4NGSA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 263
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngsA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngsA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngsA02
1CX8A 4X2TA 1TXRA 1F57A 3BHXA 2V8VA 8CPAA 1BLLE 3MRUA 3K2KA 5LRJA 3NH4A 4R76A 1CPSA 2V8HA 2AFUA 4MHYA 4NGRA 3PBBA 3ICUA 4CDKA 2PIZA 3QNVA 2C6PA 3IC1A 4P6YA 4C85A 2POKA 1ZLHA 2JBJA 1R43A 2GREA 3SJXA 1HEEA 3SJEA 1XRYA 3CDXA 1XJOA 2F8HA 3ISZA 4MCPA 1DTDA 3D67A 4TJVA 3KI9A 5K8NA 3D7GA 4Z65A 5D8NA 3FEEA 4F8ZA 1Z5RA 4C9AA 5JM6A 2ZEHA 3PFOA 1DE4C 4OC2A 6CPAA 5LYDA 4DJLA 2QVPA 3B3WA 3PB8X 2PJAA 1ARMA 4F9UA 3NH8A 2ZOFA 3D68A 2PJ4A 3N5FA 4P4FA 4NFRA 3TC8A 5LRKA 3PRTA 3FF3A 4P4JA 3WC7A 2PVVA 1XFOA 1HDQA 3FECA 1YW4A 4C8UA 4FUUA 2XEGA 3KQXA 4NGMA 3D66A 2JBKA 1VIXA 3FX6A 4C8PA 4ZI6A 3PB4X 3S9MA 3FVLA 4UIAA 1IGBA 2PRQA 2ZENA 2PJ3A 4G1PA 2ZEMA 4PPZA 2HB6A 4YU9A 2EWBA 5LYIA 3PEIA 2PJBA 4PXDA 1PCAA 1BPNA 2CF4A 3WT4A 1QMUA 5JH9A 2PVWA 1Y9ZA 2XEFA 4NGQA 5K8PA 2GLJA 1WVMA 4JYWA 3WC6A 1VHOA 4PQAA 3BI1A 3KHZA 5HXDA 4H2KA 1QQ9A 5LYFA 3FH4A 4BD9A 3B7IA 2NSMA 1Q7LA 2CTBA 3CPAA 2CIJA 1GYTA 4UEEA 3IEHA 4NJRA 3IFEA 2DEAA 3B35A 4NGPA 1IY7A 2ANPA 1CP6A 1TF8A 2AFMA 4C99A 3LMSA 4FAIA 4OC1A 2CTCA 4C8TA 1Y7EA 4OKOA 4C9VA 4PXBA 3WABA 4O23A 2EK9A 4K3NA 2RB7A 2VL1A 2V77A 4UEFA 2PJ9A 2ZEGA 3VH9A 1R3NA 2PJ7A 3SJFA 4OIDA 4KNGE 1FT7A 2IMOA 3B3SA 1AMPA 2QYVA 2V8GA 4P4DA 4EMEA 3I6SA 2OR4A 1UWYA 3B2YA 2BCOA 3B3CA 4ONWA 3CPXA 4C8FA 2IQ6A 3VARA 3KL9A 4P10A 1LCPA 4MXUA 3D7FA 2FVGA 3VATA 3KHXA 1JQGA 2J9AA 4IK2A 1RTQA 3DLJA 1CPXA 1LOKA 3SI2A 4DYOA 3PB7X 2ZEFA 4TJXA 3KASA 3RAMA 1LAPA 1AYEA 2C6GA 5F09A 4R6TA 4C8AA 3IIBA 5J1QA 1FNOA 4OMEA 4UIBA 1OBRA 4MCRA 3KR5A 4OC4A 1ZG9A 2HC9A 2WYRA 4MHNA 4OC0A 5DS0A 4MMOA 2PJ2A 4NGTA 2PJ5A 5LYLA 1LAMA 2BO9A 4DUKA 4C9EA 4Q7AA 4ZY0A 2V8DA 4GM5A 1TF9A 5CPAA 5CBMA 4C84A 3MN8A 5THWA 4RUHA 1NSAA 4MCQA 2Q51A 3GB0A 4ZX9A 4NGNA 2C1CA 4FWUA 3L2NA 3T8WA 3BXMA 1EE3P 3SI1A 3PB9X 3IJ3A 4R8FA 3RZAA 3DGVA 2O4HA 4ZY2A 4C8CA 1PYTB 3IWWA 4CDJA 3CT9A 4PXEA 7CPAA 1TKHA 1YMEA 2QJ8A 4W9YA 1VGYA 2ZEOA 3NA6A 4A39A 3IO1A 2PIYA 2I3CA 2IJZA 2PJCA 3B3VA 2PJ0A 3ISXA 2O53A 1BAVA 1ZLIA 2BOAA 1YLOA 4OC5A 2Q43A 4KSIA 2RFHA 2EK8A 5K8OA 1ELMP 1CG2A 4NJQA 4A38A 1ARLA 4C9RA 2PCUA 3HLPA 1ZG8A 4A94A 1YSJA 4ZY1A 1F2OA 4OC3A 2OOTA 4LQGA 1Z8LA 3D7HA 5HVGA 4C86A 3H8GA 4MHPA 1ZG7A 3S9LA 2ZOGA 4NGSA 3GLJA 3JRUA 1Z2LA 4OIWA 2AFSA 2ABZA 4X3RA 2NYQA 3VTAA 5HVFA 3TX8A 1Y0YA 2ZEDA 4FBEA 4WJBA 5IB9A 4ZX8A 3K9TA 3SJGA 4TWEA 4ZYQA 1YW6A 1LANA 4YN3A 1H8LA 1KWMA 2JEWA 3D4UA 3V38A 3KZWA 5K8MA 3KQZA 2PJ8A 3H8EA 3KGQA 1ELLP 4AXVA 4P45A 4P4BA 4JZ0A 5JGFA 3FEDA 4UEZA 1XF1A 2AFZA 4WWVA 2Q4ZA 3WC5A 3I74A 3S9NA 4P44A 1CBXA 3NFZA 4MHZA 4EWTA 3V7ZA 1TKJA 2AFOA 2C6CA 3KR4A 4PXCA 5LRGA 1LFWA 3FMCA 2XEJA 4EFDA 1HDUA 1CP7A 1VHEA 3PFEA 3RBUA 1TKFA 3EIFA 4MCSA 4R7MA 5ELYA 4OP4A 4YWYA 2F7VA 3NH5A 1F2PA 2PJ6A 4TNUA 5D29A 4UF4A 2PE3A 3GUXA 5I4MA 2XEIA 3D7DA 2G9DA 2ZEEA 4A37A 1V6CA 4F9VA 2GLFA 3B3TA 4MRIA 3FJUA 2PJ1A 4P4EA 1XBUA 1BPMA 1M4LA 3HUVA 1Y0RA 3BI0A 3H8FA 5HVHA 3I1UA 4X8IA 1XMBA 4P4IA 3PBEA 4B6ZA 4IAVA 4CPAA 2WZNA 2AFXA 2GU2A 2AFWA 3SI0A 4IHMA 3LWUA 2ZELA 3PB6X 4C9UA 2ZEPA
chains in the Genus database with same CATH superfamily
1CX8A 4X2TA 2Z3PA 1IOFA 3HPGG 1TXRA 1F57A 3FNCA 3BHXA 5HKWA 2FIWA 2V8VA 8CPAA 1BLLE 2B5GB 1NSLA 2FT0A 3SXNA 1YGHA 3GY9A 3D8PA 3A9LA 2UV8G 3MRUA 1QSRA 3K2KA 5LRJA 4AB7A 3NH4A 1VKCA 4R76A 1CPSA 2V8HA 1XIXA 2CNTA 4PSWA 2AFUA 1YVOA 3GIUA 4MHYA 4NGRA 3PBBA 4B11A 2DIKA 4XPKA 3HMJG 3R1KA 3ICUA 4CDKA 2PIZA 2GP4A 1Z8TA 1Z8WA 3QNVA 2C6PA 1Z4EA 3G8WA 3IC1A 4KUBA 4P6YA 3TE4A 4HKFA 4QVTA 4C85A 2EO8A 2POKA 1ZYMA 3SR3A 4M85A 2OU2A 1ZLHA 2JBJA 1R43A 2BUEA 2GREA 2HQYA 1I12A 2O28A 4A4CA 3DR8A 3RNZA 3SJXA 2PCNA 1HEEA 3SJEA 1XRYA 4RR2B 2PR1A 4UA3A 3T07A 1IYKA 3CDXA 5J3XA 1XJOA 2F8HA 2R7HA 3F5BA 2ZXVA 3ISZA 3W6XA 2C5QA 4MCPA 1B6BA 1DTDA 3D67A 4H1HA 4E8OA 4OAEA 4TJVA 3KI9A 5K8NA 3PT1A 1S60A 3JTKA 2EBJA 3VWEA 1FBVA 3NE8A 3D7GA 4UWJA 4FD5A 4Z65A 1PU9A 2OH1A 2B4JC 1YVKA 3FEEA 3BJ7A 3JUWA 5D8NA 3R95A 3TCVA 4F8ZA 5HMNA 3C26A 4M3SA 1QSNA 2GE3A 4CGOA 2HI6A 2RC4A 3TLYA 3FRMA 3BUOB 1Z5RA 2J8NA 1DIKA 1VBGA 4C9AA 1JWQA 2HUZA 4RS2A 5JM6A 1OZPA 2PSWA 3TLCA 5HH1A 3PLFB 3H4QA 5IB0A 2ZEHA 3PFOA 1DE4C 3UY5A 4L89A 4NCZA 4OC2A 6CPAA 3TLAA 3CXQA 5LYDA 1R61A 1IB1E 4DJLA 2QVPA 3B3WA 3PB8X 2PJAA 2Z0ZA 4HPSA 1ARMA 3U88C 4KLVA 4F9UA 3NH8A 4JXRA 4JD6A 2ZOFA 3D68A 2PJ4A 3N5FA 2B4BA 2EZAA 4P4FA 4NFRA 3TC8A 5LRKA 3PRTA 4KSAA 2AUMA 2G3AA 3FF3A 3U1BA 4XNHC 4P4JA 1I21A 3WC7A 2PVVA 3S6GA 1XFOA 5JYBA 4LUAA 1HDQA 3FECA 4CYNA 5J8FA 1YW4A 3O8ZA 4I49A 4UFVA 3FIXA 4CZ1A 4C8UA 2OB0A 4FUUA 4X5KA 1KUVA 2XEGA 3KQXA 4NGMA 4BPUB 5A27A 2EUIA 3D66A 4R87A 1IYLA 3ZZIA 2D4OA 2JLMA 2FE7A 1JDBC 1UFHA 2JBKA 1VIXA 3FX6A 4IIYA 2H5MA 3GJZA 2EVNA 1XF1A 2QMLA 4C8PA 4ZI6A 3PB4X 4F6AA 2QECA 2HWGA 4MI1A 5F5XA 1M1DA 1XOVA 3F9KC 2ARHA 3S9MA 2ATRA 3S6FA 4II9A 1EZAA 2EZBA 2XPLA 3PZJA 4BPWB 4A4BA 4C7IA 3FVLA 4KS9A 4NF1A 4UCMA 4UIAA 4XPLA 1IGBA 2Y1NA 2I00A 2PRQA 2Z3MA 5F49A 2ZENA 2YGWA 3S6KA 2Q7SA 3T9YA 1IIDA 2PJ3A 4G1PA 3BUXB 3VROA 2GFQA 2ZEMA 1BO4A 1Q2YA 4MHDA 5AGEA 4PPZA 4BMHA 2OLSA 2HB6A 4YU9A 4CRYB 5F46A 4B10A 5GCNA 2EWBA 5LYIA 1GHEA 3EO4A 3IU1A 3PEIA 2PJBA 4PSXA 2Q0YA 4GS4A 4PXDA 4AVAA 3BUWB 1PCAA 1BPNA 1WK4A 4KOSA 2CF4A 3KKWA 5F48A 3FB3A 5F47A 3WT4A 3K4IA 3PGPA 1QMUA 4FD6A 5JH9A 2PVWA 1Y9ZA 2XEFA 4NGQA 5JQ4A 4COGA 1KUXA 1XE4A 3LACA 5K8PA 2PQ8A 4RN7A 2GLJA 3RO0A 1WVMA 3WR7A 4KVME 4JYWA 2Z3OA 1RXTA 5AG4A 3KRVA 3WC6A 1VHOA 4PQAA 3BI1A 3KHZA 1CM0A 2VI7A 4H2KA 1QQ9A 4J3GA 5HXDA 4A32A 3VRRA 5LYFA 4Y49C 2REEA 4KZTA 3FH4A 2MP0A 3TOBA 4BD9A 1KEEB 3B7IA 4B12A 2NSMA 1Q7LA 4KOWA 3BLNA 3R9GA 2CTBA 3CPAA 3P2HA 5AXIA 4KUAA 3D3SA 2YNCC 3S6HA 4DNCA 2YNEA 2CIJA 4M6HA 3TO9A 4CAEA 1GYTA 4UEEA 4KOTA 4BTFA 3IEHA 4NEXA 4NJRA 5DWNA 2Q4YA 5C88A 5G20A 4A30A 1M6VB 2YJVA 3IFEA 3R9EA 4E5SA 5G22A 2DEAA 3B35A 4B5PA 2EZCA 4NGPA 1IY7A 2ANPA 2FIAA 1CP6A 1VI4A 1TF8A 3K9UA 2AFMA 5FD8A 4C99A 3LMSA 3ZJ0A 4KLWA 4FAIA 1I1DA 2K5TA 4OC1A 2CTCA 4C8TA 1Y7EA 3QAHA 4M6GA 2GIVA 4OKOA 2HROA 4PXBA 2ZW6A 3WABA 2N3AB 2EK9A 4K3NA 4O23A 1RO5A 2RB7A 2VL1A 3NOJA 2ZPAA 2V77A 3VRNA 2Z11A 4UEFA 1IICA 2PJ9A 1P0HA 2ZEGA 3QB8A 3SXOA 3VH9A 1R3NA 2PJ7A 3W6SA 1QSTA 2FS5A 3SJFA 1YLEA 4BBHA 2R98A 2CXAA 3T05A 2FSRA 4OIDA 1XMTA 2GANA 1M4IA 4KNGE 5JVLA 1FT7A 1VHSA 2IMOA 4AG9A 3BUMB 3B3SA 1AMPA 4FD7A 4MJ8A 3R96A 4UWIA 4A2ZA 2G0BA 3G23A 3D2MA 2QYVA 2B4DB 2OZUA 1WJTA 2V8GA 4P4DA 2B58A 4EMEA 1MJ9A 3F8KA 1S3ZA 2KCWA 1GGOA 2OR4A 1UWYA 3B2YA 3I6SA 4IUSA 4INJA 4AVBA 1IOIA 2AE6A 2BCOA 3B3CA 2QIRA 4ONWA 3R9FA 3CPXA 4C8FA 3T90A 5CNPA 2IQ6A 4C2XA 4B5OA 3VARA 3VRPA 3KL9A 5HKYA 1Y9WA 4KORA 1T36B 2DXQA 4P10A 1LCPA 2NMTA 4MXUA 4B13A 4KSFA 3D7FA 2FVGA 2Z3LA 4MFQA 5BWAB 3VATA 2ZW5A 3KHXA 1JQGA 2Q4VA 2J9AA 4IK2A 1M4DA 1RTQA 1MK4A 3DLJA 4Q36A 1CPXA 1LOKA 1QSOA 3SI2A 4DYOA 1LRZA 4KOXA 4JXQA 3PB7X 2ZEFA 2WSAA 1AUGA 2Q44A 1TIQA 3EC4A 2Z10A 4TJXA 3KASA 4GPLB 5FVJA 3RAMA 4CGMA 3OB2B 1LAPA 2VZYA 3QAYA 4CAFA 1AYEA 2C6GA 4UCPA 5F09A 4R6TA 4C8AA 3OWCA 4QUSA 3TLZA 4HNXB 2XPNA 4M8DA 5ISVA 3IIBA 3EXNA 5J1QA 1J3LA 2X7BA 1N71A 1FNOA 4OMEA 3I3GA 4KOVA 5AG6A 4CAVA 1NXJA 1Y9KA 2B4DA 5EC4A 4CGPA 3VGOA 4UIBA 1OBRA 3IU2A 1B87A 3CXPA 4MCRA 3KR5A 4OC4A 2VEZA 3CZXA 4H6UA 1ZG9A 1YVHA 2PRBA 4OADA 2HC9A 3TO7A 2WYRA 1C3OB 4MHNA 2CY2A 2DF5A 3E0KA 4OC0A 5DS0A 5H84A 2R1IA 5KTDA 4R3KA 2FXFA 4LX9A 4MMOA 4XPDC 1EO0A 3F0AA 1Y7RA 2PJ2A 4NGTA 2PJ5A 5LYLA 2BEIA 1L0CA 1LAMA 2BO9A 4XNHB 4DUKA 1YREA 3IWEA 3TLEA 4Q7AA 4C9EA 4ZY0A 2V8DA 1K4JA 4GM5A 1TF9A 2I79A 2ZW4A 4K30A 4L8AA 1YX0A 1MJBA 4UBRA 5CPAA 2B0AA 4R3LA 5CBMA 4QC6A 2CBLA 4C84A 3MN8A 5THWA 4RUHA 3ZNIA 3RYOA 1NSAA 3DSBA 4MCQA 4MJXA 2Q51A 1Z8XA 3GB0A 3JVNA 4ZX9A 4NGNA 1IU8A 5IR2A 2C1CA 3IWGA 4F0YA 4FWUA 2OZHA 3L2NA 4B5PB 1S5KA 3T8WA 4RI1A 3BXMA 1EE3P 1M44A 1NBWA 2CNSA 3BUNB 3SI1A 4Y49B 3PB9X 3IJ3A 4R8FA 5G1ZA 3RZAA 3DGVA 4JWPA 4CYQA 1P4NA 4IF5A 4C68A 3DNSA 5BY0A 2O4HA 2JDCA 4ZY2A 4BINA 4C8CA 4E0AA 2VZZA 1PYTB 3IWWA 1ZRSA 3NE7A 4CDJA 2ZW7A 2AJ6A 3CT9A 1ON0A 4PXEA 7CPAA 1TKHA 4COBA 2PDOA 2YJTA 5F9MA 4MFJA 5KTAA 4MFKA 4ONUA 1YMEA 1YQEA 2QJ8A 4W9YA 1VGYA 2VBQA 2ZEOA 4EYSA 4FD4A 3TLGB 1A9XB 1YK3A 2CNMA 3CXSA 3NA6A 4A39A 3EZAA 3IO1A 2PIYA 2I3CA 4U5YA 2IJZA 2PJCA 3B3VA 5AG7A 4PK3A 4PK2A 3TTHA 1S7NA 2PR8A 5AG5A 4C2ZA 5KTCA 4MI4A 2PJ0A 4MY0A 3ISXA 2OZGA 2O53A 3V8IA 1BAVA 1ZLIA 2BOAA 1YLOA 4OC5A 2Q43A 3FBUA 4KSIA 4CGLA 4R57A 2RFHA 2EK8A 4CYPA 3VRQA 1NMTA 4GXHA 4M6IA 5K8OA 3GYAA 1ELMP 4C2YA 5J8CA 1C30B 1CG2A 2VKZG 5E96A 4NJQA 2C27A 4A38A 4CAXA 1ARLA 4H6ZA 3LD2A 5F1YA 4C9RA 4Q38A 2P6EA 2PCUA 3HLPA 1ZG8A 4A94A 3GKRA 1YSJA 4F0XA 4ZY1A 1S7KA 2XPOA 3VWDA 1F2OA 5C82A 2D0PA 4YRHA 4UFWA 4OC3A 2OOTA 4LQGA 1Z8LA 1KC7A 3D7HA 4ORFA 5HVGA 4C86A 3FXTA 3H8GA 2X0SA 2WPXA 2J8RA 1ZG7A 1M4GA 4HNYB 4MHPA 2P6FA 2FCKA 1ZO0A 2HV2A 3LODA 3S9LA 4UCNA 3TLBA 1YR0A 2BL1A 2Y1MA 2ZOGA 4NGSA 3GLJA 3JRUA 3T0TA 1QSMA 1Z2LA 3TO6A 2B3UA 2Z3KA 4EVYA 4C9VA 4OIWA 3EZBA 2DLAA 2AFSA 4CS0B 3TLGA 4YFJA 3HPHE 5EBVA 1S7FA 1Q5XA 4NSQA 2ABZA 4X3RA 4MY3A 5A28A 2NYQA 1EZBA 3VTAA 5HVFA 1CJWA 4KVXA 2P0WA 3TX8A 1Y0YA 2ZEDA 2FM4A 4JVOA 2BSWA 4MFLA 4FBEA 4WJBA 5IB9A 4ZX8A 3B8GA 3SJGA 2IL4A 3K9TA 4TWEA 2Y0MA 4ZYQA 5I0CA 3TYXA 1YW6A 3DR6A 2JDDA 1LANA 1XEBA 4MBUA 4KOYA 1MJAA 2Z3NA 4YN3A 1H8LA 1NE9A 1KWMA 2JEWA 3D4UA 3V38A 1BOBA 4CO9A 3KZWA 3EIFA 4ZBGA 5EMIA 3KQZA 5K8MA 2PC1A 2D4PA 1J4JA 1KZFA 3NFQA 1XF8A 2PJ8A 5DWMA 3H8EA 3KGQA 1ELLP 3N7ZA 4P45A 4A95A 4P4BA 4AXVA 4JZ0A 3SHPA 2REFA 4UFXA 4XPDB 2P6GA 4MFZA 5JGFA 3FEDA 3FYNA 3DDDA 4UEZA 4ZGYB 2A4NA 2AFZA 5F13A 3I9SA 4E2AA 1CE8B 3T5MA 4WWVA 2Q4ZA 3WC5A 3I74A 3PFVA 5JPHA 3S9NA 4P44A 1CBXA 3NFZA 4MFPA 2XPPA 4MHZA 4EWTA 1BXRB 1JDEA 3EZEA 4IIXA 4KOUA 3TOAA 3EY5A 3V7ZA 1TKJA 2AFOA 1S7LA 2C6CA 2J8MA 3KR4A 4CGNA 4PXCA 2R82A 5LRGA 1LFWA 1V0CA 2YNCA 5H86A 3FMCA 3OAKA 3H5ZA 4U9YA 2XEJA 4U9ZA 2D0OA 4OLLA 4EFDA 4QBJA 3OP0A 1HDUA 1SQHA 3C8OA 1CP7A 1ZL0A 3EFAA 2WUUA 4YGOA 1VHEA 2B3VA 5IX3A 1B47A 2F5IA 3PFEA 3RBUA 2B5GA 1FY7A 1TKFA 4MCSA 5ELYA 1WWZA 4OP4A 2F7VA 1X10A 4R7MA 4YWYA 3NH5A 1F2PA 2ODFA 2PJ6A 3G3SA 4TNUA 5D29A 4UF4A 4KVOE 2WPWA 4CRZB 4H89A 2PE3A 3GUXA 3IGRA 2XEIA 1Z9EA 2VQYA 3D7DA 5I4MA 2G9DA 4PV6A 3W91A 4LQ6A 3TFYA 2JEVA 3OB1B 2ZEEA 4A37A 1V6CA 4F9VA 4E94A 1KUYA 2GLFA 1X12A 3B3TA 4MRIA 3TT2A 3FJUA 2PJ1A 4CYOA 4A33A 2FL4A 3MGDA 4P4EA 1XBUA 4B14A 1BPMA 1M4LA 2Q04A 2G3TA 2VXKA 1Y0RA 3HUVA 3BI0A 4QB9A 1Q2DA 1R57A 3H8FA 4CAWA 5HVHA 3I1UA 5IV0A 4X8IA 1Z9UA 1VBHA 1CS0B 1XMBA 4P4IA 2YNDA 3PBEA 4B6ZA 1U6MA 4IAVA 2Q7BA 4A31A 4CPAA 4BPXB 2WZNA 3D2PA 2AFXA 5G21A 2DPSA 2DPTA 2GU2A 4NXYA 2E28A 1A2ZA 2AFWA 3P2FA 3SI0A 2R8VA 3PP9A 1PUAA 1Z4RA 4IHMA 4C7HA 2AUNA 4R9MA 3LWUA 2ZELA 3PB6X 4HNWB 4JLYA 4AVCA 4J0NA 4C9UA 4AG7A 1Q2CA 2ZEPA 5K99A 4JJXA 5HKZA 3BJ8A 1KBLA
chains in the Genus database with same CATH topology
1CX8A 4X2TA 1TXRA 1F57A 3BHXA 2V8VA 8CPAA 1BLLE 3MRUA 3K2KA 5LRJA 3NH4A 4R76A 1CPSA 2V8HA 2AFUA 4MHYA 4NGRA 3PBBA 3ICUA 4CDKA 2PIZA 2GP4A 3QNVA 2C6PA 3IC1A 4P6YA 4C85A 2POKA 1ZLHA 2JBJA 1R43A 2GREA 3SJXA 1HEEA 3SJEA 1XRYA 3CDXA 1XJOA 2F8HA 3ISZA 2C5QA 4MCPA 1DTDA 3D67A 4TJVA 3KI9A 5K8NA 3D7GA 4Z65A 5D8NA 3FEEA 4F8ZA 1Z5RA 4C9AA 5JM6A 2ZEHA 3PFOA 1DE4C 4OC2A 6CPAA 5LYDA 4DJLA 2QVPA 3B3WA 3PB8X 2PJAA 1ARMA 4F9UA 3NH8A 2ZOFA 3D68A 2PJ4A 3N5FA 4P4FA 4NFRA 3TC8A 5LRKA 3PRTA 3FF3A 4P4JA 3WC7A 2PVVA 1XFOA 1HDQA 3FECA 1YW4A 4C8UA 4FUUA 2XEGA 3KQXA 4NGMA 3D66A 2JBKA 1VIXA 3FX6A 4C8PA 4ZI6A 3PB4X 3S9MA 3FVLA 4UIAA 1IGBA 2PRQA 2ZENA 2PJ3A 4G1PA 2ZEMA 4PPZA 2HB6A 4YU9A 2EWBA 5LYIA 3PEIA 2PJBA 4PXDA 1PCAA 1BPNA 2CF4A 3WT4A 1QMUA 5JH9A 2PVWA 1Y9ZA 2XEFA 4NGQA 5K8PA 2GLJA 1WVMA 4JYWA 3WC6A 1VHOA 4PQAA 3BI1A 3KHZA 5HXDA 4H2KA 1QQ9A 5LYFA 3FH4A 4BD9A 3B7IA 2NSMA 1Q7LA 2CTBA 3CPAA 2CIJA 1GYTA 4UEEA 3IEHA 4NJRA 3IFEA 2DEAA 3B35A 4NGPA 1IY7A 2ANPA 1CP6A 1TF8A 2AFMA 4C99A 3LMSA 4FAIA 4OC1A 2CTCA 4C8TA 1Y7EA 4OKOA 4C9VA 4PXBA 3WABA 4O23A 2EK9A 4K3NA 2RB7A 2VL1A 2V77A 4UEFA 2PJ9A 2ZEGA 3VH9A 1R3NA 2PJ7A 3SJFA 4OIDA 4KNGE 1FT7A 2IMOA 3B3SA 1AMPA 2QYVA 2V8GA 4P4DA 4EMEA 3I6SA 2OR4A 1UWYA 3B2YA 2BCOA 3B3CA 4ONWA 3CPXA 4C8FA 2IQ6A 3VARA 3KL9A 4P10A 1LCPA 4MXUA 3D7FA 2FVGA 3VATA 3KHXA 1JQGA 2J9AA 4IK2A 1RTQA 3DLJA 1CPXA 1LOKA 3SI2A 4DYOA 3PB7X 2ZEFA 4TJXA 3KASA 3RAMA 1LAPA 1AYEA 2C6GA 5F09A 4R6TA 4C8AA 3IIBA 5J1QA 1FNOA 4OMEA 4UIBA 1OBRA 4MCRA 3KR5A 4OC4A 1ZG9A 2HC9A 2WYRA 4MHNA 4OC0A 5DS0A 4MMOA 2PJ2A 4NGTA 2PJ5A 5LYLA 1LAMA 2BO9A 4DUKA 4C9EA 4Q7AA 4ZY0A 2V8DA 4GM5A 1TF9A 5CPAA 5CBMA 4C84A 3MN8A 5THWA 4RUHA 1NSAA 4MCQA 2Q51A 3GB0A 4ZX9A 4NGNA 5IR2A 2C1CA 4FWUA 3L2NA 3T8WA 3BXMA 1EE3P 3SI1A 3PB9X 3IJ3A 4R8FA 3RZAA 3DGVA 2O4HA 4ZY2A 4C8CA 1PYTB 3IWWA 4CDJA 3CT9A 4PXEA 7CPAA 1TKHA 1YMEA 2QJ8A 4W9YA 1VGYA 2ZEOA 3NA6A 4A39A 3IO1A 2PIYA 2I3CA 2IJZA 2PJCA 3B3VA 2PJ0A 3ISXA 2O53A 1BAVA 1ZLIA 2BOAA 1YLOA 4OC5A 2Q43A 4KSIA 2RFHA 2EK8A 5K8OA 1ELMP 1CG2A 4NJQA 4A38A 1ARLA 4C9RA 2PCUA 3HLPA 1ZG8A 4A94A 1YSJA 4ZY1A 1F2OA 4OC3A 2OOTA 4LQGA 1Z8LA 3D7HA 5HVGA 4C86A 3H8GA 4MHPA 1ZG7A 3S9LA 2ZOGA 4NGSA 3GLJA 3JRUA 1Z2LA 4OIWA 2AFSA 2ABZA 4X3RA 2NYQA 3VTAA 5HVFA 3TX8A 1Y0YA 2ZEDA 4FBEA 4WJBA 5IB9A 4ZX8A 3K9TA 3SJGA 4TWEA 4ZYQA 1YW6A 1LANA 4YN3A 1H8LA 1KWMA 2JEWA 3D4UA 3V38A 3KZWA 5K8MA 3KQZA 2PJ8A 3H8EA 3KGQA 1ELLP 4AXVA 4P45A 4P4BA 4JZ0A 5JGFA 3FEDA 4UEZA 1XF1A 2AFZA 4WWVA 2Q4ZA 3WC5A 3I74A 3S9NA 4P44A 1CBXA 3NFZA 4MHZA 4EWTA 3V7ZA 1TKJA 2AFOA 2C6CA 3KR4A 4PXCA 5LRGA 1LFWA 3FMCA 2XEJA 4EFDA 1HDUA 1CP7A 1VHEA 3PFEA 3RBUA 1TKFA 3EIFA 4MCSA 4R7MA 5ELYA 4OP4A 4YWYA 2F7VA 3NH5A 1F2PA 2PJ6A 4TNUA 5D29A 4UF4A 2PE3A 3GUXA 5I4MA 2XEIA 3D7DA 2G9DA 2ZEEA 4A37A 1V6CA 4F9VA 2GLFA 3B3TA 4MRIA 3FJUA 2PJ1A 4P4EA 1XBUA 1BPMA 1M4LA 3HUVA 1Y0RA 3BI0A 3H8FA 5HVHA 3I1UA 4X8IA 1XMBA 4P4IA 3PBEA 4B6ZA 4IAVA 4CPAA 2WZNA 2AFXA 2GU2A 2AFWA 3SI0A 4IHMA 3LWUA 2ZELA 3PB6X 4C9UA 2ZEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CX8 A;  4X2T A;  1TXR A;  1F57 A;  3BHX A;  2V8V A;  8CPA A;  1BLL E;  3MRU A;  3K2K A;  5LRJ A;  3NH4 A;  4R76 A;  1CPS A;  2V8H A;  2AFU A;  4MHY A;  4NGR A;  3PBB A;  3ICU A;  4CDK A;  2PIZ A;  3QNV A;  2C6P A;  3IC1 A;  4P6Y A;  4C85 A;  2POK A;  1ZLH A;  2JBJ A;  1R43 A;  2GRE A;  3SJX A;  1HEE A;  3SJE A;  1XRY A;  3CDX A;  1XJO A;  2F8H A;  3ISZ A;  4MCP A;  1DTD A;  3D67 A;  4TJV A;  3KI9 A;  5K8N A;  3D7G A;  4Z65 A;  5D8N A;  3FEE A;  4F8Z A;  1Z5R A;  4C9A A;  5JM6 A;  2ZEH A;  3PFO A;  1DE4 C;  4OC2 A;  6CPA A;  5LYD A;  4DJL A;  2QVP A;  3B3W A;  3PB8 X;  2PJA A;  1ARM A;  4F9U A;  3NH8 A;  2ZOF A;  3D68 A;  2PJ4 A;  3N5F A;  4P4F A;  4NFR A;  3TC8 A;  5LRK A;  3PRT A;  3FF3 A;  4P4J A;  3WC7 A;  2PVV A;  1XFO A;  1HDQ A;  3FEC A;  1YW4 A;  4C8U A;  4FUU A;  2XEG A;  3KQX A;  4NGM A;  3D66 A;  2JBK A;  1VIX A;  3FX6 A;  4C8P A;  4ZI6 A;  3PB4 X;  3S9M A;  3FVL A;  4UIA A;  1IGB A;  2PRQ A;  2ZEN A;  2PJ3 A;  4G1P A;  2ZEM A;  4PPZ A;  2HB6 A;  4YU9 A;  2EWB A;  5LYI A;  3PEI A;  2PJB A;  4PXD A;  1PCA A;  1BPN A;  2CF4 A;  3WT4 A;  1QMU A;  5JH9 A;  2PVW A;  1Y9Z A;  2XEF A;  4NGQ A;  5K8P A;  2GLJ A;  1WVM A;  4JYW A;  3WC6 A;  1VHO A;  4PQA A;  3BI1 A;  3KHZ A;  5HXD A;  4H2K A;  1QQ9 A;  5LYF A;  3FH4 A;  4BD9 A;  3B7I A;  2NSM A;  1Q7L A;  2CTB A;  3CPA A;  2CIJ A;  1GYT A;  4UEE A;  3IEH A;  4NJR A;  3IFE A;  2DEA A;  3B35 A;  4NGP A;  1IY7 A;  2ANP A;  1CP6 A;  1TF8 A;  2AFM A;  4C99 A;  3LMS A;  4FAI A;  4OC1 A;  2CTC A;  4C8T A;  1Y7E A;  4OKO A;  4C9V A;  4PXB A;  3WAB A;  4O23 A;  2EK9 A;  4K3N A;  2RB7 A;  2VL1 A;  2V77 A;  4UEF A;  2PJ9 A;  2ZEG A;  3VH9 A;  1R3N A;  2PJ7 A;  3SJF A;  4OID A;  4KNG E;  1FT7 A;  2IMO A;  3B3S A;  1AMP A;  2QYV A;  2V8G A;  4P4D A;  4EME A;  3I6S A;  2OR4 A;  1UWY A;  3B2Y A;  2BCO A;  3B3C A;  4ONW A;  3CPX A;  4C8F A;  2IQ6 A;  3VAR A;  3KL9 A;  4P10 A;  1LCP A;  4MXU A;  3D7F A;  2FVG A;  3VAT A;  3KHX A;  1JQG A;  2J9A A;  4IK2 A;  1RTQ A;  3DLJ A;  1CPX A;  1LOK A;  3SI2 A;  4DYO A;  3PB7 X;  2ZEF A;  4TJX A;  3KAS A;  3RAM A;  1LAP A;  1AYE A;  2C6G A;  5F09 A;  4R6T A;  4C8A A;  3IIB A;  5J1Q A;  1FNO A;  4OME A;  4UIB A;  1OBR A;  4MCR A;  3KR5 A;  4OC4 A;  1ZG9 A;  2HC9 A;  2WYR A;  4MHN A;  4OC0 A;  5DS0 A;  4MMO A;  2PJ2 A;  4NGT A;  2PJ5 A;  5LYL A;  1LAM A;  2BO9 A;  4DUK A;  4C9E A;  4Q7A A;  4ZY0 A;  2V8D A;  4GM5 A;  1TF9 A;  5CPA A;  5CBM A;  4C84 A;  3MN8 A;  5THW A;  4RUH A;  1NSA A;  4MCQ A;  2Q51 A;  3GB0 A;  4ZX9 A;  4NGN A;  2C1C A;  4FWU A;  3L2N A;  3T8W A;  3BXM A;  1EE3 P;  3SI1 A;  3PB9 X;  3IJ3 A;  4R8F A;  3RZA A;  3DGV A;  2O4H A;  4ZY2 A;  4C8C A;  1PYT B;  3IWW A;  4CDJ A;  3CT9 A;  4PXE A;  7CPA A;  1TKH A;  1YME A;  2QJ8 A;  4W9Y A;  1VGY A;  2ZEO A;  3NA6 A;  4A39 A;  3IO1 A;  2PIY A;  2I3C A;  2IJZ A;  2PJC A;  3B3V A;  2PJ0 A;  3ISX A;  2O53 A;  1BAV A;  1ZLI A;  2BOA A;  1YLO A;  4OC5 A;  2Q43 A;  4KSI A;  2RFH A;  2EK8 A;  5K8O A;  1ELM P;  1CG2 A;  4NJQ A;  4A38 A;  1ARL A;  4C9R A;  2PCU A;  3HLP A;  1ZG8 A;  4A94 A;  1YSJ A;  4ZY1 A;  1F2O A;  4OC3 A;  2OOT A;  4LQG A;  1Z8L A;  3D7H A;  5HVG A;  4C86 A;  3H8G A;  4MHP A;  1ZG7 A;  3S9L A;  2ZOG A;  4NGS A;  3GLJ A;  3JRU A;  1Z2L A;  4OIW A;  2AFS A;  2ABZ A;  4X3R A;  2NYQ A;  3VTA A;  5HVF A;  3TX8 A;  1Y0Y A;  2ZED A;  4FBE A;  4WJB A;  5IB9 A;  4ZX8 A;  3K9T A;  3SJG A;  4TWE A;  4ZYQ A;  1YW6 A;  1LAN A;  4YN3 A;  1H8L A;  1KWM A;  2JEW A;  3D4U A;  3V38 A;  3KZW A;  5K8M A;  3KQZ A;  2PJ8 A;  3H8E A;  3KGQ A;  1ELL P;  4AXV A;  4P45 A;  4P4B A;  4JZ0 A;  5JGF A;  3FED A;  4UEZ A;  1XF1 A;  2AFZ A;  4WWV A;  2Q4Z A;  3WC5 A;  3I74 A;  3S9N A;  4P44 A;  1CBX A;  3NFZ A;  4MHZ A;  4EWT A;  3V7Z A;  1TKJ A;  2AFO A;  2C6C A;  3KR4 A;  4PXC A;  5LRG A;  1LFW A;  3FMC A;  2XEJ A;  4EFD A;  1HDU A;  1CP7 A;  1VHE A;  3PFE A;  3RBU A;  1TKF A;  3EIF A;  4MCS A;  4R7M A;  5ELY A;  4OP4 A;  4YWY A;  2F7V A;  3NH5 A;  1F2P A;  2PJ6 A;  4TNU A;  5D29 A;  4UF4 A;  2PE3 A;  3GUX A;  5I4M A;  2XEI A;  3D7D A;  2G9D A;  2ZEE A;  4A37 A;  1V6C A;  4F9V A;  2GLF A;  3B3T A;  4MRI A;  3FJU A;  2PJ1 A;  4P4E A;  1XBU A;  1BPM A;  1M4L A;  3HUV A;  1Y0R A;  3BI0 A;  3H8F A;  5HVH A;  3I1U A;  4X8I A;  1XMB A;  4P4I A;  3PBE A;  4B6Z A;  4IAV A;  4CPA A;  2WZN A;  2AFX A;  2GU2 A;  2AFW A;  3SI0 A;  4IHM A;  3LWU A;  2ZEL A;  3PB6 X;  4C9U A;  2ZEP A; 
#chains in the Genus database with same CATH topology
 1CX8 A;  4X2T A;  2Z3P A;  1IOF A;  3HPG G;  1TXR A;  1F57 A;  3FNC A;  3BHX A;  5HKW A;  2FIW A;  2V8V A;  8CPA A;  1BLL E;  2B5G B;  1NSL A;  2FT0 A;  3SXN A;  1YGH A;  3GY9 A;  3D8P A;  3A9L A;  2UV8 G;  3MRU A;  1QSR A;  3K2K A;  5LRJ A;  4AB7 A;  3NH4 A;  1VKC A;  4R76 A;  1CPS A;  2V8H A;  1XIX A;  2CNT A;  4PSW A;  2AFU A;  1YVO A;  3GIU A;  4MHY A;  4NGR A;  3PBB A;  4B11 A;  2DIK A;  4XPK A;  3HMJ G;  3R1K A;  3ICU A;  4CDK A;  2PIZ A;  2GP4 A;  1Z8T A;  1Z8W A;  3QNV A;  2C6P A;  1Z4E A;  3G8W A;  3IC1 A;  4KUB A;  4P6Y A;  3TE4 A;  4HKF A;  4QVT A;  4C85 A;  2EO8 A;  2POK A;  1ZYM A;  3SR3 A;  4M85 A;  2OU2 A;  1ZLH A;  2JBJ A;  1R43 A;  2BUE A;  2GRE A;  2HQY A;  1I12 A;  2O28 A;  4A4C A;  3DR8 A;  3RNZ A;  3SJX A;  2PCN A;  1HEE A;  3SJE A;  1XRY A;  4RR2 B;  2PR1 A;  4UA3 A;  3T07 A;  1IYK A;  3CDX A;  5J3X A;  1XJO A;  2F8H A;  2R7H A;  3F5B A;  2ZXV A;  3ISZ A;  3W6X A;  2C5Q A;  4MCP A;  1B6B A;  1DTD A;  3D67 A;  4H1H A;  4E8O A;  4OAE A;  4TJV A;  3KI9 A;  5K8N A;  3PT1 A;  1S60 A;  3JTK A;  2EBJ A;  3VWE A;  1FBV A;  3NE8 A;  3D7G A;  4UWJ A;  4FD5 A;  4Z65 A;  1PU9 A;  2OH1 A;  2B4J C;  1YVK A;  3FEE A;  3BJ7 A;  3JUW A;  5D8N A;  3R95 A;  3TCV A;  4F8Z A;  5HMN A;  3C26 A;  4M3S A;  1QSN A;  2GE3 A;  4CGO A;  2HI6 A;  2RC4 A;  3TLY A;  3FRM A;  3BUO B;  1Z5R A;  2J8N A;  1DIK A;  1VBG A;  4C9A A;  1JWQ A;  2HUZ A;  4RS2 A;  5JM6 A;  1OZP A;  2PSW A;  3TLC A;  5HH1 A;  3PLF B;  3H4Q A;  5IB0 A;  2ZEH A;  3PFO A;  1DE4 C;  3UY5 A;  4L89 A;  4NCZ A;  4OC2 A;  6CPA A;  3TLA A;  3CXQ A;  5LYD A;  1R61 A;  1IB1 E;  4DJL A;  2QVP A;  3B3W A;  3PB8 X;  2PJA A;  2Z0Z A;  4HPS A;  1ARM A;  3U88 C;  4KLV A;  4F9U A;  3NH8 A;  4JXR A;  4JD6 A;  2ZOF A;  3D68 A;  2PJ4 A;  3N5F A;  2B4B A;  2EZA A;  4P4F A;  4NFR A;  3TC8 A;  5LRK A;  3PRT A;  4KSA A;  2AUM A;  2G3A A;  3FF3 A;  3U1B A;  4XNH C;  4P4J A;  1I21 A;  3WC7 A;  2PVV A;  3S6G A;  1XFO A;  5JYB A;  4LUA A;  1HDQ A;  3FEC A;  4CYN A;  5J8F A;  1YW4 A;  3O8Z A;  4I49 A;  4UFV A;  3FIX A;  4CZ1 A;  4C8U A;  2OB0 A;  4FUU A;  4X5K A;  1KUV A;  2XEG A;  3KQX A;  4NGM A;  4BPU B;  5A27 A;  2EUI A;  3D66 A;  4R87 A;  1IYL A;  3ZZI A;  2D4O A;  2JLM A;  2FE7 A;  1JDB C;  1UFH A;  2JBK A;  1VIX A;  3FX6 A;  4IIY A;  2H5M A;  3GJZ A;  2EVN A;  1XF1 A;  2QML A;  4C8P A;  4ZI6 A;  3PB4 X;  4F6A A;  2QEC A;  2HWG A;  4MI1 A;  5F5X A;  1M1D A;  1XOV A;  3F9K C;  2ARH A;  3S9M A;  2ATR A;  3S6F A;  4II9 A;  1EZA A;  2EZB A;  2XPL A;  3PZJ A;  4BPW B;  4A4B A;  4C7I A;  3FVL A;  4KS9 A;  4NF1 A;  4UCM A;  4UIA A;  4XPL A;  1IGB A;  2Y1N A;  2I00 A;  2PRQ A;  2Z3M A;  5F49 A;  2ZEN A;  2YGW A;  3S6K A;  2Q7S A;  3T9Y A;  1IID A;  2PJ3 A;  4G1P A;  3BUX B;  3VRO A;  2GFQ A;  2ZEM A;  1BO4 A;  1Q2Y A;  4MHD A;  5AGE A;  4PPZ A;  4BMH A;  2OLS A;  2HB6 A;  4YU9 A;  4CRY B;  5F46 A;  4B10 A;  5GCN A;  2EWB A;  5LYI A;  1GHE A;  3EO4 A;  3IU1 A;  3PEI A;  2PJB A;  4PSX A;  2Q0Y A;  4GS4 A;  4PXD A;  4AVA A;  3BUW B;  1PCA A;  1BPN A;  1WK4 A;  4KOS A;  2CF4 A;  3KKW A;  5F48 A;  3FB3 A;  5F47 A;  3WT4 A;  3K4I A;  3PGP A;  1QMU A;  4FD6 A;  5JH9 A;  2PVW A;  1Y9Z A;  2XEF A;  4NGQ A;  5JQ4 A;  4COG A;  1KUX A;  1XE4 A;  3LAC A;  5K8P A;  2PQ8 A;  4RN7 A;  2GLJ A;  3RO0 A;  1WVM A;  3WR7 A;  4KVM E;  4JYW A;  2Z3O A;  1RXT A;  5AG4 A;  3KRV A;  3WC6 A;  1VHO A;  4PQA A;  3BI1 A;  3KHZ A;  1CM0 A;  2VI7 A;  4H2K A;  1QQ9 A;  4J3G A;  5HXD A;  4A32 A;  3VRR A;  5LYF A;  4Y49 C;  2REE A;  4KZT A;  3FH4 A;  2MP0 A;  3TOB A;  4BD9 A;  1KEE B;  3B7I A;  4B12 A;  2NSM A;  1Q7L A;  4KOW A;  3BLN A;  3R9G A;  2CTB A;  3CPA A;  3P2H A;  5AXI A;  4KUA A;  3D3S A;  2YNC C;  3S6H A;  4DNC A;  2YNE A;  2CIJ A;  4M6H A;  3TO9 A;  4CAE A;  1GYT A;  4UEE A;  4KOT A;  4BTF A;  3IEH A;  4NEX A;  4NJR A;  5DWN A;  2Q4Y A;  5C88 A;  5G20 A;  4A30 A;  1M6V B;  2YJV A;  3IFE A;  3R9E A;  4E5S A;  5G22 A;  2DEA A;  3B35 A;  4B5P A;  2EZC A;  4NGP A;  1IY7 A;  2ANP A;  2FIA A;  1CP6 A;  1VI4 A;  1TF8 A;  3K9U A;  2AFM A;  5FD8 A;  4C99 A;  3LMS A;  3ZJ0 A;  4KLW A;  4FAI A;  1I1D A;  2K5T A;  4OC1 A;  2CTC A;  4C8T A;  1Y7E A;  3QAH A;  4M6G A;  2GIV A;  4OKO A;  2HRO A;  4PXB A;  2ZW6 A;  3WAB A;  2N3A B;  2EK9 A;  4K3N A;  4O23 A;  1RO5 A;  2RB7 A;  2VL1 A;  3NOJ A;  2ZPA A;  2V77 A;  3VRN A;  2Z11 A;  4UEF A;  1IIC A;  2PJ9 A;  1P0H A;  2ZEG A;  3QB8 A;  3SXO A;  3VH9 A;  1R3N A;  2PJ7 A;  3W6S A;  1QST A;  2FS5 A;  3SJF A;  1YLE A;  4BBH A;  2R98 A;  2CXA A;  3T05 A;  2FSR A;  4OID A;  1XMT A;  2GAN A;  1M4I A;  4KNG E;  5JVL A;  1FT7 A;  1VHS A;  2IMO A;  4AG9 A;  3BUM B;  3B3S A;  1AMP A;  4FD7 A;  4MJ8 A;  3R96 A;  4UWI A;  4A2Z A;  2G0B A;  3G23 A;  3D2M A;  2QYV A;  2B4D B;  2OZU A;  1WJT A;  2V8G A;  4P4D A;  2B58 A;  4EME A;  1MJ9 A;  3F8K A;  1S3Z A;  2KCW A;  1GGO A;  2OR4 A;  1UWY A;  3B2Y A;  3I6S A;  4IUS A;  4INJ A;  4AVB A;  1IOI A;  2AE6 A;  2BCO A;  3B3C A;  2QIR A;  4ONW A;  3R9F A;  3CPX A;  4C8F A;  3T90 A;  5CNP A;  2IQ6 A;  4C2X A;  4B5O A;  3VAR A;  3VRP A;  3KL9 A;  5HKY A;  1Y9W A;  4KOR A;  1T36 B;  2DXQ A;  4P10 A;  1LCP A;  2NMT A;  4MXU A;  4B13 A;  4KSF A;  3D7F A;  2FVG A;  2Z3L A;  4MFQ A;  5BWA B;  3VAT A;  2ZW5 A;  3KHX A;  1JQG A;  2Q4V A;  2J9A A;  4IK2 A;  1M4D A;  1RTQ A;  1MK4 A;  3DLJ A;  4Q36 A;  1CPX A;  1LOK A;  1QSO A;  3SI2 A;  4DYO A;  1LRZ A;  4KOX A;  4JXQ A;  3PB7 X;  2ZEF A;  2WSA A;  1AUG A;  2Q44 A;  1TIQ A;  3EC4 A;  2Z10 A;  4TJX A;  3KAS A;  4GPL B;  5FVJ A;  3RAM A;  4CGM A;  3OB2 B;  1LAP A;  2VZY A;  3QAY A;  4CAF A;  1AYE A;  2C6G A;  4UCP A;  5F09 A;  4R6T A;  4C8A A;  3OWC A;  4QUS A;  3TLZ A;  4HNX B;  2XPN A;  4M8D A;  5ISV A;  3IIB A;  3EXN A;  5J1Q A;  1J3L A;  2X7B A;  1N71 A;  1FNO A;  4OME A;  3I3G A;  4KOV A;  5AG6 A;  4CAV A;  1NXJ A;  1Y9K A;  2B4D A;  5EC4 A;  4CGP A;  3VGO A;  4UIB A;  1OBR A;  3IU2 A;  1B87 A;  3CXP A;  4MCR A;  3KR5 A;  4OC4 A;  2VEZ A;  3CZX A;  4H6U A;  1ZG9 A;  1YVH A;  2PRB A;  4OAD A;  2HC9 A;  3TO7 A;  2WYR A;  1C3O B;  4MHN A;  2CY2 A;  2DF5 A;  3E0K A;  4OC0 A;  5DS0 A;  5H84 A;  2R1I A;  5KTD A;  4R3K A;  2FXF A;  4LX9 A;  4MMO A;  4XPD C;  1EO0 A;  3F0A A;  1Y7R A;  2PJ2 A;  4NGT A;  2PJ5 A;  5LYL A;  2BEI A;  1L0C A;  1LAM A;  2BO9 A;  4XNH B;  4DUK A;  1YRE A;  3IWE A;  3TLE A;  4Q7A A;  4C9E A;  4ZY0 A;  2V8D A;  1K4J A;  4GM5 A;  1TF9 A;  2I79 A;  2ZW4 A;  4K30 A;  4L8A A;  1YX0 A;  1MJB A;  4UBR A;  5CPA A;  2B0A A;  4R3L A;  5CBM A;  4QC6 A;  2CBL A;  4C84 A;  3MN8 A;  5THW A;  4RUH A;  3ZNI A;  3RYO A;  1NSA A;  3DSB A;  4MCQ A;  4MJX A;  2Q51 A;  1Z8X A;  3GB0 A;  3JVN A;  4ZX9 A;  4NGN A;  1IU8 A;  5IR2 A;  2C1C A;  3IWG A;  4F0Y A;  4FWU A;  2OZH A;  3L2N A;  4B5P B;  1S5K A;  3T8W A;  4RI1 A;  3BXM A;  1EE3 P;  1M44 A;  1NBW A;  2CNS A;  3BUN B;  3SI1 A;  4Y49 B;  3PB9 X;  3IJ3 A;  4R8F A;  5G1Z A;  3RZA A;  3DGV A;  4JWP A;  4CYQ A;  1P4N A;  4IF5 A;  4C68 A;  3DNS A;  5BY0 A;  2O4H A;  2JDC A;  4ZY2 A;  4BIN A;  4C8C A;  4E0A A;  2VZZ A;  1PYT B;  3IWW A;  1ZRS A;  3NE7 A;  4CDJ A;  2ZW7 A;  2AJ6 A;  3CT9 A;  1ON0 A;  4PXE A;  7CPA A;  1TKH A;  4COB A;  2PDO A;  2YJT A;  5F9M A;  4MFJ A;  5KTA A;  4MFK A;  4ONU A;  1YME A;  1YQE A;  2QJ8 A;  4W9Y A;  1VGY A;  2VBQ A;  2ZEO A;  4EYS A;  4FD4 A;  3TLG B;  1A9X B;  1YK3 A;  2CNM A;  3CXS A;  3NA6 A;  4A39 A;  3EZA A;  3IO1 A;  2PIY A;  2I3C A;  4U5Y A;  2IJZ A;  2PJC A;  3B3V A;  5AG7 A;  4PK3 A;  4PK2 A;  3TTH A;  1S7N A;  2PR8 A;  5AG5 A;  4C2Z A;  5KTC A;  4MI4 A;  2PJ0 A;  4MY0 A;  3ISX A;  2OZG A;  2O53 A;  3V8I A;  1BAV A;  1ZLI A;  2BOA A;  1YLO A;  4OC5 A;  2Q43 A;  3FBU A;  4KSI A;  4CGL A;  4R57 A;  2RFH A;  2EK8 A;  4CYP A;  3VRQ A;  1NMT A;  4GXH A;  4M6I A;  5K8O A;  3GYA A;  1ELM P;  4C2Y A;  5J8C A;  1C30 B;  1CG2 A;  2VKZ G;  5E96 A;  4NJQ A;  2C27 A;  4A38 A;  4CAX A;  1ARL A;  4H6Z A;  3LD2 A;  5F1Y A;  4C9R A;  4Q38 A;  2P6E A;  2PCU A;  3HLP A;  1ZG8 A;  4A94 A;  3GKR A;  1YSJ A;  4F0X A;  4ZY1 A;  1S7K A;  2XPO A;  3VWD A;  1F2O A;  5C82 A;  2D0P A;  4YRH A;  4UFW A;  4OC3 A;  2OOT A;  4LQG A;  1Z8L A;  1KC7 A;  3D7H A;  4ORF A;  5HVG A;  4C86 A;  3FXT A;  3H8G A;  2X0S A;  2WPX A;  2J8R A;  1ZG7 A;  1M4G A;  4HNY B;  4MHP A;  2P6F A;  2FCK A;  1ZO0 A;  2HV2 A;  3LOD A;  3S9L A;  4UCN A;  3TLB A;  1YR0 A;  2BL1 A;  2Y1M A;  2ZOG A;  4NGS A;  3GLJ A;  3JRU A;  3T0T A;  1QSM A;  1Z2L A;  3TO6 A;  2B3U A;  2Z3K A;  4EVY A;  4C9V A;  4OIW A;  3EZB A;  2DLA A;  2AFS A;  4CS0 B;  3TLG A;  4YFJ A;  3HPH E;  5EBV A;  1S7F A;  1Q5X A;  4NSQ A;  2ABZ A;  4X3R A;  4MY3 A;  5A28 A;  2NYQ A;  1EZB A;  3VTA A;  5HVF A;  1CJW A;  4KVX A;  2P0W A;  3TX8 A;  1Y0Y A;  2ZED A;  2FM4 A;  4JVO A;  2BSW A;  4MFL A;  4FBE A;  4WJB A;  5IB9 A;  4ZX8 A;  3B8G A;  3SJG A;  2IL4 A;  3K9T A;  4TWE A;  2Y0M A;  4ZYQ A;  5I0C A;  3TYX A;  1YW6 A;  3DR6 A;  2JDD A;  1LAN A;  1XEB A;  4MBU A;  4KOY A;  1MJA A;  2Z3N A;  4YN3 A;  1H8L A;  1NE9 A;  1KWM A;  2JEW A;  3D4U A;  3V38 A;  1BOB A;  4CO9 A;  3KZW A;  3EIF A;  4ZBG A;  5EMI A;  3KQZ A;  5K8M A;  2PC1 A;  2D4P A;  1J4J A;  1KZF A;  3NFQ A;  1XF8 A;  2PJ8 A;  5DWM A;  3H8E A;  3KGQ A;  1ELL P;  3N7Z A;  4P45 A;  4A95 A;  4P4B A;  4AXV A;  4JZ0 A;  3SHP A;  2REF A;  4UFX A;  4XPD B;  2P6G A;  4MFZ A;  5JGF A;  3FED A;  3FYN A;  3DDD A;  4UEZ A;  4ZGY B;  2A4N A;  2AFZ A;  5F13 A;  3I9S A;  4E2A A;  1CE8 B;  3T5M A;  4WWV A;  2Q4Z A;  3WC5 A;  3I74 A;  3PFV A;  5JPH A;  3S9N A;  4P44 A;  1CBX A;  3NFZ A;  4MFP A;  2XPP A;  4MHZ A;  4EWT A;  1BXR B;  1JDE A;  3EZE A;  4IIX A;  4KOU A;  3TOA A;  3EY5 A;  3V7Z A;  1TKJ A;  2AFO A;  1S7L A;  2C6C A;  2J8M A;  3KR4 A;  4CGN A;  4PXC A;  2R82 A;  5LRG A;  1LFW A;  1V0C A;  2YNC A;  5H86 A;  3FMC A;  3OAK A;  3H5Z A;  4U9Y A;  2XEJ A;  4U9Z A;  2D0O A;  4OLL A;  4EFD A;  4QBJ A;  3OP0 A;  1HDU A;  1SQH A;  3C8O A;  1CP7 A;  1ZL0 A;  3EFA A;  2WUU A;  4YGO A;  1VHE A;  2B3V A;  5IX3 A;  1B47 A;  2F5I A;  3PFE A;  3RBU A;  2B5G A;  1FY7 A;  1TKF A;  4MCS A;  5ELY A;  1WWZ A;  4OP4 A;  2F7V A;  1X10 A;  4R7M A;  4YWY A;  3NH5 A;  1F2P A;  2ODF A;  2PJ6 A;  3G3S A;  4TNU A;  5D29 A;  4UF4 A;  4KVO E;  2WPW A;  4CRZ B;  4H89 A;  2PE3 A;  3GUX A;  3IGR A;  2XEI A;  1Z9E A;  2VQY A;  3D7D A;  5I4M A;  2G9D A;  4PV6 A;  3W91 A;  4LQ6 A;  3TFY A;  2JEV A;  3OB1 B;  2ZEE A;  4A37 A;  1V6C A;  4F9V A;  4E94 A;  1KUY A;  2GLF A;  1X12 A;  3B3T A;  4MRI A;  3TT2 A;  3FJU A;  2PJ1 A;  4CYO A;  4A33 A;  2FL4 A;  3MGD A;  4P4E A;  1XBU A;  4B14 A;  1BPM A;  1M4L A;  2Q04 A;  2G3T A;  2VXK A;  1Y0R A;  3HUV A;  3BI0 A;  4QB9 A;  1Q2D A;  1R57 A;  3H8F A;  4CAW A;  5HVH A;  3I1U A;  5IV0 A;  4X8I A;  1Z9U A;  1VBH A;  1CS0 B;  1XMB A;  4P4I A;  2YND A;  3PBE A;  4B6Z A;  1U6M A;  4IAV A;  2Q7B A;  4A31 A;  4CPA A;  4BPX B;  2WZN A;  3D2P A;  2AFX A;  5G21 A;  2DPS A;  2DPT A;  2GU2 A;  4NXY A;  2E28 A;  1A2Z A;  2AFW A;  3P2F A;  3SI0 A;  2R8V A;  3PP9 A;  1PUA A;  1Z4R A;  4IHM A;  4C7H A;  2AUN A;  4R9M A;  3LWU A;  2ZEL A;  3PB6 X;  4HNW B;  4JLY A;  4AVC A;  4J0N A;  4C9U A;  4AG7 A;  1Q2C A;  2ZEP A;  5K99 A;  4JJX A;  5HKZ A;  3BJ8 A;  1KBL A; 
#chains in the Genus database with same CATH homology
 1CX8 A;  4X2T A;  1TXR A;  1F57 A;  3BHX A;  2V8V A;  8CPA A;  1BLL E;  3MRU A;  3K2K A;  5LRJ A;  3NH4 A;  4R76 A;  1CPS A;  2V8H A;  2AFU A;  4MHY A;  4NGR A;  3PBB A;  3ICU A;  4CDK A;  2PIZ A;  2GP4 A;  3QNV A;  2C6P A;  3IC1 A;  4P6Y A;  4C85 A;  2POK A;  1ZLH A;  2JBJ A;  1R43 A;  2GRE A;  3SJX A;  1HEE A;  3SJE A;  1XRY A;  3CDX A;  1XJO A;  2F8H A;  3ISZ A;  2C5Q A;  4MCP A;  1DTD A;  3D67 A;  4TJV A;  3KI9 A;  5K8N A;  3D7G A;  4Z65 A;  5D8N A;  3FEE A;  4F8Z A;  1Z5R A;  4C9A A;  5JM6 A;  2ZEH A;  3PFO A;  1DE4 C;  4OC2 A;  6CPA A;  5LYD A;  4DJL A;  2QVP A;  3B3W A;  3PB8 X;  2PJA A;  1ARM A;  4F9U A;  3NH8 A;  2ZOF A;  3D68 A;  2PJ4 A;  3N5F A;  4P4F A;  4NFR A;  3TC8 A;  5LRK A;  3PRT A;  3FF3 A;  4P4J A;  3WC7 A;  2PVV A;  1XFO A;  1HDQ A;  3FEC A;  1YW4 A;  4C8U A;  4FUU A;  2XEG A;  3KQX A;  4NGM A;  3D66 A;  2JBK A;  1VIX A;  3FX6 A;  4C8P A;  4ZI6 A;  3PB4 X;  3S9M A;  3FVL A;  4UIA A;  1IGB A;  2PRQ A;  2ZEN A;  2PJ3 A;  4G1P A;  2ZEM A;  4PPZ A;  2HB6 A;  4YU9 A;  2EWB A;  5LYI A;  3PEI A;  2PJB A;  4PXD A;  1PCA A;  1BPN A;  2CF4 A;  3WT4 A;  1QMU A;  5JH9 A;  2PVW A;  1Y9Z A;  2XEF A;  4NGQ A;  5K8P A;  2GLJ A;  1WVM A;  4JYW A;  3WC6 A;  1VHO A;  4PQA A;  3BI1 A;  3KHZ A;  5HXD A;  4H2K A;  1QQ9 A;  5LYF A;  3FH4 A;  4BD9 A;  3B7I A;  2NSM A;  1Q7L A;  2CTB A;  3CPA A;  2CIJ A;  1GYT A;  4UEE A;  3IEH A;  4NJR A;  3IFE A;  2DEA A;  3B35 A;  4NGP A;  1IY7 A;  2ANP A;  1CP6 A;  1TF8 A;  2AFM A;  4C99 A;  3LMS A;  4FAI A;  4OC1 A;  2CTC A;  4C8T A;  1Y7E A;  4OKO A;  4C9V A;  4PXB A;  3WAB A;  4O23 A;  2EK9 A;  4K3N A;  2RB7 A;  2VL1 A;  2V77 A;  4UEF A;  2PJ9 A;  2ZEG A;  3VH9 A;  1R3N A;  2PJ7 A;  3SJF A;  4OID A;  4KNG E;  1FT7 A;  2IMO A;  3B3S A;  1AMP A;  2QYV A;  2V8G A;  4P4D A;  4EME A;  3I6S A;  2OR4 A;  1UWY A;  3B2Y A;  2BCO A;  3B3C A;  4ONW A;  3CPX A;  4C8F A;  2IQ6 A;  3VAR A;  3KL9 A;  4P10 A;  1LCP A;  4MXU A;  3D7F A;  2FVG A;  3VAT A;  3KHX A;  1JQG A;  2J9A A;  4IK2 A;  1RTQ A;  3DLJ A;  1CPX A;  1LOK A;  3SI2 A;  4DYO A;  3PB7 X;  2ZEF A;  4TJX A;  3KAS A;  3RAM A;  1LAP A;  1AYE A;  2C6G A;  5F09 A;  4R6T A;  4C8A A;  3IIB A;  5J1Q A;  1FNO A;  4OME A;  4UIB A;  1OBR A;  4MCR A;  3KR5 A;  4OC4 A;  1ZG9 A;  2HC9 A;  2WYR A;  4MHN A;  4OC0 A;  5DS0 A;  4MMO A;  2PJ2 A;  4NGT A;  2PJ5 A;  5LYL A;  1LAM A;  2BO9 A;  4DUK A;  4C9E A;  4Q7A A;  4ZY0 A;  2V8D A;  4GM5 A;  1TF9 A;  5CPA A;  5CBM A;  4C84 A;  3MN8 A;  5THW A;  4RUH A;  1NSA A;  4MCQ A;  2Q51 A;  3GB0 A;  4ZX9 A;  4NGN A;  5IR2 A;  2C1C A;  4FWU A;  3L2N A;  3T8W A;  3BXM A;  1EE3 P;  3SI1 A;  3PB9 X;  3IJ3 A;  4R8F A;  3RZA A;  3DGV A;  2O4H A;  4ZY2 A;  4C8C A;  1PYT B;  3IWW A;  4CDJ A;  3CT9 A;  4PXE A;  7CPA A;  1TKH A;  1YME A;  2QJ8 A;  4W9Y A;  1VGY A;  2ZEO A;  3NA6 A;  4A39 A;  3IO1 A;  2PIY A;  2I3C A;  2IJZ A;  2PJC A;  3B3V A;  2PJ0 A;  3ISX A;  2O53 A;  1BAV A;  1ZLI A;  2BOA A;  1YLO A;  4OC5 A;  2Q43 A;  4KSI A;  2RFH A;  2EK8 A;  5K8O A;  1ELM P;  1CG2 A;  4NJQ A;  4A38 A;  1ARL A;  4C9R A;  2PCU A;  3HLP A;  1ZG8 A;  4A94 A;  1YSJ A;  4ZY1 A;  1F2O A;  4OC3 A;  2OOT A;  4LQG A;  1Z8L A;  3D7H A;  5HVG A;  4C86 A;  3H8G A;  4MHP A;  1ZG7 A;  3S9L A;  2ZOG A;  4NGS A;  3GLJ A;  3JRU A;  1Z2L A;  4OIW A;  2AFS A;  2ABZ A;  4X3R A;  2NYQ A;  3VTA A;  5HVF A;  3TX8 A;  1Y0Y A;  2ZED A;  4FBE A;  4WJB A;  5IB9 A;  4ZX8 A;  3K9T A;  3SJG A;  4TWE A;  4ZYQ A;  1YW6 A;  1LAN A;  4YN3 A;  1H8L A;  1KWM A;  2JEW A;  3D4U A;  3V38 A;  3KZW A;  5K8M A;  3KQZ A;  2PJ8 A;  3H8E A;  3KGQ A;  1ELL P;  4AXV A;  4P45 A;  4P4B A;  4JZ0 A;  5JGF A;  3FED A;  4UEZ A;  1XF1 A;  2AFZ A;  4WWV A;  2Q4Z A;  3WC5 A;  3I74 A;  3S9N A;  4P44 A;  1CBX A;  3NFZ A;  4MHZ A;  4EWT A;  3V7Z A;  1TKJ A;  2AFO A;  2C6C A;  3KR4 A;  4PXC A;  5LRG A;  1LFW A;  3FMC A;  2XEJ A;  4EFD A;  1HDU A;  1CP7 A;  1VHE A;  3PFE A;  3RBU A;  1TKF A;  3EIF A;  4MCS A;  4R7M A;  5ELY A;  4OP4 A;  4YWY A;  2F7V A;  3NH5 A;  1F2P A;  2PJ6 A;  4TNU A;  5D29 A;  4UF4 A;  2PE3 A;  3GUX A;  5I4M A;  2XEI A;  3D7D A;  2G9D A;  2ZEE A;  4A37 A;  1V6C A;  4F9V A;  2GLF A;  3B3T A;  4MRI A;  3FJU A;  2PJ1 A;  4P4E A;  1XBU A;  1BPM A;  1M4L A;  3HUV A;  1Y0R A;  3BI0 A;  3H8F A;  5HVH A;  3I1U A;  4X8I A;  1XMB A;  4P4I A;  3PBE A;  4B6Z A;  4IAV A;  4CPA A;  2WZN A;  2AFX A;  2GU2 A;  2AFW A;  3SI0 A;  4IHM A;  3LWU A;  2ZEL A;  3PB6 X;  4C9U A;  2ZEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...