4NGSA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
696
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 263
structure length 696
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngsA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngsA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngsA02
3NA6A 3K2KA 3SI2A 4C9VA 4UF4A 3RAMA 2ZELA 3JRUA 1XF1A 1ARLA 2F7VA 2AFMA 4MCSA 2QYVA 3QNVA 4MHNA 4UEEA 2PJ4A 3IIBA 2POKA 3SI1A 3RBUA 2C6GA 1ELLP 1CPSA 1F2OA 4BD9A 2C6PA 4YN3A 2PIYA 3KQZA 1IGBA 4Z65A 3FMCA 3PFOA 3CPAA 4YU9A 1YLOA 2AFSA 3VATA 4UIAA 3FF3A 2IJZA 3MN8A 3IFEA 1WVMA 3I74A 2WZNA 4OC0A 4DUKA 2ZEEA 2ZEPA 1KWMA 2CTCA 1XFOA 4A37A 4IHMA 4ZY1A 1NSAA 1EE3P 4EWTA 1LANA 4CDJA 1Z5RA 4P45A 1HEEA 3KHZA 5HVFA 4NGPA 3DGVA 4P6YA 2ZEGA 3HLPA 3FVLA 2BO9A 1XJOA 2XEIA 4C8AA 2GLJA 5F09A 4C84A 4X3RA 4NGSA 4R6TA 3L2NA 5LYIA 4NJRA 1BAVA 2ANPA 1CPXA 2V8HA 1H8LA 4Q7AA 4PXEA 3PBEA 2XEJA 4FBEA 3PB9X 1YW4A 3NH5A 2EK9A 4PQAA 4GM5A 2PJ9A 1R3NA 4TJVA 4MHPA 3KR4A 5CPAA 1QMUA 3H8GA 1M4LA 4JZ0A 5JGFA 2GLFA 4R7MA 3KASA 2Q43A 3LWUA 4DYOA 3D7FA 3BI0A 2OR4A 4ONWA 2PJBA 2PVVA 4F9VA 2IQ6A 1TKJA 2AFZA 4IK2A 5JH9A 1PCAA 1CP7A 3KHXA 4B6ZA 7CPAA 4O23A 2PJ2A 3GB0A 4EFDA 2OOTA 3BHXA 5ELYA 1ARMA 3KI9A 1DE4C 1ZG7A 1JQGA 5K8OA 2I3CA 4WJBA 4MHYA 1XMBA 1DTDA 4OMEA 4TNUA 2CF4A 3WT4A 4RUHA 2F8HA 3H8FA 2BOAA 1TKHA 4ZYQA 1AMPA 1FT7A 1VIXA 1Y9ZA 3SJFA 1LOKA 3D68A 1CG2A 2AFWA 1BPNA 2WYRA 3GLJA 4NJQA 3D7HA 4P44A 1TKFA 2ABZA 5IB9A 2PJ8A 4C8FA 4P4BA 3B3SA 4KNGE 4P4FA 4A94A 1TF8A 3ISZA 3IEHA 2CTBA 3B3WA 4OP4A 2V77A 2V8VA 4NGRA 2O53A 1TF9A 1CX8A 3TX8A 3B2YA 5D8NA 3RZAA 5LYDA 4FWUA 1VHOA 4MHZA 1XRYA 4OIWA 1Y7EA 3WABA 2PJAA 4ZX8A 4ZX9A 4NGQA 4P4IA 3LMSA 4IAVA 3DLJA 3PEIA 4NGTA 4C9RA 1R43A 2JEWA 4NGNA 4OC4A 2O4HA 1ZG8A 2PRQA 3SJXA 1IY7A 1CBXA 4NGMA 5K8NA 3VARA 2ZEOA 2V8DA 4K3NA 1GYTA 3PB8X 3S9LA 1Y0YA 4C99A 3FEEA 4OC3A 2FVGA 2ZEMA 5LRGA 3D7GA 2ZEDA 1TXRA 1LFWA 1CP6A 2RB7A 3NFZA 3B3VA 3FH4A 3FECA 4OC2A 3WC6A 3B3CA 2Q4ZA 3FJUA 2GREA 3EIFA 3TC8A 3WC7A 4MCRA 4LQGA 3WC5A 2G9DA 4WWVA 1ZLIA 4AXVA 4OKOA 4TJXA 3ICUA 1Q7LA 8CPAA 1VHEA 4TWEA 2PE3A 1BPMA 1VGYA 4FUUA 1AYEA 3KGQA 4MRIA 1BLLE 2AFUA 4PPZA 2VL1A 2PIZA 1Z8LA 3B7IA 3HUVA 3FX6A 5THWA 3KQXA 4MCPA 1LCPA 4MCQA 2PJ5A 3D7DA 4P4EA 4EMEA 3BI1A 1YSJA 2PJ0A 3IC1A 3SJEA 3B3TA 5K8MA 3KZWA 1UWYA 3SJGA 4PXCA 3BXMA 1V6CA 4PXDA 5LRKA 1HDUA 5DS0A 5J1QA 3FEDA 2DEAA 3B35A 1ZLHA 4P10A 3IWWA 3PB6X 2HB6A 2C6CA 3S9NA 3IJ3A 1PYTB 1QQ9A 2PVWA 3CT9A 2PJ7A 1YMEA 2CIJA 5JM6A 2AFXA 3H8EA 4P4JA 4W9YA 4C8UA 5HVHA 3VH9A 3CPXA 4UEFA 3SI0A 5LYFA 1ZG9A 3PB7X 2EWBA 2ZEHA 4R76A 2ZOGA 1Y0RA 3N5FA 2QVPA 1YW6A 4PXBA 4YWYA 5HVGA 4C85A 3PRTA 2IMOA 3T8WA 4CPAA 5K8PA 3I6SA 3K9TA 2GU2A 2PJ3A 4JYWA 4C9UA 3S9MA 4MMOA 4OC1A 2JBJA 3VTAA 3CDXA 2RFHA 4ZY2A 5I4MA 2C1CA 2V8GA 3V38A 4C8CA 2EK8A 4DJLA 4C86A 2XEGA 3PB4X 3MRUA 4KSIA 3KR5A 2Q51A 4C8PA 6CPAA 4ZY0A 1HDQA 4X2TA 3NH8A 2HC9A 4MXUA 1F57A 3D66A 4ZI6A 1Z2LA 3NH4A 2PCUA 2J9AA 4C8TA 3ISXA 4NFRA 4X8IA 1LAMA 3V7ZA 3PBBA 2XEFA 4R8FA 1LAPA 4C9AA 4G1PA 2NSMA 1FNOA 4OIDA 2ZENA 2PJ1A 5LRJA 2JBKA 2BCOA 4F9UA 4A39A 2PJCA 3KL9A 4UIBA 5LYLA 4UEZA 4F8ZA 2PJ6A 4OC5A 4CDKA 3D4UA 1RTQA 2AFOA 1OBRA 2ZOFA 3IO1A 3I1UA 5HXDA 1XBUA 4FAIA 4H2KA 4P4DA 1F2PA 3D67A 2NYQA 5D29A 3GUXA 5CBMA 4C9EA 2QJ8A 4A38A 2ZEFA 3PFEA 1ELMP
chains in the Genus database with same CATH superfamily
3NA6A 1X12A 3K2KA 4F6AA 3SI2A 4C9VA 3E0KA 4UF4A 2Z3PA 2ZELA 3RAMA 1C30B 2OZUA 2B3VA 3JRUA 1ARLA 4M85A 4A4BA 1XF1A 2F7VA 3NFQA 2AFMA 4MCSA 2FE7A 2QYVA 3F0AA 3QNVA 3EY5A 3BJ7A 4MHNA 4UEEA 4DNCA 2PJ4A 4AG7A 3IIBA 4KLVA 2POKA 2B4DA 4PV6A 3T0TA 2UV8G 3SI1A 4AVCA 5FVJA 1Z9UA 2EZBA 3RBUA 1QSNA 5F48A 2C6GA 1ELLP 2IL4A 1CPSA 1F2OA 4KORA 2C6PA 4NXYA 4BD9A 2PIYA 3KQZA 1XOVA 4YN3A 2DXQA 4UFWA 3R1KA 1IGBA 3C26A 4BPXB 4Z65A 4A31A 3FMCA 2Z3MA 3PFOA 1A2ZA 4UFXA 4B11A 1Z8WA 3CPAA 1PUAA 3NE8A 4YU9A 4UCMA 1YLOA 2AFSA 3VATA 4UIAA 3FF3A 5BY0A 2IJZA 4UA3A 1M1DA 3MN8A 3IFEA 2B4JC 2FIAA 4PSWA 1WVMA 3OWCA 1YQEA 2OU2A 2WZNA 4OC0A 4JD6A 4KUAA 4B13A 4A4CA 4DUKA 2OB0A 3I74A 3G3SA 2ZEEA 3D3SA 3PP9A 2ZEPA 4A95A 1KWMA 3W6SA 2CTCA 1R61A 1KUYA 1RXTA 4KVXA 1XFOA 4A37A 4IHMA 3BUWB 4MJ8A 2Z3KA 4ZY1A 1NSAA 1EE3P 4KVOE 1LANA 1GHEA 4EWTA 1J3LA 4CDJA 1Z5RA 4P45A 1HEEA 3KHZA 5HVFA 4NGPA 3DGVA 1Y7RA 3PGPA 4P6YA 1IB1E 4CAEA 2ZEGA 3HLPA 3FVLA 2BO9A 1XJOA 2XEIA 4C8AA 2GLJA 4K30A 1PU9A 4JLYA 5F09A 3OAKA 1GGOA 3DR6A 1M4IA 4CZ1A 1YVHA 4C84A 5EBVA 4X3RA 3DR8A 4NGSA 4R6TA 4HKFA 4Q38A 3NE7A 3L2NA 2K5TA 4CYOA 5LYIA 4NJRA 2P6GA 1BAVA 2ANPA 2C5QA 1CPXA 3CZXA 2V8HA 1H8LA 4Q7AA 4QUSA 4H6UA 1X10A 2XPPA 3F5BA 4MFPA 2ZW5A 1K4JA 4PXEA 3PBEA 2XEJA 4FD4A 3PB9X 4M3SA 4BINA 4B5OA 4FBEA 1YW4A 4INJA 3NH5A 3EZEA 3TLZA 4LX9A 2EK9A 4PQAA 4GM5A 1SQHA 1I1DA 2PJ9A 1R3NA 2I00A 3EZBA 1S3ZA 2AJ6A 4ORFA 4MHPA 2J8RA 4C7IA 4MJXA 1Z4EA 4TJVA 2R1IA 3KR4A 5CPAA 1QMUA 3H8GA 1M4LA 4OAEA 4UBRA 4JZ0A 4OADA 5JGFA 2GLFA 3VRNA 4IF5A 2PCNA 4R7MA 3KASA 3DDDA 1VHSA 2Q43A 3R96A 3LWUA 4E94A 4DYOA 3D7FA 4NEXA 1R57A 3GY9A 3BI0A 4R3KA 2Q7SA 2OR4A 2YNCC 1KC7A 3G8WA 4ONWA 2PJBA 2PVVA 2R98A 4F9VA 2BEIA 2IQ6A 2QIRA 4CGLA 2Y1MA 3T9YA 1VKCA 1TKJA 2ZW7A 2XPOA 3BUNB 2AFZA 3SXOA 5JPHA 2Q04A 1IYLA 2FS5A 1JDEA 4IK2A 4M8DA 3TT2A 1P4NA 1XEBA 2GIVA 5JH9A 1LRZA 1BXRB 4QC6A 1PCAA 1CP7A 3KHXA 4B6ZA 2ATRA 2B3UA 3BUXB 7CPAA 3DSBA 1YX0A 2PJ2A 1XE4A 4O23A 3GB0A 4EFDA 2OOTA 3I9SA 3BHXA 4Y49C 2Z3NA 4CYPA 5IR2A 5J8FA 4H89A 4MY3A 4B5PB 5ELYA 2GANA 1KUVA 4CAFA 1ARMA 5EC4A 3KI9A 3P2FA 1DE4C 1IOIA 2VZYA 2Z11A 4CS0B 3IWEA 3SR3A 1WK4A 1ZG7A 1JQGA 3GJZA 3TLCA 4MFQA 5K8OA 2YNDA 4FD6A 3TLGB 3F9KC 2I3CA 4WJBA 4MHYA 2JLMA 2G3AA 3LD2A 4J3GA 1XMBA 1DTDA 2WSAA 4C2YA 2R82A 2BL1A 4OMEA 4J0NA 1BOBA 4TNUA 2J8NA 2Q4VA 1NSLA 2WUUA 3S6GA 5JYBA 4E2AA 1QSMA 4M6GA 4CGPA 2P0WA 4ZBGA 4QBJA 1B6BA 2CF4A 2OLSA 3FB3A 3GIUA 2FM4A 3WT4A 3FNCA 3GYAA 1MJBA 2D0OA 1YREA 4RUHA 1Z9EA 4QVTA 5GCNA 1MK4A 2F8HA 2QMLA 2ZW4A 2BOAA 1TKHA 3H8FA 3MGDA 4ZYQA 1AMPA 4A33A 1FT7A 4PK2A 1VIXA 4UWJA 4NSQA 1EZAA 1Y9ZA 2B58A 3SJFA 3F8KA 1T36B 1LOKA 4KZTA 3VRQA 3T90A 3D68A 4KS9A 4HNWB 1CG2A 2AFWA 1BPNA 1JWQA 4BPUB 2DPSA 1Q2YA 2WYRA 3GLJA 4NJQA 4B10A 5DWNA 3D7HA 4P44A 1TKFA 2ABZA 4GXHA 5IB9A 1XMTA 3BLNA 2PJ8A 4C8FA 5FD8A 4P4BA 4B12A 3B3SA 4F0XA 4KNGE 4P4FA 1B47A 3QAYA 4A94A 5CNPA 1TF8A 3ISZA 5ISVA 4X5KA 4R3LA 3IEHA 2CTBA 3B3WA 4OP4A 3NOJA 4Y49B 1FY7A 2FCKA 2V77A 2V8VA 5F47A 2QECA 4L8AA 2AUNA 4CAXA 2G3TA 3LODA 4NGRA 2O53A 5EMIA 5HH1A 1TF9A 1TIQA 3PLFB 1CX8A 2O28A 3DNSA 1VBHA 3TX8A 2PC1A 3B2YA 4M6HA 5D8NA 3RZAA 5LYDA 1M6VB 2R7HA 3FYNA 1VHOA 2VI7A 4FWUA 4XPLA 4MHZA 1Z8TA 2B4DB 4A32A 1XRYA 4NF1A 3RYOA 4EVYA 4OIWA 1Y7EA 4KOSA 3WABA 2B5GA 2PJAA 4KOUA 2CNSA 1I21A 4ZX9A 4ZX8A 4NGQA 3CXQA 4LUAA 4P4IA 3TOBA 2FIWA 3LMSA 3P2HA 4IAVA 4KOVA 3K4IA 3DLJA 3PEIA 4IUSA 3A9LA 3H5ZA 4NGTA 1NXJA 4KOYA 3ZNIA 4C9RA 2FXFA 4HPSA 1R43A 2R8VA 2JEWA 2DPTA 3PT1A 1KBLA 4NGNA 4OC4A 2O4HA 4FD5A 5KTCA 2XPLA 3R9EA 1ZG8A 2FSRA 2Z3LA 4AG9A 5KTDA 2PRQA 1IOFA 4RI1A 3SXNA 3SJXA 1IY7A 1CBXA 3S6HA 4BTFA 3SHPA 4NGMA 3D2MA 5K8NA 1ZO0A 1CS0B 2GE3A 2Q4YA 1P0HA 3U88C 3VARA 5IV0A 3T07A 2ZEOA 1EO0A 2V8DA 2YNEA 4K3NA 1GYTA 3PB8X 3S9LA 1Y0YA 4C99A 4MFJA 4NCZA 1NE9A 3FEEA 1S5KA 3EFAA 4OC3A 2FVGA 2ZEMA 4KOTA 5LRGA 5K8MA 1CM0A 3D7GA 2GP4A 4CYQA 2ZEDA 5G22A 3RO0A 3TO7A 3TLEA 1TXRA 1LFWA 1CP6A 3JTKA 4KSAA 2RB7A 4BBHA 3NFZA 3B3VA 5J3XA 4XPDB 5G20A 3IGRA 4C68A 1YVKA 3FRMA 3EZAA 5H86A 1S7FA 3FH4A 3FECA 4H1HA 4OC2A 3HMJG 3T05A 4QB9A 1KZFA 2JDCA 2PRBA 3WC6A 4IIYA 2REEA 4EYSA 5C82A 1MJ9A 1RO5A 3B3CA 1IU8A 2Q4ZA 5IX3A 3FJUA 3KRVA 3BUOB 2GREA 3EIFA 3TC8A 4F0YA 1YGHA 3WC7A 4MHDA 4MCRA 2HWGA 4LQGA 3TE4A 4MFZA 3WC5A 3CXSA 3TLGA 2G9DA 4WWVA 3TO9A 1Q5XA 3C8OA 4JJXA 3BJ8A 4LQ6A 3S6FA 4CRZB 4A30A 3TYXA 2OZHA 4CAWA 3N7ZA 4CAVA 1ZLIA 1WWZA 3FXTA 3JUWA 4OKOA 1Q7LA 3UY5A 3S6KA 4AXVA 3ICUA 8CPAA 1VHEA 2Q44A 2EUIA 1Q2DA 4TWEA 4MI1A 2WPWA 1EZBA 2JDDA 3VGOA 2PE3A 2DF5A 2HQYA 4MY0A 1BPMA 4JXQA 2H5MA 3GKRA 2YJVA 3G23A 1ZL0A 4R9MA 3VWDA 1VGYA 3TLYA 4CGOA 2Q0YA 4FUUA 5HKZA 1AYEA 2DLAA 3KGQA 2F5IA 3I3GA 1BLLE 2AFUA 2NMTA 1AUGA 4MRIA 4UFVA 2YJTA 1A9XB 3D2PA 3RNZA 4OLLA 2VL1A 4PPZA 5J8CA 2PIZA 1Z8LA 2YNCA 3B7IA 2N3AB 3FBUA 3HUVA 4AVBA 3FX6A 5THWA 2B0AA 2ODFA 1S7NA 3KQXA 1YR0A 2VBQA 2Z10A 4FD7A 5HMNA 1S60A 4MCPA 1LCPA 1QSRA 5I0CA 2PSWA 1NBWA 2KCWA 1FBVA 4MCQA 5F13A 2PJ5A 3D7DA 1M44A 4CYNA 4TJXA 3OP0A 5AG4A 4P4EA 2FT0A 4EMEA 3BI1A 1YSJA 2PJ0A 4Q36A 3IC1A 3SJEA 3B3TA 4KSFA 2WPXA 2ZW6A 1UWYA 3SJGA 3KZWA 3BXMA 3VROA 1YVOA 3PZJA 2EO8A 4PXCA 4PXDA 5IB0A 1V6CA 2BSWA 2XPNA 4RN7A 5LRKA 3HPHE 1HDUA 4AVAA 2MP0A 5H84A 5DS0A 5HKYA 3T5MA 2CXAA 4CGNA 4XNHB 5K99A 2BUEA 5J1QA 2ZPAA 2CY2A 3FEDA 2C27A 2DEAA 1ZLHA 3B35A 4P10A 3IWWA 1MJAA 4R57A 3PB6X 4JWPA 3JVNA 1BO4A 2FL4A 2HB6A 2Z0ZA 3ZZIA 5F5XA 2C6CA 4PSXA 3O8ZA 3TTHA 3S9NA 3IJ3A 1OZPA 1PYTB 4B14A 3TOAA 4L89A 1QQ9A 4XPDC 3EO4A 5KTAA 4UWIA 3KKWA 4MI4A 3EC4A 2PVWA 5AG6A 3CT9A 2J8MA 2X0SA 2PJ7A 3ZJ0A 1YMEA 2CIJA 2Z3OA 5JM6A 2CNMA 1IIDA 4YFJA 3EXNA 4PK3A 4RS2A 1C3OB 2AFXA 3H8EA 4P4JA 1U6MA 3IWGA 4W9YA 4C8UA 5HVHA 1M4GA 2B4BA 3VH9A 3CPXA 4UEFA 3SI0A 5LYFA 1ZG9A 4MFKA 1Y9KA 2G0BA 3PB7X 2EWBA 2Q7BA 2ZEHA 5HKWA 4R76A 1ZRSA 4E5SA 2ZOGA 1Y0RA 1YLEA 2VKZG 3N5FA 2AUMA 2QVPA 5AGEA 4JXRA 1YW6A 5G21A 3TCVA 4YRHA 2OH1A 2PR8A 1UFHA 4PXBA 4YWYA 5HVGA 4C85A 3PRTA 4KVME 3TO6A 5F1YA 2PDOA 3TLBA 2IMOA 3T8WA 4CPAA 5K8PA 3I6SA 3K9TA 4CO9A 4KOXA 2HV2A 2VZZA 2JEVA 2GU2A 1B87A 4M6IA 2PJ3A 4JYWA 4C2ZA 4C9UA 4U9YA 2Y1NA 4YGOA 5F9MA 4COBA 4RR2B 3S9MA 4U9ZA 4A2ZA 4MMOA 3U1BA 4OC1A 2JBJA 3VTAA 3LACA 3CDXA 3R95A 2RFHA 5E96A 4ZY2A 5I4MA 1N71A 2C1CA 4ZGYB 5JVLA 2V8GA 2P6EA 4GS4A 3V38A 4C8CA 1I12A 1QSOA 1Z8XA 2EK8A 2Y0MA 3CXPA 2EBJA 4U5YA 4DJLA 1VBGA 2DIKA 5DWMA 2EVNA 3V8IA 1VI4A 4C86A 3K9UA 2VQYA 2XEGA 1S7KA 2AE6A 3PB4X 1NMTA 2CNTA 1Q2CA 2D4OA 3MRUA 3W91A 3VRRA 2PR1A 4KSIA 3KR5A 2B5GB 2OZGA 2Q51A 2RC4A 4E0AA 3VWEA 4C8PA 1L0CA 6CPAA 4I49A 4ZY0A 1HDQA 4X2TA 2P6FA 3BUMB 2CBLA 3NH8A 4KOWA 4XNHC 2VEZA 2HC9A 4C7HA 4IIXA 4MXUA 5C88A 3HPGG 2HROA 1F57A 4JVOA 4B5PA 3D66A 4ZI6A 3PFVA 1Z2LA 3NH4A 3QAHA 2PCUA 4R87A 2J9AA 3TLAA 4C8TA 3ISXA 2PQ8A 4NFRA 4X8IA 5BWAB 1LAMA 1ZYMA 1JDBC 5G1ZA 3PBBA 3V7ZA 5JQ4A 3R9GA 4AB7A 1YK3A 3B8GA 2XEFA 3IU2A 4ONUA 3H4QA 1ON0A 1DIKA 5A27A 2EZCA 1Y9WA 5F49A 5F46A 5A28A 4R8FA 1XF8A 1LAPA 5AXIA 4C9AA 4G1PA 1J4JA 2NSMA 3R9FA 1FNOA 4OIDA 4H6ZA 1V0CA 5AG7A 2YGWA 2ZXVA 2ZENA 3QB8A 4XPKA 2PJ1A 5LRJA 2JBKA 2BCOA 4MFLA 4F9UA 2REFA 2I79A 4A39A 2E28A 2PJCA 4GPLB 3KL9A 3IU1A 4UIBA 5LYLA 4UEZA 3WR7A 3OB2B 1M4DA 4BPWB 4F8ZA 1IYKA 2PJ6A 5AG5A 2A4NA 4OC5A 2EZAA 1CJWA 1KUXA 3W6XA 4II9A 2ARHA 2D0PA 4CDKA 3D4UA 1RTQA 2AFOA 1S7LA 4KUBA 1OBRA 2GFQA 4MBUA 1WJTA 2ZOFA 3IO1A 1XIXA 4BMHA 3TFYA 3OB1B 3FIXA 4HNXB 3I1UA 5HXDA 1Z4RA 1XBUA 4FAIA 4E8OA 2HI6A 4H2KA 4P4DA 1F2PA 3D67A 4HNYB 2HUZA 2NYQA 4UCNA 1KEEB 4C2XA 2VXKA 3D8PA 1CE8B 4KLWA 5D29A 3GUXA 4UCPA 2D4PA 4CRYB 5CBMA 4C9EA 2QJ8A 4A38A 4COGA 2ZEFA 1IICA 2X7BA 3PFEA 1ELMP 4CGMA 1QSTA 3VRPA
chains in the Genus database with same CATH topology
3NA6A 3K2KA 3SI2A 4C9VA 4UF4A 3RAMA 2ZELA 3JRUA 1XF1A 1ARLA 2F7VA 2AFMA 4MCSA 2QYVA 3QNVA 4MHNA 4UEEA 2PJ4A 3IIBA 2POKA 3SI1A 3RBUA 2C6GA 1ELLP 1CPSA 1F2OA 4BD9A 2C6PA 4YN3A 2PIYA 3KQZA 1IGBA 4Z65A 3FMCA 3PFOA 3CPAA 4YU9A 1YLOA 2AFSA 3VATA 4UIAA 3FF3A 2IJZA 3MN8A 3IFEA 1WVMA 3I74A 2WZNA 4OC0A 4DUKA 2ZEEA 2ZEPA 1KWMA 2CTCA 1XFOA 4A37A 4IHMA 4ZY1A 1NSAA 1EE3P 4EWTA 1LANA 4CDJA 1Z5RA 4P45A 1HEEA 3KHZA 5HVFA 4NGPA 3DGVA 4P6YA 2ZEGA 3HLPA 3FVLA 2BO9A 1XJOA 2XEIA 4C8AA 2GLJA 5F09A 4C84A 4X3RA 4NGSA 4R6TA 3L2NA 5LYIA 4NJRA 1BAVA 2ANPA 2C5QA 1CPXA 2V8HA 1H8LA 4Q7AA 4PXEA 3PBEA 2XEJA 4FBEA 3PB9X 1YW4A 3NH5A 2EK9A 4PQAA 4GM5A 2PJ9A 1R3NA 4TJVA 4MHPA 3KR4A 5CPAA 1QMUA 3H8GA 1M4LA 4JZ0A 5JGFA 2GLFA 4R7MA 3KASA 2Q43A 3LWUA 4DYOA 3D7FA 3BI0A 2OR4A 4ONWA 2PJBA 2PVVA 4F9VA 2IQ6A 1TKJA 2AFZA 4IK2A 5JH9A 1PCAA 1CP7A 3KHXA 4B6ZA 7CPAA 4O23A 2PJ2A 3GB0A 4EFDA 2OOTA 3BHXA 5IR2A 5ELYA 1ARMA 3KI9A 1DE4C 1ZG7A 1JQGA 5K8OA 2I3CA 4WJBA 4MHYA 1XMBA 1DTDA 4OMEA 4TNUA 2CF4A 3WT4A 4RUHA 2F8HA 3H8FA 2BOAA 1TKHA 4ZYQA 1AMPA 1FT7A 1VIXA 1Y9ZA 3SJFA 1LOKA 3D68A 1CG2A 2AFWA 1BPNA 2WYRA 3GLJA 4NJQA 3D7HA 4P44A 1TKFA 2ABZA 5IB9A 2PJ8A 4C8FA 4P4BA 3B3SA 4KNGE 4P4FA 4A94A 1TF8A 3ISZA 3IEHA 2CTBA 3B3WA 4OP4A 2V77A 2V8VA 4NGRA 2O53A 1TF9A 1CX8A 3TX8A 3B2YA 5D8NA 3RZAA 5LYDA 4FWUA 1VHOA 4MHZA 1XRYA 4OIWA 1Y7EA 3WABA 2PJAA 4ZX8A 4ZX9A 4NGQA 4P4IA 3LMSA 4IAVA 3DLJA 3PEIA 4NGTA 4C9RA 1R43A 2JEWA 4NGNA 4OC4A 2O4HA 1ZG8A 2PRQA 3SJXA 1IY7A 1CBXA 4NGMA 5K8NA 3VARA 2ZEOA 2V8DA 4K3NA 1GYTA 3PB8X 3S9LA 1Y0YA 4C99A 3FEEA 4OC3A 2FVGA 2ZEMA 5LRGA 3D7GA 2GP4A 2ZEDA 1TXRA 1LFWA 1CP6A 2RB7A 3NFZA 3B3VA 3FH4A 3FECA 4OC2A 3WC6A 3B3CA 2Q4ZA 3FJUA 2GREA 3EIFA 3TC8A 3WC7A 4MCRA 4LQGA 3WC5A 2G9DA 4WWVA 1ZLIA 4AXVA 4OKOA 4TJXA 3ICUA 1Q7LA 8CPAA 1VHEA 4TWEA 2PE3A 1BPMA 1VGYA 4FUUA 1AYEA 3KGQA 4MRIA 1BLLE 2AFUA 4PPZA 2VL1A 2PIZA 1Z8LA 3B7IA 3HUVA 3FX6A 5THWA 3KQXA 4MCPA 1LCPA 4MCQA 2PJ5A 3D7DA 4P4EA 4EMEA 3BI1A 1YSJA 2PJ0A 3IC1A 3SJEA 3B3TA 5K8MA 3KZWA 1UWYA 3SJGA 4PXCA 3BXMA 1V6CA 4PXDA 5LRKA 1HDUA 5DS0A 5J1QA 3FEDA 2DEAA 3B35A 1ZLHA 4P10A 3IWWA 3PB6X 2HB6A 2C6CA 3S9NA 3IJ3A 1PYTB 1QQ9A 2PVWA 3CT9A 2PJ7A 1YMEA 2CIJA 5JM6A 2AFXA 3H8EA 4P4JA 4W9YA 4C8UA 5HVHA 3VH9A 3CPXA 4UEFA 3SI0A 5LYFA 1ZG9A 3PB7X 2EWBA 2ZEHA 4R76A 2ZOGA 1Y0RA 3N5FA 2QVPA 1YW6A 4PXBA 4YWYA 5HVGA 4C85A 3PRTA 2IMOA 3T8WA 4CPAA 5K8PA 3I6SA 3K9TA 2GU2A 2PJ3A 4JYWA 4C9UA 3S9MA 4MMOA 4OC1A 2JBJA 3VTAA 3CDXA 2RFHA 4ZY2A 5I4MA 2C1CA 2V8GA 3V38A 4C8CA 2EK8A 4DJLA 4C86A 2XEGA 3PB4X 3MRUA 4KSIA 3KR5A 2Q51A 4C8PA 6CPAA 4ZY0A 1HDQA 4X2TA 3NH8A 2HC9A 4MXUA 1F57A 3D66A 4ZI6A 1Z2LA 3NH4A 2PCUA 2J9AA 4C8TA 3ISXA 4NFRA 4X8IA 1LAMA 3V7ZA 3PBBA 2XEFA 4R8FA 1LAPA 4C9AA 4G1PA 2NSMA 1FNOA 4OIDA 2ZENA 2PJ1A 5LRJA 2JBKA 2BCOA 4F9UA 4A39A 2PJCA 3KL9A 4UIBA 5LYLA 4UEZA 4F8ZA 2PJ6A 4OC5A 4CDKA 3D4UA 1RTQA 2AFOA 1OBRA 2ZOFA 3IO1A 3I1UA 5HXDA 1XBUA 4FAIA 4H2KA 4P4DA 1F2PA 3D67A 2NYQA 5D29A 3GUXA 5CBMA 4C9EA 2QJ8A 4A38A 2ZEFA 3PFEA 1ELMP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NA6 A;  3K2K A;  3SI2 A;  4C9V A;  4UF4 A;  3RAM A;  2ZEL A;  3JRU A;  1XF1 A;  1ARL A;  2F7V A;  2AFM A;  4MCS A;  2QYV A;  3QNV A;  4MHN A;  4UEE A;  2PJ4 A;  3IIB A;  2POK A;  3SI1 A;  3RBU A;  2C6G A;  1ELL P;  1CPS A;  1F2O A;  4BD9 A;  2C6P A;  4YN3 A;  2PIY A;  3KQZ A;  1IGB A;  4Z65 A;  3FMC A;  3PFO A;  3CPA A;  4YU9 A;  1YLO A;  2AFS A;  3VAT A;  4UIA A;  3FF3 A;  2IJZ A;  3MN8 A;  3IFE A;  1WVM A;  3I74 A;  2WZN A;  4OC0 A;  4DUK A;  2ZEE A;  2ZEP A;  1KWM A;  2CTC A;  1XFO A;  4A37 A;  4IHM A;  4ZY1 A;  1NSA A;  1EE3 P;  4EWT A;  1LAN A;  4CDJ A;  1Z5R A;  4P45 A;  1HEE A;  3KHZ A;  5HVF A;  4NGP A;  3DGV A;  4P6Y A;  2ZEG A;  3HLP A;  3FVL A;  2BO9 A;  1XJO A;  2XEI A;  4C8A A;  2GLJ A;  5F09 A;  4C84 A;  4X3R A;  4NGS A;  4R6T A;  3L2N A;  5LYI A;  4NJR A;  1BAV A;  2ANP A;  1CPX A;  2V8H A;  1H8L A;  4Q7A A;  4PXE A;  3PBE A;  2XEJ A;  4FBE A;  3PB9 X;  1YW4 A;  3NH5 A;  2EK9 A;  4PQA A;  4GM5 A;  2PJ9 A;  1R3N A;  4TJV A;  4MHP A;  3KR4 A;  5CPA A;  1QMU A;  3H8G A;  1M4L A;  4JZ0 A;  5JGF A;  2GLF A;  4R7M A;  3KAS A;  2Q43 A;  3LWU A;  4DYO A;  3D7F A;  3BI0 A;  2OR4 A;  4ONW A;  2PJB A;  2PVV A;  4F9V A;  2IQ6 A;  1TKJ A;  2AFZ A;  4IK2 A;  5JH9 A;  1PCA A;  1CP7 A;  3KHX A;  4B6Z A;  7CPA A;  4O23 A;  2PJ2 A;  3GB0 A;  4EFD A;  2OOT A;  3BHX A;  5ELY A;  1ARM A;  3KI9 A;  1DE4 C;  1ZG7 A;  1JQG A;  5K8O A;  2I3C A;  4WJB A;  4MHY A;  1XMB A;  1DTD A;  4OME A;  4TNU A;  2CF4 A;  3WT4 A;  4RUH A;  2F8H A;  3H8F A;  2BOA A;  1TKH A;  4ZYQ A;  1AMP A;  1FT7 A;  1VIX A;  1Y9Z A;  3SJF A;  1LOK A;  3D68 A;  1CG2 A;  2AFW A;  1BPN A;  2WYR A;  3GLJ A;  4NJQ A;  3D7H A;  4P44 A;  1TKF A;  2ABZ A;  5IB9 A;  2PJ8 A;  4C8F A;  4P4B A;  3B3S A;  4KNG E;  4P4F A;  4A94 A;  1TF8 A;  3ISZ A;  3IEH A;  2CTB A;  3B3W A;  4OP4 A;  2V77 A;  2V8V A;  4NGR A;  2O53 A;  1TF9 A;  1CX8 A;  3TX8 A;  3B2Y A;  5D8N A;  3RZA A;  5LYD A;  4FWU A;  1VHO A;  4MHZ A;  1XRY A;  4OIW A;  1Y7E A;  3WAB A;  2PJA A;  4ZX8 A;  4ZX9 A;  4NGQ A;  4P4I A;  3LMS A;  4IAV A;  3DLJ A;  3PEI A;  4NGT A;  4C9R A;  1R43 A;  2JEW A;  4NGN A;  4OC4 A;  2O4H A;  1ZG8 A;  2PRQ A;  3SJX A;  1IY7 A;  1CBX A;  4NGM A;  5K8N A;  3VAR A;  2ZEO A;  2V8D A;  4K3N A;  1GYT A;  3PB8 X;  3S9L A;  1Y0Y A;  4C99 A;  3FEE A;  4OC3 A;  2FVG A;  2ZEM A;  5LRG A;  3D7G A;  2ZED A;  1TXR A;  1LFW A;  1CP6 A;  2RB7 A;  3NFZ A;  3B3V A;  3FH4 A;  3FEC A;  4OC2 A;  3WC6 A;  3B3C A;  2Q4Z A;  3FJU A;  2GRE A;  3EIF A;  3TC8 A;  3WC7 A;  4MCR A;  4LQG A;  3WC5 A;  2G9D A;  4WWV A;  1ZLI A;  4AXV A;  4OKO A;  4TJX A;  3ICU A;  1Q7L A;  8CPA A;  1VHE A;  4TWE A;  2PE3 A;  1BPM A;  1VGY A;  4FUU A;  1AYE A;  3KGQ A;  4MRI A;  1BLL E;  2AFU A;  4PPZ A;  2VL1 A;  2PIZ A;  1Z8L A;  3B7I A;  3HUV A;  3FX6 A;  5THW A;  3KQX A;  4MCP A;  1LCP A;  4MCQ A;  2PJ5 A;  3D7D A;  4P4E A;  4EME A;  3BI1 A;  1YSJ A;  2PJ0 A;  3IC1 A;  3SJE A;  3B3T A;  5K8M A;  3KZW A;  1UWY A;  3SJG A;  4PXC A;  3BXM A;  1V6C A;  4PXD A;  5LRK A;  1HDU A;  5DS0 A;  5J1Q A;  3FED A;  2DEA A;  3B35 A;  1ZLH A;  4P10 A;  3IWW A;  3PB6 X;  2HB6 A;  2C6C A;  3S9N A;  3IJ3 A;  1PYT B;  1QQ9 A;  2PVW A;  3CT9 A;  2PJ7 A;  1YME A;  2CIJ A;  5JM6 A;  2AFX A;  3H8E A;  4P4J A;  4W9Y A;  4C8U A;  5HVH A;  3VH9 A;  3CPX A;  4UEF A;  3SI0 A;  5LYF A;  1ZG9 A;  3PB7 X;  2EWB A;  2ZEH A;  4R76 A;  2ZOG A;  1Y0R A;  3N5F A;  2QVP A;  1YW6 A;  4PXB A;  4YWY A;  5HVG A;  4C85 A;  3PRT A;  2IMO A;  3T8W A;  4CPA A;  5K8P A;  3I6S A;  3K9T A;  2GU2 A;  2PJ3 A;  4JYW A;  4C9U A;  3S9M A;  4MMO A;  4OC1 A;  2JBJ A;  3VTA A;  3CDX A;  2RFH A;  4ZY2 A;  5I4M A;  2C1C A;  2V8G A;  3V38 A;  4C8C A;  2EK8 A;  4DJL A;  4C86 A;  2XEG A;  3PB4 X;  3MRU A;  4KSI A;  3KR5 A;  2Q51 A;  4C8P A;  6CPA A;  4ZY0 A;  1HDQ A;  4X2T A;  3NH8 A;  2HC9 A;  4MXU A;  1F57 A;  3D66 A;  4ZI6 A;  1Z2L A;  3NH4 A;  2PCU A;  2J9A A;  4C8T A;  3ISX A;  4NFR A;  4X8I A;  1LAM A;  3V7Z A;  3PBB A;  2XEF A;  4R8F A;  1LAP A;  4C9A A;  4G1P A;  2NSM A;  1FNO A;  4OID A;  2ZEN A;  2PJ1 A;  5LRJ A;  2JBK A;  2BCO A;  4F9U A;  4A39 A;  2PJC A;  3KL9 A;  4UIB A;  5LYL A;  4UEZ A;  4F8Z A;  2PJ6 A;  4OC5 A;  4CDK A;  3D4U A;  1RTQ A;  2AFO A;  1OBR A;  2ZOF A;  3IO1 A;  3I1U A;  5HXD A;  1XBU A;  4FAI A;  4H2K A;  4P4D A;  1F2P A;  3D67 A;  2NYQ A;  5D29 A;  3GUX A;  5CBM A;  4C9E A;  2QJ8 A;  4A38 A;  2ZEF A;  3PFE A;  1ELM P; 
#chains in the Genus database with same CATH topology
 3NA6 A;  1X12 A;  3K2K A;  4F6A A;  3SI2 A;  4C9V A;  3E0K A;  4UF4 A;  2Z3P A;  2ZEL A;  3RAM A;  1C30 B;  2OZU A;  2B3V A;  3JRU A;  1ARL A;  4M85 A;  4A4B A;  1XF1 A;  2F7V A;  3NFQ A;  2AFM A;  4MCS A;  2FE7 A;  2QYV A;  3F0A A;  3QNV A;  3EY5 A;  3BJ7 A;  4MHN A;  4UEE A;  4DNC A;  2PJ4 A;  4AG7 A;  3IIB A;  4KLV A;  2POK A;  2B4D A;  4PV6 A;  3T0T A;  2UV8 G;  3SI1 A;  4AVC A;  5FVJ A;  1Z9U A;  2EZB A;  3RBU A;  1QSN A;  5F48 A;  2C6G A;  1ELL P;  2IL4 A;  1CPS A;  1F2O A;  4KOR A;  2C6P A;  4NXY A;  4BD9 A;  2PIY A;  3KQZ A;  1XOV A;  4YN3 A;  2DXQ A;  4UFW A;  3R1K A;  1IGB A;  3C26 A;  4BPX B;  4Z65 A;  4A31 A;  3FMC A;  2Z3M A;  3PFO A;  1A2Z A;  4UFX A;  4B11 A;  1Z8W A;  3CPA A;  1PUA A;  3NE8 A;  4YU9 A;  4UCM A;  1YLO A;  2AFS A;  3VAT A;  4UIA A;  3FF3 A;  5BY0 A;  2IJZ A;  4UA3 A;  1M1D A;  3MN8 A;  3IFE A;  2B4J C;  2FIA A;  4PSW A;  1WVM A;  3OWC A;  1YQE A;  2OU2 A;  2WZN A;  4OC0 A;  4JD6 A;  4KUA A;  4B13 A;  4A4C A;  4DUK A;  2OB0 A;  3I74 A;  3G3S A;  2ZEE A;  3D3S A;  3PP9 A;  2ZEP A;  4A95 A;  1KWM A;  3W6S A;  2CTC A;  1R61 A;  1KUY A;  1RXT A;  4KVX A;  1XFO A;  4A37 A;  4IHM A;  3BUW B;  4MJ8 A;  2Z3K A;  4ZY1 A;  1NSA A;  1EE3 P;  4KVO E;  1LAN A;  1GHE A;  4EWT A;  1J3L A;  4CDJ A;  1Z5R A;  4P45 A;  1HEE A;  3KHZ A;  5HVF A;  4NGP A;  3DGV A;  1Y7R A;  3PGP A;  4P6Y A;  1IB1 E;  4CAE A;  2ZEG A;  3HLP A;  3FVL A;  2BO9 A;  1XJO A;  2XEI A;  4C8A A;  2GLJ A;  4K30 A;  1PU9 A;  4JLY A;  5F09 A;  3OAK A;  1GGO A;  3DR6 A;  1M4I A;  4CZ1 A;  1YVH A;  4C84 A;  5EBV A;  4X3R A;  3DR8 A;  4NGS A;  4R6T A;  4HKF A;  4Q38 A;  3NE7 A;  3L2N A;  2K5T A;  4CYO A;  5LYI A;  4NJR A;  2P6G A;  1BAV A;  2ANP A;  2C5Q A;  1CPX A;  3CZX A;  2V8H A;  1H8L A;  4Q7A A;  4QUS A;  4H6U A;  1X10 A;  2XPP A;  3F5B A;  4MFP A;  2ZW5 A;  1K4J A;  4PXE A;  3PBE A;  2XEJ A;  4FD4 A;  3PB9 X;  4M3S A;  4BIN A;  4B5O A;  4FBE A;  1YW4 A;  4INJ A;  3NH5 A;  3EZE A;  3TLZ A;  4LX9 A;  2EK9 A;  4PQA A;  4GM5 A;  1SQH A;  1I1D A;  2PJ9 A;  1R3N A;  2I00 A;  3EZB A;  1S3Z A;  2AJ6 A;  4ORF A;  4MHP A;  2J8R A;  4C7I A;  4MJX A;  1Z4E A;  4TJV A;  2R1I A;  3KR4 A;  5CPA A;  1QMU A;  3H8G A;  1M4L A;  4OAE A;  4UBR A;  4JZ0 A;  4OAD A;  5JGF A;  2GLF A;  3VRN A;  4IF5 A;  2PCN A;  4R7M A;  3KAS A;  3DDD A;  1VHS A;  2Q43 A;  3R96 A;  3LWU A;  4E94 A;  4DYO A;  3D7F A;  4NEX A;  1R57 A;  3GY9 A;  3BI0 A;  4R3K A;  2Q7S A;  2OR4 A;  2YNC C;  1KC7 A;  3G8W A;  4ONW A;  2PJB A;  2PVV A;  2R98 A;  4F9V A;  2BEI A;  2IQ6 A;  2QIR A;  4CGL A;  2Y1M A;  3T9Y A;  1VKC A;  1TKJ A;  2ZW7 A;  2XPO A;  3BUN B;  2AFZ A;  3SXO A;  5JPH A;  2Q04 A;  1IYL A;  2FS5 A;  1JDE A;  4IK2 A;  4M8D A;  3TT2 A;  1P4N A;  1XEB A;  2GIV A;  5JH9 A;  1LRZ A;  1BXR B;  4QC6 A;  1PCA A;  1CP7 A;  3KHX A;  4B6Z A;  2ATR A;  2B3U A;  3BUX B;  7CPA A;  3DSB A;  1YX0 A;  2PJ2 A;  1XE4 A;  4O23 A;  3GB0 A;  4EFD A;  2OOT A;  3I9S A;  3BHX A;  4Y49 C;  2Z3N A;  4CYP A;  5IR2 A;  5J8F A;  4H89 A;  4MY3 A;  4B5P B;  5ELY A;  2GAN A;  1KUV A;  4CAF A;  1ARM A;  5EC4 A;  3KI9 A;  3P2F A;  1DE4 C;  1IOI A;  2VZY A;  2Z11 A;  4CS0 B;  3IWE A;  3SR3 A;  1WK4 A;  1ZG7 A;  1JQG A;  3GJZ A;  3TLC A;  4MFQ A;  5K8O A;  2YND A;  4FD6 A;  3TLG B;  3F9K C;  2I3C A;  4WJB A;  4MHY A;  2JLM A;  2G3A A;  3LD2 A;  4J3G A;  1XMB A;  1DTD A;  2WSA A;  4C2Y A;  2R82 A;  2BL1 A;  4OME A;  4J0N A;  1BOB A;  4TNU A;  2J8N A;  2Q4V A;  1NSL A;  2WUU A;  3S6G A;  5JYB A;  4E2A A;  1QSM A;  4M6G A;  4CGP A;  2P0W A;  4ZBG A;  4QBJ A;  1B6B A;  2CF4 A;  2OLS A;  3FB3 A;  3GIU A;  2FM4 A;  3WT4 A;  3FNC A;  3GYA A;  1MJB A;  2D0O A;  1YRE A;  4RUH A;  1Z9E A;  4QVT A;  5GCN A;  1MK4 A;  2F8H A;  2QML A;  2ZW4 A;  2BOA A;  1TKH A;  3H8F A;  3MGD A;  4ZYQ A;  1AMP A;  4A33 A;  1FT7 A;  4PK2 A;  1VIX A;  4UWJ A;  4NSQ A;  1EZA A;  1Y9Z A;  2B58 A;  3SJF A;  3F8K A;  1T36 B;  1LOK A;  4KZT A;  3VRQ A;  3T90 A;  3D68 A;  4KS9 A;  4HNW B;  1CG2 A;  2AFW A;  1BPN A;  1JWQ A;  4BPU B;  2DPS A;  1Q2Y A;  2WYR A;  3GLJ A;  4NJQ A;  4B10 A;  5DWN A;  3D7H A;  4P44 A;  1TKF A;  2ABZ A;  4GXH A;  5IB9 A;  1XMT A;  3BLN A;  2PJ8 A;  4C8F A;  5FD8 A;  4P4B A;  4B12 A;  3B3S A;  4F0X A;  4KNG E;  4P4F A;  1B47 A;  3QAY A;  4A94 A;  5CNP A;  1TF8 A;  3ISZ A;  5ISV A;  4X5K A;  4R3L A;  3IEH A;  2CTB A;  3B3W A;  4OP4 A;  3NOJ A;  4Y49 B;  1FY7 A;  2FCK A;  2V77 A;  2V8V A;  5F47 A;  2QEC A;  4L8A A;  2AUN A;  4CAX A;  2G3T A;  3LOD A;  4NGR A;  2O53 A;  5EMI A;  5HH1 A;  1TF9 A;  1TIQ A;  3PLF B;  1CX8 A;  2O28 A;  3DNS A;  1VBH A;  3TX8 A;  2PC1 A;  3B2Y A;  4M6H A;  5D8N A;  3RZA A;  5LYD A;  1M6V B;  2R7H A;  3FYN A;  1VHO A;  2VI7 A;  4FWU A;  4XPL A;  4MHZ A;  1Z8T A;  2B4D B;  4A32 A;  1XRY A;  4NF1 A;  3RYO A;  4EVY A;  4OIW A;  1Y7E A;  4KOS A;  3WAB A;  2B5G A;  2PJA A;  4KOU A;  2CNS A;  1I21 A;  4ZX9 A;  4ZX8 A;  4NGQ A;  3CXQ A;  4LUA A;  4P4I A;  3TOB A;  2FIW A;  3LMS A;  3P2H A;  4IAV A;  4KOV A;  3K4I A;  3DLJ A;  3PEI A;  4IUS A;  3A9L A;  3H5Z A;  4NGT A;  1NXJ A;  4KOY A;  3ZNI A;  4C9R A;  2FXF A;  4HPS A;  1R43 A;  2R8V A;  2JEW A;  2DPT A;  3PT1 A;  1KBL A;  4NGN A;  4OC4 A;  2O4H A;  4FD5 A;  5KTC A;  2XPL A;  3R9E A;  1ZG8 A;  2FSR A;  2Z3L A;  4AG9 A;  5KTD A;  2PRQ A;  1IOF A;  4RI1 A;  3SXN A;  3SJX A;  1IY7 A;  1CBX A;  3S6H A;  4BTF A;  3SHP A;  4NGM A;  3D2M A;  5K8N A;  1ZO0 A;  1CS0 B;  2GE3 A;  2Q4Y A;  1P0H A;  3U88 C;  3VAR A;  5IV0 A;  3T07 A;  2ZEO A;  1EO0 A;  2V8D A;  2YNE A;  4K3N A;  1GYT A;  3PB8 X;  3S9L A;  1Y0Y A;  4C99 A;  4MFJ A;  4NCZ A;  1NE9 A;  3FEE A;  1S5K A;  3EFA A;  4OC3 A;  2FVG A;  2ZEM A;  4KOT A;  5LRG A;  5K8M A;  1CM0 A;  3D7G A;  2GP4 A;  4CYQ A;  2ZED A;  5G22 A;  3RO0 A;  3TO7 A;  3TLE A;  1TXR A;  1LFW A;  1CP6 A;  3JTK A;  4KSA A;  2RB7 A;  4BBH A;  3NFZ A;  3B3V A;  5J3X A;  4XPD B;  5G20 A;  3IGR A;  4C68 A;  1YVK A;  3FRM A;  3EZA A;  5H86 A;  1S7F A;  3FH4 A;  3FEC A;  4H1H A;  4OC2 A;  3HMJ G;  3T05 A;  4QB9 A;  1KZF A;  2JDC A;  2PRB A;  3WC6 A;  4IIY A;  2REE A;  4EYS A;  5C82 A;  1MJ9 A;  1RO5 A;  3B3C A;  1IU8 A;  2Q4Z A;  5IX3 A;  3FJU A;  3KRV A;  3BUO B;  2GRE A;  3EIF A;  3TC8 A;  4F0Y A;  1YGH A;  3WC7 A;  4MHD A;  4MCR A;  2HWG A;  4LQG A;  3TE4 A;  4MFZ A;  3WC5 A;  3CXS A;  3TLG A;  2G9D A;  4WWV A;  3TO9 A;  1Q5X A;  3C8O A;  4JJX A;  3BJ8 A;  4LQ6 A;  3S6F A;  4CRZ B;  4A30 A;  3TYX A;  2OZH A;  4CAW A;  3N7Z A;  4CAV A;  1ZLI A;  1WWZ A;  3FXT A;  3JUW A;  4OKO A;  1Q7L A;  3UY5 A;  3S6K A;  4AXV A;  3ICU A;  8CPA A;  1VHE A;  2Q44 A;  2EUI A;  1Q2D A;  4TWE A;  4MI1 A;  2WPW A;  1EZB A;  2JDD A;  3VGO A;  2PE3 A;  2DF5 A;  2HQY A;  4MY0 A;  1BPM A;  4JXQ A;  2H5M A;  3GKR A;  2YJV A;  3G23 A;  1ZL0 A;  4R9M A;  3VWD A;  1VGY A;  3TLY A;  4CGO A;  2Q0Y A;  4FUU A;  5HKZ A;  1AYE A;  2DLA A;  3KGQ A;  2F5I A;  3I3G A;  1BLL E;  2AFU A;  2NMT A;  1AUG A;  4MRI A;  4UFV A;  2YJT A;  1A9X B;  3D2P A;  3RNZ A;  4OLL A;  2VL1 A;  4PPZ A;  5J8C A;  2PIZ A;  1Z8L A;  2YNC A;  3B7I A;  2N3A B;  3FBU A;  3HUV A;  4AVB A;  3FX6 A;  5THW A;  2B0A A;  2ODF A;  1S7N A;  3KQX A;  1YR0 A;  2VBQ A;  2Z10 A;  4FD7 A;  5HMN A;  1S60 A;  4MCP A;  1LCP A;  1QSR A;  5I0C A;  2PSW A;  1NBW A;  2KCW A;  1FBV A;  4MCQ A;  5F13 A;  2PJ5 A;  3D7D A;  1M44 A;  4CYN A;  4TJX A;  3OP0 A;  5AG4 A;  4P4E A;  2FT0 A;  4EME A;  3BI1 A;  1YSJ A;  2PJ0 A;  4Q36 A;  3IC1 A;  3SJE A;  3B3T A;  4KSF A;  2WPX A;  2ZW6 A;  1UWY A;  3SJG A;  3KZW A;  3BXM A;  3VRO A;  1YVO A;  3PZJ A;  2EO8 A;  4PXC A;  4PXD A;  5IB0 A;  1V6C A;  2BSW A;  2XPN A;  4RN7 A;  5LRK A;  3HPH E;  1HDU A;  4AVA A;  2MP0 A;  5H84 A;  5DS0 A;  5HKY A;  3T5M A;  2CXA A;  4CGN A;  4XNH B;  5K99 A;  2BUE A;  5J1Q A;  2ZPA A;  2CY2 A;  3FED A;  2C27 A;  2DEA A;  1ZLH A;  3B35 A;  4P10 A;  3IWW A;  1MJA A;  4R57 A;  3PB6 X;  4JWP A;  3JVN A;  1BO4 A;  2FL4 A;  2HB6 A;  2Z0Z A;  3ZZI A;  5F5X A;  2C6C A;  4PSX A;  3O8Z A;  3TTH A;  3S9N A;  3IJ3 A;  1OZP A;  1PYT B;  4B14 A;  3TOA A;  4L89 A;  1QQ9 A;  4XPD C;  3EO4 A;  5KTA A;  4UWI A;  3KKW A;  4MI4 A;  3EC4 A;  2PVW A;  5AG6 A;  3CT9 A;  2J8M A;  2X0S A;  2PJ7 A;  3ZJ0 A;  1YME A;  2CIJ A;  2Z3O A;  5JM6 A;  2CNM A;  1IID A;  4YFJ A;  3EXN A;  4PK3 A;  4RS2 A;  1C3O B;  2AFX A;  3H8E A;  4P4J A;  1U6M A;  3IWG A;  4W9Y A;  4C8U A;  5HVH A;  1M4G A;  2B4B A;  3VH9 A;  3CPX A;  4UEF A;  3SI0 A;  5LYF A;  1ZG9 A;  4MFK A;  1Y9K A;  2G0B A;  3PB7 X;  2EWB A;  2Q7B A;  2ZEH A;  5HKW A;  4R76 A;  1ZRS A;  4E5S A;  2ZOG A;  1Y0R A;  1YLE A;  2VKZ G;  3N5F A;  2AUM A;  2QVP A;  5AGE A;  4JXR A;  1YW6 A;  5G21 A;  3TCV A;  4YRH A;  2OH1 A;  2PR8 A;  1UFH A;  4PXB A;  4YWY A;  5HVG A;  4C85 A;  3PRT A;  4KVM E;  3TO6 A;  5F1Y A;  2PDO A;  3TLB A;  2IMO A;  3T8W A;  4CPA A;  5K8P A;  3I6S A;  3K9T A;  4CO9 A;  4KOX A;  2HV2 A;  2VZZ A;  2JEV A;  2GU2 A;  1B87 A;  4M6I A;  2PJ3 A;  4JYW A;  4C2Z A;  4C9U A;  4U9Y A;  2Y1N A;  4YGO A;  5F9M A;  4COB A;  4RR2 B;  3S9M A;  4U9Z A;  4A2Z A;  4MMO A;  3U1B A;  4OC1 A;  2JBJ A;  3VTA A;  3LAC A;  3CDX A;  3R95 A;  2RFH A;  5E96 A;  4ZY2 A;  5I4M A;  1N71 A;  2C1C A;  4ZGY B;  5JVL A;  2V8G A;  2P6E A;  4GS4 A;  3V38 A;  4C8C A;  1I12 A;  1QSO A;  1Z8X A;  2EK8 A;  2Y0M A;  3CXP A;  2EBJ A;  4U5Y A;  4DJL A;  1VBG A;  2DIK A;  5DWM A;  2EVN A;  3V8I A;  1VI4 A;  4C86 A;  3K9U A;  2VQY A;  2XEG A;  1S7K A;  2AE6 A;  3PB4 X;  1NMT A;  2CNT A;  1Q2C A;  2D4O A;  3MRU A;  3W91 A;  3VRR A;  2PR1 A;  4KSI A;  3KR5 A;  2B5G B;  2OZG A;  2Q51 A;  2RC4 A;  4E0A A;  3VWE A;  4C8P A;  1L0C A;  6CPA A;  4I49 A;  4ZY0 A;  1HDQ A;  4X2T A;  2P6F A;  3BUM B;  2CBL A;  3NH8 A;  4KOW A;  4XNH C;  2VEZ A;  2HC9 A;  4C7H A;  4IIX A;  4MXU A;  5C88 A;  3HPG G;  2HRO A;  1F57 A;  4JVO A;  4B5P A;  3D66 A;  4ZI6 A;  3PFV A;  1Z2L A;  3NH4 A;  3QAH A;  2PCU A;  4R87 A;  2J9A A;  3TLA A;  4C8T A;  3ISX A;  2PQ8 A;  4NFR A;  4X8I A;  5BWA B;  1LAM A;  1ZYM A;  1JDB C;  5G1Z A;  3PBB A;  3V7Z A;  5JQ4 A;  3R9G A;  4AB7 A;  1YK3 A;  3B8G A;  2XEF A;  3IU2 A;  4ONU A;  3H4Q A;  1ON0 A;  1DIK A;  5A27 A;  2EZC A;  1Y9W A;  5F49 A;  5F46 A;  5A28 A;  4R8F A;  1XF8 A;  1LAP A;  5AXI A;  4C9A A;  4G1P A;  1J4J A;  2NSM A;  3R9F A;  1FNO A;  4OID A;  4H6Z A;  1V0C A;  5AG7 A;  2YGW A;  2ZXV A;  2ZEN A;  3QB8 A;  4XPK A;  2PJ1 A;  5LRJ A;  2JBK A;  2BCO A;  4MFL A;  4F9U A;  2REF A;  2I79 A;  4A39 A;  2E28 A;  2PJC A;  4GPL B;  3KL9 A;  3IU1 A;  4UIB A;  5LYL A;  4UEZ A;  3WR7 A;  3OB2 B;  1M4D A;  4BPW B;  4F8Z A;  1IYK A;  2PJ6 A;  5AG5 A;  2A4N A;  4OC5 A;  2EZA A;  1CJW A;  1KUX A;  3W6X A;  4II9 A;  2ARH A;  2D0P A;  4CDK A;  3D4U A;  1RTQ A;  2AFO A;  1S7L A;  4KUB A;  1OBR A;  2GFQ A;  4MBU A;  1WJT A;  2ZOF A;  3IO1 A;  1XIX A;  4BMH A;  3TFY A;  3OB1 B;  3FIX A;  4HNX B;  3I1U A;  5HXD A;  1Z4R A;  1XBU A;  4FAI A;  4E8O A;  2HI6 A;  4H2K A;  4P4D A;  1F2P A;  3D67 A;  4HNY B;  2HUZ A;  2NYQ A;  4UCN A;  1KEE B;  4C2X A;  2VXK A;  3D8P A;  1CE8 B;  4KLW A;  5D29 A;  3GUX A;  4UCP A;  2D4P A;  4CRY B;  5CBM A;  4C9E A;  2QJ8 A;  4A38 A;  4COG A;  2ZEF A;  1IIC A;  2X7B A;  3PFE A;  1ELM P;  4CGM A;  1QST A;  3VRP A; 
#chains in the Genus database with same CATH homology
 3NA6 A;  3K2K A;  3SI2 A;  4C9V A;  4UF4 A;  3RAM A;  2ZEL A;  3JRU A;  1XF1 A;  1ARL A;  2F7V A;  2AFM A;  4MCS A;  2QYV A;  3QNV A;  4MHN A;  4UEE A;  2PJ4 A;  3IIB A;  2POK A;  3SI1 A;  3RBU A;  2C6G A;  1ELL P;  1CPS A;  1F2O A;  4BD9 A;  2C6P A;  4YN3 A;  2PIY A;  3KQZ A;  1IGB A;  4Z65 A;  3FMC A;  3PFO A;  3CPA A;  4YU9 A;  1YLO A;  2AFS A;  3VAT A;  4UIA A;  3FF3 A;  2IJZ A;  3MN8 A;  3IFE A;  1WVM A;  3I74 A;  2WZN A;  4OC0 A;  4DUK A;  2ZEE A;  2ZEP A;  1KWM A;  2CTC A;  1XFO A;  4A37 A;  4IHM A;  4ZY1 A;  1NSA A;  1EE3 P;  4EWT A;  1LAN A;  4CDJ A;  1Z5R A;  4P45 A;  1HEE A;  3KHZ A;  5HVF A;  4NGP A;  3DGV A;  4P6Y A;  2ZEG A;  3HLP A;  3FVL A;  2BO9 A;  1XJO A;  2XEI A;  4C8A A;  2GLJ A;  5F09 A;  4C84 A;  4X3R A;  4NGS A;  4R6T A;  3L2N A;  5LYI A;  4NJR A;  1BAV A;  2ANP A;  2C5Q A;  1CPX A;  2V8H A;  1H8L A;  4Q7A A;  4PXE A;  3PBE A;  2XEJ A;  4FBE A;  3PB9 X;  1YW4 A;  3NH5 A;  2EK9 A;  4PQA A;  4GM5 A;  2PJ9 A;  1R3N A;  4TJV A;  4MHP A;  3KR4 A;  5CPA A;  1QMU A;  3H8G A;  1M4L A;  4JZ0 A;  5JGF A;  2GLF A;  4R7M A;  3KAS A;  2Q43 A;  3LWU A;  4DYO A;  3D7F A;  3BI0 A;  2OR4 A;  4ONW A;  2PJB A;  2PVV A;  4F9V A;  2IQ6 A;  1TKJ A;  2AFZ A;  4IK2 A;  5JH9 A;  1PCA A;  1CP7 A;  3KHX A;  4B6Z A;  7CPA A;  4O23 A;  2PJ2 A;  3GB0 A;  4EFD A;  2OOT A;  3BHX A;  5IR2 A;  5ELY A;  1ARM A;  3KI9 A;  1DE4 C;  1ZG7 A;  1JQG A;  5K8O A;  2I3C A;  4WJB A;  4MHY A;  1XMB A;  1DTD A;  4OME A;  4TNU A;  2CF4 A;  3WT4 A;  4RUH A;  2F8H A;  3H8F A;  2BOA A;  1TKH A;  4ZYQ A;  1AMP A;  1FT7 A;  1VIX A;  1Y9Z A;  3SJF A;  1LOK A;  3D68 A;  1CG2 A;  2AFW A;  1BPN A;  2WYR A;  3GLJ A;  4NJQ A;  3D7H A;  4P44 A;  1TKF A;  2ABZ A;  5IB9 A;  2PJ8 A;  4C8F A;  4P4B A;  3B3S A;  4KNG E;  4P4F A;  4A94 A;  1TF8 A;  3ISZ A;  3IEH A;  2CTB A;  3B3W A;  4OP4 A;  2V77 A;  2V8V A;  4NGR A;  2O53 A;  1TF9 A;  1CX8 A;  3TX8 A;  3B2Y A;  5D8N A;  3RZA A;  5LYD A;  4FWU A;  1VHO A;  4MHZ A;  1XRY A;  4OIW A;  1Y7E A;  3WAB A;  2PJA A;  4ZX8 A;  4ZX9 A;  4NGQ A;  4P4I A;  3LMS A;  4IAV A;  3DLJ A;  3PEI A;  4NGT A;  4C9R A;  1R43 A;  2JEW A;  4NGN A;  4OC4 A;  2O4H A;  1ZG8 A;  2PRQ A;  3SJX A;  1IY7 A;  1CBX A;  4NGM A;  5K8N A;  3VAR A;  2ZEO A;  2V8D A;  4K3N A;  1GYT A;  3PB8 X;  3S9L A;  1Y0Y A;  4C99 A;  3FEE A;  4OC3 A;  2FVG A;  2ZEM A;  5LRG A;  3D7G A;  2GP4 A;  2ZED A;  1TXR A;  1LFW A;  1CP6 A;  2RB7 A;  3NFZ A;  3B3V A;  3FH4 A;  3FEC A;  4OC2 A;  3WC6 A;  3B3C A;  2Q4Z A;  3FJU A;  2GRE A;  3EIF A;  3TC8 A;  3WC7 A;  4MCR A;  4LQG A;  3WC5 A;  2G9D A;  4WWV A;  1ZLI A;  4AXV A;  4OKO A;  4TJX A;  3ICU A;  1Q7L A;  8CPA A;  1VHE A;  4TWE A;  2PE3 A;  1BPM A;  1VGY A;  4FUU A;  1AYE A;  3KGQ A;  4MRI A;  1BLL E;  2AFU A;  4PPZ A;  2VL1 A;  2PIZ A;  1Z8L A;  3B7I A;  3HUV A;  3FX6 A;  5THW A;  3KQX A;  4MCP A;  1LCP A;  4MCQ A;  2PJ5 A;  3D7D A;  4P4E A;  4EME A;  3BI1 A;  1YSJ A;  2PJ0 A;  3IC1 A;  3SJE A;  3B3T A;  5K8M A;  3KZW A;  1UWY A;  3SJG A;  4PXC A;  3BXM A;  1V6C A;  4PXD A;  5LRK A;  1HDU A;  5DS0 A;  5J1Q A;  3FED A;  2DEA A;  3B35 A;  1ZLH A;  4P10 A;  3IWW A;  3PB6 X;  2HB6 A;  2C6C A;  3S9N A;  3IJ3 A;  1PYT B;  1QQ9 A;  2PVW A;  3CT9 A;  2PJ7 A;  1YME A;  2CIJ A;  5JM6 A;  2AFX A;  3H8E A;  4P4J A;  4W9Y A;  4C8U A;  5HVH A;  3VH9 A;  3CPX A;  4UEF A;  3SI0 A;  5LYF A;  1ZG9 A;  3PB7 X;  2EWB A;  2ZEH A;  4R76 A;  2ZOG A;  1Y0R A;  3N5F A;  2QVP A;  1YW6 A;  4PXB A;  4YWY A;  5HVG A;  4C85 A;  3PRT A;  2IMO A;  3T8W A;  4CPA A;  5K8P A;  3I6S A;  3K9T A;  2GU2 A;  2PJ3 A;  4JYW A;  4C9U A;  3S9M A;  4MMO A;  4OC1 A;  2JBJ A;  3VTA A;  3CDX A;  2RFH A;  4ZY2 A;  5I4M A;  2C1C A;  2V8G A;  3V38 A;  4C8C A;  2EK8 A;  4DJL A;  4C86 A;  2XEG A;  3PB4 X;  3MRU A;  4KSI A;  3KR5 A;  2Q51 A;  4C8P A;  6CPA A;  4ZY0 A;  1HDQ A;  4X2T A;  3NH8 A;  2HC9 A;  4MXU A;  1F57 A;  3D66 A;  4ZI6 A;  1Z2L A;  3NH4 A;  2PCU A;  2J9A A;  4C8T A;  3ISX A;  4NFR A;  4X8I A;  1LAM A;  3V7Z A;  3PBB A;  2XEF A;  4R8F A;  1LAP A;  4C9A A;  4G1P A;  2NSM A;  1FNO A;  4OID A;  2ZEN A;  2PJ1 A;  5LRJ A;  2JBK A;  2BCO A;  4F9U A;  4A39 A;  2PJC A;  3KL9 A;  4UIB A;  5LYL A;  4UEZ A;  4F8Z A;  2PJ6 A;  4OC5 A;  4CDK A;  3D4U A;  1RTQ A;  2AFO A;  1OBR A;  2ZOF A;  3IO1 A;  3I1U A;  5HXD A;  1XBU A;  4FAI A;  4H2K A;  4P4D A;  1F2P A;  3D67 A;  2NYQ A;  5D29 A;  3GUX A;  5CBM A;  4C9E A;  2QJ8 A;  4A38 A;  2ZEF A;  3PFE A;  1ELM P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...