4X3RA

Avi-gcpii structure in complex with fitc-conjugated gcpii-specific inhibitor
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
690
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of highly potent urea-based, exosite-binding inhibitors selective for glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 261
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4x3rA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x3rA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4x3rA02
3VTAA 1ZLIA 3FX6A 4ZX8A 1KWMA 4OKOA 4C85A 2CIJA 3S9NA 3KHXA 1FNOA 4B6ZA 2JBJA 3IEHA 3PFEA 4TWEA 2Q51A 2ZEPA 2AFUA 5HXDA 2EK8A 4C9RA 4P4EA 2CTCA 1H8LA 4Q7AA 2XEIA 3FH4A 4TJVA 2PJ8A 4NFRA 4CDJA 3SI2A 2PIZA 4EMEA 1Z2LA 4P44A 4NGNA 4F8ZA 3S9LA 4DUKA 1Y9ZA 2ZELA 1LOKA 2WZNA 2AFZA 4P4IA 4NGPA 3VH9A 4PXDA 4C84A 4IK2A 4ZY0A 1CX8A 3GB0A 3PB6X 4FWUA 3N5FA 3H8FA 2ZOGA 2V8GA 3JRUA 3PB9X 3RZAA 2O4HA 4MCPA 2FVGA 3WC6A 1PCAA 4A39A 4PXEA 4MCSA 3B3VA 2QVPA 3CPXA 1TF8A 2AFXA 1F2PA 4CDKA 1CPSA 3IC1A 3KL9A 5CBMA 2ZEOA 3B2YA 3FMCA 3IO1A 4P45A 4MHPA 2HB6A 2PJ7A 4FBEA 1ARMA 3MRUA 3CT9A 3B3TA 4EWTA 2C6PA 2PIYA 1YLOA 2O53A 3PB7X 3NH8A 3KZWA 3KQXA 4MHNA 4NGTA 2PCUA 3FJUA 5LYDA 2C6GA 4OC5A 2HC9A 2AFSA 5D29A 2ZEDA 3I74A 1JQGA 1DE4C 1Z5RA 4BD9A 3SI1A 2PVVA 1UWYA 3GUXA 3NA6A 4OC4A 1AYEA 4JZ0A 1CPXA 1DTDA 3FVLA 1ZG7A 1IY7A 4CPAA 1Y0RA 5ELYA 5HVFA 1YMEA 3K2KA 4NGSA 4RUHA 4H2KA 4C99A 1ARLA 2IQ6A 3ICUA 4UIAA 3MN8A 1QQ9A 4IAVA 1TF9A 1XF1A 1R3NA 1CP7A 4C9AA 1M4LA 2C1CA 3NH5A 1HEEA 4LQGA 3FEEA 2JBKA 1F57A 1TKFA 4P4FA 3KHZA 5LYFA 4NGRA 3PBBA 3EIFA 4C9VA 2OR4A 4TNUA 4F9VA 1LCPA 2POKA 2XEJA 2PE3A 2Q4ZA 3DGVA 4C8FA 1WVMA 1BPNA 1PYTB 3T8WA 1NSAA 4P4DA 2QYVA 5LYLA 5THWA 4PXBA 2EWBA 1YW6A 1FT7A 3KGQA 4UIBA 4MHZA 4P4JA 5K8NA 1V6CA 2ANPA 2CTBA 2ZEMA 4P6YA 3V7ZA 3I6SA 4GM5A 3TC8A 4YU9A 4AXVA 3HUVA 4UEFA 3VATA 3B35A 2ZENA 3CPAA 5JM6A 5D8NA 1TKJA 2VL1A 1ZLHA 1LANA 3B7IA 2PJ5A 2AFMA 1Z8LA 4A37A 1HDQA 4P10A 2V8VA 3D67A 5DS0A 1Y7EA 4ZI6A 2ZEFA 4UEEA 4WJBA 3D4UA 3S9MA 3D7FA 4IHMA 3WABA 4OC0A 2GLFA 5K8OA 4NJRA 2AFOA 4NJQA 5J1QA 1XFOA 3KASA 3BI1A 4PPZA 3IFEA 2PJ2A 4ZYQA 2PVWA 3KI9A 2PJ4A 3D66A 4FAIA 4UF4A 2Q43A 3ISZA 4MMOA 1HDUA 4UEZA 1LFWA 2C6CA 4R7MA 1R43A 1ZG8A 5LRKA 1ZG9A 3SJEA 1VGYA 3BHXA 7CPAA 5JH9A 1XMBA 5IB9A 4W9YA 4A38A 4OMEA 4EFDA 4PQAA 3QNVA 1VIXA 4ONWA 2V8HA 4KSIA 3GLJA 1LAPA 4MHYA 3SJGA 2IMOA 3TX8A 3B3WA 4JYWA 3KR5A 1XBUA 3IWWA 1CP6A 2PJBA 3SJFA 1YW4A 2F8HA 3RAMA 4MCRA 1QMUA 2ZEEA 3VARA 3PB8X 2V8DA 3D7HA 5HVGA 3IJ3A 4C9UA 3FEDA 3PFOA 4Z65A 5K8MA 1BLLE 4DYOA 1CG2A 5F09A 3I1UA 4F9UA 1LAMA 4C9EA 1F2OA 2XEFA 2V77A 4K3NA 3NFZA 3RBUA 2I3CA 2PJ3A 4ZY1A 3SJXA 4YN3A 4ZX9A 2ZEGA 1Y0YA 2PJAA 3B3CA 5LYIA 1ELLP 8CPAA 4R8FA 3HLPA 3BXMA 4FUUA 3KQZA 3PBEA 4MCQA 3DLJA 3PRTA 4G1PA 1VHOA 2OOTA 2AFWA 3CDXA 2ZOFA 3LMSA 3D68A 2JEWA 5HVHA 3IIBA 2PJ1A 3SI0A 2DEAA 3H8GA 5LRGA 4MXUA 2NSMA 4TJXA 4YWYA 1XRYA 2BOAA 4C8CA 3L2NA 4R76A 2BO9A 2CF4A 4DJLA 2RFHA 1BPMA 2RB7A 2GU2A 3PB4X 2PJ6A 4OIWA 2QJ8A 1ELMP 2PJ0A 3WC7A 3KR4A 2PJCA 3BI0A 1Q7LA 4OIDA 2GLJA 4O23A 2IJZA 3B3SA 4C8TA 2EK9A 1TKHA 2GREA 4PXCA 2BCOA 2PRQA 4P4BA 1EE3P 2XEGA 3WT4A 2WYRA 5CPAA 4R6TA 3LWUA 3D7GA 1AMPA 3V38A 4C86A 1RTQA 2PJ9A 4A94A 4OC3A 4OC1A 5JGFA 4OC2A 2ABZA 4C8AA 1TXRA 3FECA 1XJOA 1VHEA 4X2TA 4NGQA 1IGBA 2J9AA 4KNGE 5LRJA 4OP4A 3WC5A 1CBXA 3D7DA 4WWVA 4C8UA 3H8EA 1GYTA 4ZY2A 1OBRA 2ZEHA 4NGMA 2NYQA 4X3RA 2G9DA 6CPAA 5I4MA 2F7VA 3FF3A 3PEIA 4C8PA 4MRIA 5K8PA 3ISXA 3K9TA 4X8IA 3NH4A 1BAVA 1YSJA
chains in the Genus database with same CATH superfamily
3VTAA 1ZLIA 1Z8TA 3FX6A 1KWMA 4OKOA 5F47A 4ZX8A 3IWEA 4CGMA 4KLWA 2CIJA 3T07A 4C85A 3S9NA 3KHXA 1MJBA 1FNOA 3PT1A 1YVKA 2XPPA 4B6ZA 3KRVA 2JBJA 2YGWA 3IEHA 3PFEA 2B0AA 2Y1MA 2B4DA 4TWEA 5DWNA 2Q51A 1YK3A 2ZEPA 2Z11A 1JDBC 1Z8WA 1PUAA 2JDDA 2AFUA 2Q4VA 4ZGYB 5HXDA 4KSAA 2EK8A 5C82A 4C9RA 3NOJA 2BEIA 1ON0A 1IOFA 3BUXB 1B87A 3SXOA 5KTCA 2N3AB 3TE4A 4P4EA 2CTCA 3EFAA 1H8LA 1QSOA 4Q7AA 2XEIA 1CM0A 3FH4A 4TJVA 1SQHA 2PJ8A 4NFRA 4KVME 4CDJA 2Z10A 2FM4A 3SI2A 4KLVA 2DPSA 2PIZA 2ZW7A 1Z2LA 4C68A 4EMEA 5AG6A 4KOXA 4P44A 5IX3A 1ZYMA 4NGNA 3ZNIA 2VEZA 3S9LA 4F8ZA 2R7HA 4DUKA 4BPXB 4Y49C 1Y9ZA 4XPDC 2ZELA 1LOKA 1QSMA 4PSXA 4RN7A 1KUVA 2WZNA 2AFZA 4EVYA 4P4IA 2B5GB 2Z3PA 4NGPA 3VH9A 2EZBA 4MFQA 4PXDA 1QSTA 4HKFA 4C84A 4IK2A 4ZY0A 3ZJ0A 5GCNA 1KZFA 5I0CA 1CX8A 3GB0A 1Q5XA 3PB6X 2EZCA 2X7BA 4MJXA 3H4QA 2WUUA 4FWUA 1GGOA 3EY5A 3H8FA 2ZOGA 3N5FA 4AG7A 2V8GA 3JRUA 1X10A 3PB9X 2GANA 2C27A 3RZAA 4CS0B 2O4HA 4MCPA 4UCPA 4KVXA 2FVGA 4BMHA 2FSRA 3HPHE 3WC6A 1PCAA 4M6HA 5AG5A 4A39A 4JWPA 2XPLA 3TLEA 4PXEA 4NF1A 3JTKA 4MCSA 1S7LA 2FS5A 3K9UA 1EZBA 3B3VA 1PU9A 4CYQA 1P0HA 2A4NA 2QVPA 3CPXA 3R9FA 4CYPA 1TF8A 2AFXA 1F2PA 1GHEA 4CDKA 5JYBA 1CPSA 3T05A 3IC1A 5HH1A 1Z9EA 2Y1NA 3S6HA 3KL9A 2PDOA 1MJAA 5CBMA 2B4BA 5K99A 2ZEOA 1T36B 3B2YA 3T5MA 2OU2A 1BOBA 4HNYB 4KOUA 3FMCA 2KCWA 3G3SA 4FD4A 4DNCA 4F6AA 5IB0A 2AUNA 3IO1A 2Y0MA 2DF5A 4P45A 4MHPA 4MY0A 2HB6A 5FVJA 4CAEA 2PJ7A 1S7NA 3EZAA 4FBEA 1ARMA 3MRUA 1FBVA 3S6GA 3WR7A 2GIVA 3PLFB 3TO7A 2WSAA 3CT9A 5BWAB 3B3TA 4EWTA 2BL1A 2CNSA 2C6PA 4XNHB 3PGPA 2Q4YA 2PIYA 5EMIA 4CYOA 1U6MA 4UWIA 1YLOA 2O53A 3PB7X 2QMLA 5EC4A 2J8NA 2JEVA 1C3OB 3NH8A 3KZWA 1BO4A 4GPLB 1YX0A 1CJWA 3KQXA 4KOYA 4MHNA 4NGTA 2PCUA 3FJUA 5LYDA 2C6GA 4E0AA 4OC5A 1B47A 4YGOA 1MJ9A 2HC9A 2AFSA 2VZYA 4B13A 5A27A 5D29A 2ZEDA 3I74A 1JQGA 1DE4C 1Z5RA 4BD9A 2B3VA 4U9ZA 3SI1A 3E0KA 2PVVA 1UWYA 4JVOA 3GUXA 3NA6A 4C2ZA 1S7FA 2FE7A 3FRMA 3EXNA 2MP0A 4OC4A 1AYEA 4Q36A 2X0SA 4JZ0A 1CPXA 1DTDA 3FVLA 1ZG7A 1IY7A 4CPAA 3EZEA 1Y0RA 5ELYA 4NEXA 2Z3KA 4R9MA 5A28A 4OLLA 1VI4A 5HVFA 5ISVA 1YMEA 2JLMA 4NGSA 3K2KA 4KZTA 4H2KA 3RYOA 3TTHA 4AVAA 4RUHA 4C99A 3ZZIA 1ARLA 2OZHA 1MK4A 3FIXA 4PK2A 3FXTA 2IQ6A 2Z0ZA 3ICUA 3U88C 1XIXA 4UIAA 4LX9A 4HNXB 4CYNA 3OP0A 3DDDA 4CAVA 2XPOA 3MN8A 1QQ9A 4IAVA 5IV0A 1TF9A 3PP9A 3S6FA 4GXHA 4M85A 1R3NA 5BY0A 1YQEA 1CP7A 3GY9A 4FD7A 3VRQA 1M4LA 1XF1A 4C9AA 2C1CA 1KBLA 3NH5A 4JLYA 1HEEA 4LQGA 3FEEA 2JBKA 1Q2DA 1F57A 4C7IA 4UFWA 1Z9UA 1YREA 4I49A 1TKFA 4P4FA 2ATRA 3KHZA 4KOSA 5LYFA 2B5GA 4NGRA 3PBBA 3R96A 3S6KA 1IIDA 3EIFA 2HV2A 4KUAA 4KSFA 4UWJA 2YJTA 4C9VA 2OR4A 3FB3A 4TNUA 4F9VA 1LCPA 1NBWA 4QC6A 2POKA 4CAFA 2XPNA 3OB1B 1Z4EA 2XEJA 2PE3A 2Q4ZA 3DGVA 4YFJA 4H6ZA 4GS4A 2HQYA 1BPNA 1PYTB 1TIQA 4OADA 4CRYB 2I00A 1EZAA 1QSRA 3T8WA 2GP4A 2ARHA 1NSAA 4P4DA 2QYVA 4MI4A 3GIUA 3UY5A 5LYLA 2YNEA 2Q44A 5THWA 4PXBA 2Z3OA 2C5QA 2Z3MA 3TOBA 4NXYA 2EWBA 1VBHA 3FNCA 1YW6A 2FIWA 3HMJG 5HMNA 1CE8B 2OLSA 1FT7A 3KGQA 1NXJA 1S3ZA 4UIBA 4MHZA 4P4JA 5K8NA 1VHSA 1V6CA 4MHDA 2ANPA 4MFPA 5F5XA 4J3GA 4B11A 2CTBA 2ZEMA 4P6YA 2Q7BA 3V7ZA 3I6SA 4GM5A 3TC8A 2CBLA 3GKRA 3TO9A 1M4GA 4YU9A 4AXVA 1WVMA 3JVNA 3IU1A 1YLEA 3HUVA 4UEFA 4Y49B 3VATA 4XPDB 4A33A 4FD6A 1BXRB 3B35A 2DPTA 2ZENA 4UCNA 1IOIA 5G22A 3CPAA 2WPWA 5JM6A 5D8NA 1YVOA 4CGOA 1TKJA 2VL1A 3TLZA 3TOAA 1ZLHA 1LANA 1NMTA 4NCZA 1YR0A 1A9XB 4M6IA 5HKWA 2PSWA 2OH1A 2K5TA 3B7IA 4AG9A 2B4DB 5AG7A 3BUMB 1Y9WA 4R57A 3TLGA 1Y7RA 5F1YA 2PJ5A 2R8VA 2AFMA 2EUIA 3NE8A 1Z8LA 3OWCA 2ZW4A 2G3TA 4A37A 1HDQA 3EC4A 4P10A 2DXQA 2V8VA 1NE9A 4B5OA 4MBUA 3D67A 2WPXA 5DS0A 4U5YA 1IYKA 4KUBA 1Y7EA 4MFKA 4ZI6A 3B8GA 3W6XA 2PC1A 2REEA 2EO8A 2PR8A 2ZEFA 4UEEA 2CXAA 1IICA 4B5PB 4WJBA 4R3KA 2BSWA 3IGRA 4CRZB 3VRRA 1XMTA 3D4UA 3TLBA 3S9MA 4KOTA 3I9SA 2GFQA 2B3UA 4C7HA 3D7FA 4IHMA 3WABA 4OC0A 2GLFA 3BJ8A 5K8OA 3K4IA 4UCMA 2Q0YA 4NJRA 2DLAA 5F13A 2CNTA 2AFOA 2YNCA 3CZXA 4NJQA 5J1QA 1XFOA 4U9YA 3KASA 3TO6A 3NE7A 3BI1A 4PPZA 3O8ZA 3IFEA 4H1HA 2PJ2A 4EYSA 3BUOB 4CGPA 4ZYQA 2PVWA 3KI9A 4JXRA 2PJ4A 3D66A 4FAIA 2ZW6A 1KUYA 1N71A 4IF5A 4MFLA 5DWMA 4UF4A 4F0XA 2Q43A 3ISZA 4MMOA 2ZW5A 1HDUA 4UEZA 1LFWA 4INJA 2C6CA 2ZXVA 1P4NA 4XNHC 3OAKA 4MJ8A 1S60A 2Z3LA 4BPWB 2I79A 4R7MA 1R43A 2YJVA 3T0TA 3HPGG 3RNZA 3QB8A 1Y9KA 1ZG8A 5LRKA 3TLCA 1ZG9A 3SJEA 3GJZA 1VGYA 5FD8A 2VZZA 4KOVA 3BHXA 2G3AA 2CNMA 7CPAA 4A4BA 4QUSA 3VROA 3CXQA 1XMBA 4BBHA 1AUGA 5JH9A 1WJTA 5IB9A 4IIXA 1M4IA 4MI1A 4W9YA 4AVCA 1DIKA 4IIYA 5JVLA 4UFXA 4A38A 4CZ1A 1Q2YA 1Z8XA 3TFYA 4OMEA 2YNDA 2YNCC 3U1BA 2E28A 2Z3NA 4PQAA 1IYLA 4EFDA 3QAHA 1VIXA 3QNVA 5IR2A 4L89A 4ONWA 4RR2B 2V8HA 4X5KA 3RO0A 4KSIA 2FCKA 3GLJA 2PCNA 3DSBA 3P2HA 4MFJA 1LAPA 5HKZA 3D8PA 4MHYA 3SJGA 1YVHA 2IMOA 4E94A 4AVBA 3TX8A 3B3WA 3R9EA 4JYWA 4A2ZA 3KR5A 2OZGA 1XBUA 3SR3A 1XF8A 3V8IA 4F0YA 3IWWA 1CP6A 2PJBA 4ORFA 3SJFA 2VKZG 3FYNA 1YW4A 2F8HA 5J8FA 1XE4A 5CNPA 3RAMA 4MCRA 1QMUA 2ZEEA 4II9A 2AUMA 3VARA 3PB8X 2D0PA 1UFHA 2PR1A 5F48A 1A2ZA 5F46A 2FXFA 2V8DA 3D7HA 3IWGA 3IJ3A 2P6EA 4PV6A 2PQ8A 4PSWA 5HVGA 1M6VB 2FIAA 3OB2B 4COGA 3FEDA 3PFOA 1I12A 3LODA 3CXSA 3T90A 2O28A 4Z65A 5K8MA 4UA3A 2HROA 1BLLE 4RS2A 4DYOA 1CG2A 4CGLA 1J3LA 1QSNA 5F09A 3I1UA 4F9UA 3DNSA 1LAMA 4ONUA 4C9EA 2QIRA 2F5IA 4E5SA 1F2OA 2XEFA 1M1DA 2V77A 2RC4A 3F8KA 3H5ZA 1YGHA 3NFZA 4K3NA 4KOWA 3RBUA 2I3CA 5H86A 3TYXA 2EVNA 2PJ3A 3SJXA 4ZY1A 2R98A 2HI6A 3C8OA 1ZO0A 4A32A 3D2MA 4YN3A 4ZX9A 2ZEGA 4CGNA 2AJ6A 4RI1A 3SXNA 1Y0YA 2PJAA 3VWEA 4UBRA 2H5MA 3B3CA 1FY7A 2REFA 3F9KC 3BLNA 1ELLP 5LYIA 4QBJA 3KKWA 4R8FA 8CPAA 5F9MA 3TLAA 3HLPA 3BXMA 4FUUA 4R3LA 3BJ7A 2HWGA 3W6SA 3KQZA 1S5KA 3PBEA 4MCQA 5EBVA 4A30A 1JDEA 3PZJA 5G1ZA 2ZPAA 4C9UA 4H6UA 4B10A 3VGOA 3LACA 3DLJA 4JD6A 1WK4A 1VBGA 2G0BA 3PRTA 4H89A 2UV8G 3I3GA 2VBQA 3C26A 4G1PA 2OZUA 1NSLA 3W91A 1KC7A 5JQ4A 1VHOA 2OOTA 2AFWA 3EO4A 4QB9A 3VWDA 4BINA 4M6GA 5KTDA 1JWQA 2IL4A 4B5PA 3CDXA 4XPLA 2ZOFA 3LMSA 2J8RA 3F0AA 4FD5A 4Q38A 3D68A 2JEWA 5HVHA 1S7KA 3IIBA 3IU2A 2PJ1A 2VI7A 3VRNA 3PFVA 3DR6A 4OAEA 2P0WA 4XPKA 4L8AA 4MFZA 2DEAA 3H8GA 3SI0A 5J8CA 3TT2A 5H84A 5LRGA 4MXUA 4YRHA 1R57A 1XEBA 2QECA 1M4DA 3BUWB 4UFVA 2NSMA 4TJXA 2OB0A 4CAXA 1IB1E 2Q7SA 4M3SA 4E2AA 3TLYA 3EZBA 4YWYA 1XRYA 2BOAA 4C8CA 2EZAA 5J3XA 3L2NA 4R76A 2BO9A 2CF4A 5E96A 4DJLA 5AG4A 2RFHA 3MGDA 1BPMA 2RB7A 5C88A 2GU2A 3PB4X 3D2PA 4BTFA 2PJ6A 4OIWA 2QJ8A 2P6GA 3LD2A 1ELMP 2PJ0A 3WC7A 1RXTA 3KR4A 4R87A 4B14A 5KTAA 3N7ZA 2D0OA 2PJCA 3BI0A 1Q7LA 4PK3A 2Q04A 2BUEA 2R1IA 4OIDA 2DIKA 2GLJA 4O23A 2IJZA 4C2XA 3DR8A 3B3SA 4C8TA 2JDCA 1C30B 2EK9A 1XOVA 1TKHA 1Q2CA 2B4JC 1K4JA 2GREA 3GYAA 4B12A 4PXCA 1J4JA 3JUWA 2BCOA 1KEEB 2PRQA 2VXKA 4P4BA 3R95A 1EE3P 4A4CA 4K30A 5AGEA 2D4PA 5F49A 1WWZA 3BUNB 4KS9A 5AXIA 2XEGA 4KORA 3T9YA 4COBA 2D4OA 3WT4A 2WYRA 1B6BA 3R1KA 4ZBGA 5CPAA 1ZRSA 3R9GA 4R6TA 3TLGB 3LWUA 4JXQA 3D7GA 1AMPA 3FBUA 3V38A 4M8DA 4C86A 5HKYA 4MY3A 3QAYA 3G23A 2R82A 1LRZA 1RTQA 2PJ9A 3NFQA 2PRBA 4A94A 4OC3A 1IU8A 3G8WA 4OC1A 5JGFA 4OC2A 2ABZA 4E8OA 2EBJA 3SHPA 1EO0A 1TXRA 3TCVA 4C8AA 3FECA 1XJOA 1VHEA 1I1DA 2J8MA 4X2TA 1M44A 4NGQA 1IGBA 2J9AA 2VQYA 2B58A 4KNGE 4KVOE 4LUAA 4A31A 5LRJA 3D3SA 3VRPA 4OP4A 3WC5A 1CBXA 2FL4A 4C2YA 4J0NA 4BPUB 4HPSA 3D7DA 4WWVA 4AB7A 3H8EA 3P2FA 4LQ6A 4C8UA 1GYTA 3CXPA 4ZY2A 4CAWA 1I21A 1ZL0A 1OBRA 2ZEHA 4NGMA 2NYQA 1OZPA 1VKCA 4X3RA 4QVTA 2G9DA 6CPAA 4JJXA 4NSQA 5I4MA 1CS0B 4CO9A 2CY2A 2P6FA 1X12A 1R61A 1RO5A 4IUSA 5JPHA 2AE6A 2F7VA 3FF3A 1Z4RA 2NMTA 3PEIA 4C8PA 4MRIA 5K8PA 3F5BA 3ISXA 3K9TA 2ODFA 3A9LA 2FT0A 4C8FA 1KUXA 3NH4A 1V0CA 4X8IA 1L0CA 4HNWB 5G21A 1BAVA 2HUZA 2GE3A 5G20A 4A95A 1YSJA
chains in the Genus database with same CATH topology
3VTAA 1ZLIA 3FX6A 4ZX8A 1KWMA 4OKOA 4C85A 2CIJA 3S9NA 3KHXA 1FNOA 4B6ZA 2JBJA 3IEHA 3PFEA 4TWEA 2Q51A 2ZEPA 2AFUA 5HXDA 2EK8A 4C9RA 4P4EA 2CTCA 1H8LA 4Q7AA 2XEIA 3FH4A 4TJVA 2PJ8A 4NFRA 4CDJA 3SI2A 2PIZA 4EMEA 1Z2LA 4P44A 4NGNA 4F8ZA 3S9LA 4DUKA 1Y9ZA 2ZELA 1LOKA 2WZNA 2AFZA 4P4IA 4NGPA 3VH9A 4PXDA 4C84A 4IK2A 4ZY0A 1CX8A 3GB0A 3PB6X 4FWUA 3N5FA 3H8FA 2ZOGA 2V8GA 3JRUA 3PB9X 3RZAA 2O4HA 4MCPA 2FVGA 3WC6A 1PCAA 4A39A 4PXEA 4MCSA 3B3VA 2QVPA 3CPXA 1TF8A 2AFXA 1F2PA 4CDKA 1CPSA 3IC1A 3KL9A 5CBMA 2ZEOA 3B2YA 3FMCA 3IO1A 4P45A 4MHPA 2HB6A 2PJ7A 4FBEA 1ARMA 3MRUA 3CT9A 3B3TA 4EWTA 2C6PA 2PIYA 1YLOA 2O53A 3PB7X 3NH8A 3KZWA 3KQXA 4MHNA 4NGTA 2PCUA 3FJUA 5LYDA 2C6GA 4OC5A 2HC9A 2AFSA 5D29A 2ZEDA 3I74A 1JQGA 1DE4C 1Z5RA 4BD9A 3SI1A 2PVVA 1UWYA 3GUXA 3NA6A 4OC4A 1AYEA 4JZ0A 1CPXA 1DTDA 3FVLA 1ZG7A 1IY7A 4CPAA 1Y0RA 5ELYA 5HVFA 1YMEA 3K2KA 4NGSA 4RUHA 4H2KA 4C99A 1ARLA 2IQ6A 3ICUA 4UIAA 3MN8A 1QQ9A 4IAVA 1TF9A 1XF1A 1R3NA 1CP7A 4C9AA 1M4LA 2C1CA 3NH5A 1HEEA 4LQGA 3FEEA 2JBKA 1F57A 1TKFA 4P4FA 3KHZA 5LYFA 4NGRA 3PBBA 3EIFA 4C9VA 2OR4A 4TNUA 4F9VA 1LCPA 2POKA 2XEJA 2PE3A 2Q4ZA 3DGVA 4C8FA 1WVMA 1BPNA 1PYTB 2GP4A 3T8WA 1NSAA 4P4DA 2QYVA 5LYLA 5THWA 4PXBA 2C5QA 2EWBA 1YW6A 1FT7A 3KGQA 4UIBA 4MHZA 4P4JA 5K8NA 1V6CA 2ANPA 2CTBA 2ZEMA 4P6YA 3V7ZA 3I6SA 4GM5A 3TC8A 4YU9A 4AXVA 3HUVA 4UEFA 3VATA 3B35A 2ZENA 3CPAA 5JM6A 5D8NA 1TKJA 2VL1A 1ZLHA 1LANA 3B7IA 2PJ5A 2AFMA 1Z8LA 4A37A 1HDQA 4P10A 2V8VA 3D67A 5DS0A 1Y7EA 4ZI6A 2ZEFA 4UEEA 4WJBA 3D4UA 3S9MA 3D7FA 4IHMA 3WABA 4OC0A 2GLFA 5K8OA 4NJRA 2AFOA 4NJQA 5J1QA 1XFOA 3KASA 3BI1A 4PPZA 3IFEA 2PJ2A 4ZYQA 2PVWA 3KI9A 2PJ4A 3D66A 4FAIA 4UF4A 2Q43A 3ISZA 4MMOA 1HDUA 4UEZA 1LFWA 2C6CA 4R7MA 1R43A 1ZG8A 5LRKA 1ZG9A 3SJEA 1VGYA 3BHXA 7CPAA 5JH9A 1XMBA 5IB9A 4W9YA 4A38A 4OMEA 4EFDA 4PQAA 3QNVA 1VIXA 5IR2A 4ONWA 2V8HA 4KSIA 3GLJA 1LAPA 4MHYA 3SJGA 2IMOA 3TX8A 3B3WA 4JYWA 3KR5A 1XBUA 3IWWA 1CP6A 2PJBA 3SJFA 1YW4A 2F8HA 3RAMA 4MCRA 1QMUA 2ZEEA 3VARA 3PB8X 2V8DA 3D7HA 5HVGA 3IJ3A 4C9UA 3FEDA 3PFOA 4Z65A 5K8MA 1BLLE 4DYOA 1CG2A 5F09A 3I1UA 4F9UA 1LAMA 4C9EA 1F2OA 2XEFA 2V77A 4K3NA 3NFZA 3RBUA 2I3CA 2PJ3A 4ZY1A 3SJXA 4YN3A 4ZX9A 2ZEGA 1Y0YA 2PJAA 3B3CA 5LYIA 1ELLP 8CPAA 4R8FA 3HLPA 3BXMA 4FUUA 3KQZA 3PBEA 4MCQA 3DLJA 3PRTA 4G1PA 1VHOA 2OOTA 2AFWA 3CDXA 2ZOFA 3LMSA 3D68A 2JEWA 5HVHA 3IIBA 2PJ1A 3SI0A 2DEAA 3H8GA 5LRGA 4MXUA 2NSMA 4TJXA 4YWYA 1XRYA 2BOAA 4C8CA 3L2NA 4R76A 2BO9A 2CF4A 4DJLA 2RFHA 1BPMA 2RB7A 2GU2A 3PB4X 2PJ6A 4OIWA 2QJ8A 1ELMP 2PJ0A 3WC7A 3KR4A 2PJCA 3BI0A 1Q7LA 4OIDA 2GLJA 4O23A 2IJZA 3B3SA 4C8TA 2EK9A 1TKHA 2GREA 4PXCA 2BCOA 2PRQA 4P4BA 1EE3P 2XEGA 3WT4A 2WYRA 5CPAA 4R6TA 3LWUA 3D7GA 1AMPA 3V38A 4C86A 1RTQA 2PJ9A 4A94A 4OC3A 4OC1A 5JGFA 4OC2A 2ABZA 4C8AA 1TXRA 3FECA 1XJOA 1VHEA 4X2TA 4NGQA 1IGBA 2J9AA 4KNGE 5LRJA 4OP4A 3WC5A 1CBXA 3D7DA 4WWVA 4C8UA 3H8EA 1GYTA 4ZY2A 1OBRA 2ZEHA 4NGMA 2NYQA 4X3RA 2G9DA 6CPAA 5I4MA 2F7VA 3FF3A 3PEIA 4C8PA 4MRIA 5K8PA 3ISXA 3K9TA 4X8IA 3NH4A 1BAVA 1YSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTA A;  1ZLI A;  3FX6 A;  4ZX8 A;  1KWM A;  4OKO A;  4C85 A;  2CIJ A;  3S9N A;  3KHX A;  1FNO A;  4B6Z A;  2JBJ A;  3IEH A;  3PFE A;  4TWE A;  2Q51 A;  2ZEP A;  2AFU A;  5HXD A;  2EK8 A;  4C9R A;  4P4E A;  2CTC A;  1H8L A;  4Q7A A;  2XEI A;  3FH4 A;  4TJV A;  2PJ8 A;  4NFR A;  4CDJ A;  3SI2 A;  2PIZ A;  4EME A;  1Z2L A;  4P44 A;  4NGN A;  4F8Z A;  3S9L A;  4DUK A;  1Y9Z A;  2ZEL A;  1LOK A;  2WZN A;  2AFZ A;  4P4I A;  4NGP A;  3VH9 A;  4PXD A;  4C84 A;  4IK2 A;  4ZY0 A;  1CX8 A;  3GB0 A;  3PB6 X;  4FWU A;  3N5F A;  3H8F A;  2ZOG A;  2V8G A;  3JRU A;  3PB9 X;  3RZA A;  2O4H A;  4MCP A;  2FVG A;  3WC6 A;  1PCA A;  4A39 A;  4PXE A;  4MCS A;  3B3V A;  2QVP A;  3CPX A;  1TF8 A;  2AFX A;  1F2P A;  4CDK A;  1CPS A;  3IC1 A;  3KL9 A;  5CBM A;  2ZEO A;  3B2Y A;  3FMC A;  3IO1 A;  4P45 A;  4MHP A;  2HB6 A;  2PJ7 A;  4FBE A;  1ARM A;  3MRU A;  3CT9 A;  3B3T A;  4EWT A;  2C6P A;  2PIY A;  1YLO A;  2O53 A;  3PB7 X;  3NH8 A;  3KZW A;  3KQX A;  4MHN A;  4NGT A;  2PCU A;  3FJU A;  5LYD A;  2C6G A;  4OC5 A;  2HC9 A;  2AFS A;  5D29 A;  2ZED A;  3I74 A;  1JQG A;  1DE4 C;  1Z5R A;  4BD9 A;  3SI1 A;  2PVV A;  1UWY A;  3GUX A;  3NA6 A;  4OC4 A;  1AYE A;  4JZ0 A;  1CPX A;  1DTD A;  3FVL A;  1ZG7 A;  1IY7 A;  4CPA A;  1Y0R A;  5ELY A;  5HVF A;  1YME A;  3K2K A;  4NGS A;  4RUH A;  4H2K A;  4C99 A;  1ARL A;  2IQ6 A;  3ICU A;  4UIA A;  3MN8 A;  1QQ9 A;  4IAV A;  1TF9 A;  1XF1 A;  1R3N A;  1CP7 A;  4C9A A;  1M4L A;  2C1C A;  3NH5 A;  1HEE A;  4LQG A;  3FEE A;  2JBK A;  1F57 A;  1TKF A;  4P4F A;  3KHZ A;  5LYF A;  4NGR A;  3PBB A;  3EIF A;  4C9V A;  2OR4 A;  4TNU A;  4F9V A;  1LCP A;  2POK A;  2XEJ A;  2PE3 A;  2Q4Z A;  3DGV A;  4C8F A;  1WVM A;  1BPN A;  1PYT B;  3T8W A;  1NSA A;  4P4D A;  2QYV A;  5LYL A;  5THW A;  4PXB A;  2EWB A;  1YW6 A;  1FT7 A;  3KGQ A;  4UIB A;  4MHZ A;  4P4J A;  5K8N A;  1V6C A;  2ANP A;  2CTB A;  2ZEM A;  4P6Y A;  3V7Z A;  3I6S A;  4GM5 A;  3TC8 A;  4YU9 A;  4AXV A;  3HUV A;  4UEF A;  3VAT A;  3B35 A;  2ZEN A;  3CPA A;  5JM6 A;  5D8N A;  1TKJ A;  2VL1 A;  1ZLH A;  1LAN A;  3B7I A;  2PJ5 A;  2AFM A;  1Z8L A;  4A37 A;  1HDQ A;  4P10 A;  2V8V A;  3D67 A;  5DS0 A;  1Y7E A;  4ZI6 A;  2ZEF A;  4UEE A;  4WJB A;  3D4U A;  3S9M A;  3D7F A;  4IHM A;  3WAB A;  4OC0 A;  2GLF A;  5K8O A;  4NJR A;  2AFO A;  4NJQ A;  5J1Q A;  1XFO A;  3KAS A;  3BI1 A;  4PPZ A;  3IFE A;  2PJ2 A;  4ZYQ A;  2PVW A;  3KI9 A;  2PJ4 A;  3D66 A;  4FAI A;  4UF4 A;  2Q43 A;  3ISZ A;  4MMO A;  1HDU A;  4UEZ A;  1LFW A;  2C6C A;  4R7M A;  1R43 A;  1ZG8 A;  5LRK A;  1ZG9 A;  3SJE A;  1VGY A;  3BHX A;  7CPA A;  5JH9 A;  1XMB A;  5IB9 A;  4W9Y A;  4A38 A;  4OME A;  4EFD A;  4PQA A;  3QNV A;  1VIX A;  4ONW A;  2V8H A;  4KSI A;  3GLJ A;  1LAP A;  4MHY A;  3SJG A;  2IMO A;  3TX8 A;  3B3W A;  4JYW A;  3KR5 A;  1XBU A;  3IWW A;  1CP6 A;  2PJB A;  3SJF A;  1YW4 A;  2F8H A;  3RAM A;  4MCR A;  1QMU A;  2ZEE A;  3VAR A;  3PB8 X;  2V8D A;  3D7H A;  5HVG A;  3IJ3 A;  4C9U A;  3FED A;  3PFO A;  4Z65 A;  5K8M A;  1BLL E;  4DYO A;  1CG2 A;  5F09 A;  3I1U A;  4F9U A;  1LAM A;  4C9E A;  1F2O A;  2XEF A;  2V77 A;  4K3N A;  3NFZ A;  3RBU A;  2I3C A;  2PJ3 A;  4ZY1 A;  3SJX A;  4YN3 A;  4ZX9 A;  2ZEG A;  1Y0Y A;  2PJA A;  3B3C A;  5LYI A;  1ELL P;  8CPA A;  4R8F A;  3HLP A;  3BXM A;  4FUU A;  3KQZ A;  3PBE A;  4MCQ A;  3DLJ A;  3PRT A;  4G1P A;  1VHO A;  2OOT A;  2AFW A;  3CDX A;  2ZOF A;  3LMS A;  3D68 A;  2JEW A;  5HVH A;  3IIB A;  2PJ1 A;  3SI0 A;  2DEA A;  3H8G A;  5LRG A;  4MXU A;  2NSM A;  4TJX A;  4YWY A;  1XRY A;  2BOA A;  4C8C A;  3L2N A;  4R76 A;  2BO9 A;  2CF4 A;  4DJL A;  2RFH A;  1BPM A;  2RB7 A;  2GU2 A;  3PB4 X;  2PJ6 A;  4OIW A;  2QJ8 A;  1ELM P;  2PJ0 A;  3WC7 A;  3KR4 A;  2PJC A;  3BI0 A;  1Q7L A;  4OID A;  2GLJ A;  4O23 A;  2IJZ A;  3B3S A;  4C8T A;  2EK9 A;  1TKH A;  2GRE A;  4PXC A;  2BCO A;  2PRQ A;  4P4B A;  1EE3 P;  2XEG A;  3WT4 A;  2WYR A;  5CPA A;  4R6T A;  3LWU A;  3D7G A;  1AMP A;  3V38 A;  4C86 A;  1RTQ A;  2PJ9 A;  4A94 A;  4OC3 A;  4OC1 A;  5JGF A;  4OC2 A;  2ABZ A;  4C8A A;  1TXR A;  3FEC A;  1XJO A;  1VHE A;  4X2T A;  4NGQ A;  1IGB A;  2J9A A;  4KNG E;  5LRJ A;  4OP4 A;  3WC5 A;  1CBX A;  3D7D A;  4WWV A;  4C8U A;  3H8E A;  1GYT A;  4ZY2 A;  1OBR A;  2ZEH A;  4NGM A;  2NYQ A;  4X3R A;  2G9D A;  6CPA A;  5I4M A;  2F7V A;  3FF3 A;  3PEI A;  4C8P A;  4MRI A;  5K8P A;  3ISX A;  3K9T A;  4X8I A;  3NH4 A;  1BAV A;  1YSJ A; 
#chains in the Genus database with same CATH topology
 3VTA A;  1ZLI A;  1Z8T A;  3FX6 A;  1KWM A;  4OKO A;  5F47 A;  4ZX8 A;  3IWE A;  4CGM A;  4KLW A;  2CIJ A;  3T07 A;  4C85 A;  3S9N A;  3KHX A;  1MJB A;  1FNO A;  3PT1 A;  1YVK A;  2XPP A;  4B6Z A;  3KRV A;  2JBJ A;  2YGW A;  3IEH A;  3PFE A;  2B0A A;  2Y1M A;  2B4D A;  4TWE A;  5DWN A;  2Q51 A;  1YK3 A;  2ZEP A;  2Z11 A;  1JDB C;  1Z8W A;  1PUA A;  2JDD A;  2AFU A;  2Q4V A;  4ZGY B;  5HXD A;  4KSA A;  2EK8 A;  5C82 A;  4C9R A;  3NOJ A;  2BEI A;  1ON0 A;  1IOF A;  3BUX B;  1B87 A;  3SXO A;  5KTC A;  2N3A B;  3TE4 A;  4P4E A;  2CTC A;  3EFA A;  1H8L A;  1QSO A;  4Q7A A;  2XEI A;  1CM0 A;  3FH4 A;  4TJV A;  1SQH A;  2PJ8 A;  4NFR A;  4KVM E;  4CDJ A;  2Z10 A;  2FM4 A;  3SI2 A;  4KLV A;  2DPS A;  2PIZ A;  2ZW7 A;  1Z2L A;  4C68 A;  4EME A;  5AG6 A;  4KOX A;  4P44 A;  5IX3 A;  1ZYM A;  4NGN A;  3ZNI A;  2VEZ A;  3S9L A;  4F8Z A;  2R7H A;  4DUK A;  4BPX B;  4Y49 C;  1Y9Z A;  4XPD C;  2ZEL A;  1LOK A;  1QSM A;  4PSX A;  4RN7 A;  1KUV A;  2WZN A;  2AFZ A;  4EVY A;  4P4I A;  2B5G B;  2Z3P A;  4NGP A;  3VH9 A;  2EZB A;  4MFQ A;  4PXD A;  1QST A;  4HKF A;  4C84 A;  4IK2 A;  4ZY0 A;  3ZJ0 A;  5GCN A;  1KZF A;  5I0C A;  1CX8 A;  3GB0 A;  1Q5X A;  3PB6 X;  2EZC A;  2X7B A;  4MJX A;  3H4Q A;  2WUU A;  4FWU A;  1GGO A;  3EY5 A;  3H8F A;  2ZOG A;  3N5F A;  4AG7 A;  2V8G A;  3JRU A;  1X10 A;  3PB9 X;  2GAN A;  2C27 A;  3RZA A;  4CS0 B;  2O4H A;  4MCP A;  4UCP A;  4KVX A;  2FVG A;  4BMH A;  2FSR A;  3HPH E;  3WC6 A;  1PCA A;  4M6H A;  5AG5 A;  4A39 A;  4JWP A;  2XPL A;  3TLE A;  4PXE A;  4NF1 A;  3JTK A;  4MCS A;  1S7L A;  2FS5 A;  3K9U A;  1EZB A;  3B3V A;  1PU9 A;  4CYQ A;  1P0H A;  2A4N A;  2QVP A;  3CPX A;  3R9F A;  4CYP A;  1TF8 A;  2AFX A;  1F2P A;  1GHE A;  4CDK A;  5JYB A;  1CPS A;  3T05 A;  3IC1 A;  5HH1 A;  1Z9E A;  2Y1N A;  3S6H A;  3KL9 A;  2PDO A;  1MJA A;  5CBM A;  2B4B A;  5K99 A;  2ZEO A;  1T36 B;  3B2Y A;  3T5M A;  2OU2 A;  1BOB A;  4HNY B;  4KOU A;  3FMC A;  2KCW A;  3G3S A;  4FD4 A;  4DNC A;  4F6A A;  5IB0 A;  2AUN A;  3IO1 A;  2Y0M A;  2DF5 A;  4P45 A;  4MHP A;  4MY0 A;  2HB6 A;  5FVJ A;  4CAE A;  2PJ7 A;  1S7N A;  3EZA A;  4FBE A;  1ARM A;  3MRU A;  1FBV A;  3S6G A;  3WR7 A;  2GIV A;  3PLF B;  3TO7 A;  2WSA A;  3CT9 A;  5BWA B;  3B3T A;  4EWT A;  2BL1 A;  2CNS A;  2C6P A;  4XNH B;  3PGP A;  2Q4Y A;  2PIY A;  5EMI A;  4CYO A;  1U6M A;  4UWI A;  1YLO A;  2O53 A;  3PB7 X;  2QML A;  5EC4 A;  2J8N A;  2JEV A;  1C3O B;  3NH8 A;  3KZW A;  1BO4 A;  4GPL B;  1YX0 A;  1CJW A;  3KQX A;  4KOY A;  4MHN A;  4NGT A;  2PCU A;  3FJU A;  5LYD A;  2C6G A;  4E0A A;  4OC5 A;  1B47 A;  4YGO A;  1MJ9 A;  2HC9 A;  2AFS A;  2VZY A;  4B13 A;  5A27 A;  5D29 A;  2ZED A;  3I74 A;  1JQG A;  1DE4 C;  1Z5R A;  4BD9 A;  2B3V A;  4U9Z A;  3SI1 A;  3E0K A;  2PVV A;  1UWY A;  4JVO A;  3GUX A;  3NA6 A;  4C2Z A;  1S7F A;  2FE7 A;  3FRM A;  3EXN A;  2MP0 A;  4OC4 A;  1AYE A;  4Q36 A;  2X0S A;  4JZ0 A;  1CPX A;  1DTD A;  3FVL A;  1ZG7 A;  1IY7 A;  4CPA A;  3EZE A;  1Y0R A;  5ELY A;  4NEX A;  2Z3K A;  4R9M A;  5A28 A;  4OLL A;  1VI4 A;  5HVF A;  5ISV A;  1YME A;  2JLM A;  4NGS A;  3K2K A;  4KZT A;  4H2K A;  3RYO A;  3TTH A;  4AVA A;  4RUH A;  4C99 A;  3ZZI A;  1ARL A;  2OZH A;  1MK4 A;  3FIX A;  4PK2 A;  3FXT A;  2IQ6 A;  2Z0Z A;  3ICU A;  3U88 C;  1XIX A;  4UIA A;  4LX9 A;  4HNX B;  4CYN A;  3OP0 A;  3DDD A;  4CAV A;  2XPO A;  3MN8 A;  1QQ9 A;  4IAV A;  5IV0 A;  1TF9 A;  3PP9 A;  3S6F A;  4GXH A;  4M85 A;  1R3N A;  5BY0 A;  1YQE A;  1CP7 A;  3GY9 A;  4FD7 A;  3VRQ A;  1M4L A;  1XF1 A;  4C9A A;  2C1C A;  1KBL A;  3NH5 A;  4JLY A;  1HEE A;  4LQG A;  3FEE A;  2JBK A;  1Q2D A;  1F57 A;  4C7I A;  4UFW A;  1Z9U A;  1YRE A;  4I49 A;  1TKF A;  4P4F A;  2ATR A;  3KHZ A;  4KOS A;  5LYF A;  2B5G A;  4NGR A;  3PBB A;  3R96 A;  3S6K A;  1IID A;  3EIF A;  2HV2 A;  4KUA A;  4KSF A;  4UWJ A;  2YJT A;  4C9V A;  2OR4 A;  3FB3 A;  4TNU A;  4F9V A;  1LCP A;  1NBW A;  4QC6 A;  2POK A;  4CAF A;  2XPN A;  3OB1 B;  1Z4E A;  2XEJ A;  2PE3 A;  2Q4Z A;  3DGV A;  4YFJ A;  4H6Z A;  4GS4 A;  2HQY A;  1BPN A;  1PYT B;  1TIQ A;  4OAD A;  4CRY B;  2I00 A;  1EZA A;  1QSR A;  3T8W A;  2GP4 A;  2ARH A;  1NSA A;  4P4D A;  2QYV A;  4MI4 A;  3GIU A;  3UY5 A;  5LYL A;  2YNE A;  2Q44 A;  5THW A;  4PXB A;  2Z3O A;  2C5Q A;  2Z3M A;  3TOB A;  4NXY A;  2EWB A;  1VBH A;  3FNC A;  1YW6 A;  2FIW A;  3HMJ G;  5HMN A;  1CE8 B;  2OLS A;  1FT7 A;  3KGQ A;  1NXJ A;  1S3Z A;  4UIB A;  4MHZ A;  4P4J A;  5K8N A;  1VHS A;  1V6C A;  4MHD A;  2ANP A;  4MFP A;  5F5X A;  4J3G A;  4B11 A;  2CTB A;  2ZEM A;  4P6Y A;  2Q7B A;  3V7Z A;  3I6S A;  4GM5 A;  3TC8 A;  2CBL A;  3GKR A;  3TO9 A;  1M4G A;  4YU9 A;  4AXV A;  1WVM A;  3JVN A;  3IU1 A;  1YLE A;  3HUV A;  4UEF A;  4Y49 B;  3VAT A;  4XPD B;  4A33 A;  4FD6 A;  1BXR B;  3B35 A;  2DPT A;  2ZEN A;  4UCN A;  1IOI A;  5G22 A;  3CPA A;  2WPW A;  5JM6 A;  5D8N A;  1YVO A;  4CGO A;  1TKJ A;  2VL1 A;  3TLZ A;  3TOA A;  1ZLH A;  1LAN A;  1NMT A;  4NCZ A;  1YR0 A;  1A9X B;  4M6I A;  5HKW A;  2PSW A;  2OH1 A;  2K5T A;  3B7I A;  4AG9 A;  2B4D B;  5AG7 A;  3BUM B;  1Y9W A;  4R57 A;  3TLG A;  1Y7R A;  5F1Y A;  2PJ5 A;  2R8V A;  2AFM A;  2EUI A;  3NE8 A;  1Z8L A;  3OWC A;  2ZW4 A;  2G3T A;  4A37 A;  1HDQ A;  3EC4 A;  4P10 A;  2DXQ A;  2V8V A;  1NE9 A;  4B5O A;  4MBU A;  3D67 A;  2WPX A;  5DS0 A;  4U5Y A;  1IYK A;  4KUB A;  1Y7E A;  4MFK A;  4ZI6 A;  3B8G A;  3W6X A;  2PC1 A;  2REE A;  2EO8 A;  2PR8 A;  2ZEF A;  4UEE A;  2CXA A;  1IIC A;  4B5P B;  4WJB A;  4R3K A;  2BSW A;  3IGR A;  4CRZ B;  3VRR A;  1XMT A;  3D4U A;  3TLB A;  3S9M A;  4KOT A;  3I9S A;  2GFQ A;  2B3U A;  4C7H A;  3D7F A;  4IHM A;  3WAB A;  4OC0 A;  2GLF A;  3BJ8 A;  5K8O A;  3K4I A;  4UCM A;  2Q0Y A;  4NJR A;  2DLA A;  5F13 A;  2CNT A;  2AFO A;  2YNC A;  3CZX A;  4NJQ A;  5J1Q A;  1XFO A;  4U9Y A;  3KAS A;  3TO6 A;  3NE7 A;  3BI1 A;  4PPZ A;  3O8Z A;  3IFE A;  4H1H A;  2PJ2 A;  4EYS A;  3BUO B;  4CGP A;  4ZYQ A;  2PVW A;  3KI9 A;  4JXR A;  2PJ4 A;  3D66 A;  4FAI A;  2ZW6 A;  1KUY A;  1N71 A;  4IF5 A;  4MFL A;  5DWM A;  4UF4 A;  4F0X A;  2Q43 A;  3ISZ A;  4MMO A;  2ZW5 A;  1HDU A;  4UEZ A;  1LFW A;  4INJ A;  2C6C A;  2ZXV A;  1P4N A;  4XNH C;  3OAK A;  4MJ8 A;  1S60 A;  2Z3L A;  4BPW B;  2I79 A;  4R7M A;  1R43 A;  2YJV A;  3T0T A;  3HPG G;  3RNZ A;  3QB8 A;  1Y9K A;  1ZG8 A;  5LRK A;  3TLC A;  1ZG9 A;  3SJE A;  3GJZ A;  1VGY A;  5FD8 A;  2VZZ A;  4KOV A;  3BHX A;  2G3A A;  2CNM A;  7CPA A;  4A4B A;  4QUS A;  3VRO A;  3CXQ A;  1XMB A;  4BBH A;  1AUG A;  5JH9 A;  1WJT A;  5IB9 A;  4IIX A;  1M4I A;  4MI1 A;  4W9Y A;  4AVC A;  1DIK A;  4IIY A;  5JVL A;  4UFX A;  4A38 A;  4CZ1 A;  1Q2Y A;  1Z8X A;  3TFY A;  4OME A;  2YND A;  2YNC C;  3U1B A;  2E28 A;  2Z3N A;  4PQA A;  1IYL A;  4EFD A;  3QAH A;  1VIX A;  3QNV A;  5IR2 A;  4L89 A;  4ONW A;  4RR2 B;  2V8H A;  4X5K A;  3RO0 A;  4KSI A;  2FCK A;  3GLJ A;  2PCN A;  3DSB A;  3P2H A;  4MFJ A;  1LAP A;  5HKZ A;  3D8P A;  4MHY A;  3SJG A;  1YVH A;  2IMO A;  4E94 A;  4AVB A;  3TX8 A;  3B3W A;  3R9E A;  4JYW A;  4A2Z A;  3KR5 A;  2OZG A;  1XBU A;  3SR3 A;  1XF8 A;  3V8I A;  4F0Y A;  3IWW A;  1CP6 A;  2PJB A;  4ORF A;  3SJF A;  2VKZ G;  3FYN A;  1YW4 A;  2F8H A;  5J8F A;  1XE4 A;  5CNP A;  3RAM A;  4MCR A;  1QMU A;  2ZEE A;  4II9 A;  2AUM A;  3VAR A;  3PB8 X;  2D0P A;  1UFH A;  2PR1 A;  5F48 A;  1A2Z A;  5F46 A;  2FXF A;  2V8D A;  3D7H A;  3IWG A;  3IJ3 A;  2P6E A;  4PV6 A;  2PQ8 A;  4PSW A;  5HVG A;  1M6V B;  2FIA A;  3OB2 B;  4COG A;  3FED A;  3PFO A;  1I12 A;  3LOD A;  3CXS A;  3T90 A;  2O28 A;  4Z65 A;  5K8M A;  4UA3 A;  2HRO A;  1BLL E;  4RS2 A;  4DYO A;  1CG2 A;  4CGL A;  1J3L A;  1QSN A;  5F09 A;  3I1U A;  4F9U A;  3DNS A;  1LAM A;  4ONU A;  4C9E A;  2QIR A;  2F5I A;  4E5S A;  1F2O A;  2XEF A;  1M1D A;  2V77 A;  2RC4 A;  3F8K A;  3H5Z A;  1YGH A;  3NFZ A;  4K3N A;  4KOW A;  3RBU A;  2I3C A;  5H86 A;  3TYX A;  2EVN A;  2PJ3 A;  3SJX A;  4ZY1 A;  2R98 A;  2HI6 A;  3C8O A;  1ZO0 A;  4A32 A;  3D2M A;  4YN3 A;  4ZX9 A;  2ZEG A;  4CGN A;  2AJ6 A;  4RI1 A;  3SXN A;  1Y0Y A;  2PJA A;  3VWE A;  4UBR A;  2H5M A;  3B3C A;  1FY7 A;  2REF A;  3F9K C;  3BLN A;  1ELL P;  5LYI A;  4QBJ A;  3KKW A;  4R8F A;  8CPA A;  5F9M A;  3TLA A;  3HLP A;  3BXM A;  4FUU A;  4R3L A;  3BJ7 A;  2HWG A;  3W6S A;  3KQZ A;  1S5K A;  3PBE A;  4MCQ A;  5EBV A;  4A30 A;  1JDE A;  3PZJ A;  5G1Z A;  2ZPA A;  4C9U A;  4H6U A;  4B10 A;  3VGO A;  3LAC A;  3DLJ A;  4JD6 A;  1WK4 A;  1VBG A;  2G0B A;  3PRT A;  4H89 A;  2UV8 G;  3I3G A;  2VBQ A;  3C26 A;  4G1P A;  2OZU A;  1NSL A;  3W91 A;  1KC7 A;  5JQ4 A;  1VHO A;  2OOT A;  2AFW A;  3EO4 A;  4QB9 A;  3VWD A;  4BIN A;  4M6G A;  5KTD A;  1JWQ A;  2IL4 A;  4B5P A;  3CDX A;  4XPL A;  2ZOF A;  3LMS A;  2J8R A;  3F0A A;  4FD5 A;  4Q38 A;  3D68 A;  2JEW A;  5HVH A;  1S7K A;  3IIB A;  3IU2 A;  2PJ1 A;  2VI7 A;  3VRN A;  3PFV A;  3DR6 A;  4OAE A;  2P0W A;  4XPK A;  4L8A A;  4MFZ A;  2DEA A;  3H8G A;  3SI0 A;  5J8C A;  3TT2 A;  5H84 A;  5LRG A;  4MXU A;  4YRH A;  1R57 A;  1XEB A;  2QEC A;  1M4D A;  3BUW B;  4UFV A;  2NSM A;  4TJX A;  2OB0 A;  4CAX A;  1IB1 E;  2Q7S A;  4M3S A;  4E2A A;  3TLY A;  3EZB A;  4YWY A;  1XRY A;  2BOA A;  4C8C A;  2EZA A;  5J3X A;  3L2N A;  4R76 A;  2BO9 A;  2CF4 A;  5E96 A;  4DJL A;  5AG4 A;  2RFH A;  3MGD A;  1BPM A;  2RB7 A;  5C88 A;  2GU2 A;  3PB4 X;  3D2P A;  4BTF A;  2PJ6 A;  4OIW A;  2QJ8 A;  2P6G A;  3LD2 A;  1ELM P;  2PJ0 A;  3WC7 A;  1RXT A;  3KR4 A;  4R87 A;  4B14 A;  5KTA A;  3N7Z A;  2D0O A;  2PJC A;  3BI0 A;  1Q7L A;  4PK3 A;  2Q04 A;  2BUE A;  2R1I A;  4OID A;  2DIK A;  2GLJ A;  4O23 A;  2IJZ A;  4C2X A;  3DR8 A;  3B3S A;  4C8T A;  2JDC A;  1C30 B;  2EK9 A;  1XOV A;  1TKH A;  1Q2C A;  2B4J C;  1K4J A;  2GRE A;  3GYA A;  4B12 A;  4PXC A;  1J4J A;  3JUW A;  2BCO A;  1KEE B;  2PRQ A;  2VXK A;  4P4B A;  3R95 A;  1EE3 P;  4A4C A;  4K30 A;  5AGE A;  2D4P A;  5F49 A;  1WWZ A;  3BUN B;  4KS9 A;  5AXI A;  2XEG A;  4KOR A;  3T9Y A;  4COB A;  2D4O A;  3WT4 A;  2WYR A;  1B6B A;  3R1K A;  4ZBG A;  5CPA A;  1ZRS A;  3R9G A;  4R6T A;  3TLG B;  3LWU A;  4JXQ A;  3D7G A;  1AMP A;  3FBU A;  3V38 A;  4M8D A;  4C86 A;  5HKY A;  4MY3 A;  3QAY A;  3G23 A;  2R82 A;  1LRZ A;  1RTQ A;  2PJ9 A;  3NFQ A;  2PRB A;  4A94 A;  4OC3 A;  1IU8 A;  3G8W A;  4OC1 A;  5JGF A;  4OC2 A;  2ABZ A;  4E8O A;  2EBJ A;  3SHP A;  1EO0 A;  1TXR A;  3TCV A;  4C8A A;  3FEC A;  1XJO A;  1VHE A;  1I1D A;  2J8M A;  4X2T A;  1M44 A;  4NGQ A;  1IGB A;  2J9A A;  2VQY A;  2B58 A;  4KNG E;  4KVO E;  4LUA A;  4A31 A;  5LRJ A;  3D3S A;  3VRP A;  4OP4 A;  3WC5 A;  1CBX A;  2FL4 A;  4C2Y A;  4J0N A;  4BPU B;  4HPS A;  3D7D A;  4WWV A;  4AB7 A;  3H8E A;  3P2F A;  4LQ6 A;  4C8U A;  1GYT A;  3CXP A;  4ZY2 A;  4CAW A;  1I21 A;  1ZL0 A;  1OBR A;  2ZEH A;  4NGM A;  2NYQ A;  1OZP A;  1VKC A;  4X3R A;  4QVT A;  2G9D A;  6CPA A;  4JJX A;  4NSQ A;  5I4M A;  1CS0 B;  4CO9 A;  2CY2 A;  2P6F A;  1X12 A;  1R61 A;  1RO5 A;  4IUS A;  5JPH A;  2AE6 A;  2F7V A;  3FF3 A;  1Z4R A;  2NMT A;  3PEI A;  4C8P A;  4MRI A;  5K8P A;  3F5B A;  3ISX A;  3K9T A;  2ODF A;  3A9L A;  2FT0 A;  4C8F A;  1KUX A;  3NH4 A;  1V0C A;  4X8I A;  1L0C A;  4HNW B;  5G21 A;  1BAV A;  2HUZ A;  2GE3 A;  5G20 A;  4A95 A;  1YSJ A; 
#chains in the Genus database with same CATH homology
 3VTA A;  1ZLI A;  3FX6 A;  4ZX8 A;  1KWM A;  4OKO A;  4C85 A;  2CIJ A;  3S9N A;  3KHX A;  1FNO A;  4B6Z A;  2JBJ A;  3IEH A;  3PFE A;  4TWE A;  2Q51 A;  2ZEP A;  2AFU A;  5HXD A;  2EK8 A;  4C9R A;  4P4E A;  2CTC A;  1H8L A;  4Q7A A;  2XEI A;  3FH4 A;  4TJV A;  2PJ8 A;  4NFR A;  4CDJ A;  3SI2 A;  2PIZ A;  4EME A;  1Z2L A;  4P44 A;  4NGN A;  4F8Z A;  3S9L A;  4DUK A;  1Y9Z A;  2ZEL A;  1LOK A;  2WZN A;  2AFZ A;  4P4I A;  4NGP A;  3VH9 A;  4PXD A;  4C84 A;  4IK2 A;  4ZY0 A;  1CX8 A;  3GB0 A;  3PB6 X;  4FWU A;  3N5F A;  3H8F A;  2ZOG A;  2V8G A;  3JRU A;  3PB9 X;  3RZA A;  2O4H A;  4MCP A;  2FVG A;  3WC6 A;  1PCA A;  4A39 A;  4PXE A;  4MCS A;  3B3V A;  2QVP A;  3CPX A;  1TF8 A;  2AFX A;  1F2P A;  4CDK A;  1CPS A;  3IC1 A;  3KL9 A;  5CBM A;  2ZEO A;  3B2Y A;  3FMC A;  3IO1 A;  4P45 A;  4MHP A;  2HB6 A;  2PJ7 A;  4FBE A;  1ARM A;  3MRU A;  3CT9 A;  3B3T A;  4EWT A;  2C6P A;  2PIY A;  1YLO A;  2O53 A;  3PB7 X;  3NH8 A;  3KZW A;  3KQX A;  4MHN A;  4NGT A;  2PCU A;  3FJU A;  5LYD A;  2C6G A;  4OC5 A;  2HC9 A;  2AFS A;  5D29 A;  2ZED A;  3I74 A;  1JQG A;  1DE4 C;  1Z5R A;  4BD9 A;  3SI1 A;  2PVV A;  1UWY A;  3GUX A;  3NA6 A;  4OC4 A;  1AYE A;  4JZ0 A;  1CPX A;  1DTD A;  3FVL A;  1ZG7 A;  1IY7 A;  4CPA A;  1Y0R A;  5ELY A;  5HVF A;  1YME A;  3K2K A;  4NGS A;  4RUH A;  4H2K A;  4C99 A;  1ARL A;  2IQ6 A;  3ICU A;  4UIA A;  3MN8 A;  1QQ9 A;  4IAV A;  1TF9 A;  1XF1 A;  1R3N A;  1CP7 A;  4C9A A;  1M4L A;  2C1C A;  3NH5 A;  1HEE A;  4LQG A;  3FEE A;  2JBK A;  1F57 A;  1TKF A;  4P4F A;  3KHZ A;  5LYF A;  4NGR A;  3PBB A;  3EIF A;  4C9V A;  2OR4 A;  4TNU A;  4F9V A;  1LCP A;  2POK A;  2XEJ A;  2PE3 A;  2Q4Z A;  3DGV A;  4C8F A;  1WVM A;  1BPN A;  1PYT B;  2GP4 A;  3T8W A;  1NSA A;  4P4D A;  2QYV A;  5LYL A;  5THW A;  4PXB A;  2C5Q A;  2EWB A;  1YW6 A;  1FT7 A;  3KGQ A;  4UIB A;  4MHZ A;  4P4J A;  5K8N A;  1V6C A;  2ANP A;  2CTB A;  2ZEM A;  4P6Y A;  3V7Z A;  3I6S A;  4GM5 A;  3TC8 A;  4YU9 A;  4AXV A;  3HUV A;  4UEF A;  3VAT A;  3B35 A;  2ZEN A;  3CPA A;  5JM6 A;  5D8N A;  1TKJ A;  2VL1 A;  1ZLH A;  1LAN A;  3B7I A;  2PJ5 A;  2AFM A;  1Z8L A;  4A37 A;  1HDQ A;  4P10 A;  2V8V A;  3D67 A;  5DS0 A;  1Y7E A;  4ZI6 A;  2ZEF A;  4UEE A;  4WJB A;  3D4U A;  3S9M A;  3D7F A;  4IHM A;  3WAB A;  4OC0 A;  2GLF A;  5K8O A;  4NJR A;  2AFO A;  4NJQ A;  5J1Q A;  1XFO A;  3KAS A;  3BI1 A;  4PPZ A;  3IFE A;  2PJ2 A;  4ZYQ A;  2PVW A;  3KI9 A;  2PJ4 A;  3D66 A;  4FAI A;  4UF4 A;  2Q43 A;  3ISZ A;  4MMO A;  1HDU A;  4UEZ A;  1LFW A;  2C6C A;  4R7M A;  1R43 A;  1ZG8 A;  5LRK A;  1ZG9 A;  3SJE A;  1VGY A;  3BHX A;  7CPA A;  5JH9 A;  1XMB A;  5IB9 A;  4W9Y A;  4A38 A;  4OME A;  4EFD A;  4PQA A;  3QNV A;  1VIX A;  5IR2 A;  4ONW A;  2V8H A;  4KSI A;  3GLJ A;  1LAP A;  4MHY A;  3SJG A;  2IMO A;  3TX8 A;  3B3W A;  4JYW A;  3KR5 A;  1XBU A;  3IWW A;  1CP6 A;  2PJB A;  3SJF A;  1YW4 A;  2F8H A;  3RAM A;  4MCR A;  1QMU A;  2ZEE A;  3VAR A;  3PB8 X;  2V8D A;  3D7H A;  5HVG A;  3IJ3 A;  4C9U A;  3FED A;  3PFO A;  4Z65 A;  5K8M A;  1BLL E;  4DYO A;  1CG2 A;  5F09 A;  3I1U A;  4F9U A;  1LAM A;  4C9E A;  1F2O A;  2XEF A;  2V77 A;  4K3N A;  3NFZ A;  3RBU A;  2I3C A;  2PJ3 A;  4ZY1 A;  3SJX A;  4YN3 A;  4ZX9 A;  2ZEG A;  1Y0Y A;  2PJA A;  3B3C A;  5LYI A;  1ELL P;  8CPA A;  4R8F A;  3HLP A;  3BXM A;  4FUU A;  3KQZ A;  3PBE A;  4MCQ A;  3DLJ A;  3PRT A;  4G1P A;  1VHO A;  2OOT A;  2AFW A;  3CDX A;  2ZOF A;  3LMS A;  3D68 A;  2JEW A;  5HVH A;  3IIB A;  2PJ1 A;  3SI0 A;  2DEA A;  3H8G A;  5LRG A;  4MXU A;  2NSM A;  4TJX A;  4YWY A;  1XRY A;  2BOA A;  4C8C A;  3L2N A;  4R76 A;  2BO9 A;  2CF4 A;  4DJL A;  2RFH A;  1BPM A;  2RB7 A;  2GU2 A;  3PB4 X;  2PJ6 A;  4OIW A;  2QJ8 A;  1ELM P;  2PJ0 A;  3WC7 A;  3KR4 A;  2PJC A;  3BI0 A;  1Q7L A;  4OID A;  2GLJ A;  4O23 A;  2IJZ A;  3B3S A;  4C8T A;  2EK9 A;  1TKH A;  2GRE A;  4PXC A;  2BCO A;  2PRQ A;  4P4B A;  1EE3 P;  2XEG A;  3WT4 A;  2WYR A;  5CPA A;  4R6T A;  3LWU A;  3D7G A;  1AMP A;  3V38 A;  4C86 A;  1RTQ A;  2PJ9 A;  4A94 A;  4OC3 A;  4OC1 A;  5JGF A;  4OC2 A;  2ABZ A;  4C8A A;  1TXR A;  3FEC A;  1XJO A;  1VHE A;  4X2T A;  4NGQ A;  1IGB A;  2J9A A;  4KNG E;  5LRJ A;  4OP4 A;  3WC5 A;  1CBX A;  3D7D A;  4WWV A;  4C8U A;  3H8E A;  1GYT A;  4ZY2 A;  1OBR A;  2ZEH A;  4NGM A;  2NYQ A;  4X3R A;  2G9D A;  6CPA A;  5I4M A;  2F7V A;  3FF3 A;  3PEI A;  4C8P A;  4MRI A;  5K8P A;  3ISX A;  3K9T A;  4X8I A;  3NH4 A;  1BAV A;  1YSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...