;  1TKJ A;  2PJC A;  2PIZ A;  4FBE A;  2F7V A;  4P45 A;  4MRI A;  2EK8 A;  4IAV A;  4OME A;  1VHO A;  3GLJ A;  2ZEN A;  3KZW A;  2XEJ A;  3FEC A;  3SJX A;  3JRU A;  1YSJ A;  2NSM A;  2BO9 A;  3MN8 A;  4PXC A;  3V7Z A;  3KHZ A;  2V8H A;  4PXE A;  4A37 A;  2PRQ A;  5IR2 A;  4WWV A;  2V8G A;  3D66 A;  1BLL E;  2WYR A;  3WT4 A;  4ZY0 A;  2JBJ A;  4YU9 A;  2F8H A;  3S9N A;  1LAN A;  2PJA A;  4C99 A;  4UEE A;  5LRK A;  1CPX A;  1TKF A;  5F09 A;  1ARL A;  2O4H A;  2PJ7 A;  4PPZ A;  5I4M A;  2C6P A;  1FNO A;  3QNV A;  3B3C A;  3T8W A;  1ELL P;  1LOK A;  4EWT A;  4BD9 A;  3NH8 A;  3KL9 A;  4OID A;  3FVL A;  3ICU A;  3PBE A;  4UIB A;  3IO1 A;  4ZI6 A;  1KWM A;  4IHM A;  2ZEP A;  4C86 A;  5THW A;  4NGM A;  3I74 A;  3RZA A;  1Z8L A;  2V8D A;  3BHX A;  5CPA A;  4NGR A;  2ZEH A;  4MCS A;  2NYQ A;  2QVP A;  3FH4 A;  1LCP A;  1JQG A;  3KHX A;  4C9A A;  4P4J A;  2Q4Z A;  4MCP A;  3D4U A;  3DGV A;  2ZOG A;  3WC7 A;  2XEF A;  1OBR A;  1TKH A;  2ZEL A;  4C8A A;  4MHP A;  1XFO A;  3WC5 A;  3KQX A;  3EIF A;  4KSI A;  2PJ6 A;  2Q51 A;  3NA6 A;  4W9Y A;  2AFO A;  5IB9 A;  5D8N A;  5JM6 A;  1XJO A;  4UIA A;  2PIY A;  1IY7 A;  2QJ8 A;  1XMB A;  4OC1 A;  1ZG9 A;  1ARM A;  1M4L A;  2BCO A;  1HEE A;  2C6G A;  5CBM A;  5LYI A;  2I3C A;  4MXU A;  2CF4 A;  4P4B A;  4P4F A;  4C8C A;  1F2O A;  4B6Z A;  3VTA A;  3DLJ A;  4F9U A;  4NGQ A;  4ZX9 A;  1LAM A;  4PQA A;  4C9U A;  1CP6 A;  3GB0 A;  3TX8 A;  3FJU A;  1CBX A;  3D7D A;  2PJ0 A;  4C8T A;  4DUK A;  4UEZ A;  3B3W A;  2DEA A;  3IEH A;  4P4I A;  2IMO A;  3PRT A;  4KNG E;  3PB8 X;  4OC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...