3D7DA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcfbd, a urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 263
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7dA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7dA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7dA02
1BLLE 2QJ8A 4UEFA 4A39A 2RB7A 2NSMA 3DGVA 4W9YA 1Y0YA 3H8GA 2PIZA 1F57A 1JQGA 2ANPA 4UEEA 2PCUA 3ISXA 4TWEA 3T8WA 3NH4A 3IWWA 3MRUA 2CTBA 4TJXA 3FMCA 4DUKA 1YW6A 1ZG9A 1R43A 2BOAA 2AFMA 3FH4A 4P4EA 1XBUA 2ZENA 3SJFA 3LWUA 2C6CA 1AMPA 3I1UA 2ZEPA 4ZYQA 3S9MA 1EE3P 4B6ZA 2AFZA 1BPMA 1HDQA 5JGFA 2C6PA 2PVWA 2XEGA 3BHXA 4X2TA 5JM6A 4UIAA 4MRIA 5HVHA 2AFUA 3KR5A 5CBMA 2NYQA 4O23A 2VL1A 1ARMA 4NGNA 5IB9A 3FF3A 4P44A 4A37A 1YSJA 4DJLA 4C8FA 2F8HA 4OIWA 4C9RA 2V8VA 3FEEA 4P6YA 1CX8A 3IJ3A 3FX6A 2IQ6A 2G9DA 4OC4A 1Q7LA 5K8NA 4TJVA 1VGYA 3HLPA 4AXVA 2PVVA 1ZLHA 2ZEMA 3FEDA 5ELYA 2C6GA 2PE3A 2Q4ZA 3VH9A 1BAVA 1QMUA 1LCPA 5I4MA 1FT7A 5J1QA 3QNVA 3K9TA 1CPSA 1Y7EA 1H8LA 4Q7AA 2V8HA 3B35A 3B3TA 2PJAA 4MCSA 3NH5A 4ONWA 4NGQA 1LAMA 2PIYA 4OC0A 3KHXA 1IY7A 1F2OA 4NGMA 1NSAA 1TF9A 2PJ4A 3ICUA 4ZX9A 1ZG7A 4IHMA 3S9LA 4C8TA 4P4BA 2XEFA 3HUVA 2DEAA 3PB9X 4F9UA 3PB4X 4G1PA 2QVPA 1ELLP 1CPXA 1CP7A 1CP6A 1XRYA 3CPXA 1ARLA 3PEIA 5D8NA 4F8ZA 1F2PA 3KQXA 3KZWA 3I74A 3WABA 1HEEA 3SI2A 5JH9A 4NGTA 1XFOA 3PFEA 4NGPA 3L2NA 3PB7X 1GYTA 1PYTB 3D7FA 2JBJA 2I3CA 6CPAA 4C9AA 5LRKA 1LOKA 3H8EA 1HDUA 5F09A 2F7VA 3ISZA 3D68A 3FECA 4Z65A 1RTQA 4MHZA 4WWVA 4C8AA 7CPAA 2WYRA 2JBKA 2PJ8A 2ZEDA 3BXMA 3NH8A 4MXUA 4UF4A 2RFHA 3KGQA 1DE4C 3NFZA 4C9UA 1PCAA 4P4DA 2AFSA 4P4IA 4LQGA 3TC8A 4NFRA 4R76A 4C9VA 2IJZA 3LMSA 4PXBA 1CBXA 4EFDA 4MHPA 3VATA 3RBUA 4P10A 4C85A 5LYDA 3IO1A 3PBBA 1Y0RA 2J9AA 3PBEA 3FJUA 4FBEA 4OC3A 4EWTA 1XMBA 4C9EA 3D67A 3BI1A 3V7ZA 3VARA 4YWYA 4NJRA 4YN3A 4OIDA 3CT9A 5LRGA 3B7IA 3KR4A 3K2KA 1CG2A 2ZEEA 2ZEOA 4PPZA 5LYIA 2Q51A 2CIJA 4BD9A 3WC5A 2POKA 1KWMA 2BCOA 4H2KA 4R7MA 3GUXA 2OR4A 3IC1A 4C86A 2PJ2A 1R3NA 2XEJA 1TKFA 2ZOFA 4JZ0A 3D7HA 1ZG8A 4FAIA 2PJ3A 4ZY0A 2ABZA 3EIFA 1Z5RA 2AFOA 3SJEA 4OC2A 1VHOA 4MHYA 5LRJA 3WT4A 5K8OA 4UIBA 2PRQA 4NGSA 3DLJA 4A38A 2O4HA 4IK2A 2PJ1A 1LANA 2PJ6A 3I6SA 2PJCA 2GLJA 3PFOA 2IMOA 4MCPA 2ZELA 3D66A 5HVGA 5HVFA 3B3SA 5K8MA 4K3NA 1TXRA 3GB0A 4RUHA 3SJGA 2PJ0A 1DTDA 1VIXA 3H8FA 3IIBA 4FWUA 4KNGE 4OKOA 2PJ7A 3BI0A 1BPNA 3S9NA 2AFXA 2GLFA 3GLJA 2Q43A 3PB6X 4PXDA 1XJOA 3V38A 2CF4A 4OP4A 4GM5A 1ELMP 3KI9A 1YMEA 4CDJA 1TKJA 2PJ5A 4C84A 4YU9A 4R6TA 1FNOA 2PJBA 2BO9A 4PQAA 4PXEA 3SJXA 3SI1A 1TF8A 2WZNA 2C1CA 2ZOGA 3FVLA 4P4JA 2PJ9A 2OOTA 3MN8A 4P4FA 2ZEFA 3KQZA 4C8PA 3PB8X 1IGBA 1Z8LA 4TNUA 4WJBA 4NGRA 4CPAA 3D4UA 2JEWA 1WVMA 3JRUA 1AYEA 4CDKA 2V8DA 5CPAA 2ZEHA 1OBRA 4PXCA 3TX8A 4DYOA 2XEIA 3WC6A 1LFWA 2EK8A 3IEHA 2FVGA 4MMOA 2V77A 2QYVA 4C8UA 2GU2A 4X8IA 3CPAA 4OC5A 1UWYA 1ZLIA 5LYLA 2CTCA 1M4LA 5D29A 3NA6A 1LAPA 1QQ9A 4X3RA 5K8PA 1YW4A 3IFEA 1XF1A 1V6CA 2HB6A 4A94A 3D7DA 5LYFA 4NJQA 4JYWA 4R8FA 8CPAA 4MHNA 1YLOA 4C8CA 3PRTA 1Y9ZA 4UEZA 1TKHA 3RAMA 4MCQA 1VHEA 4KSIA 4ZY2A 3B3CA 2EWBA 4EMEA 2GREA 2HC9A 4ZI6A 2AFWA 4P45A 5THWA 4MCRA 1Z2LA 3KL9A 4F9VA 3RZAA 2ZEGA 4IAVA 3WC7A 3CDXA 5HXDA 4OC1A 3B3WA 3VTAA 4C99A 3B2YA 2EK9A 2O53A 3SI0A 4ZY1A 3N5FA 2V8GA 3KASA 5DS0A 3KHZA 4FUUA 4OMEA 3B3VA 4ZX8A 3D7GA
chains in the Genus database with same CATH superfamily
1BLLE 2PR1A 2Y1NA 1XF8A 4YFJA 2QJ8A 2WUUA 2DXQA 4UEFA 5DWMA 1VBHA 4A39A 3U1BA 1ZRSA 3DDDA 5AXIA 3R9FA 4COBA 2RB7A 3A9LA 2NSMA 3DGVA 2P6FA 4A32A 4GPLB 4W9YA 3T05A 1Y0YA 4C2XA 2R1IA 3T0TA 3H8GA 1GHEA 4INJA 4UBRA 3F0AA 3OP0A 2VQYA 4GS4A 1BO4A 2PIZA 1F57A 4CAVA 4QVTA 1JQGA 5C88A 3G8WA 2C5QA 2ANPA 4Q36A 4UEEA 4AVCA 2PCUA 4F6AA 5ISVA 1Z8XA 1YVOA 3ISXA 5JVLA 5HKZA 4M8DA 4TWEA 2AUNA 1GGOA 4IIXA 5KTDA 1QSTA 3GY9A 2EO8A 3T8WA 3NH4A 4A30A 3IWWA 3MRUA 2XPLA 4M85A 2X0SA 3EZEA 2CTBA 3I3GA 1C3OB 3FMCA 4TJXA 3BLNA 1Z4RA 4DUKA 3EFAA 1YW6A 1XMTA 3T07A 3TLAA 3VRNA 1MJBA 2QECA 4PSWA 3QAHA 3TLZA 1ZG9A 1EO0A 1IU8A 1R43A 2Z3OA 2BOAA 3SXNA 3PT1A 5HKYA 2R8VA 1Z8WA 2B4JC 2AFMA 2EVNA 4P4EA 3FH4A 3W6XA 4XPLA 2PC1A 3E0KA 1XBUA 3PGPA 5H84A 1R61A 2ZENA 2B0AA 2J8MA 3SJFA 3LWUA 2C6CA 1AMPA 2OH1A 3I1UA 3SHPA 2JDCA 3BUMB 2ZEPA 4ZYQA 1IOFA 1ON0A 1KUYA 4UWIA 1EZAA 3S9MA 1EE3P 1Z9EA 2AFZA 4B6ZA 2DPSA 3ZZIA 4E0AA 1BPMA 1HDQA 2FT0A 4B13A 4UA3A 3TTHA 2VBQA 5JGFA 4B5PB 2C6PA 4C8FA 2PVWA 4CGNA 1MJAA 4L89A 2P6EA 3N7ZA 2XEGA 3BHXA 3IWEA 4X2TA 5JM6A 4UIAA 5AG7A 4MRIA 3EY5A 5HVHA 2AFUA 2FS5A 4KLVA 5A28A 3B8GA 3FB3A 3KR5A 2YNCC 1B47A 3NFQA 2NYQA 5CBMA 4UFWA 3LACA 2D0PA 1WK4A 4O23A 1J3LA 4MFJA 2VL1A 2VXKA 1YK3A 1IB1E 1ARMA 4NGNA 3D2MA 5FVJA 5IB9A 3I9SA 1T36B 4R87A 2VEZA 3FF3A 2EBJA 3SXOA 4P44A 5KTAA 1NBWA 2FSRA 2QIRA 1MK4A 1YSJA 4M3SA 4A37A 4DJLA 2F8HA 4OIWA 2OU2A 4A95A 1PUAA 3C8OA 4C9RA 4HNXB 3HPHE 1JDEA 4CAWA 5HMNA 1RO5A 3FXTA 2V8VA 4E8OA 4MJ8A 3FEEA 4JXRA 4P6YA 1CX8A 3IJ3A 4HNWB 3FX6A 2IQ6A 2G9DA 4XPDC 4A31A 4OC4A 1Z9UA 2KCWA 1LRZA 1XOVA 2N3AB 2VZZA 1Q7LA 5K8NA 2B3UA 5F46A 2EUIA 1VKCA 4JLYA 2ZW6A 2ARHA 2CNMA 5EMIA 4TJVA 2ZPAA 5CNPA 1VGYA 5F48A 3HLPA 2AUMA 3FBUA 4MFKA 2PVVA 4AXVA 1YR0A 4BPXB 1ZLHA 2ZEMA 4MFZA 3W91A 4BPWB 3FEDA 5ELYA 2C6GA 2PE3A 2Q4ZA 1P4NA 3PZJA 3VH9A 3VWDA 4EVYA 4I49A 1BAVA 1QMUA 1LCPA 5I4MA 2NMTA 3BJ8A 1FT7A 2D0OA 4KORA 5J1QA 3QNVA 4Y49C 5AG5A 4GXHA 3K9TA 1CPSA 4FD4A 1Y7EA 5AGEA 1H8LA 1KEEB 1M4IA 2CXAA 4Q7AA 2REEA 2V8HA 1Q2DA 2GFQA 2PJAA 3B35A 3B3TA 3R9EA 4CGPA 2FM4A 4MCSA 3NH5A 4ONWA 4NGQA 1LAMA 2PIYA 3CXSA 4H1HA 3VRQA 4CO9A 4OC0A 3KHXA 4ZBGA 1S5KA 1IY7A 4RN7A 2ZW7A 1F2OA 4NGMA 1NSAA 1CM0A 1TF9A 2PJ4A 4MHDA 4ZX9A 1TIQA 3ICUA 1ZG7A 4IHMA 1XEBA 3S9LA 4C8TA 4A4CA 3BUXB 3VRPA 4P4BA 4KOUA 2Z11A 2XEFA 3HUVA 2DEAA 5BWAB 3NE7A 2CNTA 3PB9X 4F9UA 2Z3PA 3BUNB 3PB4X 4RS2A 4XNHB 4G1PA 2BSWA 3VROA 4YRHA 5J8FA 2QVPA 4PK3A 1ELLP 1CPXA 1FBVA 1CP7A 1CP6A 1S7LA 4NCZA 1XRYA 1N71A 2VKZG 1ARLA 3BJ7A 3CPXA 3PEIA 5D8NA 4RR2B 3FIXA 5IB0A 4BBHA 1X12A 2PR8A 4F8ZA 1F2PA 3KQXA 3KZWA 3I74A 1Z4EA 4HNYB 3WABA 1HEEA 2GP4A 5F1YA 3SI2A 3TO7A 4QBJA 5EC4A 5JH9A 4NGTA 4EYSA 3D8PA 1XFOA 4H89A 4KOYA 4FD6A 3PFEA 2ZW4A 3H5ZA 4NGPA 3L2NA 1KUXA 3F8KA 3PB7X 1NSLA 1GYTA 1PYTB 3D7FA 2ZW5A 2REFA 2JBJA 2I3CA 3PP9A 5AG6A 6CPAA 4F0XA 4C9AA 2B5GB 1LOKA 3H8EA 4NEXA 1HDUA 4M6GA 5LRKA 5F09A 2F7VA 2YJVA 3ISZA 4B10A 5A27A 3BUWB 1OZPA 3D68A 4H6UA 2O28A 3S6GA 3FECA 2J8RA 2P0WA 4Z65A 1RTQA 1CS0B 2EZAA 4MHZA 4KVME 4WWVA 2HV2A 3U88C 4C8AA 2Z3MA 7CPAA 2Q0YA 4K30A 4CRYB 4MI1A 3TO6A 3ZJ0A 2WYRA 4NXYA 2I79A 3OB1B 2JBKA 1KUVA 2PJ8A 3NOJA 2F5IA 1IYLA 3BXMA 2ZEDA 3NH8A 2WPXA 4MXUA 3R9GA 1KC7A 3OAKA 4UF4A 4MI4A 2Q44A 2RFHA 3KGQA 1DE4C 3NFZA 4M6HA 5I0CA 3W6SA 4C9UA 3VRRA 2DPTA 1ZYMA 1PCAA 5EBVA 4P4DA 2AFSA 3CXPA 1L0CA 3D3SA 3EZBA 3CZXA 4P4IA 3DNSA 1S3ZA 4LQGA 2PQ8A 2OZHA 4QC6A 3GIUA 3TC8A 3TOAA 5G1ZA 4NFRA 4R76A 4C9VA 1M4DA 2IJZA 2YGWA 3LMSA 4MY0A 4PXBA 1IIDA 2Q04A 3RO0A 2DF5A 1CBXA 4EFDA 4R9MA 4MHPA 2YNDA 4E5SA 3VATA 1PU9A 3RBUA 3FRMA 4P10A 4C85A 1S7NA 5LYDA 3IO1A 5HH1A 3R1KA 3PBBA 4B5PA 2QMLA 1A2ZA 1Y0RA 2J9AA 3T5MA 1ZL0A 4MFPA 3PBEA 3PFVA 2FCKA 3FJUA 2Z10A 4AVBA 2X7BA 4NSQA 4FBEA 2EZBA 2HQYA 4BTFA 4OC3A 1NXJA 4EWTA 1XMBA 1YX0A 4KOSA 4CGOA 3RNZA 3VGOA 2MP0A 4C68A 4C9EA 3D67A 4AVAA 3BI1A 1CE8B 3V7ZA 3VARA 4CYNA 3G3SA 4YWYA 4NJRA 2G3TA 4OIDA 3KRVA 4KS9A 3CT9A 4YN3A 4B12A 4DNCA 5LRGA 2A4NA 2ZXVA 2H5MA 3B7IA 3S6KA 3KR4A 4KUAA 3K2KA 3P2HA 5KTCA 1CG2A 2Z0ZA 2ZEEA 2ZEOA 4PPZA 5LYIA 2Q51A 1QSNA 2B4DB 2CIJA 3D2PA 3LODA 4BD9A 2PDOA 2Y1MA 2POKA 3WC5A 1KWMA 1XIXA 2B3VA 2JDDA 2B4BA 2BCOA 5F13A 1J4JA 4H2KA 4R7MA 1P0HA 3GUXA 2Z3LA 2GIVA 3LD2A 2OR4A 2K5TA 3IC1A 4C86A 2PJ2A 2P6GA 1SQHA 4UFVA 3TCVA 1R3NA 2XEJA 1C30B 1TKFA 2ZOFA 2OB0A 4CYOA 3TFYA 5G20A 4JZ0A 4CGMA 3D7HA 2YNCA 4CRZB 1ZG8A 4FAIA 2PJ3A 4OLLA 2YJTA 4C2YA 4ZY0A 2ABZA 4YGOA 2Z3KA 4R3LA 1B87A 2J8NA 2PCNA 5F5XA 3EIFA 1Z5RA 4XPDB 1QSMA 2AFOA 3DR6A 5IR2A 2Q4YA 4KOXA 2BL1A 3SJEA 4B14A 4OC2A 3TLGB 1VHOA 4MHYA 2PRBA 3MGDA 4L8AA 4LQ6A 5LRJA 3WT4A 5K8OA 4UIBA 3R96A 5FD8A 3BUOB 2PRQA 1S7KA 2Y0MA 4J3GA 4NF1A 4AG7A 4NGSA 3NE8A 3DLJA 4A38A 3FNCA 2O4HA 4IK2A 3R95A 2PJ1A 2FE7A 1BOBA 2XPOA 1LANA 2FIAA 2PJ6A 2PJCA 3I6SA 2PSWA 3F5BA 2GLJA 1I12A 2HUZA 2IMOA 4MCPA 1RXTA 2ZELA 3PFOA 5E96A 3K4IA 4U9ZA 3D66A 5HVGA 5HVFA 3B3SA 4AG9A 5K8MA 4KLWA 4Y49B 4K3NA 4B11A 1TXRA 2HI6A 3GB0A 4RUHA 3KKWA 4LX9A 1IOIA 4KUBA 4MBUA 1CJWA 4X5KA 3DSBA 3SJGA 4IUSA 4E94A 1Q2YA 5F49A 3EZAA 2PJ0A 2RC4A 1UFHA 4KOTA 1BXRB 1DTDA 1VIXA 1KBLA 2AJ6A 3H8FA 1YQEA 3IIBA 2Q4VA 4LUAA 1VBGA 4FWUA 4KNGE 4OKOA 5DWNA 1Y7RA 4C7IA 2PJ7A 2ATRA 1M6VB 3BI0A 1BPNA 3S9NA 1MJ9A 2AFXA 2GLFA 4KSFA 1JWQA 4A2ZA 2DIKA 1V0CA 3GLJA 2Q43A 3PB6X 1QSOA 4RI1A 4CAFA 4CAXA 4CZ1A 4PXDA 5JYBA 1XJOA 2R82A 4A33A 3TOBA 4UFXA 5IX3A 3G23A 3V38A 2CF4A 4OP4A 3TLBA 4GM5A 3WR7A 1ELMP 2CBLA 4A4BA 3KI9A 1YMEA 3EC4A 4UCMA 4B5OA 4CDJA 1TKJA 2PJ5A 4C84A 1KZFA 2B5GA 4YU9A 4R6TA 4U5YA 2GANA 4AB7A 3F9KC 3HMJG 1FNOA 3IWGA 1DIKA 1NMTA 2PJBA 4PK2A 2BO9A 1YVKA 1ZO0A 4H6ZA 3FYNA 1B6BA 4PQAA 3TO9A 1AUGA 4F0YA 5J8CA 4IF5A 4PXEA 2XPPA 2AE6A 2Z3NA 2HROA 3SJXA 3SI1A 1TF8A 4QB9A 2WZNA 2C1CA 4BINA 2DLAA 1M4GA 2ZOGA 3S6FA 2GE3A 1WWZA 4P4JA 2OOTA 2PJ9A 3FVLA 4Q38A 2D4OA 3GYAA 3MN8A 4MFLA 4P4FA 2ZEFA 3KQZA 3O8ZA 3PB8X 3RYOA 4C8PA 1IGBA 1Z8LA 1WJTA 3IU1A 4MJXA 4TNUA 4HKFA 4WJBA 3TLCA 2WSAA 2R98A 4ORFA 3EO4A 4NGRA 3JUWA 4ZGYB 4CPAA 2R7HA 4QUSA 2OLSA 5HKWA 4M6IA 1X10A 3D4UA 2JEWA 1EZBA 5K99A 3V8IA 1WVMA 1VI4A 3UY5A 3S6HA 3JRUA 1AYEA 4CDKA 2UV8G 2V8DA 4FD5A 5CPAA 2ZEHA 4CS0B 4OAEA 1OBRA 4PXCA 3IU2A 3EXNA 3DR8A 3GKRA 3TX8A 4C2ZA 3ZNIA 4DYOA 2XEIA 2E28A 1XE4A 4KOVA 4UCNA 4KOWA 2WPWA 4MY3A 3WC6A 1K4JA 1LFWA 4OADA 4PSXA 2EK8A 3HPGG 3IEHA 2VZYA 4PV6A 3TT2A 2FVGA 4MMOA 2V77A 1Q2CA 3T9YA 2QYVA 5G21A 4C8UA 1I21A 2GU2A 4X8IA 4CGLA 4HPSA 3CPAA 1R57A 4OC5A 1Y9WA 4JXQA 5JPHA 4JVOA 4BPUB 3TLYA 2CY2A 3TYXA 1UWYA 1ZLIA 1M44A 2Q7SA 5LYLA 2CTCA 2FIWA 1M4LA 1YVHA 5D29A 2G0BA 1QSRA 1LAPA 1QQ9A 3NA6A 4JJXA 3P2FA 4MFQA 2FXFA 4X3RA 4R3KA 2YNEA 2B58A 4KZTA 5K8PA 1YW4A 2B4DA 3IFEA 1XF1A 5G22A 2C27A 2HB6A 3T90A 1YLEA 4A94A 4BMHA 1V6CA 4FD7A 5F9MA 3D7DA 4C7HA 3TE4A 3IGRA 5H86A 1FY7A 4JD6A 1S7FA 5LYFA 5J3XA 3VWEA 4COGA 4KVOE 4NJQA 3C26A 4JYWA 4IIYA 1YREA 3JTKA 3H4QA 4R8FA 1M1DA 5F47A 8CPAA 1U6MA 2BEIA 4MHNA 2VI7A 2CNSA 2EZCA 1YLOA 4C8CA 3PRTA 1Y9ZA 4XNHC 3SR3A 3QB8A 2I00A 4KVXA 4UEZA 5JQ4A 1IICA 1NE9A 1TKHA 3CXQA 3RAMA 3PLFB 3JVNA 4CYQA 2BUEA 4MCQA 1VHEA 1Z8TA 2FL4A 3OWCA 4KSIA 3B3CA 4ZY2A 5C82A 1JDBC 1Q5XA 3TLGA 4CYPA 2EWBA 2OZGA 1YGHA 4EMEA 2IL4A 2JEVA 2OZUA 4E2AA 2GREA 2HC9A 1I1DA 4ZI6A 2AFWA 4UCPA 4P45A 2JLMA 3OB2B 4MCRA 1Z2LA 3KL9A 4ONUA 5THWA 3RZAA 4CAEA 4F9VA 2ODFA 2ZEGA 2XPNA 4J0NA 4IAVA 3K9UA 3WC7A 3CDXA 4KSAA 4U9YA 2HWGA 5HXDA 2D4PA 1IYKA 3GJZA 4R57A 4OC1A 4JWPA 3B3WA 3QAYA 3VTAA 5IV0A 1S60A 3B2YA 3TLEA 2EK9A 2O53A 4XPKA 5AG4A 4C99A 2G3AA 3SI0A 4UWJA 4ZY1A 5GCNA 3N5FA 5BY0A 1VHSA 2V8GA 3KASA 2Q7BA 4II9A 5DS0A 1A9XB 3KHZA 4FUUA 1Y9KA 4OMEA 3B3VA 4ZX8A 3D7GA
chains in the Genus database with same CATH topology
1BLLE 2QJ8A 4UEFA 4A39A 2RB7A 2NSMA 3DGVA 4W9YA 1Y0YA 3H8GA 2PIZA 1F57A 1JQGA 2C5QA 2ANPA 4UEEA 2PCUA 3ISXA 4TWEA 3T8WA 3NH4A 3IWWA 3MRUA 2CTBA 4TJXA 3FMCA 4DUKA 1YW6A 1ZG9A 1R43A 2BOAA 2AFMA 3FH4A 4P4EA 1XBUA 2ZENA 3SJFA 3LWUA 2C6CA 1AMPA 3I1UA 2ZEPA 4ZYQA 3S9MA 1EE3P 4B6ZA 2AFZA 1BPMA 1HDQA 5JGFA 2C6PA 2PVWA 2XEGA 3BHXA 4X2TA 5JM6A 4UIAA 4MRIA 5HVHA 2AFUA 3KR5A 5CBMA 2NYQA 4O23A 2VL1A 1ARMA 4NGNA 5IB9A 3FF3A 4P44A 4A37A 1YSJA 4DJLA 4C8FA 2F8HA 4OIWA 4C9RA 2V8VA 3FEEA 4P6YA 1CX8A 3IJ3A 3FX6A 2IQ6A 2G9DA 4OC4A 1Q7LA 5K8NA 4TJVA 1VGYA 3HLPA 4AXVA 2PVVA 1ZLHA 2ZEMA 3FEDA 5ELYA 2C6GA 2PE3A 2Q4ZA 3VH9A 1BAVA 1QMUA 1LCPA 5I4MA 1FT7A 5J1QA 3QNVA 3K9TA 1CPSA 1Y7EA 1H8LA 4Q7AA 2V8HA 3B35A 3B3TA 2PJAA 4MCSA 3NH5A 4ONWA 4NGQA 1LAMA 2PIYA 4OC0A 3KHXA 1IY7A 1F2OA 4NGMA 1NSAA 1TF9A 2PJ4A 3ICUA 4ZX9A 1ZG7A 4IHMA 3S9LA 4C8TA 4P4BA 2XEFA 3HUVA 2DEAA 3PB9X 4F9UA 3PB4X 4G1PA 2QVPA 1ELLP 1CPXA 1CP7A 1CP6A 1XRYA 3CPXA 1ARLA 3PEIA 5D8NA 4F8ZA 1F2PA 3KQXA 3KZWA 3I74A 3WABA 1HEEA 2GP4A 3SI2A 5JH9A 4NGTA 1XFOA 3PFEA 4NGPA 3L2NA 3PB7X 1GYTA 1PYTB 3D7FA 2JBJA 2I3CA 6CPAA 4C9AA 5LRKA 1LOKA 3H8EA 1HDUA 5F09A 2F7VA 3ISZA 3D68A 3FECA 4Z65A 1RTQA 4MHZA 4WWVA 4C8AA 7CPAA 2WYRA 2JBKA 2PJ8A 2ZEDA 3BXMA 3NH8A 4MXUA 4UF4A 2RFHA 3KGQA 1DE4C 3NFZA 4C9UA 1PCAA 4P4DA 2AFSA 4P4IA 4LQGA 3TC8A 4NFRA 4R76A 4C9VA 2IJZA 3LMSA 4PXBA 1CBXA 4EFDA 4MHPA 3VATA 3RBUA 4P10A 4C85A 5LYDA 3IO1A 3PBBA 1Y0RA 2J9AA 3PBEA 3FJUA 4FBEA 4OC3A 4EWTA 1XMBA 4C9EA 3D67A 3BI1A 3V7ZA 3VARA 4YWYA 4NJRA 4YN3A 4OIDA 3CT9A 5LRGA 3B7IA 3KR4A 3K2KA 1CG2A 2ZEEA 2ZEOA 4PPZA 5LYIA 2Q51A 2CIJA 4BD9A 3WC5A 2POKA 1KWMA 2BCOA 4H2KA 4R7MA 3GUXA 2OR4A 3IC1A 4C86A 2PJ2A 1R3NA 2XEJA 1TKFA 2ZOFA 4JZ0A 3D7HA 1ZG8A 4FAIA 2PJ3A 4ZY0A 2ABZA 3EIFA 1Z5RA 2AFOA 5IR2A 3SJEA 4OC2A 1VHOA 4MHYA 5LRJA 3WT4A 5K8OA 4UIBA 2PRQA 4NGSA 3DLJA 4A38A 2O4HA 4IK2A 2PJ1A 1LANA 2PJ6A 3I6SA 2PJCA 2GLJA 3PFOA 2IMOA 4MCPA 2ZELA 3D66A 5HVGA 5HVFA 3B3SA 5K8MA 4K3NA 1TXRA 3GB0A 4RUHA 3SJGA 2PJ0A 1DTDA 1VIXA 3H8FA 3IIBA 4FWUA 4KNGE 4OKOA 2PJ7A 3BI0A 1BPNA 3S9NA 2AFXA 2GLFA 3GLJA 2Q43A 3PB6X 4PXDA 1XJOA 3V38A 2CF4A 4OP4A 4GM5A 1ELMP 3KI9A 1YMEA 4CDJA 1TKJA 2PJ5A 4C84A 4YU9A 4R6TA 1FNOA 2PJBA 2BO9A 4PQAA 4PXEA 3SJXA 3SI1A 1TF8A 2WZNA 2C1CA 2ZOGA 3FVLA 4P4JA 2PJ9A 2OOTA 3MN8A 4P4FA 2ZEFA 3KQZA 4C8PA 3PB8X 1IGBA 1Z8LA 4TNUA 4WJBA 4NGRA 4CPAA 3D4UA 2JEWA 1WVMA 3JRUA 1AYEA 4CDKA 2V8DA 5CPAA 2ZEHA 1OBRA 4PXCA 3TX8A 4DYOA 2XEIA 3WC6A 1LFWA 2EK8A 3IEHA 2FVGA 4MMOA 2V77A 2QYVA 4C8UA 2GU2A 4X8IA 3CPAA 4OC5A 1UWYA 1ZLIA 5LYLA 2CTCA 1M4LA 5D29A 3NA6A 1LAPA 1QQ9A 4X3RA 5K8PA 1YW4A 3IFEA 1XF1A 1V6CA 2HB6A 4A94A 3D7DA 5LYFA 4NJQA 4JYWA 4R8FA 8CPAA 4MHNA 1YLOA 4C8CA 3PRTA 1Y9ZA 4UEZA 1TKHA 3RAMA 4MCQA 1VHEA 4KSIA 4ZY2A 3B3CA 2EWBA 4EMEA 2GREA 2HC9A 4ZI6A 2AFWA 4P45A 5THWA 4MCRA 1Z2LA 3KL9A 4F9VA 3RZAA 2ZEGA 4IAVA 3WC7A 3CDXA 5HXDA 4OC1A 3B3WA 3VTAA 4C99A 3B2YA 2EK9A 2O53A 3SI0A 4ZY1A 3N5FA 2V8GA 3KASA 5DS0A 3KHZA 4FUUA 4OMEA 3B3VA 4ZX8A 3D7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLL E;  2QJ8 A;  4UEF A;  4A39 A;  2RB7 A;  2NSM A;  3DGV A;  4W9Y A;  1Y0Y A;  3H8G A;  2PIZ A;  1F57 A;  1JQG A;  2ANP A;  4UEE A;  2PCU A;  3ISX A;  4TWE A;  3T8W A;  3NH4 A;  3IWW A;  3MRU A;  2CTB A;  4TJX A;  3FMC A;  4DUK A;  1YW6 A;  1ZG9 A;  1R43 A;  2BOA A;  2AFM A;  3FH4 A;  4P4E A;  1XBU A;  2ZEN A;  3SJF A;  3LWU A;  2C6C A;  1AMP A;  3I1U A;  2ZEP A;  4ZYQ A;  3S9M A;  1EE3 P;  4B6Z A;  2AFZ A;  1BPM A;  1HDQ A;  5JGF A;  2C6P A;  2PVW A;  2XEG A;  3BHX A;  4X2T A;  5JM6 A;  4UIA A;  4MRI A;  5HVH A;  2AFU A;  3KR5 A;  5CBM A;  2NYQ A;  4O23 A;  2VL1 A;  1ARM A;  4NGN A;  5IB9 A;  3FF3 A;  4P44 A;  4A37 A;  1YSJ A;  4DJL A;  4C8F A;  2F8H A;  4OIW A;  4C9R A;  2V8V A;  3FEE A;  4P6Y A;  1CX8 A;  3IJ3 A;  3FX6 A;  2IQ6 A;  2G9D A;  4OC4 A;  1Q7L A;  5K8N A;  4TJV A;  1VGY A;  3HLP A;  4AXV A;  2PVV A;  1ZLH A;  2ZEM A;  3FED A;  5ELY A;  2C6G A;  2PE3 A;  2Q4Z A;  3VH9 A;  1BAV A;  1QMU A;  1LCP A;  5I4M A;  1FT7 A;  5J1Q A;  3QNV A;  3K9T A;  1CPS A;  1Y7E A;  1H8L A;  4Q7A A;  2V8H A;  3B35 A;  3B3T A;  2PJA A;  4MCS A;  3NH5 A;  4ONW A;  4NGQ A;  1LAM A;  2PIY A;  4OC0 A;  3KHX A;  1IY7 A;  1F2O A;  4NGM A;  1NSA A;  1TF9 A;  2PJ4 A;  3ICU A;  4ZX9 A;  1ZG7 A;  4IHM A;  3S9L A;  4C8T A;  4P4B A;  2XEF A;  3HUV A;  2DEA A;  3PB9 X;  4F9U A;  3PB4 X;  4G1P A;  2QVP A;  1ELL P;  1CPX A;  1CP7 A;  1CP6 A;  1XRY A;  3CPX A;  1ARL A;  3PEI A;  5D8N A;  4F8Z A;  1F2P A;  3KQX A;  3KZW A;  3I74 A;  3WAB A;  1HEE A;  3SI2 A;  5JH9 A;  4NGT A;  1XFO A;  3PFE A;  4NGP A;  3L2N A;  3PB7 X;  1GYT A;  1PYT B;  3D7F A;  2JBJ A;  2I3C A;  6CPA A;  4C9A A;  5LRK A;  1LOK A;  3H8E A;  1HDU A;  5F09 A;  2F7V A;  3ISZ A;  3D68 A;  3FEC A;  4Z65 A;  1RTQ A;  4MHZ A;  4WWV A;  4C8A A;  7CPA A;  2WYR A;  2JBK A;  2PJ8 A;  2ZED A;  3BXM A;  3NH8 A;  4MXU A;  4UF4 A;  2RFH A;  3KGQ A;  1DE4 C;  3NFZ A;  4C9U A;  1PCA A;  4P4D A;  2AFS A;  4P4I A;  4LQG A;  3TC8 A;  4NFR A;  4R76 A;  4C9V A;  2IJZ A;  3LMS A;  4PXB A;  1CBX A;  4EFD A;  4MHP A;  3VAT A;  3RBU A;  4P10 A;  4C85 A;  5LYD A;  3IO1 A;  3PBB A;  1Y0R A;  2J9A A;  3PBE A;  3FJU A;  4FBE A;  4OC3 A;  4EWT A;  1XMB A;  4C9E A;  3D67 A;  3BI1 A;  3V7Z A;  3VAR A;  4YWY A;  4NJR A;  4YN3 A;  4OID A;  3CT9 A;  5LRG A;  3B7I A;  3KR4 A;  3K2K A;  1CG2 A;  2ZEE A;  2ZEO A;  4PPZ A;  5LYI A;  2Q51 A;  2CIJ A;  4BD9 A;  3WC5 A;  2POK A;  1KWM A;  2BCO A;  4H2K A;  4R7M A;  3GUX A;  2OR4 A;  3IC1 A;  4C86 A;  2PJ2 A;  1R3N A;  2XEJ A;  1TKF A;  2ZOF A;  4JZ0 A;  3D7H A;  1ZG8 A;  4FAI A;  2PJ3 A;  4ZY0 A;  2ABZ A;  3EIF A;  1Z5R A;  2AFO A;  3SJE A;  4OC2 A;  1VHO A;  4MHY A;  5LRJ A;  3WT4 A;  5K8O A;  4UIB A;  2PRQ A;  4NGS A;  3DLJ A;  4A38 A;  2O4H A;  4IK2 A;  2PJ1 A;  1LAN A;  2PJ6 A;  3I6S A;  2PJC A;  2GLJ A;  3PFO A;  2IMO A;  4MCP A;  2ZEL A;  3D66 A;  5HVG A;  5HVF A;  3B3S A;  5K8M A;  4K3N A;  1TXR A;  3GB0 A;  4RUH A;  3SJG A;  2PJ0 A;  1DTD A;  1VIX A;  3H8F A;  3IIB A;  4FWU A;  4KNG E;  4OKO A;  2PJ7 A;  3BI0 A;  1BPN A;  3S9N A;  2AFX A;  2GLF A;  3GLJ A;  2Q43 A;  3PB6 X;  4PXD A;  1XJO A;  3V38 A;  2CF4 A;  4OP4 A;  4GM5 A;  1ELM P;  3KI9 A;  1YME A;  4CDJ A;  1TKJ A;  2PJ5 A;  4C84 A;  4YU9 A;  4R6T A;  1FNO A;  2PJB A;  2BO9 A;  4PQA A;  4PXE A;  3SJX A;  3SI1 A;  1TF8 A;  2WZN A;  2C1C A;  2ZOG A;  3FVL A;  4P4J A;  2PJ9 A;  2OOT A;  3MN8 A;  4P4F A;  2ZEF A;  3KQZ A;  4C8P A;  3PB8 X;  1IGB A;  1Z8L A;  4TNU A;  4WJB A;  4NGR A;  4CPA A;  3D4U A;  2JEW A;  1WVM A;  3JRU A;  1AYE A;  4CDK A;  2V8D A;  5CPA A;  2ZEH A;  1OBR A;  4PXC A;  3TX8 A;  4DYO A;  2XEI A;  3WC6 A;  1LFW A;  2EK8 A;  3IEH A;  2FVG A;  4MMO A;  2V77 A;  2QYV A;  4C8U A;  2GU2 A;  4X8I A;  3CPA A;  4OC5 A;  1UWY A;  1ZLI A;  5LYL A;  2CTC A;  1M4L A;  5D29 A;  3NA6 A;  1LAP A;  1QQ9 A;  4X3R A;  5K8P A;  1YW4 A;  3IFE A;  1XF1 A;  1V6C A;  2HB6 A;  4A94 A;  3D7D A;  5LYF A;  4NJQ A;  4JYW A;  4R8F A;  8CPA A;  4MHN A;  1YLO A;  4C8C A;  3PRT A;  1Y9Z A;  4UEZ A;  1TKH A;  3RAM A;  4MCQ A;  1VHE A;  4KSI A;  4ZY2 A;  3B3C A;  2EWB A;  4EME A;  2GRE A;  2HC9 A;  4ZI6 A;  2AFW A;  4P45 A;  5THW A;  4MCR A;  1Z2L A;  3KL9 A;  4F9V A;  3RZA A;  2ZEG A;  4IAV A;  3WC7 A;  3CDX A;  5HXD A;  4OC1 A;  3B3W A;  3VTA A;  4C99 A;  3B2Y A;  2EK9 A;  2O53 A;  3SI0 A;  4ZY1 A;  3N5F A;  2V8G A;  3KAS A;  5DS0 A;  3KHZ A;  4FUU A;  4OME A;  3B3V A;  4ZX8 A;  3D7G A; 
#chains in the Genus database with same CATH topology
 1BLL E;  2PR1 A;  2Y1N A;  1XF8 A;  4YFJ A;  2QJ8 A;  2WUU A;  2DXQ A;  4UEF A;  5DWM A;  1VBH A;  4A39 A;  3U1B A;  1ZRS A;  3DDD A;  5AXI A;  3R9F A;  4COB A;  2RB7 A;  3A9L A;  2NSM A;  3DGV A;  2P6F A;  4A32 A;  4GPL B;  4W9Y A;  3T05 A;  1Y0Y A;  4C2X A;  2R1I A;  3T0T A;  3H8G A;  1GHE A;  4INJ A;  4UBR A;  3F0A A;  3OP0 A;  2VQY A;  4GS4 A;  1BO4 A;  2PIZ A;  1F57 A;  4CAV A;  4QVT A;  1JQG A;  5C88 A;  3G8W A;  2C5Q A;  2ANP A;  4Q36 A;  4UEE A;  4AVC A;  2PCU A;  4F6A A;  5ISV A;  1Z8X A;  1YVO A;  3ISX A;  5JVL A;  5HKZ A;  4M8D A;  4TWE A;  2AUN A;  1GGO A;  4IIX A;  5KTD A;  1QST A;  3GY9 A;  2EO8 A;  3T8W A;  3NH4 A;  4A30 A;  3IWW A;  3MRU A;  2XPL A;  4M85 A;  2X0S A;  3EZE A;  2CTB A;  3I3G A;  1C3O B;  3FMC A;  4TJX A;  3BLN A;  1Z4R A;  4DUK A;  3EFA A;  1YW6 A;  1XMT A;  3T07 A;  3TLA A;  3VRN A;  1MJB A;  2QEC A;  4PSW A;  3QAH A;  3TLZ A;  1ZG9 A;  1EO0 A;  1IU8 A;  1R43 A;  2Z3O A;  2BOA A;  3SXN A;  3PT1 A;  5HKY A;  2R8V A;  1Z8W A;  2B4J C;  2AFM A;  2EVN A;  4P4E A;  3FH4 A;  3W6X A;  4XPL A;  2PC1 A;  3E0K A;  1XBU A;  3PGP A;  5H84 A;  1R61 A;  2ZEN A;  2B0A A;  2J8M A;  3SJF A;  3LWU A;  2C6C A;  1AMP A;  2OH1 A;  3I1U A;  3SHP A;  2JDC A;  3BUM B;  2ZEP A;  4ZYQ A;  1IOF A;  1ON0 A;  1KUY A;  4UWI A;  1EZA A;  3S9M A;  1EE3 P;  1Z9E A;  2AFZ A;  4B6Z A;  2DPS A;  3ZZI A;  4E0A A;  1BPM A;  1HDQ A;  2FT0 A;  4B13 A;  4UA3 A;  3TTH A;  2VBQ A;  5JGF A;  4B5P B;  2C6P A;  4C8F A;  2PVW A;  4CGN A;  1MJA A;  4L89 A;  2P6E A;  3N7Z A;  2XEG A;  3BHX A;  3IWE A;  4X2T A;  5JM6 A;  4UIA A;  5AG7 A;  4MRI A;  3EY5 A;  5HVH A;  2AFU A;  2FS5 A;  4KLV A;  5A28 A;  3B8G A;  3FB3 A;  3KR5 A;  2YNC C;  1B47 A;  3NFQ A;  2NYQ A;  5CBM A;  4UFW A;  3LAC A;  2D0P A;  1WK4 A;  4O23 A;  1J3L A;  4MFJ A;  2VL1 A;  2VXK A;  1YK3 A;  1IB1 E;  1ARM A;  4NGN A;  3D2M A;  5FVJ A;  5IB9 A;  3I9S A;  1T36 B;  4R87 A;  2VEZ A;  3FF3 A;  2EBJ A;  3SXO A;  4P44 A;  5KTA A;  1NBW A;  2FSR A;  2QIR A;  1MK4 A;  1YSJ A;  4M3S A;  4A37 A;  4DJL A;  2F8H A;  4OIW A;  2OU2 A;  4A95 A;  1PUA A;  3C8O A;  4C9R A;  4HNX B;  3HPH E;  1JDE A;  4CAW A;  5HMN A;  1RO5 A;  3FXT A;  2V8V A;  4E8O A;  4MJ8 A;  3FEE A;  4JXR A;  4P6Y A;  1CX8 A;  3IJ3 A;  4HNW B;  3FX6 A;  2IQ6 A;  2G9D A;  4XPD C;  4A31 A;  4OC4 A;  1Z9U A;  2KCW A;  1LRZ A;  1XOV A;  2N3A B;  2VZZ A;  1Q7L A;  5K8N A;  2B3U A;  5F46 A;  2EUI A;  1VKC A;  4JLY A;  2ZW6 A;  2ARH A;  2CNM A;  5EMI A;  4TJV A;  2ZPA A;  5CNP A;  1VGY A;  5F48 A;  3HLP A;  2AUM A;  3FBU A;  4MFK A;  2PVV A;  4AXV A;  1YR0 A;  4BPX B;  1ZLH A;  2ZEM A;  4MFZ A;  3W91 A;  4BPW B;  3FED A;  5ELY A;  2C6G A;  2PE3 A;  2Q4Z A;  1P4N A;  3PZJ A;  3VH9 A;  3VWD A;  4EVY A;  4I49 A;  1BAV A;  1QMU A;  1LCP A;  5I4M A;  2NMT A;  3BJ8 A;  1FT7 A;  2D0O A;  4KOR A;  5J1Q A;  3QNV A;  4Y49 C;  5AG5 A;  4GXH A;  3K9T A;  1CPS A;  4FD4 A;  1Y7E A;  5AGE A;  1H8L A;  1KEE B;  1M4I A;  2CXA A;  4Q7A A;  2REE A;  2V8H A;  1Q2D A;  2GFQ A;  2PJA A;  3B35 A;  3B3T A;  3R9E A;  4CGP A;  2FM4 A;  4MCS A;  3NH5 A;  4ONW A;  4NGQ A;  1LAM A;  2PIY A;  3CXS A;  4H1H A;  3VRQ A;  4CO9 A;  4OC0 A;  3KHX A;  4ZBG A;  1S5K A;  1IY7 A;  4RN7 A;  2ZW7 A;  1F2O A;  4NGM A;  1NSA A;  1CM0 A;  1TF9 A;  2PJ4 A;  4MHD A;  4ZX9 A;  1TIQ A;  3ICU A;  1ZG7 A;  4IHM A;  1XEB A;  3S9L A;  4C8T A;  4A4C A;  3BUX B;  3VRP A;  4P4B A;  4KOU A;  2Z11 A;  2XEF A;  3HUV A;  2DEA A;  5BWA B;  3NE7 A;  2CNT A;  3PB9 X;  4F9U A;  2Z3P A;  3BUN B;  3PB4 X;  4RS2 A;  4XNH B;  4G1P A;  2BSW A;  3VRO A;  4YRH A;  5J8F A;  2QVP A;  4PK3 A;  1ELL P;  1CPX A;  1FBV A;  1CP7 A;  1CP6 A;  1S7L A;  4NCZ A;  1XRY A;  1N71 A;  2VKZ G;  1ARL A;  3BJ7 A;  3CPX A;  3PEI A;  5D8N A;  4RR2 B;  3FIX A;  5IB0 A;  4BBH A;  1X12 A;  2PR8 A;  4F8Z A;  1F2P A;  3KQX A;  3KZW A;  3I74 A;  1Z4E A;  4HNY B;  3WAB A;  1HEE A;  2GP4 A;  5F1Y A;  3SI2 A;  3TO7 A;  4QBJ A;  5EC4 A;  5JH9 A;  4NGT A;  4EYS A;  3D8P A;  1XFO A;  4H89 A;  4KOY A;  4FD6 A;  3PFE A;  2ZW4 A;  3H5Z A;  4NGP A;  3L2N A;  1KUX A;  3F8K A;  3PB7 X;  1NSL A;  1GYT A;  1PYT B;  3D7F A;  2ZW5 A;  2REF A;  2JBJ A;  2I3C A;  3PP9 A;  5AG6 A;  6CPA A;  4F0X A;  4C9A A;  2B5G B;  1LOK A;  3H8E A;  4NEX A;  1HDU A;  4M6G A;  5LRK A;  5F09 A;  2F7V A;  2YJV A;  3ISZ A;  4B10 A;  5A27 A;  3BUW B;  1OZP A;  3D68 A;  4H6U A;  2O28 A;  3S6G A;  3FEC A;  2J8R A;  2P0W A;  4Z65 A;  1RTQ A;  1CS0 B;  2EZA A;  4MHZ A;  4KVM E;  4WWV A;  2HV2 A;  3U88 C;  4C8A A;  2Z3M A;  7CPA A;  2Q0Y A;  4K30 A;  4CRY B;  4MI1 A;  3TO6 A;  3ZJ0 A;  2WYR A;  4NXY A;  2I79 A;  3OB1 B;  2JBK A;  1KUV A;  2PJ8 A;  3NOJ A;  2F5I A;  1IYL A;  3BXM A;  2ZED A;  3NH8 A;  2WPX A;  4MXU A;  3R9G A;  1KC7 A;  3OAK A;  4UF4 A;  4MI4 A;  2Q44 A;  2RFH A;  3KGQ A;  1DE4 C;  3NFZ A;  4M6H A;  5I0C A;  3W6S A;  4C9U A;  3VRR A;  2DPT A;  1ZYM A;  1PCA A;  5EBV A;  4P4D A;  2AFS A;  3CXP A;  1L0C A;  3D3S A;  3EZB A;  3CZX A;  4P4I A;  3DNS A;  1S3Z A;  4LQG A;  2PQ8 A;  2OZH A;  4QC6 A;  3GIU A;  3TC8 A;  3TOA A;  5G1Z A;  4NFR A;  4R76 A;  4C9V A;  1M4D A;  2IJZ A;  2YGW A;  3LMS A;  4MY0 A;  4PXB A;  1IID A;  2Q04 A;  3RO0 A;  2DF5 A;  1CBX A;  4EFD A;  4R9M A;  4MHP A;  2YND A;  4E5S A;  3VAT A;  1PU9 A;  3RBU A;  3FRM A;  4P10 A;  4C85 A;  1S7N A;  5LYD A;  3IO1 A;  5HH1 A;  3R1K A;  3PBB A;  4B5P A;  2QML A;  1A2Z A;  1Y0R A;  2J9A A;  3T5M A;  1ZL0 A;  4MFP A;  3PBE A;  3PFV A;  2FCK A;  3FJU A;  2Z10 A;  4AVB A;  2X7B A;  4NSQ A;  4FBE A;  2EZB A;  2HQY A;  4BTF A;  4OC3 A;  1NXJ A;  4EWT A;  1XMB A;  1YX0 A;  4KOS A;  4CGO A;  3RNZ A;  3VGO A;  2MP0 A;  4C68 A;  4C9E A;  3D67 A;  4AVA A;  3BI1 A;  1CE8 B;  3V7Z A;  3VAR A;  4CYN A;  3G3S A;  4YWY A;  4NJR A;  2G3T A;  4OID A;  3KRV A;  4KS9 A;  3CT9 A;  4YN3 A;  4B12 A;  4DNC A;  5LRG A;  2A4N A;  2ZXV A;  2H5M A;  3B7I A;  3S6K A;  3KR4 A;  4KUA A;  3K2K A;  3P2H A;  5KTC A;  1CG2 A;  2Z0Z A;  2ZEE A;  2ZEO A;  4PPZ A;  5LYI A;  2Q51 A;  1QSN A;  2B4D B;  2CIJ A;  3D2P A;  3LOD A;  4BD9 A;  2PDO A;  2Y1M A;  2POK A;  3WC5 A;  1KWM A;  1XIX A;  2B3V A;  2JDD A;  2B4B A;  2BCO A;  5F13 A;  1J4J A;  4H2K A;  4R7M A;  1P0H A;  3GUX A;  2Z3L A;  2GIV A;  3LD2 A;  2OR4 A;  2K5T A;  3IC1 A;  4C86 A;  2PJ2 A;  2P6G A;  1SQH A;  4UFV A;  3TCV A;  1R3N A;  2XEJ A;  1C30 B;  1TKF A;  2ZOF A;  2OB0 A;  4CYO A;  3TFY A;  5G20 A;  4JZ0 A;  4CGM A;  3D7H A;  2YNC A;  4CRZ B;  1ZG8 A;  4FAI A;  2PJ3 A;  4OLL A;  2YJT A;  4C2Y A;  4ZY0 A;  2ABZ A;  4YGO A;  2Z3K A;  4R3L A;  1B87 A;  2J8N A;  2PCN A;  5F5X A;  3EIF A;  1Z5R A;  4XPD B;  1QSM A;  2AFO A;  3DR6 A;  5IR2 A;  2Q4Y A;  4KOX A;  2BL1 A;  3SJE A;  4B14 A;  4OC2 A;  3TLG B;  1VHO A;  4MHY A;  2PRB A;  3MGD A;  4L8A A;  4LQ6 A;  5LRJ A;  3WT4 A;  5K8O A;  4UIB A;  3R96 A;  5FD8 A;  3BUO B;  2PRQ A;  1S7K A;  2Y0M A;  4J3G A;  4NF1 A;  4AG7 A;  4NGS A;  3NE8 A;  3DLJ A;  4A38 A;  3FNC A;  2O4H A;  4IK2 A;  3R95 A;  2PJ1 A;  2FE7 A;  1BOB A;  2XPO A;  1LAN A;  2FIA A;  2PJ6 A;  2PJC A;  3I6S A;  2PSW A;  3F5B A;  2GLJ A;  1I12 A;  2HUZ A;  2IMO A;  4MCP A;  1RXT A;  2ZEL A;  3PFO A;  5E96 A;  3K4I A;  4U9Z A;  3D66 A;  5HVG A;  5HVF A;  3B3S A;  4AG9 A;  5K8M A;  4KLW A;  4Y49 B;  4K3N A;  4B11 A;  1TXR A;  2HI6 A;  3GB0 A;  4RUH A;  3KKW A;  4LX9 A;  1IOI A;  4KUB A;  4MBU A;  1CJW A;  4X5K A;  3DSB A;  3SJG A;  4IUS A;  4E94 A;  1Q2Y A;  5F49 A;  3EZA A;  2PJ0 A;  2RC4 A;  1UFH A;  4KOT A;  1BXR B;  1DTD A;  1VIX A;  1KBL A;  2AJ6 A;  3H8F A;  1YQE A;  3IIB A;  2Q4V A;  4LUA A;  1VBG A;  4FWU A;  4KNG E;  4OKO A;  5DWN A;  1Y7R A;  4C7I A;  2PJ7 A;  2ATR A;  1M6V B;  3BI0 A;  1BPN A;  3S9N A;  1MJ9 A;  2AFX A;  2GLF A;  4KSF A;  1JWQ A;  4A2Z A;  2DIK A;  1V0C A;  3GLJ A;  2Q43 A;  3PB6 X;  1QSO A;  4RI1 A;  4CAF A;  4CAX A;  4CZ1 A;  4PXD A;  5JYB A;  1XJO A;  2R82 A;  4A33 A;  3TOB A;  4UFX A;  5IX3 A;  3G23 A;  3V38 A;  2CF4 A;  4OP4 A;  3TLB A;  4GM5 A;  3WR7 A;  1ELM P;  2CBL A;  4A4B A;  3KI9 A;  1YME A;  3EC4 A;  4UCM A;  4B5O A;  4CDJ A;  1TKJ A;  2PJ5 A;  4C84 A;  1KZF A;  2B5G A;  4YU9 A;  4R6T A;  4U5Y A;  2GAN A;  4AB7 A;  3F9K C;  3HMJ G;  1FNO A;  3IWG A;  1DIK A;  1NMT A;  2PJB A;  4PK2 A;  2BO9 A;  1YVK A;  1ZO0 A;  4H6Z A;  3FYN A;  1B6B A;  4PQA A;  3TO9 A;  1AUG A;  4F0Y A;  5J8C A;  4IF5 A;  4PXE A;  2XPP A;  2AE6 A;  2Z3N A;  2HRO A;  3SJX A;  3SI1 A;  1TF8 A;  4QB9 A;  2WZN A;  2C1C A;  4BIN A;  2DLA A;  1M4G A;  2ZOG A;  3S6F A;  2GE3 A;  1WWZ A;  4P4J A;  2OOT A;  2PJ9 A;  3FVL A;  4Q38 A;  2D4O A;  3GYA A;  3MN8 A;  4MFL A;  4P4F A;  2ZEF A;  3KQZ A;  3O8Z A;  3PB8 X;  3RYO A;  4C8P A;  1IGB A;  1Z8L A;  1WJT A;  3IU1 A;  4MJX A;  4TNU A;  4HKF A;  4WJB A;  3TLC A;  2WSA A;  2R98 A;  4ORF A;  3EO4 A;  4NGR A;  3JUW A;  4ZGY B;  4CPA A;  2R7H A;  4QUS A;  2OLS A;  5HKW A;  4M6I A;  1X10 A;  3D4U A;  2JEW A;  1EZB A;  5K99 A;  3V8I A;  1WVM A;  1VI4 A;  3UY5 A;  3S6H A;  3JRU A;  1AYE A;  4CDK A;  2UV8 G;  2V8D A;  4FD5 A;  5CPA A;  2ZEH A;  4CS0 B;  4OAE A;  1OBR A;  4PXC A;  3IU2 A;  3EXN A;  3DR8 A;  3GKR A;  3TX8 A;  4C2Z A;  3ZNI A;  4DYO A;  2XEI A;  2E28 A;  1XE4 A;  4KOV A;  4UCN A;  4KOW A;  2WPW A;  4MY3 A;  3WC6 A;  1K4J A;  1LFW A;  4OAD A;  4PSX A;  2EK8 A;  3HPG G;  3IEH A;  2VZY A;  4PV6 A;  3TT2 A;  2FVG A;  4MMO A;  2V77 A;  1Q2C A;  3T9Y A;  2QYV A;  5G21 A;  4C8U A;  1I21 A;  2GU2 A;  4X8I A;  4CGL A;  4HPS A;  3CPA A;  1R57 A;  4OC5 A;  1Y9W A;  4JXQ A;  5JPH A;  4JVO A;  4BPU B;  3TLY A;  2CY2 A;  3TYX A;  1UWY A;  1ZLI A;  1M44 A;  2Q7S A;  5LYL A;  2CTC A;  2FIW A;  1M4L A;  1YVH A;  5D29 A;  2G0B A;  1QSR A;  1LAP A;  1QQ9 A;  3NA6 A;  4JJX A;  3P2F A;  4MFQ A;  2FXF A;  4X3R A;  4R3K A;  2YNE A;  2B58 A;  4KZT A;  5K8P A;  1YW4 A;  2B4D A;  3IFE A;  1XF1 A;  5G22 A;  2C27 A;  2HB6 A;  3T90 A;  1YLE A;  4A94 A;  4BMH A;  1V6C A;  4FD7 A;  5F9M A;  3D7D A;  4C7H A;  3TE4 A;  3IGR A;  5H86 A;  1FY7 A;  4JD6 A;  1S7F A;  5LYF A;  5J3X A;  3VWE A;  4COG A;  4KVO E;  4NJQ A;  3C26 A;  4JYW A;  4IIY A;  1YRE A;  3JTK A;  3H4Q A;  4R8F A;  1M1D A;  5F47 A;  8CPA A;  1U6M A;  2BEI A;  4MHN A;  2VI7 A;  2CNS A;  2EZC A;  1YLO A;  4C8C A;  3PRT A;  1Y9Z A;  4XNH C;  3SR3 A;  3QB8 A;  2I00 A;  4KVX A;  4UEZ A;  5JQ4 A;  1IIC A;  1NE9 A;  1TKH A;  3CXQ A;  3RAM A;  3PLF B;  3JVN A;  4CYQ A;  2BUE A;  4MCQ A;  1VHE A;  1Z8T A;  2FL4 A;  3OWC A;  4KSI A;  3B3C A;  4ZY2 A;  5C82 A;  1JDB C;  1Q5X A;  3TLG A;  4CYP A;  2EWB A;  2OZG A;  1YGH A;  4EME A;  2IL4 A;  2JEV A;  2OZU A;  4E2A A;  2GRE A;  2HC9 A;  1I1D A;  4ZI6 A;  2AFW A;  4UCP A;  4P45 A;  2JLM A;  3OB2 B;  4MCR A;  1Z2L A;  3KL9 A;  4ONU A;  5THW A;  3RZA A;  4CAE A;  4F9V A;  2ODF A;  2ZEG A;  2XPN A;  4J0N A;  4IAV A;  3K9U A;  3WC7 A;  3CDX A;  4KSA A;  4U9Y A;  2HWG A;  5HXD A;  2D4P A;  1IYK A;  3GJZ A;  4R57 A;  4OC1 A;  4JWP A;  3B3W A;  3QAY A;  3VTA A;  5IV0 A;  1S60 A;  3B2Y A;  3TLE A;  2EK9 A;  2O53 A;  4XPK A;  5AG4 A;  4C99 A;  2G3A A;  3SI0 A;  4UWJ A;  4ZY1 A;  5GCN A;  3N5F A;  5BY0 A;  1VHS A;  2V8G A;  3KAS A;  2Q7B A;  4II9 A;  5DS0 A;  1A9X B;  3KHZ A;  4FUU A;  1Y9K A;  4OME A;  3B3V A;  4ZX8 A;  3D7G A; 
#chains in the Genus database with same CATH homology
 1BLL E;  2QJ8 A;  4UEF A;  4A39 A;  2RB7 A;  2NSM A;  3DGV A;  4W9Y A;  1Y0Y A;  3H8G A;  2PIZ A;  1F57 A;  1JQG A;  2C5Q A;  2ANP A;  4UEE A;  2PCU A;  3ISX A;  4TWE A;  3T8W A;  3NH4 A;  3IWW A;  3MRU A;  2CTB A;  4TJX A;  3FMC A;  4DUK A;  1YW6 A;  1ZG9 A;  1R43 A;  2BOA A;  2AFM A;  3FH4 A;  4P4E A;  1XBU A;  2ZEN A;  3SJF A;  3LWU A;  2C6C A;  1AMP A;  3I1U A;  2ZEP A;  4ZYQ A;  3S9M A;  1EE3 P;  4B6Z A;  2AFZ A;  1BPM A;  1HDQ A;  5JGF A;  2C6P A;  2PVW A;  2XEG A;  3BHX A;  4X2T A;  5JM6 A;  4UIA A;  4MRI A;  5HVH A;  2AFU A;  3KR5 A;  5CBM A;  2NYQ A;  4O23 A;  2VL1 A;  1ARM A;  4NGN A;  5IB9 A;  3FF3 A;  4P44 A;  4A37 A;  1YSJ A;  4DJL A;  4C8F A;  2F8H A;  4OIW A;  4C9R A;  2V8V A;  3FEE A;  4P6Y A;  1CX8 A;  3IJ3 A;  3FX6 A;  2IQ6 A;  2G9D A;  4OC4 A;  1Q7L A;  5K8N A;  4TJV A;  1VGY A;  3HLP A;  4AXV A;  2PVV A;  1ZLH A;  2ZEM A;  3FED A;  5ELY A;  2C6G A;  2PE3 A;  2Q4Z A;  3VH9 A;  1BAV A;  1QMU A;  1LCP A;  5I4M A;  1FT7 A;  5J1Q A;  3QNV A;  3K9T A;  1CPS A;  1Y7E A;  1H8L A;  4Q7A A;  2V8H A;  3B35 A;  3B3T A;  2PJA A;  4MCS A;  3NH5 A;  4ONW A;  4NGQ A;  1LAM A;  2PIY A;  4OC0 A;  3KHX A;  1IY7 A;  1F2O A;  4NGM A;  1NSA A;  1TF9 A;  2PJ4 A;  3ICU A;  4ZX9 A;  1ZG7 A;  4IHM A;  3S9L A;  4C8T A;  4P4B A;  2XEF A;  3HUV A;  2DEA A;  3PB9 X;  4F9U A;  3PB4 X;  4G1P A;  2QVP A;  1ELL P;  1CPX A;  1CP7 A;  1CP6 A;  1XRY A;  3CPX A;  1ARL A;  3PEI A;  5D8N A;  4F8Z A;  1F2P A;  3KQX A;  3KZW A;  3I74 A;  3WAB A;  1HEE A;  2GP4 A;  3SI2 A;  5JH9 A;  4NGT A;  1XFO A;  3PFE A;  4NGP A;  3L2N A;  3PB7 X;  1GYT A;  1PYT B;  3D7F A;  2JBJ A;  2I3C A;  6CPA A;  4C9A A;  5LRK A;  1LOK A;  3H8E A;  1HDU A;  5F09 A;  2F7V A;  3ISZ A;  3D68 A;  3FEC A;  4Z65 A;  1RTQ A;  4MHZ A;  4WWV A;  4C8A A;  7CPA A;  2WYR A;  2JBK A;  2PJ8 A;  2ZED A;  3BXM A;  3NH8 A;  4MXU A;  4UF4 A;  2RFH A;  3KGQ A;  1DE4 C;  3NFZ A;  4C9U A;  1PCA A;  4P4D A;  2AFS A;  4P4I A;  4LQG A;  3TC8 A;  4NFR A;  4R76 A;  4C9V A;  2IJZ A;  3LMS A;  4PXB A;  1CBX A;  4EFD A;  4MHP A;  3VAT A;  3RBU A;  4P10 A;  4C85 A;  5LYD A;  3IO1 A;  3PBB A;  1Y0R A;  2J9A A;  3PBE A;  3FJU A;  4FBE A;  4OC3 A;  4EWT A;  1XMB A;  4C9E A;  3D67 A;  3BI1 A;  3V7Z A;  3VAR A;  4YWY A;  4NJR A;  4YN3 A;  4OID A;  3CT9 A;  5LRG A;  3B7I A;  3KR4 A;  3K2K A;  1CG2 A;  2ZEE A;  2ZEO A;  4PPZ A;  5LYI A;  2Q51 A;  2CIJ A;  4BD9 A;  3WC5 A;  2POK A;  1KWM A;  2BCO A;  4H2K A;  4R7M A;  3GUX A;  2OR4 A;  3IC1 A;  4C86 A;  2PJ2 A;  1R3N A;  2XEJ A;  1TKF A;  2ZOF A;  4JZ0 A;  3D7H A;  1ZG8 A;  4FAI A;  2PJ3 A;  4ZY0 A;  2ABZ A;  3EIF A;  1Z5R A;  2AFO A;  5IR2 A;  3SJE A;  4OC2 A;  1VHO A;  4MHY A;  5LRJ A;  3WT4 A;  5K8O A;  4UIB A;  2PRQ A;  4NGS A;  3DLJ A;  4A38 A;  2O4H A;  4IK2 A;  2PJ1 A;  1LAN A;  2PJ6 A;  3I6S A;  2PJC A;  2GLJ A;  3PFO A;  2IMO A;  4MCP A;  2ZEL A;  3D66 A;  5HVG A;  5HVF A;  3B3S A;  5K8M A;  4K3N A;  1TXR A;  3GB0 A;  4RUH A;  3SJG A;  2PJ0 A;  1DTD A;  1VIX A;  3H8F A;  3IIB A;  4FWU A;  4KNG E;  4OKO A;  2PJ7 A;  3BI0 A;  1BPN A;  3S9N A;  2AFX A;  2GLF A;  3GLJ A;  2Q43 A;  3PB6 X;  4PXD A;  1XJO A;  3V38 A;  2CF4 A;  4OP4 A;  4GM5 A;  1ELM P;  3KI9 A;  1YME A;  4CDJ A;  1TKJ A;  2PJ5 A;  4C84 A;  4YU9 A;  4R6T A;  1FNO A;  2PJB A;  2BO9 A;  4PQA A;  4PXE A;  3SJX A;  3SI1 A;  1TF8 A;  2WZN A;  2C1C A;  2ZOG A;  3FVL A;  4P4J A;  2PJ9 A;  2OOT A;  3MN8 A;  4P4F A;  2ZEF A;  3KQZ A;  4C8P A;  3PB8 X;  1IGB A;  1Z8L A;  4TNU A;  4WJB A;  4NGR A;  4CPA A;  3D4U A;  2JEW A;  1WVM A;  3JRU A;  1AYE A;  4CDK A;  2V8D A;  5CPA A;  2ZEH A;  1OBR A;  4PXC A;  3TX8 A;  4DYO A;  2XEI A;  3WC6 A;  1LFW A;  2EK8 A;  3IEH A;  2FVG A;  4MMO A;  2V77 A;  2QYV A;  4C8U A;  2GU2 A;  4X8I A;  3CPA A;  4OC5 A;  1UWY A;  1ZLI A;  5LYL A;  2CTC A;  1M4L A;  5D29 A;  3NA6 A;  1LAP A;  1QQ9 A;  4X3R A;  5K8P A;  1YW4 A;  3IFE A;  1XF1 A;  1V6C A;  2HB6 A;  4A94 A;  3D7D A;  5LYF A;  4NJQ A;  4JYW A;  4R8F A;  8CPA A;  4MHN A;  1YLO A;  4C8C A;  3PRT A;  1Y9Z A;  4UEZ A;  1TKH A;  3RAM A;  4MCQ A;  1VHE A;  4KSI A;  4ZY2 A;  3B3C A;  2EWB A;  4EME A;  2GRE A;  2HC9 A;  4ZI6 A;  2AFW A;  4P45 A;  5THW A;  4MCR A;  1Z2L A;  3KL9 A;  4F9V A;  3RZA A;  2ZEG A;  4IAV A;  3WC7 A;  3CDX A;  5HXD A;  4OC1 A;  3B3W A;  3VTA A;  4C99 A;  3B2Y A;  2EK9 A;  2O53 A;  3SI0 A;  4ZY1 A;  3N5F A;  2V8G A;  3KAS A;  5DS0 A;  3KHZ A;  4FUU A;  4OME A;  3B3V A;  4ZX8 A;  3D7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...