4X3RA

Avi-gcpii structure in complex with fitc-conjugated gcpii-specific inhibitor
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
690
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of highly potent urea-based, exosite-binding inhibitors selective for glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 261
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4x3rA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x3rA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4x3rA02
1CX8A 1YMEA 4P4IA 4MCQA 4MCRA 1HDQA 4P44A 2RB7A 3H8EA 4TJVA 3B3SA 4X2TA 2EK8A 4UEFA 2C6PA 2WZNA 4C8TA 2PJ3A 1AMPA 4NGQA 5HVHA 4NGPA 1VGYA 3JRUA 2PJ7A 3D66A 1ARLA 2PJAA 1CPSA 3K9TA 1ELLP 4EFDA 2ZOGA 2HB6A 2RFHA 3ISXA 4F9UA 5J1QA 3FX6A 4MHYA 5JGFA 1BLLE 2PJCA 3D7HA 3IEHA 1RTQA 1R43A 1FT7A 4WJBA 3B3TA 1TKJA 2PVWA 2V8HA 2Q51A 2C6GA 4PXBA 5K8PA 2ZEFA 4C85A 3KGQA 1KWMA 4TWEA 4EMEA 1YW4A 3T8WA 3DLJA 2FVGA 5I4MA 1DTDA 1Y0RA 4OIWA 4MHPA 3IJ3A 4G1PA 2IQ6A 2ABZA 3D68A 2V77A 1LAPA 3S9LA 5LYFA 2NYQA 1YW6A 2V8VA 1OBRA 4MRIA 4OC3A 4C9RA 4OC0A 3B7IA 4C9VA 3WT4A 2PCUA 1TKFA 1XJOA 2BCOA 4TNUA 4UF4A 2ZEHA 2PIZA 2ZEPA 8CPAA 5LYIA 3RBUA 2CIJA 1VHEA 4ZX8A 3NA6A 3RZAA 4YWYA 2PJ8A 4RUHA 2CF4A 2ZEEA 4MHZA 4NGTA 4DJLA 4R8FA 3FMCA 2IMOA 2PJBA 1Q7LA 3BI0A 4OKOA 1F57A 2NSMA 1TKHA 3GUXA 4Z65A 3PB6X 4NGMA 1FNOA 1CG2A 4AXVA 1GYTA 4C86A 3I1UA 1QMUA 4MCPA 4FBEA 3WC5A 1Y9ZA 5D8NA 4FAIA 4UEZA 4GM5A 2POKA 1ZG9A 4OP4A 3K2KA 3I74A 1LANA 4R76A 2ZEMA 1WVMA 2PRQA 4PXEA 5LRGA 2AFUA 3KZWA 1V6CA 1AYEA 1H8LA 3WABA 4O23A 4ZX9A 1PYTB 2ZOFA 3SI2A 1CP7A 3IFEA 2PJ2A 3ISZA 4P10A 3BXMA 1Z5RA 2JEWA 1IY7A 3PB8X 3PBEA 2JBKA 4PXCA 4NJQA 4F9VA 4C8PA 2AFSA 4UEEA 4UIAA 4WWVA 1BPMA 3B3CA 3PFEA 2BO9A 2O4HA 4P4DA 4KNGE 3FJUA 1JQGA 4ZI6A 1EE3P 4DUKA 1CPXA 2AFXA 3BI1A 4OC2A 3CT9A 5CBMA 4KSIA 3IC1A 4PXDA 4NFRA 4X8IA 5F09A 4DYOA 4CPAA 3VH9A 2GLFA 4F8ZA 3FVLA 3TX8A 4B6ZA 2AFWA 3D4UA 3PFOA 3SJFA 3VARA 2XEIA 2QJ8A 4K3NA 2PE3A 1ELMP 1HDUA 1YSJA 2GREA 3GLJA 4NGSA 3H8FA 2GU2A 4C9UA 4P45A 3D7GA 3IWWA 3NH4A 4JYWA 2AFMA 1NSAA 4MMOA 3SI0A 2ZEGA 2PJ1A 1LAMA 1YLOA 3HUVA 4PPZA 2IJZA 2ZEDA 4Q7AA 4R6TA 2PJ5A 5LRKA 3KQZA 4JZ0A 2QVPA 5LRJA 2J9AA 4OIDA 2O53A 4C99A 3SI1A 1VIXA 5LYDA 1LOKA 5JM6A 3WC6A 3VTAA 4MXUA 2AFZA 5K8NA 3BHXA 5LYLA 4FUUA 2F7VA 3SJGA 1TF8A 4C8AA 4P6YA 3PB9X 4IAVA 1LFWA 2ZEOA 4OMEA 3QNVA 2XEGA 3I6SA 6CPAA 5K8OA 3HLPA 3IO1A 2XEJA 1XRYA 3KHZA 5IB9A 2JBJA 4MCSA 3WC7A 2XEFA 1HEEA 4W9YA 3KHXA 1ZG7A 4C8FA 2VL1A 5HVFA 4ZY0A 4X3RA 2Q4ZA 1IGBA 4ZY1A 2CTCA 4YU9A 1PCAA 2PIYA 1BPNA 4OC4A 1ARMA 3NH8A 3FEDA 2PJ4A 3SJEA 4C84A 3ICUA 3GB0A 3H8GA 2CTBA 3KR5A 3B3VA 2ZENA 3KL9A 4R7MA 1Z8LA 5HVGA 4A37A 2ANPA 7CPAA 2QYVA 3D67A 2C1CA 4NGNA 1UWYA 4P4JA 1ZG8A 1LCPA 4C8UA 2EK9A 3SJXA 4TJXA 4A94A 3KQXA 3PEIA 3KI9A 3FECA 2PJ6A 1R3NA 3TC8A 2G9DA 3VATA 4ZY2A 2GLJA 5CPAA 4OC1A 4EWTA 2BOAA 5THWA 1ZLHA 4IK2A 3PB4X 4NGRA 4P4EA 2I3CA 3N5FA 3DGVA 4C9AA 1TXRA 4CDKA 4PQAA 3L2NA 3FEEA 3S9NA 1Y7EA 4C9EA 2PVVA 3V7ZA 2V8GA 4A39A 1XFOA 4A38A 3S9MA 2C6CA 3B35A 2PJ9A 2AFOA 4NJRA 3PBBA 3MRUA 1CBXA 2HC9A 1M4LA 1Z2LA 5ELYA 3FF3A 4CDJA 5JH9A 4P4FA 4OC5A 2EWBA 4ZYQA 4C8CA 3IIBA 1VHOA 3MN8A 3CPXA 3NFZA 1BAVA 3FH4A 2V8DA 2PJ0A 1ZLIA 1XBUA 4ONWA 5DS0A 2WYRA 2DEAA 3D7FA 1CP6A 5HXDA 1TF9A 1XMBA 2OOTA 3LMSA 4YN3A 2Q43A 1DE4C 5K8MA 3V38A 4UIBA 3EIFA 1F2OA 4FWUA 4BD9A 3NH5A 3CDXA 4P4BA 1QQ9A 3D7DA 3KASA 4H2KA 4LQGA 4MHNA 3LWUA 3PRTA 1XF1A 3B2YA 3CPAA 3PB7X 2F8HA 1F2PA 1Y0YA 2OR4A 2ZELA 3KR4A 3RAMA 5D29A 4IHMA 3B3WA
chains in the Genus database with same CATH superfamily
1CX8A 2Z3LA 4YGOA 3G3SA 2QIRA 1YMEA 3B8GA 3TCVA 4P4IA 4BMHA 4MCQA 4B5PB 4MCRA 1HDQA 4P44A 3VROA 2RB7A 3H8EA 3JTKA 3B3SA 4X2TA 4B5PA 4TJVA 4PV6A 2EK8A 4UEFA 2C6PA 4XPDB 3S6GA 3IWGA 2VI7A 4MY3A 1XMTA 1M4DA 2WZNA 5JVLA 3DR6A 4C8TA 4II9A 3CXSA 2PJ3A 5DWMA 3SHPA 3T90A 4C2YA 1AMPA 4EVYA 2XPOA 4NGQA 1Z4RA 2P6EA 5HVHA 4NGPA 4KOXA 1VGYA 3JRUA 5J3XA 2BEIA 2EO8A 2PJ7A 3D66A 1ZO0A 4UWIA 1ARLA 2CXAA 2PJAA 1CPSA 3K9TA 1ELLP 4EFDA 1XE4A 3PLFB 2ZOGA 4Y49C 2HB6A 4KLVA 3EZEA 2RFHA 3RNZA 2EUIA 3ISXA 4EYSA 3LACA 3S6FA 3D2MA 4F9UA 5J1QA 3FIXA 3FX6A 4E2AA 5KTCA 4KORA 4M6IA 4MHYA 4C2ZA 5JGFA 2PDOA 2YNDA 1BLLE 2AJ6A 1XOVA 4M8DA 3GKRA 2PJCA 3D7HA 2G3AA 1PU9A 1R43A 1RTQA 1FT7A 3IEHA 3RO0A 2YJVA 2P0WA 2ZXVA 4WJBA 4QVTA 1ZL0A 1NMTA 5IX3A 3W91A 3ZNIA 3B3TA 1TKJA 2I00A 2EZBA 1YR0A 2O28A 2PVWA 2VKZG 1YX0A 1VI4A 2V8HA 2Q51A 2C6GA 4UCPA 3TOAA 2R8VA 5C82A 5HKZA 4PXBA 4UA3A 5K8PA 4AVAA 2ZEFA 4HKFA 4C85A 3EY5A 2OZGA 1KWMA 3KGQA 4TWEA 5K99A 1N71A 5F49A 1QSOA 4EMEA 2Q7SA 5HKWA 1YW4A 3I3GA 4LX9A 3T05A 4PSWA 3GY9A 3S6KA 3F9KC 3T8WA 3E0KA 3TLGA 1Z8WA 3DLJA 1Z8TA 2FVGA 3D2PA 3NOJA 3FBUA 5I4MA 1DTDA 1Y0RA 3KKWA 1FY7A 4OIWA 5C88A 1S3ZA 2Y1MA 2J8RA 3IJ3A 4G1PA 4MHPA 2YJTA 4AVBA 2IQ6A 2ZW4A 2ABZA 3D68A 1NSLA 2V77A 1LAPA 4B11A 3VWEA 1S7LA 4BPXB 3S9LA 2P6FA 3P2FA 4PSXA 2XPPA 3TOBA 2WPWA 4KVOE 4CRZB 1CJWA 2NYQA 1YW6A 2V8VA 3H4QA 1OBRA 4R3LA 1UFHA 2C27A 3DR8A 4MRIA 4OC3A 2G3TA 2B3UA 4OC0A 3FXTA 3B7IA 4M6GA 4NF1A 4UFWA 4INJA 4C9VA 4C9RA 3WT4A 2D4PA 1P4NA 1Z4EA 4CGNA 2PCUA 1TKFA 1XJOA 2BCOA 1J4JA 1M1DA 2Z3NA 3DDDA 4TNUA 4UF4A 2OU2A 2PC1A 2ZPAA 2ZEHA 2PIZA 2ZEPA 8CPAA 3BJ8A 1AUGA 5LYIA 1I21A 4KSFA 3EFAA 3C26A 4NXYA 1IB1E 4RI1A 4J3GA 3RBUA 2HI6A 2Z11A 1A9XB 1YK3A 2CIJA 1VHEA 3F0AA 4ZX8A 2ATRA 2EZAA 1VBHA 3NA6A 2RC4A 3RZAA 2WSAA 4YWYA 2HROA 2PJ8A 4RUHA 2CF4A 3HPHE 2ZEEA 4MHZA 4NGTA 4XNHC 3OWCA 1QSTA 4DJLA 5A27A 5F47A 4KS9A 4OLLA 4R8FA 3FMCA 3NFQA 1Q7LA 2IMOA 3BI0A 2BL1A 2PJBA 3C8OA 5AG6A 4OKOA 1F57A 2NSMA 2PR8A 1Z9EA 1TKHA 3GUXA 2OB0A 3PGPA 3R9FA 4Z65A 3GIUA 3PB6X 4FD4A 3R9GA 3OB2B 4NGMA 1FNOA 2FXFA 4CAWA 1CG2A 3EZAA 5G22A 5IV0A 5G1ZA 4AXVA 1GYTA 1MJBA 4MFQA 3I1UA 1GGOA 4C86A 1QMUA 4RR2B 4MCPA 4A31A 3VRQA 1YVKA 4FBEA 3WC5A 4E5SA 1Y9ZA 5D8NA 1WWZA 2FIAA 4XNHB 4DNCA 4UFXA 4CGLA 3TO7A 3IU1A 4FAIA 2VZZA 5AG5A 2X7BA 3F8KA 5DWNA 4C7IA 2YNCA 4CZ1A 4UEZA 1B6BA 2KCWA 4GM5A 5G21A 2POKA 1ZG9A 4OP4A 5BWAB 3K2KA 3TLCA 2B4DB 2WPXA 2B4DA 3I74A 3LODA 2PRBA 5AGEA 4XPDC 1LANA 4J0NA 4LUAA 3GYAA 4MFJA 1VBGA 3HMJG 4JWPA 4R76A 4K30A 4L8AA 2ZEMA 1WVMA 4CYOA 2D0OA 2PRQA 4PXEA 4IIYA 5LRGA 1KBLA 1YVOA 1NXJA 2YGWA 2AFUA 3KZWA 4QC6A 2B4BA 1V6CA 1AYEA 4NEXA 4E0AA 1H8LA 1IIDA 1KUYA 2ZW5A 3WABA 2P6GA 4O23A 3JUWA 4ZX9A 1BO4A 1PYTB 2ZOFA 4NCZA 3SI2A 3NE7A 1CP7A 3IFEA 2B58A 2PJ2A 4RS2A 2VXKA 5F46A 1Y9WA 3ISZA 4ORFA 4P10A 3U88C 3BXMA 4CAFA 4ZBGA 1Z5RA 2JDDA 2JEWA 2ODFA 1IY7A 3PB8X 3PBEA 2JBKA 4JXQA 4JD6A 4PXCA 4E8OA 4NJQA 1IYLA 3NE8A 2R1IA 4M6HA 4OADA 4F9VA 1MJ9A 4F6AA 4C8PA 4GPLB 1XIXA 1CS0B 2PR1A 2AFSA 1DIKA 3TLAA 2R98A 4UEEA 4UIAA 1M4IA 4KUBA 4WWVA 3TYXA 1C30B 4MI4A 4ONUA 1S7KA 1BPMA 3B3CA 2CNMA 3DNSA 4IF5A 4B10A 3PFEA 3SXOA 3D3SA 4BBHA 3IWEA 4PK3A 4QBJA 3TLBA 2BO9A 2O4HA 4P4DA 4KNGE 3FJUA 3KRVA 3BLNA 1JDEA 2D4OA 4F0YA 5KTDA 1JQGA 4ZI6A 1IOIA 2FM4A 3VRRA 3BUMB 4BPWB 1EE3P 4DUKA 5AG4A 4BPUB 1CPXA 4CAVA 4MHDA 4B12A 2AFXA 3BI1A 4OC2A 1MK4A 3CT9A 4NSQA 2BUEA 5CBMA 4KSIA 3IC1A 4PXDA 3EZBA 4NFRA 1S5KA 3IGRA 1EZBA 4CRYB 3LD2A 3OAKA 4CGOA 4X8IA 4FD7A 4E94A 5F09A 4RN7A 4CPAA 4DYOA 2J8MA 3VH9A 3TLGB 2GLFA 2HUZA 2JLMA 4F8ZA 3FVLA 3TX8A 4JLYA 4R57A 3TLYA 4B6ZA 4MFKA 2C5QA 2Q04A 2AFWA 2WUUA 1Y7RA 3T0TA 3D4UA 3FB3A 3PFOA 4CAEA 2EZCA 3SJFA 3VARA 3VRPA 2CNTA 2XEIA 5GCNA 1L0CA 2QJ8A 4K3NA 4UCMA 2PE3A 1ELMP 2GP4A 4Q36A 1T36B 3H5ZA 2VQYA 3JVNA 1HDUA 1YSJA 2GREA 3BUOB 3VGOA 1A2ZA 1M4GA 2FE7A 2Q44A 3GLJA 3O8ZA 4HNYB 1BXRB 5LYFA 5FVJA 3PFVA 4NGSA 4GS4A 4QUSA 4A33A 3CZXA 3H8FA 2R82A 1OZPA 2GU2A 5HKYA 3A9LA 3CXQA 4CYPA 4C9UA 3TLZA 4P45A 3D7GA 1QSMA 3IWWA 3NH4A 1IYKA 2CNSA 4JYWA 2AE6A 2AFMA 2QECA 3T9YA 1NSAA 4MMOA 3SI0A 3W6XA 1ZRSA 1B47A 1MJAA 2ZEGA 2PJ1A 4AB7A 1LAMA 1YLOA 1YGHA 3HUVA 2E28A 4PPZA 3SR3A 2IJZA 2ZEDA 2DPSA 4Q7AA 4R6TA 3SXNA 1XEBA 3OP0A 2PJ5A 5EMIA 1X12A 1NBWA 5LRKA 2UV8G 1I1DA 3KQZA 4JZ0A 2QVPA 2VEZA 2ZW7A 4MJ8A 2JDCA 2J9AA 4OIDA 2DF5A 5LRJA 3R96A 3TO6A 2O53A 2OLSA 3D8PA 2YNCC 2OH1A 1I12A 1ZYMA 2FCKA 1YREA 4C99A 3HPGG 3SI1A 1VIXA 1S60A 2Y0MA 3QAYA 5HH1A 1Z9UA 5LYDA 1YVHA 1LOKA 4A30A 3PP9A 4FD6A 5E96A 5JM6A 1EZAA 2Z10A 4CGPA 1K4JA 4X5KA 4MY0A 3WC6A 4MBUA 2HWGA 3W6SA 5KTAA 4MXUA 5JQ4A 4B14A 3VTAA 2AFZA 4COGA 4UWJA 3ZZIA 4MI1A 1WJTA 3BHXA 5K8NA 1XF8A 5LYLA 4FUUA 2J8NA 2F7VA 4KOYA 3SJGA 1TF8A 1JDBC 4C8AA 2GIVA 2AUNA 4P6YA 2XPLA 3PB9X 4IAVA 1LFWA 2ZEOA 3VRNA 4OMEA 3QNVA 4COBA 2XEGA 2IL4A 2B3VA 5IB0A 3I6SA 1QSRA 1VHSA 6CPAA 2VZYA 2DPTA 3R9EA 5K8OA 2CBLA 4MJXA 3HLPA 1Q2CA 3IO1A 5CNPA 3WR7A 2XEJA 1XRYA 3KHZA 5IB9A 5IR2A 2CY2A 4AG9A 2DIKA 1J3LA 2JBJA 4MCSA 1TIQA 3WC7A 2XEFA 1HEEA 3TLEA 4W9YA 2REEA 3KHXA 2F5IA 1ZG7A 3QB8A 3TT2A 3TTHA 2Z3PA 5AXIA 4HPSA 2HV2A 4C8FA 1X10A 2EVNA 4CYQA 4L89A 1Q5XA 2BSWA 2VL1A 5HVFA 1R57A 4BTFA 2Z3OA 4A4CA 2ZW6A 4KOSA 1P0HA 4KUAA 4Q38A 4ZGYB 4X3RA 4M3SA 4ZY0A 2Q4ZA 4H1HA 1IGBA 1YLEA 2OZUA 4F0XA 5F5XA 4C8CA 4ZY1A 1Z8XA 2CTCA 4YU9A 1PCAA 2PIYA 1BPNA 4AG7A 4OC4A 1ARMA 1V0CA 4KOTA 1KZFA 3TO9A 3NH8A 3FEDA 2PJ4A 4KVME 3EXNA 4MFPA 2Q4VA 3SJEA 3P2HA 4C84A 5JPHA 3ICUA 3GB0A 3H8GA 5EC4A 4IIXA 5FD8A 2CTBA 3KR5A 3B3VA 1B87A 3DSBA 1KUVA 1U6MA 2ZENA 1M44A 4YRHA 1CE8B 5AG7A 3KL9A 4R7MA 2AUMA 1Z8LA 5HVGA 4A37A 2ANPA 7CPAA 2N3AB 2QYVA 4B5OA 3D67A 2C1CA 4U9YA 4NGNA 1UWYA 2FT0A 5H86A 2FIWA 4P4JA 4C68A 1ZG8A 1LCPA 4C8UA 2Q4YA 2EK9A 1VKCA 2Y1NA 3SJXA 3ZJ0A 3TE4A 4TJXA 4A94A 3KQXA 3U1BA 3PEIA 4BINA 3KI9A 3FECA 2PJ6A 3K9UA 4M85A 5ISVA 1R3NA 1SQHA 4R9MA 3TC8A 2G9DA 2K5TA 3BUNB 2DXQA 4QB9A 3VATA 1ON0A 4ZY2A 3G23A 1CM0A 3IU2A 4A32A 2GLJA 5CPAA 4OC1A 4EWTA 2PCNA 2BOAA 2GE3A 1ZLHA 2Z3MA 5THWA 2R7HA 1WK4A 1M6VB 4IK2A 3PB4X 1NE9A 4KLWA 4NGRA 4Y49B 4P4EA 3G8WA 2I3CA 1RXTA 3N5FA 4JVOA 5J8CA 5EBVA 3DGVA 4C9AA 4UFVA 2G0BA 5G20A 1KEEB 4H6ZA 1TXRA 3FNCA 4CDKA 4PQAA 3PT1A 4JXRA 3BJ7A 2PSWA 3L2NA 3FEEA 3S9NA 1Y7EA 4C9EA 5F1YA 4KOVA 2QMLA 2PVVA 2XPNA 2FL4A 2YNEA 3R1KA 1FBVA 4IUSA 2Q7BA 3V7ZA 1Y9KA 2V8GA 5F9MA 1GHEA 5F48A 4A39A 4A95A 1XFOA 4A38A 3S9MA 4C7HA 4YFJA 3GJZA 1R61A 1IU8A 2C6CA 3MGDA 3B35A 2PJ9A 2AFOA 4NJRA 3PBBA 4CS0B 4CYNA 1RO5A 4U9ZA 3UY5A 4OAEA 3TFYA 3MRUA 1CBXA 2GANA 2HC9A 3FRMA 4KVXA 3EO4A 3OB1B 1M4LA 2D0PA 2NMTA 1BOBA 1Z2LA 4A2ZA 4U5YA 1EO0A 4CO9A 5ELYA 3FF3A 5F13A 4KOUA 4GXHA 4CDJA 5JYBA 3K4IA 2DLAA 4H6UA 5JH9A 4P4FA 4OC5A 2EWBA 4KOWA 4R3KA 3IIBA 1VHOA 4CAXA 3MN8A 4ZYQA 1JWQA 1Q2YA 3CPXA 3NFZA 1BAVA 3FH4A 2V8DA 4A4BA 1ZLIA 2PJ0A 1XBUA 4ONWA 2I79A 4FD5A 3N7ZA 4PK2A 5I0CA 5DS0A 4C2XA 2ARHA 2WYRA 2DEAA 3D7FA 1CP6A 4R87A 5HXDA 1TF9A 4XPKA 1YQEA 2X0SA 1S7FA 4MFZA 4HNXB 1XMBA 2OOTA 2EBJA 4H89A 3LMSA 4YN3A 3I9SA 2Q43A 5H84A 1DE4C 5K8MA 1KUXA 4HNWB 4UIBA 3V38A 1C3OB 3QAHA 2B0AA 2JEVA 4KSAA 2VBQA 5A28A 4UCNA 3EIFA 3CXPA 3T5MA 2B4JC 1F2OA 3PZJA 2B5GB 2B5GA 3FYNA 4I49A 1PUAA 5J8FA 3R95A 4FWUA 4AVCA 4BD9A 5BY0A 3CDXA 2Z0ZA 3NH5A 4P4BA 1QQ9A 3D7DA 1S7NA 1IICA 3KASA 2Z3KA 2H5MA 4H2KA 2GFQA 4LQGA 4MHNA 5HMNA 2A4NA 4LQ6A 3S6HA 3LWUA 3PRTA 4MFLA 4XPLA 2HQYA 3EC4A 3V8IA 4CGMA 1XF1A 1LRZA 3B2YA 3CPAA 3PB7X 3RYOA 4B13A 1Q2DA 3F5BA 2PQ8A 2F8HA 1QSNA 1Y0YA 1F2PA 2REFA 2OR4A 2Q0YA 2ZELA 4JJXA 3KR4A 3T07A 2OZHA 3RAMA 1KC7A 3BUXB 4KZTA 5D29A 2FS5A 4UBRA 2FSRA 4IHMA 1IOFA 3VWDA 3BUWB 3B3WA 2MP0A
chains in the Genus database with same CATH topology
1CX8A 1YMEA 4P4IA 4MCQA 4MCRA 1HDQA 4P44A 2RB7A 3H8EA 4TJVA 3B3SA 4X2TA 2EK8A 4UEFA 2C6PA 2WZNA 4C8TA 2PJ3A 1AMPA 4NGQA 5HVHA 4NGPA 1VGYA 3JRUA 2PJ7A 3D66A 1ARLA 2PJAA 1CPSA 3K9TA 1ELLP 4EFDA 2ZOGA 2HB6A 2RFHA 3ISXA 4F9UA 5J1QA 3FX6A 4MHYA 5JGFA 1BLLE 2PJCA 3D7HA 3IEHA 1RTQA 1R43A 1FT7A 4WJBA 3B3TA 1TKJA 2PVWA 2V8HA 2Q51A 2C6GA 4PXBA 5K8PA 2ZEFA 4C85A 3KGQA 1KWMA 4TWEA 4EMEA 1YW4A 3T8WA 3DLJA 2FVGA 5I4MA 1DTDA 1Y0RA 4OIWA 4MHPA 3IJ3A 4G1PA 2IQ6A 2ABZA 3D68A 2V77A 1LAPA 3S9LA 5LYFA 2NYQA 1YW6A 2V8VA 1OBRA 4MRIA 4OC3A 4C9RA 4OC0A 3B7IA 4C9VA 3WT4A 2PCUA 1TKFA 1XJOA 2BCOA 4TNUA 4UF4A 2ZEHA 2PIZA 2ZEPA 8CPAA 5LYIA 3RBUA 2CIJA 1VHEA 4ZX8A 3NA6A 3RZAA 4YWYA 2PJ8A 4RUHA 2CF4A 2ZEEA 4MHZA 4NGTA 4DJLA 4R8FA 3FMCA 2IMOA 2PJBA 1Q7LA 3BI0A 4OKOA 1F57A 2NSMA 1TKHA 3GUXA 4Z65A 3PB6X 4NGMA 1FNOA 1CG2A 4AXVA 1GYTA 4C86A 3I1UA 1QMUA 4MCPA 4FBEA 3WC5A 1Y9ZA 5D8NA 4FAIA 4UEZA 4GM5A 2POKA 1ZG9A 4OP4A 3K2KA 3I74A 1LANA 4R76A 2ZEMA 1WVMA 2PRQA 4PXEA 5LRGA 2AFUA 3KZWA 1V6CA 1AYEA 1H8LA 3WABA 4O23A 4ZX9A 1PYTB 2ZOFA 3SI2A 1CP7A 3IFEA 2PJ2A 3ISZA 4P10A 3BXMA 1Z5RA 2JEWA 1IY7A 3PB8X 3PBEA 2JBKA 4PXCA 4NJQA 4F9VA 4C8PA 2AFSA 4UEEA 4UIAA 4WWVA 1BPMA 3B3CA 3PFEA 2BO9A 2O4HA 4P4DA 4KNGE 3FJUA 1JQGA 4ZI6A 1EE3P 4DUKA 1CPXA 2AFXA 3BI1A 4OC2A 3CT9A 5CBMA 4KSIA 3IC1A 4PXDA 4NFRA 4X8IA 5F09A 4DYOA 4CPAA 3VH9A 2GLFA 4F8ZA 3FVLA 3TX8A 4B6ZA 2C5QA 2AFWA 3D4UA 3PFOA 3SJFA 3VARA 2XEIA 2QJ8A 4K3NA 2PE3A 1ELMP 2GP4A 1HDUA 1YSJA 2GREA 3GLJA 4NGSA 3H8FA 2GU2A 4C9UA 4P45A 3D7GA 3IWWA 3NH4A 4JYWA 2AFMA 1NSAA 4MMOA 3SI0A 2ZEGA 2PJ1A 1LAMA 1YLOA 3HUVA 4PPZA 2IJZA 2ZEDA 4Q7AA 4R6TA 2PJ5A 5LRKA 3KQZA 4JZ0A 2QVPA 5LRJA 2J9AA 4OIDA 2O53A 4C99A 3SI1A 1VIXA 5LYDA 1LOKA 5JM6A 3WC6A 3VTAA 4MXUA 2AFZA 5K8NA 3BHXA 5LYLA 4FUUA 2F7VA 3SJGA 1TF8A 4C8AA 4P6YA 3PB9X 4IAVA 1LFWA 2ZEOA 4OMEA 3QNVA 2XEGA 3I6SA 6CPAA 5K8OA 3HLPA 3IO1A 2XEJA 1XRYA 3KHZA 5IB9A 5IR2A 2JBJA 4MCSA 3WC7A 2XEFA 1HEEA 4W9YA 3KHXA 1ZG7A 4C8FA 2VL1A 5HVFA 4ZY0A 4X3RA 2Q4ZA 1IGBA 4ZY1A 2CTCA 4YU9A 1PCAA 2PIYA 1BPNA 4OC4A 1ARMA 3NH8A 3FEDA 2PJ4A 3SJEA 4C84A 3ICUA 3GB0A 3H8GA 2CTBA 3KR5A 3B3VA 2ZENA 3KL9A 4R7MA 1Z8LA 5HVGA 4A37A 2ANPA 7CPAA 2QYVA 3D67A 2C1CA 4NGNA 1UWYA 4P4JA 1ZG8A 1LCPA 4C8UA 2EK9A 3SJXA 4TJXA 4A94A 3KQXA 3PEIA 3KI9A 3FECA 2PJ6A 1R3NA 3TC8A 2G9DA 3VATA 4ZY2A 2GLJA 5CPAA 4OC1A 4EWTA 2BOAA 5THWA 1ZLHA 4IK2A 3PB4X 4NGRA 4P4EA 2I3CA 3N5FA 3DGVA 4C9AA 1TXRA 4CDKA 4PQAA 3L2NA 3FEEA 3S9NA 1Y7EA 4C9EA 2PVVA 3V7ZA 2V8GA 4A39A 1XFOA 4A38A 3S9MA 2C6CA 3B35A 2PJ9A 2AFOA 4NJRA 3PBBA 3MRUA 1CBXA 2HC9A 1M4LA 1Z2LA 5ELYA 3FF3A 4CDJA 5JH9A 4P4FA 4OC5A 2EWBA 4ZYQA 4C8CA 3IIBA 1VHOA 3MN8A 3CPXA 3NFZA 1BAVA 3FH4A 2V8DA 2PJ0A 1ZLIA 1XBUA 4ONWA 5DS0A 2WYRA 2DEAA 3D7FA 1CP6A 5HXDA 1TF9A 1XMBA 2OOTA 3LMSA 4YN3A 2Q43A 1DE4C 5K8MA 3V38A 4UIBA 3EIFA 1F2OA 4FWUA 4BD9A 3NH5A 3CDXA 4P4BA 1QQ9A 3D7DA 3KASA 4H2KA 4LQGA 4MHNA 3LWUA 3PRTA 1XF1A 3B2YA 3CPAA 3PB7X 2F8HA 1F2PA 1Y0YA 2OR4A 2ZELA 3KR4A 3RAMA 5D29A 4IHMA 3B3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CX8 A;  1YME A;  4P4I A;  4MCQ A;  4MCR A;  1HDQ A;  4P44 A;  2RB7 A;  3H8E A;  4TJV A;  3B3S A;  4X2T A;  2EK8 A;  4UEF A;  2C6P A;  2WZN A;  4C8T A;  2PJ3 A;  1AMP A;  4NGQ A;  5HVH A;  4NGP A;  1VGY A;  3JRU A;  2PJ7 A;  3D66 A;  1ARL A;  2PJA A;  1CPS A;  3K9T A;  1ELL P;  4EFD A;  2ZOG A;  2HB6 A;  2RFH A;  3ISX A;  4F9U A;  5J1Q A;  3FX6 A;  4MHY A;  5JGF A;  1BLL E;  2PJC A;  3D7H A;  3IEH A;  1RTQ A;  1R43 A;  1FT7 A;  4WJB A;  3B3T A;  1TKJ A;  2PVW A;  2V8H A;  2Q51 A;  2C6G A;  4PXB A;  5K8P A;  2ZEF A;  4C85 A;  3KGQ A;  1KWM A;  4TWE A;  4EME A;  1YW4 A;  3T8W A;  3DLJ A;  2FVG A;  5I4M A;  1DTD A;  1Y0R A;  4OIW A;  4MHP A;  3IJ3 A;  4G1P A;  2IQ6 A;  2ABZ A;  3D68 A;  2V77 A;  1LAP A;  3S9L A;  5LYF A;  2NYQ A;  1YW6 A;  2V8V A;  1OBR A;  4MRI A;  4OC3 A;  4C9R A;  4OC0 A;  3B7I A;  4C9V A;  3WT4 A;  2PCU A;  1TKF A;  1XJO A;  2BCO A;  4TNU A;  4UF4 A;  2ZEH A;  2PIZ A;  2ZEP A;  8CPA A;  5LYI A;  3RBU A;  2CIJ A;  1VHE A;  4ZX8 A;  3NA6 A;  3RZA A;  4YWY A;  2PJ8 A;  4RUH A;  2CF4 A;  2ZEE A;  4MHZ A;  4NGT A;  4DJL A;  4R8F A;  3FMC A;  2IMO A;  2PJB A;  1Q7L A;  3BI0 A;  4OKO A;  1F57 A;  2NSM A;  1TKH A;  3GUX A;  4Z65 A;  3PB6 X;  4NGM A;  1FNO A;  1CG2 A;  4AXV A;  1GYT A;  4C86 A;  3I1U A;  1QMU A;  4MCP A;  4FBE A;  3WC5 A;  1Y9Z A;  5D8N A;  4FAI A;  4UEZ A;  4GM5 A;  2POK A;  1ZG9 A;  4OP4 A;  3K2K A;  3I74 A;  1LAN A;  4R76 A;  2ZEM A;  1WVM A;  2PRQ A;  4PXE A;  5LRG A;  2AFU A;  3KZW A;  1V6C A;  1AYE A;  1H8L A;  3WAB A;  4O23 A;  4ZX9 A;  1PYT B;  2ZOF A;  3SI2 A;  1CP7 A;  3IFE A;  2PJ2 A;  3ISZ A;  4P10 A;  3BXM A;  1Z5R A;  2JEW A;  1IY7 A;  3PB8 X;  3PBE A;  2JBK A;  4PXC A;  4NJQ A;  4F9V A;  4C8P A;  2AFS A;  4UEE A;  4UIA A;  4WWV A;  1BPM A;  3B3C A;  3PFE A;  2BO9 A;  2O4H A;  4P4D A;  4KNG E;  3FJU A;  1JQG A;  4ZI6 A;  1EE3 P;  4DUK A;  1CPX A;  2AFX A;  3BI1 A;  4OC2 A;  3CT9 A;  5CBM A;  4KSI A;  3IC1 A;  4PXD A;  4NFR A;  4X8I A;  5F09 A;  4DYO A;  4CPA A;  3VH9 A;  2GLF A;  4F8Z A;  3FVL A;  3TX8 A;  4B6Z A;  2AFW A;  3D4U A;  3PFO A;  3SJF A;  3VAR A;  2XEI A;  2QJ8 A;  4K3N A;  2PE3 A;  1ELM P;  1HDU A;  1YSJ A;  2GRE A;  3GLJ A;  4NGS A;  3H8F A;  2GU2 A;  4C9U A;  4P45 A;  3D7G A;  3IWW A;  3NH4 A;  4JYW A;  2AFM A;  1NSA A;  4MMO A;  3SI0 A;  2ZEG A;  2PJ1 A;  1LAM A;  1YLO A;  3HUV A;  4PPZ A;  2IJZ A;  2ZED A;  4Q7A A;  4R6T A;  2PJ5 A;  5LRK A;  3KQZ A;  4JZ0 A;  2QVP A;  5LRJ A;  2J9A A;  4OID A;  2O53 A;  4C99 A;  3SI1 A;  1VIX A;  5LYD A;  1LOK A;  5JM6 A;  3WC6 A;  3VTA A;  4MXU A;  2AFZ A;  5K8N A;  3BHX A;  5LYL A;  4FUU A;  2F7V A;  3SJG A;  1TF8 A;  4C8A A;  4P6Y A;  3PB9 X;  4IAV A;  1LFW A;  2ZEO A;  4OME A;  3QNV A;  2XEG A;  3I6S A;  6CPA A;  5K8O A;  3HLP A;  3IO1 A;  2XEJ A;  1XRY A;  3KHZ A;  5IB9 A;  2JBJ A;  4MCS A;  3WC7 A;  2XEF A;  1HEE A;  4W9Y A;  3KHX A;  1ZG7 A;  4C8F A;  2VL1 A;  5HVF A;  4ZY0 A;  4X3R A;  2Q4Z A;  1IGB A;  4ZY1 A;  2CTC A;  4YU9 A;  1PCA A;  2PIY A;  1BPN A;  4OC4 A;  1ARM A;  3NH8 A;  3FED A;  2PJ4 A;  3SJE A;  4C84 A;  3ICU A;  3GB0 A;  3H8G A;  2CTB A;  3KR5 A;  3B3V A;  2ZEN A;  3KL9 A;  4R7M A;  1Z8L A;  5HVG A;  4A37 A;  2ANP A;  7CPA A;  2QYV A;  3D67 A;  2C1C A;  4NGN A;  1UWY A;  4P4J A;  1ZG8 A;  1LCP A;  4C8U A;  2EK9 A;  3SJX A;  4TJX A;  4A94 A;  3KQX A;  3PEI A;  3KI9 A;  3FEC A;  2PJ6 A;  1R3N A;  3TC8 A;  2G9D A;  3VAT A;  4ZY2 A;  2GLJ A;  5CPA A;  4OC1 A;  4EWT A;  2BOA A;  5THW A;  1ZLH A;  4IK2 A;  3PB4 X;  4NGR A;  4P4E A;  2I3C A;  3N5F A;  3DGV A;  4C9A A;  1TXR A;  4CDK A;  4PQA A;  3L2N A;  3FEE A;  3S9N A;  1Y7E A;  4C9E A;  2PVV A;  3V7Z A;  2V8G A;  4A39 A;  1XFO A;  4A38 A;  3S9M A;  2C6C A;  3B35 A;  2PJ9 A;  2AFO A;  4NJR A;  3PBB A;  3MRU A;  1CBX A;  2HC9 A;  1M4L A;  1Z2L A;  5ELY A;  3FF3 A;  4CDJ A;  5JH9 A;  4P4F A;  4OC5 A;  2EWB A;  4ZYQ A;  4C8C A;  3IIB A;  1VHO A;  3MN8 A;  3CPX A;  3NFZ A;  1BAV A;  3FH4 A;  2V8D A;  2PJ0 A;  1ZLI A;  1XBU A;  4ONW A;  5DS0 A;  2WYR A;  2DEA A;  3D7F A;  1CP6 A;  5HXD A;  1TF9 A;  1XMB A;  2OOT A;  3LMS A;  4YN3 A;  2Q43 A;  1DE4 C;  5K8M A;  3V38 A;  4UIB A;  3EIF A;  1F2O A;  4FWU A;  4BD9 A;  3NH5 A;  3CDX A;  4P4B A;  1QQ9 A;  3D7D A;  3KAS A;  4H2K A;  4LQG A;  4MHN A;  3LWU A;  3PRT A;  1XF1 A;  3B2Y A;  3CPA A;  3PB7 X;  2F8H A;  1F2P A;  1Y0Y A;  2OR4 A;  2ZEL A;  3KR4 A;  3RAM A;  5D29 A;  4IHM A;  3B3W A; 
#chains in the Genus database with same CATH topology
 1CX8 A;  2Z3L A;  4YGO A;  3G3S A;  2QIR A;  1YME A;  3B8G A;  3TCV A;  4P4I A;  4BMH A;  4MCQ A;  4B5P B;  4MCR A;  1HDQ A;  4P44 A;  3VRO A;  2RB7 A;  3H8E A;  3JTK A;  3B3S A;  4X2T A;  4B5P A;  4TJV A;  4PV6 A;  2EK8 A;  4UEF A;  2C6P A;  4XPD B;  3S6G A;  3IWG A;  2VI7 A;  4MY3 A;  1XMT A;  1M4D A;  2WZN A;  5JVL A;  3DR6 A;  4C8T A;  4II9 A;  3CXS A;  2PJ3 A;  5DWM A;  3SHP A;  3T90 A;  4C2Y A;  1AMP A;  4EVY A;  2XPO A;  4NGQ A;  1Z4R A;  2P6E A;  5HVH A;  4NGP A;  4KOX A;  1VGY A;  3JRU A;  5J3X A;  2BEI A;  2EO8 A;  2PJ7 A;  3D66 A;  1ZO0 A;  4UWI A;  1ARL A;  2CXA A;  2PJA A;  1CPS A;  3K9T A;  1ELL P;  4EFD A;  1XE4 A;  3PLF B;  2ZOG A;  4Y49 C;  2HB6 A;  4KLV A;  3EZE A;  2RFH A;  3RNZ A;  2EUI A;  3ISX A;  4EYS A;  3LAC A;  3S6F A;  3D2M A;  4F9U A;  5J1Q A;  3FIX A;  3FX6 A;  4E2A A;  5KTC A;  4KOR A;  4M6I A;  4MHY A;  4C2Z A;  5JGF A;  2PDO A;  2YND A;  1BLL E;  2AJ6 A;  1XOV A;  4M8D A;  3GKR A;  2PJC A;  3D7H A;  2G3A A;  1PU9 A;  1R43 A;  1RTQ A;  1FT7 A;  3IEH A;  3RO0 A;  2YJV A;  2P0W A;  2ZXV A;  4WJB A;  4QVT A;  1ZL0 A;  1NMT A;  5IX3 A;  3W91 A;  3ZNI A;  3B3T A;  1TKJ A;  2I00 A;  2EZB A;  1YR0 A;  2O28 A;  2PVW A;  2VKZ G;  1YX0 A;  1VI4 A;  2V8H A;  2Q51 A;  2C6G A;  4UCP A;  3TOA A;  2R8V A;  5C82 A;  5HKZ A;  4PXB A;  4UA3 A;  5K8P A;  4AVA A;  2ZEF A;  4HKF A;  4C85 A;  3EY5 A;  2OZG A;  1KWM A;  3KGQ A;  4TWE A;  5K99 A;  1N71 A;  5F49 A;  1QSO A;  4EME A;  2Q7S A;  5HKW A;  1YW4 A;  3I3G A;  4LX9 A;  3T05 A;  4PSW A;  3GY9 A;  3S6K A;  3F9K C;  3T8W A;  3E0K A;  3TLG A;  1Z8W A;  3DLJ A;  1Z8T A;  2FVG A;  3D2P A;  3NOJ A;  3FBU A;  5I4M A;  1DTD A;  1Y0R A;  3KKW A;  1FY7 A;  4OIW A;  5C88 A;  1S3Z A;  2Y1M A;  2J8R A;  3IJ3 A;  4G1P A;  4MHP A;  2YJT A;  4AVB A;  2IQ6 A;  2ZW4 A;  2ABZ A;  3D68 A;  1NSL A;  2V77 A;  1LAP A;  4B11 A;  3VWE A;  1S7L A;  4BPX B;  3S9L A;  2P6F A;  3P2F A;  4PSX A;  2XPP A;  3TOB A;  2WPW A;  4KVO E;  4CRZ B;  1CJW A;  2NYQ A;  1YW6 A;  2V8V A;  3H4Q A;  1OBR A;  4R3L A;  1UFH A;  2C27 A;  3DR8 A;  4MRI A;  4OC3 A;  2G3T A;  2B3U A;  4OC0 A;  3FXT A;  3B7I A;  4M6G A;  4NF1 A;  4UFW A;  4INJ A;  4C9V A;  4C9R A;  3WT4 A;  2D4P A;  1P4N A;  1Z4E A;  4CGN A;  2PCU A;  1TKF A;  1XJO A;  2BCO A;  1J4J A;  1M1D A;  2Z3N A;  3DDD A;  4TNU A;  4UF4 A;  2OU2 A;  2PC1 A;  2ZPA A;  2ZEH A;  2PIZ A;  2ZEP A;  8CPA A;  3BJ8 A;  1AUG A;  5LYI A;  1I21 A;  4KSF A;  3EFA A;  3C26 A;  4NXY A;  1IB1 E;  4RI1 A;  4J3G A;  3RBU A;  2HI6 A;  2Z11 A;  1A9X B;  1YK3 A;  2CIJ A;  1VHE A;  3F0A A;  4ZX8 A;  2ATR A;  2EZA A;  1VBH A;  3NA6 A;  2RC4 A;  3RZA A;  2WSA A;  4YWY A;  2HRO A;  2PJ8 A;  4RUH A;  2CF4 A;  3HPH E;  2ZEE A;  4MHZ A;  4NGT A;  4XNH C;  3OWC A;  1QST A;  4DJL A;  5A27 A;  5F47 A;  4KS9 A;  4OLL A;  4R8F A;  3FMC A;  3NFQ A;  1Q7L A;  2IMO A;  3BI0 A;  2BL1 A;  2PJB A;  3C8O A;  5AG6 A;  4OKO A;  1F57 A;  2NSM A;  2PR8 A;  1Z9E A;  1TKH A;  3GUX A;  2OB0 A;  3PGP A;  3R9F A;  4Z65 A;  3GIU A;  3PB6 X;  4FD4 A;  3R9G A;  3OB2 B;  4NGM A;  1FNO A;  2FXF A;  4CAW A;  1CG2 A;  3EZA A;  5G22 A;  5IV0 A;  5G1Z A;  4AXV A;  1GYT A;  1MJB A;  4MFQ A;  3I1U A;  1GGO A;  4C86 A;  1QMU A;  4RR2 B;  4MCP A;  4A31 A;  3VRQ A;  1YVK A;  4FBE A;  3WC5 A;  4E5S A;  1Y9Z A;  5D8N A;  1WWZ A;  2FIA A;  4XNH B;  4DNC A;  4UFX A;  4CGL A;  3TO7 A;  3IU1 A;  4FAI A;  2VZZ A;  5AG5 A;  2X7B A;  3F8K A;  5DWN A;  4C7I A;  2YNC A;  4CZ1 A;  4UEZ A;  1B6B A;  2KCW A;  4GM5 A;  5G21 A;  2POK A;  1ZG9 A;  4OP4 A;  5BWA B;  3K2K A;  3TLC A;  2B4D B;  2WPX A;  2B4D A;  3I74 A;  3LOD A;  2PRB A;  5AGE A;  4XPD C;  1LAN A;  4J0N A;  4LUA A;  3GYA A;  4MFJ A;  1VBG A;  3HMJ G;  4JWP A;  4R76 A;  4K30 A;  4L8A A;  2ZEM A;  1WVM A;  4CYO A;  2D0O A;  2PRQ A;  4PXE A;  4IIY A;  5LRG A;  1KBL A;  1YVO A;  1NXJ A;  2YGW A;  2AFU A;  3KZW A;  4QC6 A;  2B4B A;  1V6C A;  1AYE A;  4NEX A;  4E0A A;  1H8L A;  1IID A;  1KUY A;  2ZW5 A;  3WAB A;  2P6G A;  4O23 A;  3JUW A;  4ZX9 A;  1BO4 A;  1PYT B;  2ZOF A;  4NCZ A;  3SI2 A;  3NE7 A;  1CP7 A;  3IFE A;  2B58 A;  2PJ2 A;  4RS2 A;  2VXK A;  5F46 A;  1Y9W A;  3ISZ A;  4ORF A;  4P10 A;  3U88 C;  3BXM A;  4CAF A;  4ZBG A;  1Z5R A;  2JDD A;  2JEW A;  2ODF A;  1IY7 A;  3PB8 X;  3PBE A;  2JBK A;  4JXQ A;  4JD6 A;  4PXC A;  4E8O A;  4NJQ A;  1IYL A;  3NE8 A;  2R1I A;  4M6H A;  4OAD A;  4F9V A;  1MJ9 A;  4F6A A;  4C8P A;  4GPL B;  1XIX A;  1CS0 B;  2PR1 A;  2AFS A;  1DIK A;  3TLA A;  2R98 A;  4UEE A;  4UIA A;  1M4I A;  4KUB A;  4WWV A;  3TYX A;  1C30 B;  4MI4 A;  4ONU A;  1S7K A;  1BPM A;  3B3C A;  2CNM A;  3DNS A;  4IF5 A;  4B10 A;  3PFE A;  3SXO A;  3D3S A;  4BBH A;  3IWE A;  4PK3 A;  4QBJ A;  3TLB A;  2BO9 A;  2O4H A;  4P4D A;  4KNG E;  3FJU A;  3KRV A;  3BLN A;  1JDE A;  2D4O A;  4F0Y A;  5KTD A;  1JQG A;  4ZI6 A;  1IOI A;  2FM4 A;  3VRR A;  3BUM B;  4BPW B;  1EE3 P;  4DUK A;  5AG4 A;  4BPU B;  1CPX A;  4CAV A;  4MHD A;  4B12 A;  2AFX A;  3BI1 A;  4OC2 A;  1MK4 A;  3CT9 A;  4NSQ A;  2BUE A;  5CBM A;  4KSI A;  3IC1 A;  4PXD A;  3EZB A;  4NFR A;  1S5K A;  3IGR A;  1EZB A;  4CRY B;  3LD2 A;  3OAK A;  4CGO A;  4X8I A;  4FD7 A;  4E94 A;  5F09 A;  4RN7 A;  4CPA A;  4DYO A;  2J8M A;  3VH9 A;  3TLG B;  2GLF A;  2HUZ A;  2JLM A;  4F8Z A;  3FVL A;  3TX8 A;  4JLY A;  4R57 A;  3TLY A;  4B6Z A;  4MFK A;  2C5Q A;  2Q04 A;  2AFW A;  2WUU A;  1Y7R A;  3T0T A;  3D4U A;  3FB3 A;  3PFO A;  4CAE A;  2EZC A;  3SJF A;  3VAR A;  3VRP A;  2CNT A;  2XEI A;  5GCN A;  1L0C A;  2QJ8 A;  4K3N A;  4UCM A;  2PE3 A;  1ELM P;  2GP4 A;  4Q36 A;  1T36 B;  3H5Z A;  2VQY A;  3JVN A;  1HDU A;  1YSJ A;  2GRE A;  3BUO B;  3VGO A;  1A2Z A;  1M4G A;  2FE7 A;  2Q44 A;  3GLJ A;  3O8Z A;  4HNY B;  1BXR B;  5LYF A;  5FVJ A;  3PFV A;  4NGS A;  4GS4 A;  4QUS A;  4A33 A;  3CZX A;  3H8F A;  2R82 A;  1OZP A;  2GU2 A;  5HKY A;  3A9L A;  3CXQ A;  4CYP A;  4C9U A;  3TLZ A;  4P45 A;  3D7G A;  1QSM A;  3IWW A;  3NH4 A;  1IYK A;  2CNS A;  4JYW A;  2AE6 A;  2AFM A;  2QEC A;  3T9Y A;  1NSA A;  4MMO A;  3SI0 A;  3W6X A;  1ZRS A;  1B47 A;  1MJA A;  2ZEG A;  2PJ1 A;  4AB7 A;  1LAM A;  1YLO A;  1YGH A;  3HUV A;  2E28 A;  4PPZ A;  3SR3 A;  2IJZ A;  2ZED A;  2DPS A;  4Q7A A;  4R6T A;  3SXN A;  1XEB A;  3OP0 A;  2PJ5 A;  5EMI A;  1X12 A;  1NBW A;  5LRK A;  2UV8 G;  1I1D A;  3KQZ A;  4JZ0 A;  2QVP A;  2VEZ A;  2ZW7 A;  4MJ8 A;  2JDC A;  2J9A A;  4OID A;  2DF5 A;  5LRJ A;  3R96 A;  3TO6 A;  2O53 A;  2OLS A;  3D8P A;  2YNC C;  2OH1 A;  1I12 A;  1ZYM A;  2FCK A;  1YRE A;  4C99 A;  3HPG G;  3SI1 A;  1VIX A;  1S60 A;  2Y0M A;  3QAY A;  5HH1 A;  1Z9U A;  5LYD A;  1YVH A;  1LOK A;  4A30 A;  3PP9 A;  4FD6 A;  5E96 A;  5JM6 A;  1EZA A;  2Z10 A;  4CGP A;  1K4J A;  4X5K A;  4MY0 A;  3WC6 A;  4MBU A;  2HWG A;  3W6S A;  5KTA A;  4MXU A;  5JQ4 A;  4B14 A;  3VTA A;  2AFZ A;  4COG A;  4UWJ A;  3ZZI A;  4MI1 A;  1WJT A;  3BHX A;  5K8N A;  1XF8 A;  5LYL A;  4FUU A;  2J8N A;  2F7V A;  4KOY A;  3SJG A;  1TF8 A;  1JDB C;  4C8A A;  2GIV A;  2AUN A;  4P6Y A;  2XPL A;  3PB9 X;  4IAV A;  1LFW A;  2ZEO A;  3VRN A;  4OME A;  3QNV A;  4COB A;  2XEG A;  2IL4 A;  2B3V A;  5IB0 A;  3I6S A;  1QSR A;  1VHS A;  6CPA A;  2VZY A;  2DPT A;  3R9E A;  5K8O A;  2CBL A;  4MJX A;  3HLP A;  1Q2C A;  3IO1 A;  5CNP A;  3WR7 A;  2XEJ A;  1XRY A;  3KHZ A;  5IB9 A;  5IR2 A;  2CY2 A;  4AG9 A;  2DIK A;  1J3L A;  2JBJ A;  4MCS A;  1TIQ A;  3WC7 A;  2XEF A;  1HEE A;  3TLE A;  4W9Y A;  2REE A;  3KHX A;  2F5I A;  1ZG7 A;  3QB8 A;  3TT2 A;  3TTH A;  2Z3P A;  5AXI A;  4HPS A;  2HV2 A;  4C8F A;  1X10 A;  2EVN A;  4CYQ A;  4L89 A;  1Q5X A;  2BSW A;  2VL1 A;  5HVF A;  1R57 A;  4BTF A;  2Z3O A;  4A4C A;  2ZW6 A;  4KOS A;  1P0H A;  4KUA A;  4Q38 A;  4ZGY B;  4X3R A;  4M3S A;  4ZY0 A;  2Q4Z A;  4H1H A;  1IGB A;  1YLE A;  2OZU A;  4F0X A;  5F5X A;  4C8C A;  4ZY1 A;  1Z8X A;  2CTC A;  4YU9 A;  1PCA A;  2PIY A;  1BPN A;  4AG7 A;  4OC4 A;  1ARM A;  1V0C A;  4KOT A;  1KZF A;  3TO9 A;  3NH8 A;  3FED A;  2PJ4 A;  4KVM E;  3EXN A;  4MFP A;  2Q4V A;  3SJE A;  3P2H A;  4C84 A;  5JPH A;  3ICU A;  3GB0 A;  3H8G A;  5EC4 A;  4IIX A;  5FD8 A;  2CTB A;  3KR5 A;  3B3V A;  1B87 A;  3DSB A;  1KUV A;  1U6M A;  2ZEN A;  1M44 A;  4YRH A;  1CE8 B;  5AG7 A;  3KL9 A;  4R7M A;  2AUM A;  1Z8L A;  5HVG A;  4A37 A;  2ANP A;  7CPA A;  2N3A B;  2QYV A;  4B5O A;  3D67 A;  2C1C A;  4U9Y A;  4NGN A;  1UWY A;  2FT0 A;  5H86 A;  2FIW A;  4P4J A;  4C68 A;  1ZG8 A;  1LCP A;  4C8U A;  2Q4Y A;  2EK9 A;  1VKC A;  2Y1N A;  3SJX A;  3ZJ0 A;  3TE4 A;  4TJX A;  4A94 A;  3KQX A;  3U1B A;  3PEI A;  4BIN A;  3KI9 A;  3FEC A;  2PJ6 A;  3K9U A;  4M85 A;  5ISV A;  1R3N A;  1SQH A;  4R9M A;  3TC8 A;  2G9D A;  2K5T A;  3BUN B;  2DXQ A;  4QB9 A;  3VAT A;  1ON0 A;  4ZY2 A;  3G23 A;  1CM0 A;  3IU2 A;  4A32 A;  2GLJ A;  5CPA A;  4OC1 A;  4EWT A;  2PCN A;  2BOA A;  2GE3 A;  1ZLH A;  2Z3M A;  5THW A;  2R7H A;  1WK4 A;  1M6V B;  4IK2 A;  3PB4 X;  1NE9 A;  4KLW A;  4NGR A;  4Y49 B;  4P4E A;  3G8W A;  2I3C A;  1RXT A;  3N5F A;  4JVO A;  5J8C A;  5EBV A;  3DGV A;  4C9A A;  4UFV A;  2G0B A;  5G20 A;  1KEE B;  4H6Z A;  1TXR A;  3FNC A;  4CDK A;  4PQA A;  3PT1 A;  4JXR A;  3BJ7 A;  2PSW A;  3L2N A;  3FEE A;  3S9N A;  1Y7E A;  4C9E A;  5F1Y A;  4KOV A;  2QML A;  2PVV A;  2XPN A;  2FL4 A;  2YNE A;  3R1K A;  1FBV A;  4IUS A;  2Q7B A;  3V7Z A;  1Y9K A;  2V8G A;  5F9M A;  1GHE A;  5F48 A;  4A39 A;  4A95 A;  1XFO A;  4A38 A;  3S9M A;  4C7H A;  4YFJ A;  3GJZ A;  1R61 A;  1IU8 A;  2C6C A;  3MGD A;  3B35 A;  2PJ9 A;  2AFO A;  4NJR A;  3PBB A;  4CS0 B;  4CYN A;  1RO5 A;  4U9Z A;  3UY5 A;  4OAE A;  3TFY A;  3MRU A;  1CBX A;  2GAN A;  2HC9 A;  3FRM A;  4KVX A;  3EO4 A;  3OB1 B;  1M4L A;  2D0P A;  2NMT A;  1BOB A;  1Z2L A;  4A2Z A;  4U5Y A;  1EO0 A;  4CO9 A;  5ELY A;  3FF3 A;  5F13 A;  4KOU A;  4GXH A;  4CDJ A;  5JYB A;  3K4I A;  2DLA A;  4H6U A;  5JH9 A;  4P4F A;  4OC5 A;  2EWB A;  4KOW A;  4R3K A;  3IIB A;  1VHO A;  4CAX A;  3MN8 A;  4ZYQ A;  1JWQ A;  1Q2Y A;  3CPX A;  3NFZ A;  1BAV A;  3FH4 A;  2V8D A;  4A4B A;  1ZLI A;  2PJ0 A;  1XBU A;  4ONW A;  2I79 A;  4FD5 A;  3N7Z A;  4PK2 A;  5I0C A;  5DS0 A;  4C2X A;  2ARH A;  2WYR A;  2DEA A;  3D7F A;  1CP6 A;  4R87 A;  5HXD A;  1TF9 A;  4XPK A;  1YQE A;  2X0S A;  1S7F A;  4MFZ A;  4HNX B;  1XMB A;  2OOT A;  2EBJ A;  4H89 A;  3LMS A;  4YN3 A;  3I9S A;  2Q43 A;  5H84 A;  1DE4 C;  5K8M A;  1KUX A;  4HNW B;  4UIB A;  3V38 A;  1C3O B;  3QAH A;  2B0A A;  2JEV A;  4KSA A;  2VBQ A;  5A28 A;  4UCN A;  3EIF A;  3CXP A;  3T5M A;  2B4J C;  1F2O A;  3PZJ A;  2B5G B;  2B5G A;  3FYN A;  4I49 A;  1PUA A;  5J8F A;  3R95 A;  4FWU A;  4AVC A;  4BD9 A;  5BY0 A;  3CDX A;  2Z0Z A;  3NH5 A;  4P4B A;  1QQ9 A;  3D7D A;  1S7N A;  1IIC A;  3KAS A;  2Z3K A;  2H5M A;  4H2K A;  2GFQ A;  4LQG A;  4MHN A;  5HMN A;  2A4N A;  4LQ6 A;  3S6H A;  3LWU A;  3PRT A;  4MFL A;  4XPL A;  2HQY A;  3EC4 A;  3V8I A;  4CGM A;  1XF1 A;  1LRZ A;  3B2Y A;  3CPA A;  3PB7 X;  3RYO A;  4B13 A;  1Q2D A;  3F5B A;  2PQ8 A;  2F8H A;  1QSN A;  1Y0Y A;  1F2P A;  2REF A;  2OR4 A;  2Q0Y A;  2ZEL A;  4JJX A;  3KR4 A;  3T07 A;  2OZH A;  3RAM A;  1KC7 A;  3BUX B;  4KZT A;  5D29 A;  2FS5 A;  4UBR A;  2FSR A;  4IHM A;  1IOF A;  3VWD A;  3BUW B;  3B3W A;  2MP0 A; 
#chains in the Genus database with same CATH homology
 1CX8 A;  1YME A;  4P4I A;  4MCQ A;  4MCR A;  1HDQ A;  4P44 A;  2RB7 A;  3H8E A;  4TJV A;  3B3S A;  4X2T A;  2EK8 A;  4UEF A;  2C6P A;  2WZN A;  4C8T A;  2PJ3 A;  1AMP A;  4NGQ A;  5HVH A;  4NGP A;  1VGY A;  3JRU A;  2PJ7 A;  3D66 A;  1ARL A;  2PJA A;  1CPS A;  3K9T A;  1ELL P;  4EFD A;  2ZOG A;  2HB6 A;  2RFH A;  3ISX A;  4F9U A;  5J1Q A;  3FX6 A;  4MHY A;  5JGF A;  1BLL E;  2PJC A;  3D7H A;  3IEH A;  1RTQ A;  1R43 A;  1FT7 A;  4WJB A;  3B3T A;  1TKJ A;  2PVW A;  2V8H A;  2Q51 A;  2C6G A;  4PXB A;  5K8P A;  2ZEF A;  4C85 A;  3KGQ A;  1KWM A;  4TWE A;  4EME A;  1YW4 A;  3T8W A;  3DLJ A;  2FVG A;  5I4M A;  1DTD A;  1Y0R A;  4OIW A;  4MHP A;  3IJ3 A;  4G1P A;  2IQ6 A;  2ABZ A;  3D68 A;  2V77 A;  1LAP A;  3S9L A;  5LYF A;  2NYQ A;  1YW6 A;  2V8V A;  1OBR A;  4MRI A;  4OC3 A;  4C9R A;  4OC0 A;  3B7I A;  4C9V A;  3WT4 A;  2PCU A;  1TKF A;  1XJO A;  2BCO A;  4TNU A;  4UF4 A;  2ZEH A;  2PIZ A;  2ZEP A;  8CPA A;  5LYI A;  3RBU A;  2CIJ A;  1VHE A;  4ZX8 A;  3NA6 A;  3RZA A;  4YWY A;  2PJ8 A;  4RUH A;  2CF4 A;  2ZEE A;  4MHZ A;  4NGT A;  4DJL A;  4R8F A;  3FMC A;  2IMO A;  2PJB A;  1Q7L A;  3BI0 A;  4OKO A;  1F57 A;  2NSM A;  1TKH A;  3GUX A;  4Z65 A;  3PB6 X;  4NGM A;  1FNO A;  1CG2 A;  4AXV A;  1GYT A;  4C86 A;  3I1U A;  1QMU A;  4MCP A;  4FBE A;  3WC5 A;  1Y9Z A;  5D8N A;  4FAI A;  4UEZ A;  4GM5 A;  2POK A;  1ZG9 A;  4OP4 A;  3K2K A;  3I74 A;  1LAN A;  4R76 A;  2ZEM A;  1WVM A;  2PRQ A;  4PXE A;  5LRG A;  2AFU A;  3KZW A;  1V6C A;  1AYE A;  1H8L A;  3WAB A;  4O23 A;  4ZX9 A;  1PYT B;  2ZOF A;  3SI2 A;  1CP7 A;  3IFE A;  2PJ2 A;  3ISZ A;  4P10 A;  3BXM A;  1Z5R A;  2JEW A;  1IY7 A;  3PB8 X;  3PBE A;  2JBK A;  4PXC A;  4NJQ A;  4F9V A;  4C8P A;  2AFS A;  4UEE A;  4UIA A;  4WWV A;  1BPM A;  3B3C A;  3PFE A;  2BO9 A;  2O4H A;  4P4D A;  4KNG E;  3FJU A;  1JQG A;  4ZI6 A;  1EE3 P;  4DUK A;  1CPX A;  2AFX A;  3BI1 A;  4OC2 A;  3CT9 A;  5CBM A;  4KSI A;  3IC1 A;  4PXD A;  4NFR A;  4X8I A;  5F09 A;  4DYO A;  4CPA A;  3VH9 A;  2GLF A;  4F8Z A;  3FVL A;  3TX8 A;  4B6Z A;  2C5Q A;  2AFW A;  3D4U A;  3PFO A;  3SJF A;  3VAR A;  2XEI A;  2QJ8 A;  4K3N A;  2PE3 A;  1ELM P;  2GP4 A;  1HDU A;  1YSJ A;  2GRE A;  3GLJ A;  4NGS A;  3H8F A;  2GU2 A;  4C9U A;  4P45 A;  3D7G A;  3IWW A;  3NH4 A;  4JYW A;  2AFM A;  1NSA A;  4MMO A;  3SI0 A;  2ZEG A;  2PJ1 A;  1LAM A;  1YLO A;  3HUV A;  4PPZ A;  2IJZ A;  2ZED A;  4Q7A A;  4R6T A;  2PJ5 A;  5LRK A;  3KQZ A;  4JZ0 A;  2QVP A;  5LRJ A;  2J9A A;  4OID A;  2O53 A;  4C99 A;  3SI1 A;  1VIX A;  5LYD A;  1LOK A;  5JM6 A;  3WC6 A;  3VTA A;  4MXU A;  2AFZ A;  5K8N A;  3BHX A;  5LYL A;  4FUU A;  2F7V A;  3SJG A;  1TF8 A;  4C8A A;  4P6Y A;  3PB9 X;  4IAV A;  1LFW A;  2ZEO A;  4OME A;  3QNV A;  2XEG A;  3I6S A;  6CPA A;  5K8O A;  3HLP A;  3IO1 A;  2XEJ A;  1XRY A;  3KHZ A;  5IB9 A;  5IR2 A;  2JBJ A;  4MCS A;  3WC7 A;  2XEF A;  1HEE A;  4W9Y A;  3KHX A;  1ZG7 A;  4C8F A;  2VL1 A;  5HVF A;  4ZY0 A;  4X3R A;  2Q4Z A;  1IGB A;  4ZY1 A;  2CTC A;  4YU9 A;  1PCA A;  2PIY A;  1BPN A;  4OC4 A;  1ARM A;  3NH8 A;  3FED A;  2PJ4 A;  3SJE A;  4C84 A;  3ICU A;  3GB0 A;  3H8G A;  2CTB A;  3KR5 A;  3B3V A;  2ZEN A;  3KL9 A;  4R7M A;  1Z8L A;  5HVG A;  4A37 A;  2ANP A;  7CPA A;  2QYV A;  3D67 A;  2C1C A;  4NGN A;  1UWY A;  4P4J A;  1ZG8 A;  1LCP A;  4C8U A;  2EK9 A;  3SJX A;  4TJX A;  4A94 A;  3KQX A;  3PEI A;  3KI9 A;  3FEC A;  2PJ6 A;  1R3N A;  3TC8 A;  2G9D A;  3VAT A;  4ZY2 A;  2GLJ A;  5CPA A;  4OC1 A;  4EWT A;  2BOA A;  5THW A;  1ZLH A;  4IK2 A;  3PB4 X;  4NGR A;  4P4E A;  2I3C A;  3N5F A;  3DGV A;  4C9A A;  1TXR A;  4CDK A;  4PQA A;  3L2N A;  3FEE A;  3S9N A;  1Y7E A;  4C9E A;  2PVV A;  3V7Z A;  2V8G A;  4A39 A;  1XFO A;  4A38 A;  3S9M A;  2C6C A;  3B35 A;  2PJ9 A;  2AFO A;  4NJR A;  3PBB A;  3MRU A;  1CBX A;  2HC9 A;  1M4L A;  1Z2L A;  5ELY A;  3FF3 A;  4CDJ A;  5JH9 A;  4P4F A;  4OC5 A;  2EWB A;  4ZYQ A;  4C8C A;  3IIB A;  1VHO A;  3MN8 A;  3CPX A;  3NFZ A;  1BAV A;  3FH4 A;  2V8D A;  2PJ0 A;  1ZLI A;  1XBU A;  4ONW A;  5DS0 A;  2WYR A;  2DEA A;  3D7F A;  1CP6 A;  5HXD A;  1TF9 A;  1XMB A;  2OOT A;  3LMS A;  4YN3 A;  2Q43 A;  1DE4 C;  5K8M A;  3V38 A;  4UIB A;  3EIF A;  1F2O A;  4FWU A;  4BD9 A;  3NH5 A;  3CDX A;  4P4B A;  1QQ9 A;  3D7D A;  3KAS A;  4H2K A;  4LQG A;  4MHN A;  3LWU A;  3PRT A;  1XF1 A;  3B2Y A;  3CPA A;  3PB7 X;  2F8H A;  1F2P A;  1Y0Y A;  2OR4 A;  2ZEL A;  3KR4 A;  3RAM A;  5D29 A;  4IHM A;  3B3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...