4NGSA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
total genus 263
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngsA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngsA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngsA02
2JBKA 4F9UA 3D66A 2JEWA 3SJEA 2XEIA 4KNGE 2NYQA 2CIJA 2PJBA 4CPAA 5THWA 3FEEA 8CPAA 5F09A 3PBEA 4TJVA 1ZG9A 3MRUA 2ZEMA 1VHEA 1DE4C 2Q43A 5HVHA 3B35A 3PEIA 3BI1A 2C6CA 5K8OA 4ZI6A 2PJ1A 3VATA 1Y0YA 1NSAA 4PPZA 4C9AA 3H8FA 2BCOA 4P45A 3KI9A 1Y0RA 2F8HA 4EFDA 4OC3A 4KSIA 4UEZA 1CG2A 3PRTA 2POKA 2V77A 1HDQA 2PIZA 4RUHA 4MMOA 4W9YA 1XFOA 4C84A 3FX6A 5JM6A 1VHOA 2PJ6A 3WABA 4IK2A 2PVWA 4MCRA 2I3CA 1VIXA 4UIBA 2PCUA 4P4IA 3CPXA 4TNUA 2ZEPA 4Z65A 4R76A 2PJ3A 3EIFA 1Q7LA 4OMEA 4LQGA 3PFEA 5D8NA 5K8PA 3NH4A 1R3NA 3DGVA 4O23A 4K3NA 3IO1A 4A37A 4TJXA 5IB9A 3D7GA 2PRQA 2HC9A 4H2KA 4PQAA 4PXDA 4R8FA 3FMCA 1WVMA 1ZG8A 4C8FA 3S9MA 4G1PA 3BXMA 1XBUA 3WC5A 4MCQA 2IQ6A 2RB7A 4OC2A 4JYWA 3K2KA 4ZY0A 3NA6A 4CDKA 1F57A 1F2OA 1R43A 3SI1A 4DUKA 2PJ2A 5LYIA 5LRGA 1CP7A 2QVPA 5D29A 4Q7AA 4CDJA 4BD9A 2ZEOA 3IJ3A 1LANA 4C9UA 3WT4A 3VTAA 2BO9A 1AMPA 1YW4A 2XEJA 1ARLA 3KHXA 3IEHA 4NJRA 3PB4X 3KHZA 2IJZA 2ZOFA 4NGNA 4NGSA 3D7FA 2EK8A 1XMBA 3CDXA 4UIAA 3WC6A 3WC7A 3PFOA 4FWUA 2G9DA 1ZLHA 1AYEA 1DTDA 4AXVA 5K8MA 2F7VA 4JZ0A 4A94A 4ZY1A 4MXUA 5ELYA 3FEDA 2CF4A 4FAIA 3FF3A 3B3TA 3B2YA 4PXBA 4YWYA 2PJ0A 1OBRA 2WZNA 4B6ZA 3KASA 3KR5A 1CBXA 2GLFA 4PXCA 1FT7A 2CTBA 3T8WA 4C8TA 2QJ8A 3PBBA 3HLPA 2ZEGA 3JRUA 4OP4A 1HDUA 4UEEA 3SJXA 4NGRA 2AFXA 4IHMA 2AFUA 4NGPA 7CPAA 3B3SA 1TF8A 1IY7A 3SI0A 4X3RA 4P10A 3RZAA 3B3CA 4GM5A 1ZLIA 4MRIA 4C8CA 2XEGA 4X2TA 2DEAA 1CP6A 1ARMA 3B3WA 4NJQA 4NGMA 2V8VA 4YN3A 2O4HA 1PCAA 3I6SA 2IMOA 1BPNA 1YSJA 3PB7X 1XF1A 3S9NA 2ZOGA 5LYFA 1TXRA 1M4LA 5HVFA 2HB6A 3D67A 5K8NA 4ZX8A 1LCPA 2ZEHA 4WWVA 3ICUA 5LRKA 3D7DA 3TC8A 4P4BA 1YW6A 4R6TA 2PJ5A 2Q4ZA 2NSMA 3D68A 3IIBA 1XRYA 4ZY2A 1KWMA 4MHZA 5LRJA 2GLJA 4C99A 5CPAA 1Z2LA 1QQ9A 4EMEA 4P4EA 3BI0A 2ZEDA 3CPAA 4IAVA 4NGTA 5CBMA 2AFZA 2PJ9A 2PE3A 3LWUA 4OIWA 4OC1A 4OC4A 1EE3P 1BAVA 1Y7EA 3HUVA 4DYOA 1CX8A 5HXDA 4C9EA 3CT9A 4NGQA 1TF9A 4C8UA 1QMUA 4MCSA 4MCPA 4A39A 3D7HA 2PIYA 4P6YA 2OR4A 2OOTA 4MHYA 4A38A 1PYTB 5DS0A 4F8ZA 3SJFA 4OKOA 4C9RA 3H8EA 3NFZA 5LYLA 2VL1A 1YMEA 4WJBA 2EWBA 3KL9A 5JGFA 1CPXA 4P4FA 3PB6X 4DJLA 2PJCA 1Y9ZA 4UF4A 2BOAA 5JH9A 2AFWA 3GB0A 1VGYA 1BPMA 4C8AA 2JBJA 2QYVA 4P44A 1V6CA 3H8GA 1JQGA 3BHXA 3SI2A 4FBEA 3SJGA 1H8LA 3RAMA 1RTQA 4OC5A 1XJOA 3GUXA 6CPAA 2C6PA 1ELMP 2WYRA 2PJ4A 4F9VA 4MHNA 4NFRA 4ZX9A 2FVGA 3IC1A 2V8HA 3VARA 1CPSA 2ZENA 3GLJA 3KGQA 5I4MA 5LYDA 2PJAA 4C8PA 4FUUA 3B7IA 4P4JA 4R7MA 3LMSA 1Z5RA 1HEEA 3IWWA 3I74A 2O53A 4OIDA 5HVGA 4EWTA 5J1QA 1LAMA 4OC0A 2GU2A 3FVLA 2Q51A 4C86A 3ISXA 2GREA 1ELLP 2V8GA 2ZELA 2AFOA 3V7ZA 2PJ8A 3RBUA 2V8DA 1TKFA 1TKHA 2C1CA 2EK9A 4C85A 3V38A 4X8IA 2ZEFA 4YU9A 3N5FA 2PJ7A 1LFWA 3KR4A 1LOKA 2ANPA 3VH9A 4ONWA 4ZYQA 3PB9X 1GYTA 3NH5A 3QNVA 2C6GA 4P4DA 3I1UA 3IFEA 3K9TA 2ABZA 4TWEA 1IGBA 4MHPA 3MN8A 1UWYA 3KQZA 3FH4A 3D4UA 1BLLE 3PB8X 3ISZA 2AFMA 1LAPA 3L2NA 3NH8A 1F2PA 2CTCA 3B3VA 4C9VA 3S9LA 3TX8A 1ZG7A 2ZEEA 1YLOA 4UEFA 1Z8LA 3DLJA 2RFHA 3FECA 2AFSA 1FNOA 2PVVA 3KQXA 1TKJA 4PXEA 2XEFA 2J9AA 3KZWA 3FJUA
chains in the Genus database with same CATH superfamily
2DF5A 2JBKA 4F9UA 3EZEA 4KLWA 3D66A 4M6HA 3TLAA 3C8OA 2JEWA 3IWEA 3SJEA 4NSQA 2XEIA 4UFXA 4C7HA 1S3ZA 2NYQA 4X5KA 4CYQA 4BTFA 4KNGE 2CIJA 2PJBA 4C2ZA 4MY3A 4CPAA 5THWA 4AB7A 2QIRA 3FEEA 8CPAA 5F09A 3FXTA 3I3GA 3PBEA 4TJVA 1ZG9A 5DWNA 4A32A 3MRUA 2ZEMA 1VHEA 2ZXVA 3EFAA 4B11A 3U88C 2FM4A 1DE4C 5G1ZA 1RXTA 2Q43A 3VRNA 4E2AA 2QMLA 3ZJ0A 5HVHA 1WWZA 2PC1A 3B35A 3PEIA 1M1DA 1UFHA 1XIXA 3W6SA 4A31A 3BI1A 2UV8G 3DR6A 1SQHA 2C6CA 2J8NA 3LACA 4ZI6A 5K8OA 2PJ1A 2YNDA 5AGEA 3VATA 4KORA 3H4QA 1Y0YA 1NSAA 4QBJA 4PPZA 1XF8A 5AG4A 4C9AA 3H8FA 2BCOA 5G22A 5DWMA 2ZPAA 4P45A 2B3UA 3KI9A 2EZBA 2Y1NA 1IICA 1Y0RA 2F8HA 3TLCA 3F8KA 4EFDA 2ZW6A 2BUEA 4OC3A 5GCNA 4KSIA 3CZXA 4UEZA 3W6XA 1CG2A 3FNCA 4C68A 2AUNA 3PRTA 2POKA 4LQ6A 2Q7SA 4NEXA 5J8FA 4KVME 5JQ4A 2V77A 5IB0A 5KTAA 4BPWB 1HDQA 2PIZA 4RUHA 1BO4A 2VZZA 3A9LA 4MMOA 3OAKA 2H5MA 3R9FA 2EVNA 4W9YA 1RO5A 1S60A 3T05A 1XFOA 1NSLA 4YRHA 4C84A 3FX6A 4H6UA 5JM6A 1VHOA 1JDBC 1M44A 4Y49C 5F1YA 2PJ6A 3OP0A 3WABA 4IK2A 2PVWA 4FD4A 5FVJA 4B5PB 5FD8A 3PLFB 4MCRA 4FD5A 2I3CA 3TLZA 1VIXA 4PV6A 3BUMB 4UIBA 2PCUA 1Q5XA 4P4IA 3CPXA 4TNUA 3BLNA 3IU1A 2ZEPA 2Z3MA 4R9MA 4Z65A 4R76A 4AVCA 2PJ3A 3EIFA 1Q7LA 4OMEA 2OU2A 4LQGA 4M6GA 1C3OB 1ZO0A 3VRRA 2FIWA 3PFEA 2R82A 3K4IA 2O28A 5D8NA 2I79A 5K8PA 3O8ZA 4Q38A 2MP0A 2XPOA 3NH4A 1C30B 3FRMA 2HI6A 1R3NA 2VXKA 3DGVA 4O23A 2Z3KA 3QB8A 1R61A 4K3NA 3IO1A 3ZNIA 4A37A 2EUIA 4TJXA 2CNSA 2B3VA 3D7GA 2PRQA 1IYKA 2R1IA 2REEA 1YVHA 2HC9A 5HH1A 4C2YA 4H2KA 2PSWA 4PQAA 4RS2A 3G3SA 4PXDA 4R8FA 5JPHA 3FMCA 4DNCA 1WVMA 4KOSA 1ZG8A 4M6IA 1EZAA 1Z8WA 4C8FA 2Z3LA 3FIXA 5ISVA 2C5QA 4NXYA 3S9MA 4KOVA 4G1PA 3BXMA 3UY5A 1XOVA 4JVOA 1XBUA 3WC5A 4MCQA 3VROA 2IQ6A 2RB7A 3FBUA 4MFJA 1DIKA 3R9EA 1EO0A 1P0HA 4OC2A 3K9UA 4JYWA 2WPWA 3K2KA 4ZY0A 2Z3PA 3NA6A 3FYNA 4CDKA 4B10A 2RC4A 5HKZA 1F2OA 1F57A 1R43A 3SI1A 4UFVA 4XPDB 2PJ2A 5LYIA 4DUKA 5LRGA 1CP7A 1MK4A 5D29A 2GIVA 2P0WA 2QVPA 3D3SA 2J8RA 4Q7AA 3P2HA 4CDJA 4BD9A 1MJ9A 2ZEOA 5BY0A 3IJ3A 5F48A 1LANA 4BINA 2PDOA 4C9UA 3WT4A 3VTAA 3PP9A 2BO9A 1AMPA 1YW4A 4CAWA 4U5YA 2XEJA 1I21A 4QUSA 2VQYA 1ARLA 4XNHB 1IYLA 2BSWA 3KHXA 5IX3A 3IEHA 4A30A 4ORFA 4NJRA 3PB4X 5EC4A 3KHZA 4B5OA 1VBHA 1JWQA 2IJZA 2ZOFA 4NGNA 2HQYA 2ZW4A 2Q04A 4NGSA 4B5PA 3D7FA 1KUYA 2EK8A 4QC6A 1XMBA 2D0OA 2Z3OA 3CDXA 1Z4EA 4UIAA 3WC6A 1S7FA 4QB9A 3WC7A 2G3AA 5F47A 3TTHA 3PFOA 1GHEA 4KUBA 2G3TA 4FWUA 4KOUA 1KZFA 5AG5A 3R96A 3RO0A 1KEEB 5KTDA 2CXAA 2G9DA 3MGDA 4HNYB 4IF5A 1ZLHA 4B13A 1QSOA 1AYEA 1DTDA 3T0TA 1IU8A 2FE7A 4RN7A 3DDDA 3KKWA 3NE7A 3S6FA 4AXVA 5K8MA 2F7VA 4JZ0A 4INJA 1QSRA 2Q0YA 4A94A 4ZY1A 4MXUA 4IIYA 3TLEA 3TT2A 5ELYA 3FEDA 4Q36A 4JWPA 3TO7A 2CF4A 2X7BA 4FAIA 3FF3A 4M85A 4U9ZA 2B0AA 4YFJA 1Z8TA 1KUXA 2CNMA 3B3TA 1B87A 2PR1A 3B2YA 4PXBA 4UA3A 1CJWA 2PJ0A 4YWYA 1OBRA 3T07A 1PU9A 2WZNA 3FB3A 3CXQA 2K5TA 3RNZA 5KTCA 1PUAA 4B6ZA 3KASA 3KR5A 1CBXA 1FY7A 2HWGA 2GLFA 3HPHE 5IV0A 4PXCA 1FT7A 3KRVA 2Q4YA 4YGOA 2B4JC 5HMNA 2CTBA 3T8WA 4ZGYB 3GY9A 4KOYA 1IOFA 2QJ8A 4R3KA 4C8TA 4MFZA 4CAFA 3VRPA 3PBBA 2XPPA 4PSWA 4F0YA 3HLPA 2ZEGA 3JRUA 4OP4A 1HDUA 4UEEA 3SJXA 1YREA 4NGRA 4HNXB 4QVTA 4XPLA 3DR8A 1IIDA 3EXNA 4UCPA 3PFVA 3EO4A 4E94A 2AFXA 4IHMA 2AFUA 5G20A 4NGPA 4B14A 7CPAA 3B3SA 2WUUA 1BXRB 2CBLA 4CO9A 3G23A 3I9SA 1TF8A 4KOWA 2Q44A 3QAYA 3TLGB 5J3XA 1IY7A 2KCWA 2DXQA 3SI0A 3SHPA 5AG7A 4BPXB 4LX9A 4A4CA 3WR7A 4OADA 4X3RA 4E8OA 4P10A 1Q2DA 4U9YA 3RZAA 3B3CA 4GM5A 2C27A 1I12A 4UWJA 1ZLIA 2D4PA 1L0CA 4MRIA 3TLBA 2G0BA 3JVNA 4KSAA 2XEGA 3BUWB 1KUVA 2WSAA 2EZAA 4C8CA 1IB1E 2Q4VA 4X2TA 2FS5A 3TO6A 2B5GB 2DEAA 4MFQA 4UWIA 4GPLB 5EBVA 1FBVA 3TYXA 1CP6A 1ARMA 3B3WA 4KVXA 1Z9EA 4NGMA 2V8VA 4NJQA 4YN3A 2O4HA 1PCAA 2FXFA 2IMOA 3I6SA 1BPNA 1YSJA 4LUAA 3PB7X 3RYOA 5EMIA 3S9NA 1B6BA 1Y9WA 2QECA 3SXNA 1XF1A 2ZOGA 2YNEA 5LYFA 1TXRA 3TO9A 1M4LA 5HVFA 2OB0A 4I49A 4CYOA 4CGNA 3OB2B 5I0CA 4COGA 4HPSA 2HB6A 3D67A 2OZGA 3SXOA 2CY2A 2EBJA 4ZX8A 5K8NA 1CS0B 4JXQA 5C82A 1TIQA 2CNTA 3N7ZA 3QAHA 3TOBA 3VWEA 5JYBA 4MI4A 1LCPA 1NE9A 2IL4A 2DPSA 2ZEHA 3EY5A 4WWVA 4CS0B 3ICUA 5LRKA 3D7DA 3TC8A 4P4BA 3VGOA 1YW6A 4R6TA 2PJ5A 4KUAA 2Q4ZA 1ZRSA 4M3SA 2NSMA 3D68A 3IIBA 3W91A 1XRYA 2ODFA 4ZY2A 4C2XA 1KWMA 5K99A 2EO8A 4ONUA 4MHZA 1P4NA 5LRJA 2OH1A 1XE4A 2GLJA 2Z0ZA 4E0AA 3G8WA 4R57A 2Q7BA 4CGOA 2DIKA 4C99A 5CPAA 5JVLA 3F9KC 4F0XA 3TFYA 2YJTA 1J4JA 1M4IA 1Z2LA 1QQ9A 2WPXA 4EMEA 5A28A 2VZYA 4P4EA 1V0CA 2B58A 4KSFA 4EVYA 5F9MA 1AUGA 3BI0A 2ZEDA 1IOIA 3CPAA 3D2MA 4NGTA 3E0KA 4IAVA 4IUSA 4XPDC 5CBMA 4A4BA 4H1HA 1EZBA 4JJXA 2AFZA 2HUZA 3JUWA 3F0AA 2PJ9A 1X12A 2FT0A 1LRZA 1BOBA 2PE3A 3LWUA 3IGRA 4OIWA 4OC1A 4KOXA 4MFLA 2YJVA 4OC4A 2A4NA 5AG6A 4BMHA 3TLGA 1EE3P 2HV2A 1BAVA 3CXSA 1Y7EA 1CM0A 1MJBA 4HNWB 3HUVA 3OB1B 4DYOA 4GS4A 2JDCA 3EC4A 1CX8A 5HXDA 3HMJG 4XNHC 1NXJA 4C9EA 2VBQA 3CT9A 2FL4A 2HROA 4NGQA 1TF9A 1M4DA 2DPTA 1QMUA 4C8UA 1CE8B 1Z8XA 4MY0A 4MCSA 3P2FA 1K4JA 1M4GA 2OZUA 4JLYA 4MCPA 2GE3A 4MFKA 3D7HA 3R9GA 1A2ZA 2PIYA 4P6YA 3R95A 2OR4A 3BUNB 2OOTA 4FD7A 2B5GA 3PZJA 1Y9KA 4J3GA 4JD6A 1VBGA 1I1DA 4MHYA 4E5SA 5E96A 4A38A 4IIXA 5F5XA 2GFQA 2JLMA 3IWGA 1PYTB 5DS0A 4RI1A 4F8ZA 3SJFA 4OKOA 4C9RA 3H8EA 3NFZA 4OLLA 1YR0A 5LYLA 2PR8A 1YVKA 2VL1A 1YMEA 1YQEA 4WJBA 3GJZA 2EWBA 4KS9A 3KL9A 4CRZB 2JEVA 1CPXA 5JGFA 4P4FA 1Y7RA 3PB6X 4DJLA 2R7HA 2PJCA 2PRBA 5HKWA 1YGHA 4UF4A 3V8IA 4CAXA 3TE4A 1Y9ZA 1B47A 2BOAA 5JH9A 2AE6A 1KC7A 2AFWA 5BWAB 3GB0A 1VGYA 1BPMA 2B4DB 2OLSA 4A2ZA 2P6FA 4C8AA 4H89A 2JBJA 2XPLA 4P44A 1S7NA 2FSRA 2QYVA 3H8GA 1V6CA 1JQGA 1ZL0A 3BHXA 3SI2A 1QSTA 1NBWA 4FBEA 3SJGA 1H8LA 4RR2B 3BUXB 1RTQA 1XJOA 4OC5A 5H86A 5F49A 3GUXA 3RAMA 6CPAA 2C6PA 1ELMP 2WYRA 3C26A 2PJ4A 4F9VA 3EZAA 4CGLA 1NMTA 4MHNA 4NFRA 2YNCC 1ON0A 4ZX9A 3S6HA 2ZW7A 2FVGA 4PK3A 4M8DA 3IC1A 5AXIA 2V8HA 3VARA 4MJ8A 3D2PA 4COBA 4CAEA 1CPSA 2ZENA 2ARHA 2X0SA 4CGMA 1Z4RA 2OZHA 4J0NA 3GLJA 3BJ8A 2P6EA 2VEZA 3GIUA 3BJ7A 3KGQA 1N71A 2PCNA 1ZYMA 1X10A 1XEBA 5I4MA 1S7KA 3CXPA 4NCZA 3LD2A 4EYSA 5LYDA 2N3AB 5F13A 4MI1A 2PJAA 2Y0MA 4L89A 4R87A 4Y49B 4C8PA 1A9XB 3EZBA 4FUUA 4NF1A 3B7IA 2GANA 4P4JA 3PT1A 4R7MA 2REFA 5HKYA 4UBRA 4MJXA 3LMSA 1Z5RA 1HEEA 5IR2A 4KOTA 2AUMA 3IWWA 2BEIA 2VI7A 4OAEA 3S6KA 1GGOA 3I74A 2O53A 4OIDA 5HVGA 2BL1A 4EWTA 1VHSA 5J1QA 1J3LA 1LAMA 3VWDA 1YVOA 2JDDA 4F6AA 4CZ1A 5J8CA 4UFWA 4OC0A 2GU2A 3FVLA 4BBHA 2Q51A 4C86A 3ISXA 2GREA 4CGPA 1ELLP 2V8GA 2ZELA 4L8AA 3T90A 2AFOA 4KLVA 3V7ZA 4UCNA 1YX0A 4C7IA 2PJ8A 1QSMA 3RBUA 2R98A 2NMTA 2V8DA 4AVBA 1TKFA 1TKHA 2C1CA 2EK9A 4C85A 2J8MA 3V38A 3H5ZA 1M6VB 2PQ8A 4X8IA 2Z10A 4AVAA 3GYAA 2ZEFA 3DNSA 1S5KA 1U6MA 4YU9A 3N5FA 2PJ7A 5C88A 1LFWA 2Z11A 3KR4A 3JTKA 4AG7A 2D4OA 1LOKA 2ANPA 4ZBGA 3VH9A 1KBLA 4ONWA 3T9YA 5G21A 2B4DA 3PB9X 4ZYQA 2E28A 4K30A 1Q2YA 2YNCA 4KZTA 1OZPA 1R57A 3PGPA 4KVOE 2ZW5A 4XPKA 1GYTA 4A33A 4FD6A 3NH5A 3QNVA 4CYNA 4CYPA 4HKFA 2FIAA 2Z3NA 2AJ6A 3R1KA 3LODA 3TOAA 4PK2A 2C6GA 3BUOB 4P4DA 3I1UA 3IFEA 3F5BA 5H84A 3VRQA 3K9TA 1YK3A 3GKRA 2ABZA 4TWEA 3NOJA 1IGBA 2I00A 3ZZIA 4MHPA 3TCVA 1T36B 5F46A 2Y1MA 4MHDA 1Q2CA 3OWCA 2P6GA 3NE8A 2XPNA 3MN8A 1UWYA 3TLYA 3IU2A 3KQZA 3FH4A 3T5MA 3D4UA 3HPGG 1BLLE 4A95A 2D0PA 3PB8X 3NFQA 3ISZA 1Z9UA 2AFMA 3U1BA 4MBUA 4BPUB 1LAPA 3L2NA 3NH8A 4H6ZA 1F2PA 4MFPA 4UCMA 4II9A 1WK4A 2CTCA 1JDEA 3B3VA 3DSBA 3B8GA 1QSNA 3D8PA 3S6GA 4C9VA 2GP4A 3S9LA 3TX8A 4B12A 1ZG7A 5IB9A 4CAVA 2ZEEA 4A39A 1YLOA 4UEFA 1Z8LA 3DLJA 2DLAA 3FECA 2AFSA 2RFHA 2FCKA 1MJAA 2ATRA 1FNOA 4CRYB 1VI4A 4GXHA 1VKCA 1S7LA 2PVVA 4R3LA 4PSXA 5A27A 3KQXA 1TKJA 4AG9A 3SR3A 4PXEA 2YGWA 2B4BA 2XEFA 2R8VA 2VKZG 2J9AA 3KZWA 5CNPA 4JXRA 2EZCA 3FJUA 2F5IA 1XMTA 1WJTA 1YLEA
chains in the Genus database with same CATH topology
2JBKA 4F9UA 3D66A 2JEWA 3SJEA 2XEIA 4KNGE 2NYQA 2CIJA 2PJBA 4CPAA 5THWA 3FEEA 8CPAA 5F09A 3PBEA 4TJVA 1ZG9A 3MRUA 2ZEMA 1VHEA 1DE4C 2Q43A 5HVHA 3B35A 3PEIA 3BI1A 2C6CA 5K8OA 4ZI6A 2PJ1A 3VATA 1Y0YA 1NSAA 4PPZA 4C9AA 3H8FA 2BCOA 4P45A 3KI9A 1Y0RA 2F8HA 4EFDA 4OC3A 4KSIA 4UEZA 1CG2A 3PRTA 2POKA 2V77A 1HDQA 2PIZA 4RUHA 4MMOA 4W9YA 1XFOA 4C84A 3FX6A 5JM6A 1VHOA 2PJ6A 3WABA 4IK2A 2PVWA 4MCRA 2I3CA 1VIXA 4UIBA 2PCUA 4P4IA 3CPXA 4TNUA 2ZEPA 4Z65A 4R76A 2PJ3A 3EIFA 1Q7LA 4OMEA 4LQGA 3PFEA 5D8NA 5K8PA 3NH4A 1R3NA 3DGVA 4O23A 4K3NA 3IO1A 4A37A 4TJXA 5IB9A 3D7GA 2PRQA 2HC9A 4H2KA 4PQAA 4PXDA 4R8FA 3FMCA 1WVMA 1ZG8A 4C8FA 2C5QA 3S9MA 4G1PA 3BXMA 1XBUA 3WC5A 4MCQA 2IQ6A 2RB7A 4OC2A 4JYWA 3K2KA 4ZY0A 3NA6A 4CDKA 1F57A 1F2OA 1R43A 3SI1A 4DUKA 2PJ2A 5LYIA 5LRGA 1CP7A 2QVPA 5D29A 4Q7AA 4CDJA 4BD9A 2ZEOA 3IJ3A 1LANA 4C9UA 3WT4A 3VTAA 2BO9A 1AMPA 1YW4A 2XEJA 1ARLA 3KHXA 3IEHA 4NJRA 3PB4X 3KHZA 2IJZA 2ZOFA 4NGNA 4NGSA 3D7FA 2EK8A 1XMBA 3CDXA 4UIAA 3WC6A 3WC7A 3PFOA 4FWUA 2G9DA 1ZLHA 1AYEA 1DTDA 4AXVA 5K8MA 2F7VA 4JZ0A 4A94A 4ZY1A 4MXUA 5ELYA 3FEDA 2CF4A 4FAIA 3FF3A 3B3TA 3B2YA 4PXBA 4YWYA 2PJ0A 1OBRA 2WZNA 4B6ZA 3KASA 3KR5A 1CBXA 2GLFA 4PXCA 1FT7A 2CTBA 3T8WA 4C8TA 2QJ8A 3PBBA 3HLPA 2ZEGA 3JRUA 4OP4A 1HDUA 4UEEA 3SJXA 4NGRA 2AFXA 4IHMA 2AFUA 4NGPA 7CPAA 3B3SA 1TF8A 1IY7A 3SI0A 4X3RA 4P10A 3RZAA 3B3CA 4GM5A 1ZLIA 4MRIA 4C8CA 2XEGA 4X2TA 2DEAA 1CP6A 1ARMA 3B3WA 4NJQA 4NGMA 2V8VA 4YN3A 2O4HA 1PCAA 3I6SA 2IMOA 1BPNA 1YSJA 3PB7X 1XF1A 3S9NA 2ZOGA 5LYFA 1TXRA 1M4LA 5HVFA 2HB6A 3D67A 5K8NA 4ZX8A 1LCPA 2ZEHA 4WWVA 3ICUA 5LRKA 3D7DA 3TC8A 4P4BA 1YW6A 4R6TA 2PJ5A 2Q4ZA 2NSMA 3D68A 3IIBA 1XRYA 4ZY2A 1KWMA 4MHZA 5LRJA 2GLJA 4C99A 5CPAA 1Z2LA 1QQ9A 4EMEA 4P4EA 3BI0A 2ZEDA 3CPAA 4IAVA 4NGTA 5CBMA 2AFZA 2PJ9A 2PE3A 3LWUA 4OIWA 4OC1A 4OC4A 1EE3P 1BAVA 1Y7EA 3HUVA 4DYOA 1CX8A 5HXDA 4C9EA 3CT9A 4NGQA 1TF9A 4C8UA 1QMUA 4MCSA 4MCPA 4A39A 3D7HA 2PIYA 4P6YA 2OR4A 2OOTA 4MHYA 4A38A 1PYTB 5DS0A 4F8ZA 3SJFA 4OKOA 4C9RA 3H8EA 3NFZA 5LYLA 2VL1A 1YMEA 4WJBA 2EWBA 3KL9A 5JGFA 1CPXA 4P4FA 3PB6X 4DJLA 2PJCA 1Y9ZA 4UF4A 2BOAA 5JH9A 2AFWA 3GB0A 1VGYA 1BPMA 4C8AA 2JBJA 2QYVA 4P44A 1V6CA 3H8GA 1JQGA 3BHXA 3SI2A 4FBEA 3SJGA 1H8LA 3RAMA 1RTQA 4OC5A 1XJOA 3GUXA 6CPAA 2C6PA 1ELMP 2WYRA 2PJ4A 4F9VA 4MHNA 4NFRA 4ZX9A 2FVGA 3IC1A 2V8HA 3VARA 1CPSA 2ZENA 3GLJA 3KGQA 5I4MA 5LYDA 2PJAA 4C8PA 4FUUA 3B7IA 4P4JA 4R7MA 3LMSA 1Z5RA 1HEEA 5IR2A 3IWWA 3I74A 2O53A 4OIDA 5HVGA 4EWTA 5J1QA 1LAMA 4OC0A 2GU2A 3FVLA 2Q51A 4C86A 3ISXA 2GREA 1ELLP 2V8GA 2ZELA 2AFOA 3V7ZA 2PJ8A 3RBUA 2V8DA 1TKFA 1TKHA 2C1CA 2EK9A 4C85A 3V38A 4X8IA 2ZEFA 4YU9A 3N5FA 2PJ7A 1LFWA 3KR4A 1LOKA 2ANPA 3VH9A 4ONWA 4ZYQA 3PB9X 1GYTA 3NH5A 3QNVA 2C6GA 4P4DA 3I1UA 3IFEA 3K9TA 2ABZA 4TWEA 1IGBA 4MHPA 3MN8A 1UWYA 3KQZA 3FH4A 3D4UA 1BLLE 3PB8X 3ISZA 2AFMA 1LAPA 3L2NA 3NH8A 1F2PA 2CTCA 3B3VA 4C9VA 2GP4A 3S9LA 3TX8A 1ZG7A 2ZEEA 1YLOA 4UEFA 1Z8LA 3DLJA 2RFHA 3FECA 2AFSA 1FNOA 2PVVA 3KQXA 1TKJA 4PXEA 2XEFA 2J9AA 3KZWA 3FJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JBK A;  4F9U A;  3D66 A;  2JEW A;  3SJE A;  2XEI A;  4KNG E;  2NYQ A;  2CIJ A;  2PJB A;  4CPA A;  5THW A;  3FEE A;  8CPA A;  5F09 A;  3PBE A;  4TJV A;  1ZG9 A;  3MRU A;  2ZEM A;  1VHE A;  1DE4 C;  2Q43 A;  5HVH A;  3B35 A;  3PEI A;  3BI1 A;  2C6C A;  5K8O A;  4ZI6 A;  2PJ1 A;  3VAT A;  1Y0Y A;  1NSA A;  4PPZ A;  4C9A A;  3H8F A;  2BCO A;  4P45 A;  3KI9 A;  1Y0R A;  2F8H A;  4EFD A;  4OC3 A;  4KSI A;  4UEZ A;  1CG2 A;  3PRT A;  2POK A;  2V77 A;  1HDQ A;  2PIZ A;  4RUH A;  4MMO A;  4W9Y A;  1XFO A;  4C84 A;  3FX6 A;  5JM6 A;  1VHO A;  2PJ6 A;  3WAB A;  4IK2 A;  2PVW A;  4MCR A;  2I3C A;  1VIX A;  4UIB A;  2PCU A;  4P4I A;  3CPX A;  4TNU A;  2ZEP A;  4Z65 A;  4R76 A;  2PJ3 A;  3EIF A;  1Q7L A;  4OME A;  4LQG A;  3PFE A;  5D8N A;  5K8P A;  3NH4 A;  1R3N A;  3DGV A;  4O23 A;  4K3N A;  3IO1 A;  4A37 A;  4TJX A;  5IB9 A;  3D7G A;  2PRQ A;  2HC9 A;  4H2K A;  4PQA A;  4PXD A;  4R8F A;  3FMC A;  1WVM A;  1ZG8 A;  4C8F A;  3S9M A;  4G1P A;  3BXM A;  1XBU A;  3WC5 A;  4MCQ A;  2IQ6 A;  2RB7 A;  4OC2 A;  4JYW A;  3K2K A;  4ZY0 A;  3NA6 A;  4CDK A;  1F57 A;  1F2O A;  1R43 A;  3SI1 A;  4DUK A;  2PJ2 A;  5LYI A;  5LRG A;  1CP7 A;  2QVP A;  5D29 A;  4Q7A A;  4CDJ A;  4BD9 A;  2ZEO A;  3IJ3 A;  1LAN A;  4C9U A;  3WT4 A;  3VTA A;  2BO9 A;  1AMP A;  1YW4 A;  2XEJ A;  1ARL A;  3KHX A;  3IEH A;  4NJR A;  3PB4 X;  3KHZ A;  2IJZ A;  2ZOF A;  4NGN A;  4NGS A;  3D7F A;  2EK8 A;  1XMB A;  3CDX A;  4UIA A;  3WC6 A;  3WC7 A;  3PFO A;  4FWU A;  2G9D A;  1ZLH A;  1AYE A;  1DTD A;  4AXV A;  5K8M A;  2F7V A;  4JZ0 A;  4A94 A;  4ZY1 A;  4MXU A;  5ELY A;  3FED A;  2CF4 A;  4FAI A;  3FF3 A;  3B3T A;  3B2Y A;  4PXB A;  4YWY A;  2PJ0 A;  1OBR A;  2WZN A;  4B6Z A;  3KAS A;  3KR5 A;  1CBX A;  2GLF A;  4PXC A;  1FT7 A;  2CTB A;  3T8W A;  4C8T A;  2QJ8 A;  3PBB A;  3HLP A;  2ZEG A;  3JRU A;  4OP4 A;  1HDU A;  4UEE A;  3SJX A;  4NGR A;  2AFX A;  4IHM A;  2AFU A;  4NGP A;  7CPA A;  3B3S A;  1TF8 A;  1IY7 A;  3SI0 A;  4X3R A;  4P10 A;  3RZA A;  3B3C A;  4GM5 A;  1ZLI A;  4MRI A;  4C8C A;  2XEG A;  4X2T A;  2DEA A;  1CP6 A;  1ARM A;  3B3W A;  4NJQ A;  4NGM A;  2V8V A;  4YN3 A;  2O4H A;  1PCA A;  3I6S A;  2IMO A;  1BPN A;  1YSJ A;  3PB7 X;  1XF1 A;  3S9N A;  2ZOG A;  5LYF A;  1TXR A;  1M4L A;  5HVF A;  2HB6 A;  3D67 A;  5K8N A;  4ZX8 A;  1LCP A;  2ZEH A;  4WWV A;  3ICU A;  5LRK A;  3D7D A;  3TC8 A;  4P4B A;  1YW6 A;  4R6T A;  2PJ5 A;  2Q4Z A;  2NSM A;  3D68 A;  3IIB A;  1XRY A;  4ZY2 A;  1KWM A;  4MHZ A;  5LRJ A;  2GLJ A;  4C99 A;  5CPA A;  1Z2L A;  1QQ9 A;  4EME A;  4P4E A;  3BI0 A;  2ZED A;  3CPA A;  4IAV A;  4NGT A;  5CBM A;  2AFZ A;  2PJ9 A;  2PE3 A;  3LWU A;  4OIW A;  4OC1 A;  4OC4 A;  1EE3 P;  1BAV A;  1Y7E A;  3HUV A;  4DYO A;  1CX8 A;  5HXD A;  4C9E A;  3CT9 A;  4NGQ A;  1TF9 A;  4C8U A;  1QMU A;  4MCS A;  4MCP A;  4A39 A;  3D7H A;  2PIY A;  4P6Y A;  2OR4 A;  2OOT A;  4MHY A;  4A38 A;  1PYT B;  5DS0 A;  4F8Z A;  3SJF A;  4OKO A;  4C9R A;  3H8E A;  3NFZ A;  5LYL A;  2VL1 A;  1YME A;  4WJB A;  2EWB A;  3KL9 A;  5JGF A;  1CPX A;  4P4F A;  3PB6 X;  4DJL A;  2PJC A;  1Y9Z A;  4UF4 A;  2BOA A;  5JH9 A;  2AFW A;  3GB0 A;  1VGY A;  1BPM A;  4C8A A;  2JBJ A;  2QYV A;  4P44 A;  1V6C A;  3H8G A;  1JQG A;  3BHX A;  3SI2 A;  4FBE A;  3SJG A;  1H8L A;  3RAM A;  1RTQ A;  4OC5 A;  1XJO A;  3GUX A;  6CPA A;  2C6P A;  1ELM P;  2WYR A;  2PJ4 A;  4F9V A;  4MHN A;  4NFR A;  4ZX9 A;  2FVG A;  3IC1 A;  2V8H A;  3VAR A;  1CPS A;  2ZEN A;  3GLJ A;  3KGQ A;  5I4M A;  5LYD A;  2PJA A;  4C8P A;  4FUU A;  3B7I A;  4P4J A;  4R7M A;  3LMS A;  1Z5R A;  1HEE A;  3IWW A;  3I74 A;  2O53 A;  4OID A;  5HVG A;  4EWT A;  5J1Q A;  1LAM A;  4OC0 A;  2GU2 A;  3FVL A;  2Q51 A;  4C86 A;  3ISX A;  2GRE A;  1ELL P;  2V8G A;  2ZEL A;  2AFO A;  3V7Z A;  2PJ8 A;  3RBU A;  2V8D A;  1TKF A;  1TKH A;  2C1C A;  2EK9 A;  4C85 A;  3V38 A;  4X8I A;  2ZEF A;  4YU9 A;  3N5F A;  2PJ7 A;  1LFW A;  3KR4 A;  1LOK A;  2ANP A;  3VH9 A;  4ONW A;  4ZYQ A;  3PB9 X;  1GYT A;  3NH5 A;  3QNV A;  2C6G A;  4P4D A;  3I1U A;  3IFE A;  3K9T A;  2ABZ A;  4TWE A;  1IGB A;  4MHP A;  3MN8 A;  1UWY A;  3KQZ A;  3FH4 A;  3D4U A;  1BLL E;  3PB8 X;  3ISZ A;  2AFM A;  1LAP A;  3L2N A;  3NH8 A;  1F2P A;  2CTC A;  3B3V A;  4C9V A;  3S9L A;  3TX8 A;  1ZG7 A;  2ZEE A;  1YLO A;  4UEF A;  1Z8L A;  3DLJ A;  2RFH A;  3FEC A;  2AFS A;  1FNO A;  2PVV A;  3KQX A;  1TKJ A;  4PXE A;  2XEF A;  2J9A A;  3KZW A;  3FJU A; 
#chains in the Genus database with same CATH topology
 2DF5 A;  2JBK A;  4F9U A;  3EZE A;  4KLW A;  3D66 A;  4M6H A;  3TLA A;  3C8O A;  2JEW A;  3IWE A;  3SJE A;  4NSQ A;  2XEI A;  4UFX A;  4C7H A;  1S3Z A;  2NYQ A;  4X5K A;  4CYQ A;  4BTF A;  4KNG E;  2CIJ A;  2PJB A;  4C2Z A;  4MY3 A;  4CPA A;  5THW A;  4AB7 A;  2QIR A;  3FEE A;  8CPA A;  5F09 A;  3FXT A;  3I3G A;  3PBE A;  4TJV A;  1ZG9 A;  5DWN A;  4A32 A;  3MRU A;  2ZEM A;  1VHE A;  2ZXV A;  3EFA A;  4B11 A;  3U88 C;  2FM4 A;  1DE4 C;  5G1Z A;  1RXT A;  2Q43 A;  3VRN A;  4E2A A;  2QML A;  3ZJ0 A;  5HVH A;  1WWZ A;  2PC1 A;  3B35 A;  3PEI A;  1M1D A;  1UFH A;  1XIX A;  3W6S A;  4A31 A;  3BI1 A;  2UV8 G;  3DR6 A;  1SQH A;  2C6C A;  2J8N A;  3LAC A;  4ZI6 A;  5K8O A;  2PJ1 A;  2YND A;  5AGE A;  3VAT A;  4KOR A;  3H4Q A;  1Y0Y A;  1NSA A;  4QBJ A;  4PPZ A;  1XF8 A;  5AG4 A;  4C9A A;  3H8F A;  2BCO A;  5G22 A;  5DWM A;  2ZPA A;  4P45 A;  2B3U A;  3KI9 A;  2EZB A;  2Y1N A;  1IIC A;  1Y0R A;  2F8H A;  3TLC A;  3F8K A;  4EFD A;  2ZW6 A;  2BUE A;  4OC3 A;  5GCN A;  4KSI A;  3CZX A;  4UEZ A;  3W6X A;  1CG2 A;  3FNC A;  4C68 A;  2AUN A;  3PRT A;  2POK A;  4LQ6 A;  2Q7S A;  4NEX A;  5J8F A;  4KVM E;  5JQ4 A;  2V77 A;  5IB0 A;  5KTA A;  4BPW B;  1HDQ A;  2PIZ A;  4RUH A;  1BO4 A;  2VZZ A;  3A9L A;  4MMO A;  3OAK A;  2H5M A;  3R9F A;  2EVN A;  4W9Y A;  1RO5 A;  1S60 A;  3T05 A;  1XFO A;  1NSL A;  4YRH A;  4C84 A;  3FX6 A;  4H6U A;  5JM6 A;  1VHO A;  1JDB C;  1M44 A;  4Y49 C;  5F1Y A;  2PJ6 A;  3OP0 A;  3WAB A;  4IK2 A;  2PVW A;  4FD4 A;  5FVJ A;  4B5P B;  5FD8 A;  3PLF B;  4MCR A;  4FD5 A;  2I3C A;  3TLZ A;  1VIX A;  4PV6 A;  3BUM B;  4UIB A;  2PCU A;  1Q5X A;  4P4I A;  3CPX A;  4TNU A;  3BLN A;  3IU1 A;  2ZEP A;  2Z3M A;  4R9M A;  4Z65 A;  4R76 A;  4AVC A;  2PJ3 A;  3EIF A;  1Q7L A;  4OME A;  2OU2 A;  4LQG A;  4M6G A;  1C3O B;  1ZO0 A;  3VRR A;  2FIW A;  3PFE A;  2R82 A;  3K4I A;  2O28 A;  5D8N A;  2I79 A;  5K8P A;  3O8Z A;  4Q38 A;  2MP0 A;  2XPO A;  3NH4 A;  1C30 B;  3FRM A;  2HI6 A;  1R3N A;  2VXK A;  3DGV A;  4O23 A;  2Z3K A;  3QB8 A;  1R61 A;  4K3N A;  3IO1 A;  3ZNI A;  4A37 A;  2EUI A;  4TJX A;  2CNS A;  2B3V A;  3D7G A;  2PRQ A;  1IYK A;  2R1I A;  2REE A;  1YVH A;  2HC9 A;  5HH1 A;  4C2Y A;  4H2K A;  2PSW A;  4PQA A;  4RS2 A;  3G3S A;  4PXD A;  4R8F A;  5JPH A;  3FMC A;  4DNC A;  1WVM A;  4KOS A;  1ZG8 A;  4M6I A;  1EZA A;  1Z8W A;  4C8F A;  2Z3L A;  3FIX A;  5ISV A;  2C5Q A;  4NXY A;  3S9M A;  4KOV A;  4G1P A;  3BXM A;  3UY5 A;  1XOV A;  4JVO A;  1XBU A;  3WC5 A;  4MCQ A;  3VRO A;  2IQ6 A;  2RB7 A;  3FBU A;  4MFJ A;  1DIK A;  3R9E A;  1EO0 A;  1P0H A;  4OC2 A;  3K9U A;  4JYW A;  2WPW A;  3K2K A;  4ZY0 A;  2Z3P A;  3NA6 A;  3FYN A;  4CDK A;  4B10 A;  2RC4 A;  5HKZ A;  1F2O A;  1F57 A;  1R43 A;  3SI1 A;  4UFV A;  4XPD B;  2PJ2 A;  5LYI A;  4DUK A;  5LRG A;  1CP7 A;  1MK4 A;  5D29 A;  2GIV A;  2P0W A;  2QVP A;  3D3S A;  2J8R A;  4Q7A A;  3P2H A;  4CDJ A;  4BD9 A;  1MJ9 A;  2ZEO A;  5BY0 A;  3IJ3 A;  5F48 A;  1LAN A;  4BIN A;  2PDO A;  4C9U A;  3WT4 A;  3VTA A;  3PP9 A;  2BO9 A;  1AMP A;  1YW4 A;  4CAW A;  4U5Y A;  2XEJ A;  1I21 A;  4QUS A;  2VQY A;  1ARL A;  4XNH B;  1IYL A;  2BSW A;  3KHX A;  5IX3 A;  3IEH A;  4A30 A;  4ORF A;  4NJR A;  3PB4 X;  5EC4 A;  3KHZ A;  4B5O A;  1VBH A;  1JWQ A;  2IJZ A;  2ZOF A;  4NGN A;  2HQY A;  2ZW4 A;  2Q04 A;  4NGS A;  4B5P A;  3D7F A;  1KUY A;  2EK8 A;  4QC6 A;  1XMB A;  2D0O A;  2Z3O A;  3CDX A;  1Z4E A;  4UIA A;  3WC6 A;  1S7F A;  4QB9 A;  3WC7 A;  2G3A A;  5F47 A;  3TTH A;  3PFO A;  1GHE A;  4KUB A;  2G3T A;  4FWU A;  4KOU A;  1KZF A;  5AG5 A;  3R96 A;  3RO0 A;  1KEE B;  5KTD A;  2CXA A;  2G9D A;  3MGD A;  4HNY B;  4IF5 A;  1ZLH A;  4B13 A;  1QSO A;  1AYE A;  1DTD A;  3T0T A;  1IU8 A;  2FE7 A;  4RN7 A;  3DDD A;  3KKW A;  3NE7 A;  3S6F A;  4AXV A;  5K8M A;  2F7V A;  4JZ0 A;  4INJ A;  1QSR A;  2Q0Y A;  4A94 A;  4ZY1 A;  4MXU A;  4IIY A;  3TLE A;  3TT2 A;  5ELY A;  3FED A;  4Q36 A;  4JWP A;  3TO7 A;  2CF4 A;  2X7B A;  4FAI A;  3FF3 A;  4M85 A;  4U9Z A;  2B0A A;  4YFJ A;  1Z8T A;  1KUX A;  2CNM A;  3B3T A;  1B87 A;  2PR1 A;  3B2Y A;  4PXB A;  4UA3 A;  1CJW A;  2PJ0 A;  4YWY A;  1OBR A;  3T07 A;  1PU9 A;  2WZN A;  3FB3 A;  3CXQ A;  2K5T A;  3RNZ A;  5KTC A;  1PUA A;  4B6Z A;  3KAS A;  3KR5 A;  1CBX A;  1FY7 A;  2HWG A;  2GLF A;  3HPH E;  5IV0 A;  4PXC A;  1FT7 A;  3KRV A;  2Q4Y A;  4YGO A;  2B4J C;  5HMN A;  2CTB A;  3T8W A;  4ZGY B;  3GY9 A;  4KOY A;  1IOF A;  2QJ8 A;  4R3K A;  4C8T A;  4MFZ A;  4CAF A;  3VRP A;  3PBB A;  2XPP A;  4PSW A;  4F0Y A;  3HLP A;  2ZEG A;  3JRU A;  4OP4 A;  1HDU A;  4UEE A;  3SJX A;  1YRE A;  4NGR A;  4HNX B;  4QVT A;  4XPL A;  3DR8 A;  1IID A;  3EXN A;  4UCP A;  3PFV A;  3EO4 A;  4E94 A;  2AFX A;  4IHM A;  2AFU A;  5G20 A;  4NGP A;  4B14 A;  7CPA A;  3B3S A;  2WUU A;  1BXR B;  2CBL A;  4CO9 A;  3G23 A;  3I9S A;  1TF8 A;  4KOW A;  2Q44 A;  3QAY A;  3TLG B;  5J3X A;  1IY7 A;  2KCW A;  2DXQ A;  3SI0 A;  3SHP A;  5AG7 A;  4BPX B;  4LX9 A;  4A4C A;  3WR7 A;  4OAD A;  4X3R A;  4E8O A;  4P10 A;  1Q2D A;  4U9Y A;  3RZA A;  3B3C A;  4GM5 A;  2C27 A;  1I12 A;  4UWJ A;  1ZLI A;  2D4P A;  1L0C A;  4MRI A;  3TLB A;  2G0B A;  3JVN A;  4KSA A;  2XEG A;  3BUW B;  1KUV A;  2WSA A;  2EZA A;  4C8C A;  1IB1 E;  2Q4V A;  4X2T A;  2FS5 A;  3TO6 A;  2B5G B;  2DEA A;  4MFQ A;  4UWI A;  4GPL B;  5EBV A;  1FBV A;  3TYX A;  1CP6 A;  1ARM A;  3B3W A;  4KVX A;  1Z9E A;  4NGM A;  2V8V A;  4NJQ A;  4YN3 A;  2O4H A;  1PCA A;  2FXF A;  2IMO A;  3I6S A;  1BPN A;  1YSJ A;  4LUA A;  3PB7 X;  3RYO A;  5EMI A;  3S9N A;  1B6B A;  1Y9W A;  2QEC A;  3SXN A;  1XF1 A;  2ZOG A;  2YNE A;  5LYF A;  1TXR A;  3TO9 A;  1M4L A;  5HVF A;  2OB0 A;  4I49 A;  4CYO A;  4CGN A;  3OB2 B;  5I0C A;  4COG A;  4HPS A;  2HB6 A;  3D67 A;  2OZG A;  3SXO A;  2CY2 A;  2EBJ A;  4ZX8 A;  5K8N A;  1CS0 B;  4JXQ A;  5C82 A;  1TIQ A;  2CNT A;  3N7Z A;  3QAH A;  3TOB A;  3VWE A;  5JYB A;  4MI4 A;  1LCP A;  1NE9 A;  2IL4 A;  2DPS A;  2ZEH A;  3EY5 A;  4WWV A;  4CS0 B;  3ICU A;  5LRK A;  3D7D A;  3TC8 A;  4P4B A;  3VGO A;  1YW6 A;  4R6T A;  2PJ5 A;  4KUA A;  2Q4Z A;  1ZRS A;  4M3S A;  2NSM A;  3D68 A;  3IIB A;  3W91 A;  1XRY A;  2ODF A;  4ZY2 A;  4C2X A;  1KWM A;  5K99 A;  2EO8 A;  4ONU A;  4MHZ A;  1P4N A;  5LRJ A;  2OH1 A;  1XE4 A;  2GLJ A;  2Z0Z A;  4E0A A;  3G8W A;  4R57 A;  2Q7B A;  4CGO A;  2DIK A;  4C99 A;  5CPA A;  5JVL A;  3F9K C;  4F0X A;  3TFY A;  2YJT A;  1J4J A;  1M4I A;  1Z2L A;  1QQ9 A;  2WPX A;  4EME A;  5A28 A;  2VZY A;  4P4E A;  1V0C A;  2B58 A;  4KSF A;  4EVY A;  5F9M A;  1AUG A;  3BI0 A;  2ZED A;  1IOI A;  3CPA A;  3D2M A;  4NGT A;  3E0K A;  4IAV A;  4IUS A;  4XPD C;  5CBM A;  4A4B A;  4H1H A;  1EZB A;  4JJX A;  2AFZ A;  2HUZ A;  3JUW A;  3F0A A;  2PJ9 A;  1X12 A;  2FT0 A;  1LRZ A;  1BOB A;  2PE3 A;  3LWU A;  3IGR A;  4OIW A;  4OC1 A;  4KOX A;  4MFL A;  2YJV A;  4OC4 A;  2A4N A;  5AG6 A;  4BMH A;  3TLG A;  1EE3 P;  2HV2 A;  1BAV A;  3CXS A;  1Y7E A;  1CM0 A;  1MJB A;  4HNW B;  3HUV A;  3OB1 B;  4DYO A;  4GS4 A;  2JDC A;  3EC4 A;  1CX8 A;  5HXD A;  3HMJ G;  4XNH C;  1NXJ A;  4C9E A;  2VBQ A;  3CT9 A;  2FL4 A;  2HRO A;  4NGQ A;  1TF9 A;  1M4D A;  2DPT A;  1QMU A;  4C8U A;  1CE8 B;  1Z8X A;  4MY0 A;  4MCS A;  3P2F A;  1K4J A;  1M4G A;  2OZU A;  4JLY A;  4MCP A;  2GE3 A;  4MFK A;  3D7H A;  3R9G A;  1A2Z A;  2PIY A;  4P6Y A;  3R95 A;  2OR4 A;  3BUN B;  2OOT A;  4FD7 A;  2B5G A;  3PZJ A;  1Y9K A;  4J3G A;  4JD6 A;  1VBG A;  1I1D A;  4MHY A;  4E5S A;  5E96 A;  4A38 A;  4IIX A;  5F5X A;  2GFQ A;  2JLM A;  3IWG A;  1PYT B;  5DS0 A;  4RI1 A;  4F8Z A;  3SJF A;  4OKO A;  4C9R A;  3H8E A;  3NFZ A;  4OLL A;  1YR0 A;  5LYL A;  2PR8 A;  1YVK A;  2VL1 A;  1YME A;  1YQE A;  4WJB A;  3GJZ A;  2EWB A;  4KS9 A;  3KL9 A;  4CRZ B;  2JEV A;  1CPX A;  5JGF A;  4P4F A;  1Y7R A;  3PB6 X;  4DJL A;  2R7H A;  2PJC A;  2PRB A;  5HKW A;  1YGH A;  4UF4 A;  3V8I A;  4CAX A;  3TE4 A;  1Y9Z A;  1B47 A;  2BOA A;  5JH9 A;  2AE6 A;  1KC7 A;  2AFW A;  5BWA B;  3GB0 A;  1VGY A;  1BPM A;  2B4D B;  2OLS A;  4A2Z A;  2P6F A;  4C8A A;  4H89 A;  2JBJ A;  2XPL A;  4P44 A;  1S7N A;  2FSR A;  2QYV A;  3H8G A;  1V6C A;  1JQG A;  1ZL0 A;  3BHX A;  3SI2 A;  1QST A;  1NBW A;  4FBE A;  3SJG A;  1H8L A;  4RR2 B;  3BUX B;  1RTQ A;  1XJO A;  4OC5 A;  5H86 A;  5F49 A;  3GUX A;  3RAM A;  6CPA A;  2C6P A;  1ELM P;  2WYR A;  3C26 A;  2PJ4 A;  4F9V A;  3EZA A;  4CGL A;  1NMT A;  4MHN A;  4NFR A;  2YNC C;  1ON0 A;  4ZX9 A;  3S6H A;  2ZW7 A;  2FVG A;  4PK3 A;  4M8D A;  3IC1 A;  5AXI A;  2V8H A;  3VAR A;  4MJ8 A;  3D2P A;  4COB A;  4CAE A;  1CPS A;  2ZEN A;  2ARH A;  2X0S A;  4CGM A;  1Z4R A;  2OZH A;  4J0N A;  3GLJ A;  3BJ8 A;  2P6E A;  2VEZ A;  3GIU A;  3BJ7 A;  3KGQ A;  1N71 A;  2PCN A;  1ZYM A;  1X10 A;  1XEB A;  5I4M A;  1S7K A;  3CXP A;  4NCZ A;  3LD2 A;  4EYS A;  5LYD A;  2N3A B;  5F13 A;  4MI1 A;  2PJA A;  2Y0M A;  4L89 A;  4R87 A;  4Y49 B;  4C8P A;  1A9X B;  3EZB A;  4FUU A;  4NF1 A;  3B7I A;  2GAN A;  4P4J A;  3PT1 A;  4R7M A;  2REF A;  5HKY A;  4UBR A;  4MJX A;  3LMS A;  1Z5R A;  1HEE A;  5IR2 A;  4KOT A;  2AUM A;  3IWW A;  2BEI A;  2VI7 A;  4OAE A;  3S6K A;  1GGO A;  3I74 A;  2O53 A;  4OID A;  5HVG A;  2BL1 A;  4EWT A;  1VHS A;  5J1Q A;  1J3L A;  1LAM A;  3VWD A;  1YVO A;  2JDD A;  4F6A A;  4CZ1 A;  5J8C A;  4UFW A;  4OC0 A;  2GU2 A;  3FVL A;  4BBH A;  2Q51 A;  4C86 A;  3ISX A;  2GRE A;  4CGP A;  1ELL P;  2V8G A;  2ZEL A;  4L8A A;  3T90 A;  2AFO A;  4KLV A;  3V7Z A;  4UCN A;  1YX0 A;  4C7I A;  2PJ8 A;  1QSM A;  3RBU A;  2R98 A;  2NMT A;  2V8D A;  4AVB A;  1TKF A;  1TKH A;  2C1C A;  2EK9 A;  4C85 A;  2J8M A;  3V38 A;  3H5Z A;  1M6V B;  2PQ8 A;  4X8I A;  2Z10 A;  4AVA A;  3GYA A;  2ZEF A;  3DNS A;  1S5K A;  1U6M A;  4YU9 A;  3N5F A;  2PJ7 A;  5C88 A;  1LFW A;  2Z11 A;  3KR4 A;  3JTK A;  4AG7 A;  2D4O A;  1LOK A;  2ANP A;  4ZBG A;  3VH9 A;  1KBL A;  4ONW A;  3T9Y A;  5G21 A;  2B4D A;  3PB9 X;  4ZYQ A;  2E28 A;  4K30 A;  1Q2Y A;  2YNC A;  4KZT A;  1OZP A;  1R57 A;  3PGP A;  4KVO E;  2ZW5 A;  4XPK A;  1GYT A;  4A33 A;  4FD6 A;  3NH5 A;  3QNV A;  4CYN A;  4CYP A;  4HKF A;  2FIA A;  2Z3N A;  2AJ6 A;  3R1K A;  3LOD A;  3TOA A;  4PK2 A;  2C6G A;  3BUO B;  4P4D A;  3I1U A;  3IFE A;  3F5B A;  5H84 A;  3VRQ A;  3K9T A;  1YK3 A;  3GKR A;  2ABZ A;  4TWE A;  3NOJ A;  1IGB A;  2I00 A;  3ZZI A;  4MHP A;  3TCV A;  1T36 B;  5F46 A;  2Y1M A;  4MHD A;  1Q2C A;  3OWC A;  2P6G A;  3NE8 A;  2XPN A;  3MN8 A;  1UWY A;  3TLY A;  3IU2 A;  3KQZ A;  3FH4 A;  3T5M A;  3D4U A;  3HPG G;  1BLL E;  4A95 A;  2D0P A;  3PB8 X;  3NFQ A;  3ISZ A;  1Z9U A;  2AFM A;  3U1B A;  4MBU A;  4BPU B;  1LAP A;  3L2N A;  3NH8 A;  4H6Z A;  1F2P A;  4MFP A;  4UCM A;  4II9 A;  1WK4 A;  2CTC A;  1JDE A;  3B3V A;  3DSB A;  3B8G A;  1QSN A;  3D8P A;  3S6G A;  4C9V A;  2GP4 A;  3S9L A;  3TX8 A;  4B12 A;  1ZG7 A;  5IB9 A;  4CAV A;  2ZEE A;  4A39 A;  1YLO A;  4UEF A;  1Z8L A;  3DLJ A;  2DLA A;  3FEC A;  2AFS A;  2RFH A;  2FCK A;  1MJA A;  2ATR A;  1FNO A;  4CRY B;  1VI4 A;  4GXH A;  1VKC A;  1S7L A;  2PVV A;  4R3L A;  4PSX A;  5A27 A;  3KQX A;  1TKJ A;  4AG9 A;  3SR3 A;  4PXE A;  2YGW A;  2B4B A;  2XEF A;  2R8V A;  2VKZ G;  2J9A A;  3KZW A;  5CNP A;  4JXR A;  2EZC A;  3FJU A;  2F5I A;  1XMT A;  1WJT A;  1YLE A; 
#chains in the Genus database with same CATH homology
 2JBK A;  4F9U A;  3D66 A;  2JEW A;  3SJE A;  2XEI A;  4KNG E;  2NYQ A;  2CIJ A;  2PJB A;  4CPA A;  5THW A;  3FEE A;  8CPA A;  5F09 A;  3PBE A;  4TJV A;  1ZG9 A;  3MRU A;  2ZEM A;  1VHE A;  1DE4 C;  2Q43 A;  5HVH A;  3B35 A;  3PEI A;  3BI1 A;  2C6C A;  5K8O A;  4ZI6 A;  2PJ1 A;  3VAT A;  1Y0Y A;  1NSA A;  4PPZ A;  4C9A A;  3H8F A;  2BCO A;  4P45 A;  3KI9 A;  1Y0R A;  2F8H A;  4EFD A;  4OC3 A;  4KSI A;  4UEZ A;  1CG2 A;  3PRT A;  2POK A;  2V77 A;  1HDQ A;  2PIZ A;  4RUH A;  4MMO A;  4W9Y A;  1XFO A;  4C84 A;  3FX6 A;  5JM6 A;  1VHO A;  2PJ6 A;  3WAB A;  4IK2 A;  2PVW A;  4MCR A;  2I3C A;  1VIX A;  4UIB A;  2PCU A;  4P4I A;  3CPX A;  4TNU A;  2ZEP A;  4Z65 A;  4R76 A;  2PJ3 A;  3EIF A;  1Q7L A;  4OME A;  4LQG A;  3PFE A;  5D8N A;  5K8P A;  3NH4 A;  1R3N A;  3DGV A;  4O23 A;  4K3N A;  3IO1 A;  4A37 A;  4TJX A;  5IB9 A;  3D7G A;  2PRQ A;  2HC9 A;  4H2K A;  4PQA A;  4PXD A;  4R8F A;  3FMC A;  1WVM A;  1ZG8 A;  4C8F A;  2C5Q A;  3S9M A;  4G1P A;  3BXM A;  1XBU A;  3WC5 A;  4MCQ A;  2IQ6 A;  2RB7 A;  4OC2 A;  4JYW A;  3K2K A;  4ZY0 A;  3NA6 A;  4CDK A;  1F57 A;  1F2O A;  1R43 A;  3SI1 A;  4DUK A;  2PJ2 A;  5LYI A;  5LRG A;  1CP7 A;  2QVP A;  5D29 A;  4Q7A A;  4CDJ A;  4BD9 A;  2ZEO A;  3IJ3 A;  1LAN A;  4C9U A;  3WT4 A;  3VTA A;  2BO9 A;  1AMP A;  1YW4 A;  2XEJ A;  1ARL A;  3KHX A;  3IEH A;  4NJR A;  3PB4 X;  3KHZ A;  2IJZ A;  2ZOF A;  4NGN A;  4NGS A;  3D7F A;  2EK8 A;  1XMB A;  3CDX A;  4UIA A;  3WC6 A;  3WC7 A;  3PFO A;  4FWU A;  2G9D A;  1ZLH A;  1AYE A;  1DTD A;  4AXV A;  5K8M A;  2F7V A;  4JZ0 A;  4A94 A;  4ZY1 A;  4MXU A;  5ELY A;  3FED A;  2CF4 A;  4FAI A;  3FF3 A;  3B3T A;  3B2Y A;  4PXB A;  4YWY A;  2PJ0 A;  1OBR A;  2WZN A;  4B6Z A;  3KAS A;  3KR5 A;  1CBX A;  2GLF A;  4PXC A;  1FT7 A;  2CTB A;  3T8W A;  4C8T A;  2QJ8 A;  3PBB A;  3HLP A;  2ZEG A;  3JRU A;  4OP4 A;  1HDU A;  4UEE A;  3SJX A;  4NGR A;  2AFX A;  4IHM A;  2AFU A;  4NGP A;  7CPA A;  3B3S A;  1TF8 A;  1IY7 A;  3SI0 A;  4X3R A;  4P10 A;  3RZA A;  3B3C A;  4GM5 A;  1ZLI A;  4MRI A;  4C8C A;  2XEG A;  4X2T A;  2DEA A;  1CP6 A;  1ARM A;  3B3W A;  4NJQ A;  4NGM A;  2V8V A;  4YN3 A;  2O4H A;  1PCA A;  3I6S A;  2IMO A;  1BPN A;  1YSJ A;  3PB7 X;  1XF1 A;  3S9N A;  2ZOG A;  5LYF A;  1TXR A;  1M4L A;  5HVF A;  2HB6 A;  3D67 A;  5K8N A;  4ZX8 A;  1LCP A;  2ZEH A;  4WWV A;  3ICU A;  5LRK A;  3D7D A;  3TC8 A;  4P4B A;  1YW6 A;  4R6T A;  2PJ5 A;  2Q4Z A;  2NSM A;  3D68 A;  3IIB A;  1XRY A;  4ZY2 A;  1KWM A;  4MHZ A;  5LRJ A;  2GLJ A;  4C99 A;  5CPA A;  1Z2L A;  1QQ9 A;  4EME A;  4P4E A;  3BI0 A;  2ZED A;  3CPA A;  4IAV A;  4NGT A;  5CBM A;  2AFZ A;  2PJ9 A;  2PE3 A;  3LWU A;  4OIW A;  4OC1 A;  4OC4 A;  1EE3 P;  1BAV A;  1Y7E A;  3HUV A;  4DYO A;  1CX8 A;  5HXD A;  4C9E A;  3CT9 A;  4NGQ A;  1TF9 A;  4C8U A;  1QMU A;  4MCS A;  4MCP A;  4A39 A;  3D7H A;  2PIY A;  4P6Y A;  2OR4 A;  2OOT A;  4MHY A;  4A38 A;  1PYT B;  5DS0 A;  4F8Z A;  3SJF A;  4OKO A;  4C9R A;  3H8E A;  3NFZ A;  5LYL A;  2VL1 A;  1YME A;  4WJB A;  2EWB A;  3KL9 A;  5JGF A;  1CPX A;  4P4F A;  3PB6 X;  4DJL A;  2PJC A;  1Y9Z A;  4UF4 A;  2BOA A;  5JH9 A;  2AFW A;  3GB0 A;  1VGY A;  1BPM A;  4C8A A;  2JBJ A;  2QYV A;  4P44 A;  1V6C A;  3H8G A;  1JQG A;  3BHX A;  3SI2 A;  4FBE A;  3SJG A;  1H8L A;  3RAM A;  1RTQ A;  4OC5 A;  1XJO A;  3GUX A;  6CPA A;  2C6P A;  1ELM P;  2WYR A;  2PJ4 A;  4F9V A;  4MHN A;  4NFR A;  4ZX9 A;  2FVG A;  3IC1 A;  2V8H A;  3VAR A;  1CPS A;  2ZEN A;  3GLJ A;  3KGQ A;  5I4M A;  5LYD A;  2PJA A;  4C8P A;  4FUU A;  3B7I A;  4P4J A;  4R7M A;  3LMS A;  1Z5R A;  1HEE A;  5IR2 A;  3IWW A;  3I74 A;  2O53 A;  4OID A;  5HVG A;  4EWT A;  5J1Q A;  1LAM A;  4OC0 A;  2GU2 A;  3FVL A;  2Q51 A;  4C86 A;  3ISX A;  2GRE A;  1ELL P;  2V8G A;  2ZEL A;  2AFO A;  3V7Z A;  2PJ8 A;  3RBU A;  2V8D A;  1TKF A;  1TKH A;  2C1C A;  2EK9 A;  4C85 A;  3V38 A;  4X8I A;  2ZEF A;  4YU9 A;  3N5F A;  2PJ7 A;  1LFW A;  3KR4 A;  1LOK A;  2ANP A;  3VH9 A;  4ONW A;  4ZYQ A;  3PB9 X;  1GYT A;  3NH5 A;  3QNV A;  2C6G A;  4P4D A;  3I1U A;  3IFE A;  3K9T A;  2ABZ A;  4TWE A;  1IGB A;  4MHP A;  3MN8 A;  1UWY A;  3KQZ A;  3FH4 A;  3D4U A;  1BLL E;  3PB8 X;  3ISZ A;  2AFM A;  1LAP A;  3L2N A;  3NH8 A;  1F2P A;  2CTC A;  3B3V A;  4C9V A;  2GP4 A;  3S9L A;  3TX8 A;  1ZG7 A;  2ZEE A;  1YLO A;  4UEF A;  1Z8L A;  3DLJ A;  2RFH A;  3FEC A;  2AFS A;  1FNO A;  2PVV A;  3KQX A;  1TKJ A;  4PXE A;  2XEF A;  2J9A A;  3KZW A;  3FJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...