4NGSA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
696
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 263
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngsA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngsA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngsA02
4KSIA 2GU2A 1BAVA 2FVGA 3LMSA 4F8ZA 4JZ0A 4EFDA 4IHMA 2GLFA 3K2KA 1ZLIA 1CBXA 3HUVA 4ZI6A 3S9MA 3BHXA 1JQGA 1ARLA 3IJ3A 3D67A 2GREA 1Z8LA 2JEWA 2EK8A 1CP7A 3IIBA 3SI2A 4C8TA 5LYDA 4MCRA 1YMEA 2C1CA 3GLJA 3KGQA 5LRGA 1R43A 1CX8A 2EWBA 1H8LA 3B3CA 1TKJA 4P45A 2JBKA 4NGNA 1HEEA 1QMUA 2IJZA 3DGVA 5DS0A 4NGSA 4OC0A 3FJUA 3FEDA 5LYFA 3TC8A 2VL1A 5D8NA 3ISZA 4OKOA 3BI1A 2BO9A 1ZG8A 3L2NA 2AFSA 1AYEA 1CPSA 3D7DA 5ELYA 4LQGA 4KNGE 1XBUA 1ZG9A 4R7MA 4PXDA 3KHXA 1Y0YA 3FX6A 2BOAA 2F7VA 4MCQA 8CPAA 4W9YA 4MHPA 4TJVA 1OBRA 4PPZA 4ZX9A 3I74A 3LWUA 2PVWA 4OMEA 4P4EA 3WT4A 2AFOA 3B7IA 3S9LA 2ZEMA 1FT7A 5HVFA 3ICUA 4MRIA 4UEEA 4YN3A 2ZENA 2ANPA 1F2PA 4G1PA 3MN8A 4YWYA 2V8VA 3NA6A 3BI0A 1BPNA 1R3NA 2J9AA 2PJAA 3PB8X 3RBUA 2DEAA 2HC9A 2PIYA 3VATA 4Q7AA 4OC5A 1TF8A 2G9DA 4NGMA 1DTDA 2Q43A 4K3NA 4X3RA 4P4IA 1F57A 5IB9A 3EIFA 2RB7A 5THWA 5LRJA 3S9NA 3D68A 5CPAA 3K9TA 1Y0RA 3D7GA 3BXMA 3NH4A 1M4LA 2AFWA 4BD9A 4B6ZA 1AMPA 2ZELA 2V77A 4R76A 3D7FA 2PCUA 2NYQA 3IFEA 3KHZA 3B35A 4NGQA 2AFZA 3RAMA 3KQXA 3IO1A 2JBJA 4FBEA 4R6TA 2Q4ZA 1F2OA 4FWUA 2PJ7A 4P44A 3H8FA 3PFEA 5JM6A 1BLLE 1VHOA 3KR5A 2ZEOA 1IGBA 2ZEDA 2OR4A 1Q7LA 7CPAA 3KASA 1LOKA 1UWYA 4NGRA 2ZEEA 3HLPA 2V8HA 3H8GA 2PJ0A 3MRUA 1HDQA 4DYOA 3FEEA 4AXVA 4OC1A 2ABZA 4F9UA 3PBBA 3PBEA 2PJ3A 1ELLP 3PB7X 4ZY0A 3IC1A 4P4DA 2RFHA 3SJGA 2BCOA 4A37A 4OC4A 4C9VA 5D29A 3TX8A 2ZEGA 3PEIA 3VH9A 3PB9X 3KI9A 3SJFA 3KL9A 2ZEHA 3QNVA 1LANA 4TWEA 2O53A 4WWVA 1XF1A 3WC6A 4P4BA 4JYWA 4P4FA 5CBMA 3B2YA 1CP6A 1Y9ZA 2HB6A 2POKA 1YW4A 4C9RA 1ARMA 4ZX8A 1CPXA 1YW6A 1V6CA 1YLOA 2PJ8A 1TKFA 4P4JA 4C8FA 3I6SA 2CF4A 3CT9A 3V38A 4C9UA 5I4MA 4R8FA 4NGTA 1FNOA 4TNUA 4C84A 3KZWA 3B3SA 1QQ9A 5K8OA 5HXDA 1KWMA 2PJBA 1WVMA 4A39A 4F9VA 5J1QA 3FMCA 3B3VA 5LRKA 4A94A 4PQAA 4CDKA 1VIXA 4PXCA 2PJ9A 4X8IA 1XFOA 1RTQA 4MHZA 3CDXA 2AFMA 1YSJA 2WYRA 1PYTB 4C9EA 3B3WA 1ELMP 2V8GA 5LYIA 3ISXA 4MCSA 2PJ6A 2WZNA 4C99A 1LAPA 2C6PA 4MHYA 3PFOA 4NJRA 4IK2A 3NH5A 1GYTA 1IY7A 4C9AA 5JH9A 2ZOGA 4OC3A 2GLJA 2PJ4A 4DUKA 1XRYA 4X2TA 2ZEPA 2C6CA 3WC7A 3NH8A 3IEHA 3WC5A 3FH4A 5K8PA 5LYLA 2I3CA 4OC2A 1VHEA 3VARA 2NSMA 1LCPA 4ZY2A 3CPAA 4GM5A 1HDUA 2CTBA 3IWWA 5JGFA 1TXRA 1Y7EA 4A38A 3D7HA 4OIDA 1XMBA 1Z5RA 3NFZA 4UIBA 2Q51A 4ONWA 4NFRA 4C8UA 3SI1A 4ZYQA 4MCPA 4PXEA 1BPMA 4UEFA 3JRUA 2AFXA 3FVLA 3VTAA 1LFWA 2QVPA 4P10A 4P6YA 3SJEA 4H2KA 2OOTA 5HVGA 4YU9A 4FAIA 2PJCA 2PE3A 2XEIA 2QJ8A 4C8AA 2CTCA 3SJXA 1NSAA 3PRTA 1PCAA 4O23A 1TKHA 3D66A 2XEJA 4MXUA 2EK9A 3H8EA 2CIJA 2C6GA 2PJ5A 3DLJA 1XJOA 3D4UA 4CDJA 5K8NA 3KR4A 3KQZA 3CPXA 3T8WA 2PVVA 2IMOA 2PRQA 3FF3A 4OIWA 3RZAA 4C8CA 1CG2A 4WJBA 2ZEFA 4C8PA 1ZLHA 5HVHA 2F8HA 2O4HA 4NGPA 2PJ2A 4FUUA 4IAVA 4NJQA 1DE4C 3V7ZA 3SI0A 4UEZA 6CPAA 3GB0A 4OP4A 4EWTA 1ZG7A 4TJXA 4C85A 3PB4X 1EE3P 4CPAA 2ZOFA 4UF4A 5K8MA 4MMOA 4DJLA 2AFUA 1LAMA 1Z2LA 5F09A 4EMEA 2IQ6A 4RUHA 4UIAA 4ZY1A 1VGYA 2QYVA 3WABA 4C86A 3PB6X 3B3TA 2V8DA 1TF9A 4Z65A 2PIZA 4PXBA 2XEGA 2PJ1A 2XEFA 3N5FA 3I1UA 3FECA 3GUXA 4MHNA
chains in the Genus database with same CATH superfamily
3DR6A 3TE4A 2JDDA 2AUMA 1YR0A 1S7NA 4XPDB 4KSIA 2EZCA 1BOBA 2GU2A 4H89A 4XNHB 4UCNA 1BAVA 4OLLA 2FVGA 3D2PA 4B14A 3LMSA 1L0CA 4JZ0A 1UFHA 3FYNA 4XPDC 4EFDA 4F8ZA 5F1YA 1A2ZA 1MK4A 2P6GA 4IHMA 2GLFA 4XNHC 3K2KA 1ZLIA 5F5XA 1CBXA 3HUVA 2B5GB 4ZI6A 2VKZG 3IWGA 4A2ZA 3S9MA 3EZEA 2K5TA 3BHXA 1JQGA 1ARLA 3IJ3A 2B4DB 4KOYA 5HH1A 3T8WA 2FT0A 2RC4A 4CRYB 2Q0YA 3D67A 4B5PA 4E2AA 2GREA 1Z8LA 3VRQA 2XPNA 1QSTA 3VRNA 2JEWA 4Q38A 2EK8A 4U9ZA 1CP7A 2CNSA 3IIBA 3SI2A 4E8OA 1GGOA 4C8TA 1Q2YA 1ZYMA 4CAWA 2OZHA 3DSBA 3TCVA 5LYDA 2YJVA 4MCRA 3U88C 1YMEA 4H6UA 3V8IA 2C1CA 3GLJA 3KGQA 2D4OA 2WSAA 5DWMA 5LRGA 1R43A 2OZUA 4UCMA 5J3XA 1PUAA 3F0AA 4ONUA 3TLBA 4GPLB 2OLSA 3VROA 3SR3A 2FCKA 4KOXA 1CX8A 3OWCA 2EWBA 4JXRA 1H8LA 3TOAA 3BUOB 3B3CA 2Z3MA 4QVTA 4F6AA 4HNXB 1TKJA 4YGOA 4P45A 2JBKA 4NGNA 4CYQA 3G23A 1HEEA 1QMUA 4FD6A 2N3AB 2IJZA 2CXAA 3R1KA 4B10A 3DGVA 4Q36A 5DS0A 4NGSA 4LQ6A 4OC0A 1IB1E 3FJUA 3U1BA 4COGA 3G8WA 3PGPA 3PZJA 4CAXA 3FEDA 5LYFA 1Y9KA 3TC8A 2VL1A 2C5QA 5D8NA 3ISZA 4OKOA 4R57A 2EZBA 4MJXA 3BI1A 4AB7A 2BO9A 1ZG8A 3L2NA 2AFSA 1AYEA 1CPSA 3D7DA 4EVYA 5AG4A 4MI4A 5ELYA 4LQGA 4KNGE 4KVXA 3BUXB 2B0AA 1XBUA 1VBGA 3GIUA 3BJ7A 2VQYA 1ZG9A 4BTFA 2D0PA 4MJ8A 4HNYB 5IB0A 4R7MA 1BXRB 2Q4YA 3CXSA 3OB2B 3KHXA 4PXDA 2IL4A 1Y0YA 3FX6A 2BOAA 3VWDA 2F7VA 5A28A 4E94A 4MCQA 8CPAA 1A9XB 4NEXA 2QMLA 4C2XA 2OU2A 2PCNA 4W9YA 4LX9A 4MHPA 4TJVA 1IICA 1R57A 1OBRA 4PPZA 4ZX9A 2D0OA 4OADA 1YVKA 3LWUA 5F47A 1ZRSA 3VGOA 2PVWA 2HV2A 3I74A 5F9MA 3TLGB 4KVME 4OMEA 4P4EA 2QIRA 1YGHA 3K9UA 3WT4A 2AFOA 2Z10A 1CJWA 3EFAA 4CGPA 3B7IA 3S9LA 2ZEMA 1FT7A 3W91A 5HVFA 1NBWA 5G20A 3ICUA 3NFQA 1M4GA 4KLVA 3TYXA 4MRIA 4UEEA 5EC4A 1YLEA 4NCZA 4YN3A 2ZENA 2ANPA 2VZZA 1F2PA 4G1PA 2BUEA 3B8GA 4QC6A 3MN8A 2VXKA 4YWYA 3T0TA 2V8VA 3NA6A 4INJA 3BI0A 5JPHA 4CO9A 2I79A 2ATRA 1BPNA 2JLMA 4MFPA 1R3NA 1Z8WA 5H86A 2J9AA 2PJAA 2QECA 3PB8X 1JDEA 3RBUA 3GY9A 4CRZB 2DEAA 2HC9A 4C9RA 2YGWA 2PIYA 4HKFA 3LD2A 4Q7AA 3VATA 4OC5A 4CGMA 5HMNA 3ZNIA 1TF8A 2G9DA 3O8ZA 4NGMA 3DNSA 1DTDA 3BLNA 3JTKA 3UY5A 2Q43A 4AVBA 4AVAA 1KEEB 1OZPA 3RYOA 4K3NA 4X3RA 1DIKA 3R9GA 3TLAA 4P4IA 1F57A 5G1ZA 5IB9A 3EIFA 5I0CA 2RB7A 5THWA 5LRJA 5BWAB 3S9NA 3D68A 5CPAA 3OB1B 3K9TA 2Q44A 1Y0RA 3D7GA 1FBVA 3BXMA 3TTHA 3NH4A 1M4LA 1EZBA 2AFWA 3PP9A 4ORFA 4BD9A 2B4BA 4JWPA 4KOTA 3W6XA 4B6ZA 3TLZA 3PT1A 1AMPA 2ZELA 4PK2A 2V77A 4R76A 5F48A 2PQ8A 4Y49B 4YRHA 4DNCA 4UWIA 3D7FA 1MJ9A 2G0BA 2NYQA 2PCUA 2Z3OA 3B35A 3IFEA 1BO4A 3KHZA 2F5IA 4KS9A 4NGQA 4M3SA 4RS2A 2J8MA 4MFLA 2AFZA 3RAMA 3ZJ0A 2PDOA 1EZAA 4BPWB 1M44A 2O28A 3KQXA 1Z8XA 3IO1A 1NE9A 2GIVA 2Q04A 2JBJA 3RO0A 4FBEA 4R6TA 3RNZA 2Q4ZA 1F2OA 4FWUA 2PJ7A 4P44A 2B4DA 3CZXA 2ZW6A 3H8FA 1U6MA 2OB0A 3PFEA 1WJTA 3WR7A 1BLLE 1VHOA 2Z3PA 4F0XA 5BY0A 5JM6A 4L89A 3KR5A 2ZEOA 1IGBA 3FBUA 2ZEDA 2OR4A 3R96A 1Q7LA 1CE8B 2HWGA 4KUBA 3T07A 3S6GA 2PC1A 2B3VA 4MY3A 7CPAA 4L8AA 3VRPA 3KASA 1LOKA 1UWYA 4MY0A 4NGRA 4M85A 3T05A 1S7FA 2ZEEA 2V8HA 3BUMB 3H8GA 3HLPA 2ARHA 2YNCC 2PJ0A 3MRUA 3TO7A 1HDQA 3EO4A 4DYOA 4YFJA 3FEEA 3D8PA 4OC1A 2ABZA 1JWQA 2CY2A 4AXVA 1NMTA 2VEZA 4CGNA 4F9UA 3PBBA 4A4CA 1Z4RA 4NSQA 5H84A 1PU9A 3PBEA 2PJ3A 4RI1A 5FVJA 5HKZA 1ELLP 3PB7X 1ZO0A 3N7ZA 4C7HA 4ZY0A 4AVCA 3IC1A 1YVHA 4P4DA 1J4JA 3SJGA 2RFHA 2BCOA 1QSMA 3JVNA 4MBUA 4OC4A 4A37A 4C68A 5D29A 1X10A 1T36B 1XEBA 3TX8A 4A31A 4IIYA 1XE4A 2ZEGA 1N71A 3PEIA 3VH9A 1KUVA 3PB9X 5KTDA 3KI9A 3SJFA 2YNDA 3KL9A 2ZEHA 5IR2A 1IOFA 2FXFA 1LANA 3QNVA 1V0CA 4PK3A 1QSNA 4QB9A 4TWEA 4II9A 5JYBA 3FXTA 2O53A 5IV0A 3GYAA 2DIKA 5HKWA 3E0KA 4WWVA 1XF1A 4KOSA 4U9YA 3WC6A 3GKRA 3KRVA 3SXOA 4P4BA 1Y9WA 4JYWA 3EZAA 2ODFA 3DDDA 4P4FA 5CBMA 5HKYA 3B2YA 2BEIA 2G3TA 1C30B 1CP6A 3R9EA 1Y9ZA 2DF5A 2HB6A 2POKA 4JLYA 4QBJA 2GFQA 2DPSA 4GXHA 1YW4A 3ZZIA 1ARMA 4CAEA 3HMJG 4MHDA 4JD6A 4ZX8A 3TOBA 2J8NA 3QAYA 3QB8A 1CPXA 1YW6A 4B11A 1V6CA 1YLOA 2PJ8A 1M4DA 1TKFA 1XIXA 4P4JA 2DPTA 2Q4VA 4C8FA 4H1HA 2DLAA 4M6GA 4CAVA 2HROA 2REEA 3I6SA 4JJXA 4KUAA 2CF4A 2FM4A 3I3GA 3W6SA 5AXIA 4UFXA 1RO5A 1Z9UA 3CT9A 4XPKA 3V38A 4C9UA 4J0NA 2ZPAA 4NXYA 3T90A 4KOUA 5I4MA 2D4PA 4R8FA 4NGTA 3HPGG 1FNOA 2FIWA 2HQYA 3S6KA 5AG5A 4TNUA 4C84A 3F5BA 3KZWA 1IYKA 4B5OA 4ZGYB 3B3SA 1QQ9A 2A4NA 2E28A 5K8OA 5HXDA 5IX3A 1YX0A 1KWMA 5F46A 5JVLA 2PJBA 1WVMA 4A39A 1P0HA 3H4QA 4F9VA 3FMCA 4K30A 2UV8G 3B3VA 5J1QA 1Z8TA 5LRKA 4MFJA 3TFYA 1VKCA 4KZTA 4A94A 4PQAA 4CDKA 4UCPA 1VIXA 4PXCA 3NOJA 2PJ9A 4CYPA 3D2MA 4JXQA 1NXJA 2JEVA 3CXPA 3FIXA 2YJTA 4X8IA 4A33A 1XFOA 4R9MA 1RTQA 3P2HA 1CM0A 4MHZA 2G3AA 3CDXA 2AFMA 1K4JA 4KSAA 1YSJA 1M6VB 2FL4A 1P4NA 1PYTB 2WYRA 3B3WA 4C9EA 3LODA 2Z11A 3JUWA 2XPOA 1ELMP 2V8GA 5AG6A 2YNEA 4MCSA 3ISXA 5LYIA 4BBHA 3PLFB 2GE3A 2PJ6A 2WZNA 3GJZA 2R1IA 5JQ4A 1LAPA 2R7HA 4C99A 2C6PA 5J8FA 2AJ6A 1M4IA 3A9LA 4CGLA 5ISVA 1KZFA 4MHYA 3PFOA 4NJRA 4Y49C 2B5GA 2J8RA 4CGOA 2B4JC 3NH5A 1GYTA 1IY7A 4IK2A 4C9AA 2CNTA 2ZOGA 5JH9A 1X12A 4OC3A 2YNCA 3MGDA 4R3KA 1YQEA 1Q5XA 4NF1A 2Y1MA 2HUZA 3IWEA 5A27A 2PR1A 2GLJA 2PJ4A 1ZL0A 4DUKA 3F9KC 3FB3A 5GCNA 1XRYA 3QAHA 1XMTA 3DR8A 2VBQA 3S6HA 4X2TA 2ZEPA 2C6CA 3C8OA 3WC7A 1IOIA 3NH8A 3IEHA 3WC5A 3FH4A 5K8PA 4PSXA 2I3CA 5LYLA 4OC2A 1IIDA 1VHEA 2WUUA 3FNCA 3VARA 4A95A 2NSMA 3VWEA 1LCPA 4A30A 4ZY2A 2OH1A 4LUAA 3CPAA 4GM5A 1HDUA 1I21A 2VZYA 4FD7A 2DXQA 4HPSA 5KTCA 1Y7RA 2CTBA 3IWWA 2Y0MA 2Y1NA 1S7LA 4JVOA 4EYSA 4CYOA 2P6FA 5JGFA 1WWZA 1TXRA 4C2ZA 3NE8A 1Y7EA 5EBVA 1XOVA 3D7HA 4OIDA 4IF5A 4A38A 2R8VA 5KTAA 2ZW7A 5AGEA 1XMBA 1Z5RA 1M1DA 3NFZA 4AG7A 4UIBA 3KKWA 4OAEA 2Q51A 4ONWA 3P2FA 4NFRA 1J3LA 4C8UA 3SI1A 4ZYQA 1KC7A 3SHPA 2FIAA 4RR2B 4KVOE 4MCPA 1I12A 4PXEA 1BPMA 4FD4A 3CXQA 4UEFA 3JRUA 4C2YA 3K4IA 3C26A 1B87A 2AFXA 2Z0ZA 4CAFA 2OZGA 1C3OB 2WPXA 4J3GA 3FVLA 2HI6A 3VTAA 1LFWA 4B5PB 2FSRA 2QVPA 1LRZA 1SQHA 2EO8A 1VHSA 2NMTA 4P10A 4MFZA 3HPHE 1CS0B 4COBA 4P6YA 2MP0A 5F49A 4R3LA 3SJEA 2PR8A 5G21A 4H2KA 2OOTA 5HVGA 4YU9A 4FAIA 1RXTA 2PE3A 2PJCA 3H5ZA 5K99A 4UA3A 3TLGA 2XEIA 2QJ8A 2XPPA 2CTCA 4C8AA 3SJXA 1NSAA 3PRTA 1PCAA 4I49A 4MFKA 4E0AA 1KBLA 5G22A 1VI4A 4O23A 1TKHA 3FRMA 1B6BA 4KOWA 1YVOA 2Q7BA 4CZ1A 3D66A 3EXNA 3T5MA 3IGRA 1S5KA 2ZW5A 4ZBGA 2EZAA 2R82A 1Q2CA 1Q2DA 4CS0B 4A4BA 2XEJA 3BUWB 4MXUA 4BMHA 4C85A 4XPLA 3BUNB 2EK9A 4PV6A 3H8EA 2CIJA 2B3UA 4A32A 2C6GA 2PJ5A 2VI7A 2WPWA 2Z3LA 2BSWA 3NE7A 3DLJA 3R95A 1QSRA 3TLEA 1XJOA 3D4UA 3TO6A 4CDJA 1Z4EA 4KSFA 5K8NA 3I9SA 3KR4A 2EUIA 3CPXA 1YK3A 2CNMA 3KQZA 2B58A 2PVVA 1S60A 2IMOA 3EY5A 1WK4A 4HNWB 4M6HA 4QUSA 4B13A 5J8CA 1QSOA 2H5MA 2PRQA 4UBRA 4UWJA 3FF3A 1KUXA 1MJBA 4OIWA 3RZAA 4B12A 4C8CA 1CG2A 4KLWA 1S7KA 4BPXB 1YREA 4WJBA 2R98A 2AE6A 2ZEFA 2X0SA 2ZXVA 4M6IA 1NSLA 3TLYA 4C8PA 2XPLA 1AUGA 1ZLHA 1S3ZA 4AG9A 5HVHA 2FE7A 3D3SA 2F8HA 2O4HA 4PSWA 2C27A 4NGPA 2PJ2A 3LACA 4R87A 4C9VA 1R61A 4FUUA 3PFVA 5FD8A 4IAVA 4NJQA 1DE4C 4IIXA 3V7ZA 3SI0A 4UEZA 4C7IA 2P6EA 4U5YA 6CPAA 3GB0A 4MFQA 4OP4A 3IU1A 4FD5A 2Z3NA 3IU2A 1FY7A 1ZG7A 2PSWA 3R9FA 4EWTA 2AUNA 4M8DA 3PB4X 1EE3P 2JDCA 1I1DA 2ZOFA 4UF4A 4CPAA 4TJXA 5K8MA 1VBHA 2EVNA 4MMOA 4BPUB 3S6FA 4DJLA 2CBLA 3OP0A 3EC4A 2P0WA 2AFUA 1Z9EA 1LAMA 1Z2LA 5F09A 4RN7A 3SXNA 4F0YA 3EZBA 2Z3KA 4E5SA 1EO0A 4KOVA 2GANA 2KCWA 4H6ZA 1B47A 5DWNA 5EMIA 4EMEA 4MI1A 2IQ6A 3BJ8A 5CNPA 2PRBA 1KUYA 4KORA 5C88A 4RUHA 1XF8A 4UIAA 4CYNA 4ZY1A 1JDBC 1TIQA 3OAKA 1VGYA 3TO9A 2QYVA 4UFWA 3VRRA 3WABA 2X7BA 4C86A 4BINA 1ON0A 3PB6X 3B3TA 2BL1A 5E96A 5C82A 1MJAA 2V8DA 1TF9A 4Z65A 2Q7SA 4GS4A 2PIZA 2ZW4A 4IUSA 4PXBA 3G3SA 2XEGA 1GHEA 2I00A 2PJ1A 2GP4A 2XEFA 3N5FA 4X5KA 3TT2A 3FECA 5F13A 2FS5A 2REFA 3F8KA 3GUXA 3I1UA 4UFVA 5AG7A 3T9YA 2EBJA 3TLCA 1IU8A 4MHNA 1IYLA
chains in the Genus database with same CATH topology
4KSIA 2GU2A 1BAVA 2FVGA 3LMSA 4F8ZA 4JZ0A 4EFDA 4IHMA 2GLFA 3K2KA 1ZLIA 1CBXA 3HUVA 4ZI6A 3S9MA 3BHXA 1JQGA 1ARLA 3IJ3A 3D67A 2GREA 1Z8LA 2JEWA 2EK8A 1CP7A 3IIBA 3SI2A 4C8TA 5LYDA 4MCRA 1YMEA 2C1CA 3GLJA 3KGQA 5LRGA 1R43A 1CX8A 2EWBA 1H8LA 3B3CA 1TKJA 4P45A 2JBKA 4NGNA 1HEEA 1QMUA 2IJZA 3DGVA 5DS0A 4NGSA 4OC0A 3FJUA 3FEDA 5LYFA 3TC8A 2VL1A 2C5QA 5D8NA 3ISZA 4OKOA 3BI1A 2BO9A 1ZG8A 3L2NA 2AFSA 1AYEA 1CPSA 3D7DA 5ELYA 4LQGA 4KNGE 1XBUA 1ZG9A 4R7MA 4PXDA 3KHXA 1Y0YA 3FX6A 2BOAA 2F7VA 4MCQA 8CPAA 4W9YA 4MHPA 4TJVA 1OBRA 4PPZA 4ZX9A 3I74A 3LWUA 2PVWA 4OMEA 4P4EA 3WT4A 2AFOA 3B7IA 3S9LA 2ZEMA 1FT7A 5HVFA 3ICUA 4MRIA 4UEEA 4YN3A 2ZENA 2ANPA 1F2PA 4G1PA 3MN8A 4YWYA 2V8VA 3NA6A 3BI0A 1BPNA 1R3NA 2J9AA 2PJAA 3PB8X 3RBUA 2DEAA 2HC9A 2PIYA 3VATA 4Q7AA 4OC5A 1TF8A 2G9DA 4NGMA 1DTDA 2Q43A 4K3NA 4X3RA 4P4IA 1F57A 5IB9A 3EIFA 2RB7A 5THWA 5LRJA 3S9NA 3D68A 5CPAA 3K9TA 1Y0RA 3D7GA 3BXMA 3NH4A 1M4LA 2AFWA 4BD9A 4B6ZA 1AMPA 2ZELA 2V77A 4R76A 3D7FA 2PCUA 2NYQA 3IFEA 3KHZA 3B35A 4NGQA 2AFZA 3RAMA 3KQXA 3IO1A 2JBJA 4FBEA 4R6TA 2Q4ZA 1F2OA 4FWUA 2PJ7A 4P44A 3H8FA 3PFEA 5JM6A 1BLLE 1VHOA 3KR5A 2ZEOA 1IGBA 2ZEDA 2OR4A 1Q7LA 7CPAA 3KASA 1LOKA 1UWYA 4NGRA 2ZEEA 3HLPA 2V8HA 3H8GA 2PJ0A 3MRUA 1HDQA 4DYOA 3FEEA 4AXVA 4OC1A 2ABZA 4F9UA 3PBBA 3PBEA 2PJ3A 1ELLP 3PB7X 4ZY0A 3IC1A 4P4DA 2RFHA 3SJGA 2BCOA 4A37A 4OC4A 4C9VA 5D29A 3TX8A 2ZEGA 3PEIA 3VH9A 3PB9X 3KI9A 3SJFA 3KL9A 2ZEHA 5IR2A 3QNVA 1LANA 4TWEA 2O53A 4WWVA 1XF1A 3WC6A 4P4BA 4JYWA 4P4FA 5CBMA 3B2YA 1CP6A 1Y9ZA 2HB6A 2POKA 1YW4A 4C9RA 1ARMA 4ZX8A 1CPXA 1YW6A 1V6CA 1YLOA 2PJ8A 1TKFA 4P4JA 4C8FA 3I6SA 2CF4A 3CT9A 3V38A 4C9UA 5I4MA 4R8FA 4NGTA 1FNOA 4TNUA 4C84A 3KZWA 3B3SA 1QQ9A 5K8OA 5HXDA 1KWMA 2PJBA 1WVMA 4A39A 4F9VA 5J1QA 3FMCA 3B3VA 5LRKA 4A94A 4PQAA 4CDKA 1VIXA 4PXCA 2PJ9A 4X8IA 1XFOA 1RTQA 4MHZA 3CDXA 2AFMA 1YSJA 2WYRA 1PYTB 4C9EA 3B3WA 1ELMP 2V8GA 5LYIA 3ISXA 4MCSA 2PJ6A 2WZNA 4C99A 1LAPA 2C6PA 4MHYA 3PFOA 4NJRA 4IK2A 3NH5A 1GYTA 1IY7A 4C9AA 5JH9A 2ZOGA 4OC3A 2GLJA 2PJ4A 4DUKA 1XRYA 4X2TA 2ZEPA 2C6CA 3WC7A 3NH8A 3IEHA 3WC5A 3FH4A 5K8PA 5LYLA 2I3CA 4OC2A 1VHEA 3VARA 2NSMA 1LCPA 4ZY2A 3CPAA 4GM5A 1HDUA 2CTBA 3IWWA 5JGFA 1TXRA 1Y7EA 4A38A 3D7HA 4OIDA 1XMBA 1Z5RA 3NFZA 4UIBA 2Q51A 4ONWA 4NFRA 4C8UA 3SI1A 4ZYQA 4MCPA 4PXEA 1BPMA 4UEFA 3JRUA 2AFXA 3FVLA 3VTAA 1LFWA 2QVPA 4P10A 4P6YA 3SJEA 4H2KA 2OOTA 5HVGA 4YU9A 4FAIA 2PJCA 2PE3A 2XEIA 2QJ8A 4C8AA 2CTCA 3SJXA 1NSAA 3PRTA 1PCAA 4O23A 1TKHA 3D66A 2XEJA 4MXUA 2EK9A 3H8EA 2CIJA 2C6GA 2PJ5A 3DLJA 1XJOA 3D4UA 4CDJA 5K8NA 3KR4A 3KQZA 3CPXA 3T8WA 2PVVA 2IMOA 2PRQA 3FF3A 4OIWA 3RZAA 4C8CA 1CG2A 4WJBA 2ZEFA 4C8PA 1ZLHA 5HVHA 2F8HA 2O4HA 4NGPA 2PJ2A 4FUUA 4IAVA 4NJQA 1DE4C 3V7ZA 3SI0A 4UEZA 6CPAA 3GB0A 4OP4A 4EWTA 1ZG7A 4TJXA 4C85A 3PB4X 1EE3P 4CPAA 2ZOFA 4UF4A 5K8MA 4MMOA 4DJLA 2AFUA 1LAMA 1Z2LA 5F09A 4EMEA 2IQ6A 4RUHA 4UIAA 4ZY1A 1VGYA 2QYVA 3WABA 4C86A 3PB6X 3B3TA 2V8DA 1TF9A 4Z65A 2PIZA 4PXBA 2XEGA 2PJ1A 2GP4A 2XEFA 3N5FA 3I1UA 3FECA 3GUXA 4MHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSI A;  2GU2 A;  1BAV A;  2FVG A;  3LMS A;  4F8Z A;  4JZ0 A;  4EFD A;  4IHM A;  2GLF A;  3K2K A;  1ZLI A;  1CBX A;  3HUV A;  4ZI6 A;  3S9M A;  3BHX A;  1JQG A;  1ARL A;  3IJ3 A;  3D67 A;  2GRE A;  1Z8L A;  2JEW A;  2EK8 A;  1CP7 A;  3IIB A;  3SI2 A;  4C8T A;  5LYD A;  4MCR A;  1YME A;  2C1C A;  3GLJ A;  3KGQ A;  5LRG A;  1R43 A;  1CX8 A;  2EWB A;  1H8L A;  3B3C A;  1TKJ A;  4P45 A;  2JBK A;  4NGN A;  1HEE A;  1QMU A;  2IJZ A;  3DGV A;  5DS0 A;  4NGS A;  4OC0 A;  3FJU A;  3FED A;  5LYF A;  3TC8 A;  2VL1 A;  5D8N A;  3ISZ A;  4OKO A;  3BI1 A;  2BO9 A;  1ZG8 A;  3L2N A;  2AFS A;  1AYE A;  1CPS A;  3D7D A;  5ELY A;  4LQG A;  4KNG E;  1XBU A;  1ZG9 A;  4R7M A;  4PXD A;  3KHX A;  1Y0Y A;  3FX6 A;  2BOA A;  2F7V A;  4MCQ A;  8CPA A;  4W9Y A;  4MHP A;  4TJV A;  1OBR A;  4PPZ A;  4ZX9 A;  3I74 A;  3LWU A;  2PVW A;  4OME A;  4P4E A;  3WT4 A;  2AFO A;  3B7I A;  3S9L A;  2ZEM A;  1FT7 A;  5HVF A;  3ICU A;  4MRI A;  4UEE A;  4YN3 A;  2ZEN A;  2ANP A;  1F2P A;  4G1P A;  3MN8 A;  4YWY A;  2V8V A;  3NA6 A;  3BI0 A;  1BPN A;  1R3N A;  2J9A A;  2PJA A;  3PB8 X;  3RBU A;  2DEA A;  2HC9 A;  2PIY A;  3VAT A;  4Q7A A;  4OC5 A;  1TF8 A;  2G9D A;  4NGM A;  1DTD A;  2Q43 A;  4K3N A;  4X3R A;  4P4I A;  1F57 A;  5IB9 A;  3EIF A;  2RB7 A;  5THW A;  5LRJ A;  3S9N A;  3D68 A;  5CPA A;  3K9T A;  1Y0R A;  3D7G A;  3BXM A;  3NH4 A;  1M4L A;  2AFW A;  4BD9 A;  4B6Z A;  1AMP A;  2ZEL A;  2V77 A;  4R76 A;  3D7F A;  2PCU A;  2NYQ A;  3IFE A;  3KHZ A;  3B35 A;  4NGQ A;  2AFZ A;  3RAM A;  3KQX A;  3IO1 A;  2JBJ A;  4FBE A;  4R6T A;  2Q4Z A;  1F2O A;  4FWU A;  2PJ7 A;  4P44 A;  3H8F A;  3PFE A;  5JM6 A;  1BLL E;  1VHO A;  3KR5 A;  2ZEO A;  1IGB A;  2ZED A;  2OR4 A;  1Q7L A;  7CPA A;  3KAS A;  1LOK A;  1UWY A;  4NGR A;  2ZEE A;  3HLP A;  2V8H A;  3H8G A;  2PJ0 A;  3MRU A;  1HDQ A;  4DYO A;  3FEE A;  4AXV A;  4OC1 A;  2ABZ A;  4F9U A;  3PBB A;  3PBE A;  2PJ3 A;  1ELL P;  3PB7 X;  4ZY0 A;  3IC1 A;  4P4D A;  2RFH A;  3SJG A;  2BCO A;  4A37 A;  4OC4 A;  4C9V A;  5D29 A;  3TX8 A;  2ZEG A;  3PEI A;  3VH9 A;  3PB9 X;  3KI9 A;  3SJF A;  3KL9 A;  2ZEH A;  3QNV A;  1LAN A;  4TWE A;  2O53 A;  4WWV A;  1XF1 A;  3WC6 A;  4P4B A;  4JYW A;  4P4F A;  5CBM A;  3B2Y A;  1CP6 A;  1Y9Z A;  2HB6 A;  2POK A;  1YW4 A;  4C9R A;  1ARM A;  4ZX8 A;  1CPX A;  1YW6 A;  1V6C A;  1YLO A;  2PJ8 A;  1TKF A;  4P4J A;  4C8F A;  3I6S A;  2CF4 A;  3CT9 A;  3V38 A;  4C9U A;  5I4M A;  4R8F A;  4NGT A;  1FNO A;  4TNU A;  4C84 A;  3KZW A;  3B3S A;  1QQ9 A;  5K8O A;  5HXD A;  1KWM A;  2PJB A;  1WVM A;  4A39 A;  4F9V A;  5J1Q A;  3FMC A;  3B3V A;  5LRK A;  4A94 A;  4PQA A;  4CDK A;  1VIX A;  4PXC A;  2PJ9 A;  4X8I A;  1XFO A;  1RTQ A;  4MHZ A;  3CDX A;  2AFM A;  1YSJ A;  2WYR A;  1PYT B;  4C9E A;  3B3W A;  1ELM P;  2V8G A;  5LYI A;  3ISX A;  4MCS A;  2PJ6 A;  2WZN A;  4C99 A;  1LAP A;  2C6P A;  4MHY A;  3PFO A;  4NJR A;  4IK2 A;  3NH5 A;  1GYT A;  1IY7 A;  4C9A A;  5JH9 A;  2ZOG A;  4OC3 A;  2GLJ A;  2PJ4 A;  4DUK A;  1XRY A;  4X2T A;  2ZEP A;  2C6C A;  3WC7 A;  3NH8 A;  3IEH A;  3WC5 A;  3FH4 A;  5K8P A;  5LYL A;  2I3C A;  4OC2 A;  1VHE A;  3VAR A;  2NSM A;  1LCP A;  4ZY2 A;  3CPA A;  4GM5 A;  1HDU A;  2CTB A;  3IWW A;  5JGF A;  1TXR A;  1Y7E A;  4A38 A;  3D7H A;  4OID A;  1XMB A;  1Z5R A;  3NFZ A;  4UIB A;  2Q51 A;  4ONW A;  4NFR A;  4C8U A;  3SI1 A;  4ZYQ A;  4MCP A;  4PXE A;  1BPM A;  4UEF A;  3JRU A;  2AFX A;  3FVL A;  3VTA A;  1LFW A;  2QVP A;  4P10 A;  4P6Y A;  3SJE A;  4H2K A;  2OOT A;  5HVG A;  4YU9 A;  4FAI A;  2PJC A;  2PE3 A;  2XEI A;  2QJ8 A;  4C8A A;  2CTC A;  3SJX A;  1NSA A;  3PRT A;  1PCA A;  4O23 A;  1TKH A;  3D66 A;  2XEJ A;  4MXU A;  2EK9 A;  3H8E A;  2CIJ A;  2C6G A;  2PJ5 A;  3DLJ A;  1XJO A;  3D4U A;  4CDJ A;  5K8N A;  3KR4 A;  3KQZ A;  3CPX A;  3T8W A;  2PVV A;  2IMO A;  2PRQ A;  3FF3 A;  4OIW A;  3RZA A;  4C8C A;  1CG2 A;  4WJB A;  2ZEF A;  4C8P A;  1ZLH A;  5HVH A;  2F8H A;  2O4H A;  4NGP A;  2PJ2 A;  4FUU A;  4IAV A;  4NJQ A;  1DE4 C;  3V7Z A;  3SI0 A;  4UEZ A;  6CPA A;  3GB0 A;  4OP4 A;  4EWT A;  1ZG7 A;  4TJX A;  4C85 A;  3PB4 X;  1EE3 P;  4CPA A;  2ZOF A;  4UF4 A;  5K8M A;  4MMO A;  4DJL A;  2AFU A;  1LAM A;  1Z2L A;  5F09 A;  4EME A;  2IQ6 A;  4RUH A;  4UIA A;  4ZY1 A;  1VGY A;  2QYV A;  3WAB A;  4C86 A;  3PB6 X;  3B3T A;  2V8D A;  1TF9 A;  4Z65 A;  2PIZ A;  4PXB A;  2XEG A;  2PJ1 A;  2XEF A;  3N5F A;  3I1U A;  3FEC A;  3GUX A;  4MHN A; 
#chains in the Genus database with same CATH topology
 3DR6 A;  3TE4 A;  2JDD A;  2AUM A;  1YR0 A;  1S7N A;  4XPD B;  4KSI A;  2EZC A;  1BOB A;  2GU2 A;  4H89 A;  4XNH B;  4UCN A;  1BAV A;  4OLL A;  2FVG A;  3D2P A;  4B14 A;  3LMS A;  1L0C A;  4JZ0 A;  1UFH A;  3FYN A;  4XPD C;  4EFD A;  4F8Z A;  5F1Y A;  1A2Z A;  1MK4 A;  2P6G A;  4IHM A;  2GLF A;  4XNH C;  3K2K A;  1ZLI A;  5F5X A;  1CBX A;  3HUV A;  2B5G B;  4ZI6 A;  2VKZ G;  3IWG A;  4A2Z A;  3S9M A;  3EZE A;  2K5T A;  3BHX A;  1JQG A;  1ARL A;  3IJ3 A;  2B4D B;  4KOY A;  5HH1 A;  3T8W A;  2FT0 A;  2RC4 A;  4CRY B;  2Q0Y A;  3D67 A;  4B5P A;  4E2A A;  2GRE A;  1Z8L A;  3VRQ A;  2XPN A;  1QST A;  3VRN A;  2JEW A;  4Q38 A;  2EK8 A;  4U9Z A;  1CP7 A;  2CNS A;  3IIB A;  3SI2 A;  4E8O A;  1GGO A;  4C8T A;  1Q2Y A;  1ZYM A;  4CAW A;  2OZH A;  3DSB A;  3TCV A;  5LYD A;  2YJV A;  4MCR A;  3U88 C;  1YME A;  4H6U A;  3V8I A;  2C1C A;  3GLJ A;  3KGQ A;  2D4O A;  2WSA A;  5DWM A;  5LRG A;  1R43 A;  2OZU A;  4UCM A;  5J3X A;  1PUA A;  3F0A A;  4ONU A;  3TLB A;  4GPL B;  2OLS A;  3VRO A;  3SR3 A;  2FCK A;  4KOX A;  1CX8 A;  3OWC A;  2EWB A;  4JXR A;  1H8L A;  3TOA A;  3BUO B;  3B3C A;  2Z3M A;  4QVT A;  4F6A A;  4HNX B;  1TKJ A;  4YGO A;  4P45 A;  2JBK A;  4NGN A;  4CYQ A;  3G23 A;  1HEE A;  1QMU A;  4FD6 A;  2N3A B;  2IJZ A;  2CXA A;  3R1K A;  4B10 A;  3DGV A;  4Q36 A;  5DS0 A;  4NGS A;  4LQ6 A;  4OC0 A;  1IB1 E;  3FJU A;  3U1B A;  4COG A;  3G8W A;  3PGP A;  3PZJ A;  4CAX A;  3FED A;  5LYF A;  1Y9K A;  3TC8 A;  2VL1 A;  2C5Q A;  5D8N A;  3ISZ A;  4OKO A;  4R57 A;  2EZB A;  4MJX A;  3BI1 A;  4AB7 A;  2BO9 A;  1ZG8 A;  3L2N A;  2AFS A;  1AYE A;  1CPS A;  3D7D A;  4EVY A;  5AG4 A;  4MI4 A;  5ELY A;  4LQG A;  4KNG E;  4KVX A;  3BUX B;  2B0A A;  1XBU A;  1VBG A;  3GIU A;  3BJ7 A;  2VQY A;  1ZG9 A;  4BTF A;  2D0P A;  4MJ8 A;  4HNY B;  5IB0 A;  4R7M A;  1BXR B;  2Q4Y A;  3CXS A;  3OB2 B;  3KHX A;  4PXD A;  2IL4 A;  1Y0Y A;  3FX6 A;  2BOA A;  3VWD A;  2F7V A;  5A28 A;  4E94 A;  4MCQ A;  8CPA A;  1A9X B;  4NEX A;  2QML A;  4C2X A;  2OU2 A;  2PCN A;  4W9Y A;  4LX9 A;  4MHP A;  4TJV A;  1IIC A;  1R57 A;  1OBR A;  4PPZ A;  4ZX9 A;  2D0O A;  4OAD A;  1YVK A;  3LWU A;  5F47 A;  1ZRS A;  3VGO A;  2PVW A;  2HV2 A;  3I74 A;  5F9M A;  3TLG B;  4KVM E;  4OME A;  4P4E A;  2QIR A;  1YGH A;  3K9U A;  3WT4 A;  2AFO A;  2Z10 A;  1CJW A;  3EFA A;  4CGP A;  3B7I A;  3S9L A;  2ZEM A;  1FT7 A;  3W91 A;  5HVF A;  1NBW A;  5G20 A;  3ICU A;  3NFQ A;  1M4G A;  4KLV A;  3TYX A;  4MRI A;  4UEE A;  5EC4 A;  1YLE A;  4NCZ A;  4YN3 A;  2ZEN A;  2ANP A;  2VZZ A;  1F2P A;  4G1P A;  2BUE A;  3B8G A;  4QC6 A;  3MN8 A;  2VXK A;  4YWY A;  3T0T A;  2V8V A;  3NA6 A;  4INJ A;  3BI0 A;  5JPH A;  4CO9 A;  2I79 A;  2ATR A;  1BPN A;  2JLM A;  4MFP A;  1R3N A;  1Z8W A;  5H86 A;  2J9A A;  2PJA A;  2QEC A;  3PB8 X;  1JDE A;  3RBU A;  3GY9 A;  4CRZ B;  2DEA A;  2HC9 A;  4C9R A;  2YGW A;  2PIY A;  4HKF A;  3LD2 A;  4Q7A A;  3VAT A;  4OC5 A;  4CGM A;  5HMN A;  3ZNI A;  1TF8 A;  2G9D A;  3O8Z A;  4NGM A;  3DNS A;  1DTD A;  3BLN A;  3JTK A;  3UY5 A;  2Q43 A;  4AVB A;  4AVA A;  1KEE B;  1OZP A;  3RYO A;  4K3N A;  4X3R A;  1DIK A;  3R9G A;  3TLA A;  4P4I A;  1F57 A;  5G1Z A;  5IB9 A;  3EIF A;  5I0C A;  2RB7 A;  5THW A;  5LRJ A;  5BWA B;  3S9N A;  3D68 A;  5CPA A;  3OB1 B;  3K9T A;  2Q44 A;  1Y0R A;  3D7G A;  1FBV A;  3BXM A;  3TTH A;  3NH4 A;  1M4L A;  1EZB A;  2AFW A;  3PP9 A;  4ORF A;  4BD9 A;  2B4B A;  4JWP A;  4KOT A;  3W6X A;  4B6Z A;  3TLZ A;  3PT1 A;  1AMP A;  2ZEL A;  4PK2 A;  2V77 A;  4R76 A;  5F48 A;  2PQ8 A;  4Y49 B;  4YRH A;  4DNC A;  4UWI A;  3D7F A;  1MJ9 A;  2G0B A;  2NYQ A;  2PCU A;  2Z3O A;  3B35 A;  3IFE A;  1BO4 A;  3KHZ A;  2F5I A;  4KS9 A;  4NGQ A;  4M3S A;  4RS2 A;  2J8M A;  4MFL A;  2AFZ A;  3RAM A;  3ZJ0 A;  2PDO A;  1EZA A;  4BPW B;  1M44 A;  2O28 A;  3KQX A;  1Z8X A;  3IO1 A;  1NE9 A;  2GIV A;  2Q04 A;  2JBJ A;  3RO0 A;  4FBE A;  4R6T A;  3RNZ A;  2Q4Z A;  1F2O A;  4FWU A;  2PJ7 A;  4P44 A;  2B4D A;  3CZX A;  2ZW6 A;  3H8F A;  1U6M A;  2OB0 A;  3PFE A;  1WJT A;  3WR7 A;  1BLL E;  1VHO A;  2Z3P A;  4F0X A;  5BY0 A;  5JM6 A;  4L89 A;  3KR5 A;  2ZEO A;  1IGB A;  3FBU A;  2ZED A;  2OR4 A;  3R96 A;  1Q7L A;  1CE8 B;  2HWG A;  4KUB A;  3T07 A;  3S6G A;  2PC1 A;  2B3V A;  4MY3 A;  7CPA A;  4L8A A;  3VRP A;  3KAS A;  1LOK A;  1UWY A;  4MY0 A;  4NGR A;  4M85 A;  3T05 A;  1S7F A;  2ZEE A;  2V8H A;  3BUM B;  3H8G A;  3HLP A;  2ARH A;  2YNC C;  2PJ0 A;  3MRU A;  3TO7 A;  1HDQ A;  3EO4 A;  4DYO A;  4YFJ A;  3FEE A;  3D8P A;  4OC1 A;  2ABZ A;  1JWQ A;  2CY2 A;  4AXV A;  1NMT A;  2VEZ A;  4CGN A;  4F9U A;  3PBB A;  4A4C A;  1Z4R A;  4NSQ A;  5H84 A;  1PU9 A;  3PBE A;  2PJ3 A;  4RI1 A;  5FVJ A;  5HKZ A;  1ELL P;  3PB7 X;  1ZO0 A;  3N7Z A;  4C7H A;  4ZY0 A;  4AVC A;  3IC1 A;  1YVH A;  4P4D A;  1J4J A;  3SJG A;  2RFH A;  2BCO A;  1QSM A;  3JVN A;  4MBU A;  4OC4 A;  4A37 A;  4C68 A;  5D29 A;  1X10 A;  1T36 B;  1XEB A;  3TX8 A;  4A31 A;  4IIY A;  1XE4 A;  2ZEG A;  1N71 A;  3PEI A;  3VH9 A;  1KUV A;  3PB9 X;  5KTD A;  3KI9 A;  3SJF A;  2YND A;  3KL9 A;  2ZEH A;  5IR2 A;  1IOF A;  2FXF A;  1LAN A;  3QNV A;  1V0C A;  4PK3 A;  1QSN A;  4QB9 A;  4TWE A;  4II9 A;  5JYB A;  3FXT A;  2O53 A;  5IV0 A;  3GYA A;  2DIK A;  5HKW A;  3E0K A;  4WWV A;  1XF1 A;  4KOS A;  4U9Y A;  3WC6 A;  3GKR A;  3KRV A;  3SXO A;  4P4B A;  1Y9W A;  4JYW A;  3EZA A;  2ODF A;  3DDD A;  4P4F A;  5CBM A;  5HKY A;  3B2Y A;  2BEI A;  2G3T A;  1C30 B;  1CP6 A;  3R9E A;  1Y9Z A;  2DF5 A;  2HB6 A;  2POK A;  4JLY A;  4QBJ A;  2GFQ A;  2DPS A;  4GXH A;  1YW4 A;  3ZZI A;  1ARM A;  4CAE A;  3HMJ G;  4MHD A;  4JD6 A;  4ZX8 A;  3TOB A;  2J8N A;  3QAY A;  3QB8 A;  1CPX A;  1YW6 A;  4B11 A;  1V6C A;  1YLO A;  2PJ8 A;  1M4D A;  1TKF A;  1XIX A;  4P4J A;  2DPT A;  2Q4V A;  4C8F A;  4H1H A;  2DLA A;  4M6G A;  4CAV A;  2HRO A;  2REE A;  3I6S A;  4JJX A;  4KUA A;  2CF4 A;  2FM4 A;  3I3G A;  3W6S A;  5AXI A;  4UFX A;  1RO5 A;  1Z9U A;  3CT9 A;  4XPK A;  3V38 A;  4C9U A;  4J0N A;  2ZPA A;  4NXY A;  3T90 A;  4KOU A;  5I4M A;  2D4P A;  4R8F A;  4NGT A;  3HPG G;  1FNO A;  2FIW A;  2HQY A;  3S6K A;  5AG5 A;  4TNU A;  4C84 A;  3F5B A;  3KZW A;  1IYK A;  4B5O A;  4ZGY B;  3B3S A;  1QQ9 A;  2A4N A;  2E28 A;  5K8O A;  5HXD A;  5IX3 A;  1YX0 A;  1KWM A;  5F46 A;  5JVL A;  2PJB A;  1WVM A;  4A39 A;  1P0H A;  3H4Q A;  4F9V A;  3FMC A;  4K30 A;  2UV8 G;  3B3V A;  5J1Q A;  1Z8T A;  5LRK A;  4MFJ A;  3TFY A;  1VKC A;  4KZT A;  4A94 A;  4PQA A;  4CDK A;  4UCP A;  1VIX A;  4PXC A;  3NOJ A;  2PJ9 A;  4CYP A;  3D2M A;  4JXQ A;  1NXJ A;  2JEV A;  3CXP A;  3FIX A;  2YJT A;  4X8I A;  4A33 A;  1XFO A;  4R9M A;  1RTQ A;  3P2H A;  1CM0 A;  4MHZ A;  2G3A A;  3CDX A;  2AFM A;  1K4J A;  4KSA A;  1YSJ A;  1M6V B;  2FL4 A;  1P4N A;  1PYT B;  2WYR A;  3B3W A;  4C9E A;  3LOD A;  2Z11 A;  3JUW A;  2XPO A;  1ELM P;  2V8G A;  5AG6 A;  2YNE A;  4MCS A;  3ISX A;  5LYI A;  4BBH A;  3PLF B;  2GE3 A;  2PJ6 A;  2WZN A;  3GJZ A;  2R1I A;  5JQ4 A;  1LAP A;  2R7H A;  4C99 A;  2C6P A;  5J8F A;  2AJ6 A;  1M4I A;  3A9L A;  4CGL A;  5ISV A;  1KZF A;  4MHY A;  3PFO A;  4NJR A;  4Y49 C;  2B5G A;  2J8R A;  4CGO A;  2B4J C;  3NH5 A;  1GYT A;  1IY7 A;  4IK2 A;  4C9A A;  2CNT A;  2ZOG A;  5JH9 A;  1X12 A;  4OC3 A;  2YNC A;  3MGD A;  4R3K A;  1YQE A;  1Q5X A;  4NF1 A;  2Y1M A;  2HUZ A;  3IWE A;  5A27 A;  2PR1 A;  2GLJ A;  2PJ4 A;  1ZL0 A;  4DUK A;  3F9K C;  3FB3 A;  5GCN A;  1XRY A;  3QAH A;  1XMT A;  3DR8 A;  2VBQ A;  3S6H A;  4X2T A;  2ZEP A;  2C6C A;  3C8O A;  3WC7 A;  1IOI A;  3NH8 A;  3IEH A;  3WC5 A;  3FH4 A;  5K8P A;  4PSX A;  2I3C A;  5LYL A;  4OC2 A;  1IID A;  1VHE A;  2WUU A;  3FNC A;  3VAR A;  4A95 A;  2NSM A;  3VWE A;  1LCP A;  4A30 A;  4ZY2 A;  2OH1 A;  4LUA A;  3CPA A;  4GM5 A;  1HDU A;  1I21 A;  2VZY A;  4FD7 A;  2DXQ A;  4HPS A;  5KTC A;  1Y7R A;  2CTB A;  3IWW A;  2Y0M A;  2Y1N A;  1S7L A;  4JVO A;  4EYS A;  4CYO A;  2P6F A;  5JGF A;  1WWZ A;  1TXR A;  4C2Z A;  3NE8 A;  1Y7E A;  5EBV A;  1XOV A;  3D7H A;  4OID A;  4IF5 A;  4A38 A;  2R8V A;  5KTA A;  2ZW7 A;  5AGE A;  1XMB A;  1Z5R A;  1M1D A;  3NFZ A;  4AG7 A;  4UIB A;  3KKW A;  4OAE A;  2Q51 A;  4ONW A;  3P2F A;  4NFR A;  1J3L A;  4C8U A;  3SI1 A;  4ZYQ A;  1KC7 A;  3SHP A;  2FIA A;  4RR2 B;  4KVO E;  4MCP A;  1I12 A;  4PXE A;  1BPM A;  4FD4 A;  3CXQ A;  4UEF A;  3JRU A;  4C2Y A;  3K4I A;  3C26 A;  1B87 A;  2AFX A;  2Z0Z A;  4CAF A;  2OZG A;  1C3O B;  2WPX A;  4J3G A;  3FVL A;  2HI6 A;  3VTA A;  1LFW A;  4B5P B;  2FSR A;  2QVP A;  1LRZ A;  1SQH A;  2EO8 A;  1VHS A;  2NMT A;  4P10 A;  4MFZ A;  3HPH E;  1CS0 B;  4COB A;  4P6Y A;  2MP0 A;  5F49 A;  4R3L A;  3SJE A;  2PR8 A;  5G21 A;  4H2K A;  2OOT A;  5HVG A;  4YU9 A;  4FAI A;  1RXT A;  2PE3 A;  2PJC A;  3H5Z A;  5K99 A;  4UA3 A;  3TLG A;  2XEI A;  2QJ8 A;  2XPP A;  2CTC A;  4C8A A;  3SJX A;  1NSA A;  3PRT A;  1PCA A;  4I49 A;  4MFK A;  4E0A A;  1KBL A;  5G22 A;  1VI4 A;  4O23 A;  1TKH A;  3FRM A;  1B6B A;  4KOW A;  1YVO A;  2Q7B A;  4CZ1 A;  3D66 A;  3EXN A;  3T5M A;  3IGR A;  1S5K A;  2ZW5 A;  4ZBG A;  2EZA A;  2R82 A;  1Q2C A;  1Q2D A;  4CS0 B;  4A4B A;  2XEJ A;  3BUW B;  4MXU A;  4BMH A;  4C85 A;  4XPL A;  3BUN B;  2EK9 A;  4PV6 A;  3H8E A;  2CIJ A;  2B3U A;  4A32 A;  2C6G A;  2PJ5 A;  2VI7 A;  2WPW A;  2Z3L A;  2BSW A;  3NE7 A;  3DLJ A;  3R95 A;  1QSR A;  3TLE A;  1XJO A;  3D4U A;  3TO6 A;  4CDJ A;  1Z4E A;  4KSF A;  5K8N A;  3I9S A;  3KR4 A;  2EUI A;  3CPX A;  1YK3 A;  2CNM A;  3KQZ A;  2B58 A;  2PVV A;  1S60 A;  2IMO A;  3EY5 A;  1WK4 A;  4HNW B;  4M6H A;  4QUS A;  4B13 A;  5J8C A;  1QSO A;  2H5M A;  2PRQ A;  4UBR A;  4UWJ A;  3FF3 A;  1KUX A;  1MJB A;  4OIW A;  3RZA A;  4B12 A;  4C8C A;  1CG2 A;  4KLW A;  1S7K A;  4BPX B;  1YRE A;  4WJB A;  2R98 A;  2AE6 A;  2ZEF A;  2X0S A;  2ZXV A;  4M6I A;  1NSL A;  3TLY A;  4C8P A;  2XPL A;  1AUG A;  1ZLH A;  1S3Z A;  4AG9 A;  5HVH A;  2FE7 A;  3D3S A;  2F8H A;  2O4H A;  4PSW A;  2C27 A;  4NGP A;  2PJ2 A;  3LAC A;  4R87 A;  4C9V A;  1R61 A;  4FUU A;  3PFV A;  5FD8 A;  4IAV A;  4NJQ A;  1DE4 C;  4IIX A;  3V7Z A;  3SI0 A;  4UEZ A;  4C7I A;  2P6E A;  4U5Y A;  6CPA A;  3GB0 A;  4MFQ A;  4OP4 A;  3IU1 A;  4FD5 A;  2Z3N A;  3IU2 A;  1FY7 A;  1ZG7 A;  2PSW A;  3R9F A;  4EWT A;  2AUN A;  4M8D A;  3PB4 X;  1EE3 P;  2JDC A;  1I1D A;  2ZOF A;  4UF4 A;  4CPA A;  4TJX A;  5K8M A;  1VBH A;  2EVN A;  4MMO A;  4BPU B;  3S6F A;  4DJL A;  2CBL A;  3OP0 A;  3EC4 A;  2P0W A;  2AFU A;  1Z9E A;  1LAM A;  1Z2L A;  5F09 A;  4RN7 A;  3SXN A;  4F0Y A;  3EZB A;  2Z3K A;  4E5S A;  1EO0 A;  4KOV A;  2GAN A;  2KCW A;  4H6Z A;  1B47 A;  5DWN A;  5EMI A;  4EME A;  4MI1 A;  2IQ6 A;  3BJ8 A;  5CNP A;  2PRB A;  1KUY A;  4KOR A;  5C88 A;  4RUH A;  1XF8 A;  4UIA A;  4CYN A;  4ZY1 A;  1JDB C;  1TIQ A;  3OAK A;  1VGY A;  3TO9 A;  2QYV A;  4UFW A;  3VRR A;  3WAB A;  2X7B A;  4C86 A;  4BIN A;  1ON0 A;  3PB6 X;  3B3T A;  2BL1 A;  5E96 A;  5C82 A;  1MJA A;  2V8D A;  1TF9 A;  4Z65 A;  2Q7S A;  4GS4 A;  2PIZ A;  2ZW4 A;  4IUS A;  4PXB A;  3G3S A;  2XEG A;  1GHE A;  2I00 A;  2PJ1 A;  2GP4 A;  2XEF A;  3N5F A;  4X5K A;  3TT2 A;  3FEC A;  5F13 A;  2FS5 A;  2REF A;  3F8K A;  3GUX A;  3I1U A;  4UFV A;  5AG7 A;  3T9Y A;  2EBJ A;  3TLC A;  1IU8 A;  4MHN A;  1IYL A; 
#chains in the Genus database with same CATH homology
 4KSI A;  2GU2 A;  1BAV A;  2FVG A;  3LMS A;  4F8Z A;  4JZ0 A;  4EFD A;  4IHM A;  2GLF A;  3K2K A;  1ZLI A;  1CBX A;  3HUV A;  4ZI6 A;  3S9M A;  3BHX A;  1JQG A;  1ARL A;  3IJ3 A;  3D67 A;  2GRE A;  1Z8L A;  2JEW A;  2EK8 A;  1CP7 A;  3IIB A;  3SI2 A;  4C8T A;  5LYD A;  4MCR A;  1YME A;  2C1C A;  3GLJ A;  3KGQ A;  5LRG A;  1R43 A;  1CX8 A;  2EWB A;  1H8L A;  3B3C A;  1TKJ A;  4P45 A;  2JBK A;  4NGN A;  1HEE A;  1QMU A;  2IJZ A;  3DGV A;  5DS0 A;  4NGS A;  4OC0 A;  3FJU A;  3FED A;  5LYF A;  3TC8 A;  2VL1 A;  2C5Q A;  5D8N A;  3ISZ A;  4OKO A;  3BI1 A;  2BO9 A;  1ZG8 A;  3L2N A;  2AFS A;  1AYE A;  1CPS A;  3D7D A;  5ELY A;  4LQG A;  4KNG E;  1XBU A;  1ZG9 A;  4R7M A;  4PXD A;  3KHX A;  1Y0Y A;  3FX6 A;  2BOA A;  2F7V A;  4MCQ A;  8CPA A;  4W9Y A;  4MHP A;  4TJV A;  1OBR A;  4PPZ A;  4ZX9 A;  3I74 A;  3LWU A;  2PVW A;  4OME A;  4P4E A;  3WT4 A;  2AFO A;  3B7I A;  3S9L A;  2ZEM A;  1FT7 A;  5HVF A;  3ICU A;  4MRI A;  4UEE A;  4YN3 A;  2ZEN A;  2ANP A;  1F2P A;  4G1P A;  3MN8 A;  4YWY A;  2V8V A;  3NA6 A;  3BI0 A;  1BPN A;  1R3N A;  2J9A A;  2PJA A;  3PB8 X;  3RBU A;  2DEA A;  2HC9 A;  2PIY A;  3VAT A;  4Q7A A;  4OC5 A;  1TF8 A;  2G9D A;  4NGM A;  1DTD A;  2Q43 A;  4K3N A;  4X3R A;  4P4I A;  1F57 A;  5IB9 A;  3EIF A;  2RB7 A;  5THW A;  5LRJ A;  3S9N A;  3D68 A;  5CPA A;  3K9T A;  1Y0R A;  3D7G A;  3BXM A;  3NH4 A;  1M4L A;  2AFW A;  4BD9 A;  4B6Z A;  1AMP A;  2ZEL A;  2V77 A;  4R76 A;  3D7F A;  2PCU A;  2NYQ A;  3IFE A;  3KHZ A;  3B35 A;  4NGQ A;  2AFZ A;  3RAM A;  3KQX A;  3IO1 A;  2JBJ A;  4FBE A;  4R6T A;  2Q4Z A;  1F2O A;  4FWU A;  2PJ7 A;  4P44 A;  3H8F A;  3PFE A;  5JM6 A;  1BLL E;  1VHO A;  3KR5 A;  2ZEO A;  1IGB A;  2ZED A;  2OR4 A;  1Q7L A;  7CPA A;  3KAS A;  1LOK A;  1UWY A;  4NGR A;  2ZEE A;  3HLP A;  2V8H A;  3H8G A;  2PJ0 A;  3MRU A;  1HDQ A;  4DYO A;  3FEE A;  4AXV A;  4OC1 A;  2ABZ A;  4F9U A;  3PBB A;  3PBE A;  2PJ3 A;  1ELL P;  3PB7 X;  4ZY0 A;  3IC1 A;  4P4D A;  2RFH A;  3SJG A;  2BCO A;  4A37 A;  4OC4 A;  4C9V A;  5D29 A;  3TX8 A;  2ZEG A;  3PEI A;  3VH9 A;  3PB9 X;  3KI9 A;  3SJF A;  3KL9 A;  2ZEH A;  5IR2 A;  3QNV A;  1LAN A;  4TWE A;  2O53 A;  4WWV A;  1XF1 A;  3WC6 A;  4P4B A;  4JYW A;  4P4F A;  5CBM A;  3B2Y A;  1CP6 A;  1Y9Z A;  2HB6 A;  2POK A;  1YW4 A;  4C9R A;  1ARM A;  4ZX8 A;  1CPX A;  1YW6 A;  1V6C A;  1YLO A;  2PJ8 A;  1TKF A;  4P4J A;  4C8F A;  3I6S A;  2CF4 A;  3CT9 A;  3V38 A;  4C9U A;  5I4M A;  4R8F A;  4NGT A;  1FNO A;  4TNU A;  4C84 A;  3KZW A;  3B3S A;  1QQ9 A;  5K8O A;  5HXD A;  1KWM A;  2PJB A;  1WVM A;  4A39 A;  4F9V A;  5J1Q A;  3FMC A;  3B3V A;  5LRK A;  4A94 A;  4PQA A;  4CDK A;  1VIX A;  4PXC A;  2PJ9 A;  4X8I A;  1XFO A;  1RTQ A;  4MHZ A;  3CDX A;  2AFM A;  1YSJ A;  2WYR A;  1PYT B;  4C9E A;  3B3W A;  1ELM P;  2V8G A;  5LYI A;  3ISX A;  4MCS A;  2PJ6 A;  2WZN A;  4C99 A;  1LAP A;  2C6P A;  4MHY A;  3PFO A;  4NJR A;  4IK2 A;  3NH5 A;  1GYT A;  1IY7 A;  4C9A A;  5JH9 A;  2ZOG A;  4OC3 A;  2GLJ A;  2PJ4 A;  4DUK A;  1XRY A;  4X2T A;  2ZEP A;  2C6C A;  3WC7 A;  3NH8 A;  3IEH A;  3WC5 A;  3FH4 A;  5K8P A;  5LYL A;  2I3C A;  4OC2 A;  1VHE A;  3VAR A;  2NSM A;  1LCP A;  4ZY2 A;  3CPA A;  4GM5 A;  1HDU A;  2CTB A;  3IWW A;  5JGF A;  1TXR A;  1Y7E A;  4A38 A;  3D7H A;  4OID A;  1XMB A;  1Z5R A;  3NFZ A;  4UIB A;  2Q51 A;  4ONW A;  4NFR A;  4C8U A;  3SI1 A;  4ZYQ A;  4MCP A;  4PXE A;  1BPM A;  4UEF A;  3JRU A;  2AFX A;  3FVL A;  3VTA A;  1LFW A;  2QVP A;  4P10 A;  4P6Y A;  3SJE A;  4H2K A;  2OOT A;  5HVG A;  4YU9 A;  4FAI A;  2PJC A;  2PE3 A;  2XEI A;  2QJ8 A;  4C8A A;  2CTC A;  3SJX A;  1NSA A;  3PRT A;  1PCA A;  4O23 A;  1TKH A;  3D66 A;  2XEJ A;  4MXU A;  2EK9 A;  3H8E A;  2CIJ A;  2C6G A;  2PJ5 A;  3DLJ A;  1XJO A;  3D4U A;  4CDJ A;  5K8N A;  3KR4 A;  3KQZ A;  3CPX A;  3T8W A;  2PVV A;  2IMO A;  2PRQ A;  3FF3 A;  4OIW A;  3RZA A;  4C8C A;  1CG2 A;  4WJB A;  2ZEF A;  4C8P A;  1ZLH A;  5HVH A;  2F8H A;  2O4H A;  4NGP A;  2PJ2 A;  4FUU A;  4IAV A;  4NJQ A;  1DE4 C;  3V7Z A;  3SI0 A;  4UEZ A;  6CPA A;  3GB0 A;  4OP4 A;  4EWT A;  1ZG7 A;  4TJX A;  4C85 A;  3PB4 X;  1EE3 P;  4CPA A;  2ZOF A;  4UF4 A;  5K8M A;  4MMO A;  4DJL A;  2AFU A;  1LAM A;  1Z2L A;  5F09 A;  4EME A;  2IQ6 A;  4RUH A;  4UIA A;  4ZY1 A;  1VGY A;  2QYV A;  3WAB A;  4C86 A;  3PB6 X;  3B3T A;  2V8D A;  1TF9 A;  4Z65 A;  2PIZ A;  4PXB A;  2XEG A;  2PJ1 A;  2GP4 A;  2XEF A;  3N5F A;  3I1U A;  3FEC A;  3GUX A;  4MHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...