4NGSA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 263
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngsA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngsA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngsA02
4P45A 4OC2A 1V6CA 2PVWA 3KASA 2PJ0A 3ISZA 3QNVA 4MHNA 1ELMP 5K8OA 1OBRA 4P4EA 2GLFA 5LYLA 3FMCA 4KNGE 2CTBA 3B3VA 1F2OA 3B3WA 2Q43A 2V8DA 4ONWA 1EE3P 3GLJA 4P4JA 2IMOA 2AFMA 3IFEA 3FVLA 1Y0RA 3K9TA 4OP4A 2GREA 3KQZA 3WC6A 4UEEA 3SJGA 4P4BA 2XEJA 4F9VA 1Z8LA 4YWYA 4MXUA 4P10A 4F8ZA 5ELYA 3RZAA 4H2KA 3B7IA 2GLJA 2PJ1A 1RTQA 5LYDA 4X2TA 1M4LA 3JRUA 3SI1A 2O53A 3PB4X 1YSJA 2RB7A 4UEZA 2FVGA 1YW4A 1Y0YA 3KGQA 3CPXA 3S9NA 4MCPA 1ZLIA 3CT9A 3NFZA 3ICUA 4EWTA 2C6GA 3KI9A 4NGPA 4EFDA 1ELLP 4NGNA 3LMSA 2ZEDA 3HLPA 2ZOFA 2PJ9A 5LYFA 3MRUA 8CPAA 3DGVA 3S9LA 2JBKA 7CPAA 5LRJA 4PXDA 4P4FA 2BO9A 4C84A 4NGMA 2XEIA 3BI0A 3NA6A 2AFWA 4C9RA 5LRGA 4DUKA 2V8HA 4C9UA 5HXDA 1NSAA 3NH5A 1PYTB 2AFOA 1CPXA 2QVPA 4PXCA 3IIBA 3RBUA 3KR4A 3FF3A 3PFOA 5K8NA 2PJBA 4ZX9A 3VTAA 2DEAA 4Q7AA 1LAPA 3TC8A 4TJVA 4DYOA 5CBMA 1VHEA 2XEFA 4PQAA 3VARA 2V8VA 4FUUA 3PBBA 1ZG9A 1YMEA 1ZG8A 4P4IA 4MCSA 3TX8A 4GM5A 2PJCA 3D66A 3MN8A 2OOTA 1R3NA 4X3RA 4X8IA 3D7FA 3KZWA 4ZYQA 1TKFA 2ZENA 2PJ6A 5LYIA 1TF8A 3D7HA 4TJXA 4TWEA 3PRTA 3B3SA 4O23A 3FJUA 3V7ZA 1ZLHA 2PJ4A 1F57A 3PFEA 4K3NA 1IGBA 4ZY1A 1CBXA 4C8FA 2QYVA 1XJOA 3IO1A 3SI0A 3RAMA 3WC7A 1Z2LA 4P6YA 4OC0A 2ZEEA 1YLOA 1DTDA 3PBEA 1Z5RA 2C6CA 4R8FA 3ISXA 3BHXA 4YU9A 4NGTA 2Q4ZA 4EMEA 2C6PA 3I74A 3SJEA 1TXRA 1TKHA 5JM6A 1Y7EA 3H8GA 2PIYA 4R6TA 4F9UA 5HVFA 1Q7LA 1QQ9A 1XFOA 4LQGA 1LFWA 3B2YA 4RUHA 4PXEA 4OC4A 4G1PA 1IY7A 4NGRA 2OR4A 4FAIA 1F2PA 3KHXA 4MCRA 2PIZA 3KQXA 4OIWA 5D8NA 4A39A 3FEDA 4NFRA 4P44A 1YW6A 3D68A 2QJ8A 4NJQA 4PXBA 1XMBA 1AMPA 1LCPA 4B6ZA 4IHMA 3IC1A 4A37A 4C9VA 3D67A 4UF4A 2C1CA 3D7GA 4MMOA 4C8UA 3KHZA 4C8TA 4OMEA 2BOAA 4C8AA 4NGSA 3IJ3A 1TF9A 1VHOA 2WYRA 4CDKA 3CDXA 1XBUA 4AXVA 2NYQA 3HUVA 3VATA 1LOKA 1XF1A 4YN3A 2CTCA 2PJ7A 1FT7A 2J9AA 4TNUA 5F09A 2PJ8A 1ARMA 3KL9A 3WT4A 4DJLA 4NJRA 4BD9A 3FX6A 4R76A 2PJ2A 2PJ5A 5HVGA 5J1QA 1BLLE 3H8EA 2RFHA 1VGYA 2CF4A 2F8HA 3EIFA 4ZX8A 4C85A 1KWMA 2EK8A 1Y9ZA 3WC5A 2V8GA 4ZY0A 4P4DA 3N5FA 5D29A 4CPAA 3BXMA 1HDUA 5JH9A 3NH8A 4C86A 4FWUA 1LAMA 2EK9A 2V77A 2AFZA 2AFXA 2ZEMA 4C99A 5LRKA 2AFSA 1CX8A 6CPAA 3I1UA 2JBJA 2ZEOA 3LWUA 4C8CA 5I4MA 1GYTA 2XEGA 3VH9A 5DS0A 2BCOA 1CG2A 4IAVA 2GU2A 3PB6X 3S9MA 5THWA 4ZI6A 2PJAA 3WABA 4R7MA 4C9EA 2POKA 2ANPA 3IWWA 5IB9A 2Q51A 2ZOGA 1ZG7A 4OC3A 2I3CA 3SI2A 2ZEFA 1DE4C 1PCAA 4A94A 1WVMA 1LANA 3NH4A 2F7VA 4UIBA 3PB9X 4A38A 1ARLA 1HEEA 3B35A 1BPNA 4OKOA 3D4UA 4UIAA 2PVVA 2PRQA 4MHYA 3T8WA 4Z65A 4IK2A 4OC5A 2WZNA 1JQGA 4W9YA 1HDQA 3SJFA 1AYEA 3L2NA 4WJBA 4PPZA 1BAVA 2G9DA 4MHZA 4FBEA 1TKJA 2IJZA 1H8LA 4NGQA 1FNOA 2ZELA 2ZEHA 3FH4A 3B3TA 2HC9A 1CP6A 1VIXA 2ABZA 5K8MA 4OIDA 1CP7A 4MCQA 4CDJA 3FECA 2IQ6A 3SJXA 4JZ0A 2ZEPA 5JGFA 1UWYA 2PE3A 1CPSA 2PCUA 3KR5A 2O4HA 3CPAA 4WWVA 4KSIA 2HB6A 3IEHA 4C8PA 3H8FA 1QMUA 2PJ3A 3K2KA 4MHPA 1XRYA 3FEEA 2VL1A 2ZEGA 2EWBA 4C9AA 4ZY2A 3V38A 3B3CA 3GUXA 3GB0A 3PEIA 3DLJA 5HVHA 3PB8X 4UEFA 4JYWA 3PB7X 2CIJA 3D7DA 1R43A 3BI1A 5CPAA 3I6SA 2NSMA 5K8PA 2JEWA 4OC1A 1BPMA 2AFUA 4MRIA
chains in the Genus database with same CATH superfamily
2RC4A 4P45A 2VI7A 1Z9EA 1WWZA 2ATRA 4AG9A 1DIKA 4OC2A 1V6CA 3FIXA 2PVWA 3KASA 1KC7A 5KTDA 2PJ0A 4MFKA 3ISZA 4B11A 2FM4A 1ZO0A 4CO9A 3OWCA 3VRPA 5GCNA 4IUSA 3QNVA 4B14A 3EC4A 2YJTA 1WK4A 3EY5A 1XEBA 4MHNA 1ELMP 4UWJA 5K8OA 4A31A 2FCKA 2ZW7A 2B3VA 3SXNA 1OBRA 3TT2A 2VZZA 4P4EA 2GLFA 5LYLA 3T0TA 3FMCA 2HUZA 4KNGE 2CTBA 3B3VA 1F2OA 3B3WA 2Q43A 2V8DA 2ZXVA 4OADA 4ONWA 1EE3P 2QECA 3GLJA 4CGPA 4P4JA 2IMOA 2AFMA 3IFEA 3FVLA 3QAHA 1Y0RA 4H89A 4KLVA 2H5MA 3K9TA 4UFXA 4C2ZA 3EZBA 1I1DA 4OP4A 2R98A 2GREA 3KQZA 4KSFA 4UEEA 3SJGA 3WC6A 2A4NA 4U9YA 4H6ZA 3SR3A 4LUAA 3OAKA 2Z11A 2JDDA 4P4BA 2DXQA 2XEJA 4F9VA 1KEEB 1KUVA 3EO4A 2KCWA 3GJZA 1Z8LA 1Q5XA 2REFA 2O28A 4MXUA 4P10A 2VBQA 2FXFA 4YWYA 4CRZB 1ZRSA 3ZNIA 4F0XA 4F8ZA 5ELYA 1OZPA 2VXKA 3RZAA 4B10A 2D4PA 4H2KA 4H6UA 3B7IA 3PFVA 1Y7RA 1RTQA 2GLJA 2PJ1A 2Q4YA 5LYDA 3TOAA 4X2TA 1M4LA 4B5PA 4CYOA 3RYOA 2R7HA 3JRUA 4UCNA 3SI1A 4CGMA 4JJXA 4FD5A 4QVTA 3QB8A 2WSAA 1L0CA 2O53A 3PB4X 5F46A 1YSJA 2RB7A 2P0WA 4RS2A 4UEZA 2FVGA 4RN7A 2Q7BA 1NBWA 4E8OA 1YQEA 1Y0YA 1YW4A 1Y9KA 3S9NA 3CPXA 3KGQA 3EZAA 4MCPA 5J3XA 1ZLIA 2NMTA 3CT9A 1SQHA 3DR6A 4R87A 3R96A 1T36B 4YGOA 5KTAA 2C27A 3NFZA 3ICUA 3DR8A 3T5MA 4EWTA 2C6GA 4BPWB 3KI9A 1J4JA 4KUAA 4NGPA 2ODFA 5DWMA 4L89A 4EFDA 4HKFA 1PU9A 4L8AA 3I6SA 1ELLP 2JEVA 5C88A 4NGNA 5A27A 3LMSA 2ZEDA 3HLPA 4Q38A 4H1HA 2ZOFA 1I21A 2PJ9A 4CAEA 1KBLA 4U5YA 2HWGA 5LYFA 1GGOA 1FBVA 5IR2A 3MRUA 2GP4A 1MK4A 1BXRB 2Q4VA 2YNDA 3R9GA 3LD2A 3W6XA 8CPAA 5A28A 4KOWA 2CNTA 3PZJA 3DGVA 1M4DA 2CBLA 2JBKA 3S9LA 1RXTA 2ZW4A 5LRJA 4PXDA 4P4FA 4UCPA 7CPAA 2BO9A 1IYLA 4C84A 2QMLA 4C2XA 4NGMA 3TE4A 5K99A 3O8ZA 2OLSA 4NSQA 4IIYA 5G21A 2XEIA 3T90A 1ZL0A 1LRZA 3MGDA 1M4GA 3R95A 1WJTA 3G23A 4KOXA 5F13A 3BI0A 3NA6A 3EZEA 4CGLA 4XPDB 5FVJA 2AFWA 4A2ZA 5KTCA 4B5OA 5LRGA 4C9RA 4F0YA 2PSWA 1QSTA 4NEXA 2WPWA 5DWNA 4OLLA 2V8HA 4DUKA 4MFQA 4QUSA 4C9UA 1B6BA 5HXDA 1NSAA 3F0AA 4IIXA 4Y49B 3TYXA 3TO6A 4ONUA 3NH5A 1IIDA 2OZHA 1PYTB 1S7LA 1CS0B 2AFOA 5FD8A 1CPXA 2P6FA 1S5KA 3VGOA 2QVPA 2ARHA 4PXCA 4HNXB 3IIBA 2B5GB 3RBUA 3KR4A 2R1IA 3FF3A 4BMHA 3BUOB 3V8IA 2Q7SA 3PFOA 4EYSA 4ZGYB 5K8NA 3D2MA 2Z3PA 2PJBA 2ZW6A 4ZX9A 3VTAA 2VZYA 1CJWA 1RO5A 1VBGA 2DEAA 4JLYA 4Q7AA 1LAPA 3TC8A 4TJVA 1EZBA 4LX9A 4DYOA 5CBMA 1VHEA 1Q2CA 2XEFA 4PQAA 1S7KA 2V8VA 3VARA 4FUUA 3TLYA 3PBBA 1ZG9A 1YMEA 1ZG8A 4MFLA 4P4IA 1QSMA 2DPSA 4MCSA 4PK2A 4CYNA 1M6VB 2GANA 1NSLA 4GM5A 3TX8A 2PJCA 3D66A 2X0SA 2Q04A 2P6EA 2OOTA 3MN8A 1R3NA 2FSRA 2BL1A 1XF8A 4X3RA 2B58A 5HMNA 1Q2YA 4X8IA 3D7FA 3BJ8A 4Q36A 3KZWA 4ZYQA 1TKFA 2B4DB 4R9MA 2Z3LA 1X12A 2BSWA 5JQ4A 2ZENA 5JYBA 4FD7A 2PJ6A 5LYIA 3TLZA 1TF8A 2YNCC 3D7HA 4MJXA 5F47A 4M3SA 4CYQA 4TWEA 4AVAA 3PRTA 4TJXA 3B3SA 1JDEA 3PT1A 4O23A 3FJUA 2EZAA 3S6FA 4M8DA 4UBRA 2N3AB 4DNCA 2DIKA 3PGPA 4BPXB 3V7ZA 2GIVA 2DPTA 4R3LA 4B12A 3TOBA 2REEA 4BBHA 4AG7A 1ZLHA 1KUXA 1F57A 2PJ4A 3PFEA 4K3NA 3R9FA 1U6MA 3S6KA 2G3TA 1IGBA 1EO0A 4ZY1A 1CBXA 4FD4A 4UCMA 3H5ZA 4C8FA 4MHDA 2QYVA 4I49A 5HKWA 4KVXA 1XJOA 3G3SA 3IO1A 4KLWA 3SI0A 3IWGA 1CE8B 4KVME 3RAMA 2F5IA 4MY3A 1GHEA 3WC7A 4E2AA 1Z2LA 3GY9A 2Z3KA 4P6YA 4KOYA 3OB1B 1XIXA 4OC0A 2ZEEA 1YLOA 5IX3A 1DTDA 2XPOA 3PBEA 1Z5RA 3RO0A 5I0CA 3BUNB 2R82A 2C6CA 4QB9A 2XPLA 4R8FA 4C7HA 3TLAA 3ISXA 3FRMA 3BHXA 1XE4A 3GIUA 5AG6A 5G1ZA 4YU9A 1NXJA 3T05A 3F5BA 3TO9A 3TLEA 4NGTA 2Z0ZA 4MI1A 2EUIA 2Q4ZA 2Z3OA 4EMEA 2C6PA 4YFJA 3I74A 3SJEA 1TXRA 2OB0A 1TKHA 5JM6A 1Y7EA 2CXAA 4JWPA 4JXQA 2FIWA 3W91A 3H8GA 5C82A 2PIYA 4R6TA 4F9UA 5HVFA 1Q7LA 1QQ9A 1XFOA 4LQGA 2OH1A 1LFWA 4A32A 3B2YA 4UFVA 4RUHA 2Y0MA 3W6SA 3BLNA 4PXEA 3K9UA 4OC4A 4G1PA 1IY7A 3LACA 4NF1A 4NGRA 3FYNA 2OU2A 2OR4A 3BUMB 4FAIA 4U9ZA 5J8FA 4K30A 5EC4A 1IYKA 2Z3MA 1VI4A 2B5GA 1J3LA 2E28A 4ZBGA 1TIQA 4BTFA 1F2PA 2B4BA 1P0HA 1XMTA 3KHXA 1YVKA 4MCRA 2PIZA 3KQXA 4OIWA 4PV6A 3RNZA 5D8NA 4A39A 3FEDA 4NFRA 1VBHA 3K4IA 2IL4A 3ZZIA 4P44A 1R57A 5AGEA 3BJ7A 1YW6A 3D68A 2QJ8A 3JUWA 4NJQA 4PXBA 1XMBA 1AMPA 5CNPA 5F5XA 1LCPA 4F6AA 4YRHA 4B6ZA 3VRQA 4IHMA 3IC1A 4A37A 3NOJA 4C9VA 3D67A 3EFAA 4UF4A 2C1CA 3D7GA 2EO8A 4MMOA 4AB7A 2J8MA 4C8UA 2OZGA 3IGRA 3KHZA 5ISVA 1ZYMA 4OMEA 2BOAA 4RI1A 3BUWB 4C8TA 4C8AA 4NGSA 3IJ3A 1TF9A 1VHOA 2FT0A 2WYRA 4CDKA 1Z4EA 3OP0A 5EMIA 2B4DA 4INJA 2PCNA 3JTKA 1JWQA 3NE7A 3CDXA 3GYAA 4KORA 2XPNA 2FIAA 1IU8A 2X7BA 1XBUA 3F8KA 2K5TA 1R61A 3HMJG 4KZTA 3S6GA 4AXVA 4C2YA 4KOUA 2NYQA 4HPSA 4LQ6A 3CXPA 3HUVA 1X10A 3FNCA 3LODA 3TLBA 3VATA 2B3UA 1LOKA 3QAYA 1XF1A 1YLEA 4YN3A 2CTCA 1V0CA 2PJ7A 4PSXA 3HPGG 1K4JA 1FT7A 2Q0YA 2BUEA 4MFJA 2J9AA 4TNUA 5F09A 2JDCA 2PJ8A 1ARMA 2Z10A 3KL9A 3WT4A 4DJLA 3TLCA 2VKZG 4BPUB 3R1KA 4COGA 2GFQA 3NFQA 2WUUA 3P2FA 4NJRA 4BD9A 2B0AA 5JVLA 1ON0A 3FX6A 4JD6A 5G22A 4JVOA 4R76A 3TLGB 3TO7A 2I79A 2GE3A 3FBUA 2PJ2A 2CNMA 3T9YA 3H4QA 2PJ5A 3D8PA 1XOVA 4EVYA 4JXRA 1YGHA 5HVGA 5J1QA 1BLLE 2YNCA 4CS0B 1A9XB 3H8EA 2EZBA 2RFHA 1VGYA 1M4IA 2CF4A 2F8HA 4GS4A 3EIFA 5E96A 4ZX8A 4C85A 2EVNA 4M85A 4KOSA 1KWMA 1QSRA 2EK8A 2YNEA 4PSWA 3WC5A 1Y9ZA 1YX0A 2V8GA 4ZY0A 4QBJA 3G8WA 3C26A 1BO4A 2C5QA 2G3AA 4CRYB 4P4DA 4A33A 3N5FA 5D29A 1YK3A 4CPAA 3BXMA 1HDUA 3P2HA 5JH9A 5AG4A 5H86A 1EZAA 3NH8A 4MI4A 1N71A 4FWUA 4GXHA 2HI6A 4AVBA 4C86A 1MJBA 1Q2DA 1LAMA 2EK9A 2V77A 2AFZA 4COBA 3ZJ0A 3DSBA 2PR1A 2AFXA 3PLFB 4HNYB 2ZEMA 4C99A 5EBVA 4A4BA 5F49A 3C8OA 4NXYA 5LRKA 2EZCA 2QIRA 3R9EA 2AFSA 1CX8A 3S6HA 6CPAA 3I1UA 4CGOA 1KZFA 2JBJA 4UWIA 2ZEOA 3LWUA 1I12A 3HPHE 5I4MA 4C8CA 3VWDA 1GYTA 2XEGA 1Z9UA 2BEIA 3TCVA 3VH9A 4A4CA 1PUAA 3EXNA 1C3OB 5DS0A 2BCOA 4E94A 1IOFA 1M1DA 3E0KA 4KVOE 5G20A 1CG2A 1YVOA 4IAVA 3DDDA 2DLAA 3U1BA 2GU2A 3PB6X 3S9MA 5THWA 1IOIA 4MFPA 4CYPA 4ZI6A 4KSAA 2PJAA 3IU1A 4KUBA 1YR0A 3SXOA 3DNSA 3WABA 4R7MA 4C9EA 2POKA 2DF5A 1Z8TA 2ANPA 3IWWA 4M6IA 4MJ8A 5F9MA 1M44A 5IB9A 2Q51A 2ZOGA 2PRBA 4MY0A 3I9SA 1ZG7A 4OC3A 1BOBA 2CNSA 3NE8A 2I3CA 4J3GA 3F9KC 4CAWA 3SI2A 1P4NA 3PP9A 2ZEFA 1DE4C 5BWAB 3JVNA 1YREA 4CAFA 4A95A 1PCAA 3CZXA 4A94A 1Z8WA 1WVMA 1LANA 4MBUA 2AUNA 4RR2B 2PR8A 2YGWA 4X5KA 2B4JC 4CZ1A 1Z4RA 3NH4A 2F7VA 3D3SA 4J0NA 3FB3A 4UFWA 4UIBA 4XPKA 1S7NA 3PB9X 4R57A 4C68A 4A38A 1ARLA 1HEEA 3B35A 5F48A 1BPNA 4XNHC 4OKOA 1MJAA 4A30A 5IV0A 3D4UA 3FXTA 4PK3A 4UIAA 4FD6A 2D4OA 2PVVA 2PRQA 4KS9A 5AG5A 4B13A 4MHYA 2EBJA 2FS5A 4HNWB 3T8WA 4M6HA 4XPDC 4Z65A 1JDBC 2AUMA 1KUYA 2MP0A 4CGNA 4IK2A 4OC5A 1B87A 4BINA 2WZNA 1JQGA 2JLMA 4W9YA 1HDQA 3CXQA 3VWEA 3WR7A 3SJFA 1AYEA 3L2NA 1S7FA 4WJBA 1NE9A 3TLGA 1C30B 4PPZA 4UA3A 5HKYA 5AXIA 1BAVA 2G0BA 1CM0A 2HROA 2FL4A 2G9DA 3A9LA 3IU2A 4Y49C 2Q44A 4MHZA 2AJ6A 4FBEA 1TKJA 4E5SA 3OB2B 3N7ZA 2IJZA 4KOTA 2VEZA 5BY0A 1IB1E 2UV8G 4IF5A 1H8LA 4NGQA 2YJVA 1FNOA 2ZELA 4AVCA 4KOVA 4B5PB 3VROA 2ZEHA 3TTHA 1Y9WA 2J8NA 2Y1MA 2VQYA 3FH4A 3B3TA 4ORFA 2HC9A 1CP6A 1IICA 4XNHB 1VIXA 2ABZA 5K8MA 4OIDA 1CP7A 5J8CA 4MCQA 4CAXA 4XPLA 1MJ9A 3D2PA 5AG7A 4CDJA 3FECA 3IWEA 2D0OA 3SHPA 3T07A 5HH1A 2IQ6A 3SJXA 1QSOA 2Z3NA 1AUGA 4JZ0A 4II9A 2ZEPA 5JGFA 2PC1A 2PQ8A 2WPXA 1UWYA 2PE3A 4E0AA 1CPSA 4R3KA 2FE7A 2PCUA 3UY5A 3KR5A 2O4HA 1Z8XA 3CPAA 2R8VA 3I3GA 4KSIA 2HB6A 4WWVA 5JPHA 3IEHA 4C8PA 2HV2A 1QMUA 2PJ3A 3H8FA 3K2KA 2D0PA 3U88C 4MHPA 1XRYA 3FEEA 2CY2A 1VHSA 2PDOA 1S60A 1FY7A 2VL1A 2ZEGA 1B47A 2EWBA 4C7IA 2HQYA 1QSNA 4C9AA 4ZY2A 4MFZA 1UFHA 3KKWA 3V38A 3GKRA 5IB0A 2Y1NA 4GPLB 2AE6A 3B3CA 3GB0A 3GUXA 3BUXB 2J8RA 3PEIA 3DLJA 3KRVA 2I00A 5HVHA 3VRNA 1S3ZA 3B8GA 4CAVA 3CXSA 3PB8X 4UEFA 5F1YA 2ZPAA 2ZW5A 4QC6A 2OZUA 4JYWA 3PB7X 1VKCA 2P6GA 2CIJA 4OAEA 3D7DA 1R43A 3BI1A 3VRRA 4M6GA 2NSMA 1YVHA 2JEWA 5CPAA 5H84A 1NMTA 5HKZA 5K8PA 4OC1A 1BPMA 2XPPA 2AFUA 1A2ZA 3TFYA 4MRIA 4NCZA
chains in the Genus database with same CATH topology
4P45A 4OC2A 1V6CA 2PVWA 3KASA 2PJ0A 3ISZA 3QNVA 4MHNA 1ELMP 5K8OA 1OBRA 4P4EA 2GLFA 5LYLA 3FMCA 4KNGE 2CTBA 3B3VA 1F2OA 3B3WA 2Q43A 2V8DA 4ONWA 1EE3P 3GLJA 4P4JA 2IMOA 2AFMA 3IFEA 3FVLA 1Y0RA 3K9TA 4OP4A 2GREA 3KQZA 3WC6A 4UEEA 3SJGA 4P4BA 2XEJA 4F9VA 1Z8LA 4YWYA 4MXUA 4P10A 4F8ZA 5ELYA 3RZAA 4H2KA 3B7IA 2GLJA 2PJ1A 1RTQA 5LYDA 4X2TA 1M4LA 3JRUA 3SI1A 2O53A 3PB4X 1YSJA 2RB7A 4UEZA 2FVGA 1YW4A 1Y0YA 3KGQA 3CPXA 3S9NA 4MCPA 1ZLIA 3CT9A 3NFZA 3ICUA 4EWTA 2C6GA 3KI9A 4NGPA 4EFDA 1ELLP 4NGNA 3LMSA 2ZEDA 3HLPA 2ZOFA 2PJ9A 5LYFA 5IR2A 3MRUA 2GP4A 8CPAA 3DGVA 3S9LA 2JBKA 7CPAA 5LRJA 4PXDA 4P4FA 2BO9A 4C84A 4NGMA 2XEIA 3BI0A 3NA6A 2AFWA 4C9RA 5LRGA 4DUKA 2V8HA 4C9UA 5HXDA 1NSAA 3NH5A 1PYTB 2AFOA 1CPXA 2QVPA 4PXCA 3IIBA 3RBUA 3KR4A 3FF3A 3PFOA 5K8NA 2PJBA 4ZX9A 3VTAA 2DEAA 4Q7AA 1LAPA 3TC8A 4TJVA 4DYOA 5CBMA 1VHEA 2XEFA 4PQAA 3VARA 2V8VA 4FUUA 3PBBA 1ZG9A 1YMEA 1ZG8A 4P4IA 4MCSA 3TX8A 4GM5A 2PJCA 3D66A 3MN8A 2OOTA 1R3NA 4X3RA 4X8IA 3D7FA 3KZWA 4ZYQA 1TKFA 2ZENA 2PJ6A 5LYIA 1TF8A 3D7HA 4TJXA 4TWEA 3PRTA 3B3SA 4O23A 3FJUA 3V7ZA 1ZLHA 2PJ4A 1F57A 3PFEA 4K3NA 1IGBA 4ZY1A 1CBXA 4C8FA 2QYVA 1XJOA 3IO1A 3SI0A 3RAMA 3WC7A 1Z2LA 4P6YA 4OC0A 2ZEEA 1YLOA 1DTDA 3PBEA 1Z5RA 2C6CA 4R8FA 3ISXA 3BHXA 4YU9A 4NGTA 2Q4ZA 4EMEA 2C6PA 3I74A 3SJEA 1TXRA 1TKHA 5JM6A 1Y7EA 3H8GA 2PIYA 4R6TA 4F9UA 5HVFA 1Q7LA 1QQ9A 1XFOA 4LQGA 1LFWA 3B2YA 4RUHA 4PXEA 4OC4A 4G1PA 1IY7A 4NGRA 2OR4A 4FAIA 1F2PA 3KHXA 4MCRA 2PIZA 3KQXA 4OIWA 5D8NA 4A39A 3FEDA 4NFRA 4P44A 1YW6A 3D68A 2QJ8A 4NJQA 4PXBA 1XMBA 1AMPA 1LCPA 4B6ZA 4IHMA 3IC1A 4A37A 4C9VA 3D67A 4UF4A 2C1CA 3D7GA 4MMOA 4C8UA 3KHZA 4C8TA 4OMEA 2BOAA 4C8AA 4NGSA 3IJ3A 1TF9A 1VHOA 2WYRA 4CDKA 3CDXA 1XBUA 4AXVA 2NYQA 3HUVA 3VATA 1LOKA 1XF1A 4YN3A 2CTCA 2PJ7A 1FT7A 2J9AA 4TNUA 5F09A 2PJ8A 1ARMA 3KL9A 3WT4A 4DJLA 4NJRA 4BD9A 3FX6A 4R76A 2PJ2A 2PJ5A 5HVGA 5J1QA 1BLLE 3H8EA 2RFHA 1VGYA 2CF4A 2F8HA 3EIFA 4ZX8A 4C85A 1KWMA 2EK8A 1Y9ZA 3WC5A 2V8GA 4ZY0A 2C5QA 4P4DA 3N5FA 5D29A 4CPAA 3BXMA 1HDUA 5JH9A 3NH8A 4C86A 4FWUA 1LAMA 2EK9A 2V77A 2AFZA 2AFXA 2ZEMA 4C99A 5LRKA 2AFSA 1CX8A 6CPAA 3I1UA 2JBJA 2ZEOA 3LWUA 4C8CA 5I4MA 1GYTA 2XEGA 3VH9A 5DS0A 2BCOA 1CG2A 4IAVA 2GU2A 3PB6X 3S9MA 5THWA 4ZI6A 2PJAA 3WABA 4R7MA 4C9EA 2POKA 2ANPA 3IWWA 5IB9A 2Q51A 2ZOGA 1ZG7A 4OC3A 2I3CA 3SI2A 2ZEFA 1DE4C 1PCAA 4A94A 1WVMA 1LANA 3NH4A 2F7VA 4UIBA 3PB9X 4A38A 1ARLA 1HEEA 3B35A 1BPNA 4OKOA 3D4UA 4UIAA 2PVVA 2PRQA 4MHYA 3T8WA 4Z65A 4IK2A 4OC5A 2WZNA 1JQGA 4W9YA 1HDQA 3SJFA 1AYEA 3L2NA 4WJBA 4PPZA 1BAVA 2G9DA 4MHZA 4FBEA 1TKJA 2IJZA 1H8LA 4NGQA 1FNOA 2ZELA 2ZEHA 3FH4A 3B3TA 2HC9A 1CP6A 1VIXA 2ABZA 5K8MA 4OIDA 1CP7A 4MCQA 4CDJA 3FECA 2IQ6A 3SJXA 4JZ0A 2ZEPA 5JGFA 1UWYA 2PE3A 1CPSA 2PCUA 3KR5A 2O4HA 3CPAA 4WWVA 4KSIA 2HB6A 3IEHA 4C8PA 3H8FA 1QMUA 2PJ3A 3K2KA 4MHPA 1XRYA 3FEEA 2VL1A 2ZEGA 2EWBA 4C9AA 4ZY2A 3V38A 3B3CA 3GUXA 3GB0A 3PEIA 3DLJA 5HVHA 3PB8X 4UEFA 4JYWA 3PB7X 2CIJA 3D7DA 1R43A 3BI1A 5CPAA 3I6SA 2NSMA 5K8PA 2JEWA 4OC1A 1BPMA 2AFUA 4MRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P45 A;  4OC2 A;  1V6C A;  2PVW A;  3KAS A;  2PJ0 A;  3ISZ A;  3QNV A;  4MHN A;  1ELM P;  5K8O A;  1OBR A;  4P4E A;  2GLF A;  5LYL A;  3FMC A;  4KNG E;  2CTB A;  3B3V A;  1F2O A;  3B3W A;  2Q43 A;  2V8D A;  4ONW A;  1EE3 P;  3GLJ A;  4P4J A;  2IMO A;  2AFM A;  3IFE A;  3FVL A;  1Y0R A;  3K9T A;  4OP4 A;  2GRE A;  3KQZ A;  3WC6 A;  4UEE A;  3SJG A;  4P4B A;  2XEJ A;  4F9V A;  1Z8L A;  4YWY A;  4MXU A;  4P10 A;  4F8Z A;  5ELY A;  3RZA A;  4H2K A;  3B7I A;  2GLJ A;  2PJ1 A;  1RTQ A;  5LYD A;  4X2T A;  1M4L A;  3JRU A;  3SI1 A;  2O53 A;  3PB4 X;  1YSJ A;  2RB7 A;  4UEZ A;  2FVG A;  1YW4 A;  1Y0Y A;  3KGQ A;  3CPX A;  3S9N A;  4MCP A;  1ZLI A;  3CT9 A;  3NFZ A;  3ICU A;  4EWT A;  2C6G A;  3KI9 A;  4NGP A;  4EFD A;  1ELL P;  4NGN A;  3LMS A;  2ZED A;  3HLP A;  2ZOF A;  2PJ9 A;  5LYF A;  3MRU A;  8CPA A;  3DGV A;  3S9L A;  2JBK A;  7CPA A;  5LRJ A;  4PXD A;  4P4F A;  2BO9 A;  4C84 A;  4NGM A;  2XEI A;  3BI0 A;  3NA6 A;  2AFW A;  4C9R A;  5LRG A;  4DUK A;  2V8H A;  4C9U A;  5HXD A;  1NSA A;  3NH5 A;  1PYT B;  2AFO A;  1CPX A;  2QVP A;  4PXC A;  3IIB A;  3RBU A;  3KR4 A;  3FF3 A;  3PFO A;  5K8N A;  2PJB A;  4ZX9 A;  3VTA A;  2DEA A;  4Q7A A;  1LAP A;  3TC8 A;  4TJV A;  4DYO A;  5CBM A;  1VHE A;  2XEF A;  4PQA A;  3VAR A;  2V8V A;  4FUU A;  3PBB A;  1ZG9 A;  1YME A;  1ZG8 A;  4P4I A;  4MCS A;  3TX8 A;  4GM5 A;  2PJC A;  3D66 A;  3MN8 A;  2OOT A;  1R3N A;  4X3R A;  4X8I A;  3D7F A;  3KZW A;  4ZYQ A;  1TKF A;  2ZEN A;  2PJ6 A;  5LYI A;  1TF8 A;  3D7H A;  4TJX A;  4TWE A;  3PRT A;  3B3S A;  4O23 A;  3FJU A;  3V7Z A;  1ZLH A;  2PJ4 A;  1F57 A;  3PFE A;  4K3N A;  1IGB A;  4ZY1 A;  1CBX A;  4C8F A;  2QYV A;  1XJO A;  3IO1 A;  3SI0 A;  3RAM A;  3WC7 A;  1Z2L A;  4P6Y A;  4OC0 A;  2ZEE A;  1YLO A;  1DTD A;  3PBE A;  1Z5R A;  2C6C A;  4R8F A;  3ISX A;  3BHX A;  4YU9 A;  4NGT A;  2Q4Z A;  4EME A;  2C6P A;  3I74 A;  3SJE A;  1TXR A;  1TKH A;  5JM6 A;  1Y7E A;  3H8G A;  2PIY A;  4R6T A;  4F9U A;  5HVF A;  1Q7L A;  1QQ9 A;  1XFO A;  4LQG A;  1LFW A;  3B2Y A;  4RUH A;  4PXE A;  4OC4 A;  4G1P A;  1IY7 A;  4NGR A;  2OR4 A;  4FAI A;  1F2P A;  3KHX A;  4MCR A;  2PIZ A;  3KQX A;  4OIW A;  5D8N A;  4A39 A;  3FED A;  4NFR A;  4P44 A;  1YW6 A;  3D68 A;  2QJ8 A;  4NJQ A;  4PXB A;  1XMB A;  1AMP A;  1LCP A;  4B6Z A;  4IHM A;  3IC1 A;  4A37 A;  4C9V A;  3D67 A;  4UF4 A;  2C1C A;  3D7G A;  4MMO A;  4C8U A;  3KHZ A;  4C8T A;  4OME A;  2BOA A;  4C8A A;  4NGS A;  3IJ3 A;  1TF9 A;  1VHO A;  2WYR A;  4CDK A;  3CDX A;  1XBU A;  4AXV A;  2NYQ A;  3HUV A;  3VAT A;  1LOK A;  1XF1 A;  4YN3 A;  2CTC A;  2PJ7 A;  1FT7 A;  2J9A A;  4TNU A;  5F09 A;  2PJ8 A;  1ARM A;  3KL9 A;  3WT4 A;  4DJL A;  4NJR A;  4BD9 A;  3FX6 A;  4R76 A;  2PJ2 A;  2PJ5 A;  5HVG A;  5J1Q A;  1BLL E;  3H8E A;  2RFH A;  1VGY A;  2CF4 A;  2F8H A;  3EIF A;  4ZX8 A;  4C85 A;  1KWM A;  2EK8 A;  1Y9Z A;  3WC5 A;  2V8G A;  4ZY0 A;  4P4D A;  3N5F A;  5D29 A;  4CPA A;  3BXM A;  1HDU A;  5JH9 A;  3NH8 A;  4C86 A;  4FWU A;  1LAM A;  2EK9 A;  2V77 A;  2AFZ A;  2AFX A;  2ZEM A;  4C99 A;  5LRK A;  2AFS A;  1CX8 A;  6CPA A;  3I1U A;  2JBJ A;  2ZEO A;  3LWU A;  4C8C A;  5I4M A;  1GYT A;  2XEG A;  3VH9 A;  5DS0 A;  2BCO A;  1CG2 A;  4IAV A;  2GU2 A;  3PB6 X;  3S9M A;  5THW A;  4ZI6 A;  2PJA A;  3WAB A;  4R7M A;  4C9E A;  2POK A;  2ANP A;  3IWW A;  5IB9 A;  2Q51 A;  2ZOG A;  1ZG7 A;  4OC3 A;  2I3C A;  3SI2 A;  2ZEF A;  1DE4 C;  1PCA A;  4A94 A;  1WVM A;  1LAN A;  3NH4 A;  2F7V A;  4UIB A;  3PB9 X;  4A38 A;  1ARL A;  1HEE A;  3B35 A;  1BPN A;  4OKO A;  3D4U A;  4UIA A;  2PVV A;  2PRQ A;  4MHY A;  3T8W A;  4Z65 A;  4IK2 A;  4OC5 A;  2WZN A;  1JQG A;  4W9Y A;  1HDQ A;  3SJF A;  1AYE A;  3L2N A;  4WJB A;  4PPZ A;  1BAV A;  2G9D A;  4MHZ A;  4FBE A;  1TKJ A;  2IJZ A;  1H8L A;  4NGQ A;  1FNO A;  2ZEL A;  2ZEH A;  3FH4 A;  3B3T A;  2HC9 A;  1CP6 A;  1VIX A;  2ABZ A;  5K8M A;  4OID A;  1CP7 A;  4MCQ A;  4CDJ A;  3FEC A;  2IQ6 A;  3SJX A;  4JZ0 A;  2ZEP A;  5JGF A;  1UWY A;  2PE3 A;  1CPS A;  2PCU A;  3KR5 A;  2O4H A;  3CPA A;  4WWV A;  4KSI A;  2HB6 A;  3IEH A;  4C8P A;  3H8F A;  1QMU A;  2PJ3 A;  3K2K A;  4MHP A;  1XRY A;  3FEE A;  2VL1 A;  2ZEG A;  2EWB A;  4C9A A;  4ZY2 A;  3V38 A;  3B3C A;  3GUX A;  3GB0 A;  3PEI A;  3DLJ A;  5HVH A;  3PB8 X;  4UEF A;  4JYW A;  3PB7 X;  2CIJ A;  3D7D A;  1R43 A;  3BI1 A;  5CPA A;  3I6S A;  2NSM A;  5K8P A;  2JEW A;  4OC1 A;  1BPM A;  2AFU A;  4MRI A; 
#chains in the Genus database with same CATH topology
 2RC4 A;  4P45 A;  2VI7 A;  1Z9E A;  1WWZ A;  2ATR A;  4AG9 A;  1DIK A;  4OC2 A;  1V6C A;  3FIX A;  2PVW A;  3KAS A;  1KC7 A;  5KTD A;  2PJ0 A;  4MFK A;  3ISZ A;  4B11 A;  2FM4 A;  1ZO0 A;  4CO9 A;  3OWC A;  3VRP A;  5GCN A;  4IUS A;  3QNV A;  4B14 A;  3EC4 A;  2YJT A;  1WK4 A;  3EY5 A;  1XEB A;  4MHN A;  1ELM P;  4UWJ A;  5K8O A;  4A31 A;  2FCK A;  2ZW7 A;  2B3V A;  3SXN A;  1OBR A;  3TT2 A;  2VZZ A;  4P4E A;  2GLF A;  5LYL A;  3T0T A;  3FMC A;  2HUZ A;  4KNG E;  2CTB A;  3B3V A;  1F2O A;  3B3W A;  2Q43 A;  2V8D A;  2ZXV A;  4OAD A;  4ONW A;  1EE3 P;  2QEC A;  3GLJ A;  4CGP A;  4P4J A;  2IMO A;  2AFM A;  3IFE A;  3FVL A;  3QAH A;  1Y0R A;  4H89 A;  4KLV A;  2H5M A;  3K9T A;  4UFX A;  4C2Z A;  3EZB A;  1I1D A;  4OP4 A;  2R98 A;  2GRE A;  3KQZ A;  4KSF A;  4UEE A;  3SJG A;  3WC6 A;  2A4N A;  4U9Y A;  4H6Z A;  3SR3 A;  4LUA A;  3OAK A;  2Z11 A;  2JDD A;  4P4B A;  2DXQ A;  2XEJ A;  4F9V A;  1KEE B;  1KUV A;  3EO4 A;  2KCW A;  3GJZ A;  1Z8L A;  1Q5X A;  2REF A;  2O28 A;  4MXU A;  4P10 A;  2VBQ A;  2FXF A;  4YWY A;  4CRZ B;  1ZRS A;  3ZNI A;  4F0X A;  4F8Z A;  5ELY A;  1OZP A;  2VXK A;  3RZA A;  4B10 A;  2D4P A;  4H2K A;  4H6U A;  3B7I A;  3PFV A;  1Y7R A;  1RTQ A;  2GLJ A;  2PJ1 A;  2Q4Y A;  5LYD A;  3TOA A;  4X2T A;  1M4L A;  4B5P A;  4CYO A;  3RYO A;  2R7H A;  3JRU A;  4UCN A;  3SI1 A;  4CGM A;  4JJX A;  4FD5 A;  4QVT A;  3QB8 A;  2WSA A;  1L0C A;  2O53 A;  3PB4 X;  5F46 A;  1YSJ A;  2RB7 A;  2P0W A;  4RS2 A;  4UEZ A;  2FVG A;  4RN7 A;  2Q7B A;  1NBW A;  4E8O A;  1YQE A;  1Y0Y A;  1YW4 A;  1Y9K A;  3S9N A;  3CPX A;  3KGQ A;  3EZA A;  4MCP A;  5J3X A;  1ZLI A;  2NMT A;  3CT9 A;  1SQH A;  3DR6 A;  4R87 A;  3R96 A;  1T36 B;  4YGO A;  5KTA A;  2C27 A;  3NFZ A;  3ICU A;  3DR8 A;  3T5M A;  4EWT A;  2C6G A;  4BPW B;  3KI9 A;  1J4J A;  4KUA A;  4NGP A;  2ODF A;  5DWM A;  4L89 A;  4EFD A;  4HKF A;  1PU9 A;  4L8A A;  3I6S A;  1ELL P;  2JEV A;  5C88 A;  4NGN A;  5A27 A;  3LMS A;  2ZED A;  3HLP A;  4Q38 A;  4H1H A;  2ZOF A;  1I21 A;  2PJ9 A;  4CAE A;  1KBL A;  4U5Y A;  2HWG A;  5LYF A;  1GGO A;  1FBV A;  5IR2 A;  3MRU A;  2GP4 A;  1MK4 A;  1BXR B;  2Q4V A;  2YND A;  3R9G A;  3LD2 A;  3W6X A;  8CPA A;  5A28 A;  4KOW A;  2CNT A;  3PZJ A;  3DGV A;  1M4D A;  2CBL A;  2JBK A;  3S9L A;  1RXT A;  2ZW4 A;  5LRJ A;  4PXD A;  4P4F A;  4UCP A;  7CPA A;  2BO9 A;  1IYL A;  4C84 A;  2QML A;  4C2X A;  4NGM A;  3TE4 A;  5K99 A;  3O8Z A;  2OLS A;  4NSQ A;  4IIY A;  5G21 A;  2XEI A;  3T90 A;  1ZL0 A;  1LRZ A;  3MGD A;  1M4G A;  3R95 A;  1WJT A;  3G23 A;  4KOX A;  5F13 A;  3BI0 A;  3NA6 A;  3EZE A;  4CGL A;  4XPD B;  5FVJ A;  2AFW A;  4A2Z A;  5KTC A;  4B5O A;  5LRG A;  4C9R A;  4F0Y A;  2PSW A;  1QST A;  4NEX A;  2WPW A;  5DWN A;  4OLL A;  2V8H A;  4DUK A;  4MFQ A;  4QUS A;  4C9U A;  1B6B A;  5HXD A;  1NSA A;  3F0A A;  4IIX A;  4Y49 B;  3TYX A;  3TO6 A;  4ONU A;  3NH5 A;  1IID A;  2OZH A;  1PYT B;  1S7L A;  1CS0 B;  2AFO A;  5FD8 A;  1CPX A;  2P6F A;  1S5K A;  3VGO A;  2QVP A;  2ARH A;  4PXC A;  4HNX B;  3IIB A;  2B5G B;  3RBU A;  3KR4 A;  2R1I A;  3FF3 A;  4BMH A;  3BUO B;  3V8I A;  2Q7S A;  3PFO A;  4EYS A;  4ZGY B;  5K8N A;  3D2M A;  2Z3P A;  2PJB A;  2ZW6 A;  4ZX9 A;  3VTA A;  2VZY A;  1CJW A;  1RO5 A;  1VBG A;  2DEA A;  4JLY A;  4Q7A A;  1LAP A;  3TC8 A;  4TJV A;  1EZB A;  4LX9 A;  4DYO A;  5CBM A;  1VHE A;  1Q2C A;  2XEF A;  4PQA A;  1S7K A;  2V8V A;  3VAR A;  4FUU A;  3TLY A;  3PBB A;  1ZG9 A;  1YME A;  1ZG8 A;  4MFL A;  4P4I A;  1QSM A;  2DPS A;  4MCS A;  4PK2 A;  4CYN A;  1M6V B;  2GAN A;  1NSL A;  4GM5 A;  3TX8 A;  2PJC A;  3D66 A;  2X0S A;  2Q04 A;  2P6E A;  2OOT A;  3MN8 A;  1R3N A;  2FSR A;  2BL1 A;  1XF8 A;  4X3R A;  2B58 A;  5HMN A;  1Q2Y A;  4X8I A;  3D7F A;  3BJ8 A;  4Q36 A;  3KZW A;  4ZYQ A;  1TKF A;  2B4D B;  4R9M A;  2Z3L A;  1X12 A;  2BSW A;  5JQ4 A;  2ZEN A;  5JYB A;  4FD7 A;  2PJ6 A;  5LYI A;  3TLZ A;  1TF8 A;  2YNC C;  3D7H A;  4MJX A;  5F47 A;  4M3S A;  4CYQ A;  4TWE A;  4AVA A;  3PRT A;  4TJX A;  3B3S A;  1JDE A;  3PT1 A;  4O23 A;  3FJU A;  2EZA A;  3S6F A;  4M8D A;  4UBR A;  2N3A B;  4DNC A;  2DIK A;  3PGP A;  4BPX B;  3V7Z A;  2GIV A;  2DPT A;  4R3L A;  4B12 A;  3TOB A;  2REE A;  4BBH A;  4AG7 A;  1ZLH A;  1KUX A;  1F57 A;  2PJ4 A;  3PFE A;  4K3N A;  3R9F A;  1U6M A;  3S6K A;  2G3T A;  1IGB A;  1EO0 A;  4ZY1 A;  1CBX A;  4FD4 A;  4UCM A;  3H5Z A;  4C8F A;  4MHD A;  2QYV A;  4I49 A;  5HKW A;  4KVX A;  1XJO A;  3G3S A;  3IO1 A;  4KLW A;  3SI0 A;  3IWG A;  1CE8 B;  4KVM E;  3RAM A;  2F5I A;  4MY3 A;  1GHE A;  3WC7 A;  4E2A A;  1Z2L A;  3GY9 A;  2Z3K A;  4P6Y A;  4KOY A;  3OB1 B;  1XIX A;  4OC0 A;  2ZEE A;  1YLO A;  5IX3 A;  1DTD A;  2XPO A;  3PBE A;  1Z5R A;  3RO0 A;  5I0C A;  3BUN B;  2R82 A;  2C6C A;  4QB9 A;  2XPL A;  4R8F A;  4C7H A;  3TLA A;  3ISX A;  3FRM A;  3BHX A;  1XE4 A;  3GIU A;  5AG6 A;  5G1Z A;  4YU9 A;  1NXJ A;  3T05 A;  3F5B A;  3TO9 A;  3TLE A;  4NGT A;  2Z0Z A;  4MI1 A;  2EUI A;  2Q4Z A;  2Z3O A;  4EME A;  2C6P A;  4YFJ A;  3I74 A;  3SJE A;  1TXR A;  2OB0 A;  1TKH A;  5JM6 A;  1Y7E A;  2CXA A;  4JWP A;  4JXQ A;  2FIW A;  3W91 A;  3H8G A;  5C82 A;  2PIY A;  4R6T A;  4F9U A;  5HVF A;  1Q7L A;  1QQ9 A;  1XFO A;  4LQG A;  2OH1 A;  1LFW A;  4A32 A;  3B2Y A;  4UFV A;  4RUH A;  2Y0M A;  3W6S A;  3BLN A;  4PXE A;  3K9U A;  4OC4 A;  4G1P A;  1IY7 A;  3LAC A;  4NF1 A;  4NGR A;  3FYN A;  2OU2 A;  2OR4 A;  3BUM B;  4FAI A;  4U9Z A;  5J8F A;  4K30 A;  5EC4 A;  1IYK A;  2Z3M A;  1VI4 A;  2B5G A;  1J3L A;  2E28 A;  4ZBG A;  1TIQ A;  4BTF A;  1F2P A;  2B4B A;  1P0H A;  1XMT A;  3KHX A;  1YVK A;  4MCR A;  2PIZ A;  3KQX A;  4OIW A;  4PV6 A;  3RNZ A;  5D8N A;  4A39 A;  3FED A;  4NFR A;  1VBH A;  3K4I A;  2IL4 A;  3ZZI A;  4P44 A;  1R57 A;  5AGE A;  3BJ7 A;  1YW6 A;  3D68 A;  2QJ8 A;  3JUW A;  4NJQ A;  4PXB A;  1XMB A;  1AMP A;  5CNP A;  5F5X A;  1LCP A;  4F6A A;  4YRH A;  4B6Z A;  3VRQ A;  4IHM A;  3IC1 A;  4A37 A;  3NOJ A;  4C9V A;  3D67 A;  3EFA A;  4UF4 A;  2C1C A;  3D7G A;  2EO8 A;  4MMO A;  4AB7 A;  2J8M A;  4C8U A;  2OZG A;  3IGR A;  3KHZ A;  5ISV A;  1ZYM A;  4OME A;  2BOA A;  4RI1 A;  3BUW B;  4C8T A;  4C8A A;  4NGS A;  3IJ3 A;  1TF9 A;  1VHO A;  2FT0 A;  2WYR A;  4CDK A;  1Z4E A;  3OP0 A;  5EMI A;  2B4D A;  4INJ A;  2PCN A;  3JTK A;  1JWQ A;  3NE7 A;  3CDX A;  3GYA A;  4KOR A;  2XPN A;  2FIA A;  1IU8 A;  2X7B A;  1XBU A;  3F8K A;  2K5T A;  1R61 A;  3HMJ G;  4KZT A;  3S6G A;  4AXV A;  4C2Y A;  4KOU A;  2NYQ A;  4HPS A;  4LQ6 A;  3CXP A;  3HUV A;  1X10 A;  3FNC A;  3LOD A;  3TLB A;  3VAT A;  2B3U A;  1LOK A;  3QAY A;  1XF1 A;  1YLE A;  4YN3 A;  2CTC A;  1V0C A;  2PJ7 A;  4PSX A;  3HPG G;  1K4J A;  1FT7 A;  2Q0Y A;  2BUE A;  4MFJ A;  2J9A A;  4TNU A;  5F09 A;  2JDC A;  2PJ8 A;  1ARM A;  2Z10 A;  3KL9 A;  3WT4 A;  4DJL A;  3TLC A;  2VKZ G;  4BPU B;  3R1K A;  4COG A;  2GFQ A;  3NFQ A;  2WUU A;  3P2F A;  4NJR A;  4BD9 A;  2B0A A;  5JVL A;  1ON0 A;  3FX6 A;  4JD6 A;  5G22 A;  4JVO A;  4R76 A;  3TLG B;  3TO7 A;  2I79 A;  2GE3 A;  3FBU A;  2PJ2 A;  2CNM A;  3T9Y A;  3H4Q A;  2PJ5 A;  3D8P A;  1XOV A;  4EVY A;  4JXR A;  1YGH A;  5HVG A;  5J1Q A;  1BLL E;  2YNC A;  4CS0 B;  1A9X B;  3H8E A;  2EZB A;  2RFH A;  1VGY A;  1M4I A;  2CF4 A;  2F8H A;  4GS4 A;  3EIF A;  5E96 A;  4ZX8 A;  4C85 A;  2EVN A;  4M85 A;  4KOS A;  1KWM A;  1QSR A;  2EK8 A;  2YNE A;  4PSW A;  3WC5 A;  1Y9Z A;  1YX0 A;  2V8G A;  4ZY0 A;  4QBJ A;  3G8W A;  3C26 A;  1BO4 A;  2C5Q A;  2G3A A;  4CRY B;  4P4D A;  4A33 A;  3N5F A;  5D29 A;  1YK3 A;  4CPA A;  3BXM A;  1HDU A;  3P2H A;  5JH9 A;  5AG4 A;  5H86 A;  1EZA A;  3NH8 A;  4MI4 A;  1N71 A;  4FWU A;  4GXH A;  2HI6 A;  4AVB A;  4C86 A;  1MJB A;  1Q2D A;  1LAM A;  2EK9 A;  2V77 A;  2AFZ A;  4COB A;  3ZJ0 A;  3DSB A;  2PR1 A;  2AFX A;  3PLF B;  4HNY B;  2ZEM A;  4C99 A;  5EBV A;  4A4B A;  5F49 A;  3C8O A;  4NXY A;  5LRK A;  2EZC A;  2QIR A;  3R9E A;  2AFS A;  1CX8 A;  3S6H A;  6CPA A;  3I1U A;  4CGO A;  1KZF A;  2JBJ A;  4UWI A;  2ZEO A;  3LWU A;  1I12 A;  3HPH E;  5I4M A;  4C8C A;  3VWD A;  1GYT A;  2XEG A;  1Z9U A;  2BEI A;  3TCV A;  3VH9 A;  4A4C A;  1PUA A;  3EXN A;  1C3O B;  5DS0 A;  2BCO A;  4E94 A;  1IOF A;  1M1D A;  3E0K A;  4KVO E;  5G20 A;  1CG2 A;  1YVO A;  4IAV A;  3DDD A;  2DLA A;  3U1B A;  2GU2 A;  3PB6 X;  3S9M A;  5THW A;  1IOI A;  4MFP A;  4CYP A;  4ZI6 A;  4KSA A;  2PJA A;  3IU1 A;  4KUB A;  1YR0 A;  3SXO A;  3DNS A;  3WAB A;  4R7M A;  4C9E A;  2POK A;  2DF5 A;  1Z8T A;  2ANP A;  3IWW A;  4M6I A;  4MJ8 A;  5F9M A;  1M44 A;  5IB9 A;  2Q51 A;  2ZOG A;  2PRB A;  4MY0 A;  3I9S A;  1ZG7 A;  4OC3 A;  1BOB A;  2CNS A;  3NE8 A;  2I3C A;  4J3G A;  3F9K C;  4CAW A;  3SI2 A;  1P4N A;  3PP9 A;  2ZEF A;  1DE4 C;  5BWA B;  3JVN A;  1YRE A;  4CAF A;  4A95 A;  1PCA A;  3CZX A;  4A94 A;  1Z8W A;  1WVM A;  1LAN A;  4MBU A;  2AUN A;  4RR2 B;  2PR8 A;  2YGW A;  4X5K A;  2B4J C;  4CZ1 A;  1Z4R A;  3NH4 A;  2F7V A;  3D3S A;  4J0N A;  3FB3 A;  4UFW A;  4UIB A;  4XPK A;  1S7N A;  3PB9 X;  4R57 A;  4C68 A;  4A38 A;  1ARL A;  1HEE A;  3B35 A;  5F48 A;  1BPN A;  4XNH C;  4OKO A;  1MJA A;  4A30 A;  5IV0 A;  3D4U A;  3FXT A;  4PK3 A;  4UIA A;  4FD6 A;  2D4O A;  2PVV A;  2PRQ A;  4KS9 A;  5AG5 A;  4B13 A;  4MHY A;  2EBJ A;  2FS5 A;  4HNW B;  3T8W A;  4M6H A;  4XPD C;  4Z65 A;  1JDB C;  2AUM A;  1KUY A;  2MP0 A;  4CGN A;  4IK2 A;  4OC5 A;  1B87 A;  4BIN A;  2WZN A;  1JQG A;  2JLM A;  4W9Y A;  1HDQ A;  3CXQ A;  3VWE A;  3WR7 A;  3SJF A;  1AYE A;  3L2N A;  1S7F A;  4WJB A;  1NE9 A;  3TLG A;  1C30 B;  4PPZ A;  4UA3 A;  5HKY A;  5AXI A;  1BAV A;  2G0B A;  1CM0 A;  2HRO A;  2FL4 A;  2G9D A;  3A9L A;  3IU2 A;  4Y49 C;  2Q44 A;  4MHZ A;  2AJ6 A;  4FBE A;  1TKJ A;  4E5S A;  3OB2 B;  3N7Z A;  2IJZ A;  4KOT A;  2VEZ A;  5BY0 A;  1IB1 E;  2UV8 G;  4IF5 A;  1H8L A;  4NGQ A;  2YJV A;  1FNO A;  2ZEL A;  4AVC A;  4KOV A;  4B5P B;  3VRO A;  2ZEH A;  3TTH A;  1Y9W A;  2J8N A;  2Y1M A;  2VQY A;  3FH4 A;  3B3T A;  4ORF A;  2HC9 A;  1CP6 A;  1IIC A;  4XNH B;  1VIX A;  2ABZ A;  5K8M A;  4OID A;  1CP7 A;  5J8C A;  4MCQ A;  4CAX A;  4XPL A;  1MJ9 A;  3D2P A;  5AG7 A;  4CDJ A;  3FEC A;  3IWE A;  2D0O A;  3SHP A;  3T07 A;  5HH1 A;  2IQ6 A;  3SJX A;  1QSO A;  2Z3N A;  1AUG A;  4JZ0 A;  4II9 A;  2ZEP A;  5JGF A;  2PC1 A;  2PQ8 A;  2WPX A;  1UWY A;  2PE3 A;  4E0A A;  1CPS A;  4R3K A;  2FE7 A;  2PCU A;  3UY5 A;  3KR5 A;  2O4H A;  1Z8X A;  3CPA A;  2R8V A;  3I3G A;  4KSI A;  2HB6 A;  4WWV A;  5JPH A;  3IEH A;  4C8P A;  2HV2 A;  1QMU A;  2PJ3 A;  3H8F A;  3K2K A;  2D0P A;  3U88 C;  4MHP A;  1XRY A;  3FEE A;  2CY2 A;  1VHS A;  2PDO A;  1S60 A;  1FY7 A;  2VL1 A;  2ZEG A;  1B47 A;  2EWB A;  4C7I A;  2HQY A;  1QSN A;  4C9A A;  4ZY2 A;  4MFZ A;  1UFH A;  3KKW A;  3V38 A;  3GKR A;  5IB0 A;  2Y1N A;  4GPL B;  2AE6 A;  3B3C A;  3GB0 A;  3GUX A;  3BUX B;  2J8R A;  3PEI A;  3DLJ A;  3KRV A;  2I00 A;  5HVH A;  3VRN A;  1S3Z A;  3B8G A;  4CAV A;  3CXS A;  3PB8 X;  4UEF A;  5F1Y A;  2ZPA A;  2ZW5 A;  4QC6 A;  2OZU A;  4JYW A;  3PB7 X;  1VKC A;  2P6G A;  2CIJ A;  4OAE A;  3D7D A;  1R43 A;  3BI1 A;  3VRR A;  4M6G A;  2NSM A;  1YVH A;  2JEW A;  5CPA A;  5H84 A;  1NMT A;  5HKZ A;  5K8P A;  4OC1 A;  1BPM A;  2XPP A;  2AFU A;  1A2Z A;  3TFY A;  4MRI A;  4NCZ A; 
#chains in the Genus database with same CATH homology
 4P45 A;  4OC2 A;  1V6C A;  2PVW A;  3KAS A;  2PJ0 A;  3ISZ A;  3QNV A;  4MHN A;  1ELM P;  5K8O A;  1OBR A;  4P4E A;  2GLF A;  5LYL A;  3FMC A;  4KNG E;  2CTB A;  3B3V A;  1F2O A;  3B3W A;  2Q43 A;  2V8D A;  4ONW A;  1EE3 P;  3GLJ A;  4P4J A;  2IMO A;  2AFM A;  3IFE A;  3FVL A;  1Y0R A;  3K9T A;  4OP4 A;  2GRE A;  3KQZ A;  3WC6 A;  4UEE A;  3SJG A;  4P4B A;  2XEJ A;  4F9V A;  1Z8L A;  4YWY A;  4MXU A;  4P10 A;  4F8Z A;  5ELY A;  3RZA A;  4H2K A;  3B7I A;  2GLJ A;  2PJ1 A;  1RTQ A;  5LYD A;  4X2T A;  1M4L A;  3JRU A;  3SI1 A;  2O53 A;  3PB4 X;  1YSJ A;  2RB7 A;  4UEZ A;  2FVG A;  1YW4 A;  1Y0Y A;  3KGQ A;  3CPX A;  3S9N A;  4MCP A;  1ZLI A;  3CT9 A;  3NFZ A;  3ICU A;  4EWT A;  2C6G A;  3KI9 A;  4NGP A;  4EFD A;  1ELL P;  4NGN A;  3LMS A;  2ZED A;  3HLP A;  2ZOF A;  2PJ9 A;  5LYF A;  5IR2 A;  3MRU A;  2GP4 A;  8CPA A;  3DGV A;  3S9L A;  2JBK A;  7CPA A;  5LRJ A;  4PXD A;  4P4F A;  2BO9 A;  4C84 A;  4NGM A;  2XEI A;  3BI0 A;  3NA6 A;  2AFW A;  4C9R A;  5LRG A;  4DUK A;  2V8H A;  4C9U A;  5HXD A;  1NSA A;  3NH5 A;  1PYT B;  2AFO A;  1CPX A;  2QVP A;  4PXC A;  3IIB A;  3RBU A;  3KR4 A;  3FF3 A;  3PFO A;  5K8N A;  2PJB A;  4ZX9 A;  3VTA A;  2DEA A;  4Q7A A;  1LAP A;  3TC8 A;  4TJV A;  4DYO A;  5CBM A;  1VHE A;  2XEF A;  4PQA A;  3VAR A;  2V8V A;  4FUU A;  3PBB A;  1ZG9 A;  1YME A;  1ZG8 A;  4P4I A;  4MCS A;  3TX8 A;  4GM5 A;  2PJC A;  3D66 A;  3MN8 A;  2OOT A;  1R3N A;  4X3R A;  4X8I A;  3D7F A;  3KZW A;  4ZYQ A;  1TKF A;  2ZEN A;  2PJ6 A;  5LYI A;  1TF8 A;  3D7H A;  4TJX A;  4TWE A;  3PRT A;  3B3S A;  4O23 A;  3FJU A;  3V7Z A;  1ZLH A;  2PJ4 A;  1F57 A;  3PFE A;  4K3N A;  1IGB A;  4ZY1 A;  1CBX A;  4C8F A;  2QYV A;  1XJO A;  3IO1 A;  3SI0 A;  3RAM A;  3WC7 A;  1Z2L A;  4P6Y A;  4OC0 A;  2ZEE A;  1YLO A;  1DTD A;  3PBE A;  1Z5R A;  2C6C A;  4R8F A;  3ISX A;  3BHX A;  4YU9 A;  4NGT A;  2Q4Z A;  4EME A;  2C6P A;  3I74 A;  3SJE A;  1TXR A;  1TKH A;  5JM6 A;  1Y7E A;  3H8G A;  2PIY A;  4R6T A;  4F9U A;  5HVF A;  1Q7L A;  1QQ9 A;  1XFO A;  4LQG A;  1LFW A;  3B2Y A;  4RUH A;  4PXE A;  4OC4 A;  4G1P A;  1IY7 A;  4NGR A;  2OR4 A;  4FAI A;  1F2P A;  3KHX A;  4MCR A;  2PIZ A;  3KQX A;  4OIW A;  5D8N A;  4A39 A;  3FED A;  4NFR A;  4P44 A;  1YW6 A;  3D68 A;  2QJ8 A;  4NJQ A;  4PXB A;  1XMB A;  1AMP A;  1LCP A;  4B6Z A;  4IHM A;  3IC1 A;  4A37 A;  4C9V A;  3D67 A;  4UF4 A;  2C1C A;  3D7G A;  4MMO A;  4C8U A;  3KHZ A;  4C8T A;  4OME A;  2BOA A;  4C8A A;  4NGS A;  3IJ3 A;  1TF9 A;  1VHO A;  2WYR A;  4CDK A;  3CDX A;  1XBU A;  4AXV A;  2NYQ A;  3HUV A;  3VAT A;  1LOK A;  1XF1 A;  4YN3 A;  2CTC A;  2PJ7 A;  1FT7 A;  2J9A A;  4TNU A;  5F09 A;  2PJ8 A;  1ARM A;  3KL9 A;  3WT4 A;  4DJL A;  4NJR A;  4BD9 A;  3FX6 A;  4R76 A;  2PJ2 A;  2PJ5 A;  5HVG A;  5J1Q A;  1BLL E;  3H8E A;  2RFH A;  1VGY A;  2CF4 A;  2F8H A;  3EIF A;  4ZX8 A;  4C85 A;  1KWM A;  2EK8 A;  1Y9Z A;  3WC5 A;  2V8G A;  4ZY0 A;  2C5Q A;  4P4D A;  3N5F A;  5D29 A;  4CPA A;  3BXM A;  1HDU A;  5JH9 A;  3NH8 A;  4C86 A;  4FWU A;  1LAM A;  2EK9 A;  2V77 A;  2AFZ A;  2AFX A;  2ZEM A;  4C99 A;  5LRK A;  2AFS A;  1CX8 A;  6CPA A;  3I1U A;  2JBJ A;  2ZEO A;  3LWU A;  4C8C A;  5I4M A;  1GYT A;  2XEG A;  3VH9 A;  5DS0 A;  2BCO A;  1CG2 A;  4IAV A;  2GU2 A;  3PB6 X;  3S9M A;  5THW A;  4ZI6 A;  2PJA A;  3WAB A;  4R7M A;  4C9E A;  2POK A;  2ANP A;  3IWW A;  5IB9 A;  2Q51 A;  2ZOG A;  1ZG7 A;  4OC3 A;  2I3C A;  3SI2 A;  2ZEF A;  1DE4 C;  1PCA A;  4A94 A;  1WVM A;  1LAN A;  3NH4 A;  2F7V A;  4UIB A;  3PB9 X;  4A38 A;  1ARL A;  1HEE A;  3B35 A;  1BPN A;  4OKO A;  3D4U A;  4UIA A;  2PVV A;  2PRQ A;  4MHY A;  3T8W A;  4Z65 A;  4IK2 A;  4OC5 A;  2WZN A;  1JQG A;  4W9Y A;  1HDQ A;  3SJF A;  1AYE A;  3L2N A;  4WJB A;  4PPZ A;  1BAV A;  2G9D A;  4MHZ A;  4FBE A;  1TKJ A;  2IJZ A;  1H8L A;  4NGQ A;  1FNO A;  2ZEL A;  2ZEH A;  3FH4 A;  3B3T A;  2HC9 A;  1CP6 A;  1VIX A;  2ABZ A;  5K8M A;  4OID A;  1CP7 A;  4MCQ A;  4CDJ A;  3FEC A;  2IQ6 A;  3SJX A;  4JZ0 A;  2ZEP A;  5JGF A;  1UWY A;  2PE3 A;  1CPS A;  2PCU A;  3KR5 A;  2O4H A;  3CPA A;  4WWV A;  4KSI A;  2HB6 A;  3IEH A;  4C8P A;  3H8F A;  1QMU A;  2PJ3 A;  3K2K A;  4MHP A;  1XRY A;  3FEE A;  2VL1 A;  2ZEG A;  2EWB A;  4C9A A;  4ZY2 A;  3V38 A;  3B3C A;  3GUX A;  3GB0 A;  3PEI A;  3DLJ A;  5HVH A;  3PB8 X;  4UEF A;  4JYW A;  3PB7 X;  2CIJ A;  3D7D A;  1R43 A;  3BI1 A;  5CPA A;  3I6S A;  2NSM A;  5K8P A;  2JEW A;  4OC1 A;  1BPM A;  2AFU A;  4MRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...