3D7DA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcfbd, a urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
molecule tags Hydrolase
source organism Homo sapiens
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
total genus 263
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7dA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7dA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7dA02
2ZEHA 4C9RA 3NH5A 4C9EA 3JRUA 5D8NA 4CPAA 4ZY2A 4OIWA 4A39A 3FH4A 4TWEA 1AMPA 2PIYA 3GUXA 3FMCA 2BOAA 4EFDA 1BPNA 1LFWA 2C6GA 5JGFA 3D7DA 3PB6X 4C8TA 1CP7A 1RTQA 5DS0A 4CDKA 2O53A 4P44A 2OOTA 1GYTA 5HVHA 2PJ2A 3CPAA 3D4UA 4K3NA 3L2NA 4C9AA 4C8PA 2JBKA 1DTDA 4P4BA 5JM6A 2V8GA 4OC0A 1AYEA 4ZX9A 3PEIA 4RUHA 4ZI6A 3IO1A 4UEEA 1ELMP 4AXVA 4C8CA 2ZOFA 3VATA 3D7GA 2ZELA 1LCPA 1BAVA 3KQZA 4Z65A 4P4FA 3WABA 3SJFA 4YN3A 1ZG9A 2PJ4A 3EIFA 4OMEA 1VHOA 3BHXA 4C86A 4NGQA 4PXCA 5JH9A 4P4EA 1WVMA 2BCOA 1XFOA 4X2TA 3PB8X 3BI1A 5HVFA 3RZAA 6CPAA 1Y0YA 2CTCA 3B3VA 5K8NA 4UEZA 4R6TA 3KQXA 1XJOA 3S9MA 1TF8A 4OC4A 1TXRA 4FBEA 3SI0A 1OBRA 3IFEA 2PVVA 2ZEOA 3B7IA 4MCSA 3KHXA 8CPAA 4PQAA 5D29A 4C85A 3CPXA 3KGQA 4C99A 1Y9ZA 3PFOA 5HVGA 1YMEA 4ZY1A 5J1QA 3B2YA 2V77A 4C8AA 1R43A 4P45A 3KR5A 4BD9A 4LQGA 1UWYA 2PJ1A 3WC7A 2F7VA 4NJRA 1YSJA 1Z2LA 5I4MA 2NSMA 4OP4A 2ABZA 4P10A 1H8LA 3KZWA 1VIXA 3S9NA 3HLPA 5LYFA 2ZENA 1VGYA 2IMOA 4R8FA 4P4DA 3WT4A 3LMSA 1Q7LA 1Z5RA 4R76A 4P4IA 5K8PA 1CBXA 2ZEFA 4G1PA 1ELLP 2Q43A 2C1CA 4PPZA 3IJ3A 2DEAA 5LYDA 1F57A 2AFWA 2PVWA 3I1UA 3KL9A 3HUVA 1QMUA 3SJXA 4NGRA 3B35A 4TNUA 2C6PA 1CG2A 3PBBA 4A94A 4H2KA 4OC2A 4MHYA 4NGSA 3I6SA 4F8ZA 1M4LA 4NFRA 2PIZA 2AFOA 2PJ8A 3IIBA 4Q7AA 4O23A 1CP6A 5CBMA 3PBEA 3WC5A 3FVLA 4OKOA 1XF1A 2XEIA 5LRJA 2WYRA 4NGNA 3SI1A 2XEJA 3VARA 2OR4A 4IAVA 2EK8A 3TX8A 1ZLIA 2PE3A 1Z8LA 3FEEA 3RBUA 3FEDA 3V38A 2PJ3A 1BPMA 2WZNA 4ONWA 4GM5A 1YLOA 3FJUA 4JZ0A 4NGMA 2PJBA 3V7ZA 4ZYQA 3NH4A 1R3NA 4X8IA 3D7FA 4MHZA 1KWMA 4P6YA 4MCQA 3BI0A 1ARLA 2O4HA 3H8FA 5K8OA 2POKA 3CDXA 3H8GA 4F9VA 3S9LA 2CIJA 4NGPA 5K8MA 3BXMA 4FAIA 3I74A 3T8WA 2PJCA 5F09A 2AFXA 1HEEA 4A37A 3B3TA 4MCRA 4NGTA 4OIDA 4TJXA 1FT7A 2G9DA 2PJ7A 3MN8A 4EWTA 4MCPA 5LRGA 2NYQA 1F2PA 4UEFA 2PRQA 2V8VA 4YWYA 1IGBA 2PCUA 3DLJA 4C9UA 2CF4A 4R7MA 2V8HA 4P4JA 3GLJA 5IB9A 4W9YA 3GB0A 3PRTA 4IK2A 7CPAA 3FX6A 4PXEA 4IHMA 4EMEA 1Y7EA 1FNOA 3D68A 5THWA 2JEWA 4KNGE 1XBUA 2AFZA 2PJ0A 4WWVA 3PB9X 2QVPA 3VH9A 2IJZA 4MXUA 3B3SA 2PJ9A 4C84A 4MHNA 4UIBA 1CX8A 1XMBA 1LOKA 4WJBA 3N5FA 3PB4X 3K2KA 3SI2A 4OC5A 4X3RA 1HDUA 5ELYA 3PB7X 1LAMA 3NH8A 3SJEA 1TKHA 2IQ6A 1ZG8A 5HXDA 3QNVA 2AFUA 2EK9A 2GU2A 3IEHA 2GLFA 3IC1A 1CPXA 1VHEA 5LYIA 3FF3A 4DJLA 4OC1A 2ZEGA 3WC6A 3PFEA 3K9TA 3B3CA 1QQ9A 1BLLE 4PXDA 3IWWA 2V8DA 1JQGA 2GREA 3FECA 2Q4ZA 3MRUA 2RFHA 1CPSA 3NFZA 4FWUA 1HDQA 4TJVA 1NSAA 1LAPA 2ANPA 4DYOA 1PCAA 2CTBA 1IY7A 1LANA 4DUKA 1TKJA 1YW4A 2J9AA 4YU9A 3ICUA 2F8HA 2XEFA 2ZEPA 2C6CA 1EE3P 4B6ZA 3KI9A 3B3WA 2FVGA 1XRYA 3D66A 2HC9A 2XEGA 4MMOA 3CT9A 3ISXA 4UF4A 5LYLA 3VTAA 2AFSA 1F2OA 3KASA 1ARMA 2ZEMA 1YW6A 4C8FA 3RAMA 3SJGA 2GLJA 3LWUA 2Q51A 3KR4A 1ZLHA 2EWBA 4KSIA 3ISZA 1Y0RA 4JYWA 2HB6A 4OC3A 2ZOGA 2ZEDA 4ZX8A 1V6CA 4C8UA 2RB7A 4FUUA 1TF9A 3DGVA 2I3CA 2BO9A 2PJ6A 1TKFA 2JBJA 4UIAA 1DE4C 2QJ8A 3D67A 3D7HA 3NA6A 2ZEEA 4MRIA 1PYTB 2PJAA 2QYVA 4MHPA 4A38A 2PJ5A 4NJQA 4C9VA 4CDJA 4F9UA 3KHZA 5LRKA 4ZY0A 3TC8A 2VL1A 4PXBA 5CPAA 2AFMA 1ZG7A 3H8EA
chains in the Genus database with same CATH superfamily
5AG5A 2Z3PA 2ZEHA 3JVNA 4F0YA 5F47A 3EY5A 2Y1MA 4RI1A 2BSWA 2ZW6A 2ARHA 2KCWA 3VRQA 3NH5A 4CGOA 2FL4A 2GANA 4C9EA 3JRUA 5D8NA 4CPAA 5F49A 4MFJA 4ZY2A 2DF5A 4OIWA 1K4JA 4A39A 1Q2CA 2YNEA 3TLEA 3FH4A 3VWDA 4TWEA 3TLCA 1AMPA 4M85A 1M1DA 2PIYA 3GUXA 3FMCA 1Y9KA 4Q38A 2BOAA 4EFDA 3SXNA 1BPNA 1LFWA 4EVYA 2C6GA 2G3AA 2HV2A 5FVJA 3D7DA 5JGFA 3PB6X 4KSAA 2XPOA 2EZBA 4B5OA 2VXKA 4C8TA 4MI4A 1CP7A 2P6EA 1RTQA 5DS0A 5G1ZA 4CRZB 2CNMA 1J3LA 3GY9A 4JD6A 4CDKA 2O53A 3RYOA 2PC1A 4CAXA 4P44A 2OOTA 1GYTA 4AB7A 1S7LA 3FNCA 5HVHA 3A9LA 2PJ2A 2QMLA 4M6HA 4CYPA 3SXOA 3PP9A 2HWGA 3CPAA 3D4UA 4K3NA 3EXNA 4FD7A 2DIKA 3L2NA 4C9AA 4C8PA 2JBKA 1DTDA 3EFAA 4P4BA 4X5KA 5JM6A 1R61A 2V8GA 1Q5XA 3VROA 2VEZA 4OC0A 4CGMA 1AYEA 1IYKA 2R98A 1S60A 1M4GA 4CYOA 4JVOA 4ZX9A 3PEIA 3BJ7A 4CGLA 4RUHA 3VGOA 2ZXVA 4ZI6A 3TFYA 3EZAA 3IO1A 4UEEA 2E28A 1ELMP 4AXVA 4C8CA 1NMTA 2PR1A 1WWZA 2ZOFA 3S6KA 2G3TA 3FYNA 4A30A 3VATA 3D7GA 2Q0YA 4INJA 2ZELA 4CO9A 1JWQA 2UV8G 1KUVA 2VKZG 1LCPA 4KUBA 1BAVA 3CZXA 3KQZA 1B87A 4ONUA 4PSXA 3TOAA 4P4FA 4Z65A 3WABA 3T05A 2A4NA 3O8ZA 3SJFA 4YN3A 1ZG9A 2PJ4A 3EIFA 4KNGE 4M6IA 1DIKA 2PSWA 4OMEA 1IYLA 1VHOA 2VZYA 2WSAA 3G3SA 1VBGA 3PZJA 3BHXA 4KVME 4NGQA 2B4JC 4PXCA 1I12A 3TYXA 4C86A 1Z9UA 3WR7A 5JH9A 4P4EA 2ODFA 1WVMA 2WPWA 2BCOA 1XFOA 4JLYA 2FCKA 2VQYA 5E96A 5C82A 1X12A 4X2TA 3HPGG 1IIDA 3V8IA 3PB8X 1NBWA 4KVXA 3F9KC 4KVOE 4MFKA 4IIYA 4E94A 2FE7A 2EBJA 1QSTA 1MK4A 3BI1A 2D4PA 2WUUA 4M3SA 4OADA 1R57A 5HVFA 3RZAA 1YLEA 1Y0YA 2Z3MA 6CPAA 2Z3OA 1VHSA 1ZYMA 2CTCA 3T9YA 1EZBA 3PFVA 3B3VA 5K8NA 4BTFA 3IU2A 4R6TA 1S7KA 3KQXA 4UEZA 1XJOA 3RO0A 1TXRA 2B4DA 3S9MA 4OC4A 1Q2YA 1TF8A 2AE6A 1YX0A 3DR6A 3SI0A 4BBHA 4FBEA 2Z11A 3ZNIA 3P2HA 1OBRA 5F1YA 4QUSA 2RC4A 3IFEA 1YGHA 1EZAA 4BPWB 2YJTA 4GS4A 2PVVA 2ZEOA 4B13A 1KC7A 2I00A 3B7IA 2PCNA 1SQHA 1S7FA 4MCSA 5THWA 3KHXA 1KBLA 8CPAA 4PQAA 5D29A 3MGDA 3CPXA 5AG6A 4C85A 3KGQA 4C99A 3OB1B 3C26A 3PFOA 1Y9ZA 4UWJA 5HVGA 1YMEA 4ZY1A 5DWNA 5J1QA 1Z8XA 4C9RA 3ZZIA 3B2YA 3LACA 2V77A 4C8AA 1R43A 4P45A 2ATRA 4Y49B 4JXQA 2HUZA 3KR5A 1A2ZA 2GFQA 4BD9A 4LQGA 3TO6A 1KUYA 1UWYA 2PJ1A 3WC7A 3TLZA 2F7VA 5BWAB 2J8NA 4KLVA 1Z9EA 2FT0A 4NJRA 1YSJA 5AG7A 5IV0A 5FD8A 1Z2LA 5I4MA 2NSMA 4AVBA 3QB8A 5A28A 1BO4A 4KLWA 1JDEA 4OP4A 2ABZA 4P10A 4B5PA 3NE7A 1H8LA 3KZWA 3T07A 3H4QA 1N71A 3PT1A 3VRRA 1VIXA 1NSLA 4OLLA 3BUWB 5F48A 3S9NA 1MJBA 1YK3A 3HLPA 4LUAA 5LYFA 2ZENA 3S6GA 1VGYA 3TTHA 2IMOA 3CXSA 2PRBA 4R8FA 4P4DA 4UA3A 4UCPA 3WT4A 3LMSA 1Q7LA 1Z5RA 4CAFA 5KTAA 4R76A 1CJWA 3TLBA 1M4IA 4CRYB 4P4IA 3OWCA 4XNHC 5K8PA 1CBXA 2REEA 2ZEFA 4G1PA 2R8VA 1ELLP 3EO4A 2Q43A 2Q7SA 2C1CA 2CY2A 4PPZA 2B5GB 3IJ3A 4NCZA 2DEAA 4K30A 4M6GA 3BJ8A 2K5TA 3F0AA 1XOVA 3GIUA 5HMNA 5LYDA 4CYNA 1F57A 3EC4A 2AFWA 2PVWA 3I1UA 3HPHE 4KOYA 2FIAA 5KTCA 1ZO0A 3H5ZA 4HNYB 3KL9A 3K4IA 1C30B 3HUVA 1QMUA 4ZGYB 5HH1A 4J3GA 1YVKA 2X7BA 3SJXA 4NGRA 2JLMA 3B35A 4TNUA 4U9ZA 2C6PA 1CG2A 3PBBA 4A94A 2JEVA 1XIXA 3QAHA 4OC2A 4H2KA 5J8CA 5F5XA 1X10A 4MHYA 4NGSA 3D8PA 4AG7A 4C7IA 1GHEA 4A95A 3JTKA 4A4BA 3TE4A 4H1HA 3I6SA 4F8ZA 2ZPAA 4KOXA 3R9FA 1M4LA 1Y7RA 4F0XA 3I3GA 3N7ZA 4FD4A 4NFRA 3T0TA 2VBQA 2PIZA 2B3UA 2AFOA 1XEBA 5JYBA 2PJ8A 3IIBA 4KSFA 2Z3LA 4FD6A 3F5BA 1LRZA 2BEIA 4O23A 3BUOB 4Q7AA 3T90A 1CP6A 2QIRA 5AG4A 3NOJA 5F9MA 1B47A 5CBMA 3PBEA 3WC5A 2OH1A 3FVLA 3SR3A 1S3ZA 4H6UA 4MHDA 4R3KA 4OKOA 1XF1A 2XEIA 4GXHA 2WYRA 4NGNA 5LRJA 3SI1A 2XEJA 3VARA 2OR4A 2YGWA 4IAVA 4UFWA 2EK8A 4A4CA 4UCNA 2YNCC 3DSBA 1IB1E 5F13A 1Q2DA 3TX8A 1ZLIA 2C27A 2PE3A 3CXPA 1Z8LA 4U9YA 2P6GA 3FEEA 4DYOA 3RBUA 3FEDA 3V38A 2PJ3A 1BPMA 3FRMA 4CS0B 5J8FA 2BUEA 2WZNA 4CGNA 2GIVA 4ONWA 3S6HA 2C5QA 4RS2A 2PR8A 4UFVA 2NMTA 3C8OA 4GM5A 4B10A 5C88A 1IOIA 1YLOA 2AUMA 2OZHA 4KUAA 3B8GA 4HNXB 3FJUA 1V0CA 3P2FA 3TO9A 3PLFB 4MY0A 2VZZA 4JZ0A 4NGMA 2PJBA 3V7ZA 4M8DA 4ZYQA 5JQ4A 3GYAA 3NH4A 4CAWA 1R3NA 3GKRA 4NEXA 3TLYA 4B11A 2B58A 3D7FA 4KS9A 4X8IA 4MHZA 1B6BA 3TOBA 1KWMA 4P6YA 4MCQA 3BI0A 5G21A 2Z10A 4H89A 1TIQA 4MJXA 1ARLA 2O4HA 4BINA 2CBLA 4CAVA 3H8FA 4UBRA 5K8OA 2POKA 1M4DA 3CDXA 3H8GA 4MFQA 4PSWA 4F9VA 3S9LA 5IX3A 1XE4A 3TLGB 2CIJA 4NGPA 3VRNA 5A27A 4MFZA 5H84A 5JVLA 2ZW4A 2XPNA 3VRPA 4MFLA 5K8MA 2HQYA 3BXMA 4KOWA 4FAIA 3I74A 4QBJA 3GJZA 3T8WA 2DPTA 4KORA 4QVTA 4H6ZA 4YRHA 1P0HA 2BL1A 5F09A 2PJCA 3IGRA 5G20A 2AFXA 4MFPA 1A9XB 2Y0MA 4XNHB 1HEEA 4A37A 3B3TA 4MCRA 4NGTA 4OIDA 4XPDC 4TJXA 2D0OA 1FT7A 2G9DA 2PJ7A 3MN8A 4EWTA 1U6MA 4MCPA 5LRGA 2PQ8A 2NYQA 3ZJ0A 1F2PA 5KTDA 4UEFA 2PRQA 3T5MA 3R96A 2V8VA 1BOBA 1M44A 4YWYA 1IGBA 4XPLA 2CXAA 4A31A 2PCUA 3DLJA 4C9UA 3R9GA 2CF4A 1MJ9A 2DPSA 2R1IA 4R7MA 2V8HA 2I79A 1PU9A 4P4JA 3GLJA 5HKWA 3IU1A 4HKFA 4UWIA 1Z8WA 4C68A 4NXYA 5IB9A 4W9YA 2FSRA 3GB0A 3PRTA 4IK2A 7CPAA 5ISVA 3FX6A 2H5MA 1J4JA 3EZEA 4PXEA 4IHMA 1IICA 2WPXA 4C7HA 4EMEA 1Y7EA 2B4DB 1CM0A 4B14A 4RR2B 4E0AA 1FNOA 1KEEB 2B4BA 3D68A 1I1DA 1RXTA 2JEWA 1XBUA 2AFZA 2PJ0A 2FIWA 3IWEA 4LX9A 4WWVA 2DXQA 2Z0ZA 3PB9X 1MJAA 3TT2A 2QVPA 2YNDA 3VH9A 3HMJG 2IJZA 4L8AA 5F46A 4MXUA 2IL4A 4A33A 3B3SA 5K99A 2PJ9A 3D2PA 4GPLB 1ZRSA 1XMTA 4ORFA 4QC6A 4C84A 2FS5A 4HNWB 1OZPA 2Q4YA 4MHNA 4R57A 4UIBA 1CS0B 1CX8A 1XMBA 4CYQA 1Z8TA 1LOKA 3EZBA 4R3LA 4JXRA 3W6SA 3BUMB 3I9SA 3DNSA 4WJBA 3N5FA 3FBUA 3PB4X 2GE3A 5IB0A 3K2KA 3SI2A 4OC5A 1QSMA 2D4OA 1WJTA 4X3RA 1HDUA 2R82A 1Y9WA 5ELYA 2X0SA 2D0PA 3PB7X 2GP4A 4E2AA 1LAMA 4IIXA 2J8RA 2O28A 3BUNB 3NH8A 3SJEA 1TKHA 1GGOA 3W91A 4KZTA 2IQ6A 1ZG8A 1ZL0A 4MI1A 4MJ8A 4BPUB 5HXDA 4EYSA 3QNVA 4AVCA 4R9MA 3D3SA 2AFUA 2EK9A 3TO7A 2GU2A 1P4NA 3W6XA 4II9A 1BXRB 3OP0A 3IEHA 2GLFA 2F5IA 3G8WA 4COBA 3IC1A 4ZBGA 3U88C 1CPXA 1YVOA 3TCVA 5AXIA 1VHEA 4QB9A 1YREA 2Q04A 5LYIA 4C2ZA 3FF3A 1YR0A 4DJLA 4OC1A 5CNPA 4LQ6A 2ZEGA 3WC6A 1XF8A 1QSNA 2EO8A 3OAKA 3PFEA 4IUSA 4C2YA 4MBUA 2ZW5A 3B3CA 3K9TA 3R1KA 1QQ9A 1S7NA 5HKYA 1BLLE 4HPSA 4PXDA 4YGOA 3IWWA 2V8DA 1PUAA 2EUIA 1NXJA 1JQGA 2GREA 4KOSA 4PV6A 5IR2A 1FBVA 3FECA 2Q4ZA 1IU8A 3MRUA 3TLGA 2RFHA 5EMIA 1CPSA 2QECA 2J8MA 3NFZA 1HDQA 4FWUA 4TJVA 1NSAA 1LAPA 2ANPA 4C2XA 3FB3A 4B5PB 3LODA 1PCAA 3OB2B 1IY7A 1LANA 2CTBA 1TKJA 2G0BA 1YW4A 4DUKA 4CGPA 2OB0A 5H86A 3RNZA 2J9AA 3DR8A 4NF1A 4PK2A 4YU9A 4BMHA 3ICUA 3FIXA 2EZAA 1AUGA 2F8HA 3BLNA 1RO5A 2Z3NA 2XEFA 2ZEPA 3IWGA 4UCMA 4XPDB 2C6CA 2VI7A 4I49A 4UFXA 5DWMA 3R9EA 1T36B 4DNCA 1IOFA 1EE3P 2REFA 4B6ZA 3FXTA 3KI9A 3B3WA 1VI4A 1VBHA 2FVGA 1XRYA 4U5YA 4CZ1A 3G23A 3D66A 2HC9A 1C3OB 2XEGA 4AG9A 3QAYA 4MMOA 3CT9A 3ISXA 5AGEA 3U1BA 3KRVA 4UF4A 5LYLA 3VTAA 4PK3A 2AFSA 2OLSA 1F2OA 3KASA 1ARMA 2ZEMA 3LD2A 5GCNA 2EVNA 4COGA 1S5KA 2JDDA 2XPLA 2P0WA 4CAEA 3BUXB 1L0CA 1YW6A 2P6FA 3F8KA 1CE8B 3RAMA 4C8FA 3DDDA 2XPPA 3SJGA 1FY7A 2YJVA 2GLJA 3LWUA 2Q51A 3E0KA 1NE9A 1ZLHA 3KR4A 4JJXA 2EZCA 4YFJA 2EWBA 4KSIA 4J0NA 3ISZA 4Y49C 1Y0RA 4JYWA 2HB6A 2YNCA 2Q7BA 4E8OA 4OC3A 5EBVA 2B3VA 3K9UA 1QSOA 2R7HA 1EO0A 1YQEA 2N3AB 4KOTA 2Y1NA 2ZOGA 2AUNA 3CXQA 2ZEDA 4ZX8A 1V6CA 4E5SA 2Q4VA 2B0AA 2RB7A 4C8UA 4FUUA 4R87A 2PDOA 3R95A 5HKZA 1TF9A 4OAEA 3DGVA 2I3CA 4B12A 2BO9A 4AVAA 1JDBC 1ON0A 2HROA 2CNSA 2PJ6A 1TKFA 2JDCA 3PGPA 3S6FA 1I21A 2ZW7A 5I0CA 2JBJA 2FM4A 4NSQA 4UIAA 2DLAA 1DE4C 1Z4EA 2QJ8A 3D67A 3KKWA 5EC4A 3D7HA 5BY0A 4A32A 4F6AA 4KOVA 2HI6A 2MP0A 1M6VB 5JPHA 1KUXA 2B5GA 2FXFA 1VKCA 1Z4RA 3NA6A 4XPKA 1WK4A 3UY5A 2ZEEA 4MRIA 2Q44A 2OZUA 1PYTB 4L89A 2PJAA 3NFQA 2QYVA 5G22A 4A2ZA 4MHPA 1UFHA 2PJ5A 4NJQA 3SHPA 4A38A 4C9VA 4FD5A 3D2MA 1YVHA 2OU2A 3JUWA 5J3XA 1QSRA 2AJ6A 4CDJA 4KOUA 4RN7A 2Z3KA 4F9UA 2CNTA 2OZGA 3KHZA 5LRKA 4ZY0A 4IF5A 3TC8A 1KZFA 4BPXB 4JWPA 2VL1A 4MY3A 4PXBA 3VWEA 3TLAA 4Q36A 5CPAA 2AFMA 1ZG7A 3NE8A 3H8EA
chains in the Genus database with same CATH topology
2ZEHA 2C5QA 4C9RA 3NH5A 4C9EA 3JRUA 5D8NA 4CPAA 4ZY2A 4OIWA 4A39A 3FH4A 4TWEA 1AMPA 2PIYA 3GUXA 3FMCA 2BOAA 4EFDA 1BPNA 1LFWA 2C6GA 5JGFA 3D7DA 3PB6X 4C8TA 1CP7A 1RTQA 5DS0A 4CDKA 2O53A 4P44A 2OOTA 1GYTA 5HVHA 2PJ2A 3CPAA 3D4UA 4K3NA 3L2NA 4C9AA 4C8PA 2JBKA 1DTDA 4P4BA 5JM6A 2V8GA 4OC0A 1AYEA 4ZX9A 3PEIA 4RUHA 4ZI6A 3IO1A 4UEEA 1ELMP 4AXVA 4C8CA 2ZOFA 3VATA 3D7GA 2ZELA 1LCPA 1BAVA 3KQZA 4Z65A 4P4FA 3WABA 3SJFA 4YN3A 1ZG9A 2PJ4A 3EIFA 4OMEA 1VHOA 3BHXA 4C86A 4NGQA 4PXCA 5JH9A 4P4EA 1WVMA 2BCOA 1XFOA 4X2TA 3PB8X 3BI1A 5HVFA 3RZAA 6CPAA 1Y0YA 2CTCA 3B3VA 5K8NA 4UEZA 4R6TA 3KQXA 1XJOA 3S9MA 1TF8A 4OC4A 1TXRA 4FBEA 3SI0A 1OBRA 3IFEA 2PVVA 2ZEOA 3B7IA 4MCSA 3KHXA 8CPAA 4PQAA 5D29A 4C85A 3CPXA 3KGQA 4C99A 1Y9ZA 3PFOA 5HVGA 1YMEA 4ZY1A 5J1QA 3B2YA 2V77A 4C8AA 1R43A 4P45A 3KR5A 4BD9A 4LQGA 1UWYA 2PJ1A 3WC7A 2F7VA 4NJRA 1YSJA 1Z2LA 5I4MA 2NSMA 4OP4A 2ABZA 4P10A 1H8LA 3KZWA 1VIXA 3S9NA 3HLPA 5LYFA 2ZENA 1VGYA 2IMOA 4R8FA 4P4DA 3WT4A 3LMSA 1Q7LA 1Z5RA 4R76A 4P4IA 5K8PA 1CBXA 2ZEFA 4G1PA 1ELLP 2Q43A 2C1CA 4PPZA 3IJ3A 2DEAA 5LYDA 1F57A 2AFWA 2PVWA 3I1UA 3KL9A 3HUVA 1QMUA 3SJXA 4NGRA 3B35A 4TNUA 2C6PA 1CG2A 3PBBA 4A94A 4H2KA 4OC2A 4MHYA 4NGSA 3I6SA 4F8ZA 1M4LA 4NFRA 2PIZA 2AFOA 2PJ8A 3IIBA 4Q7AA 4O23A 1CP6A 5CBMA 3PBEA 3WC5A 3FVLA 4OKOA 1XF1A 2XEIA 5LRJA 2WYRA 4NGNA 3SI1A 2XEJA 3VARA 2OR4A 4IAVA 2EK8A 3TX8A 1ZLIA 2PE3A 1Z8LA 3FEEA 3RBUA 3FEDA 3V38A 2PJ3A 1BPMA 2WZNA 4ONWA 4GM5A 1YLOA 3FJUA 4JZ0A 4NGMA 2PJBA 3V7ZA 4ZYQA 3NH4A 1R3NA 4X8IA 3D7FA 4MHZA 1KWMA 4P6YA 4MCQA 3BI0A 1ARLA 2O4HA 3H8FA 5K8OA 2POKA 3CDXA 3H8GA 4F9VA 3S9LA 2CIJA 4NGPA 5K8MA 3BXMA 4FAIA 3I74A 3T8WA 2PJCA 5F09A 2AFXA 1HEEA 4A37A 3B3TA 4MCRA 4NGTA 4OIDA 4TJXA 1FT7A 2G9DA 2PJ7A 3MN8A 4EWTA 4MCPA 5LRGA 2NYQA 1F2PA 4UEFA 2PRQA 2V8VA 4YWYA 1IGBA 2PCUA 3DLJA 4C9UA 2CF4A 4R7MA 2V8HA 4P4JA 3GLJA 5IB9A 4W9YA 3GB0A 3PRTA 4IK2A 7CPAA 3FX6A 4PXEA 4IHMA 4EMEA 1Y7EA 1FNOA 3D68A 5THWA 2JEWA 4KNGE 1XBUA 2AFZA 2PJ0A 4WWVA 3PB9X 2QVPA 3VH9A 2IJZA 4MXUA 3B3SA 2PJ9A 4C84A 4MHNA 4UIBA 1CX8A 1XMBA 1LOKA 4WJBA 3N5FA 3PB4X 3K2KA 3SI2A 4OC5A 4X3RA 1HDUA 5ELYA 3PB7X 2GP4A 1LAMA 3NH8A 3SJEA 1TKHA 2IQ6A 1ZG8A 5HXDA 3QNVA 2AFUA 2EK9A 2GU2A 3IEHA 2GLFA 3IC1A 1CPXA 1VHEA 5LYIA 3FF3A 4DJLA 4OC1A 2ZEGA 3WC6A 3PFEA 3K9TA 3B3CA 1QQ9A 1BLLE 4PXDA 3IWWA 2V8DA 1JQGA 2GREA 5IR2A 3FECA 2Q4ZA 3MRUA 2RFHA 1CPSA 3NFZA 4FWUA 1HDQA 4TJVA 1NSAA 1LAPA 2ANPA 4DYOA 1PCAA 2CTBA 1IY7A 1LANA 4DUKA 1TKJA 1YW4A 2J9AA 4YU9A 3ICUA 2F8HA 2XEFA 2ZEPA 2C6CA 1EE3P 4B6ZA 3KI9A 3B3WA 2FVGA 1XRYA 3D66A 2HC9A 2XEGA 4MMOA 3CT9A 3ISXA 4UF4A 5LYLA 3VTAA 2AFSA 1F2OA 3KASA 1ARMA 2ZEMA 1YW6A 4C8FA 3RAMA 3SJGA 2GLJA 3LWUA 2Q51A 3KR4A 1ZLHA 2EWBA 4KSIA 3ISZA 1Y0RA 4JYWA 2HB6A 4OC3A 2ZOGA 2ZEDA 4ZX8A 1V6CA 4C8UA 2RB7A 4FUUA 1TF9A 3DGVA 2I3CA 2BO9A 2PJ6A 1TKFA 2JBJA 4UIAA 1DE4C 2QJ8A 3D67A 3D7HA 3NA6A 2ZEEA 4MRIA 1PYTB 2PJAA 2QYVA 4MHPA 4A38A 2PJ5A 4NJQA 4C9VA 4CDJA 4F9UA 3KHZA 5LRKA 4ZY0A 3TC8A 2VL1A 4PXBA 5CPAA 2AFMA 1ZG7A 3H8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEH A;  4C9R A;  3NH5 A;  4C9E A;  3JRU A;  5D8N A;  4CPA A;  4ZY2 A;  4OIW A;  4A39 A;  3FH4 A;  4TWE A;  1AMP A;  2PIY A;  3GUX A;  3FMC A;  2BOA A;  4EFD A;  1BPN A;  1LFW A;  2C6G A;  5JGF A;  3D7D A;  3PB6 X;  4C8T A;  1CP7 A;  1RTQ A;  5DS0 A;  4CDK A;  2O53 A;  4P44 A;  2OOT A;  1GYT A;  5HVH A;  2PJ2 A;  3CPA A;  3D4U A;  4K3N A;  3L2N A;  4C9A A;  4C8P A;  2JBK A;  1DTD A;  4P4B A;  5JM6 A;  2V8G A;  4OC0 A;  1AYE A;  4ZX9 A;  3PEI A;  4RUH A;  4ZI6 A;  3IO1 A;  4UEE A;  1ELM P;  4AXV A;  4C8C A;  2ZOF A;  3VAT A;  3D7G A;  2ZEL A;  1LCP A;  1BAV A;  3KQZ A;  4Z65 A;  4P4F A;  3WAB A;  3SJF A;  4YN3 A;  1ZG9 A;  2PJ4 A;  3EIF A;  4OME A;  1VHO A;  3BHX A;  4C86 A;  4NGQ A;  4PXC A;  5JH9 A;  4P4E A;  1WVM A;  2BCO A;  1XFO A;  4X2T A;  3PB8 X;  3BI1 A;  5HVF A;  3RZA A;  6CPA A;  1Y0Y A;  2CTC A;  3B3V A;  5K8N A;  4UEZ A;  4R6T A;  3KQX A;  1XJO A;  3S9M A;  1TF8 A;  4OC4 A;  1TXR A;  4FBE A;  3SI0 A;  1OBR A;  3IFE A;  2PVV A;  2ZEO A;  3B7I A;  4MCS A;  3KHX A;  8CPA A;  4PQA A;  5D29 A;  4C85 A;  3CPX A;  3KGQ A;  4C99 A;  1Y9Z A;  3PFO A;  5HVG A;  1YME A;  4ZY1 A;  5J1Q A;  3B2Y A;  2V77 A;  4C8A A;  1R43 A;  4P45 A;  3KR5 A;  4BD9 A;  4LQG A;  1UWY A;  2PJ1 A;  3WC7 A;  2F7V A;  4NJR A;  1YSJ A;  1Z2L A;  5I4M A;  2NSM A;  4OP4 A;  2ABZ A;  4P10 A;  1H8L A;  3KZW A;  1VIX A;  3S9N A;  3HLP A;  5LYF A;  2ZEN A;  1VGY A;  2IMO A;  4R8F A;  4P4D A;  3WT4 A;  3LMS A;  1Q7L A;  1Z5R A;  4R76 A;  4P4I A;  5K8P A;  1CBX A;  2ZEF A;  4G1P A;  1ELL P;  2Q43 A;  2C1C A;  4PPZ A;  3IJ3 A;  2DEA A;  5LYD A;  1F57 A;  2AFW A;  2PVW A;  3I1U A;  3KL9 A;  3HUV A;  1QMU A;  3SJX A;  4NGR A;  3B35 A;  4TNU A;  2C6P A;  1CG2 A;  3PBB A;  4A94 A;  4H2K A;  4OC2 A;  4MHY A;  4NGS A;  3I6S A;  4F8Z A;  1M4L A;  4NFR A;  2PIZ A;  2AFO A;  2PJ8 A;  3IIB A;  4Q7A A;  4O23 A;  1CP6 A;  5CBM A;  3PBE A;  3WC5 A;  3FVL A;  4OKO A;  1XF1 A;  2XEI A;  5LRJ A;  2WYR A;  4NGN A;  3SI1 A;  2XEJ A;  3VAR A;  2OR4 A;  4IAV A;  2EK8 A;  3TX8 A;  1ZLI A;  2PE3 A;  1Z8L A;  3FEE A;  3RBU A;  3FED A;  3V38 A;  2PJ3 A;  1BPM A;  2WZN A;  4ONW A;  4GM5 A;  1YLO A;  3FJU A;  4JZ0 A;  4NGM A;  2PJB A;  3V7Z A;  4ZYQ A;  3NH4 A;  1R3N A;  4X8I A;  3D7F A;  4MHZ A;  1KWM A;  4P6Y A;  4MCQ A;  3BI0 A;  1ARL A;  2O4H A;  3H8F A;  5K8O A;  2POK A;  3CDX A;  3H8G A;  4F9V A;  3S9L A;  2CIJ A;  4NGP A;  5K8M A;  3BXM A;  4FAI A;  3I74 A;  3T8W A;  2PJC A;  5F09 A;  2AFX A;  1HEE A;  4A37 A;  3B3T A;  4MCR A;  4NGT A;  4OID A;  4TJX A;  1FT7 A;  2G9D A;  2PJ7 A;  3MN8 A;  4EWT A;  4MCP A;  5LRG A;  2NYQ A;  1F2P A;  4UEF A;  2PRQ A;  2V8V A;  4YWY A;  1IGB A;  2PCU A;  3DLJ A;  4C9U A;  2CF4 A;  4R7M A;  2V8H A;  4P4J A;  3GLJ A;  5IB9 A;  4W9Y A;  3GB0 A;  3PRT A;  4IK2 A;  7CPA A;  3FX6 A;  4PXE A;  4IHM A;  4EME A;  1Y7E A;  1FNO A;  3D68 A;  5THW A;  2JEW A;  4KNG E;  1XBU A;  2AFZ A;  2PJ0 A;  4WWV A;  3PB9 X;  2QVP A;  3VH9 A;  2IJZ A;  4MXU A;  3B3S A;  2PJ9 A;  4C84 A;  4MHN A;  4UIB A;  1CX8 A;  1XMB A;  1LOK A;  4WJB A;  3N5F A;  3PB4 X;  3K2K A;  3SI2 A;  4OC5 A;  4X3R A;  1HDU A;  5ELY A;  3PB7 X;  1LAM A;  3NH8 A;  3SJE A;  1TKH A;  2IQ6 A;  1ZG8 A;  5HXD A;  3QNV A;  2AFU A;  2EK9 A;  2GU2 A;  3IEH A;  2GLF A;  3IC1 A;  1CPX A;  1VHE A;  5LYI A;  3FF3 A;  4DJL A;  4OC1 A;  2ZEG A;  3WC6 A;  3PFE A;  3K9T A;  3B3C A;  1QQ9 A;  1BLL E;  4PXD A;  3IWW A;  2V8D A;  1JQG A;  2GRE A;  3FEC A;  2Q4Z A;  3MRU A;  2RFH A;  1CPS A;  3NFZ A;  4FWU A;  1HDQ A;  4TJV A;  1NSA A;  1LAP A;  2ANP A;  4DYO A;  1PCA A;  2CTB A;  1IY7 A;  1LAN A;  4DUK A;  1TKJ A;  1YW4 A;  2J9A A;  4YU9 A;  3ICU A;  2F8H A;  2XEF A;  2ZEP A;  2C6C A;  1EE3 P;  4B6Z A;  3KI9 A;  3B3W A;  2FVG A;  1XRY A;  3D66 A;  2HC9 A;  2XEG A;  4MMO A;  3CT9 A;  3ISX A;  4UF4 A;  5LYL A;  3VTA A;  2AFS A;  1F2O A;  3KAS A;  1ARM A;  2ZEM A;  1YW6 A;  4C8F A;  3RAM A;  3SJG A;  2GLJ A;  3LWU A;  2Q51 A;  3KR4 A;  1ZLH A;  2EWB A;  4KSI A;  3ISZ A;  1Y0R A;  4JYW A;  2HB6 A;  4OC3 A;  2ZOG A;  2ZED A;  4ZX8 A;  1V6C A;  4C8U A;  2RB7 A;  4FUU A;  1TF9 A;  3DGV A;  2I3C A;  2BO9 A;  2PJ6 A;  1TKF A;  2JBJ A;  4UIA A;  1DE4 C;  2QJ8 A;  3D67 A;  3D7H A;  3NA6 A;  2ZEE A;  4MRI A;  1PYT B;  2PJA A;  2QYV A;  4MHP A;  4A38 A;  2PJ5 A;  4NJQ A;  4C9V A;  4CDJ A;  4F9U A;  3KHZ A;  5LRK A;  4ZY0 A;  3TC8 A;  2VL1 A;  4PXB A;  5CPA A;  2AFM A;  1ZG7 A;  3H8E A; 
#chains in the Genus database with same CATH topology
 5AG5 A;  2Z3P A;  2ZEH A;  3JVN A;  4F0Y A;  5F47 A;  3EY5 A;  2Y1M A;  4RI1 A;  2BSW A;  2ZW6 A;  2ARH A;  2KCW A;  3VRQ A;  3NH5 A;  4CGO A;  2FL4 A;  2GAN A;  4C9E A;  3JRU A;  5D8N A;  4CPA A;  5F49 A;  4MFJ A;  4ZY2 A;  2DF5 A;  4OIW A;  1K4J A;  4A39 A;  1Q2C A;  2YNE A;  3TLE A;  3FH4 A;  3VWD A;  4TWE A;  3TLC A;  1AMP A;  4M85 A;  1M1D A;  2PIY A;  3GUX A;  3FMC A;  1Y9K A;  4Q38 A;  2BOA A;  4EFD A;  3SXN A;  1BPN A;  1LFW A;  4EVY A;  2C6G A;  2G3A A;  2HV2 A;  5FVJ A;  3D7D A;  5JGF A;  3PB6 X;  4KSA A;  2XPO A;  2EZB A;  4B5O A;  2VXK A;  4C8T A;  4MI4 A;  1CP7 A;  2P6E A;  1RTQ A;  5DS0 A;  5G1Z A;  4CRZ B;  2CNM A;  1J3L A;  3GY9 A;  4JD6 A;  4CDK A;  2O53 A;  3RYO A;  2PC1 A;  4CAX A;  4P44 A;  2OOT A;  1GYT A;  4AB7 A;  1S7L A;  3FNC A;  5HVH A;  3A9L A;  2PJ2 A;  2QML A;  4M6H A;  4CYP A;  3SXO A;  3PP9 A;  2HWG A;  3CPA A;  3D4U A;  4K3N A;  3EXN A;  4FD7 A;  2DIK A;  3L2N A;  4C9A A;  4C8P A;  2JBK A;  1DTD A;  3EFA A;  4P4B A;  4X5K A;  5JM6 A;  1R61 A;  2V8G A;  1Q5X A;  3VRO A;  2VEZ A;  4OC0 A;  4CGM A;  1AYE A;  1IYK A;  2R98 A;  1S60 A;  1M4G A;  4CYO A;  4JVO A;  4ZX9 A;  3PEI A;  3BJ7 A;  4CGL A;  4RUH A;  3VGO A;  2ZXV A;  4ZI6 A;  3TFY A;  3EZA A;  3IO1 A;  4UEE A;  2E28 A;  1ELM P;  4AXV A;  4C8C A;  1NMT A;  2PR1 A;  1WWZ A;  2ZOF A;  3S6K A;  2G3T A;  3FYN A;  4A30 A;  3VAT A;  3D7G A;  2Q0Y A;  4INJ A;  2ZEL A;  4CO9 A;  1JWQ A;  2UV8 G;  1KUV A;  2VKZ G;  1LCP A;  4KUB A;  1BAV A;  3CZX A;  3KQZ A;  1B87 A;  4ONU A;  4PSX A;  3TOA A;  4P4F A;  4Z65 A;  3WAB A;  3T05 A;  2A4N A;  3O8Z A;  3SJF A;  4YN3 A;  1ZG9 A;  2PJ4 A;  3EIF A;  4KNG E;  4M6I A;  1DIK A;  2PSW A;  4OME A;  1IYL A;  1VHO A;  2VZY A;  2WSA A;  3G3S A;  1VBG A;  3PZJ A;  3BHX A;  4KVM E;  4NGQ A;  2B4J C;  4PXC A;  1I12 A;  3TYX A;  4C86 A;  1Z9U A;  3WR7 A;  5JH9 A;  4P4E A;  2ODF A;  1WVM A;  2WPW A;  2BCO A;  1XFO A;  4JLY A;  2FCK A;  2VQY A;  5E96 A;  5C82 A;  1X12 A;  4X2T A;  3HPG G;  1IID A;  3V8I A;  3PB8 X;  1NBW A;  4KVX A;  3F9K C;  4KVO E;  4MFK A;  4IIY A;  4E94 A;  2FE7 A;  2EBJ A;  1QST A;  1MK4 A;  3BI1 A;  2D4P A;  2WUU A;  4M3S A;  4OAD A;  1R57 A;  5HVF A;  3RZA A;  1YLE A;  1Y0Y A;  2Z3M A;  6CPA A;  2Z3O A;  1VHS A;  1ZYM A;  2CTC A;  3T9Y A;  1EZB A;  3PFV A;  3B3V A;  5K8N A;  4BTF A;  3IU2 A;  4R6T A;  1S7K A;  3KQX A;  4UEZ A;  1XJO A;  3RO0 A;  1TXR A;  2B4D A;  3S9M A;  4OC4 A;  1Q2Y A;  1TF8 A;  2AE6 A;  1YX0 A;  3DR6 A;  3SI0 A;  4BBH A;  4FBE A;  2Z11 A;  3ZNI A;  3P2H A;  1OBR A;  5F1Y A;  4QUS A;  2RC4 A;  3IFE A;  1YGH A;  1EZA A;  4BPW B;  2YJT A;  4GS4 A;  2PVV A;  2ZEO A;  4B13 A;  1KC7 A;  2I00 A;  3B7I A;  2PCN A;  1SQH A;  1S7F A;  4MCS A;  5THW A;  3KHX A;  1KBL A;  8CPA A;  4PQA A;  5D29 A;  3MGD A;  3CPX A;  5AG6 A;  4C85 A;  3KGQ A;  4C99 A;  3OB1 B;  3C26 A;  3PFO A;  1Y9Z A;  4UWJ A;  5HVG A;  1YME A;  4ZY1 A;  5DWN A;  5J1Q A;  1Z8X A;  4C9R A;  3ZZI A;  3B2Y A;  3LAC A;  2V77 A;  4C8A A;  1R43 A;  4P45 A;  2ATR A;  4Y49 B;  4JXQ A;  2HUZ A;  3KR5 A;  1A2Z A;  2GFQ A;  4BD9 A;  4LQG A;  3TO6 A;  1KUY A;  1UWY A;  2PJ1 A;  3WC7 A;  3TLZ A;  2F7V A;  5BWA B;  2J8N A;  4KLV A;  1Z9E A;  2FT0 A;  4NJR A;  1YSJ A;  5AG7 A;  5IV0 A;  5FD8 A;  1Z2L A;  5I4M A;  2NSM A;  4AVB A;  3QB8 A;  5A28 A;  1BO4 A;  4KLW A;  1JDE A;  4OP4 A;  2ABZ A;  4P10 A;  4B5P A;  3NE7 A;  1H8L A;  3KZW A;  3T07 A;  3H4Q A;  1N71 A;  3PT1 A;  3VRR A;  1VIX A;  1NSL A;  4OLL A;  3BUW B;  5F48 A;  3S9N A;  1MJB A;  1YK3 A;  3HLP A;  4LUA A;  5LYF A;  2ZEN A;  3S6G A;  1VGY A;  3TTH A;  2IMO A;  3CXS A;  2PRB A;  4R8F A;  4P4D A;  4UA3 A;  4UCP A;  3WT4 A;  3LMS A;  1Q7L A;  1Z5R A;  4CAF A;  5KTA A;  4R76 A;  1CJW A;  3TLB A;  1M4I A;  4CRY B;  4P4I A;  3OWC A;  4XNH C;  5K8P A;  1CBX A;  2REE A;  2ZEF A;  4G1P A;  2R8V A;  1ELL P;  3EO4 A;  2Q43 A;  2Q7S A;  2C1C A;  2CY2 A;  4PPZ A;  2B5G B;  3IJ3 A;  4NCZ A;  2DEA A;  4K30 A;  4M6G A;  3BJ8 A;  2K5T A;  3F0A A;  1XOV A;  3GIU A;  5HMN A;  5LYD A;  4CYN A;  1F57 A;  3EC4 A;  2AFW A;  2PVW A;  3I1U A;  3HPH E;  4KOY A;  2FIA A;  5KTC A;  1ZO0 A;  3H5Z A;  4HNY B;  3KL9 A;  3K4I A;  1C30 B;  3HUV A;  1QMU A;  4ZGY B;  5HH1 A;  4J3G A;  1YVK A;  2X7B A;  3SJX A;  4NGR A;  2JLM A;  3B35 A;  4TNU A;  4U9Z A;  2C6P A;  1CG2 A;  3PBB A;  4A94 A;  2JEV A;  1XIX A;  3QAH A;  4OC2 A;  4H2K A;  5J8C A;  5F5X A;  1X10 A;  4MHY A;  4NGS A;  3D8P A;  4AG7 A;  4C7I A;  1GHE A;  4A95 A;  3JTK A;  4A4B A;  3TE4 A;  4H1H A;  3I6S A;  4F8Z A;  2ZPA A;  4KOX A;  3R9F A;  1M4L A;  1Y7R A;  4F0X A;  3I3G A;  3N7Z A;  4FD4 A;  4NFR A;  3T0T A;  2VBQ A;  2PIZ A;  2B3U A;  2AFO A;  1XEB A;  5JYB A;  2PJ8 A;  3IIB A;  4KSF A;  2Z3L A;  4FD6 A;  3F5B A;  1LRZ A;  2BEI A;  4O23 A;  3BUO B;  4Q7A A;  3T90 A;  1CP6 A;  2QIR A;  5AG4 A;  3NOJ A;  5F9M A;  1B47 A;  5CBM A;  3PBE A;  3WC5 A;  2OH1 A;  3FVL A;  3SR3 A;  1S3Z A;  4H6U A;  4MHD A;  4R3K A;  4OKO A;  1XF1 A;  2XEI A;  4GXH A;  2WYR A;  4NGN A;  5LRJ A;  3SI1 A;  2XEJ A;  3VAR A;  2OR4 A;  2YGW A;  4IAV A;  4UFW A;  2EK8 A;  4A4C A;  4UCN A;  2YNC C;  3DSB A;  1IB1 E;  5F13 A;  1Q2D A;  3TX8 A;  1ZLI A;  2C27 A;  2PE3 A;  3CXP A;  1Z8L A;  4U9Y A;  2P6G A;  3FEE A;  4DYO A;  3RBU A;  3FED A;  3V38 A;  2PJ3 A;  1BPM A;  3FRM A;  4CS0 B;  5J8F A;  2BUE A;  2WZN A;  4CGN A;  2GIV A;  4ONW A;  3S6H A;  2C5Q A;  4RS2 A;  2PR8 A;  4UFV A;  2NMT A;  3C8O A;  4GM5 A;  4B10 A;  5C88 A;  1IOI A;  1YLO A;  2AUM A;  2OZH A;  4KUA A;  3B8G A;  4HNX B;  3FJU A;  1V0C A;  3P2F A;  3TO9 A;  3PLF B;  4MY0 A;  2VZZ A;  4JZ0 A;  4NGM A;  2PJB A;  3V7Z A;  4M8D A;  4ZYQ A;  5JQ4 A;  3GYA A;  3NH4 A;  4CAW A;  1R3N A;  3GKR A;  4NEX A;  3TLY A;  4B11 A;  2B58 A;  3D7F A;  4KS9 A;  4X8I A;  4MHZ A;  1B6B A;  3TOB A;  1KWM A;  4P6Y A;  4MCQ A;  3BI0 A;  5G21 A;  2Z10 A;  4H89 A;  1TIQ A;  4MJX A;  1ARL A;  2O4H A;  4BIN A;  2CBL A;  4CAV A;  3H8F A;  4UBR A;  5K8O A;  2POK A;  1M4D A;  3CDX A;  3H8G A;  4MFQ A;  4PSW A;  4F9V A;  3S9L A;  5IX3 A;  1XE4 A;  3TLG B;  2CIJ A;  4NGP A;  3VRN A;  5A27 A;  4MFZ A;  5H84 A;  5JVL A;  2ZW4 A;  2XPN A;  3VRP A;  4MFL A;  5K8M A;  2HQY A;  3BXM A;  4KOW A;  4FAI A;  3I74 A;  4QBJ A;  3GJZ A;  3T8W A;  2DPT A;  4KOR A;  4QVT A;  4H6Z A;  4YRH A;  1P0H A;  2BL1 A;  5F09 A;  2PJC A;  3IGR A;  5G20 A;  2AFX A;  4MFP A;  1A9X B;  2Y0M A;  4XNH B;  1HEE A;  4A37 A;  3B3T A;  4MCR A;  4NGT A;  4OID A;  4XPD C;  4TJX A;  2D0O A;  1FT7 A;  2G9D A;  2PJ7 A;  3MN8 A;  4EWT A;  1U6M A;  4MCP A;  5LRG A;  2PQ8 A;  2NYQ A;  3ZJ0 A;  1F2P A;  5KTD A;  4UEF A;  2PRQ A;  3T5M A;  3R96 A;  2V8V A;  1BOB A;  1M44 A;  4YWY A;  1IGB A;  4XPL A;  2CXA A;  4A31 A;  2PCU A;  3DLJ A;  4C9U A;  3R9G A;  2CF4 A;  1MJ9 A;  2DPS A;  2R1I A;  4R7M A;  2V8H A;  2I79 A;  1PU9 A;  4P4J A;  3GLJ A;  5HKW A;  3IU1 A;  4HKF A;  4UWI A;  1Z8W A;  4C68 A;  4NXY A;  5IB9 A;  4W9Y A;  2FSR A;  3GB0 A;  3PRT A;  4IK2 A;  7CPA A;  5ISV A;  3FX6 A;  2H5M A;  1J4J A;  3EZE A;  4PXE A;  4IHM A;  1IIC A;  2WPX A;  4C7H A;  4EME A;  1Y7E A;  2B4D B;  1CM0 A;  4B14 A;  4RR2 B;  4E0A A;  1FNO A;  1KEE B;  2B4B A;  3D68 A;  1I1D A;  1RXT A;  2JEW A;  1XBU A;  2AFZ A;  2PJ0 A;  2FIW A;  3IWE A;  4LX9 A;  4WWV A;  2DXQ A;  2Z0Z A;  3PB9 X;  1MJA A;  3TT2 A;  2QVP A;  2YND A;  3VH9 A;  3HMJ G;  2IJZ A;  4L8A A;  5F46 A;  4MXU A;  2IL4 A;  4A33 A;  3B3S A;  5K99 A;  2PJ9 A;  3D2P A;  4GPL B;  1ZRS A;  1XMT A;  4ORF A;  4QC6 A;  4C84 A;  2FS5 A;  4HNW B;  1OZP A;  2Q4Y A;  4MHN A;  4R57 A;  4UIB A;  1CS0 B;  1CX8 A;  1XMB A;  4CYQ A;  1Z8T A;  1LOK A;  3EZB A;  4R3L A;  4JXR A;  3W6S A;  3BUM B;  3I9S A;  3DNS A;  4WJB A;  3N5F A;  3FBU A;  3PB4 X;  2GE3 A;  5IB0 A;  3K2K A;  3SI2 A;  4OC5 A;  1QSM A;  2D4O A;  1WJT A;  4X3R A;  1HDU A;  2R82 A;  1Y9W A;  5ELY A;  2X0S A;  2D0P A;  3PB7 X;  2GP4 A;  4E2A A;  1LAM A;  4IIX A;  2J8R A;  2O28 A;  3BUN B;  3NH8 A;  3SJE A;  1TKH A;  1GGO A;  3W91 A;  4KZT A;  2IQ6 A;  1ZG8 A;  1ZL0 A;  4MI1 A;  4MJ8 A;  4BPU B;  5HXD A;  4EYS A;  3QNV A;  4AVC A;  4R9M A;  3D3S A;  2AFU A;  2EK9 A;  3TO7 A;  2GU2 A;  1P4N A;  3W6X A;  4II9 A;  1BXR B;  3OP0 A;  3IEH A;  2GLF A;  2F5I A;  3G8W A;  4COB A;  3IC1 A;  4ZBG A;  3U88 C;  1CPX A;  1YVO A;  3TCV A;  5AXI A;  1VHE A;  4QB9 A;  1YRE A;  2Q04 A;  5LYI A;  4C2Z A;  3FF3 A;  1YR0 A;  4DJL A;  4OC1 A;  5CNP A;  4LQ6 A;  2ZEG A;  3WC6 A;  1XF8 A;  1QSN A;  2EO8 A;  3OAK A;  3PFE A;  4IUS A;  4C2Y A;  4MBU A;  2ZW5 A;  3B3C A;  3K9T A;  3R1K A;  1QQ9 A;  1S7N A;  5HKY A;  1BLL E;  4HPS A;  4PXD A;  4YGO A;  3IWW A;  2V8D A;  1PUA A;  2EUI A;  1NXJ A;  1JQG A;  2GRE A;  4KOS A;  4PV6 A;  5IR2 A;  1FBV A;  3FEC A;  2Q4Z A;  1IU8 A;  3MRU A;  3TLG A;  2RFH A;  5EMI A;  1CPS A;  2QEC A;  2J8M A;  3NFZ A;  1HDQ A;  4FWU A;  4TJV A;  1NSA A;  1LAP A;  2ANP A;  4C2X A;  3FB3 A;  4B5P B;  3LOD A;  1PCA A;  3OB2 B;  1IY7 A;  1LAN A;  2CTB A;  1TKJ A;  2G0B A;  1YW4 A;  4DUK A;  4CGP A;  2OB0 A;  5H86 A;  3RNZ A;  2J9A A;  3DR8 A;  4NF1 A;  4PK2 A;  4YU9 A;  4BMH A;  3ICU A;  3FIX A;  2EZA A;  1AUG A;  2F8H A;  3BLN A;  1RO5 A;  2Z3N A;  2XEF A;  2ZEP A;  3IWG A;  4UCM A;  4XPD B;  2C6C A;  2VI7 A;  4I49 A;  4UFX A;  5DWM A;  3R9E A;  1T36 B;  4DNC A;  1IOF A;  1EE3 P;  2REF A;  4B6Z A;  3FXT A;  3KI9 A;  3B3W A;  1VI4 A;  1VBH A;  2FVG A;  1XRY A;  4U5Y A;  4CZ1 A;  3G23 A;  3D66 A;  2HC9 A;  1C3O B;  2XEG A;  4AG9 A;  3QAY A;  4MMO A;  3CT9 A;  3ISX A;  5AGE A;  3U1B A;  3KRV A;  4UF4 A;  5LYL A;  3VTA A;  4PK3 A;  2AFS A;  2OLS A;  1F2O A;  3KAS A;  1ARM A;  2ZEM A;  3LD2 A;  5GCN A;  2EVN A;  4COG A;  1S5K A;  2JDD A;  2XPL A;  2P0W A;  4CAE A;  3BUX B;  1L0C A;  1YW6 A;  2P6F A;  3F8K A;  1CE8 B;  3RAM A;  4C8F A;  3DDD A;  2XPP A;  3SJG A;  1FY7 A;  2YJV A;  2GLJ A;  3LWU A;  2Q51 A;  3E0K A;  1NE9 A;  1ZLH A;  3KR4 A;  4JJX A;  2EZC A;  4YFJ A;  2EWB A;  4KSI A;  4J0N A;  3ISZ A;  4Y49 C;  1Y0R A;  4JYW A;  2HB6 A;  2YNC A;  2Q7B A;  4E8O A;  4OC3 A;  5EBV A;  2B3V A;  3K9U A;  1QSO A;  2R7H A;  1EO0 A;  1YQE A;  2N3A B;  4KOT A;  2Y1N A;  2ZOG A;  2AUN A;  3CXQ A;  2ZED A;  4ZX8 A;  1V6C A;  4E5S A;  2Q4V A;  2B0A A;  2RB7 A;  4C8U A;  4FUU A;  4R87 A;  2PDO A;  3R95 A;  5HKZ A;  1TF9 A;  4OAE A;  3DGV A;  2I3C A;  4B12 A;  2BO9 A;  4AVA A;  1JDB C;  1ON0 A;  2HRO A;  2CNS A;  2PJ6 A;  1TKF A;  2JDC A;  3PGP A;  3S6F A;  1I21 A;  2ZW7 A;  5I0C A;  2JBJ A;  2FM4 A;  4NSQ A;  4UIA A;  2DLA A;  1DE4 C;  1Z4E A;  2QJ8 A;  3D67 A;  3KKW A;  5EC4 A;  3D7H A;  5BY0 A;  4A32 A;  4F6A A;  4KOV A;  2HI6 A;  2MP0 A;  1M6V B;  5JPH A;  1KUX A;  2B5G A;  2FXF A;  1VKC A;  1Z4R A;  3NA6 A;  4XPK A;  1WK4 A;  3UY5 A;  2ZEE A;  4MRI A;  2Q44 A;  2OZU A;  1PYT B;  4L89 A;  2PJA A;  3NFQ A;  2QYV A;  5G22 A;  4A2Z A;  4MHP A;  1UFH A;  2PJ5 A;  4NJQ A;  3SHP A;  4A38 A;  4C9V A;  4FD5 A;  3D2M A;  1YVH A;  2OU2 A;  3JUW A;  5J3X A;  1QSR A;  2AJ6 A;  4CDJ A;  4KOU A;  4RN7 A;  2Z3K A;  4F9U A;  2CNT A;  2OZG A;  3KHZ A;  5LRK A;  4ZY0 A;  4IF5 A;  3TC8 A;  1KZF A;  4BPX B;  4JWP A;  2VL1 A;  4MY3 A;  4PXB A;  3VWE A;  3TLA A;  4Q36 A;  5CPA A;  2AFM A;  1ZG7 A;  3NE8 A;  3H8E A; 
#chains in the Genus database with same CATH homology
 2ZEH A;  2C5Q A;  4C9R A;  3NH5 A;  4C9E A;  3JRU A;  5D8N A;  4CPA A;  4ZY2 A;  4OIW A;  4A39 A;  3FH4 A;  4TWE A;  1AMP A;  2PIY A;  3GUX A;  3FMC A;  2BOA A;  4EFD A;  1BPN A;  1LFW A;  2C6G A;  5JGF A;  3D7D A;  3PB6 X;  4C8T A;  1CP7 A;  1RTQ A;  5DS0 A;  4CDK A;  2O53 A;  4P44 A;  2OOT A;  1GYT A;  5HVH A;  2PJ2 A;  3CPA A;  3D4U A;  4K3N A;  3L2N A;  4C9A A;  4C8P A;  2JBK A;  1DTD A;  4P4B A;  5JM6 A;  2V8G A;  4OC0 A;  1AYE A;  4ZX9 A;  3PEI A;  4RUH A;  4ZI6 A;  3IO1 A;  4UEE A;  1ELM P;  4AXV A;  4C8C A;  2ZOF A;  3VAT A;  3D7G A;  2ZEL A;  1LCP A;  1BAV A;  3KQZ A;  4Z65 A;  4P4F A;  3WAB A;  3SJF A;  4YN3 A;  1ZG9 A;  2PJ4 A;  3EIF A;  4OME A;  1VHO A;  3BHX A;  4C86 A;  4NGQ A;  4PXC A;  5JH9 A;  4P4E A;  1WVM A;  2BCO A;  1XFO A;  4X2T A;  3PB8 X;  3BI1 A;  5HVF A;  3RZA A;  6CPA A;  1Y0Y A;  2CTC A;  3B3V A;  5K8N A;  4UEZ A;  4R6T A;  3KQX A;  1XJO A;  3S9M A;  1TF8 A;  4OC4 A;  1TXR A;  4FBE A;  3SI0 A;  1OBR A;  3IFE A;  2PVV A;  2ZEO A;  3B7I A;  4MCS A;  3KHX A;  8CPA A;  4PQA A;  5D29 A;  4C85 A;  3CPX A;  3KGQ A;  4C99 A;  1Y9Z A;  3PFO A;  5HVG A;  1YME A;  4ZY1 A;  5J1Q A;  3B2Y A;  2V77 A;  4C8A A;  1R43 A;  4P45 A;  3KR5 A;  4BD9 A;  4LQG A;  1UWY A;  2PJ1 A;  3WC7 A;  2F7V A;  4NJR A;  1YSJ A;  1Z2L A;  5I4M A;  2NSM A;  4OP4 A;  2ABZ A;  4P10 A;  1H8L A;  3KZW A;  1VIX A;  3S9N A;  3HLP A;  5LYF A;  2ZEN A;  1VGY A;  2IMO A;  4R8F A;  4P4D A;  3WT4 A;  3LMS A;  1Q7L A;  1Z5R A;  4R76 A;  4P4I A;  5K8P A;  1CBX A;  2ZEF A;  4G1P A;  1ELL P;  2Q43 A;  2C1C A;  4PPZ A;  3IJ3 A;  2DEA A;  5LYD A;  1F57 A;  2AFW A;  2PVW A;  3I1U A;  3KL9 A;  3HUV A;  1QMU A;  3SJX A;  4NGR A;  3B35 A;  4TNU A;  2C6P A;  1CG2 A;  3PBB A;  4A94 A;  4H2K A;  4OC2 A;  4MHY A;  4NGS A;  3I6S A;  4F8Z A;  1M4L A;  4NFR A;  2PIZ A;  2AFO A;  2PJ8 A;  3IIB A;  4Q7A A;  4O23 A;  1CP6 A;  5CBM A;  3PBE A;  3WC5 A;  3FVL A;  4OKO A;  1XF1 A;  2XEI A;  5LRJ A;  2WYR A;  4NGN A;  3SI1 A;  2XEJ A;  3VAR A;  2OR4 A;  4IAV A;  2EK8 A;  3TX8 A;  1ZLI A;  2PE3 A;  1Z8L A;  3FEE A;  3RBU A;  3FED A;  3V38 A;  2PJ3 A;  1BPM A;  2WZN A;  4ONW A;  4GM5 A;  1YLO A;  3FJU A;  4JZ0 A;  4NGM A;  2PJB A;  3V7Z A;  4ZYQ A;  3NH4 A;  1R3N A;  4X8I A;  3D7F A;  4MHZ A;  1KWM A;  4P6Y A;  4MCQ A;  3BI0 A;  1ARL A;  2O4H A;  3H8F A;  5K8O A;  2POK A;  3CDX A;  3H8G A;  4F9V A;  3S9L A;  2CIJ A;  4NGP A;  5K8M A;  3BXM A;  4FAI A;  3I74 A;  3T8W A;  2PJC A;  5F09 A;  2AFX A;  1HEE A;  4A37 A;  3B3T A;  4MCR A;  4NGT A;  4OID A;  4TJX A;  1FT7 A;  2G9D A;  2PJ7 A;  3MN8 A;  4EWT A;  4MCP A;  5LRG A;  2NYQ A;  1F2P A;  4UEF A;  2PRQ A;  2V8V A;  4YWY A;  1IGB A;  2PCU A;  3DLJ A;  4C9U A;  2CF4 A;  4R7M A;  2V8H A;  4P4J A;  3GLJ A;  5IB9 A;  4W9Y A;  3GB0 A;  3PRT A;  4IK2 A;  7CPA A;  3FX6 A;  4PXE A;  4IHM A;  4EME A;  1Y7E A;  1FNO A;  3D68 A;  5THW A;  2JEW A;  4KNG E;  1XBU A;  2AFZ A;  2PJ0 A;  4WWV A;  3PB9 X;  2QVP A;  3VH9 A;  2IJZ A;  4MXU A;  3B3S A;  2PJ9 A;  4C84 A;  4MHN A;  4UIB A;  1CX8 A;  1XMB A;  1LOK A;  4WJB A;  3N5F A;  3PB4 X;  3K2K A;  3SI2 A;  4OC5 A;  4X3R A;  1HDU A;  5ELY A;  3PB7 X;  2GP4 A;  1LAM A;  3NH8 A;  3SJE A;  1TKH A;  2IQ6 A;  1ZG8 A;  5HXD A;  3QNV A;  2AFU A;  2EK9 A;  2GU2 A;  3IEH A;  2GLF A;  3IC1 A;  1CPX A;  1VHE A;  5LYI A;  3FF3 A;  4DJL A;  4OC1 A;  2ZEG A;  3WC6 A;  3PFE A;  3K9T A;  3B3C A;  1QQ9 A;  1BLL E;  4PXD A;  3IWW A;  2V8D A;  1JQG A;  2GRE A;  5IR2 A;  3FEC A;  2Q4Z A;  3MRU A;  2RFH A;  1CPS A;  3NFZ A;  4FWU A;  1HDQ A;  4TJV A;  1NSA A;  1LAP A;  2ANP A;  4DYO A;  1PCA A;  2CTB A;  1IY7 A;  1LAN A;  4DUK A;  1TKJ A;  1YW4 A;  2J9A A;  4YU9 A;  3ICU A;  2F8H A;  2XEF A;  2ZEP A;  2C6C A;  1EE3 P;  4B6Z A;  3KI9 A;  3B3W A;  2FVG A;  1XRY A;  3D66 A;  2HC9 A;  2XEG A;  4MMO A;  3CT9 A;  3ISX A;  4UF4 A;  5LYL A;  3VTA A;  2AFS A;  1F2O A;  3KAS A;  1ARM A;  2ZEM A;  1YW6 A;  4C8F A;  3RAM A;  3SJG A;  2GLJ A;  3LWU A;  2Q51 A;  3KR4 A;  1ZLH A;  2EWB A;  4KSI A;  3ISZ A;  1Y0R A;  4JYW A;  2HB6 A;  4OC3 A;  2ZOG A;  2ZED A;  4ZX8 A;  1V6C A;  4C8U A;  2RB7 A;  4FUU A;  1TF9 A;  3DGV A;  2I3C A;  2BO9 A;  2PJ6 A;  1TKF A;  2JBJ A;  4UIA A;  1DE4 C;  2QJ8 A;  3D67 A;  3D7H A;  3NA6 A;  2ZEE A;  4MRI A;  1PYT B;  2PJA A;  2QYV A;  4MHP A;  4A38 A;  2PJ5 A;  4NJQ A;  4C9V A;  4CDJ A;  4F9U A;  3KHZ A;  5LRK A;  4ZY0 A;  3TC8 A;  2VL1 A;  4PXB A;  5CPA A;  2AFM A;  1ZG7 A;  3H8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...