3D7DA

A high resolution crystal structure of human glutamate carboxypeptidase ii (gcpii) in a complex with dcfbd, a urea-based inhibitor
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Interactions between Human Glutamate Carboxypeptidase II and Urea-Based Inhibitors: Structural Characterization
pubmed doi rcsb
source organism Homo sapiens
total genus 263
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3d7dA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3d7dA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3d7dA02
2C6CA 4IK2A 4A94A 1YMEA 4EMEA 2ZEHA 3FJUA 5JH9A 4DUKA 4JZ0A 2EK9A 1TXRA 2IQ6A 1R43A 2PJ4A 4OIDA 5LYLA 4MHPA 5JGFA 1BAVA 1V6CA 2ZENA 4ZY1A 1HDUA 4MHNA 4NJRA 2GLFA 4YWYA 3TX8A 3KL9A 5JM6A 4X3RA 3B7IA 2C6GA 3FEDA 5IB9A 4R7MA 2J9AA 3VTAA 3EIFA 3SJXA 3CPXA 2HC9A 4NJQA 2POKA 4TJVA 3D7DA 6CPAA 1AYEA 3FECA 3ISXA 2JBJA 3PB6X 2CF4A 4R76A 3SI1A 3DGVA 4BD9A 3WABA 2I3CA 4NGPA 4PXDA 4Q7AA 1YW6A 1XRYA 4W9YA 3DLJA 4OC4A 2PE3A 2V8VA 1AMPA 1RTQA 3B3TA 1VHOA 3D67A 3NA6A 1EE3P 4B6ZA 3FF3A 7CPAA 1TKHA 4UIBA 2ZOGA 1LANA 4MRIA 3KHXA 1LOKA 4NGQA 2F8HA 1R3NA 3PFOA 1PCAA 3CDXA 4MHZA 4X8IA 1TKFA 1VIXA 5LRKA 2ZEPA 1LCPA 5LYIA 1NSAA 1HDQA 4UEFA 1WVMA 1M4LA 3SJGA 1F57A 3SI0A 2QJ8A 4TNUA 5J1QA 4UIAA 1KWMA 4Z65A 2ZEEA 3I74A 5D29A 3H8FA 4ZX9A 4JYWA 3RAMA 1CP6A 4OKOA 4EWTA 3KI9A 4OMEA 4R8FA 2AFMA 3I1UA 4P10A 4C8TA 2PVVA 4PXEA 2V77A 2XEJA 1GYTA 1CG2A 2ZEMA 3FMCA 3NH5A 3MN8A 3WC7A 4OC1A 1DTDA 4ZI6A 2PJ0A 1F2OA 4R6TA 2JBKA 2V8DA 3KQXA 3L2NA 4PXCA 1CBXA 2C1CA 2ZELA 4G1PA 4C8AA 8CPAA 1DE4C 3VH9A 3ISZA 2ZEFA 4C8UA 2PJCA 4C8FA 2F7VA 2AFZA 3ICUA 5K8OA 4C99A 4P45A 5CBMA 4P4JA 3LMSA 4LQGA 2C6PA 4A39A 4NGTA 3IC1A 3GLJA 1CPXA 4ZX8A 5LYDA 2PJ6A 1HEEA 2WYRA 1QQ9A 2CTCA 4MCQA 3V38A 1LAMA 3B3VA 4OP4A 5HXDA 3D7HA 5K8PA 4FUUA 2VL1A 2GREA 4A38A 1Z5RA 2ABZA 3GB0A 4OC2A 4P4EA 2QYVA 1ARMA 5CPAA 3BXMA 2NSMA 4WWVA 1PYTB 1Y0YA 3B2YA 2Q51A 1FNOA 4UEZA 4C8PA 5D8NA 2AFXA 1Q7LA 3D7FA 4PPZA 5HVFA 3TC8A 3FEEA 3LWUA 4F8ZA 2PJ5A 3D7GA 1XFOA 4F9VA 3HUVA 3PB7X 4P6YA 3WC6A 3VATA 4OC0A 5F09A 3S9LA 3KGQA 2ZEGA 3FH4A 4IHMA 3I6SA 1QMUA 1BLLE 2AFUA 1LAPA 3K2KA 3MRUA 4MXUA 5ELYA 4EFDA 4MCRA 3IFEA 1LFWA 2CTBA 2V8GA 1H8LA 2NYQA 4ZYQA 4C86A 4F9UA 2ZOFA 3T8WA 3FX6A 2XEIA 1IGBA 2BCOA 3KASA 4FBEA 4C9EA 4X2TA 2PJBA 4NGSA 4NFRA 3H8GA 4C84A 3BI1A 4WJBA 2PJAA 1ELMP 3RZAA 4C9RA 1OBRA 4O23A 3S9MA 1ZG8A 2PJ7A 2PJ3A 3SJFA 2JEWA 3IO1A 4P4BA 2GLJA 4AXVA 4OIWA 3PBEA 2PJ1A 2ANPA 3NH4A 4NGMA 4RUHA 1YLOA 4C85A 1ELLP 5K8MA 3D66A 1F2PA 5LRGA 2IMOA 2XEGA 2QVPA 3PB4X 1YW4A 3QNVA 3PBBA 4P4FA 4OC3A 2PJ9A 5DS0A 4CPAA 2WZNA 4YN3A 3IIBA 1Y0RA 2EWBA 3CT9A 4C9UA 4FAIA 3PRTA 3PB9X 2PJ2A 1ZLHA 4UF4A 3B3WA 3B3CA 3IWWA 2OR4A 2PVWA 3K9TA 4P4IA 4UEEA 2Q43A 4CDJA 1YSJA 4TWEA 2BOAA 2DEAA 3PB8X 2HB6A 1XF1A 1FT7A 1VGYA 4C9VA 2ZEOA 3KQZA 3B3SA 4KNGE 4TJXA 3S9NA 3D4UA 5I4MA 1Y7EA 2GU2A 3CPAA 4FWUA 4ZY0A 3GUXA 4H2KA 3B35A 2AFWA 2FVGA 5HVGA 3SJEA 1UWYA 1XJOA 4MHYA 1VHEA 4NGRA 1Y9ZA 2Q4ZA 4MCPA 1ZLIA 1CPSA 1Z2LA 4C8CA 2O53A 3HLPA 3KR5A 5THWA 1Z8LA 3WC5A 3RBUA 2RFHA 3IJ3A 2PJ8A 1XBUA 2ZEDA 2PIYA 2V8HA 2RB7A 1BPMA 3KZWA 4K3NA 3BI0A 4NGNA 3PEIA 1CX8A 4ZY2A 3PFEA 3SI2A 1ARLA 1ZG7A 3NFZA 4MCSA 4P44A 3N5FA 4OC5A 3H8EA 4CDKA 1IY7A 4DYOA 4GM5A 5HVHA 5K8NA 4PXBA 4YU9A 2PRQA 4C9AA 1TKJA 2BO9A 3WT4A 1TF8A 2AFOA 3FVLA 2IJZA 4KSIA 4DJLA 2EK8A 4ONWA 3NH8A 4MMOA 1TF9A 1ZG9A 2PIZA 2G9DA 1BPNA 2XEFA 4A37A 2CIJA 3BHXA 4IAVA 3V7ZA 2O4HA 1CP7A 2PCUA 4P4DA 3D68A 3JRUA 3VARA 1JQGA 4PQAA 3IEHA 5LRJA 2AFSA 3KR4A 3KHZA 5LYFA 2OOTA 1XMBA
chains in the Genus database with same CATH superfamily
2C6CA 4IK2A 1A2ZA 4A94A 4YFJA 3TYXA 3VRNA 1MJAA 3UY5A 2NMTA 1YMEA 4EMEA 2ZEHA 3FJUA 4KZTA 5DWMA 4DUKA 5JH9A 4HNXB 4JZ0A 2C5QA 4MFKA 5DWNA 3HMJG 4NF1A 2EK9A 4FD6A 1TXRA 2DF5A 3IWGA 2IQ6A 2FSRA 4QB9A 2D0PA 4CZ1A 2ZW6A 2D4OA 4AVBA 1R43A 3T07A 2PJ4A 4OIDA 5ISVA 4L89A 2Z3MA 2FXFA 3C26A 4R3LA 1LRZA 5LYLA 4MHPA 5JGFA 1BAVA 1V6CA 5KTDA 2ZENA 2E28A 4ZY1A 2Q4YA 4FD5A 1HDUA 3F5BA 4MHNA 5KTCA 1NSLA 4NJRA 2ZW5A 2VKZG 3S6FA 2GLFA 1VBGA 4YWYA 3IU1A 3TO6A 3TX8A 3KL9A 5JM6A 4X3RA 3VROA 3P2HA 2ZW4A 3B7IA 4KOTA 3OP0A 2BEIA 2DIKA 5J8FA 2OU2A 4KUAA 2WPXA 5F49A 2C6GA 3FEDA 1Z9UA 2R98A 1QSTA 4R7MA 5G22A 5IB9A 3BUWB 2J9AA 4XNHC 2FIWA 3TFYA 3TLEA 4A4CA 3VTAA 5AG5A 3EIFA 4B11A 3SJXA 1I12A 3CPXA 2HC9A 2P0WA 4NJQA 3ZNIA 5GCNA 4CGLA 4U5YA 3BUOB 1V0CA 2POKA 1ZO0A 3D7DA 4TJVA 6CPAA 1ZL0A 3FECA 1AYEA 3ISXA 3LD2A 4KOSA 1R61A 3K4IA 4JWPA 4IIXA 2JBJA 3PB6X 2CF4A 4R76A 3SI1A 1MJ9A 3DGVA 3WABA 4BD9A 2I3CA 2JLMA 4NGPA 4RR2B 1J4JA 2ZXVA 4PXDA 4Q7AA 4EVYA 4OLLA 3KRVA 2B0AA 3SR3A 2CBLA 3EZBA 1YW6A 1XRYA 4W9YA 2JEVA 1S7KA 2WPWA 2X7BA 2ZPAA 4PK2A 4A31A 3DLJA 4YRHA 3VWEA 3RO0A 3W91A 4HNWB 5IV0A 3TE4A 1A9XB 1ZRSA 4H6UA 4OC4A 4CAEA 2GP4A 2PE3A 2V8VA 3BLNA 3R9EA 1AMPA 2HV2A 4PSXA 1KC7A 2OB0A 2BL1A 1CE8B 1IU8A 4CRZB 1Q2CA 1RTQA 3B3TA 4Y49C 2OH1A 4YGOA 1VHOA 3TLYA 3D67A 4MFQA 2CNTA 3FYNA 3NA6A 1EE3P 4JVOA 4MJXA 5C82A 1Z4EA 1C3OB 4QUSA 2B4JC 2YGWA 4B6ZA 2P6FA 4C7IA 3FF3A 3FNCA 7CPAA 1TKHA 4UIBA 2G0BA 1LANA 2FE7A 2ZOGA 4KUBA 4MRIA 5EMIA 4CYOA 3TLGA 2PDOA 1KUYA 3KHXA 4J3GA 1LOKA 2DLAA 2HUZA 1S60A 2GFQA 4NGQA 2CXAA 2VXKA 4MJ8A 2YJVA 3DNSA 2F8HA 1IYKA 1R3NA 1XF8A 1PCAA 3PFOA 1AUGA 4L8AA 1ON0A 4HKFA 3RYOA 3CDXA 2ARHA 1YK3A 4MHZA 4X8IA 1TKFA 1VIXA 4JD6A 3VRRA 5LRKA 4I49A 1Q2DA 2FM4A 2ZEPA 1LCPA 3DR6A 5LYIA 1NSAA 3WR7A 2J8RA 1HDQA 3D8PA 4UEFA 2EZAA 2YNDA 1M4LA 3SJGA 1F57A 2B3VA 2QJ8A 4TNUA 3SI0A 1WVMA 4C8TA 5J1QA 4UIAA 1KWMA 4Z65A 2ZEEA 3TO7A 3I74A 5D29A 3H8FA 4ZX9A 5H84A 4JYWA 1M1DA 4RN7A 5EC4A 1IICA 3RAMA 3E0KA 1CP6A 4B5PA 5HMNA 3EZEA 2YNCA 4NEXA 4OKOA 1CS0B 5F13A 4EWTA 3KI9A 2HWGA 2BSWA 4OMEA 1XIXA 2AFMA 3I1UA 4Q38A 4P10A 1QSRA 4R8FA 5BWAB 2X0SA 2PVVA 4BPUB 4ORFA 1S7NA 3G8WA 2FIAA 3KKWA 5F47A 3F0AA 4B5PB 4LX9A 4PXEA 2HI6A 2V77A 4U9ZA 2XEJA 3EC4A 1GYTA 3R95A 4CGOA 2D0OA 1CG2A 1YR0A 2ZEMA 3FMCA 3SXNA 5HKWA 1YVKA 3NH5A 4M3SA 2RC4A 2K5TA 2N3AB 2PRBA 3CXSA 3MN8A 4A4BA 1NXJA 3F8KA 3WC7A 4OC1A 1DTDA 4M6GA 2CY2A 2PJ0A 4ZI6A 1F2OA 2WUUA 5K99A 4R6TA 2JBKA 2J8MA 2V8DA 3KQXA 3L2NA 4PXCA 4Y49B 1CBXA 2C1CA 2ZELA 4G1PA 5E96A 5IR2A 4M6HA 3DR8A 4C8AA 1Z8XA 8CPAA 4MY3A 1DE4C 1Y9KA 2PSWA 3ISZA 3VH9A 2ZEFA 5C88A 2PJCA 3D2PA 3V8IA 4C8UA 4UFVA 1MK4A 1UFHA 4C8FA 2F7VA 4KVOE 4KSAA 2AFZA 2GANA 5G20A 3ICUA 5K8OA 1YGHA 4C99A 4P45A 1CJWA 4XPLA 5CBMA 4P4JA 3LMSA 4LQGA 2C6PA 3T0TA 3EXNA 4A39A 4NGTA 1ZYMA 3IC1A 5JQ4A 3OAKA 2ZW7A 4LUAA 3GLJA 3P2FA 4CAVA 3TLBA 3R9GA 4B10A 1CPXA 4UFXA 1VHSA 4ZX8A 5LYDA 2PJ6A 1HEEA 2WYRA 2B5GB 1R57A 2XPNA 1QQ9A 2CTCA 4AG9A 4MCQA 3V38A 1LAMA 3CXPA 3B3VA 1NMTA 4KS9A 4OP4A 4KOXA 4LQ6A 5AG7A 4A33A 4II9A 2EVNA 1VBHA 2F5IA 3TLZA 4KLWA 3TO9A 1TIQA 4MBUA 3ZJ0A 1FBVA 5HXDA 4B13A 2FL4A 3D7HA 3G23A 2REFA 3VGOA 5K8PA 4FUUA 2Q44A 2VL1A 2GREA 3NE7A 4A38A 4C7HA 1Z5RA 2ABZA 3K9UA 3GB0A 2YJTA 5F48A 4OC2A 1NE9A 4P4EA 5AGEA 2QYVA 1ARMA 5CPAA 3BXMA 3IWEA 3QAYA 2OZGA 2B3UA 2NSMA 2Z11A 4WWVA 1PYTB 1Z9EA 4ONUA 1Y0YA 3B2YA 2Q51A 5CNPA 5G21A 3T9YA 4C2YA 1U6MA 2AE6A 3NE8A 1PUAA 1FNOA 4MY0A 2B4DA 3T05A 4UEZA 4C8PA 4E94A 2P6GA 4XPDC 3DSBA 5AXIA 5D8NA 4UBRA 2AFXA 1Q7LA 1PU9A 3D7FA 1JWQA 2J8NA 3I3GA 4PPZA 4KSFA 5HVFA 2I00A 4CAXA 1VKCA 2B4DB 2VQYA 5FVJA 3TC8A 2AUNA 4BMHA 2EO8A 1Z4RA 4INJA 3FEEA 3LWUA 4H89A 2PJ5A 3PLFB 2Y0MA 4F8ZA 3D7GA 4H1HA 1XFOA 2IL4A 4PK3A 4F9VA 2P6EA 3H5ZA 3HUVA 1S3ZA 3PB7X 4P6YA 4UFWA 3VATA 3WC6A 1RO5A 4OC0A 5F09A 3S9LA 3KGQA 2ZEGA 5HKZA 4JLYA 3FH4A 1XMTA 1B87A 4IHMA 4F6AA 3I6SA 1QMUA 1BLLE 1Z8TA 3DDDA 2AFUA 1LAPA 2QECA 3K2KA 3U88C 3LACA 3MRUA 2Z0ZA 4MXUA 3W6XA 4B12A 1GGOA 5ELYA 4EFDA 3O8ZA 4MCRA 1RXTA 2Y1NA 3IFEA 4MI1A 1LFWA 2GE3A 4NSQA 2CTBA 5F46A 2V8GA 2Z3LA 3PFVA 1H8LA 2XPOA 1XOVA 2KCWA 2NYQA 5KTAA 3QAHA 4ZYQA 1KEEB 2PCNA 5EBVA 4GS4A 4X5KA 5J8CA 4C86A 2YNEA 4QVTA 1KUXA 2ZOFA 4XNHB 3T8WA 3FX6A 4F9UA 4A32A 2AUMA 4UCMA 3RNZA 3G3SA 2FT0A 3VWDA 2H5MA 2XEIA 4UWJA 4OADA 1IGBA 3SXOA 1IIDA 1IOFA 2BCOA 3KASA 2G3TA 4FBEA 3MGDA 4X2TA 4C9EA 3GKRA 2PJBA 3FXTA 3BUNB 5AG4A 4NGSA 4NFRA 3S6HA 4E0AA 1IB1E 2VZYA 3H8GA 4C84A 3BI1A 5JPHA 4WJBA 2PJAA 2UV8G 5I0CA 4Q36A 4HNYB 4GXHA 3CZXA 1ELMP 3RZAA 1XEBA 5F1YA 3NOJA 4C9RA 2PR8A 1OBRA 3F9KC 2B58A 4O23A 3S9MA 3VRQA 1ZG8A 4UA3A 3OB1B 4KORA 2VZZA 2PJ7A 3BUXB 1J3LA 2PJ3A 3SJFA 3PGPA 2JEWA 3IO1A 3PP9A 3R96A 3S6KA 3TOBA 2I79A 4KVME 2MP0A 3OWCA 4F0YA 4P4BA 2GLJA 3H4QA 1EZBA 3JUWA 1YX0A 4OIWA 4AXVA 1EO0A 1B6BA 3PBEA 2JDDA 2EZBA 4KOVA 2PJ1A 2ANPA 1B47A 2VBQA 3NH4A 1Q5XA 4CYNA 2Q0YA 1N71A 4NGMA 3HPGG 4BPWB 2Z3OA 1M4GA 4BBHA 4C2XA 4RUHA 1YLOA 1QSMA 4C85A 2PR1A 4IUSA 1ELLP 2QIRA 4QBJA 4AVAA 4M6IA 5HH1A 3D66A 5K8MA 1F2PA 2XPLA 5LRGA 2XPPA 1M44A 2ATRA 2R7HA 2IMOA 2EZCA 2XEGA 2QVPA 3PB4X 4MHDA 1VI4A 4MFPA 2OZHA 2Z3NA 1YW4A 2G3AA 3QNVA 3PBBA 3IGRA 3HPHE 1KZFA 2VEZA 4P4FA 3B8GA 4UWIA 3EY5A 4OC3A 4QC6A 2PJ9A 1FY7A 5DS0A 4CPAA 2WZNA 2Q04A 4YN3A 1IOIA 1GHEA 1YLEA 1P0HA 3IIBA 3LODA 4BTFA 2B5GA 2PC1A 3ZZIA 1Y0RA 1WJTA 2EWBA 3CT9A 4C9UA 4C68A 4FAIA 3PRTA 3PB9X 4R3KA 1S5KA 2PJ2A 3FIXA 5AG6A 3T90A 1ZLHA 4UF4A 4AVCA 3BUMB 2DPSA 2CNSA 3D3SA 4OAEA 3GJZA 2CNMA 3B3WA 5H86A 1DIKA 3B3CA 3IWWA 5A27A 1I21A 5HKYA 1T36B 2OR4A 3T5MA 2PVWA 3K9TA 4P4IA 4UEEA 2OLSA 1XE4A 3I9SA 4K30A 2Q43A 4CDJA 2Q4VA 4UCNA 1CM0A 1I1DA 1K4JA 3TT2A 1YSJA 4TWEA 2HQYA 3A9LA 2BOAA 4JXRA 4XPKA 2DEAA 4E8OA 4MFZA 3PB8X 2HB6A 1XF1A 4AG7A 1Z8WA 1FT7A 1VGYA 4R57A 4M85A 4C9VA 2Z3PA 2ZEOA 3KQZA 4M8DA 3NFQA 2B4BA 4ZBGA 1X10A 4JJXA 3B3SA 5IB0A 4KNGE 3S9NA 2C27A 3D4UA 3GY9A 4TJXA 3TLCA 1BXRB 5I4MA 1BOBA 1Y7EA 4H6ZA 2GU2A 3CPAA 4FWUA 4MI4A 4ZY0A 3GUXA 4H2KA 3B35A 4A30A 4ZGYB 5IX3A 1QSOA 4NXYA 2AFWA 2FVGA 5HVGA 1Q2YA 3JTKA 3SJEA 1UWYA 1Y7RA 1XJOA 2Z10A 2Q7SA 4MHYA 1NBWA 1VHEA 1YREA 4NGRA 1Y9ZA 4KLVA 1MJBA 2D4PA 1S7FA 2Q4ZA 4MFLA 2WSAA 4CAFA 1KBLA 4MCPA 3TTHA 4CYPA 1ZLIA 1CPSA 5J3XA 1X12A 2JDCA 1YVOA 1Z2LA 4C8CA 1L0CA 1IYLA 4JXQA 2YNCC 2O53A 2HROA 2REEA 2FS5A 3HLPA 3KR5A 5BY0A 2Q7BA 4B5OA 5FD8A 4KOWA 5THWA 2O28A 1Z8LA 3WC5A 2EUIA 2A4NA 3PT1A 3GYAA 3RBUA 2RFHA 3IJ3A 4CAWA 3C8OA 4U9YA 3OB2B 2PJ8A 4UCPA 1XBUA 2EBJA 4MFJA 2ZEDA 3FRMA 4E2AA 1S7LA 4PSWA 4RI1A 2PIYA 2V8HA 4KVXA 2DPTA 1BPMA 2RB7A 1QSNA 4KOUA 3KZWA 3PZJA 4HPSA 3BI0A 4NGNA 4K3NA 3PEIA 1CX8A 3FBUA 4ZY2A 3PFEA 2R1IA 4COGA 3SI2A 1ARLA 2ODFA 4A2ZA 1ZG7A 4J0NA 3NFZA 4GPLB 1M4IA 1WWZA 2DXQA 3D2MA 4MCSA 4P44A 3IU2A 3N5FA 2AJ6A 3R1KA 4OC5A 2GIVA 3H8EA 1KUVA 4CDKA 1IY7A 4EYSA 4DYOA 4GM5A 4CS0B 5HVHA 5K8NA 1C30B 4KOYA 4PXBA 3SHPA 4YU9A 3TLAA 5JYBA 1JDEA 1BO4A 3BJ7A 1OZPA 3W6SA 3FB3A 4CGPA 2PRQA 4AB7A 4C9AA 1SQHA 3EZAA 1TKJA 2BO9A 4COBA 4FD7A 3WT4A 1TF8A 1M4DA 3TLGB 2AFOA 4RS2A 2PQ8A 2Z3KA 3FVLA 4NCZA 2IJZA 4KSIA 1Y9WA 2EK8A 2FCKA 4DJLA 4ONWA 5JVLA 3NH8A 4MMOA 1TF9A 4PV6A 1ZG9A 2PIZA 1YQEA 2G9DA 2VI7A 3VRPA 3BJ8A 4XPDB 4DNCA 1M6VB 1JDBC 1BPNA 1EZAA 2XEFA 4R87A 5F5XA 4A37A 2CIJA 3U1BA 4CO9A 3R9FA 3BHXA 4IAVA 3V7ZA 5A28A 4BPXB 2O4HA 1CP7A 5G1ZA 5F9MA 3QB8A 1P4NA 2PCUA 3CXQA 4P4DA 2Y1MA 3N7ZA 4FD4A 2R8VA 4IF5A 4CRYB 3D68A 3JRUA 3JVNA 1JQGA 3VARA 4CGMA 4PQAA 3TOAA 3IEHA 1YVHA 4CYQA 3S6GA 2OZUA 5LRJA 2AFSA 2QMLA 1WK4A 4IIYA 3KR4A 3EFAA 4B14A 4C2ZA 3GIUA 3KHZA 3TCVA 4A95A 5LYFA 4R9MA 4CGNA 4E5SA 4F0XA 3EO4A 2R82A 2OOTA 1XMBA 4BINA 2BUEA
chains in the Genus database with same CATH topology
2C6CA 4IK2A 4A94A 1YMEA 4EMEA 2ZEHA 3FJUA 5JH9A 4DUKA 4JZ0A 2C5QA 2EK9A 1TXRA 2IQ6A 1R43A 2PJ4A 4OIDA 5LYLA 4MHPA 5JGFA 1BAVA 1V6CA 2ZENA 4ZY1A 1HDUA 4MHNA 4NJRA 2GLFA 4YWYA 3TX8A 3KL9A 5JM6A 4X3RA 3B7IA 2C6GA 3FEDA 5IB9A 4R7MA 2J9AA 3VTAA 3EIFA 3SJXA 3CPXA 2HC9A 4NJQA 2POKA 4TJVA 3D7DA 6CPAA 1AYEA 3FECA 3ISXA 2JBJA 3PB6X 2CF4A 4R76A 3SI1A 3DGVA 4BD9A 3WABA 2I3CA 4NGPA 4PXDA 4Q7AA 1YW6A 1XRYA 4W9YA 3DLJA 4OC4A 2GP4A 2PE3A 2V8VA 1AMPA 1RTQA 3B3TA 1VHOA 3D67A 3NA6A 1EE3P 4B6ZA 3FF3A 7CPAA 1TKHA 4UIBA 2ZOGA 1LANA 4MRIA 3KHXA 1LOKA 4NGQA 2F8HA 1R3NA 3PFOA 1PCAA 3CDXA 4MHZA 4X8IA 1TKFA 1VIXA 5LRKA 2ZEPA 1LCPA 5LYIA 1NSAA 1HDQA 4UEFA 1WVMA 1M4LA 3SJGA 1F57A 3SI0A 2QJ8A 4TNUA 5J1QA 4UIAA 1KWMA 4Z65A 2ZEEA 3I74A 5D29A 3H8FA 4ZX9A 4JYWA 3RAMA 1CP6A 4OKOA 4EWTA 3KI9A 4OMEA 4R8FA 2AFMA 3I1UA 4P10A 4C8TA 2PVVA 4PXEA 2V77A 2XEJA 1GYTA 1CG2A 2ZEMA 3FMCA 3NH5A 3MN8A 3WC7A 4OC1A 1DTDA 4ZI6A 2PJ0A 1F2OA 4R6TA 2JBKA 2V8DA 3KQXA 3L2NA 4PXCA 1CBXA 2C1CA 2ZELA 4G1PA 5IR2A 4C8AA 8CPAA 1DE4C 3VH9A 3ISZA 2ZEFA 4C8UA 2PJCA 4C8FA 2F7VA 2AFZA 3ICUA 5K8OA 4C99A 4P45A 5CBMA 4P4JA 3LMSA 4LQGA 2C6PA 4A39A 4NGTA 3IC1A 3GLJA 1CPXA 4ZX8A 5LYDA 2PJ6A 1HEEA 2WYRA 1QQ9A 2CTCA 4MCQA 3V38A 1LAMA 3B3VA 4OP4A 5HXDA 3D7HA 5K8PA 4FUUA 2VL1A 2GREA 4A38A 1Z5RA 2ABZA 3GB0A 4OC2A 4P4EA 2QYVA 1ARMA 5CPAA 3BXMA 2NSMA 4WWVA 1PYTB 1Y0YA 3B2YA 2Q51A 1FNOA 4UEZA 4C8PA 5D8NA 2AFXA 1Q7LA 3D7FA 4PPZA 5HVFA 3TC8A 3FEEA 3LWUA 4F8ZA 2PJ5A 3D7GA 1XFOA 4F9VA 3HUVA 3PB7X 4P6YA 3WC6A 3VATA 4OC0A 5F09A 3S9LA 3KGQA 2ZEGA 3FH4A 4IHMA 3I6SA 1QMUA 1BLLE 2AFUA 1LAPA 3K2KA 3MRUA 4MXUA 5ELYA 4EFDA 4MCRA 3IFEA 1LFWA 2CTBA 2V8GA 1H8LA 2NYQA 4ZYQA 4C86A 4F9UA 2ZOFA 3T8WA 3FX6A 2XEIA 1IGBA 2BCOA 3KASA 4FBEA 4C9EA 4X2TA 2PJBA 4NGSA 4NFRA 3H8GA 4C84A 3BI1A 4WJBA 2PJAA 1ELMP 3RZAA 4C9RA 1OBRA 4O23A 3S9MA 1ZG8A 2PJ7A 2PJ3A 3SJFA 2JEWA 3IO1A 4P4BA 2GLJA 4AXVA 4OIWA 3PBEA 2PJ1A 2ANPA 3NH4A 4NGMA 4RUHA 1YLOA 4C85A 1ELLP 5K8MA 3D66A 1F2PA 5LRGA 2IMOA 2XEGA 2QVPA 3PB4X 1YW4A 3QNVA 3PBBA 4P4FA 4OC3A 2PJ9A 5DS0A 4CPAA 2WZNA 4YN3A 3IIBA 1Y0RA 2EWBA 3CT9A 4C9UA 4FAIA 3PRTA 3PB9X 2PJ2A 1ZLHA 4UF4A 3B3WA 3B3CA 3IWWA 2OR4A 2PVWA 3K9TA 4P4IA 4UEEA 2Q43A 4CDJA 1YSJA 4TWEA 2BOAA 2DEAA 3PB8X 2HB6A 1XF1A 1FT7A 1VGYA 4C9VA 2ZEOA 3KQZA 3B3SA 4KNGE 4TJXA 3S9NA 3D4UA 5I4MA 1Y7EA 2GU2A 3CPAA 4FWUA 4ZY0A 3GUXA 4H2KA 3B35A 2AFWA 2FVGA 5HVGA 3SJEA 1UWYA 1XJOA 4MHYA 1VHEA 4NGRA 1Y9ZA 2Q4ZA 4MCPA 1ZLIA 1CPSA 1Z2LA 4C8CA 2O53A 3HLPA 3KR5A 5THWA 1Z8LA 3WC5A 3RBUA 2RFHA 3IJ3A 2PJ8A 1XBUA 2ZEDA 2PIYA 2V8HA 2RB7A 1BPMA 3KZWA 4K3NA 3BI0A 4NGNA 3PEIA 1CX8A 4ZY2A 3PFEA 3SI2A 1ARLA 1ZG7A 3NFZA 4MCSA 4P44A 3N5FA 4OC5A 3H8EA 4CDKA 1IY7A 4DYOA 4GM5A 5HVHA 5K8NA 4PXBA 4YU9A 2PRQA 4C9AA 1TKJA 2BO9A 3WT4A 1TF8A 2AFOA 3FVLA 2IJZA 4KSIA 4DJLA 2EK8A 4ONWA 3NH8A 4MMOA 1TF9A 1ZG9A 2PIZA 2G9DA 1BPNA 2XEFA 4A37A 2CIJA 3BHXA 4IAVA 3V7ZA 2O4HA 1CP7A 2PCUA 4P4DA 3D68A 3JRUA 3VARA 1JQGA 4PQAA 3IEHA 5LRJA 2AFSA 3KR4A 3KHZA 5LYFA 2OOTA 1XMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C6C A;  4IK2 A;  4A94 A;  1YME A;  4EME A;  2ZEH A;  3FJU A;  5JH9 A;  4DUK A;  4JZ0 A;  2EK9 A;  1TXR A;  2IQ6 A;  1R43 A;  2PJ4 A;  4OID A;  5LYL A;  4MHP A;  5JGF A;  1BAV A;  1V6C A;  2ZEN A;  4ZY1 A;  1HDU A;  4MHN A;  4NJR A;  2GLF A;  4YWY A;  3TX8 A;  3KL9 A;  5JM6 A;  4X3R A;  3B7I A;  2C6G A;  3FED A;  5IB9 A;  4R7M A;  2J9A A;  3VTA A;  3EIF A;  3SJX A;  3CPX A;  2HC9 A;  4NJQ A;  2POK A;  4TJV A;  3D7D A;  6CPA A;  1AYE A;  3FEC A;  3ISX A;  2JBJ A;  3PB6 X;  2CF4 A;  4R76 A;  3SI1 A;  3DGV A;  4BD9 A;  3WAB A;  2I3C A;  4NGP A;  4PXD A;  4Q7A A;  1YW6 A;  1XRY A;  4W9Y A;  3DLJ A;  4OC4 A;  2PE3 A;  2V8V A;  1AMP A;  1RTQ A;  3B3T A;  1VHO A;  3D67 A;  3NA6 A;  1EE3 P;  4B6Z A;  3FF3 A;  7CPA A;  1TKH A;  4UIB A;  2ZOG A;  1LAN A;  4MRI A;  3KHX A;  1LOK A;  4NGQ A;  2F8H A;  1R3N A;  3PFO A;  1PCA A;  3CDX A;  4MHZ A;  4X8I A;  1TKF A;  1VIX A;  5LRK A;  2ZEP A;  1LCP A;  5LYI A;  1NSA A;  1HDQ A;  4UEF A;  1WVM A;  1M4L A;  3SJG A;  1F57 A;  3SI0 A;  2QJ8 A;  4TNU A;  5J1Q A;  4UIA A;  1KWM A;  4Z65 A;  2ZEE A;  3I74 A;  5D29 A;  3H8F A;  4ZX9 A;  4JYW A;  3RAM A;  1CP6 A;  4OKO A;  4EWT A;  3KI9 A;  4OME A;  4R8F A;  2AFM A;  3I1U A;  4P10 A;  4C8T A;  2PVV A;  4PXE A;  2V77 A;  2XEJ A;  1GYT A;  1CG2 A;  2ZEM A;  3FMC A;  3NH5 A;  3MN8 A;  3WC7 A;  4OC1 A;  1DTD A;  4ZI6 A;  2PJ0 A;  1F2O A;  4R6T A;  2JBK A;  2V8D A;  3KQX A;  3L2N A;  4PXC A;  1CBX A;  2C1C A;  2ZEL A;  4G1P A;  4C8A A;  8CPA A;  1DE4 C;  3VH9 A;  3ISZ A;  2ZEF A;  4C8U A;  2PJC A;  4C8F A;  2F7V A;  2AFZ A;  3ICU A;  5K8O A;  4C99 A;  4P45 A;  5CBM A;  4P4J A;  3LMS A;  4LQG A;  2C6P A;  4A39 A;  4NGT A;  3IC1 A;  3GLJ A;  1CPX A;  4ZX8 A;  5LYD A;  2PJ6 A;  1HEE A;  2WYR A;  1QQ9 A;  2CTC A;  4MCQ A;  3V38 A;  1LAM A;  3B3V A;  4OP4 A;  5HXD A;  3D7H A;  5K8P A;  4FUU A;  2VL1 A;  2GRE A;  4A38 A;  1Z5R A;  2ABZ A;  3GB0 A;  4OC2 A;  4P4E A;  2QYV A;  1ARM A;  5CPA A;  3BXM A;  2NSM A;  4WWV A;  1PYT B;  1Y0Y A;  3B2Y A;  2Q51 A;  1FNO A;  4UEZ A;  4C8P A;  5D8N A;  2AFX A;  1Q7L A;  3D7F A;  4PPZ A;  5HVF A;  3TC8 A;  3FEE A;  3LWU A;  4F8Z A;  2PJ5 A;  3D7G A;  1XFO A;  4F9V A;  3HUV A;  3PB7 X;  4P6Y A;  3WC6 A;  3VAT A;  4OC0 A;  5F09 A;  3S9L A;  3KGQ A;  2ZEG A;  3FH4 A;  4IHM A;  3I6S A;  1QMU A;  1BLL E;  2AFU A;  1LAP A;  3K2K A;  3MRU A;  4MXU A;  5ELY A;  4EFD A;  4MCR A;  3IFE A;  1LFW A;  2CTB A;  2V8G A;  1H8L A;  2NYQ A;  4ZYQ A;  4C86 A;  4F9U A;  2ZOF A;  3T8W A;  3FX6 A;  2XEI A;  1IGB A;  2BCO A;  3KAS A;  4FBE A;  4C9E A;  4X2T A;  2PJB A;  4NGS A;  4NFR A;  3H8G A;  4C84 A;  3BI1 A;  4WJB A;  2PJA A;  1ELM P;  3RZA A;  4C9R A;  1OBR A;  4O23 A;  3S9M A;  1ZG8 A;  2PJ7 A;  2PJ3 A;  3SJF A;  2JEW A;  3IO1 A;  4P4B A;  2GLJ A;  4AXV A;  4OIW A;  3PBE A;  2PJ1 A;  2ANP A;  3NH4 A;  4NGM A;  4RUH A;  1YLO A;  4C85 A;  1ELL P;  5K8M A;  3D66 A;  1F2P A;  5LRG A;  2IMO A;  2XEG A;  2QVP A;  3PB4 X;  1YW4 A;  3QNV A;  3PBB A;  4P4F A;  4OC3 A;  2PJ9 A;  5DS0 A;  4CPA A;  2WZN A;  4YN3 A;  3IIB A;  1Y0R A;  2EWB A;  3CT9 A;  4C9U A;  4FAI A;  3PRT A;  3PB9 X;  2PJ2 A;  1ZLH A;  4UF4 A;  3B3W A;  3B3C A;  3IWW A;  2OR4 A;  2PVW A;  3K9T A;  4P4I A;  4UEE A;  2Q43 A;  4CDJ A;  1YSJ A;  4TWE A;  2BOA A;  2DEA A;  3PB8 X;  2HB6 A;  1XF1 A;  1FT7 A;  1VGY A;  4C9V A;  2ZEO A;  3KQZ A;  3B3S A;  4KNG E;  4TJX A;  3S9N A;  3D4U A;  5I4M A;  1Y7E A;  2GU2 A;  3CPA A;  4FWU A;  4ZY0 A;  3GUX A;  4H2K A;  3B35 A;  2AFW A;  2FVG A;  5HVG A;  3SJE A;  1UWY A;  1XJO A;  4MHY A;  1VHE A;  4NGR A;  1Y9Z A;  2Q4Z A;  4MCP A;  1ZLI A;  1CPS A;  1Z2L A;  4C8C A;  2O53 A;  3HLP A;  3KR5 A;  5THW A;  1Z8L A;  3WC5 A;  3RBU A;  2RFH A;  3IJ3 A;  2PJ8 A;  1XBU A;  2ZED A;  2PIY A;  2V8H A;  2RB7 A;  1BPM A;  3KZW A;  4K3N A;  3BI0 A;  4NGN A;  3PEI A;  1CX8 A;  4ZY2 A;  3PFE A;  3SI2 A;  1ARL A;  1ZG7 A;  3NFZ A;  4MCS A;  4P44 A;  3N5F A;  4OC5 A;  3H8E A;  4CDK A;  1IY7 A;  4DYO A;  4GM5 A;  5HVH A;  5K8N A;  4PXB A;  4YU9 A;  2PRQ A;  4C9A A;  1TKJ A;  2BO9 A;  3WT4 A;  1TF8 A;  2AFO A;  3FVL A;  2IJZ A;  4KSI A;  4DJL A;  2EK8 A;  4ONW A;  3NH8 A;  4MMO A;  1TF9 A;  1ZG9 A;  2PIZ A;  2G9D A;  1BPN A;  2XEF A;  4A37 A;  2CIJ A;  3BHX A;  4IAV A;  3V7Z A;  2O4H A;  1CP7 A;  2PCU A;  4P4D A;  3D68 A;  3JRU A;  3VAR A;  1JQG A;  4PQA A;  3IEH A;  5LRJ A;  2AFS A;  3KR4 A;  3KHZ A;  5LYF A;  2OOT A;  1XMB A; 
#chains in the Genus database with same CATH topology
 2C6C A;  4IK2 A;  1A2Z A;  4A94 A;  4YFJ A;  3TYX A;  3VRN A;  1MJA A;  3UY5 A;  2NMT A;  1YME A;  4EME A;  2ZEH A;  3FJU A;  4KZT A;  5DWM A;  4DUK A;  5JH9 A;  4HNX B;  4JZ0 A;  2C5Q A;  4MFK A;  5DWN A;  3HMJ G;  4NF1 A;  2EK9 A;  4FD6 A;  1TXR A;  2DF5 A;  3IWG A;  2IQ6 A;  2FSR A;  4QB9 A;  2D0P A;  4CZ1 A;  2ZW6 A;  2D4O A;  4AVB A;  1R43 A;  3T07 A;  2PJ4 A;  4OID A;  5ISV A;  4L89 A;  2Z3M A;  2FXF A;  3C26 A;  4R3L A;  1LRZ A;  5LYL A;  4MHP A;  5JGF A;  1BAV A;  1V6C A;  5KTD A;  2ZEN A;  2E28 A;  4ZY1 A;  2Q4Y A;  4FD5 A;  1HDU A;  3F5B A;  4MHN A;  5KTC A;  1NSL A;  4NJR A;  2ZW5 A;  2VKZ G;  3S6F A;  2GLF A;  1VBG A;  4YWY A;  3IU1 A;  3TO6 A;  3TX8 A;  3KL9 A;  5JM6 A;  4X3R A;  3VRO A;  3P2H A;  2ZW4 A;  3B7I A;  4KOT A;  3OP0 A;  2BEI A;  2DIK A;  5J8F A;  2OU2 A;  4KUA A;  2WPX A;  5F49 A;  2C6G A;  3FED A;  1Z9U A;  2R98 A;  1QST A;  4R7M A;  5G22 A;  5IB9 A;  3BUW B;  2J9A A;  4XNH C;  2FIW A;  3TFY A;  3TLE A;  4A4C A;  3VTA A;  5AG5 A;  3EIF A;  4B11 A;  3SJX A;  1I12 A;  3CPX A;  2HC9 A;  2P0W A;  4NJQ A;  3ZNI A;  5GCN A;  4CGL A;  4U5Y A;  3BUO B;  1V0C A;  2POK A;  1ZO0 A;  3D7D A;  4TJV A;  6CPA A;  1ZL0 A;  3FEC A;  1AYE A;  3ISX A;  3LD2 A;  4KOS A;  1R61 A;  3K4I A;  4JWP A;  4IIX A;  2JBJ A;  3PB6 X;  2CF4 A;  4R76 A;  3SI1 A;  1MJ9 A;  3DGV A;  3WAB A;  4BD9 A;  2I3C A;  2JLM A;  4NGP A;  4RR2 B;  1J4J A;  2ZXV A;  4PXD A;  4Q7A A;  4EVY A;  4OLL A;  3KRV A;  2B0A A;  3SR3 A;  2CBL A;  3EZB A;  1YW6 A;  1XRY A;  4W9Y A;  2JEV A;  1S7K A;  2WPW A;  2X7B A;  2ZPA A;  4PK2 A;  4A31 A;  3DLJ A;  4YRH A;  3VWE A;  3RO0 A;  3W91 A;  4HNW B;  5IV0 A;  3TE4 A;  1A9X B;  1ZRS A;  4H6U A;  4OC4 A;  4CAE A;  2GP4 A;  2PE3 A;  2V8V A;  3BLN A;  3R9E A;  1AMP A;  2HV2 A;  4PSX A;  1KC7 A;  2OB0 A;  2BL1 A;  1CE8 B;  1IU8 A;  4CRZ B;  1Q2C A;  1RTQ A;  3B3T A;  4Y49 C;  2OH1 A;  4YGO A;  1VHO A;  3TLY A;  3D67 A;  4MFQ A;  2CNT A;  3FYN A;  3NA6 A;  1EE3 P;  4JVO A;  4MJX A;  5C82 A;  1Z4E A;  1C3O B;  4QUS A;  2B4J C;  2YGW A;  4B6Z A;  2P6F A;  4C7I A;  3FF3 A;  3FNC A;  7CPA A;  1TKH A;  4UIB A;  2G0B A;  1LAN A;  2FE7 A;  2ZOG A;  4KUB A;  4MRI A;  5EMI A;  4CYO A;  3TLG A;  2PDO A;  1KUY A;  3KHX A;  4J3G A;  1LOK A;  2DLA A;  2HUZ A;  1S60 A;  2GFQ A;  4NGQ A;  2CXA A;  2VXK A;  4MJ8 A;  2YJV A;  3DNS A;  2F8H A;  1IYK A;  1R3N A;  1XF8 A;  1PCA A;  3PFO A;  1AUG A;  4L8A A;  1ON0 A;  4HKF A;  3RYO A;  3CDX A;  2ARH A;  1YK3 A;  4MHZ A;  4X8I A;  1TKF A;  1VIX A;  4JD6 A;  3VRR A;  5LRK A;  4I49 A;  1Q2D A;  2FM4 A;  2ZEP A;  1LCP A;  3DR6 A;  5LYI A;  1NSA A;  3WR7 A;  2J8R A;  1HDQ A;  3D8P A;  4UEF A;  2EZA A;  2YND A;  1M4L A;  3SJG A;  1F57 A;  2B3V A;  2QJ8 A;  4TNU A;  3SI0 A;  1WVM A;  4C8T A;  5J1Q A;  4UIA A;  1KWM A;  4Z65 A;  2ZEE A;  3TO7 A;  3I74 A;  5D29 A;  3H8F A;  4ZX9 A;  5H84 A;  4JYW A;  1M1D A;  4RN7 A;  5EC4 A;  1IIC A;  3RAM A;  3E0K A;  1CP6 A;  4B5P A;  5HMN A;  3EZE A;  2YNC A;  4NEX A;  4OKO A;  1CS0 B;  5F13 A;  4EWT A;  3KI9 A;  2HWG A;  2BSW A;  4OME A;  1XIX A;  2AFM A;  3I1U A;  4Q38 A;  4P10 A;  1QSR A;  4R8F A;  5BWA B;  2X0S A;  2PVV A;  4BPU B;  4ORF A;  1S7N A;  3G8W A;  2FIA A;  3KKW A;  5F47 A;  3F0A A;  4B5P B;  4LX9 A;  4PXE A;  2HI6 A;  2V77 A;  4U9Z A;  2XEJ A;  3EC4 A;  1GYT A;  3R95 A;  4CGO A;  2D0O A;  1CG2 A;  1YR0 A;  2ZEM A;  3FMC A;  3SXN A;  5HKW A;  1YVK A;  3NH5 A;  4M3S A;  2RC4 A;  2K5T A;  2N3A B;  2PRB A;  3CXS A;  3MN8 A;  4A4B A;  1NXJ A;  3F8K A;  3WC7 A;  4OC1 A;  1DTD A;  4M6G A;  2CY2 A;  2PJ0 A;  4ZI6 A;  1F2O A;  2WUU A;  5K99 A;  4R6T A;  2JBK A;  2J8M A;  2V8D A;  3KQX A;  3L2N A;  4PXC A;  4Y49 B;  1CBX A;  2C1C A;  2ZEL A;  4G1P A;  5E96 A;  5IR2 A;  4M6H A;  3DR8 A;  4C8A A;  1Z8X A;  8CPA A;  4MY3 A;  1DE4 C;  1Y9K A;  2PSW A;  3ISZ A;  3VH9 A;  2ZEF A;  5C88 A;  2PJC A;  3D2P A;  3V8I A;  4C8U A;  4UFV A;  1MK4 A;  1UFH A;  4C8F A;  2F7V A;  4KVO E;  4KSA A;  2AFZ A;  2GAN A;  5G20 A;  3ICU A;  5K8O A;  1YGH A;  4C99 A;  4P45 A;  1CJW A;  4XPL A;  5CBM A;  4P4J A;  3LMS A;  4LQG A;  2C6P A;  3T0T A;  3EXN A;  4A39 A;  4NGT A;  1ZYM A;  3IC1 A;  5JQ4 A;  3OAK A;  2ZW7 A;  4LUA A;  3GLJ A;  3P2F A;  4CAV A;  3TLB A;  3R9G A;  4B10 A;  1CPX A;  4UFX A;  1VHS A;  4ZX8 A;  5LYD A;  2PJ6 A;  1HEE A;  2WYR A;  2B5G B;  1R57 A;  2XPN A;  1QQ9 A;  2CTC A;  4AG9 A;  4MCQ A;  3V38 A;  1LAM A;  3CXP A;  3B3V A;  1NMT A;  4KS9 A;  4OP4 A;  4KOX A;  4LQ6 A;  5AG7 A;  4A33 A;  4II9 A;  2EVN A;  1VBH A;  2F5I A;  3TLZ A;  4KLW A;  3TO9 A;  1TIQ A;  4MBU A;  3ZJ0 A;  1FBV A;  5HXD A;  4B13 A;  2FL4 A;  3D7H A;  3G23 A;  2REF A;  3VGO A;  5K8P A;  4FUU A;  2Q44 A;  2VL1 A;  2GRE A;  3NE7 A;  4A38 A;  4C7H A;  1Z5R A;  2ABZ A;  3K9U A;  3GB0 A;  2YJT A;  5F48 A;  4OC2 A;  1NE9 A;  4P4E A;  5AGE A;  2QYV A;  1ARM A;  5CPA A;  3BXM A;  3IWE A;  3QAY A;  2OZG A;  2B3U A;  2NSM A;  2Z11 A;  4WWV A;  1PYT B;  1Z9E A;  4ONU A;  1Y0Y A;  3B2Y A;  2Q51 A;  5CNP A;  5G21 A;  3T9Y A;  4C2Y A;  1U6M A;  2AE6 A;  3NE8 A;  1PUA A;  1FNO A;  4MY0 A;  2B4D A;  3T05 A;  4UEZ A;  4C8P A;  4E94 A;  2P6G A;  4XPD C;  3DSB A;  5AXI A;  5D8N A;  4UBR A;  2AFX A;  1Q7L A;  1PU9 A;  3D7F A;  1JWQ A;  2J8N A;  3I3G A;  4PPZ A;  4KSF A;  5HVF A;  2I00 A;  4CAX A;  1VKC A;  2B4D B;  2VQY A;  5FVJ A;  3TC8 A;  2AUN A;  4BMH A;  2EO8 A;  1Z4R A;  4INJ A;  3FEE A;  3LWU A;  4H89 A;  2PJ5 A;  3PLF B;  2Y0M A;  4F8Z A;  3D7G A;  4H1H A;  1XFO A;  2IL4 A;  4PK3 A;  4F9V A;  2P6E A;  3H5Z A;  3HUV A;  1S3Z A;  3PB7 X;  4P6Y A;  4UFW A;  3VAT A;  3WC6 A;  1RO5 A;  4OC0 A;  5F09 A;  3S9L A;  3KGQ A;  2ZEG A;  5HKZ A;  4JLY A;  3FH4 A;  1XMT A;  1B87 A;  4IHM A;  4F6A A;  3I6S A;  1QMU A;  1BLL E;  1Z8T A;  3DDD A;  2AFU A;  1LAP A;  2QEC A;  3K2K A;  3U88 C;  3LAC A;  3MRU A;  2Z0Z A;  4MXU A;  3W6X A;  4B12 A;  1GGO A;  5ELY A;  4EFD A;  3O8Z A;  4MCR A;  1RXT A;  2Y1N A;  3IFE A;  4MI1 A;  1LFW A;  2GE3 A;  4NSQ A;  2CTB A;  5F46 A;  2V8G A;  2Z3L A;  3PFV A;  1H8L A;  2XPO A;  1XOV A;  2KCW A;  2NYQ A;  5KTA A;  3QAH A;  4ZYQ A;  1KEE B;  2PCN A;  5EBV A;  4GS4 A;  4X5K A;  5J8C A;  4C86 A;  2YNE A;  4QVT A;  1KUX A;  2ZOF A;  4XNH B;  3T8W A;  3FX6 A;  4F9U A;  4A32 A;  2AUM A;  4UCM A;  3RNZ A;  3G3S A;  2FT0 A;  3VWD A;  2H5M A;  2XEI A;  4UWJ A;  4OAD A;  1IGB A;  3SXO A;  1IID A;  1IOF A;  2BCO A;  3KAS A;  2G3T A;  4FBE A;  3MGD A;  4X2T A;  4C9E A;  3GKR A;  2PJB A;  3FXT A;  3BUN B;  5AG4 A;  4NGS A;  4NFR A;  3S6H A;  4E0A A;  1IB1 E;  2VZY A;  3H8G A;  4C84 A;  3BI1 A;  5JPH A;  4WJB A;  2PJA A;  2UV8 G;  5I0C A;  4Q36 A;  4HNY B;  4GXH A;  3CZX A;  1ELM P;  3RZA A;  1XEB A;  5F1Y A;  3NOJ A;  4C9R A;  2PR8 A;  1OBR A;  3F9K C;  2B58 A;  4O23 A;  3S9M A;  3VRQ A;  1ZG8 A;  4UA3 A;  3OB1 B;  4KOR A;  2VZZ A;  2PJ7 A;  3BUX B;  1J3L A;  2PJ3 A;  3SJF A;  3PGP A;  2JEW A;  3IO1 A;  3PP9 A;  3R96 A;  3S6K A;  3TOB A;  2I79 A;  4KVM E;  2MP0 A;  3OWC A;  4F0Y A;  4P4B A;  2GLJ A;  3H4Q A;  1EZB A;  3JUW A;  1YX0 A;  4OIW A;  4AXV A;  1EO0 A;  1B6B A;  3PBE A;  2JDD A;  2EZB A;  4KOV A;  2PJ1 A;  2ANP A;  1B47 A;  2VBQ A;  3NH4 A;  1Q5X A;  4CYN A;  2Q0Y A;  1N71 A;  4NGM A;  3HPG G;  4BPW B;  2Z3O A;  1M4G A;  4BBH A;  4C2X A;  4RUH A;  1YLO A;  1QSM A;  4C85 A;  2PR1 A;  4IUS A;  1ELL P;  2QIR A;  4QBJ A;  4AVA A;  4M6I A;  5HH1 A;  3D66 A;  5K8M A;  1F2P A;  2XPL A;  5LRG A;  2XPP A;  1M44 A;  2ATR A;  2R7H A;  2IMO A;  2EZC A;  2XEG A;  2QVP A;  3PB4 X;  4MHD A;  1VI4 A;  4MFP A;  2OZH A;  2Z3N A;  1YW4 A;  2G3A A;  3QNV A;  3PBB A;  3IGR A;  3HPH E;  1KZF A;  2VEZ A;  4P4F A;  3B8G A;  4UWI A;  3EY5 A;  4OC3 A;  4QC6 A;  2PJ9 A;  1FY7 A;  5DS0 A;  4CPA A;  2WZN A;  2Q04 A;  4YN3 A;  1IOI A;  1GHE A;  1YLE A;  1P0H A;  3IIB A;  3LOD A;  4BTF A;  2B5G A;  2PC1 A;  3ZZI A;  1Y0R A;  1WJT A;  2EWB A;  3CT9 A;  4C9U A;  4C68 A;  4FAI A;  3PRT A;  3PB9 X;  4R3K A;  1S5K A;  2PJ2 A;  3FIX A;  5AG6 A;  3T90 A;  1ZLH A;  4UF4 A;  4AVC A;  3BUM B;  2DPS A;  2CNS A;  3D3S A;  4OAE A;  3GJZ A;  2CNM A;  3B3W A;  5H86 A;  1DIK A;  3B3C A;  3IWW A;  5A27 A;  1I21 A;  5HKY A;  1T36 B;  2OR4 A;  3T5M A;  2PVW A;  3K9T A;  4P4I A;  4UEE A;  2OLS A;  1XE4 A;  3I9S A;  4K30 A;  2Q43 A;  4CDJ A;  2Q4V A;  4UCN A;  1CM0 A;  1I1D A;  1K4J A;  3TT2 A;  1YSJ A;  4TWE A;  2HQY A;  3A9L A;  2BOA A;  4JXR A;  4XPK A;  2DEA A;  4E8O A;  4MFZ A;  3PB8 X;  2HB6 A;  1XF1 A;  4AG7 A;  1Z8W A;  1FT7 A;  1VGY A;  4R57 A;  4M85 A;  4C9V A;  2Z3P A;  2ZEO A;  3KQZ A;  4M8D A;  3NFQ A;  2B4B A;  4ZBG A;  1X10 A;  4JJX A;  3B3S A;  5IB0 A;  4KNG E;  3S9N A;  2C27 A;  3D4U A;  3GY9 A;  4TJX A;  3TLC A;  1BXR B;  5I4M A;  1BOB A;  1Y7E A;  4H6Z A;  2GU2 A;  3CPA A;  4FWU A;  4MI4 A;  4ZY0 A;  3GUX A;  4H2K A;  3B35 A;  4A30 A;  4ZGY B;  5IX3 A;  1QSO A;  4NXY A;  2AFW A;  2FVG A;  5HVG A;  1Q2Y A;  3JTK A;  3SJE A;  1UWY A;  1Y7R A;  1XJO A;  2Z10 A;  2Q7S A;  4MHY A;  1NBW A;  1VHE A;  1YRE A;  4NGR A;  1Y9Z A;  4KLV A;  1MJB A;  2D4P A;  1S7F A;  2Q4Z A;  4MFL A;  2WSA A;  4CAF A;  1KBL A;  4MCP A;  3TTH A;  4CYP A;  1ZLI A;  1CPS A;  5J3X A;  1X12 A;  2JDC A;  1YVO A;  1Z2L A;  4C8C A;  1L0C A;  1IYL A;  4JXQ A;  2YNC C;  2O53 A;  2HRO A;  2REE A;  2FS5 A;  3HLP A;  3KR5 A;  5BY0 A;  2Q7B A;  4B5O A;  5FD8 A;  4KOW A;  5THW A;  2O28 A;  1Z8L A;  3WC5 A;  2EUI A;  2A4N A;  3PT1 A;  3GYA A;  3RBU A;  2RFH A;  3IJ3 A;  4CAW A;  3C8O A;  4U9Y A;  3OB2 B;  2PJ8 A;  4UCP A;  1XBU A;  2EBJ A;  4MFJ A;  2ZED A;  3FRM A;  4E2A A;  1S7L A;  4PSW A;  4RI1 A;  2PIY A;  2V8H A;  4KVX A;  2DPT A;  1BPM A;  2RB7 A;  1QSN A;  4KOU A;  3KZW A;  3PZJ A;  4HPS A;  3BI0 A;  4NGN A;  4K3N A;  3PEI A;  1CX8 A;  3FBU A;  4ZY2 A;  3PFE A;  2R1I A;  4COG A;  3SI2 A;  1ARL A;  2ODF A;  4A2Z A;  1ZG7 A;  4J0N A;  3NFZ A;  4GPL B;  1M4I A;  1WWZ A;  2DXQ A;  3D2M A;  4MCS A;  4P44 A;  3IU2 A;  3N5F A;  2AJ6 A;  3R1K A;  4OC5 A;  2GIV A;  3H8E A;  1KUV A;  4CDK A;  1IY7 A;  4EYS A;  4DYO A;  4GM5 A;  4CS0 B;  5HVH A;  5K8N A;  1C30 B;  4KOY A;  4PXB A;  3SHP A;  4YU9 A;  3TLA A;  5JYB A;  1JDE A;  1BO4 A;  3BJ7 A;  1OZP A;  3W6S A;  3FB3 A;  4CGP A;  2PRQ A;  4AB7 A;  4C9A A;  1SQH A;  3EZA A;  1TKJ A;  2BO9 A;  4COB A;  4FD7 A;  3WT4 A;  1TF8 A;  1M4D A;  3TLG B;  2AFO A;  4RS2 A;  2PQ8 A;  2Z3K A;  3FVL A;  4NCZ A;  2IJZ A;  4KSI A;  1Y9W A;  2EK8 A;  2FCK A;  4DJL A;  4ONW A;  5JVL A;  3NH8 A;  4MMO A;  1TF9 A;  4PV6 A;  1ZG9 A;  2PIZ A;  1YQE A;  2G9D A;  2VI7 A;  3VRP A;  3BJ8 A;  4XPD B;  4DNC A;  1M6V B;  1JDB C;  1BPN A;  1EZA A;  2XEF A;  4R87 A;  5F5X A;  4A37 A;  2CIJ A;  3U1B A;  4CO9 A;  3R9F A;  3BHX A;  4IAV A;  3V7Z A;  5A28 A;  4BPX B;  2O4H A;  1CP7 A;  5G1Z A;  5F9M A;  3QB8 A;  1P4N A;  2PCU A;  3CXQ A;  4P4D A;  2Y1M A;  3N7Z A;  4FD4 A;  2R8V A;  4IF5 A;  4CRY B;  3D68 A;  3JRU A;  3JVN A;  1JQG A;  3VAR A;  4CGM A;  4PQA A;  3TOA A;  3IEH A;  1YVH A;  4CYQ A;  3S6G A;  2OZU A;  5LRJ A;  2AFS A;  2QML A;  1WK4 A;  4IIY A;  3KR4 A;  3EFA A;  4B14 A;  4C2Z A;  3GIU A;  3KHZ A;  3TCV A;  4A95 A;  5LYF A;  4R9M A;  4CGN A;  4E5S A;  4F0X A;  3EO4 A;  2R82 A;  2OOT A;  1XMB A;  4BIN A;  2BUE A; 
#chains in the Genus database with same CATH homology
 2C6C A;  4IK2 A;  4A94 A;  1YME A;  4EME A;  2ZEH A;  3FJU A;  5JH9 A;  4DUK A;  4JZ0 A;  2C5Q A;  2EK9 A;  1TXR A;  2IQ6 A;  1R43 A;  2PJ4 A;  4OID A;  5LYL A;  4MHP A;  5JGF A;  1BAV A;  1V6C A;  2ZEN A;  4ZY1 A;  1HDU A;  4MHN A;  4NJR A;  2GLF A;  4YWY A;  3TX8 A;  3KL9 A;  5JM6 A;  4X3R A;  3B7I A;  2C6G A;  3FED A;  5IB9 A;  4R7M A;  2J9A A;  3VTA A;  3EIF A;  3SJX A;  3CPX A;  2HC9 A;  4NJQ A;  2POK A;  4TJV A;  3D7D A;  6CPA A;  1AYE A;  3FEC A;  3ISX A;  2JBJ A;  3PB6 X;  2CF4 A;  4R76 A;  3SI1 A;  3DGV A;  4BD9 A;  3WAB A;  2I3C A;  4NGP A;  4PXD A;  4Q7A A;  1YW6 A;  1XRY A;  4W9Y A;  3DLJ A;  4OC4 A;  2GP4 A;  2PE3 A;  2V8V A;  1AMP A;  1RTQ A;  3B3T A;  1VHO A;  3D67 A;  3NA6 A;  1EE3 P;  4B6Z A;  3FF3 A;  7CPA A;  1TKH A;  4UIB A;  2ZOG A;  1LAN A;  4MRI A;  3KHX A;  1LOK A;  4NGQ A;  2F8H A;  1R3N A;  3PFO A;  1PCA A;  3CDX A;  4MHZ A;  4X8I A;  1TKF A;  1VIX A;  5LRK A;  2ZEP A;  1LCP A;  5LYI A;  1NSA A;  1HDQ A;  4UEF A;  1WVM A;  1M4L A;  3SJG A;  1F57 A;  3SI0 A;  2QJ8 A;  4TNU A;  5J1Q A;  4UIA A;  1KWM A;  4Z65 A;  2ZEE A;  3I74 A;  5D29 A;  3H8F A;  4ZX9 A;  4JYW A;  3RAM A;  1CP6 A;  4OKO A;  4EWT A;  3KI9 A;  4OME A;  4R8F A;  2AFM A;  3I1U A;  4P10 A;  4C8T A;  2PVV A;  4PXE A;  2V77 A;  2XEJ A;  1GYT A;  1CG2 A;  2ZEM A;  3FMC A;  3NH5 A;  3MN8 A;  3WC7 A;  4OC1 A;  1DTD A;  4ZI6 A;  2PJ0 A;  1F2O A;  4R6T A;  2JBK A;  2V8D A;  3KQX A;  3L2N A;  4PXC A;  1CBX A;  2C1C A;  2ZEL A;  4G1P A;  5IR2 A;  4C8A A;  8CPA A;  1DE4 C;  3VH9 A;  3ISZ A;  2ZEF A;  4C8U A;  2PJC A;  4C8F A;  2F7V A;  2AFZ A;  3ICU A;  5K8O A;  4C99 A;  4P45 A;  5CBM A;  4P4J A;  3LMS A;  4LQG A;  2C6P A;  4A39 A;  4NGT A;  3IC1 A;  3GLJ A;  1CPX A;  4ZX8 A;  5LYD A;  2PJ6 A;  1HEE A;  2WYR A;  1QQ9 A;  2CTC A;  4MCQ A;  3V38 A;  1LAM A;  3B3V A;  4OP4 A;  5HXD A;  3D7H A;  5K8P A;  4FUU A;  2VL1 A;  2GRE A;  4A38 A;  1Z5R A;  2ABZ A;  3GB0 A;  4OC2 A;  4P4E A;  2QYV A;  1ARM A;  5CPA A;  3BXM A;  2NSM A;  4WWV A;  1PYT B;  1Y0Y A;  3B2Y A;  2Q51 A;  1FNO A;  4UEZ A;  4C8P A;  5D8N A;  2AFX A;  1Q7L A;  3D7F A;  4PPZ A;  5HVF A;  3TC8 A;  3FEE A;  3LWU A;  4F8Z A;  2PJ5 A;  3D7G A;  1XFO A;  4F9V A;  3HUV A;  3PB7 X;  4P6Y A;  3WC6 A;  3VAT A;  4OC0 A;  5F09 A;  3S9L A;  3KGQ A;  2ZEG A;  3FH4 A;  4IHM A;  3I6S A;  1QMU A;  1BLL E;  2AFU A;  1LAP A;  3K2K A;  3MRU A;  4MXU A;  5ELY A;  4EFD A;  4MCR A;  3IFE A;  1LFW A;  2CTB A;  2V8G A;  1H8L A;  2NYQ A;  4ZYQ A;  4C86 A;  4F9U A;  2ZOF A;  3T8W A;  3FX6 A;  2XEI A;  1IGB A;  2BCO A;  3KAS A;  4FBE A;  4C9E A;  4X2T A;  2PJB A;  4NGS A;  4NFR A;  3H8G A;  4C84 A;  3BI1 A;  4WJB A;  2PJA A;  1ELM P;  3RZA A;  4C9R A;  1OBR A;  4O23 A;  3S9M A;  1ZG8 A;  2PJ7 A;  2PJ3 A;  3SJF A;  2JEW A;  3IO1 A;  4P4B A;  2GLJ A;  4AXV A;  4OIW A;  3PBE A;  2PJ1 A;  2ANP A;  3NH4 A;  4NGM A;  4RUH A;  1YLO A;  4C85 A;  1ELL P;  5K8M A;  3D66 A;  1F2P A;  5LRG A;  2IMO A;  2XEG A;  2QVP A;  3PB4 X;  1YW4 A;  3QNV A;  3PBB A;  4P4F A;  4OC3 A;  2PJ9 A;  5DS0 A;  4CPA A;  2WZN A;  4YN3 A;  3IIB A;  1Y0R A;  2EWB A;  3CT9 A;  4C9U A;  4FAI A;  3PRT A;  3PB9 X;  2PJ2 A;  1ZLH A;  4UF4 A;  3B3W A;  3B3C A;  3IWW A;  2OR4 A;  2PVW A;  3K9T A;  4P4I A;  4UEE A;  2Q43 A;  4CDJ A;  1YSJ A;  4TWE A;  2BOA A;  2DEA A;  3PB8 X;  2HB6 A;  1XF1 A;  1FT7 A;  1VGY A;  4C9V A;  2ZEO A;  3KQZ A;  3B3S A;  4KNG E;  4TJX A;  3S9N A;  3D4U A;  5I4M A;  1Y7E A;  2GU2 A;  3CPA A;  4FWU A;  4ZY0 A;  3GUX A;  4H2K A;  3B35 A;  2AFW A;  2FVG A;  5HVG A;  3SJE A;  1UWY A;  1XJO A;  4MHY A;  1VHE A;  4NGR A;  1Y9Z A;  2Q4Z A;  4MCP A;  1ZLI A;  1CPS A;  1Z2L A;  4C8C A;  2O53 A;  3HLP A;  3KR5 A;  5THW A;  1Z8L A;  3WC5 A;  3RBU A;  2RFH A;  3IJ3 A;  2PJ8 A;  1XBU A;  2ZED A;  2PIY A;  2V8H A;  2RB7 A;  1BPM A;  3KZW A;  4K3N A;  3BI0 A;  4NGN A;  3PEI A;  1CX8 A;  4ZY2 A;  3PFE A;  3SI2 A;  1ARL A;  1ZG7 A;  3NFZ A;  4MCS A;  4P44 A;  3N5F A;  4OC5 A;  3H8E A;  4CDK A;  1IY7 A;  4DYO A;  4GM5 A;  5HVH A;  5K8N A;  4PXB A;  4YU9 A;  2PRQ A;  4C9A A;  1TKJ A;  2BO9 A;  3WT4 A;  1TF8 A;  2AFO A;  3FVL A;  2IJZ A;  4KSI A;  4DJL A;  2EK8 A;  4ONW A;  3NH8 A;  4MMO A;  1TF9 A;  1ZG9 A;  2PIZ A;  2G9D A;  1BPN A;  2XEF A;  4A37 A;  2CIJ A;  3BHX A;  4IAV A;  3V7Z A;  2O4H A;  1CP7 A;  2PCU A;  4P4D A;  3D68 A;  3JRU A;  3VAR A;  1JQG A;  4PQA A;  3IEH A;  5LRJ A;  2AFS A;  3KR4 A;  3KHZ A;  5LYF A;  2OOT A;  1XMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...