4X3RA

Avi-gcpii structure in complex with fitc-conjugated gcpii-specific inhibitor
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
690
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of highly potent urea-based, exosite-binding inhibitors selective for glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 261
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4x3rA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x3rA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4x3rA02
3CPXA 1LAMA 2JBJA 4Z65A 1Y7EA 2IJZA 1BLLE 4NFRA 4WJBA 3ISZA 1TKFA 1XF1A 2PJ6A 4ZY2A 3GLJA 3SJEA 2F8HA 1LFWA 1Z2LA 4NGSA 1Z8LA 2NSMA 2GLJA 3I6SA 4P4BA 4YWYA 1BPNA 4UEEA 3FVLA 4A38A 4B6ZA 1OBRA 4MHPA 2ABZA 4UIBA 3PBEA 1Z5RA 3IEHA 4MCRA 4ZX8A 1DE4C 2HB6A 4C9AA 3KZWA 2PRQA 3KL9A 2Q4ZA 4R7MA 5LRKA 4MHYA 1ELMP 4TJXA 4R76A 1VGYA 1TKJA 3WC5A 3N5FA 4RUHA 3MRUA 4X2TA 3BHXA 5JM6A 4P10A 2IQ6A 5HXDA 1FNOA 1TF9A 4TWEA 3D7FA 3KR5A 2IMOA 2V8GA 2ZEOA 3GUXA 3LWUA 3FF3A 3WABA 2ZEDA 4P4EA 1ZG9A 3KQZA 4LQGA 4C9EA 3B3VA 1TF8A 1LOKA 1ZG8A 2V8VA 4CDJA 2PJ0A 4R8FA 2O53A 4AXVA 1DTDA 2ZENA 2GU2A 2JBKA 5I4MA 5K8OA 4ZI6A 1BAVA 2BCOA 5HVFA 5F09A 2PJ7A 5THWA 3RAMA 2G9DA 3HLPA 1XFOA 1NSAA 4OC3A 4UF4A 1YMEA 3WC7A 2RB7A 5LYDA 1YW4A 3B3WA 3IJ3A 4ZX9A 1AYEA 3B3CA 5IB9A 3S9MA 4JZ0A 1VHEA 4PXDA 1EE3P 3EIFA 4MCQA 2PJCA 4NGNA 3CDXA 4ONWA 3HUVA 4DUKA 1YW6A 4F9VA 2F7VA 3FEEA 1ARMA 1LANA 2EK9A 5K8PA 2QYVA 4UIAA 4TJVA 2PVVA 3S9LA 1TKHA 5HVHA 4P4FA 2QJ8A 1XMBA 5J1QA 2ZOFA 4ZYQA 5K8NA 4X3RA 3NH4A 2GLFA 4NGPA 4OP4A 3D7HA 2JEWA 5DS0A 2CF4A 4PXEA 2ZEEA 3B7IA 3LMSA 2AFXA 3KGQA 3CPAA 2PJ9A 4A39A 2PCUA 2PJ3A 4Q7AA 3SI1A 2V8DA 2PJBA 3NH8A 4MCPA 4ZY0A 5ELYA 1CP7A 4C86A 2BOAA 4JYWA 1XBUA 5K8MA 3V7ZA 1V6CA 2PJAA 3BI1A 4NJQA 4KNGE 4EFDA 2QVPA 3D7GA 4OC2A 4OMEA 2OOTA 1UWYA 4GM5A 4OIWA 5JH9A 4G1PA 2ZEFA 4A37A 4K3NA 4P45A 3K2KA 4TNUA 3KHXA 4PXBA 5LRJA 4YU9A 3FH4A 3FMCA 3JRUA 3VTAA 1FT7A 3IO1A 1IY7A 5LYLA 3IIBA 3PB4X 4MCSA 1QMUA 2HC9A 3MN8A 2PE3A 4MXUA 3DLJA 1QQ9A 3D68A 2I3CA 2ZEPA 4NGRA 1F57A 2EWBA 4EMEA 4MHZA 4IHMA 1ELLP 4P4DA 3PEIA 4IK2A 4C9VA 3FECA 3WT4A 1KWMA 3KQXA 3FX6A 2C6GA 2AFZA 4PPZA 4NGTA 5LRGA 3H8GA 2DEAA 2V8HA 1WVMA 3B35A 2PVWA 1VHOA 2AFWA 1LCPA 5CPAA 6CPAA 3TX8A 1BPMA 4PXCA 3CT9A 4MRIA 4NGQA 1M4LA 4C8UA 2Q43A 4C85A 1VIXA 2AFSA 4DYOA 3WC6A 3H8FA 3PB7X 4NGMA 4P4IA 4W9YA 4C9UA 2PJ4A 1XRYA 5LYFA 1CPSA 1HEEA 4C84A 5D29A 2ZOGA 4C8CA 1ARLA 1CBXA 1YLOA 3IC1A 3PB8X 2CIJA 4X8IA 3T8WA 3PFOA 2O4HA 2C6CA 2PJ2A 2ANPA 4OC0A 2ZELA 3PB6X 4UEFA 4OIDA 3NH5A 3RBUA 3SI0A 3QNVA 1Y9ZA 2AFOA 8CPAA 3D7DA 3GB0A 5LYIA 4EWTA 2PIZA 4R6TA 4FUUA 3D4UA 2Q51A 4C99A 2J9AA 4C8AA 2WZNA 2BO9A 1Y0YA 3KI9A 4P6YA 3V38A 3L2NA 3PRTA 1H8LA 4C8PA 2PJ8A 2WYRA 3IWWA 1YSJA 1Y0RA 4MMOA 4DJLA 3B2YA 4YN3A 2EK8A 4BD9A 3SJFA 4FBEA 2V77A 2XEJA 3BXMA 3FEDA 4PQAA 3BI0A 4UEZA 1CG2A 1ZLIA 3VARA 3RZAA 3DGVA 1GYTA 3K9TA 2ZEMA 5D8NA 3SI2A 1F2PA 4C8TA 4IAVA 3D67A 4OC1A 2GREA 2C1CA 4ZY1A 4CPAA 3VH9A 4O23A 3TC8A 1R3NA 1JQGA 1R43A 3I74A 2OR4A 1AMPA 7CPAA 2PIYA 3I1UA 3KR4A 2CTCA 2NYQA 4OKOA 1PYTB 4WWVA 4C8FA 1ZG7A 3NFZA 4OC5A 3SJXA 1TXRA 1HDQA 2AFMA 4C9RA 3KHZA 3S9NA 5CBMA 3ISXA 2CTBA 3KASA 2VL1A 4OC4A 2PJ1A 3PBBA 4H2KA 2RFHA 3NA6A 3IFEA 2FVGA 3VATA 1XJOA 1IGBA 2AFUA 2ZEGA 2C6PA 3B3TA 2XEGA 3ICUA 3H8EA 4P44A 1CP6A 5JGFA 4A94A 4CDKA 4FAIA 1CPXA 1ZLHA 3PFEA 4F8ZA 4P4JA 1Q7LA 1RTQA 3D66A 3SJGA 4FWUA 4KSIA 2PJ5A 1LAPA 3FJUA 5HVGA 1F2OA 3B3SA 4F9UA 4MHNA 2XEFA 1CX8A 2POKA 4NJRA 2XEIA 3PB9X 2ZEHA 1PCAA 1HDUA
chains in the Genus database with same CATH superfamily
1QSRA 4HPSA 2I00A 3CPXA 1Z9EA 1LAMA 3FYNA 2FCKA 5HKWA 2Z3NA 1IIDA 2JBJA 4Z65A 1IOFA 1Y7EA 1Y9KA 5JPHA 2IJZA 2BEIA 1LRZA 1BLLE 4E5SA 4NFRA 4WJBA 3ISZA 4YFJA 1M1DA 2B5GB 1U6MA 2QMLA 1QSNA 3OAKA 4FD7A 1TKFA 2ODFA 1Z8TA 2PJ6A 5EMIA 4ZY2A 1XF1A 3GJZA 4AG7A 3GLJA 3SJEA 2F8HA 4XNHC 3K9UA 2CBLA 1LFWA 1WJTA 3BUNB 4NGSA 1Z2LA 4R3LA 4CYPA 4M8DA 1Z8LA 2NSMA 1X12A 3PT1A 2GLJA 4PK2A 4EFDA 3I6SA 4P4BA 1M4GA 5IX3A 2VQYA 2D4OA 2GE3A 2VBQA 4YWYA 1BPNA 2Z3OA 4C8CA 3EO4A 2PQ8A 3FVLA 4UEEA 4A38A 4B6ZA 1OBRA 4MHPA 2D0PA 2ABZA 4UIBA 3PBEA 5G21A 4KSFA 4JVOA 1Z5RA 3R96A 3IEHA 3TOAA 4MCRA 3TO6A 4ZX8A 1DE4C 4AG9A 2HB6A 3SR3A 3TFYA 4I49A 4DNCA 2C27A 4KOXA 3NE7A 3CXSA 3ZZIA 4CYQA 4C9AA 5HH1A 2R82A 3KZWA 4KOUA 2PRQA 3KL9A 2Q4ZA 4QVTA 4R7MA 5LRKA 2AUNA 2HV2A 4A30A 3SHPA 2XPPA 2Y0MA 2VZZA 4C2XA 4MHYA 4CGMA 2J8MA 3TOBA 2EVNA 4OADA 4B5PB 1ELMP 3WR7A 4TJXA 1A9XB 4YRHA 3OP0A 4R76A 2P0WA 2EZBA 1M44A 1VGYA 3PLFB 2FXFA 1TKJA 2CNMA 3JUWA 3N5FA 4HNYB 4QC6A 3WC5A 1UFHA 1EO0A 4RUHA 1YLEA 4H89A 2JDCA 4J0NA 3MRUA 3TO7A 3GKRA 5JVLA 4X2TA 1JDEA 3BHXA 5JM6A 4P10A 3QB8A 2IQ6A 4J3GA 3T9YA 5HXDA 1FNOA 1S3ZA 1EZAA 4XPDC 1VI4A 1TF9A 4TWEA 4QBJA 2EUIA 3D7FA 2AE6A 3KR5A 2IMOA 4ZGYB 1IICA 3H4QA 3T90A 2YNCA 2V8GA 2ZEOA 2D4PA 3GUXA 3LWUA 3FF3A 1KEEB 4U9YA 3WABA 1Z8XA 2ZEDA 3MGDA 4P4EA 1ZG9A 2B3UA 3KQZA 4LQGA 3EXNA 4L89A 3VRPA 3TE4A 1M4DA 3HMJG 4C9EA 2R7HA 4CAXA 2FS5A 2B4DB 3B3VA 1YVOA 1TF8A 4GPLB 1LOKA 1ZG8A 2V8VA 4Q38A 2PJ0A 4R8FA 1BO4A 3TLCA 4CDJA 2O53A 4AXVA 1DTDA 3PP9A 5I0CA 2ZXVA 4AB7A 2ZENA 2GU2A 2Q4YA 3TTHA 2P6GA 4PK3A 2JBKA 5I4MA 3VRQA 2QECA 5F13A 5IV0A 2DLAA 3S6HA 3W6SA 4CGOA 1BAVA 4ZI6A 1Z4RA 2BCOA 1Q2DA 5HVFA 4CS0B 4COBA 2G0BA 2QIRA 4KZTA 4HNWB 4BTFA 1Q2CA 5F09A 2F5IA 2HWGA 2PSWA 2PJ7A 3TT2A 3VRRA 2R1IA 4XPLA 2AUMA 4KLVA 5AG5A 5THWA 2G9DA 3RAMA 3SXNA 3PGPA 1CE8B 3HLPA 1XFOA 2Q4VA 4BBHA 3RYOA 1NSAA 4C2ZA 4H6UA 4OC3A 4UF4A 2OU2A 4MJ8A 3TLEA 2J8RA 4R3KA 1YMEA 2DF5A 4CGPA 3WC7A 2RB7A 3JTKA 4KVME 1YW4A 5LYDA 2OLSA 5F9MA 1QSOA 3B3WA 4B12A 2VZYA 3IJ3A 1VBHA 2Y1NA 2UV8G 4M6IA 1S5KA 3HPHE 4ZX9A 4CAEA 1AYEA 3B3CA 5IB9A 3BUMB 5HKZA 3S9MA 2BSWA 4JZ0A 1VHEA 4NCZA 4CGLA 4PXDA 5J8CA 1GGOA 1EE3P 3E0KA 3EIFA 5H86A 1NMTA 4MCQA 2PJCA 4NGNA 3CDXA 1KUYA 3F8KA 4ONWA 3HUVA 4A95A 1YW6A 4DUKA 4E94A 1XMTA 3OWCA 4F9VA 2C5QA 2F7VA 3FEEA 2ARHA 1ARMA 1LANA 3SI1A 2ATRA 3VWEA 4KOTA 2EK9A 5K8PA 1R61A 2QYVA 4UCNA 4UIAA 3R9GA 2YJTA 3NOJA 1S7LA 3DNSA 4TJVA 2PVVA 3S9LA 1TKHA 2K5TA 5HVHA 2X7BA 3PZJA 1J3LA 4P4FA 2QJ8A 2R8VA 4KOYA 1BXRB 4C7HA 4MJXA 3FIXA 4IF5A 1XMBA 4HKFA 3B8GA 1RO5A 4UFWA 2ZOFA 4QB9A 4XPKA 4ZYQA 5BWAB 5K8NA 4MBUA 2Z0ZA 4X3RA 1IB1E 1L0CA 2YNEA 3NH4A 1XE4A 4NGPA 1CM0A 2BUEA 2GLFA 3LACA 4OP4A 5IR2A 4PSXA 3D7HA 2JEWA 2HUZA 5DS0A 2CF4A 4BPUB 4PXEA 4NSQA 2OZUA 2ZEEA 3B7IA 3LMSA 2B5GA 4BPXB 2AFXA 2Z3PA 4E0AA 3KGQA 5BY0A 3GY9A 5E96A 3CPAA 4INJA 4MFKA 5F48A 5ISVA 2Q44A 2EZAA 4UFVA 5K8OA 1IYLA 1VHSA 2KCWA 2PJ9A 2PR1A 4A39A 3EZBA 2PCUA 2PJ3A 2VKZG 2XPLA 3FRMA 1AUGA 3IU1A 4Q7AA 2XPOA 2PJBA 2V8DA 3NH8A 1R57A 5GCNA 3GIUA 4MCPA 2X0SA 2JLMA 5A27A 4ZBGA 3EC4A 4F6AA 4ZY0A 2YNDA 1YX0A 5ELYA 1CP7A 2IL4A 4C86A 2EO8A 2BOAA 4JYWA 1XBUA 3U88C 5K8MA 3RNZA 3V7ZA 1ZO0A 1V6CA 3BLNA 5HKYA 2PJAA 4XNHB 3BI1A 4NJQA 5F5XA 4KNGE 1XIXA 3FNCA 3QAHA 2QVPA 3D7GA 4OC2A 4OMEA 2OOTA 1UWYA 2B4BA 3D8PA 3FBUA 4GM5A 2CNSA 4OIWA 4G1PA 1WK4A 5AG6A 2ZEFA 5G1ZA 4A37A 4K3NA 1JWQA 4K30A 5K99A 4P45A 2BL1A 3K2KA 4R9MA 3V8IA 3EY5A 2P6EA 4KSAA 3I3GA 4B5PA 1FBVA 5J1QA 1S60A 4JJXA 4TNUA 3VWDA 3KHXA 4PXBA 5CNPA 1NSLA 4MFLA 3TLYA 1M4IA 2REFA 4KUAA 1ZRSA 5LRJA 1KC7A 4YU9A 3FH4A 4MFJA 3FMCA 1Y9WA 3JRUA 4M6GA 3VTAA 5J8FA 2VEZA 1S7KA 4A4CA 1FT7A 2P6FA 4KS9A 3I9SA 3IO1A 1YVHA 1IY7A 3NE8A 3VGOA 5LYLA 3IIBA 3PB4X 4MCSA 1QMUA 1OZPA 2FSRA 2HC9A 2OH1A 2YNCC 1I12A 3MN8A 4KVOE 1V0CA 2PE3A 4MI1A 4MXUA 3DLJA 2ZW7A 1QQ9A 4YGOA 3D68A 1YGHA 2I3CA 1ON0A 2B3VA 4NGRA 2OZHA 2ZEPA 1X10A 3TYXA 1F57A 2EWBA 4EMEA 4MHZA 4IHMA 4X5KA 1ELLP 4JWPA 4P4DA 1YK3A 3PEIA 4IK2A 4C9VA 1MJAA 1PU9A 3FECA 5F47A 1CJWA 4CYNA 4UCMA 4CAWA 4AVAA 3WT4A 1KWMA 2GP4A 5J3XA 4NEXA 1YVKA 3KQXA 1P0HA 2B4DA 2PC1A 3FX6A 2CY2A 4UBRA 4XPDB 3O8ZA 2WPXA 4OAEA 2C6GA 4CAVA 4C68A 2AFZA 3F5BA 4PPZA 4NGTA 1KZFA 5EBVA 5LRGA 3KKWA 1QSMA 1PUAA 3H8GA 2DEAA 2V8HA 4AVBA 1WVMA 3B35A 2PVWA 1B47A 5AXIA 1LCPA 1VHOA 2AFWA 4PV6A 5CPAA 6CPAA 3DSBA 4LQ6A 3TO9A 4FD4A 4A2ZA 3TX8A 1BPMA 2R98A 1ZYMA 3H5ZA 1K4JA 1Y7RA 3CT9A 4MRIA 4PXCA 4NGQA 1M4LA 4QUSA 4B10A 2DPSA 4C8UA 1IU8A 2DPTA 3TLGB 2Q43A 3SXOA 1T36B 4C85A 4B13A 1VIXA 2ZW6A 3ZJ0A 2AFSA 4CYOA 4CO9A 3PFVA 1NBWA 5AG7A 4DYOA 1J4JA 3WC6A 3H8FA 2MP0A 2FIAA 4MFPA 2DIKA 4R57A 4E8OA 3OB2B 3QAYA 3PB7X 4BINA 2Z11A 3OB1B 4NGMA 3EZEA 4P4IA 1S7NA 5KTCA 2G3AA 4W9YA 4C9UA 2PJ4A 4A33A 1XRYA 5LYFA 3R9FA 1S7FA 1CPSA 4KVXA 3A9LA 4RS2A 2EBJA 1JDBC 4ORFA 4B11A 3EFAA 1M6VB 1HEEA 4C84A 5D29A 3S6KA 2ZOGA 3D2PA 3DDDA 1ARLA 1CBXA 1YLOA 3IC1A 1I21A 2CIJA 3PB8X 3ZNIA 4X8IA 4Y49C 2GFQA 2VXKA 3PFOA 3T8WA 2O4HA 4RR2B 3TCVA 1KBLA 2C6CA 3BUXB 4EYSA 2OB0A 2PJ2A 2ANPA 2ZW5A 4OC0A 2ZELA 3RO0A 3PB6X 2WPWA 4UEFA 1Q5XA 2A4NA 3R9EA 3LODA 3VROA 3RBUA 1MK4A 3NH5A 3QNVA 4OIDA 3SI0A 4EVYA 1Y9ZA 2AFOA 3F0AA 1RXTA 2D0OA 2Q0YA 8CPAA 2Y1MA 4II9A 3U1BA 3D7DA 1GHEA 4ONUA 2E28A 3GB0A 1YREA 4KOWA 3BJ8A 3DR6A 5LYIA 4JXQA 3LD2A 5JH9A 4EWTA 4HNXB 2PIZA 4R6TA 4C7IA 3CZXA 2GIVA 4FUUA 2Z3KA 2FM4A 2Q04A 4CZ1A 3T07A 2FT0A 3D4UA 2ZW4A 2Q51A 4C99A 2J9AA 2OZGA 3G8WA 4C8AA 4NXYA 5AGEA 3P2HA 4KOSA 1YR0A 2WZNA 4JD6A 5KTDA 2O28A 5DWMA 2BO9A 1Y0YA 5G22A 3KI9A 4CGNA 2GANA 3C8OA 2DXQA 4P6YA 4UA3A 5DWNA 3L2NA 3V38A 3F9KC 1H8LA 3PRTA 2EZCA 2PJ8A 4GS4A 4C8PA 5KTAA 2FIWA 2WYRA 3IWWA 1BOBA 1VKCA 1YSJA 5C82A 3C26A 5A28A 3BUOB 1Y0RA 4MMOA 4DJLA 3B2YA 4YN3A 2EK8A 3T5MA 3BUWB 2Q7BA 4BD9A 3R95A 1XEBA 3SJFA 3CXQA 4UFXA 4FBEA 3DR8A 1XOVA 2V77A 3GYAA 1IYKA 2XPNA 2XEJA 3BXMA 4KLWA 4MFZA 3TLAA 4RN7A 3FEDA 3IWEA 4PQAA 2ZPAA 2RC4A 3EZAA 3TLZA 3BI0A 3W6XA 2I79A 3P2FA 4UEZA 1CG2A 1ZLIA 3VARA 1B87A 3RZAA 4B5OA 1WWZA 1C30B 1CS0B 1Z9UA 3DGVA 1GYTA 3UY5A 4A31A 3K9TA 3S6FA 4CRZB 1I1DA 2ZEMA 5D8NA 4U9ZA 3T05A 3G3SA 4KOVA 4CAFA 3SI2A 1F2PA 1NXJA 4C8TA 3JVNA 4IAVA 4R87A 3D67A 4M6HA 4H1HA 4OC1A 1DIKA 2GREA 5F49A 2C1CA 3FXTA 4ZY1A 4CPAA 2NMTA 4FD5A 3VH9A 4E2AA 4IIYA 4O23A 3TLBA 5G20A 4MHDA 4L8AA 4BPWB 3TC8A 3W91A 3K4IA 1R3NA 5FD8A 1JQGA 5HMNA 1R43A 4MI4A 3I74A 4GXHA 2OR4A 4NF1A 4C2YA 4F0XA 5H84A 3S6GA 4MY3A 1N71A 2HQYA 2HI6A 2Z10A 1AMPA 7CPAA 4FD6A 2PIYA 1ZL0A 3I1UA 1KUXA 1B6BA 4AVCA 1MJ9A 1NE9A 3KR4A 2CNTA 1C3OB 2YGWA 2CTCA 2Q7SA 2NYQA 4OKOA 1PYTB 4WWVA 4C8FA 1ZG7A 3NFZA 1TIQA 4OC5A 4A4BA 3SJXA 2H5MA 4MY0A 1TXRA 1HDQA 4RI1A 4PSWA 2AFMA 4C9RA 4KUBA 3KHZA 1YQEA 4LUAA 3S9NA 5CBMA 3ISXA 2PRBA 5JQ4A 4M85A 3TLGA 2PR8A 1MJBA 2HROA 4COGA 3BJ7A 3IGRA 2CTBA 4UWIA 3KASA 4U5YA 1FY7A 2VL1A 4M3SA 1EZBA 1Z4EA 4OC4A 1VBGA 2PJ1A 3PBBA 4H2KA 1SQHA 2AJ6A 2RFHA 5C88A 1KUVA 3NA6A 2JEVA 4A32A 4BMHA 3IFEA 2FVGA 5FVJA 1XF8A 2FE7A 2PDOA 4JLYA 3VATA 1XJOA 1IGBA 2AFUA 3HPGG 2ZEGA 2C6PA 3B3TA 1P4NA 2XEGA 2Z3LA 3R1KA 4F0YA 3NFQA 2WUUA 2B4JC 3ICUA 3D2MA 3H8EA 4OLLA 1IOIA 4P44A 1CP6A 4KORA 4Q36A 5JGFA 4MFQA 2N3AB 5F1YA 5AG4A 3T0TA 2PCNA 4A94A 4CDKA 4FAIA 2B0AA 2YJVA 5JYBA 1CPXA 1Q2YA 4B14A 1ZLHA 3PFEA 2B58A 4F8ZA 4JXRA 3IU2A 3FB3A 4P4JA 1Q7LA 5EC4A 5IB0A 1RTQA 3D66A 3SJGA 4FWUA 4IUSA 4CRYB 3VRNA 4KSIA 4UCPA 2JDDA 5F46A 2CXAA 2PJ5A 2G3TA 1LAPA 3FJUA 3IWGA 1F2OA 3B3SA 4LX9A 5HVGA 3D3SA 1Z8WA 3CXPA 4H6ZA 4IIXA 3N7ZA 4F9UA 2WSAA 2XEFA 4MHNA 3G23A 1CX8A 2J8NA 2POKA 2VI7A 4NJRA 1A2ZA 3KRVA 2XEIA 1QSTA 3PB9X 2ZEHA 4UWJA 4Y49B 2FL4A 2REEA 1PCAA 1HDUA 2Z3MA
chains in the Genus database with same CATH topology
3CPXA 1LAMA 2JBJA 4Z65A 1Y7EA 2IJZA 1BLLE 4NFRA 4WJBA 3ISZA 1TKFA 1XF1A 2PJ6A 4ZY2A 3GLJA 3SJEA 2F8HA 1LFWA 1Z2LA 4NGSA 1Z8LA 2NSMA 2GLJA 3I6SA 4P4BA 4YWYA 1BPNA 4UEEA 3FVLA 4A38A 4B6ZA 1OBRA 4MHPA 2ABZA 4UIBA 3PBEA 1Z5RA 3IEHA 4MCRA 4ZX8A 1DE4C 2HB6A 4C9AA 3KZWA 2PRQA 3KL9A 2Q4ZA 4R7MA 5LRKA 4MHYA 1ELMP 4TJXA 4R76A 1VGYA 1TKJA 3WC5A 3N5FA 4RUHA 3MRUA 4X2TA 3BHXA 5JM6A 4P10A 2IQ6A 5HXDA 1FNOA 1TF9A 4TWEA 3D7FA 3KR5A 2IMOA 2V8GA 2ZEOA 3GUXA 3LWUA 3FF3A 3WABA 2ZEDA 4P4EA 1ZG9A 3KQZA 4LQGA 4C9EA 3B3VA 1TF8A 1LOKA 1ZG8A 2V8VA 4CDJA 2PJ0A 4R8FA 2O53A 4AXVA 1DTDA 2ZENA 2GU2A 2JBKA 5I4MA 5K8OA 4ZI6A 1BAVA 2BCOA 5HVFA 5F09A 2PJ7A 5THWA 3RAMA 2G9DA 3HLPA 1XFOA 1NSAA 4OC3A 4UF4A 1YMEA 3WC7A 2RB7A 5LYDA 1YW4A 3B3WA 3IJ3A 4ZX9A 1AYEA 3B3CA 5IB9A 3S9MA 4JZ0A 1VHEA 4PXDA 1EE3P 3EIFA 4MCQA 2PJCA 4NGNA 3CDXA 4ONWA 3HUVA 4DUKA 1YW6A 4F9VA 2C5QA 2F7VA 3FEEA 1ARMA 1LANA 2EK9A 5K8PA 2QYVA 4UIAA 4TJVA 2PVVA 3S9LA 1TKHA 5HVHA 4P4FA 2QJ8A 1XMBA 5J1QA 2ZOFA 4ZYQA 5K8NA 4X3RA 3NH4A 2GLFA 4NGPA 4OP4A 5IR2A 3D7HA 2JEWA 5DS0A 2CF4A 4PXEA 2ZEEA 3B7IA 3LMSA 2AFXA 3KGQA 3CPAA 2PJ9A 4A39A 2PCUA 2PJ3A 4Q7AA 3SI1A 2V8DA 2PJBA 3NH8A 4MCPA 4ZY0A 5ELYA 1CP7A 4C86A 2BOAA 4JYWA 1XBUA 5K8MA 3V7ZA 1V6CA 2PJAA 3BI1A 4NJQA 4KNGE 4EFDA 2QVPA 3D7GA 4OC2A 4OMEA 2OOTA 1UWYA 4GM5A 4OIWA 5JH9A 4G1PA 2ZEFA 4A37A 4K3NA 4P45A 3K2KA 4TNUA 3KHXA 4PXBA 5LRJA 4YU9A 3FH4A 3FMCA 3JRUA 3VTAA 1FT7A 3IO1A 1IY7A 5LYLA 3IIBA 3PB4X 4MCSA 1QMUA 2HC9A 3MN8A 2PE3A 4MXUA 3DLJA 1QQ9A 3D68A 2I3CA 2ZEPA 4NGRA 1F57A 2EWBA 4EMEA 4MHZA 4IHMA 1ELLP 4P4DA 3PEIA 4IK2A 4C9VA 3FECA 3WT4A 1KWMA 3KQXA 3FX6A 2C6GA 2AFZA 4PPZA 4NGTA 5LRGA 3H8GA 2DEAA 2V8HA 1WVMA 3B35A 2PVWA 1VHOA 2AFWA 1LCPA 5CPAA 6CPAA 3TX8A 1BPMA 4PXCA 3CT9A 4MRIA 4NGQA 1M4LA 4C8UA 2Q43A 4C85A 1VIXA 2AFSA 4DYOA 3WC6A 3H8FA 3PB7X 4NGMA 4P4IA 4W9YA 4C9UA 2PJ4A 1XRYA 5LYFA 1CPSA 1HEEA 4C84A 5D29A 2ZOGA 4C8CA 1ARLA 1CBXA 1YLOA 3IC1A 3PB8X 2CIJA 4X8IA 3T8WA 3PFOA 2O4HA 2C6CA 2PJ2A 2ANPA 4OC0A 2ZELA 3PB6X 4UEFA 4OIDA 3NH5A 3RBUA 3SI0A 3QNVA 1Y9ZA 2AFOA 8CPAA 3D7DA 3GB0A 5LYIA 4EWTA 2PIZA 4R6TA 4FUUA 3D4UA 2Q51A 4C99A 2J9AA 4C8AA 2WZNA 2BO9A 1Y0YA 3KI9A 4P6YA 3V38A 3L2NA 3PRTA 1H8LA 4C8PA 2PJ8A 2WYRA 3IWWA 1YSJA 1Y0RA 4MMOA 4DJLA 3B2YA 4YN3A 2EK8A 4BD9A 3SJFA 4FBEA 2V77A 2XEJA 3BXMA 3FEDA 4PQAA 3BI0A 4UEZA 1CG2A 1ZLIA 3VARA 3RZAA 2GP4A 3DGVA 1GYTA 3K9TA 2ZEMA 5D8NA 3SI2A 1F2PA 4C8TA 4IAVA 3D67A 4OC1A 2GREA 2C1CA 4ZY1A 4CPAA 3VH9A 4O23A 3TC8A 1R3NA 1JQGA 1R43A 3I74A 2OR4A 1AMPA 7CPAA 2PIYA 3I1UA 3KR4A 2CTCA 2NYQA 4OKOA 1PYTB 4WWVA 4C8FA 1ZG7A 3NFZA 4OC5A 3SJXA 1TXRA 1HDQA 2AFMA 4C9RA 3KHZA 3S9NA 5CBMA 3ISXA 2CTBA 3KASA 2VL1A 4OC4A 2PJ1A 3PBBA 4H2KA 2RFHA 3NA6A 3IFEA 2FVGA 3VATA 1XJOA 1IGBA 2AFUA 2ZEGA 2C6PA 3B3TA 2XEGA 3ICUA 3H8EA 4P44A 1CP6A 5JGFA 4A94A 4CDKA 4FAIA 1CPXA 1ZLHA 3PFEA 4F8ZA 4P4JA 1Q7LA 1RTQA 3D66A 3SJGA 4FWUA 4KSIA 2PJ5A 1LAPA 3FJUA 5HVGA 1F2OA 3B3SA 4F9UA 4MHNA 2XEFA 1CX8A 2POKA 4NJRA 2XEIA 3PB9X 2ZEHA 1PCAA 1HDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPX A;  1LAM A;  2JBJ A;  4Z65 A;  1Y7E A;  2IJZ A;  1BLL E;  4NFR A;  4WJB A;  3ISZ A;  1TKF A;  1XF1 A;  2PJ6 A;  4ZY2 A;  3GLJ A;  3SJE A;  2F8H A;  1LFW A;  1Z2L A;  4NGS A;  1Z8L A;  2NSM A;  2GLJ A;  3I6S A;  4P4B A;  4YWY A;  1BPN A;  4UEE A;  3FVL A;  4A38 A;  4B6Z A;  1OBR A;  4MHP A;  2ABZ A;  4UIB A;  3PBE A;  1Z5R A;  3IEH A;  4MCR A;  4ZX8 A;  1DE4 C;  2HB6 A;  4C9A A;  3KZW A;  2PRQ A;  3KL9 A;  2Q4Z A;  4R7M A;  5LRK A;  4MHY A;  1ELM P;  4TJX A;  4R76 A;  1VGY A;  1TKJ A;  3WC5 A;  3N5F A;  4RUH A;  3MRU A;  4X2T A;  3BHX A;  5JM6 A;  4P10 A;  2IQ6 A;  5HXD A;  1FNO A;  1TF9 A;  4TWE A;  3D7F A;  3KR5 A;  2IMO A;  2V8G A;  2ZEO A;  3GUX A;  3LWU A;  3FF3 A;  3WAB A;  2ZED A;  4P4E A;  1ZG9 A;  3KQZ A;  4LQG A;  4C9E A;  3B3V A;  1TF8 A;  1LOK A;  1ZG8 A;  2V8V A;  4CDJ A;  2PJ0 A;  4R8F A;  2O53 A;  4AXV A;  1DTD A;  2ZEN A;  2GU2 A;  2JBK A;  5I4M A;  5K8O A;  4ZI6 A;  1BAV A;  2BCO A;  5HVF A;  5F09 A;  2PJ7 A;  5THW A;  3RAM A;  2G9D A;  3HLP A;  1XFO A;  1NSA A;  4OC3 A;  4UF4 A;  1YME A;  3WC7 A;  2RB7 A;  5LYD A;  1YW4 A;  3B3W A;  3IJ3 A;  4ZX9 A;  1AYE A;  3B3C A;  5IB9 A;  3S9M A;  4JZ0 A;  1VHE A;  4PXD A;  1EE3 P;  3EIF A;  4MCQ A;  2PJC A;  4NGN A;  3CDX A;  4ONW A;  3HUV A;  4DUK A;  1YW6 A;  4F9V A;  2F7V A;  3FEE A;  1ARM A;  1LAN A;  2EK9 A;  5K8P A;  2QYV A;  4UIA A;  4TJV A;  2PVV A;  3S9L A;  1TKH A;  5HVH A;  4P4F A;  2QJ8 A;  1XMB A;  5J1Q A;  2ZOF A;  4ZYQ A;  5K8N A;  4X3R A;  3NH4 A;  2GLF A;  4NGP A;  4OP4 A;  3D7H A;  2JEW A;  5DS0 A;  2CF4 A;  4PXE A;  2ZEE A;  3B7I A;  3LMS A;  2AFX A;  3KGQ A;  3CPA A;  2PJ9 A;  4A39 A;  2PCU A;  2PJ3 A;  4Q7A A;  3SI1 A;  2V8D A;  2PJB A;  3NH8 A;  4MCP A;  4ZY0 A;  5ELY A;  1CP7 A;  4C86 A;  2BOA A;  4JYW A;  1XBU A;  5K8M A;  3V7Z A;  1V6C A;  2PJA A;  3BI1 A;  4NJQ A;  4KNG E;  4EFD A;  2QVP A;  3D7G A;  4OC2 A;  4OME A;  2OOT A;  1UWY A;  4GM5 A;  4OIW A;  5JH9 A;  4G1P A;  2ZEF A;  4A37 A;  4K3N A;  4P45 A;  3K2K A;  4TNU A;  3KHX A;  4PXB A;  5LRJ A;  4YU9 A;  3FH4 A;  3FMC A;  3JRU A;  3VTA A;  1FT7 A;  3IO1 A;  1IY7 A;  5LYL A;  3IIB A;  3PB4 X;  4MCS A;  1QMU A;  2HC9 A;  3MN8 A;  2PE3 A;  4MXU A;  3DLJ A;  1QQ9 A;  3D68 A;  2I3C A;  2ZEP A;  4NGR A;  1F57 A;  2EWB A;  4EME A;  4MHZ A;  4IHM A;  1ELL P;  4P4D A;  3PEI A;  4IK2 A;  4C9V A;  3FEC A;  3WT4 A;  1KWM A;  3KQX A;  3FX6 A;  2C6G A;  2AFZ A;  4PPZ A;  4NGT A;  5LRG A;  3H8G A;  2DEA A;  2V8H A;  1WVM A;  3B35 A;  2PVW A;  1VHO A;  2AFW A;  1LCP A;  5CPA A;  6CPA A;  3TX8 A;  1BPM A;  4PXC A;  3CT9 A;  4MRI A;  4NGQ A;  1M4L A;  4C8U A;  2Q43 A;  4C85 A;  1VIX A;  2AFS A;  4DYO A;  3WC6 A;  3H8F A;  3PB7 X;  4NGM A;  4P4I A;  4W9Y A;  4C9U A;  2PJ4 A;  1XRY A;  5LYF A;  1CPS A;  1HEE A;  4C84 A;  5D29 A;  2ZOG A;  4C8C A;  1ARL A;  1CBX A;  1YLO A;  3IC1 A;  3PB8 X;  2CIJ A;  4X8I A;  3T8W A;  3PFO A;  2O4H A;  2C6C A;  2PJ2 A;  2ANP A;  4OC0 A;  2ZEL A;  3PB6 X;  4UEF A;  4OID A;  3NH5 A;  3RBU A;  3SI0 A;  3QNV A;  1Y9Z A;  2AFO A;  8CPA A;  3D7D A;  3GB0 A;  5LYI A;  4EWT A;  2PIZ A;  4R6T A;  4FUU A;  3D4U A;  2Q51 A;  4C99 A;  2J9A A;  4C8A A;  2WZN A;  2BO9 A;  1Y0Y A;  3KI9 A;  4P6Y A;  3V38 A;  3L2N A;  3PRT A;  1H8L A;  4C8P A;  2PJ8 A;  2WYR A;  3IWW A;  1YSJ A;  1Y0R A;  4MMO A;  4DJL A;  3B2Y A;  4YN3 A;  2EK8 A;  4BD9 A;  3SJF A;  4FBE A;  2V77 A;  2XEJ A;  3BXM A;  3FED A;  4PQA A;  3BI0 A;  4UEZ A;  1CG2 A;  1ZLI A;  3VAR A;  3RZA A;  3DGV A;  1GYT A;  3K9T A;  2ZEM A;  5D8N A;  3SI2 A;  1F2P A;  4C8T A;  4IAV A;  3D67 A;  4OC1 A;  2GRE A;  2C1C A;  4ZY1 A;  4CPA A;  3VH9 A;  4O23 A;  3TC8 A;  1R3N A;  1JQG A;  1R43 A;  3I74 A;  2OR4 A;  1AMP A;  7CPA A;  2PIY A;  3I1U A;  3KR4 A;  2CTC A;  2NYQ A;  4OKO A;  1PYT B;  4WWV A;  4C8F A;  1ZG7 A;  3NFZ A;  4OC5 A;  3SJX A;  1TXR A;  1HDQ A;  2AFM A;  4C9R A;  3KHZ A;  3S9N A;  5CBM A;  3ISX A;  2CTB A;  3KAS A;  2VL1 A;  4OC4 A;  2PJ1 A;  3PBB A;  4H2K A;  2RFH A;  3NA6 A;  3IFE A;  2FVG A;  3VAT A;  1XJO A;  1IGB A;  2AFU A;  2ZEG A;  2C6P A;  3B3T A;  2XEG A;  3ICU A;  3H8E A;  4P44 A;  1CP6 A;  5JGF A;  4A94 A;  4CDK A;  4FAI A;  1CPX A;  1ZLH A;  3PFE A;  4F8Z A;  4P4J A;  1Q7L A;  1RTQ A;  3D66 A;  3SJG A;  4FWU A;  4KSI A;  2PJ5 A;  1LAP A;  3FJU A;  5HVG A;  1F2O A;  3B3S A;  4F9U A;  4MHN A;  2XEF A;  1CX8 A;  2POK A;  4NJR A;  2XEI A;  3PB9 X;  2ZEH A;  1PCA A;  1HDU A; 
#chains in the Genus database with same CATH topology
 1QSR A;  4HPS A;  2I00 A;  3CPX A;  1Z9E A;  1LAM A;  3FYN A;  2FCK A;  5HKW A;  2Z3N A;  1IID A;  2JBJ A;  4Z65 A;  1IOF A;  1Y7E A;  1Y9K A;  5JPH A;  2IJZ A;  2BEI A;  1LRZ A;  1BLL E;  4E5S A;  4NFR A;  4WJB A;  3ISZ A;  4YFJ A;  1M1D A;  2B5G B;  1U6M A;  2QML A;  1QSN A;  3OAK A;  4FD7 A;  1TKF A;  2ODF A;  1Z8T A;  2PJ6 A;  5EMI A;  4ZY2 A;  1XF1 A;  3GJZ A;  4AG7 A;  3GLJ A;  3SJE A;  2F8H A;  4XNH C;  3K9U A;  2CBL A;  1LFW A;  1WJT A;  3BUN B;  4NGS A;  1Z2L A;  4R3L A;  4CYP A;  4M8D A;  1Z8L A;  2NSM A;  1X12 A;  3PT1 A;  2GLJ A;  4PK2 A;  4EFD A;  3I6S A;  4P4B A;  1M4G A;  5IX3 A;  2VQY A;  2D4O A;  2GE3 A;  2VBQ A;  4YWY A;  1BPN A;  2Z3O A;  4C8C A;  3EO4 A;  2PQ8 A;  3FVL A;  4UEE A;  4A38 A;  4B6Z A;  1OBR A;  4MHP A;  2D0P A;  2ABZ A;  4UIB A;  3PBE A;  5G21 A;  4KSF A;  4JVO A;  1Z5R A;  3R96 A;  3IEH A;  3TOA A;  4MCR A;  3TO6 A;  4ZX8 A;  1DE4 C;  4AG9 A;  2HB6 A;  3SR3 A;  3TFY A;  4I49 A;  4DNC A;  2C27 A;  4KOX A;  3NE7 A;  3CXS A;  3ZZI A;  4CYQ A;  4C9A A;  5HH1 A;  2R82 A;  3KZW A;  4KOU A;  2PRQ A;  3KL9 A;  2Q4Z A;  4QVT A;  4R7M A;  5LRK A;  2AUN A;  2HV2 A;  4A30 A;  3SHP A;  2XPP A;  2Y0M A;  2VZZ A;  4C2X A;  4MHY A;  4CGM A;  2J8M A;  3TOB A;  2EVN A;  4OAD A;  4B5P B;  1ELM P;  3WR7 A;  4TJX A;  1A9X B;  4YRH A;  3OP0 A;  4R76 A;  2P0W A;  2EZB A;  1M44 A;  1VGY A;  3PLF B;  2FXF A;  1TKJ A;  2CNM A;  3JUW A;  3N5F A;  4HNY B;  4QC6 A;  3WC5 A;  1UFH A;  1EO0 A;  4RUH A;  1YLE A;  4H89 A;  2JDC A;  4J0N A;  3MRU A;  3TO7 A;  3GKR A;  5JVL A;  4X2T A;  1JDE A;  3BHX A;  5JM6 A;  4P10 A;  3QB8 A;  2IQ6 A;  4J3G A;  3T9Y A;  5HXD A;  1FNO A;  1S3Z A;  1EZA A;  4XPD C;  1VI4 A;  1TF9 A;  4TWE A;  4QBJ A;  2EUI A;  3D7F A;  2AE6 A;  3KR5 A;  2IMO A;  4ZGY B;  1IIC A;  3H4Q A;  3T90 A;  2YNC A;  2V8G A;  2ZEO A;  2D4P A;  3GUX A;  3LWU A;  3FF3 A;  1KEE B;  4U9Y A;  3WAB A;  1Z8X A;  2ZED A;  3MGD A;  4P4E A;  1ZG9 A;  2B3U A;  3KQZ A;  4LQG A;  3EXN A;  4L89 A;  3VRP A;  3TE4 A;  1M4D A;  3HMJ G;  4C9E A;  2R7H A;  4CAX A;  2FS5 A;  2B4D B;  3B3V A;  1YVO A;  1TF8 A;  4GPL B;  1LOK A;  1ZG8 A;  2V8V A;  4Q38 A;  2PJ0 A;  4R8F A;  1BO4 A;  3TLC A;  4CDJ A;  2O53 A;  4AXV A;  1DTD A;  3PP9 A;  5I0C A;  2ZXV A;  4AB7 A;  2ZEN A;  2GU2 A;  2Q4Y A;  3TTH A;  2P6G A;  4PK3 A;  2JBK A;  5I4M A;  3VRQ A;  2QEC A;  5F13 A;  5IV0 A;  2DLA A;  3S6H A;  3W6S A;  4CGO A;  1BAV A;  4ZI6 A;  1Z4R A;  2BCO A;  1Q2D A;  5HVF A;  4CS0 B;  4COB A;  2G0B A;  2QIR A;  4KZT A;  4HNW B;  4BTF A;  1Q2C A;  5F09 A;  2F5I A;  2HWG A;  2PSW A;  2PJ7 A;  3TT2 A;  3VRR A;  2R1I A;  4XPL A;  2AUM A;  4KLV A;  5AG5 A;  5THW A;  2G9D A;  3RAM A;  3SXN A;  3PGP A;  1CE8 B;  3HLP A;  1XFO A;  2Q4V A;  4BBH A;  3RYO A;  1NSA A;  4C2Z A;  4H6U A;  4OC3 A;  4UF4 A;  2OU2 A;  4MJ8 A;  3TLE A;  2J8R A;  4R3K A;  1YME A;  2DF5 A;  4CGP A;  3WC7 A;  2RB7 A;  3JTK A;  4KVM E;  1YW4 A;  5LYD A;  2OLS A;  5F9M A;  1QSO A;  3B3W A;  4B12 A;  2VZY A;  3IJ3 A;  1VBH A;  2Y1N A;  2UV8 G;  4M6I A;  1S5K A;  3HPH E;  4ZX9 A;  4CAE A;  1AYE A;  3B3C A;  5IB9 A;  3BUM B;  5HKZ A;  3S9M A;  2BSW A;  4JZ0 A;  1VHE A;  4NCZ A;  4CGL A;  4PXD A;  5J8C A;  1GGO A;  1EE3 P;  3E0K A;  3EIF A;  5H86 A;  1NMT A;  4MCQ A;  2PJC A;  4NGN A;  3CDX A;  1KUY A;  3F8K A;  4ONW A;  3HUV A;  4A95 A;  1YW6 A;  4DUK A;  4E94 A;  1XMT A;  3OWC A;  4F9V A;  2C5Q A;  2F7V A;  3FEE A;  2ARH A;  1ARM A;  1LAN A;  3SI1 A;  2ATR A;  3VWE A;  4KOT A;  2EK9 A;  5K8P A;  1R61 A;  2QYV A;  4UCN A;  4UIA A;  3R9G A;  2YJT A;  3NOJ A;  1S7L A;  3DNS A;  4TJV A;  2PVV A;  3S9L A;  1TKH A;  2K5T A;  5HVH A;  2X7B A;  3PZJ A;  1J3L A;  4P4F A;  2QJ8 A;  2R8V A;  4KOY A;  1BXR B;  4C7H A;  4MJX A;  3FIX A;  4IF5 A;  1XMB A;  4HKF A;  3B8G A;  1RO5 A;  4UFW A;  2ZOF A;  4QB9 A;  4XPK A;  4ZYQ A;  5BWA B;  5K8N A;  4MBU A;  2Z0Z A;  4X3R A;  1IB1 E;  1L0C A;  2YNE A;  3NH4 A;  1XE4 A;  4NGP A;  1CM0 A;  2BUE A;  2GLF A;  3LAC A;  4OP4 A;  5IR2 A;  4PSX A;  3D7H A;  2JEW A;  2HUZ A;  5DS0 A;  2CF4 A;  4BPU B;  4PXE A;  4NSQ A;  2OZU A;  2ZEE A;  3B7I A;  3LMS A;  2B5G A;  4BPX B;  2AFX A;  2Z3P A;  4E0A A;  3KGQ A;  5BY0 A;  3GY9 A;  5E96 A;  3CPA A;  4INJ A;  4MFK A;  5F48 A;  5ISV A;  2Q44 A;  2EZA A;  4UFV A;  5K8O A;  1IYL A;  1VHS A;  2KCW A;  2PJ9 A;  2PR1 A;  4A39 A;  3EZB A;  2PCU A;  2PJ3 A;  2VKZ G;  2XPL A;  3FRM A;  1AUG A;  3IU1 A;  4Q7A A;  2XPO A;  2PJB A;  2V8D A;  3NH8 A;  1R57 A;  5GCN A;  3GIU A;  4MCP A;  2X0S A;  2JLM A;  5A27 A;  4ZBG A;  3EC4 A;  4F6A A;  4ZY0 A;  2YND A;  1YX0 A;  5ELY A;  1CP7 A;  2IL4 A;  4C86 A;  2EO8 A;  2BOA A;  4JYW A;  1XBU A;  3U88 C;  5K8M A;  3RNZ A;  3V7Z A;  1ZO0 A;  1V6C A;  3BLN A;  5HKY A;  2PJA A;  4XNH B;  3BI1 A;  4NJQ A;  5F5X A;  4KNG E;  1XIX A;  3FNC A;  3QAH A;  2QVP A;  3D7G A;  4OC2 A;  4OME A;  2OOT A;  1UWY A;  2B4B A;  3D8P A;  3FBU A;  4GM5 A;  2CNS A;  4OIW A;  4G1P A;  1WK4 A;  5AG6 A;  2ZEF A;  5G1Z A;  4A37 A;  4K3N A;  1JWQ A;  4K30 A;  5K99 A;  4P45 A;  2BL1 A;  3K2K A;  4R9M A;  3V8I A;  3EY5 A;  2P6E A;  4KSA A;  3I3G A;  4B5P A;  1FBV A;  5J1Q A;  1S60 A;  4JJX A;  4TNU A;  3VWD A;  3KHX A;  4PXB A;  5CNP A;  1NSL A;  4MFL A;  3TLY A;  1M4I A;  2REF A;  4KUA A;  1ZRS A;  5LRJ A;  1KC7 A;  4YU9 A;  3FH4 A;  4MFJ A;  3FMC A;  1Y9W A;  3JRU A;  4M6G A;  3VTA A;  5J8F A;  2VEZ A;  1S7K A;  4A4C A;  1FT7 A;  2P6F A;  4KS9 A;  3I9S A;  3IO1 A;  1YVH A;  1IY7 A;  3NE8 A;  3VGO A;  5LYL A;  3IIB A;  3PB4 X;  4MCS A;  1QMU A;  1OZP A;  2FSR A;  2HC9 A;  2OH1 A;  2YNC C;  1I12 A;  3MN8 A;  4KVO E;  1V0C A;  2PE3 A;  4MI1 A;  4MXU A;  3DLJ A;  2ZW7 A;  1QQ9 A;  4YGO A;  3D68 A;  1YGH A;  2I3C A;  1ON0 A;  2B3V A;  4NGR A;  2OZH A;  2ZEP A;  1X10 A;  3TYX A;  1F57 A;  2EWB A;  4EME A;  4MHZ A;  4IHM A;  4X5K A;  1ELL P;  4JWP A;  4P4D A;  1YK3 A;  3PEI A;  4IK2 A;  4C9V A;  1MJA A;  1PU9 A;  3FEC A;  5F47 A;  1CJW A;  4CYN A;  4UCM A;  4CAW A;  4AVA A;  3WT4 A;  1KWM A;  2GP4 A;  5J3X A;  4NEX A;  1YVK A;  3KQX A;  1P0H A;  2B4D A;  2PC1 A;  3FX6 A;  2CY2 A;  4UBR A;  4XPD B;  3O8Z A;  2WPX A;  4OAE A;  2C6G A;  4CAV A;  4C68 A;  2AFZ A;  3F5B A;  4PPZ A;  4NGT A;  1KZF A;  5EBV A;  5LRG A;  3KKW A;  1QSM A;  1PUA A;  3H8G A;  2DEA A;  2V8H A;  4AVB A;  1WVM A;  3B35 A;  2PVW A;  1B47 A;  5AXI A;  1LCP A;  1VHO A;  2AFW A;  4PV6 A;  5CPA A;  6CPA A;  3DSB A;  4LQ6 A;  3TO9 A;  4FD4 A;  4A2Z A;  3TX8 A;  1BPM A;  2R98 A;  1ZYM A;  3H5Z A;  1K4J A;  1Y7R A;  3CT9 A;  4MRI A;  4PXC A;  4NGQ A;  1M4L A;  4QUS A;  4B10 A;  2DPS A;  4C8U A;  1IU8 A;  2DPT A;  3TLG B;  2Q43 A;  3SXO A;  1T36 B;  4C85 A;  4B13 A;  1VIX A;  2ZW6 A;  3ZJ0 A;  2AFS A;  4CYO A;  4CO9 A;  3PFV A;  1NBW A;  5AG7 A;  4DYO A;  1J4J A;  3WC6 A;  3H8F A;  2MP0 A;  2FIA A;  4MFP A;  2DIK A;  4R57 A;  4E8O A;  3OB2 B;  3QAY A;  3PB7 X;  4BIN A;  2Z11 A;  3OB1 B;  4NGM A;  3EZE A;  4P4I A;  1S7N A;  5KTC A;  2G3A A;  4W9Y A;  4C9U A;  2PJ4 A;  4A33 A;  1XRY A;  5LYF A;  3R9F A;  1S7F A;  1CPS A;  4KVX A;  3A9L A;  4RS2 A;  2EBJ A;  1JDB C;  4ORF A;  4B11 A;  3EFA A;  1M6V B;  1HEE A;  4C84 A;  5D29 A;  3S6K A;  2ZOG A;  3D2P A;  3DDD A;  1ARL A;  1CBX A;  1YLO A;  3IC1 A;  1I21 A;  2CIJ A;  3PB8 X;  3ZNI A;  4X8I A;  4Y49 C;  2GFQ A;  2VXK A;  3PFO A;  3T8W A;  2O4H A;  4RR2 B;  3TCV A;  1KBL A;  2C6C A;  3BUX B;  4EYS A;  2OB0 A;  2PJ2 A;  2ANP A;  2ZW5 A;  4OC0 A;  2ZEL A;  3RO0 A;  3PB6 X;  2WPW A;  4UEF A;  1Q5X A;  2A4N A;  3R9E A;  3LOD A;  3VRO A;  3RBU A;  1MK4 A;  3NH5 A;  3QNV A;  4OID A;  3SI0 A;  4EVY A;  1Y9Z A;  2AFO A;  3F0A A;  1RXT A;  2D0O A;  2Q0Y A;  8CPA A;  2Y1M A;  4II9 A;  3U1B A;  3D7D A;  1GHE A;  4ONU A;  2E28 A;  3GB0 A;  1YRE A;  4KOW A;  3BJ8 A;  3DR6 A;  5LYI A;  4JXQ A;  3LD2 A;  5JH9 A;  4EWT A;  4HNX B;  2PIZ A;  4R6T A;  4C7I A;  3CZX A;  2GIV A;  4FUU A;  2Z3K A;  2FM4 A;  2Q04 A;  4CZ1 A;  3T07 A;  2FT0 A;  3D4U A;  2ZW4 A;  2Q51 A;  4C99 A;  2J9A A;  2OZG A;  3G8W A;  4C8A A;  4NXY A;  5AGE A;  3P2H A;  4KOS A;  1YR0 A;  2WZN A;  4JD6 A;  5KTD A;  2O28 A;  5DWM A;  2BO9 A;  1Y0Y A;  5G22 A;  3KI9 A;  4CGN A;  2GAN A;  3C8O A;  2DXQ A;  4P6Y A;  4UA3 A;  5DWN A;  3L2N A;  3V38 A;  3F9K C;  1H8L A;  3PRT A;  2EZC A;  2PJ8 A;  4GS4 A;  4C8P A;  5KTA A;  2FIW A;  2WYR A;  3IWW A;  1BOB A;  1VKC A;  1YSJ A;  5C82 A;  3C26 A;  5A28 A;  3BUO B;  1Y0R A;  4MMO A;  4DJL A;  3B2Y A;  4YN3 A;  2EK8 A;  3T5M A;  3BUW B;  2Q7B A;  4BD9 A;  3R95 A;  1XEB A;  3SJF A;  3CXQ A;  4UFX A;  4FBE A;  3DR8 A;  1XOV A;  2V77 A;  3GYA A;  1IYK A;  2XPN A;  2XEJ A;  3BXM A;  4KLW A;  4MFZ A;  3TLA A;  4RN7 A;  3FED A;  3IWE A;  4PQA A;  2ZPA A;  2RC4 A;  3EZA A;  3TLZ A;  3BI0 A;  3W6X A;  2I79 A;  3P2F A;  4UEZ A;  1CG2 A;  1ZLI A;  3VAR A;  1B87 A;  3RZA A;  4B5O A;  1WWZ A;  1C30 B;  1CS0 B;  1Z9U A;  3DGV A;  1GYT A;  3UY5 A;  4A31 A;  3K9T A;  3S6F A;  4CRZ B;  1I1D A;  2ZEM A;  5D8N A;  4U9Z A;  3T05 A;  3G3S A;  4KOV A;  4CAF A;  3SI2 A;  1F2P A;  1NXJ A;  4C8T A;  3JVN A;  4IAV A;  4R87 A;  3D67 A;  4M6H A;  4H1H A;  4OC1 A;  1DIK A;  2GRE A;  5F49 A;  2C1C A;  3FXT A;  4ZY1 A;  4CPA A;  2NMT A;  4FD5 A;  3VH9 A;  4E2A A;  4IIY A;  4O23 A;  3TLB A;  5G20 A;  4MHD A;  4L8A A;  4BPW B;  3TC8 A;  3W91 A;  3K4I A;  1R3N A;  5FD8 A;  1JQG A;  5HMN A;  1R43 A;  4MI4 A;  3I74 A;  4GXH A;  2OR4 A;  4NF1 A;  4C2Y A;  4F0X A;  5H84 A;  3S6G A;  4MY3 A;  1N71 A;  2HQY A;  2HI6 A;  2Z10 A;  1AMP A;  7CPA A;  4FD6 A;  2PIY A;  1ZL0 A;  3I1U A;  1KUX A;  1B6B A;  4AVC A;  1MJ9 A;  1NE9 A;  3KR4 A;  2CNT A;  1C3O B;  2YGW A;  2CTC A;  2Q7S A;  2NYQ A;  4OKO A;  1PYT B;  4WWV A;  4C8F A;  1ZG7 A;  3NFZ A;  1TIQ A;  4OC5 A;  4A4B A;  3SJX A;  2H5M A;  4MY0 A;  1TXR A;  1HDQ A;  4RI1 A;  4PSW A;  2AFM A;  4C9R A;  4KUB A;  3KHZ A;  1YQE A;  4LUA A;  3S9N A;  5CBM A;  3ISX A;  2PRB A;  5JQ4 A;  4M85 A;  3TLG A;  2PR8 A;  1MJB A;  2HRO A;  4COG A;  3BJ7 A;  3IGR A;  2CTB A;  4UWI A;  3KAS A;  4U5Y A;  1FY7 A;  2VL1 A;  4M3S A;  1EZB A;  1Z4E A;  4OC4 A;  1VBG A;  2PJ1 A;  3PBB A;  4H2K A;  1SQH A;  2AJ6 A;  2RFH A;  5C88 A;  1KUV A;  3NA6 A;  2JEV A;  4A32 A;  4BMH A;  3IFE A;  2FVG A;  5FVJ A;  1XF8 A;  2FE7 A;  2PDO A;  4JLY A;  3VAT A;  1XJO A;  1IGB A;  2AFU A;  3HPG G;  2ZEG A;  2C6P A;  3B3T A;  1P4N A;  2XEG A;  2Z3L A;  3R1K A;  4F0Y A;  3NFQ A;  2WUU A;  2B4J C;  3ICU A;  3D2M A;  3H8E A;  4OLL A;  1IOI A;  4P44 A;  1CP6 A;  4KOR A;  4Q36 A;  5JGF A;  4MFQ A;  2N3A B;  5F1Y A;  5AG4 A;  3T0T A;  2PCN A;  4A94 A;  4CDK A;  4FAI A;  2B0A A;  2YJV A;  5JYB A;  1CPX A;  1Q2Y A;  4B14 A;  1ZLH A;  3PFE A;  2B58 A;  4F8Z A;  4JXR A;  3IU2 A;  3FB3 A;  4P4J A;  1Q7L A;  5EC4 A;  5IB0 A;  1RTQ A;  3D66 A;  3SJG A;  4FWU A;  4IUS A;  4CRY B;  3VRN A;  4KSI A;  4UCP A;  2JDD A;  5F46 A;  2CXA A;  2PJ5 A;  2G3T A;  1LAP A;  3FJU A;  3IWG A;  1F2O A;  3B3S A;  4LX9 A;  5HVG A;  3D3S A;  1Z8W A;  3CXP A;  4H6Z A;  4IIX A;  3N7Z A;  4F9U A;  2WSA A;  2XEF A;  4MHN A;  3G23 A;  1CX8 A;  2J8N A;  2POK A;  2VI7 A;  4NJR A;  1A2Z A;  3KRV A;  2XEI A;  1QST A;  3PB9 X;  2ZEH A;  4UWJ A;  4Y49 B;  2FL4 A;  2REE A;  1PCA A;  1HDU A;  2Z3M A; 
#chains in the Genus database with same CATH homology
 3CPX A;  1LAM A;  2JBJ A;  4Z65 A;  1Y7E A;  2IJZ A;  1BLL E;  4NFR A;  4WJB A;  3ISZ A;  1TKF A;  1XF1 A;  2PJ6 A;  4ZY2 A;  3GLJ A;  3SJE A;  2F8H A;  1LFW A;  1Z2L A;  4NGS A;  1Z8L A;  2NSM A;  2GLJ A;  3I6S A;  4P4B A;  4YWY A;  1BPN A;  4UEE A;  3FVL A;  4A38 A;  4B6Z A;  1OBR A;  4MHP A;  2ABZ A;  4UIB A;  3PBE A;  1Z5R A;  3IEH A;  4MCR A;  4ZX8 A;  1DE4 C;  2HB6 A;  4C9A A;  3KZW A;  2PRQ A;  3KL9 A;  2Q4Z A;  4R7M A;  5LRK A;  4MHY A;  1ELM P;  4TJX A;  4R76 A;  1VGY A;  1TKJ A;  3WC5 A;  3N5F A;  4RUH A;  3MRU A;  4X2T A;  3BHX A;  5JM6 A;  4P10 A;  2IQ6 A;  5HXD A;  1FNO A;  1TF9 A;  4TWE A;  3D7F A;  3KR5 A;  2IMO A;  2V8G A;  2ZEO A;  3GUX A;  3LWU A;  3FF3 A;  3WAB A;  2ZED A;  4P4E A;  1ZG9 A;  3KQZ A;  4LQG A;  4C9E A;  3B3V A;  1TF8 A;  1LOK A;  1ZG8 A;  2V8V A;  4CDJ A;  2PJ0 A;  4R8F A;  2O53 A;  4AXV A;  1DTD A;  2ZEN A;  2GU2 A;  2JBK A;  5I4M A;  5K8O A;  4ZI6 A;  1BAV A;  2BCO A;  5HVF A;  5F09 A;  2PJ7 A;  5THW A;  3RAM A;  2G9D A;  3HLP A;  1XFO A;  1NSA A;  4OC3 A;  4UF4 A;  1YME A;  3WC7 A;  2RB7 A;  5LYD A;  1YW4 A;  3B3W A;  3IJ3 A;  4ZX9 A;  1AYE A;  3B3C A;  5IB9 A;  3S9M A;  4JZ0 A;  1VHE A;  4PXD A;  1EE3 P;  3EIF A;  4MCQ A;  2PJC A;  4NGN A;  3CDX A;  4ONW A;  3HUV A;  4DUK A;  1YW6 A;  4F9V A;  2C5Q A;  2F7V A;  3FEE A;  1ARM A;  1LAN A;  2EK9 A;  5K8P A;  2QYV A;  4UIA A;  4TJV A;  2PVV A;  3S9L A;  1TKH A;  5HVH A;  4P4F A;  2QJ8 A;  1XMB A;  5J1Q A;  2ZOF A;  4ZYQ A;  5K8N A;  4X3R A;  3NH4 A;  2GLF A;  4NGP A;  4OP4 A;  5IR2 A;  3D7H A;  2JEW A;  5DS0 A;  2CF4 A;  4PXE A;  2ZEE A;  3B7I A;  3LMS A;  2AFX A;  3KGQ A;  3CPA A;  2PJ9 A;  4A39 A;  2PCU A;  2PJ3 A;  4Q7A A;  3SI1 A;  2V8D A;  2PJB A;  3NH8 A;  4MCP A;  4ZY0 A;  5ELY A;  1CP7 A;  4C86 A;  2BOA A;  4JYW A;  1XBU A;  5K8M A;  3V7Z A;  1V6C A;  2PJA A;  3BI1 A;  4NJQ A;  4KNG E;  4EFD A;  2QVP A;  3D7G A;  4OC2 A;  4OME A;  2OOT A;  1UWY A;  4GM5 A;  4OIW A;  5JH9 A;  4G1P A;  2ZEF A;  4A37 A;  4K3N A;  4P45 A;  3K2K A;  4TNU A;  3KHX A;  4PXB A;  5LRJ A;  4YU9 A;  3FH4 A;  3FMC A;  3JRU A;  3VTA A;  1FT7 A;  3IO1 A;  1IY7 A;  5LYL A;  3IIB A;  3PB4 X;  4MCS A;  1QMU A;  2HC9 A;  3MN8 A;  2PE3 A;  4MXU A;  3DLJ A;  1QQ9 A;  3D68 A;  2I3C A;  2ZEP A;  4NGR A;  1F57 A;  2EWB A;  4EME A;  4MHZ A;  4IHM A;  1ELL P;  4P4D A;  3PEI A;  4IK2 A;  4C9V A;  3FEC A;  3WT4 A;  1KWM A;  3KQX A;  3FX6 A;  2C6G A;  2AFZ A;  4PPZ A;  4NGT A;  5LRG A;  3H8G A;  2DEA A;  2V8H A;  1WVM A;  3B35 A;  2PVW A;  1VHO A;  2AFW A;  1LCP A;  5CPA A;  6CPA A;  3TX8 A;  1BPM A;  4PXC A;  3CT9 A;  4MRI A;  4NGQ A;  1M4L A;  4C8U A;  2Q43 A;  4C85 A;  1VIX A;  2AFS A;  4DYO A;  3WC6 A;  3H8F A;  3PB7 X;  4NGM A;  4P4I A;  4W9Y A;  4C9U A;  2PJ4 A;  1XRY A;  5LYF A;  1CPS A;  1HEE A;  4C84 A;  5D29 A;  2ZOG A;  4C8C A;  1ARL A;  1CBX A;  1YLO A;  3IC1 A;  3PB8 X;  2CIJ A;  4X8I A;  3T8W A;  3PFO A;  2O4H A;  2C6C A;  2PJ2 A;  2ANP A;  4OC0 A;  2ZEL A;  3PB6 X;  4UEF A;  4OID A;  3NH5 A;  3RBU A;  3SI0 A;  3QNV A;  1Y9Z A;  2AFO A;  8CPA A;  3D7D A;  3GB0 A;  5LYI A;  4EWT A;  2PIZ A;  4R6T A;  4FUU A;  3D4U A;  2Q51 A;  4C99 A;  2J9A A;  4C8A A;  2WZN A;  2BO9 A;  1Y0Y A;  3KI9 A;  4P6Y A;  3V38 A;  3L2N A;  3PRT A;  1H8L A;  4C8P A;  2PJ8 A;  2WYR A;  3IWW A;  1YSJ A;  1Y0R A;  4MMO A;  4DJL A;  3B2Y A;  4YN3 A;  2EK8 A;  4BD9 A;  3SJF A;  4FBE A;  2V77 A;  2XEJ A;  3BXM A;  3FED A;  4PQA A;  3BI0 A;  4UEZ A;  1CG2 A;  1ZLI A;  3VAR A;  3RZA A;  2GP4 A;  3DGV A;  1GYT A;  3K9T A;  2ZEM A;  5D8N A;  3SI2 A;  1F2P A;  4C8T A;  4IAV A;  3D67 A;  4OC1 A;  2GRE A;  2C1C A;  4ZY1 A;  4CPA A;  3VH9 A;  4O23 A;  3TC8 A;  1R3N A;  1JQG A;  1R43 A;  3I74 A;  2OR4 A;  1AMP A;  7CPA A;  2PIY A;  3I1U A;  3KR4 A;  2CTC A;  2NYQ A;  4OKO A;  1PYT B;  4WWV A;  4C8F A;  1ZG7 A;  3NFZ A;  4OC5 A;  3SJX A;  1TXR A;  1HDQ A;  2AFM A;  4C9R A;  3KHZ A;  3S9N A;  5CBM A;  3ISX A;  2CTB A;  3KAS A;  2VL1 A;  4OC4 A;  2PJ1 A;  3PBB A;  4H2K A;  2RFH A;  3NA6 A;  3IFE A;  2FVG A;  3VAT A;  1XJO A;  1IGB A;  2AFU A;  2ZEG A;  2C6P A;  3B3T A;  2XEG A;  3ICU A;  3H8E A;  4P44 A;  1CP6 A;  5JGF A;  4A94 A;  4CDK A;  4FAI A;  1CPX A;  1ZLH A;  3PFE A;  4F8Z A;  4P4J A;  1Q7L A;  1RTQ A;  3D66 A;  3SJG A;  4FWU A;  4KSI A;  2PJ5 A;  1LAP A;  3FJU A;  5HVG A;  1F2O A;  3B3S A;  4F9U A;  4MHN A;  2XEF A;  1CX8 A;  2POK A;  4NJR A;  2XEI A;  3PB9 X;  2ZEH A;  1PCA A;  1HDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...