3D7DA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcfbd, a urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 263
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7dA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7dA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7dA02
3D7GA 4OC3A 1CPXA 1YW4A 2PIZA 4OC4A 1ZG8A 3ISXA 4F9UA 2CF4A 2GREA 2XEJA 3S9MA 4NJQA 4WWVA 2V8VA 2WYRA 4NGPA 1LCPA 2PJCA 4NGNA 5LRGA 2PIYA 3IFEA 2EWBA 3NFZA 2IQ6A 4UEFA 5LYDA 2JEWA 3SI2A 1Y7EA 4A38A 3SJFA 2BO9A 4IHMA 2ZEHA 2CTCA 4MHPA 3SJEA 3B35A 3T8WA 4OC2A 4MCQA 1ZLHA 1CG2A 1WVMA 4WJBA 2ZEPA 5F09A 4LQGA 4EFDA 2ZEOA 4C8FA 3B2YA 1XF1A 4P45A 2EK8A 4P4DA 3PBEA 2PJAA 3IC1A 4MCSA 4OIWA 3BXMA 3H8EA 2HC9A 2GLJA 1ZG7A 2I3CA 4MMOA 2V8DA 1IGBA 2GLFA 5I4MA 3V38A 1TKJA 1Q7LA 2QYVA 4P10A 3PBBA 1TF8A 3LMSA 2PVWA 1LANA 3D7DA 4TWEA 4PXBA 2PJ8A 1QQ9A 2IJZA 4UEZA 3KR5A 4NJRA 5D8NA 4B6ZA 3EIFA 3B3VA 2PJ7A 4C85A 5ELYA 3BI1A 1F57A 3B3SA 3NH8A 5K8MA 2C6CA 3DGVA 4AXVA 1R3NA 4CPAA 1CP6A 5CPAA 1KWMA 4C99A 5JH9A 4ZI6A 4OC1A 4CDJA 5LRJA 1YSJA 4P4EA 3KASA 2ZELA 3I1UA 2JBJA 4YU9A 3TX8A 4UF4A 5HVHA 5JM6A 5LYIA 3L2NA 3ICUA 1F2PA 2OOTA 1Y0RA 3NA6A 4TJXA 1V6CA 2AFMA 3HUVA 1R43A 4OKOA 1TXRA 3FVLA 3MN8A 2V8GA 3N5FA 4NGRA 1PYTB 4JZ0A 3DLJA 2ZEMA 1NSAA 4O23A 2IMOA 3IIBA 1FNOA 4PPZA 3FF3A 1XBUA 1VHEA 2BOAA 4Q7AA 4DYOA 2ZEDA 1YW6A 2PJ0A 3PB7X 3HLPA 5K8NA 4NGQA 3IJ3A 4UIBA 2ZOGA 3VATA 3WC6A 2VL1A 4OC0A 1XFOA 1LAMA 3I74A 2BCOA 2F8HA 2Q4ZA 1Z2LA 4EWTA 1CBXA 4OIDA 4C9VA 4ZYQA 4P44A 1HDQA 1XJOA 4NFRA 4F8ZA 2QJ8A 5DS0A 5D29A 1XRYA 3KHXA 1EE3P 3CT9A 4FWUA 2C6GA 2XEGA 3KGQA 4OP4A 4C8UA 3BHXA 1CP7A 3VH9A 5LRKA 3B3WA 4A39A 2Q51A 4C9AA 3S9NA 1VIXA 4CDKA 2DEAA 2FVGA 4FAIA 4MCPA 3WABA 3SI1A 3B3TA 4A37A 1ZLIA 5J1QA 2XEFA 1YMEA 2JBKA 3VTAA 2AFZA 5IB9A 4F9VA 4MRIA 3VARA 4MHYA 4GM5A 3S9LA 1VHOA 2PJBA 4A94A 4P4IA 2O53A 2O4HA 2PJ1A 4ZY1A 3K9TA 4PQAA 3GB0A 3PB4X 4P4FA 4R6TA 4EMEA 3B3CA 3D67A 4ONWA 4C9RA 1ARMA 4R8FA 3WC7A 3PFOA 2PJ6A 1GYTA 4C8AA 1Y9ZA 4IAVA 3K2KA 4P4JA 3IEHA 4X8IA 4C8PA 3D68A 3NH5A 4UEEA 1ELLP 5K8PA 3I6SA 4ZY2A 1DE4C 4R76A 4X2TA 4MCRA 3FX6A 4P6YA 3SJXA 1XMBA 3IWWA 1TKHA 1LAPA 1BPMA 4OC5A 5LYFA 1TF9A 3MRUA 3SI0A 1Z8LA 2Q43A 2AFUA 1VGYA 1Y0YA 2PJ2A 3KL9A 2XEIA 3IO1A 3KZWA 1LFWA 2AFXA 4P4BA 2PJ5A 3FEEA 3BI0A 4ZY0A 3GLJA 1ZG9A 4R7MA 3ISZA 2ZEFA 3B7IA 2PCUA 4UIAA 4DJLA 1BPNA 1ARLA 2AFOA 2POKA 2ABZA 5THWA 2V8HA 7CPAA 2ANPA 2AFWA 2PJ9A 2CIJA 1CPSA 1F2OA 1HEEA 3PFEA 4C8CA 1UWYA 4NGSA 2CTBA 1AYEA 3RBUA 4C9EA 2V77A 3CDXA 3WC5A 4W9YA 4JYWA 2PRQA 2RFHA 1JQGA 1OBRA 1BAVA 2ZOFA 4FUUA 5LYLA 4KNGE 3H8GA 5CBMA 3V7ZA 3PRTA 4IK2A 3SJGA 3KQXA 3D66A 3QNVA 3FJUA 3RZAA 1AMPA 1LOKA 2NSMA 3PEIA 3PB8X 4X3RA 4C9UA 4C86A 3JRUA 1FT7A 3D7FA 3GUXA 2QVPA 3NH4A 2ZEGA 3PB9X 1ELMP 5HVFA 4H2KA 2OR4A 4NGMA 1M4LA 5K8OA 4KSIA 3CPAA 3KI9A 4PXEA 4K3NA 4TJVA 3H8FA 4PXDA 2PVVA 4TNUA 3D7HA 2ZEEA 3LWUA 6CPAA 3WT4A 1Z5RA 3D4UA 3KQZA 2EK9A 3RAMA 3FECA 4FBEA 2F7VA 4MXUA 1IY7A 1PCAA 4RUHA 3PB6X 2WZNA 1QMUA 2G9DA 2J9AA 4DUKA 1CX8A 4G1PA 1RTQA 3FMCA 3KHZA 3KR4A 1DTDA 4MHNA 4C84A 2C6PA 4BD9A 2PJ4A 4ZX9A 4YWYA 1H8LA 8CPAA 4Z65A 1HDUA 2PE3A 3CPXA 5JGFA 1TKFA 2HB6A 2GU2A 2C1CA 2NYQA 4ZX8A 2ZENA 4MHZA 1YLOA 4C8TA 4NGTA 2PJ3A 3FH4A 5HVGA 3FEDA 5HXDA 3TC8A 4YN3A 1BLLE 2AFSA 2RB7A 4PXCA 4OMEA
chains in the Genus database with same CATH superfamily
4AVCA 3D7GA 4OC3A 1CPXA 1YW4A 4KUBA 5AG4A 1MJ9A 2PIZA 2VI7A 1QSOA 4OC4A 1IOFA 1ZG8A 3ISXA 1KZFA 4U9ZA 3R9EA 4F9UA 3S6KA 1NSLA 2CF4A 4PK2A 2GREA 4PSWA 2XEJA 1S7NA 3S9MA 4NJQA 4WWVA 2V8VA 1IICA 2WYRA 3GYAA 1TIQA 3IWEA 4NGPA 4B5OA 1LCPA 2PJCA 4CRYB 4NGNA 5LRGA 2PIYA 3U88C 3IFEA 2EWBA 2VBQA 2YJTA 4A95A 4R3KA 3NFZA 2Z3PA 2IQ6A 3R95A 4UEFA 5LYDA 2FIAA 2JEWA 3GKRA 3ZZIA 4CGMA 5KTDA 3R9GA 3SI2A 3A9LA 2Z10A 1Y7EA 2GFQA 4OAEA 3SJFA 4A38A 1EZAA 2NMTA 2BO9A 4IHMA 4IF5A 4CGOA 1Q2DA 2ZEHA 4JLYA 4B5PA 3SR3A 2CTCA 2Q04A 4MHPA 5HH1A 3SJEA 3B35A 4UCMA 4CO9A 4MFKA 1XIXA 3T8WA 4MY3A 4OC2A 2AUNA 1Z4EA 1I1DA 2G0BA 4MCQA 1ZLHA 2GIVA 1CG2A 2WSAA 3H5ZA 4KVXA 4WJBA 1WVMA 4JXRA 2DLAA 2EBJA 5BY0A 5F09A 4LQGA 2G3AA 2ZEPA 4HPSA 5EBVA 4EFDA 2ZEOA 4YFJA 2D0PA 3B2YA 4KOWA 2FL4A 4P45A 1XF1A 4C8FA 2EK8A 4P4DA 2HWGA 3BUWB 1VKCA 3IU1A 3PBEA 2PJAA 3IC1A 4MCSA 4OIWA 2PR1A 2HV2A 4BPUB 4H89A 1YVHA 3BXMA 2HC9A 2GLJA 3H8EA 3G23A 4J0NA 1U6MA 3EFAA 1ZG7A 2I3CA 4CAWA 4MMOA 5IR2A 2Z3OA 4NXYA 3CXQA 3GIUA 2Q0YA 2V8DA 3GY9A 3IWGA 1IGBA 2GLFA 4KOVA 3IU2A 3TOBA 4PV6A 4A33A 5HMNA 2C5QA 5I4MA 4COBA 3V38A 1TKJA 1Q7LA 4B12A 4CS0B 3PZJA 2QYVA 3FNCA 4MBUA 2D0OA 1DIKA 4P10A 1Y9KA 3PBBA 4CRZB 1TF8A 3LMSA 2PVWA 1J4JA 1LANA 3D7DA 1QSRA 4TWEA 2GP4A 2EUIA 3TO7A 3PFVA 4PXBA 1BXRB 2PJ8A 1QQ9A 2IJZA 4UEZA 3KR5A 1KUYA 2OB0A 2PRBA 4NJRA 5FD8A 5CNPA 5D8NA 4MJXA 4B6ZA 3EIFA 4IIYA 4K30A 3VRPA 4BMHA 3B3VA 1A2ZA 2PJ7A 4C85A 1V0CA 1Q2YA 5ELYA 1N71A 3BI1A 3FB3A 2DF5A 1F57A 3B3SA 3JTKA 3NH8A 5K8MA 4R3LA 4UFWA 2C6CA 3DGVA 3OB1B 1YVOA 2Q7SA 3LACA 1R3NA 4AXVA 2ZXVA 3T9YA 4CPAA 1CP6A 3B8GA 1KWMA 1L0CA 5CPAA 4C99A 4AVBA 5JH9A 5F5XA 4ZI6A 4B10A 4OC1A 4AB7A 1Q5XA 2R82A 4ORFA 4XPDB 4CDJA 3NFQA 3TCVA 5LRJA 2QMLA 2B4BA 1S7LA 1YSJA 1WJTA 4P4EA 3KASA 3P2FA 5AG5A 2ZELA 3I1UA 2JBJA 4JWPA 4YU9A 4UA3A 3TX8A 4UF4A 5HVHA 2XPOA 5JM6A 5LYIA 3L2NA 3ICUA 1F2PA 3T05A 2B3VA 2OOTA 1Y0RA 3NA6A 4TJXA 3SXOA 1V6CA 1J3LA 2AFMA 2REEA 3HUVA 4MFZA 1R43A 4H6UA 1XEBA 2GANA 4FD6A 4OKOA 4B5PB 1VBGA 1ZRSA 2HI6A 1TXRA 2PDOA 3CXSA 4COGA 4RN7A 2FIWA 2R8VA 4QB9A 4CAEA 3FVLA 1VBHA 2I00A 4U5YA 1S3ZA 3MN8A 4BTFA 3VWDA 3W6XA 4E0AA 3OAKA 2V8GA 4XNHB 1UFHA 3F8KA 3N5FA 4R87A 4NGRA 1R57A 1PYTB 3G3SA 4ZBGA 4C68A 4JZ0A 3DLJA 2ZEMA 5AXIA 2B3UA 1QSTA 2REFA 5JYBA 1NSAA 2PSWA 5DWNA 1VHSA 2CNTA 3NE7A 2D4OA 2FCKA 4CYQA 5EC4A 4O23A 2IMOA 5KTCA 3KRVA 3TLBA 4UFVA 3IIBA 1FNOA 1M4GA 2Z3MA 1S7FA 3FBUA 3FF3A 4PPZA 1B87A 1XBUA 1VHEA 1YK3A 2BOAA 5HVFA 3K4IA 4UBRA 5FVJA 2GE3A 4NF1A 4Q7AA 5AG7A 4DYOA 2ZEDA 3P2HA 3HPGG 1YW6A 2PJ0A 3QB8A 4FD4A 3PB7X 3HLPA 1Y7RA 4NGQA 3IJ3A 1MJBA 2ZOGA 4HKFA 4MFQA 2XPNA 1M1DA 4UIBA 3VATA 3WC6A 3K9UA 2VL1A 4H6ZA 3I9SA 2D4PA 4OC0A 1XFOA 1LAMA 4L89A 2BL1A 2Q4VA 4LQ6A 3I74A 3BUMB 2BCOA 2F8HA 5G1ZA 3EZEA 2P6GA 2Q4YA 4UCNA 5K8NA 1EO0A 2Q4ZA 1IOIA 1Z2LA 2OZGA 2OLSA 4EWTA 2ZW5A 1C3OB 1CBXA 4OIDA 2B4DB 3HPHE 1A9XB 1MK4A 4C9VA 1Z4RA 4ZYQA 2P6EA 4A32A 4P44A 4QVTA 3DSBA 4EVYA 4F6AA 3TT2A 2Z3KA 4L8AA 1XOVA 1XJOA 4BPXB 1HDQA 4NFRA 3RO0A 3T90A 4F8ZA 2PCNA 2R98A 2FE7A 4DNCA 4BINA 4OLLA 1M4IA 4F0YA 2AJ6A 2QECA 2QJ8A 5DS0A 2DPTA 5E96A 2UV8G 3G8WA 2YNDA 3FIXA 4XPKA 1IYLA 2X7BA 5D29A 1XRYA 3KHXA 3IGRA 1EE3P 3MGDA 3S6FA 4C2YA 5JPHA 5F48A 3CT9A 2FSRA 4FWUA 2C6GA 2XEGA 5H86A 3KGQA 2VEZA 3H4QA 1YGHA 3OWCA 4OP4A 4C8UA 4KORA 4MI4A 4M8DA 3TFYA 4GXHA 3BHXA 1Z9UA 1CP7A 4YGOA 1GHEA 3VH9A 2BSWA 1LRZA 1S5KA 5LRKA 3HMJG 3B3WA 4KVOE 4A39A 2Q51A 3EZBA 4C9AA 4I49A 1FY7A 3SHPA 4XPLA 4KVME 1C30B 3S9NA 1VIXA 2ARHA 4CDKA 2DEAA 2FVGA 2VQYA 4FAIA 4MCPA 4E5SA 3TLGA 4C7HA 1YX0A 3WABA 3SI1A 3B3TA 3TLYA 4A37A 1ZLIA 2B5GB 4GS4A 2XEFA 1YMEA 4A4BA 2JBKA 2DXQA 4RI1A 4UCPA 4Y49C 2Z11A 5ISVA 3GJZA 3VTAA 3EZAA 2AFZA 2B4DA 3BLNA 1ZYMA 5IB9A 3W6SA 1YR0A 4CAXA 4M85A 4CGPA 4F9VA 4MI1A 5F46A 3EXNA 4MRIA 4CYOA 3VARA 1NE9A 1CE8B 1WK4A 4MHYA 2P6FA 4GM5A 3S9LA 1VHOA 3TE4A 2CNMA 1MJAA 1WWZA 2JDCA 2K5TA 2OH1A 2PJBA 4A94A 4CGLA 4P4IA 2O53A 2O4HA 1YQEA 2PJ1A 3DR8A 4IUSA 2ZW7A 1YVKA 2H5MA 4AG9A 2HQYA 4ZY1A 1AUGA 1EZBA 3EC4A 4JVOA 3T07A 3K9TA 5K99A 4PQAA 3GB0A 5F13A 3PB4X 4P4FA 3V8IA 5IV0A 3DNSA 4CZ1A 3BUXB 4M6GA 4R6TA 3VRQA 4EMEA 5IX3A 3B3CA 4B11A 3D67A 4MHDA 4ONWA 1ZO0A 4C9RA 2WPWA 3FYNA 1ARMA 1KUVA 4QC6A 3LODA 4J3GA 2RC4A 4R8FA 4HNXB 1OZPA 3WC7A 3PFOA 4NCZA 2PJ6A 1GYTA 2AE6A 4QUSA 5BWAB 4NEXA 1Y9ZA 2Z3NA 4IAVA 3K2KA 2DIKA 4C8AA 4JXQA 4P4JA 2Z3LA 3IEHA 3R1KA 4X8IA 2J8MA 1JDBC 3JUWA 4C8PA 2B5GA 3CXPA 3D68A 3NH5A 5I0CA 4UEEA 1ELLP 5K8PA 2FM4A 3I6SA 4ZY2A 1DE4C 1RXTA 4R76A 3TLAA 5J8CA 4X2TA 1M44A 4MCRA 1RO5A 3R9FA 4JD6A 3FX6A 4P6YA 2XPPA 5A28A 3SJXA 4BPWB 3TO9A 1XMBA 3IWWA 4CGNA 1TKHA 1LAPA 1B47A 1BPMA 4OC5A 4MFJA 3PLFB 5LYFA 1TF9A 3MRUA 2MP0A 3SI0A 1Z8LA 2Q43A 4MY0A 2AFUA 4KLWA 3BUOB 5JVLA 5HKYA 3PT1A 4FD7A 1Y0YA 1PU9A 1VGYA 3D2PA 2FT0A 3C26A 4PK3A 2PJ2A 4A4CA 3KL9A 2Q7BA 2DPSA 2YGWA 4KUAA 4MJ8A 1CM0A 4A30A 2HUZA 2XEIA 3IO1A 3ZJ0A 3KZWA 1LFWA 4KS9A 2AFXA 3JVNA 2CBLA 2EVNA 1JDEA 4IIXA 3TYXA 3FRMA 3KKWA 5IB0A 4P4BA 4LUAA 2PJ5A 3FEEA 3BI0A 1S7KA 4A2ZA 3TLGB 5HKWA 4EYSA 4KOXA 1I21A 3ZNIA 4ZY0A 2P0WA 2WPXA 1ZG9A 3GLJA 1X10A 4R7MA 3WR7A 3ISZA 2PQ8A 2ZEFA 2PR8A 3B7IA 2B58A 2PCUA 1NXJA 2VZYA 4UIAA 4GPLB 4II9A 2PC1A 3NOJA 3DR6A 4C2XA 4DJLA 1BO4A 5H84A 1BPNA 1JWQA 2O28A 4QBJA 1ARLA 4M6IA 2YNCC 4MFPA 2AFOA 4ONUA 5G21A 2POKA 3DDDA 1KC7A 1BOBA 1IU8A 5G20A 2ABZA 2EZCA 5F49A 1XMTA 5THWA 5A27A 2V8HA 3SXNA 2Z0ZA 5F9MA 3TLCA 2VKZG 3R96A 1M4DA 7CPAA 2ANPA 2AFWA 3TLEA 4M3SA 2PJ9A 2Y1MA 5J3XA 4RR2B 4KOTA 1KEEB 2AUMA 2CIJA 1NBWA 1CPSA 1F2OA 1HEEA 3PFEA 2J8RA 5F47A 4AVAA 4C8CA 1UWYA 4NGSA 2CTBA 1AYEA 2B4JC 3RBUA 3TO6A 4B13A 4C9EA 3RYOA 2V77A 1NMTA 5J1QA 1K4JA 4UWJA 3CDXA 3WC5A 4W9YA 4Q36A 4JYWA 1X12A 2PRQA 2RFHA 3D8PA 1YLEA 1Z9EA 1JQGA 3E0KA 3T5MA 1XE4A 1OBRA 1BAVA 1Q2CA 1XF8A 1Z8XA 4ZGYB 1VI4A 2ZOFA 4FUUA 4KOUA 3U1BA 4NSQA 4M6HA 5LYLA 4KNGE 3H8GA 4UWIA 3O8ZA 4E8OA 3V7ZA 5CBMA 1ZL0A 3PRTA 4IK2A 3SJGA 3KQXA 3D66A 4KLVA 3QNVA 3FJUA 3RZAA 1M6VB 3N7ZA 4LX9A 2ATRA 4KSAA 4Y49B 3VGOA 1AMPA 2FXFA 2R7HA 3D2MA 3PGPA 1LOKA 3QAYA 3D3SA 4U9YA 4UFXA 2FS5A 3TOAA 2NSMA 4BBHA 2R1IA 3OB2B 3PEIA 3PB8X 4X3RA 3UY5A 4C9UA 4C86A 3NE8A 3JRUA 1FT7A 3D7FA 1ON0A 2JLMA 2QVPA 1QSNA 3GUXA 3NH4A 3W91A 2YJVA 2ZEGA 3PB9X 4CYNA 4B14A 4X5KA 1ELMP 5EMIA 4C7IA 2JDDA 1IIDA 2Y0MA 4H2KA 2OR4A 4NGMA 1M4LA 2EO8A 2ZW4A 4Q38A 4KSIA 3CPAA 1FBVA 4R57A 4R9MA 5K8OA 2WUUA 1S60A 2KCWA 3KI9A 2OZHA 5AGEA 1Z8WA 3F5BA 2A4NA 4PXEA 4C2ZA 3T0TA 4K3NA 4XPDC 4TJVA 1I12A 3H8FA 2C27A 4PXDA 2PVVA 3VROA 4TNUA 3D7HA 2YNCA 4E2AA 2ZEEA 2OU2A 2I79A 3LWUA 6CPAA 3WT4A 1P4NA 1Z5RA 3D4UA 2EK9A 3KQZA 3RAMA 3S6HA 1T36B 3FECA 5DWMA 2B0AA 4FBEA 1YREA 4HNWB 2F7VA 5AG6A 2E28A 4MXUA 1KUXA 1IY7A 4AG7A 4KOSA 2BEIA 5C82A 1PCAA 2CXAA 5G22A 3EO4A 4CYPA 3TLZA 4KOYA 4A31A 4RUHA 3PB6X 2WZNA 1PUAA 2X0SA 1QMUA 1KBLA 2EZAA 2F5IA 2CNSA 2G9DA 4PSXA 4HNYB 2J9AA 4DUKA 4CAFA 1CX8A 4G1PA 3VRNA 1RTQA 2J8NA 2ZW6A 3FMCA 4FD5A 1P0HA 2ODFA 3KHZA 3KR4A 1DTDA 2N3AB 5HKZA 1QSMA 3FXTA 4MHNA 3F0AA 2BUEA 4INJA 4C84A 4OADA 2VZZA 2C6PA 4BD9A 4KZTA 2IL4A 2PJ4A 2Q44A 3F9KC 4XNHC 4ZX9A 3VRRA 4H1HA 2ZPAA 4YWYA 4E94A 3BUNB 4JJXA 1H8LA 2VXKA 3LD2A 1SQHA 8CPAA 4Z65A 3CZXA 3PP9A 5C88A 1CS0B 1R61A 1HDUA 2XPLA 2HROA 2PE3A 3CPXA 3S6GA 1GGOA 2CY2A 1CJWA 1TKFA 5JGFA 4RS2A 2HB6A 2GU2A 3BJ8A 2C1CA 2NYQA 3BJ7A 4YRHA 2QIRA 5J8FA 4ZX8A 4F0XA 2ZENA 4MHZA 2Y1NA 1YLOA 4C8TA 3C8OA 5KTAA 3OP0A 4NGTA 2PJ3A 3RNZA 5JQ4A 2G3TA 2JEVA 1Y9WA 1Z8TA 2OZUA 3FH4A 5HVGA 3FEDA 2EZBA 5HXDA 1B6BA 3QAHA 3TC8A 3I3GA 4YN3A 1BLLE 1IYKA 2AFSA 4KSFA 2RB7A 4MFLA 4PXCA 5GCNA 3TTHA 3VWEA 1IB1E 4CAVA 4OMEA 5F1YA 3EY5A 2YNEA
chains in the Genus database with same CATH topology
3D7GA 4OC3A 1CPXA 1YW4A 2PIZA 4OC4A 1ZG8A 3ISXA 4F9UA 2CF4A 2GREA 2XEJA 3S9MA 4NJQA 4WWVA 2V8VA 2WYRA 4NGPA 1LCPA 2PJCA 4NGNA 5LRGA 2PIYA 3IFEA 2EWBA 3NFZA 2IQ6A 4UEFA 5LYDA 2JEWA 3SI2A 1Y7EA 4A38A 3SJFA 2BO9A 4IHMA 2ZEHA 2CTCA 4MHPA 3SJEA 3B35A 3T8WA 4OC2A 4MCQA 1ZLHA 1CG2A 1WVMA 4WJBA 2ZEPA 5F09A 4LQGA 4EFDA 2ZEOA 4C8FA 3B2YA 1XF1A 4P45A 2EK8A 4P4DA 3PBEA 2PJAA 3IC1A 4MCSA 4OIWA 3BXMA 3H8EA 2HC9A 2GLJA 1ZG7A 2I3CA 4MMOA 5IR2A 2V8DA 1IGBA 2GLFA 2C5QA 5I4MA 3V38A 1TKJA 1Q7LA 2QYVA 4P10A 3PBBA 1TF8A 3LMSA 2PVWA 2GP4A 1LANA 3D7DA 4TWEA 4PXBA 2PJ8A 1QQ9A 2IJZA 4UEZA 3KR5A 4NJRA 5D8NA 4B6ZA 3EIFA 3B3VA 2PJ7A 4C85A 5ELYA 3BI1A 1F57A 3B3SA 3NH8A 5K8MA 2C6CA 3DGVA 4AXVA 1R3NA 4CPAA 1CP6A 5CPAA 1KWMA 4C99A 5JH9A 4ZI6A 4OC1A 4CDJA 5LRJA 1YSJA 4P4EA 3KASA 2ZELA 3I1UA 2JBJA 4YU9A 3TX8A 4UF4A 5HVHA 5JM6A 5LYIA 3L2NA 3ICUA 1F2PA 2OOTA 1Y0RA 3NA6A 4TJXA 1V6CA 2AFMA 3HUVA 1R43A 4OKOA 1TXRA 3FVLA 3MN8A 2V8GA 3N5FA 4NGRA 1PYTB 4JZ0A 3DLJA 2ZEMA 1NSAA 4O23A 2IMOA 3IIBA 1FNOA 4PPZA 3FF3A 1XBUA 1VHEA 2BOAA 4Q7AA 4DYOA 2ZEDA 1YW6A 2PJ0A 3PB7X 3HLPA 5K8NA 4NGQA 3IJ3A 4UIBA 2ZOGA 3VATA 3WC6A 2VL1A 4OC0A 1XFOA 1LAMA 3I74A 2BCOA 2F8HA 2Q4ZA 1Z2LA 4EWTA 1CBXA 4OIDA 4C9VA 4ZYQA 4P44A 1HDQA 1XJOA 4NFRA 4F8ZA 2QJ8A 5DS0A 5D29A 1XRYA 3KHXA 1EE3P 3CT9A 4FWUA 2C6GA 2XEGA 3KGQA 4OP4A 4C8UA 3BHXA 1CP7A 3VH9A 5LRKA 3B3WA 4A39A 2Q51A 4C9AA 3S9NA 1VIXA 4CDKA 2DEAA 2FVGA 4FAIA 4MCPA 3WABA 3SI1A 3B3TA 4A37A 1ZLIA 5J1QA 2XEFA 1YMEA 2JBKA 3VTAA 2AFZA 5IB9A 4F9VA 4MRIA 3VARA 4MHYA 4GM5A 3S9LA 1VHOA 2PJBA 4A94A 4P4IA 2O53A 2O4HA 2PJ1A 4ZY1A 3K9TA 4PQAA 3GB0A 3PB4X 4P4FA 4R6TA 4EMEA 3B3CA 3D67A 4ONWA 4C9RA 1ARMA 4R8FA 3WC7A 3PFOA 2PJ6A 1GYTA 4C8AA 1Y9ZA 4IAVA 3K2KA 4P4JA 3IEHA 4X8IA 4C8PA 3D68A 3NH5A 4UEEA 1ELLP 5K8PA 3I6SA 4ZY2A 1DE4C 4R76A 4X2TA 4MCRA 3FX6A 4P6YA 3SJXA 1XMBA 3IWWA 1TKHA 1LAPA 1BPMA 4OC5A 5LYFA 1TF9A 3MRUA 3SI0A 1Z8LA 2Q43A 2AFUA 1VGYA 1Y0YA 2PJ2A 3KL9A 2XEIA 3IO1A 3KZWA 1LFWA 2AFXA 4P4BA 2PJ5A 3FEEA 3BI0A 4ZY0A 3GLJA 1ZG9A 4R7MA 3ISZA 2ZEFA 3B7IA 2PCUA 4UIAA 4DJLA 1BPNA 1ARLA 2AFOA 2POKA 2ABZA 5THWA 2V8HA 7CPAA 2ANPA 2AFWA 2PJ9A 2CIJA 1CPSA 1F2OA 1HEEA 3PFEA 4C8CA 1UWYA 4NGSA 2CTBA 1AYEA 3RBUA 4C9EA 2V77A 3CDXA 3WC5A 4W9YA 4JYWA 2PRQA 2RFHA 1JQGA 1OBRA 1BAVA 2ZOFA 4FUUA 5LYLA 4KNGE 3H8GA 5CBMA 3V7ZA 3PRTA 4IK2A 3SJGA 3KQXA 3D66A 3QNVA 3FJUA 3RZAA 1AMPA 1LOKA 2NSMA 3PEIA 3PB8X 4X3RA 4C9UA 4C86A 3JRUA 1FT7A 3D7FA 3GUXA 2QVPA 3NH4A 2ZEGA 3PB9X 1ELMP 5HVFA 4H2KA 2OR4A 4NGMA 1M4LA 5K8OA 4KSIA 3CPAA 3KI9A 4PXEA 4K3NA 4TJVA 3H8FA 4PXDA 2PVVA 4TNUA 3D7HA 2ZEEA 3LWUA 6CPAA 3WT4A 1Z5RA 3D4UA 3KQZA 2EK9A 3RAMA 3FECA 4FBEA 2F7VA 4MXUA 1IY7A 1PCAA 4RUHA 3PB6X 2WZNA 1QMUA 2G9DA 2J9AA 4DUKA 1CX8A 4G1PA 1RTQA 3FMCA 3KHZA 3KR4A 1DTDA 4MHNA 4C84A 2C6PA 4BD9A 2PJ4A 4ZX9A 4YWYA 1H8LA 8CPAA 4Z65A 1HDUA 2PE3A 3CPXA 5JGFA 1TKFA 2HB6A 2GU2A 2C1CA 2NYQA 4ZX8A 2ZENA 4MHZA 1YLOA 4C8TA 4NGTA 2PJ3A 3FH4A 5HVGA 3FEDA 5HXDA 3TC8A 4YN3A 1BLLE 2AFSA 2RB7A 4PXCA 4OMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D7G A;  4OC3 A;  1CPX A;  1YW4 A;  2PIZ A;  4OC4 A;  1ZG8 A;  3ISX A;  4F9U A;  2CF4 A;  2GRE A;  2XEJ A;  3S9M A;  4NJQ A;  4WWV A;  2V8V A;  2WYR A;  4NGP A;  1LCP A;  2PJC A;  4NGN A;  5LRG A;  2PIY A;  3IFE A;  2EWB A;  3NFZ A;  2IQ6 A;  4UEF A;  5LYD A;  2JEW A;  3SI2 A;  1Y7E A;  4A38 A;  3SJF A;  2BO9 A;  4IHM A;  2ZEH A;  2CTC A;  4MHP A;  3SJE A;  3B35 A;  3T8W A;  4OC2 A;  4MCQ A;  1ZLH A;  1CG2 A;  1WVM A;  4WJB A;  2ZEP A;  5F09 A;  4LQG A;  4EFD A;  2ZEO A;  4C8F A;  3B2Y A;  1XF1 A;  4P45 A;  2EK8 A;  4P4D A;  3PBE A;  2PJA A;  3IC1 A;  4MCS A;  4OIW A;  3BXM A;  3H8E A;  2HC9 A;  2GLJ A;  1ZG7 A;  2I3C A;  4MMO A;  2V8D A;  1IGB A;  2GLF A;  5I4M A;  3V38 A;  1TKJ A;  1Q7L A;  2QYV A;  4P10 A;  3PBB A;  1TF8 A;  3LMS A;  2PVW A;  1LAN A;  3D7D A;  4TWE A;  4PXB A;  2PJ8 A;  1QQ9 A;  2IJZ A;  4UEZ A;  3KR5 A;  4NJR A;  5D8N A;  4B6Z A;  3EIF A;  3B3V A;  2PJ7 A;  4C85 A;  5ELY A;  3BI1 A;  1F57 A;  3B3S A;  3NH8 A;  5K8M A;  2C6C A;  3DGV A;  4AXV A;  1R3N A;  4CPA A;  1CP6 A;  5CPA A;  1KWM A;  4C99 A;  5JH9 A;  4ZI6 A;  4OC1 A;  4CDJ A;  5LRJ A;  1YSJ A;  4P4E A;  3KAS A;  2ZEL A;  3I1U A;  2JBJ A;  4YU9 A;  3TX8 A;  4UF4 A;  5HVH A;  5JM6 A;  5LYI A;  3L2N A;  3ICU A;  1F2P A;  2OOT A;  1Y0R A;  3NA6 A;  4TJX A;  1V6C A;  2AFM A;  3HUV A;  1R43 A;  4OKO A;  1TXR A;  3FVL A;  3MN8 A;  2V8G A;  3N5F A;  4NGR A;  1PYT B;  4JZ0 A;  3DLJ A;  2ZEM A;  1NSA A;  4O23 A;  2IMO A;  3IIB A;  1FNO A;  4PPZ A;  3FF3 A;  1XBU A;  1VHE A;  2BOA A;  4Q7A A;  4DYO A;  2ZED A;  1YW6 A;  2PJ0 A;  3PB7 X;  3HLP A;  5K8N A;  4NGQ A;  3IJ3 A;  4UIB A;  2ZOG A;  3VAT A;  3WC6 A;  2VL1 A;  4OC0 A;  1XFO A;  1LAM A;  3I74 A;  2BCO A;  2F8H A;  2Q4Z A;  1Z2L A;  4EWT A;  1CBX A;  4OID A;  4C9V A;  4ZYQ A;  4P44 A;  1HDQ A;  1XJO A;  4NFR A;  4F8Z A;  2QJ8 A;  5DS0 A;  5D29 A;  1XRY A;  3KHX A;  1EE3 P;  3CT9 A;  4FWU A;  2C6G A;  2XEG A;  3KGQ A;  4OP4 A;  4C8U A;  3BHX A;  1CP7 A;  3VH9 A;  5LRK A;  3B3W A;  4A39 A;  2Q51 A;  4C9A A;  3S9N A;  1VIX A;  4CDK A;  2DEA A;  2FVG A;  4FAI A;  4MCP A;  3WAB A;  3SI1 A;  3B3T A;  4A37 A;  1ZLI A;  5J1Q A;  2XEF A;  1YME A;  2JBK A;  3VTA A;  2AFZ A;  5IB9 A;  4F9V A;  4MRI A;  3VAR A;  4MHY A;  4GM5 A;  3S9L A;  1VHO A;  2PJB A;  4A94 A;  4P4I A;  2O53 A;  2O4H A;  2PJ1 A;  4ZY1 A;  3K9T A;  4PQA A;  3GB0 A;  3PB4 X;  4P4F A;  4R6T A;  4EME A;  3B3C A;  3D67 A;  4ONW A;  4C9R A;  1ARM A;  4R8F A;  3WC7 A;  3PFO A;  2PJ6 A;  1GYT A;  4C8A A;  1Y9Z A;  4IAV A;  3K2K A;  4P4J A;  3IEH A;  4X8I A;  4C8P A;  3D68 A;  3NH5 A;  4UEE A;  1ELL P;  5K8P A;  3I6S A;  4ZY2 A;  1DE4 C;  4R76 A;  4X2T A;  4MCR A;  3FX6 A;  4P6Y A;  3SJX A;  1XMB A;  3IWW A;  1TKH A;  1LAP A;  1BPM A;  4OC5 A;  5LYF A;  1TF9 A;  3MRU A;  3SI0 A;  1Z8L A;  2Q43 A;  2AFU A;  1VGY A;  1Y0Y A;  2PJ2 A;  3KL9 A;  2XEI A;  3IO1 A;  3KZW A;  1LFW A;  2AFX A;  4P4B A;  2PJ5 A;  3FEE A;  3BI0 A;  4ZY0 A;  3GLJ A;  1ZG9 A;  4R7M A;  3ISZ A;  2ZEF A;  3B7I A;  2PCU A;  4UIA A;  4DJL A;  1BPN A;  1ARL A;  2AFO A;  2POK A;  2ABZ A;  5THW A;  2V8H A;  7CPA A;  2ANP A;  2AFW A;  2PJ9 A;  2CIJ A;  1CPS A;  1F2O A;  1HEE A;  3PFE A;  4C8C A;  1UWY A;  4NGS A;  2CTB A;  1AYE A;  3RBU A;  4C9E A;  2V77 A;  3CDX A;  3WC5 A;  4W9Y A;  4JYW A;  2PRQ A;  2RFH A;  1JQG A;  1OBR A;  1BAV A;  2ZOF A;  4FUU A;  5LYL A;  4KNG E;  3H8G A;  5CBM A;  3V7Z A;  3PRT A;  4IK2 A;  3SJG A;  3KQX A;  3D66 A;  3QNV A;  3FJU A;  3RZA A;  1AMP A;  1LOK A;  2NSM A;  3PEI A;  3PB8 X;  4X3R A;  4C9U A;  4C86 A;  3JRU A;  1FT7 A;  3D7F A;  3GUX A;  2QVP A;  3NH4 A;  2ZEG A;  3PB9 X;  1ELM P;  5HVF A;  4H2K A;  2OR4 A;  4NGM A;  1M4L A;  5K8O A;  4KSI A;  3CPA A;  3KI9 A;  4PXE A;  4K3N A;  4TJV A;  3H8F A;  4PXD A;  2PVV A;  4TNU A;  3D7H A;  2ZEE A;  3LWU A;  6CPA A;  3WT4 A;  1Z5R A;  3D4U A;  3KQZ A;  2EK9 A;  3RAM A;  3FEC A;  4FBE A;  2F7V A;  4MXU A;  1IY7 A;  1PCA A;  4RUH A;  3PB6 X;  2WZN A;  1QMU A;  2G9D A;  2J9A A;  4DUK A;  1CX8 A;  4G1P A;  1RTQ A;  3FMC A;  3KHZ A;  3KR4 A;  1DTD A;  4MHN A;  4C84 A;  2C6P A;  4BD9 A;  2PJ4 A;  4ZX9 A;  4YWY A;  1H8L A;  8CPA A;  4Z65 A;  1HDU A;  2PE3 A;  3CPX A;  5JGF A;  1TKF A;  2HB6 A;  2GU2 A;  2C1C A;  2NYQ A;  4ZX8 A;  2ZEN A;  4MHZ A;  1YLO A;  4C8T A;  4NGT A;  2PJ3 A;  3FH4 A;  5HVG A;  3FED A;  5HXD A;  3TC8 A;  4YN3 A;  1BLL E;  2AFS A;  2RB7 A;  4PXC A;  4OME A; 
#chains in the Genus database with same CATH topology
 4AVC A;  3D7G A;  4OC3 A;  1CPX A;  1YW4 A;  4KUB A;  5AG4 A;  1MJ9 A;  2PIZ A;  2VI7 A;  1QSO A;  4OC4 A;  1IOF A;  1ZG8 A;  3ISX A;  1KZF A;  4U9Z A;  3R9E A;  4F9U A;  3S6K A;  1NSL A;  2CF4 A;  4PK2 A;  2GRE A;  4PSW A;  2XEJ A;  1S7N A;  3S9M A;  4NJQ A;  4WWV A;  2V8V A;  1IIC A;  2WYR A;  3GYA A;  1TIQ A;  3IWE A;  4NGP A;  4B5O A;  1LCP A;  2PJC A;  4CRY B;  4NGN A;  5LRG A;  2PIY A;  3U88 C;  3IFE A;  2EWB A;  2VBQ A;  2YJT A;  4A95 A;  4R3K A;  3NFZ A;  2Z3P A;  2IQ6 A;  3R95 A;  4UEF A;  5LYD A;  2FIA A;  2JEW A;  3GKR A;  3ZZI A;  4CGM A;  5KTD A;  3R9G A;  3SI2 A;  3A9L A;  2Z10 A;  1Y7E A;  2GFQ A;  4OAE A;  3SJF A;  4A38 A;  1EZA A;  2NMT A;  2BO9 A;  4IHM A;  4IF5 A;  4CGO A;  1Q2D A;  2ZEH A;  4JLY A;  4B5P A;  3SR3 A;  2CTC A;  2Q04 A;  4MHP A;  5HH1 A;  3SJE A;  3B35 A;  4UCM A;  4CO9 A;  4MFK A;  1XIX A;  3T8W A;  4MY3 A;  4OC2 A;  2AUN A;  1Z4E A;  1I1D A;  2G0B A;  4MCQ A;  1ZLH A;  2GIV A;  1CG2 A;  2WSA A;  3H5Z A;  4KVX A;  4WJB A;  1WVM A;  4JXR A;  2DLA A;  2EBJ A;  5BY0 A;  5F09 A;  4LQG A;  2G3A A;  2ZEP A;  4HPS A;  5EBV A;  4EFD A;  2ZEO A;  4YFJ A;  2D0P A;  3B2Y A;  4KOW A;  2FL4 A;  4P45 A;  1XF1 A;  4C8F A;  2EK8 A;  4P4D A;  2HWG A;  3BUW B;  1VKC A;  3IU1 A;  3PBE A;  2PJA A;  3IC1 A;  4MCS A;  4OIW A;  2PR1 A;  2HV2 A;  4BPU B;  4H89 A;  1YVH A;  3BXM A;  2HC9 A;  2GLJ A;  3H8E A;  3G23 A;  4J0N A;  1U6M A;  3EFA A;  1ZG7 A;  2I3C A;  4CAW A;  4MMO A;  5IR2 A;  2Z3O A;  4NXY A;  3CXQ A;  3GIU A;  2Q0Y A;  2V8D A;  3GY9 A;  3IWG A;  1IGB A;  2GLF A;  4KOV A;  3IU2 A;  3TOB A;  4PV6 A;  4A33 A;  5HMN A;  2C5Q A;  5I4M A;  4COB A;  3V38 A;  1TKJ A;  1Q7L A;  4B12 A;  4CS0 B;  3PZJ A;  2QYV A;  3FNC A;  4MBU A;  2D0O A;  1DIK A;  4P10 A;  1Y9K A;  3PBB A;  4CRZ B;  1TF8 A;  3LMS A;  2PVW A;  1J4J A;  1LAN A;  3D7D A;  1QSR A;  4TWE A;  2GP4 A;  2EUI A;  3TO7 A;  3PFV A;  4PXB A;  1BXR B;  2PJ8 A;  1QQ9 A;  2IJZ A;  4UEZ A;  3KR5 A;  1KUY A;  2OB0 A;  2PRB A;  4NJR A;  5FD8 A;  5CNP A;  5D8N A;  4MJX A;  4B6Z A;  3EIF A;  4IIY A;  4K30 A;  3VRP A;  4BMH A;  3B3V A;  1A2Z A;  2PJ7 A;  4C85 A;  1V0C A;  1Q2Y A;  5ELY A;  1N71 A;  3BI1 A;  3FB3 A;  2DF5 A;  1F57 A;  3B3S A;  3JTK A;  3NH8 A;  5K8M A;  4R3L A;  4UFW A;  2C6C A;  3DGV A;  3OB1 B;  1YVO A;  2Q7S A;  3LAC A;  1R3N A;  4AXV A;  2ZXV A;  3T9Y A;  4CPA A;  1CP6 A;  3B8G A;  1KWM A;  1L0C A;  5CPA A;  4C99 A;  4AVB A;  5JH9 A;  5F5X A;  4ZI6 A;  4B10 A;  4OC1 A;  4AB7 A;  1Q5X A;  2R82 A;  4ORF A;  4XPD B;  4CDJ A;  3NFQ A;  3TCV A;  5LRJ A;  2QML A;  2B4B A;  1S7L A;  1YSJ A;  1WJT A;  4P4E A;  3KAS A;  3P2F A;  5AG5 A;  2ZEL A;  3I1U A;  2JBJ A;  4JWP A;  4YU9 A;  4UA3 A;  3TX8 A;  4UF4 A;  5HVH A;  2XPO A;  5JM6 A;  5LYI A;  3L2N A;  3ICU A;  1F2P A;  3T05 A;  2B3V A;  2OOT A;  1Y0R A;  3NA6 A;  4TJX A;  3SXO A;  1V6C A;  1J3L A;  2AFM A;  2REE A;  3HUV A;  4MFZ A;  1R43 A;  4H6U A;  1XEB A;  2GAN A;  4FD6 A;  4OKO A;  4B5P B;  1VBG A;  1ZRS A;  2HI6 A;  1TXR A;  2PDO A;  3CXS A;  4COG A;  4RN7 A;  2FIW A;  2R8V A;  4QB9 A;  4CAE A;  3FVL A;  1VBH A;  2I00 A;  4U5Y A;  1S3Z A;  3MN8 A;  4BTF A;  3VWD A;  3W6X A;  4E0A A;  3OAK A;  2V8G A;  4XNH B;  1UFH A;  3F8K A;  3N5F A;  4R87 A;  4NGR A;  1R57 A;  1PYT B;  3G3S A;  4ZBG A;  4C68 A;  4JZ0 A;  3DLJ A;  2ZEM A;  5AXI A;  2B3U A;  1QST A;  2REF A;  5JYB A;  1NSA A;  2PSW A;  5DWN A;  1VHS A;  2CNT A;  3NE7 A;  2D4O A;  2FCK A;  4CYQ A;  5EC4 A;  4O23 A;  2IMO A;  5KTC A;  3KRV A;  3TLB A;  4UFV A;  3IIB A;  1FNO A;  1M4G A;  2Z3M A;  1S7F A;  3FBU A;  3FF3 A;  4PPZ A;  1B87 A;  1XBU A;  1VHE A;  1YK3 A;  2BOA A;  5HVF A;  3K4I A;  4UBR A;  5FVJ A;  2GE3 A;  4NF1 A;  4Q7A A;  5AG7 A;  4DYO A;  2ZED A;  3P2H A;  3HPG G;  1YW6 A;  2PJ0 A;  3QB8 A;  4FD4 A;  3PB7 X;  3HLP A;  1Y7R A;  4NGQ A;  3IJ3 A;  1MJB A;  2ZOG A;  4HKF A;  4MFQ A;  2XPN A;  1M1D A;  4UIB A;  3VAT A;  3WC6 A;  3K9U A;  2VL1 A;  4H6Z A;  3I9S A;  2D4P A;  4OC0 A;  1XFO A;  1LAM A;  4L89 A;  2BL1 A;  2Q4V A;  4LQ6 A;  3I74 A;  3BUM B;  2BCO A;  2F8H A;  5G1Z A;  3EZE A;  2P6G A;  2Q4Y A;  4UCN A;  5K8N A;  1EO0 A;  2Q4Z A;  1IOI A;  1Z2L A;  2OZG A;  2OLS A;  4EWT A;  2ZW5 A;  1C3O B;  1CBX A;  4OID A;  2B4D B;  3HPH E;  1A9X B;  1MK4 A;  4C9V A;  1Z4R A;  4ZYQ A;  2P6E A;  4A32 A;  4P44 A;  4QVT A;  3DSB A;  4EVY A;  4F6A A;  3TT2 A;  2Z3K A;  4L8A A;  1XOV A;  1XJO A;  4BPX B;  1HDQ A;  4NFR A;  3RO0 A;  3T90 A;  4F8Z A;  2PCN A;  2R98 A;  2FE7 A;  4DNC A;  4BIN A;  4OLL A;  1M4I A;  4F0Y A;  2AJ6 A;  2QEC A;  2QJ8 A;  5DS0 A;  2DPT A;  5E96 A;  2UV8 G;  3G8W A;  2YND A;  3FIX A;  4XPK A;  1IYL A;  2X7B A;  5D29 A;  1XRY A;  3KHX A;  3IGR A;  1EE3 P;  3MGD A;  3S6F A;  4C2Y A;  5JPH A;  5F48 A;  3CT9 A;  2FSR A;  4FWU A;  2C6G A;  2XEG A;  5H86 A;  3KGQ A;  2VEZ A;  3H4Q A;  1YGH A;  3OWC A;  4OP4 A;  4C8U A;  4KOR A;  4MI4 A;  4M8D A;  3TFY A;  4GXH A;  3BHX A;  1Z9U A;  1CP7 A;  4YGO A;  1GHE A;  3VH9 A;  2BSW A;  1LRZ A;  1S5K A;  5LRK A;  3HMJ G;  3B3W A;  4KVO E;  4A39 A;  2Q51 A;  3EZB A;  4C9A A;  4I49 A;  1FY7 A;  3SHP A;  4XPL A;  4KVM E;  1C30 B;  3S9N A;  1VIX A;  2ARH A;  4CDK A;  2DEA A;  2FVG A;  2VQY A;  4FAI A;  4MCP A;  4E5S A;  3TLG A;  4C7H A;  1YX0 A;  3WAB A;  3SI1 A;  3B3T A;  3TLY A;  4A37 A;  1ZLI A;  2B5G B;  4GS4 A;  2XEF A;  1YME A;  4A4B A;  2JBK A;  2DXQ A;  4RI1 A;  4UCP A;  4Y49 C;  2Z11 A;  5ISV A;  3GJZ A;  3VTA A;  3EZA A;  2AFZ A;  2B4D A;  3BLN A;  1ZYM A;  5IB9 A;  3W6S A;  1YR0 A;  4CAX A;  4M85 A;  4CGP A;  4F9V A;  4MI1 A;  5F46 A;  3EXN A;  4MRI A;  4CYO A;  3VAR A;  1NE9 A;  1CE8 B;  1WK4 A;  4MHY A;  2P6F A;  4GM5 A;  3S9L A;  1VHO A;  3TE4 A;  2CNM A;  1MJA A;  1WWZ A;  2JDC A;  2K5T A;  2OH1 A;  2PJB A;  4A94 A;  4CGL A;  4P4I A;  2O53 A;  2O4H A;  1YQE A;  2PJ1 A;  3DR8 A;  4IUS A;  2ZW7 A;  1YVK A;  2H5M A;  4AG9 A;  2HQY A;  4ZY1 A;  1AUG A;  1EZB A;  3EC4 A;  4JVO A;  3T07 A;  3K9T A;  5K99 A;  4PQA A;  3GB0 A;  5F13 A;  3PB4 X;  4P4F A;  3V8I A;  5IV0 A;  3DNS A;  4CZ1 A;  3BUX B;  4M6G A;  4R6T A;  3VRQ A;  4EME A;  5IX3 A;  3B3C A;  4B11 A;  3D67 A;  4MHD A;  4ONW A;  1ZO0 A;  4C9R A;  2WPW A;  3FYN A;  1ARM A;  1KUV A;  4QC6 A;  3LOD A;  4J3G A;  2RC4 A;  4R8F A;  4HNX B;  1OZP A;  3WC7 A;  3PFO A;  4NCZ A;  2PJ6 A;  1GYT A;  2AE6 A;  4QUS A;  5BWA B;  4NEX A;  1Y9Z A;  2Z3N A;  4IAV A;  3K2K A;  2DIK A;  4C8A A;  4JXQ A;  4P4J A;  2Z3L A;  3IEH A;  3R1K A;  4X8I A;  2J8M A;  1JDB C;  3JUW A;  4C8P A;  2B5G A;  3CXP A;  3D68 A;  3NH5 A;  5I0C A;  4UEE A;  1ELL P;  5K8P A;  2FM4 A;  3I6S A;  4ZY2 A;  1DE4 C;  1RXT A;  4R76 A;  3TLA A;  5J8C A;  4X2T A;  1M44 A;  4MCR A;  1RO5 A;  3R9F A;  4JD6 A;  3FX6 A;  4P6Y A;  2XPP A;  5A28 A;  3SJX A;  4BPW B;  3TO9 A;  1XMB A;  3IWW A;  4CGN A;  1TKH A;  1LAP A;  1B47 A;  1BPM A;  4OC5 A;  4MFJ A;  3PLF B;  5LYF A;  1TF9 A;  3MRU A;  2MP0 A;  3SI0 A;  1Z8L A;  2Q43 A;  4MY0 A;  2AFU A;  4KLW A;  3BUO B;  5JVL A;  5HKY A;  3PT1 A;  4FD7 A;  1Y0Y A;  1PU9 A;  1VGY A;  3D2P A;  2FT0 A;  3C26 A;  4PK3 A;  2PJ2 A;  4A4C A;  3KL9 A;  2Q7B A;  2DPS A;  2YGW A;  4KUA A;  4MJ8 A;  1CM0 A;  4A30 A;  2HUZ A;  2XEI A;  3IO1 A;  3ZJ0 A;  3KZW A;  1LFW A;  4KS9 A;  2AFX A;  3JVN A;  2CBL A;  2EVN A;  1JDE A;  4IIX A;  3TYX A;  3FRM A;  3KKW A;  5IB0 A;  4P4B A;  4LUA A;  2PJ5 A;  3FEE A;  3BI0 A;  1S7K A;  4A2Z A;  3TLG B;  5HKW A;  4EYS A;  4KOX A;  1I21 A;  3ZNI A;  4ZY0 A;  2P0W A;  2WPX A;  1ZG9 A;  3GLJ A;  1X10 A;  4R7M A;  3WR7 A;  3ISZ A;  2PQ8 A;  2ZEF A;  2PR8 A;  3B7I A;  2B58 A;  2PCU A;  1NXJ A;  2VZY A;  4UIA A;  4GPL B;  4II9 A;  2PC1 A;  3NOJ A;  3DR6 A;  4C2X A;  4DJL A;  1BO4 A;  5H84 A;  1BPN A;  1JWQ A;  2O28 A;  4QBJ A;  1ARL A;  4M6I A;  2YNC C;  4MFP A;  2AFO A;  4ONU A;  5G21 A;  2POK A;  3DDD A;  1KC7 A;  1BOB A;  1IU8 A;  5G20 A;  2ABZ A;  2EZC A;  5F49 A;  1XMT A;  5THW A;  5A27 A;  2V8H A;  3SXN A;  2Z0Z A;  5F9M A;  3TLC A;  2VKZ G;  3R96 A;  1M4D A;  7CPA A;  2ANP A;  2AFW A;  3TLE A;  4M3S A;  2PJ9 A;  2Y1M A;  5J3X A;  4RR2 B;  4KOT A;  1KEE B;  2AUM A;  2CIJ A;  1NBW A;  1CPS A;  1F2O A;  1HEE A;  3PFE A;  2J8R A;  5F47 A;  4AVA A;  4C8C A;  1UWY A;  4NGS A;  2CTB A;  1AYE A;  2B4J C;  3RBU A;  3TO6 A;  4B13 A;  4C9E A;  3RYO A;  2V77 A;  1NMT A;  5J1Q A;  1K4J A;  4UWJ A;  3CDX A;  3WC5 A;  4W9Y A;  4Q36 A;  4JYW A;  1X12 A;  2PRQ A;  2RFH A;  3D8P A;  1YLE A;  1Z9E A;  1JQG A;  3E0K A;  3T5M A;  1XE4 A;  1OBR A;  1BAV A;  1Q2C A;  1XF8 A;  1Z8X A;  4ZGY B;  1VI4 A;  2ZOF A;  4FUU A;  4KOU A;  3U1B A;  4NSQ A;  4M6H A;  5LYL A;  4KNG E;  3H8G A;  4UWI A;  3O8Z A;  4E8O A;  3V7Z A;  5CBM A;  1ZL0 A;  3PRT A;  4IK2 A;  3SJG A;  3KQX A;  3D66 A;  4KLV A;  3QNV A;  3FJU A;  3RZA A;  1M6V B;  3N7Z A;  4LX9 A;  2ATR A;  4KSA A;  4Y49 B;  3VGO A;  1AMP A;  2FXF A;  2R7H A;  3D2M A;  3PGP A;  1LOK A;  3QAY A;  3D3S A;  4U9Y A;  4UFX A;  2FS5 A;  3TOA A;  2NSM A;  4BBH A;  2R1I A;  3OB2 B;  3PEI A;  3PB8 X;  4X3R A;  3UY5 A;  4C9U A;  4C86 A;  3NE8 A;  3JRU A;  1FT7 A;  3D7F A;  1ON0 A;  2JLM A;  2QVP A;  1QSN A;  3GUX A;  3NH4 A;  3W91 A;  2YJV A;  2ZEG A;  3PB9 X;  4CYN A;  4B14 A;  4X5K A;  1ELM P;  5EMI A;  4C7I A;  2JDD A;  1IID A;  2Y0M A;  4H2K A;  2OR4 A;  4NGM A;  1M4L A;  2EO8 A;  2ZW4 A;  4Q38 A;  4KSI A;  3CPA A;  1FBV A;  4R57 A;  4R9M A;  5K8O A;  2WUU A;  1S60 A;  2KCW A;  3KI9 A;  2OZH A;  5AGE A;  1Z8W A;  3F5B A;  2A4N A;  4PXE A;  4C2Z A;  3T0T A;  4K3N A;  4XPD C;  4TJV A;  1I12 A;  3H8F A;  2C27 A;  4PXD A;  2PVV A;  3VRO A;  4TNU A;  3D7H A;  2YNC A;  4E2A A;  2ZEE A;  2OU2 A;  2I79 A;  3LWU A;  6CPA A;  3WT4 A;  1P4N A;  1Z5R A;  3D4U A;  2EK9 A;  3KQZ A;  3RAM A;  3S6H A;  1T36 B;  3FEC A;  5DWM A;  2B0A A;  4FBE A;  1YRE A;  4HNW B;  2F7V A;  5AG6 A;  2E28 A;  4MXU A;  1KUX A;  1IY7 A;  4AG7 A;  4KOS A;  2BEI A;  5C82 A;  1PCA A;  2CXA A;  5G22 A;  3EO4 A;  4CYP A;  3TLZ A;  4KOY A;  4A31 A;  4RUH A;  3PB6 X;  2WZN A;  1PUA A;  2X0S A;  1QMU A;  1KBL A;  2EZA A;  2F5I A;  2CNS A;  2G9D A;  4PSX A;  4HNY B;  2J9A A;  4DUK A;  4CAF A;  1CX8 A;  4G1P A;  3VRN A;  1RTQ A;  2J8N A;  2ZW6 A;  3FMC A;  4FD5 A;  1P0H A;  2ODF A;  3KHZ A;  3KR4 A;  1DTD A;  2N3A B;  5HKZ A;  1QSM A;  3FXT A;  4MHN A;  3F0A A;  2BUE A;  4INJ A;  4C84 A;  4OAD A;  2VZZ A;  2C6P A;  4BD9 A;  4KZT A;  2IL4 A;  2PJ4 A;  2Q44 A;  3F9K C;  4XNH C;  4ZX9 A;  3VRR A;  4H1H A;  2ZPA A;  4YWY A;  4E94 A;  3BUN B;  4JJX A;  1H8L A;  2VXK A;  3LD2 A;  1SQH A;  8CPA A;  4Z65 A;  3CZX A;  3PP9 A;  5C88 A;  1CS0 B;  1R61 A;  1HDU A;  2XPL A;  2HRO A;  2PE3 A;  3CPX A;  3S6G A;  1GGO A;  2CY2 A;  1CJW A;  1TKF A;  5JGF A;  4RS2 A;  2HB6 A;  2GU2 A;  3BJ8 A;  2C1C A;  2NYQ A;  3BJ7 A;  4YRH A;  2QIR A;  5J8F A;  4ZX8 A;  4F0X A;  2ZEN A;  4MHZ A;  2Y1N A;  1YLO A;  4C8T A;  3C8O A;  5KTA A;  3OP0 A;  4NGT A;  2PJ3 A;  3RNZ A;  5JQ4 A;  2G3T A;  2JEV A;  1Y9W A;  1Z8T A;  2OZU A;  3FH4 A;  5HVG A;  3FED A;  2EZB A;  5HXD A;  1B6B A;  3QAH A;  3TC8 A;  3I3G A;  4YN3 A;  1BLL E;  1IYK A;  2AFS A;  4KSF A;  2RB7 A;  4MFL A;  4PXC A;  5GCN A;  3TTH A;  3VWE A;  1IB1 E;  4CAV A;  4OME A;  5F1Y A;  3EY5 A;  2YNE A; 
#chains in the Genus database with same CATH homology
 3D7G A;  4OC3 A;  1CPX A;  1YW4 A;  2PIZ A;  4OC4 A;  1ZG8 A;  3ISX A;  4F9U A;  2CF4 A;  2GRE A;  2XEJ A;  3S9M A;  4NJQ A;  4WWV A;  2V8V A;  2WYR A;  4NGP A;  1LCP A;  2PJC A;  4NGN A;  5LRG A;  2PIY A;  3IFE A;  2EWB A;  3NFZ A;  2IQ6 A;  4UEF A;  5LYD A;  2JEW A;  3SI2 A;  1Y7E A;  4A38 A;  3SJF A;  2BO9 A;  4IHM A;  2ZEH A;  2CTC A;  4MHP A;  3SJE A;  3B35 A;  3T8W A;  4OC2 A;  4MCQ A;  1ZLH A;  1CG2 A;  1WVM A;  4WJB A;  2ZEP A;  5F09 A;  4LQG A;  4EFD A;  2ZEO A;  4C8F A;  3B2Y A;  1XF1 A;  4P45 A;  2EK8 A;  4P4D A;  3PBE A;  2PJA A;  3IC1 A;  4MCS A;  4OIW A;  3BXM A;  3H8E A;  2HC9 A;  2GLJ A;  1ZG7 A;  2I3C A;  4MMO A;  5IR2 A;  2V8D A;  1IGB A;  2GLF A;  2C5Q A;  5I4M A;  3V38 A;  1TKJ A;  1Q7L A;  2QYV A;  4P10 A;  3PBB A;  1TF8 A;  3LMS A;  2PVW A;  2GP4 A;  1LAN A;  3D7D A;  4TWE A;  4PXB A;  2PJ8 A;  1QQ9 A;  2IJZ A;  4UEZ A;  3KR5 A;  4NJR A;  5D8N A;  4B6Z A;  3EIF A;  3B3V A;  2PJ7 A;  4C85 A;  5ELY A;  3BI1 A;  1F57 A;  3B3S A;  3NH8 A;  5K8M A;  2C6C A;  3DGV A;  4AXV A;  1R3N A;  4CPA A;  1CP6 A;  5CPA A;  1KWM A;  4C99 A;  5JH9 A;  4ZI6 A;  4OC1 A;  4CDJ A;  5LRJ A;  1YSJ A;  4P4E A;  3KAS A;  2ZEL A;  3I1U A;  2JBJ A;  4YU9 A;  3TX8 A;  4UF4 A;  5HVH A;  5JM6 A;  5LYI A;  3L2N A;  3ICU A;  1F2P A;  2OOT A;  1Y0R A;  3NA6 A;  4TJX A;  1V6C A;  2AFM A;  3HUV A;  1R43 A;  4OKO A;  1TXR A;  3FVL A;  3MN8 A;  2V8G A;  3N5F A;  4NGR A;  1PYT B;  4JZ0 A;  3DLJ A;  2ZEM A;  1NSA A;  4O23 A;  2IMO A;  3IIB A;  1FNO A;  4PPZ A;  3FF3 A;  1XBU A;  1VHE A;  2BOA A;  4Q7A A;  4DYO A;  2ZED A;  1YW6 A;  2PJ0 A;  3PB7 X;  3HLP A;  5K8N A;  4NGQ A;  3IJ3 A;  4UIB A;  2ZOG A;  3VAT A;  3WC6 A;  2VL1 A;  4OC0 A;  1XFO A;  1LAM A;  3I74 A;  2BCO A;  2F8H A;  2Q4Z A;  1Z2L A;  4EWT A;  1CBX A;  4OID A;  4C9V A;  4ZYQ A;  4P44 A;  1HDQ A;  1XJO A;  4NFR A;  4F8Z A;  2QJ8 A;  5DS0 A;  5D29 A;  1XRY A;  3KHX A;  1EE3 P;  3CT9 A;  4FWU A;  2C6G A;  2XEG A;  3KGQ A;  4OP4 A;  4C8U A;  3BHX A;  1CP7 A;  3VH9 A;  5LRK A;  3B3W A;  4A39 A;  2Q51 A;  4C9A A;  3S9N A;  1VIX A;  4CDK A;  2DEA A;  2FVG A;  4FAI A;  4MCP A;  3WAB A;  3SI1 A;  3B3T A;  4A37 A;  1ZLI A;  5J1Q A;  2XEF A;  1YME A;  2JBK A;  3VTA A;  2AFZ A;  5IB9 A;  4F9V A;  4MRI A;  3VAR A;  4MHY A;  4GM5 A;  3S9L A;  1VHO A;  2PJB A;  4A94 A;  4P4I A;  2O53 A;  2O4H A;  2PJ1 A;  4ZY1 A;  3K9T A;  4PQA A;  3GB0 A;  3PB4 X;  4P4F A;  4R6T A;  4EME A;  3B3C A;  3D67 A;  4ONW A;  4C9R A;  1ARM A;  4R8F A;  3WC7 A;  3PFO A;  2PJ6 A;  1GYT A;  4C8A A;  1Y9Z A;  4IAV A;  3K2K A;  4P4J A;  3IEH A;  4X8I A;  4C8P A;  3D68 A;  3NH5 A;  4UEE A;  1ELL P;  5K8P A;  3I6S A;  4ZY2 A;  1DE4 C;  4R76 A;  4X2T A;  4MCR A;  3FX6 A;  4P6Y A;  3SJX A;  1XMB A;  3IWW A;  1TKH A;  1LAP A;  1BPM A;  4OC5 A;  5LYF A;  1TF9 A;  3MRU A;  3SI0 A;  1Z8L A;  2Q43 A;  2AFU A;  1VGY A;  1Y0Y A;  2PJ2 A;  3KL9 A;  2XEI A;  3IO1 A;  3KZW A;  1LFW A;  2AFX A;  4P4B A;  2PJ5 A;  3FEE A;  3BI0 A;  4ZY0 A;  3GLJ A;  1ZG9 A;  4R7M A;  3ISZ A;  2ZEF A;  3B7I A;  2PCU A;  4UIA A;  4DJL A;  1BPN A;  1ARL A;  2AFO A;  2POK A;  2ABZ A;  5THW A;  2V8H A;  7CPA A;  2ANP A;  2AFW A;  2PJ9 A;  2CIJ A;  1CPS A;  1F2O A;  1HEE A;  3PFE A;  4C8C A;  1UWY A;  4NGS A;  2CTB A;  1AYE A;  3RBU A;  4C9E A;  2V77 A;  3CDX A;  3WC5 A;  4W9Y A;  4JYW A;  2PRQ A;  2RFH A;  1JQG A;  1OBR A;  1BAV A;  2ZOF A;  4FUU A;  5LYL A;  4KNG E;  3H8G A;  5CBM A;  3V7Z A;  3PRT A;  4IK2 A;  3SJG A;  3KQX A;  3D66 A;  3QNV A;  3FJU A;  3RZA A;  1AMP A;  1LOK A;  2NSM A;  3PEI A;  3PB8 X;  4X3R A;  4C9U A;  4C86 A;  3JRU A;  1FT7 A;  3D7F A;  3GUX A;  2QVP A;  3NH4 A;  2ZEG A;  3PB9 X;  1ELM P;  5HVF A;  4H2K A;  2OR4 A;  4NGM A;  1M4L A;  5K8O A;  4KSI A;  3CPA A;  3KI9 A;  4PXE A;  4K3N A;  4TJV A;  3H8F A;  4PXD A;  2PVV A;  4TNU A;  3D7H A;  2ZEE A;  3LWU A;  6CPA A;  3WT4 A;  1Z5R A;  3D4U A;  3KQZ A;  2EK9 A;  3RAM A;  3FEC A;  4FBE A;  2F7V A;  4MXU A;  1IY7 A;  1PCA A;  4RUH A;  3PB6 X;  2WZN A;  1QMU A;  2G9D A;  2J9A A;  4DUK A;  1CX8 A;  4G1P A;  1RTQ A;  3FMC A;  3KHZ A;  3KR4 A;  1DTD A;  4MHN A;  4C84 A;  2C6P A;  4BD9 A;  2PJ4 A;  4ZX9 A;  4YWY A;  1H8L A;  8CPA A;  4Z65 A;  1HDU A;  2PE3 A;  3CPX A;  5JGF A;  1TKF A;  2HB6 A;  2GU2 A;  2C1C A;  2NYQ A;  4ZX8 A;  2ZEN A;  4MHZ A;  1YLO A;  4C8T A;  4NGT A;  2PJ3 A;  3FH4 A;  5HVG A;  3FED A;  5HXD A;  3TC8 A;  4YN3 A;  1BLL E;  2AFS A;  2RB7 A;  4PXC A;  4OME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...