2XEIA

Human glutamate carboxypeptidase ii in complex with antibody- recruiting molecule arm-p2
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title A Remote Arene-Binding Site on Prostate Specific Membrane Antigen Revealed by Antibody-Recruiting Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 264
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2xeiA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2xeiA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2xeiA02
3SJFA 2PJ7A 3KR5A 4G1PA 4OP4A 1LAPA 4OIDA 4C8AA 1ZG8A 2ZEPA 3T8WA 1XJOA 4OC3A 5D29A 3SI2A 4IAVA 4TJXA 3FECA 2FVGA 2AFOA 1HDQA 4NFRA 4R6TA 3TC8A 2CIJA 3EIFA 2ZEFA 3KASA 3KI9A 4ZI6A 2BOAA 3CPAA 1BAVA 1CBXA 4C9RA 2GREA 4C8CA 5LRJA 2CTCA 4UIAA 4MRIA 4WWVA 2XEFA 1EE3P 2ZELA 1KWMA 2V8GA 2PJ8A 4P45A 4X2TA 2AFUA 3B3WA 1Y0RA 3FJUA 3S9LA 3BHXA 4A37A 4F9VA 4EMEA 4ZY1A 3B3VA 4DUKA 4YU9A 4UEZA 2XEIA 4MMOA 4PQAA 1ZLHA 3D7GA 3IIBA 1QMUA 2Q4ZA 2I3CA 3VATA 3B35A 4OKOA 2WYRA 1RTQA 2ZEOA 2EK9A 2J9AA 1R3NA 2PRQA 4ZX8A 2RFHA 2ZEMA 2V8HA 2C6GA 1CX8A 4TWEA 3SI1A 5JH9A 5LRGA 4W9YA 4UF4A 4PXBA 3WC5A 3IJ3A 2PVVA 4NGNA 3WT4A 4BD9A 1ARMA 3ISXA 4MCRA 1TKFA 3TX8A 2QVPA 3B3CA 3JRUA 3FEDA 1FNOA 3PB9X 3CT9A 4NGRA 2PJ3A 3B3SA 3QNVA 4C86A 5LRKA 2IQ6A 4P4IA 2VL1A 1OBRA 3GUXA 4R8FA 4R76A 2C6PA 3H8FA 4FWUA 1TF8A 4P4EA 2ZOFA 4P6YA 1F57A 2PJ2A 3RZAA 1WVMA 1CPXA 1YSJA 4UIBA 1PYTB 3NFZA 4CDKA 2EK8A 4TNUA 4Q7AA 5I4MA 3FVLA 1BPNA 2JEWA 2GLJA 1M4LA 4C9VA 3PB8X 3FH4A 1QQ9A 1ZG7A 2PVWA 1Q7LA 4F8ZA 4ZYQA 1YW6A 1TXRA 2Q51A 5HVGA 4P10A 2DEAA 5JM6A 3DLJA 4P4DA 4PXDA 1Z5RA 2ZEGA 3FEEA 4C9UA 1VGYA 3GLJA 1CPSA 3SJGA 3VTAA 4MXUA 4PXEA 2IJZA 4NGTA 1TKJA 4X3RA 3KR4A 4KNGE 2AFZA 3FMCA 4MCSA 1YLOA 3ICUA 5K8MA 4GM5A 1V6CA 5CBMA 4MHNA 2HB6A 4YWYA 4FUUA 1AMPA 3PRTA 2F7VA 2AFWA 2PJ1A 3MN8A 4A39A 3KQZA 2ZOGA 1XF1A 4C8PA 4AXVA 3KGQA 2PIZA 4C99A 4C84A 3IWWA 4C8TA 2PE3A 5LYIA 3D68A 2V8DA 4IK2A 4ZX9A 3PB7X 1AYEA 4X8IA 3WC6A 3HUVA 3NH4A 3D4UA 3PFEA 1H8LA 1LANA 2ANPA 2BCOA 4IHMA 3PBEA 4OMEA 3SI0A 1IGBA 3VARA 4C9EA 2V8VA 2PJCA 2RB7A 2C1CA 4KSIA 4ZY2A 1BLLE 3LMSA 4H2KA 5CPAA 3PBBA 2NSMA 1XBUA 1DE4C 2OOTA 1GYTA 3V38A 4DJLA 4F9UA 3DGVA 3MRUA 2ZEHA 3D7FA 5HVHA 2XEJA 4MHYA 4C9AA 3KHXA 5LYDA 4WJBA 3PEIA 4FBEA 2XEGA 4UEEA 4NGQA 3FF3A 1YW4A 1Z2LA 2PJ4A 5F09A 3WABA 3BXMA 4C8FA 3RBUA 1LOKA 3PFOA 1R43A 5HXDA 3B2YA 3K9TA 2ZENA 1JQGA 1F2OA 3PB4X 1LAMA 3ISZA 2CTBA 2ABZA 3IC1A 3PB6X 1CP6A 4OIWA 1XFOA 3KQXA 4OC1A 2F8HA 4CPAA 4DYOA 3NH8A 7CPAA 5J1QA 4MHZA 4OC5A 3B3TA 2NYQA 2PCUA 4K3NA 4A38A 1NSAA 2POKA 8CPAA 3CPXA 1YMEA 1DTDA 2QYVA 3GB0A 5JGFA 5LYFA 2PJ5A 1TF9A 4FAIA 1Y0YA 4EFDA 6CPAA 3D67A 4B6ZA 1LCPA 2PJ9A 2ZEEA 2Q43A 1VHEA 2IMOA 1XMBA 5ELYA 1VHOA 2PJBA 3L2NA 3BI1A 2OR4A 1LFWA 2PJ6A 1ELLP 4P4JA 4OC0A 1Y9ZA 4P4FA 4C8UA 1IY7A 3K2KA 4C85A 5K8PA 1Z8LA 5D8NA 2AFSA 4P44A 4PPZA 4LQGA 3SJXA 3H8GA 3IFEA 2ZEDA 4RUHA 2AFMA 4YN3A 2G9DA 5HVFA 2O4HA 2C6CA 5LYLA 4NJQA 4NGSA 2GU2A 1F2PA 3I1UA 1CP7A 2QJ8A 1ELMP 3WC7A 4MCPA 2V77A 5THWA 4NJRA 3CDXA 5DS0A 3LWUA 3I74A 4NGMA 1XRYA 3I6SA 3NH5A 4CDJA 4ONWA 3RAMA 1Y7EA 3NA6A 2EWBA 2GLFA 4EWTA 4ZY0A 1BPMA 3H8EA 2JBJA 1VIXA 4JZ0A 4OC4A 4NGPA 4O23A 1ZG9A 3B7IA 3IEHA 3SJEA 4A94A 1TKHA 4P4BA 3VH9A 1ZLIA 3HLPA 1HDUA 3S9MA 4UEFA 4Z65A 4R7MA 2PJ0A 1PCAA 3FX6A 4MHPA 4JYWA 3V7ZA 2BO9A 1CG2A 3KZWA 4PXCA 3D7HA 3BI0A 2CF4A 3IO1A 3KL9A 1UWYA 3S9NA 3KHZA 3D7DA 4TJVA 1ARLA 2PJAA 5K8OA 2PIYA 4MCQA 3N5FA 5IB9A 2O53A 5K8NA 3D66A 4OC2A 1FT7A 2JBKA 1HEEA 2HC9A 2WZNA 2AFXA
chains in the Genus database with same CATH superfamily
3SJFA 4Q36A 2P0WA 2PJ7A 3KR5A 4KLWA 5IR2A 4G1PA 2R8VA 2Z3MA 4OP4A 1LAPA 2B5GA 4OIDA 5AG5A 4F6AA 1C3OB 4C8AA 3ZNIA 2C5QA 1ZG8A 4A95A 3NFQA 2ZEPA 2XPLA 1YK3A 2P6GA 4XPDC 3T8WA 1XJOA 2P6FA 3I9SA 4OC3A 5G1ZA 2QMLA 3WR7A 4F0YA 5D29A 4CYNA 3SI2A 4CYQA 2VZZA 4IAVA 4TJXA 2F5IA 1XEBA 3FECA 2FVGA 4YFJA 2AFOA 4PK2A 1HDQA 3VRNA 1Q2DA 3JTKA 4NFRA 4R6TA 4Y49C 3TC8A 2CIJA 3EIFA 5HKYA 2CY2A 2ZEFA 3KASA 5G20A 3KI9A 4GS4A 4ZI6A 3D2PA 3EXNA 4MBUA 3R9EA 2B4DA 2BL1A 3DR8A 2BOAA 1Q2YA 3CPAA 1BAVA 1CBXA 4C9RA 2GREA 4MFQA 4QUSA 4AG9A 2DLAA 2FIAA 4B5OA 4C8CA 4M6GA 3C26A 2Y0MA 4YGOA 4C2XA 5LRJA 4YRHA 4C68A 4FD4A 4HNXB 5F47A 1BO4A 1NBWA 2CTCA 4UIAA 2AUMA 1Z4EA 4MRIA 2XEFA 4WWVA 3JVNA 1EE3P 4XNHB 2ZELA 1KWMA 2V8GA 2PJ8A 4RN7A 4MI1A 4COGA 3T90A 3U1BA 3F9KC 1Y9KA 4P45A 1J4JA 4IF5A 4X2TA 4MFZA 3IGRA 2AFUA 1JDEA 3U88C 4PV6A 5KTDA 3B3WA 1Y0RA 2PR1A 1QSRA 3S9LA 3FJUA 4EVYA 2DIKA 3OP0A 1NXJA 3BHXA 4A37A 2OH1A 2FXFA 2Q7BA 4F9VA 1KUYA 3VRQA 1M4GA 1S5KA 2Z3NA 2HI6A 4EMEA 4Q38A 2OZUA 4ZY1A 3B3VA 1S7NA 4NSQA 1I12A 4DUKA 3G8WA 3VGOA 5BWAB 4YU9A 3ZJ0A 4UEZA 3D8PA 4JD6A 2XEIA 2C27A 4MMOA 1YVOA 2R98A 3IU2A 4PQAA 4R9MA 2PQ8A 4DNCA 4E8OA 4LUAA 2AUNA 2PR8A 1GGOA 4A4BA 1ZLHA 3GIUA 1YX0A 1DIKA 3D7GA 4BBHA 3IIBA 3ZZIA 1ZO0A 4M6IA 4MY0A 1QMUA 2Q4ZA 3PGPA 3VWDA 4CGNA 4PSXA 2I3CA 4B11A 2GE3A 3B35A 3FXTA 3VATA 4OKOA 4U5YA 2WYRA 2JEVA 3RYOA 4NF1A 1RTQA 2ZEOA 2Y1NA 1KUVA 4I49A 2EK9A 2G3AA 4HPSA 4U9YA 4A32A 4QBJA 4OLLA 2REFA 2J9AA 1R3NA 2VZYA 2PRQA 2R7HA 2RFHA 2ZEMA 4XPKA 4ZX8A 2GP4A 1VKCA 5G21A 2REEA 2C6GA 2V8HA 2CNTA 1C30B 1CX8A 4TWEA 3SI1A 5JH9A 4AVAA 1QSTA 5LRGA 4LX9A 4W9YA 2P6EA 3OAKA 1WK4A 4UF4A 3NE7A 3TLGB 1QSMA 4PXBA 2Q4YA 3WC5A 3IJ3A 3OB2B 2PVVA 3W6SA 1CM0A 4NGNA 3WT4A 4BD9A 1ARMA 2PSWA 4PK3A 3ISXA 2A4NA 4MCRA 2I00A 1IU8A 3TLCA 1TKFA 4X5KA 4RI1A 5AG7A 4JWPA 3GY9A 3TX8A 2QVPA 1EZBA 2QIRA 1Z9EA 2WPWA 2X0SA 3B3CA 4CGPA 3JRUA 2Q04A 2RC4A 3PZJA 4B5PB 3FEDA 3BUOB 4KOVA 1FNOA 4MFLA 3PB9X 2N3AB 1KZFA 3BUWB 3B8GA 3CT9A 4NGRA 1XF8A 4K30A 5IX3A 5IB0A 5J8CA 1SQHA 4A31A 2PDOA 2B4JC 5J3XA 2PJ3A 3B3SA 3QNVA 1S60A 2YNCC 4B12A 4C86A 5LRKA 4INJA 2IQ6A 3R9FA 2PC1A 3H4QA 2FSRA 4P4IA 2VL1A 4B10A 1OBRA 4KUAA 3GUXA 4R8FA 4R76A 2C6PA 5EMIA 3KKWA 2Z3KA 3H8FA 4FWUA 3VROA 1TF8A 4M85A 4P4EA 1I1DA 1K4JA 4UWJA 4CAVA 2Q4VA 4IIXA 5FD8A 4AB7A 2ZOFA 4CGOA 5JPHA 4P6YA 1F57A 3BUXB 2PJ2A 3EY5A 3RZAA 1VBGA 1WVMA 4KVXA 1CPXA 1YSJA 4UIBA 1I21A 1MK4A 2FS5A 1PYTB 3NFZA 2GFQA 1KEEB 4CDKA 1S3ZA 2EO8A 3CXPA 3DNSA 2Q0YA 2EK8A 3QAHA 2DPTA 4NCZA 1MJAA 4TNUA 3TTHA 5CNPA 2R1IA 4Q7AA 3BUNB 3VRRA 1ZRSA 3GJZA 5F48A 2FL4A 5I4MA 3FVLA 1BPNA 2JEWA 2GLJA 2XPPA 1M4LA 3PB8X 2ARHA 3OWCA 4J3GA 4BPXB 3CXSA 1Z9UA 3FH4A 5DWMA 5F5XA 4BTFA 1QQ9A 1ZG7A 2PVWA 2Q44A 2XPOA 1Q7LA 2VQYA 4F8ZA 1YW6A 4ZYQA 1TXRA 4CAWA 1Y7RA 3DSBA 2Q51A 5HVGA 3T05A 4P10A 2DEAA 5JM6A 3C8OA 2OZGA 3CZXA 1PUAA 1UFHA 2Y1MA 3DLJA 5H84A 5F46A 4P4DA 1P4NA 1OZPA 4KZTA 4PXDA 3SXNA 1Z4RA 1Z5RA 2ZEGA 3FYNA 3FEEA 1IICA 4A2ZA 1YVKA 1B47A 4XNHC 3FIXA 2AJ6A 2B3UA 4JXRA 3TOBA 4C9UA 5FVJA 1VGYA 3GLJA 2EZBA 1CPSA 3SJGA 3S6KA 3I3GA 2YNEA 3VTAA 2ZW6A 4MXUA 3SHPA 4PXEA 2IJZA 4PSWA 4C9VA 3G23A 5AGEA 4NGTA 3R96A 2ZW4A 4H6ZA 2B5GB 1TKJA 5JYBA 4X3RA 4KORA 3KR4A 4KNGE 3BJ7A 1A2ZA 2AFZA 3FMCA 4MCSA 2D4OA 2EUIA 3RO0A 3SR3A 3S6HA 1YLOA 3ICUA 5K8MA 4M6HA 3EO4A 4GM5A 4BPUB 2HV2A 1V6CA 1YVHA 5CBMA 4MHNA 4JVOA 2HB6A 3A9LA 4YWYA 4FUUA 1Q2CA 4CRZB 1AMPA 3PRTA 2F7VA 1YGHA 2AFWA 4JLYA 4FD6A 2PJ1A 3MN8A 3BJ8A 2CXAA 2QECA 2B4BA 2VBQA 1NSLA 3TOAA 4A39A 2B4DB 2NMTA 2ZOGA 3KQZA 3RNZA 4CZ1A 1XF1A 4C8PA 4AXVA 1Z8XA 3KGQA 5HKWA 3W6XA 2PIZA 4MI4A 2EZAA 4C99A 4C84A 5JVLA 3IWWA 1VI4A 5C88A 1CE8B 4EYSA 4C8TA 1NE9A 2PE3A 5LYIA 2VXKA 3TT2A 2WPXA 3D68A 2V8DA 3EZBA 1WWZA 4AVBA 4IK2A 1M4IA 4ZX9A 3PB7X 1JWQA 2YNDA 1AYEA 3IWGA 4X8IA 1M44A 3WC6A 1YREA 3NOJA 2CBLA 3HUVA 1FY7A 2HUZA 3NH4A 4B13A 3TLBA 1ZYMA 4NXYA 3D4UA 2JDCA 1YR0A 4H89A 4KUBA 2EZCA 2HROA 5F1YA 3PFEA 4OADA 4KOXA 1H8LA 1LANA 2ANPA 2BCOA 3TLEA 4IHMA 3TO9A 3PBEA 5HKZA 4OMEA 2YJTA 3SI0A 1IGBA 3TO7A 3VARA 4C9EA 4H1HA 2V8VA 2PJCA 2JLMA 2RB7A 4U9ZA 4C2ZA 2YNCA 2C1CA 4KSIA 3E0KA 5G22A 4ZY2A 3EFAA 1BLLE 1CS0B 2B0AA 1IYKA 1B87A 3IWEA 3LMSA 4H2KA 4KOUA 5CPAA 3PBBA 4KOSA 4C2YA 2NSMA 1XBUA 4J0NA 1DE4C 2OOTA 1GYTA 3V38A 4DJLA 4CGMA 4F9UA 3DGVA 2AE6A 3MRUA 3FNCA 4KVOE 4E2AA 1M1DA 2ZEHA 3D7FA 3EC4A 5HVHA 2XEJA 4KLVA 4MHYA 3KHXA 4C9AA 5LYDA 4WJBA 3PEIA 5EC4A 1BOBA 3JUWA 3GKRA 5AG6A 4FBEA 2XEGA 4UEEA 2YJVA 4NGQA 3FF3A 1RXTA 1YW4A 3F8KA 4JXQA 1Z2LA 2PJ4A 2PRBA 5F09A 3WABA 3BXMA 3G3SA 3S6FA 4C8FA 3RBUA 2ZXVA 1VBHA 1LOKA 3PFOA 1R43A 4QC6A 4F0XA 5HXDA 2J8RA 3B2YA 1Y9WA 3K9TA 3VRPA 5EBVA 4A33A 5AG4A 1CJWA 2JDDA 2ZENA 1JQGA 3SXOA 1F2OA 2G0BA 3PB4X 5I0CA 1NMTA 4UA3A 1LAMA 2DXQA 3ISZA 2CTBA 2ZW5A 4MJXA 2ABZA 3IC1A 3PB6X 1CP6A 4OIWA 1XFOA 4FD7A 5ISVA 1J3LA 3KQXA 4OC1A 5F9MA 1R57A 2J8NA 1EO0A 2F8HA 4CPAA 2XPNA 2H5MA 1M4DA 4DYOA 4CAFA 3LACA 3PP9A 3NH8A 4R87A 2FT0A 7CPAA 4LQ6A 3DR6A 5J1QA 1FBVA 4MHZA 4ONUA 1IOFA 2BUEA 3FB3A 4HNWB 4OC5A 4M3SA 4E0AA 3B3TA 1X12A 4KOWA 5E96A 3QB8A 2NYQA 2PCUA 3P2FA 2B58A 4K3NA 2PCNA 4A38A 3FBUA 3UY5A 1NSAA 2J8MA 3R95A 1AUGA 2POKA 4XPLA 8CPAA 4COBA 2Z3PA 3F5BA 1M6VB 3CPXA 3TCVA 4MFKA 4ZBGA 1YMEA 3O8ZA 1DTDA 2QYVA 3GB0A 5JGFA 5A28A 1IYLA 3GYAA 2G3TA 2CNSA 1IIDA 1ON0A 2VKZG 2PJ5A 3D3SA 3QAYA 3VWEA 2OZHA 3TYXA 3F0AA 1IOIA 4XPDB 3EZAA 1TF9A 4FAIA 1S7FA 1YLEA 1Y0YA 3NE8A 4EFDA 6CPAA 3D67A 4NEXA 2OB0A 4A4CA 1LCPA 2PJ9A 2ZEEA 4ORFA 4B6ZA 4CS0B 2Q43A 1VHEA 3T5MA 3P2HA 4Y49B 4HKFA 2D4PA 2IMOA 3S6GA 2E28A 1XMBA 2VEZA 2Z0ZA 2HWGA 2ATRA 2O28A 5ELYA 1R61A 1VHOA 3BI1A 2PJBA 3L2NA 1Q5XA 3TLYA 4UFVA 2OR4A 4QVTA 3TLAA 2FE7A 1L0CA 1LFWA 3CXQA 2PJ6A 2UV8G 3LODA 5J8FA 1ELLP 1U6MA 1Z8WA 4R3KA 2R82A 4P4JA 4CAXA 5H86A 4OC0A 1Y9ZA 4P4FA 4C8UA 1RO5A 3V8IA 2HQYA 1IY7A 1V0CA 3K2KA 2B3VA 4CRYB 4C85A 4RR2B 5K8PA 2FM4A 3HMJG 3OB1B 2IL4A 3FRMA 1Z8TA 4CGLA 1A9XB 1Z8LA 5D8NA 4CAEA 2AFSA 4P44A 4PPZA 2MP0A 1S7LA 4KOTA 4LQGA 1XIXA 3KRVA 3SJXA 2Z11A 2OU2A 4UCMA 4MFJA 2FIWA 3PT1A 2ODFA 2DPSA 2BSWA 4UWIA 4AG7A 2KCWA 3H8GA 3IFEA 3TLGA 2ZEDA 4RUHA 2AFMA 1IB1E 2WSAA 4YN3A 3W91A 2G9DA 5HVFA 2FCKA 2O4HA 2C6CA 4AVCA 5LYLA 4NJQA 4NGSA 4BPWB 5GCNA 2GU2A 4H6UA 4HNYB 3PLFB 1MJ9A 1F2PA 3I1UA 4C7HA 1MJBA 4CYOA 1CP7A 2QJ8A 3TFYA 3PFVA 3BUMB 1EZAA 3K4IA 2OLSA 1ELMP 3TE4A 1JDBC 3WC7A 4IUSA 4MCPA 1PU9A 3BLNA 2EVNA 5F49A 2D0OA 4B5PA 1WJTA 2V77A 5THWA 4NJRA 5HH1A 4ZGYB 3EZEA 3CDXA 5DS0A 3LWUA 5C82A 4A30A 2D0PA 3I74A 4NGMA 1XMTA 1XRYA 3D2MA 4GXHA 4RS2A 4UCNA 3I6SA 5JQ4A 3NH5A 1N71A 3H5ZA 4CDJA 4UCPA 4ONWA 4UBRA 2DF5A 3T07A 4BINA 4UFXA 2Z3OA 3TO6A 2YGWA 3RAMA 5BY0A 2Z3LA 2BEIA 4MY3A 1Y7EA 2Z10A 3NA6A 2EWBA 2GANA 2GLFA 4IIYA 4L8AA 4EWTA 1KBLA 4R3LA 4QB9A 2K5TA 1KUXA 4MHDA 4ZY0A 4OAEA 1BPMA 3H8EA 3R1KA 3N7ZA 2JBJA 1VIXA 4JZ0A 4OC4A 4NGPA 2VI7A 3IU1A 4O23A 1TIQA 1ZG9A 3HPHE 3T0TA 2CNMA 1X10A 1S7KA 3B7IA 3IEHA 5F13A 4JJXA 4L89A 4KSFA 4BMHA 4R57A 5A27A 4II9A 3SJEA 4A94A 1TKHA 4P4BA 4MFPA 1ZLIA 3VH9A 4E5SA 1B6BA 4KS9A 5LYFA 2ZW7A 2X7BA 1P0HA 4E94A 2ZPAA 3T9YA 5IV0A 1KC7A 3HLPA 1VHSA 4GPLB 3S9MA 1HDUA 4UEFA 4R7MA 4Z65A 3DDDA 1QSNA 1PCAA 1QSOA 2PJ0A 3FX6A 4JYWA 4MHPA 3R9GA 3V7ZA 2BO9A 1CG2A 2EBJA 3LD2A 3KZWA 4CO9A 4PXCA 3D7HA 4M8DA 3BI0A 2GIVA 2I79A 2Q7SA 5DWNA 4KVME 1T36B 2CF4A 1ZL0A 3IO1A 5AXIA 3TLZA 3KL9A 1YQEA 1XOVA 1UWYA 1XE4A 3S9NA 1LRZA 4FD5A 3KHZA 3D7DA 1GHEA 1ARLA 2PJAA 2WUUA 5K8OA 2PIYA 4TJVA 5KTCA 4MCQA 3N5FA 5IB9A 2O53A 4B14A 3HPGG 3D66A 5K8NA 4OC2A 4MJ8A 4C7IA 1FT7A 4CYPA 2JBKA 1HEEA 3MGDA 4KSAA 5K99A 3K9UA 2HC9A 1BXRB 4KOYA 2WZNA 5HMNA 4UFWA 2AFXA 5KTAA
chains in the Genus database with same CATH topology
3SJFA 2PJ7A 3KR5A 5IR2A 4G1PA 4OP4A 1LAPA 4OIDA 4C8AA 2C5QA 1ZG8A 2ZEPA 3T8WA 1XJOA 4OC3A 5D29A 3SI2A 4IAVA 4TJXA 3FECA 2FVGA 2AFOA 1HDQA 4NFRA 4R6TA 3TC8A 2CIJA 3EIFA 2ZEFA 3KASA 3KI9A 4ZI6A 2BOAA 3CPAA 1BAVA 1CBXA 4C9RA 2GREA 4C8CA 5LRJA 2CTCA 4UIAA 4MRIA 4WWVA 2XEFA 1EE3P 2ZELA 1KWMA 2V8GA 2PJ8A 4P45A 4X2TA 2AFUA 3B3WA 1Y0RA 3FJUA 3S9LA 3BHXA 4A37A 4F9VA 4EMEA 4ZY1A 3B3VA 4DUKA 4YU9A 4UEZA 2XEIA 4MMOA 4PQAA 1ZLHA 3D7GA 3IIBA 1QMUA 2Q4ZA 2I3CA 3VATA 3B35A 4OKOA 2WYRA 1RTQA 2ZEOA 2EK9A 2J9AA 1R3NA 2PRQA 4ZX8A 2RFHA 2ZEMA 2GP4A 2V8HA 2C6GA 1CX8A 4TWEA 3SI1A 5JH9A 5LRGA 4W9YA 4UF4A 4PXBA 3WC5A 3IJ3A 2PVVA 4NGNA 3WT4A 4BD9A 1ARMA 3ISXA 4MCRA 1TKFA 3TX8A 2QVPA 3B3CA 3JRUA 3FEDA 1FNOA 3PB9X 3CT9A 4NGRA 2PJ3A 3B3SA 3QNVA 4C86A 5LRKA 2IQ6A 4P4IA 2VL1A 1OBRA 3GUXA 4R8FA 4R76A 2C6PA 3H8FA 4FWUA 1TF8A 4P4EA 2ZOFA 4P6YA 1F57A 2PJ2A 3RZAA 1WVMA 1CPXA 1YSJA 4UIBA 1PYTB 3NFZA 4CDKA 2EK8A 4TNUA 4Q7AA 5I4MA 3FVLA 1BPNA 2JEWA 2GLJA 1M4LA 4C9VA 3PB8X 3FH4A 1QQ9A 1ZG7A 2PVWA 1Q7LA 4F8ZA 4ZYQA 1YW6A 1TXRA 2Q51A 5HVGA 4P10A 2DEAA 5JM6A 3DLJA 4P4DA 4PXDA 1Z5RA 2ZEGA 3FEEA 4C9UA 1VGYA 3GLJA 1CPSA 3SJGA 3VTAA 4MXUA 4PXEA 2IJZA 4NGTA 1TKJA 4X3RA 3KR4A 4KNGE 2AFZA 3FMCA 4MCSA 1YLOA 3ICUA 5K8MA 4GM5A 1V6CA 5CBMA 4MHNA 2HB6A 4YWYA 4FUUA 1AMPA 3PRTA 2F7VA 2AFWA 2PJ1A 3MN8A 4A39A 3KQZA 2ZOGA 1XF1A 4C8PA 4AXVA 3KGQA 2PIZA 4C99A 4C84A 3IWWA 4C8TA 2PE3A 5LYIA 3D68A 2V8DA 4IK2A 4ZX9A 3PB7X 1AYEA 4X8IA 3WC6A 3HUVA 3NH4A 3D4UA 3PFEA 1H8LA 1LANA 2ANPA 2BCOA 4IHMA 3PBEA 4OMEA 3SI0A 1IGBA 3VARA 4C9EA 2V8VA 2PJCA 2RB7A 2C1CA 4KSIA 4ZY2A 1BLLE 3LMSA 4H2KA 5CPAA 3PBBA 2NSMA 1XBUA 1DE4C 2OOTA 1GYTA 3V38A 4DJLA 4F9UA 3DGVA 3MRUA 2ZEHA 3D7FA 5HVHA 2XEJA 4MHYA 4C9AA 3KHXA 5LYDA 4WJBA 3PEIA 4FBEA 2XEGA 4UEEA 4NGQA 3FF3A 1YW4A 1Z2LA 2PJ4A 5F09A 3WABA 3BXMA 4C8FA 3RBUA 1LOKA 3PFOA 1R43A 5HXDA 3B2YA 3K9TA 2ZENA 1JQGA 1F2OA 3PB4X 1LAMA 3ISZA 2CTBA 2ABZA 3IC1A 3PB6X 1CP6A 4OIWA 1XFOA 3KQXA 4OC1A 2F8HA 4CPAA 4DYOA 3NH8A 7CPAA 5J1QA 4MHZA 4OC5A 3B3TA 2NYQA 2PCUA 4K3NA 4A38A 1NSAA 2POKA 8CPAA 3CPXA 1YMEA 1DTDA 2QYVA 3GB0A 5JGFA 5LYFA 2PJ5A 1TF9A 4FAIA 1Y0YA 4EFDA 6CPAA 3D67A 4B6ZA 1LCPA 2PJ9A 2ZEEA 2Q43A 1VHEA 2IMOA 1XMBA 5ELYA 1VHOA 2PJBA 3L2NA 3BI1A 2OR4A 1LFWA 2PJ6A 1ELLP 4P4JA 4OC0A 1Y9ZA 4P4FA 4C8UA 1IY7A 3K2KA 4C85A 5K8PA 1Z8LA 5D8NA 2AFSA 4P44A 4PPZA 4LQGA 3SJXA 3H8GA 3IFEA 2ZEDA 4RUHA 2AFMA 4YN3A 2G9DA 5HVFA 2O4HA 2C6CA 5LYLA 4NJQA 4NGSA 2GU2A 1F2PA 3I1UA 1CP7A 2QJ8A 1ELMP 3WC7A 4MCPA 2V77A 5THWA 4NJRA 3CDXA 5DS0A 3LWUA 3I74A 4NGMA 1XRYA 3I6SA 3NH5A 4CDJA 4ONWA 3RAMA 1Y7EA 3NA6A 2EWBA 2GLFA 4EWTA 4ZY0A 1BPMA 3H8EA 2JBJA 1VIXA 4JZ0A 4OC4A 4NGPA 4O23A 1ZG9A 3B7IA 3IEHA 3SJEA 4A94A 1TKHA 4P4BA 3VH9A 1ZLIA 3HLPA 1HDUA 3S9MA 4UEFA 4Z65A 4R7MA 2PJ0A 1PCAA 3FX6A 4MHPA 4JYWA 3V7ZA 2BO9A 1CG2A 3KZWA 4PXCA 3D7HA 3BI0A 2CF4A 3IO1A 3KL9A 1UWYA 3S9NA 3KHZA 3D7DA 4TJVA 1ARLA 2PJAA 5K8OA 2PIYA 4MCQA 3N5FA 5IB9A 2O53A 5K8NA 3D66A 4OC2A 1FT7A 2JBKA 1HEEA 2HC9A 2WZNA 2AFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJF A;  2PJ7 A;  3KR5 A;  4G1P A;  4OP4 A;  1LAP A;  4OID A;  4C8A A;  1ZG8 A;  2ZEP A;  3T8W A;  1XJO A;  4OC3 A;  5D29 A;  3SI2 A;  4IAV A;  4TJX A;  3FEC A;  2FVG A;  2AFO A;  1HDQ A;  4NFR A;  4R6T A;  3TC8 A;  2CIJ A;  3EIF A;  2ZEF A;  3KAS A;  3KI9 A;  4ZI6 A;  2BOA A;  3CPA A;  1BAV A;  1CBX A;  4C9R A;  2GRE A;  4C8C A;  5LRJ A;  2CTC A;  4UIA A;  4MRI A;  4WWV A;  2XEF A;  1EE3 P;  2ZEL A;  1KWM A;  2V8G A;  2PJ8 A;  4P45 A;  4X2T A;  2AFU A;  3B3W A;  1Y0R A;  3FJU A;  3S9L A;  3BHX A;  4A37 A;  4F9V A;  4EME A;  4ZY1 A;  3B3V A;  4DUK A;  4YU9 A;  4UEZ A;  2XEI A;  4MMO A;  4PQA A;  1ZLH A;  3D7G A;  3IIB A;  1QMU A;  2Q4Z A;  2I3C A;  3VAT A;  3B35 A;  4OKO A;  2WYR A;  1RTQ A;  2ZEO A;  2EK9 A;  2J9A A;  1R3N A;  2PRQ A;  4ZX8 A;  2RFH A;  2ZEM A;  2V8H A;  2C6G A;  1CX8 A;  4TWE A;  3SI1 A;  5JH9 A;  5LRG A;  4W9Y A;  4UF4 A;  4PXB A;  3WC5 A;  3IJ3 A;  2PVV A;  4NGN A;  3WT4 A;  4BD9 A;  1ARM A;  3ISX A;  4MCR A;  1TKF A;  3TX8 A;  2QVP A;  3B3C A;  3JRU A;  3FED A;  1FNO A;  3PB9 X;  3CT9 A;  4NGR A;  2PJ3 A;  3B3S A;  3QNV A;  4C86 A;  5LRK A;  2IQ6 A;  4P4I A;  2VL1 A;  1OBR A;  3GUX A;  4R8F A;  4R76 A;  2C6P A;  3H8F A;  4FWU A;  1TF8 A;  4P4E A;  2ZOF A;  4P6Y A;  1F57 A;  2PJ2 A;  3RZA A;  1WVM A;  1CPX A;  1YSJ A;  4UIB A;  1PYT B;  3NFZ A;  4CDK A;  2EK8 A;  4TNU A;  4Q7A A;  5I4M A;  3FVL A;  1BPN A;  2JEW A;  2GLJ A;  1M4L A;  4C9V A;  3PB8 X;  3FH4 A;  1QQ9 A;  1ZG7 A;  2PVW A;  1Q7L A;  4F8Z A;  4ZYQ A;  1YW6 A;  1TXR A;  2Q51 A;  5HVG A;  4P10 A;  2DEA A;  5JM6 A;  3DLJ A;  4P4D A;  4PXD A;  1Z5R A;  2ZEG A;  3FEE A;  4C9U A;  1VGY A;  3GLJ A;  1CPS A;  3SJG A;  3VTA A;  4MXU A;  4PXE A;  2IJZ A;  4NGT A;  1TKJ A;  4X3R A;  3KR4 A;  4KNG E;  2AFZ A;  3FMC A;  4MCS A;  1YLO A;  3ICU A;  5K8M A;  4GM5 A;  1V6C A;  5CBM A;  4MHN A;  2HB6 A;  4YWY A;  4FUU A;  1AMP A;  3PRT A;  2F7V A;  2AFW A;  2PJ1 A;  3MN8 A;  4A39 A;  3KQZ A;  2ZOG A;  1XF1 A;  4C8P A;  4AXV A;  3KGQ A;  2PIZ A;  4C99 A;  4C84 A;  3IWW A;  4C8T A;  2PE3 A;  5LYI A;  3D68 A;  2V8D A;  4IK2 A;  4ZX9 A;  3PB7 X;  1AYE A;  4X8I A;  3WC6 A;  3HUV A;  3NH4 A;  3D4U A;  3PFE A;  1H8L A;  1LAN A;  2ANP A;  2BCO A;  4IHM A;  3PBE A;  4OME A;  3SI0 A;  1IGB A;  3VAR A;  4C9E A;  2V8V A;  2PJC A;  2RB7 A;  2C1C A;  4KSI A;  4ZY2 A;  1BLL E;  3LMS A;  4H2K A;  5CPA A;  3PBB A;  2NSM A;  1XBU A;  1DE4 C;  2OOT A;  1GYT A;  3V38 A;  4DJL A;  4F9U A;  3DGV A;  3MRU A;  2ZEH A;  3D7F A;  5HVH A;  2XEJ A;  4MHY A;  4C9A A;  3KHX A;  5LYD A;  4WJB A;  3PEI A;  4FBE A;  2XEG A;  4UEE A;  4NGQ A;  3FF3 A;  1YW4 A;  1Z2L A;  2PJ4 A;  5F09 A;  3WAB A;  3BXM A;  4C8F A;  3RBU A;  1LOK A;  3PFO A;  1R43 A;  5HXD A;  3B2Y A;  3K9T A;  2ZEN A;  1JQG A;  1F2O A;  3PB4 X;  1LAM A;  3ISZ A;  2CTB A;  2ABZ A;  3IC1 A;  3PB6 X;  1CP6 A;  4OIW A;  1XFO A;  3KQX A;  4OC1 A;  2F8H A;  4CPA A;  4DYO A;  3NH8 A;  7CPA A;  5J1Q A;  4MHZ A;  4OC5 A;  3B3T A;  2NYQ A;  2PCU A;  4K3N A;  4A38 A;  1NSA A;  2POK A;  8CPA A;  3CPX A;  1YME A;  1DTD A;  2QYV A;  3GB0 A;  5JGF A;  5LYF A;  2PJ5 A;  1TF9 A;  4FAI A;  1Y0Y A;  4EFD A;  6CPA A;  3D67 A;  4B6Z A;  1LCP A;  2PJ9 A;  2ZEE A;  2Q43 A;  1VHE A;  2IMO A;  1XMB A;  5ELY A;  1VHO A;  2PJB A;  3L2N A;  3BI1 A;  2OR4 A;  1LFW A;  2PJ6 A;  1ELL P;  4P4J A;  4OC0 A;  1Y9Z A;  4P4F A;  4C8U A;  1IY7 A;  3K2K A;  4C85 A;  5K8P A;  1Z8L A;  5D8N A;  2AFS A;  4P44 A;  4PPZ A;  4LQG A;  3SJX A;  3H8G A;  3IFE A;  2ZED A;  4RUH A;  2AFM A;  4YN3 A;  2G9D A;  5HVF A;  2O4H A;  2C6C A;  5LYL A;  4NJQ A;  4NGS A;  2GU2 A;  1F2P A;  3I1U A;  1CP7 A;  2QJ8 A;  1ELM P;  3WC7 A;  4MCP A;  2V77 A;  5THW A;  4NJR A;  3CDX A;  5DS0 A;  3LWU A;  3I74 A;  4NGM A;  1XRY A;  3I6S A;  3NH5 A;  4CDJ A;  4ONW A;  3RAM A;  1Y7E A;  3NA6 A;  2EWB A;  2GLF A;  4EWT A;  4ZY0 A;  1BPM A;  3H8E A;  2JBJ A;  1VIX A;  4JZ0 A;  4OC4 A;  4NGP A;  4O23 A;  1ZG9 A;  3B7I A;  3IEH A;  3SJE A;  4A94 A;  1TKH A;  4P4B A;  3VH9 A;  1ZLI A;  3HLP A;  1HDU A;  3S9M A;  4UEF A;  4Z65 A;  4R7M A;  2PJ0 A;  1PCA A;  3FX6 A;  4MHP A;  4JYW A;  3V7Z A;  2BO9 A;  1CG2 A;  3KZW A;  4PXC A;  3D7H A;  3BI0 A;  2CF4 A;  3IO1 A;  3KL9 A;  1UWY A;  3S9N A;  3KHZ A;  3D7D A;  4TJV A;  1ARL A;  2PJA A;  5K8O A;  2PIY A;  4MCQ A;  3N5F A;  5IB9 A;  2O53 A;  5K8N A;  3D66 A;  4OC2 A;  1FT7 A;  2JBK A;  1HEE A;  2HC9 A;  2WZN A;  2AFX A; 
#chains in the Genus database with same CATH topology
 3SJF A;  4Q36 A;  2P0W A;  2PJ7 A;  3KR5 A;  4KLW A;  5IR2 A;  4G1P A;  2R8V A;  2Z3M A;  4OP4 A;  1LAP A;  2B5G A;  4OID A;  5AG5 A;  4F6A A;  1C3O B;  4C8A A;  3ZNI A;  2C5Q A;  1ZG8 A;  4A95 A;  3NFQ A;  2ZEP A;  2XPL A;  1YK3 A;  2P6G A;  4XPD C;  3T8W A;  1XJO A;  2P6F A;  3I9S A;  4OC3 A;  5G1Z A;  2QML A;  3WR7 A;  4F0Y A;  5D29 A;  4CYN A;  3SI2 A;  4CYQ A;  2VZZ A;  4IAV A;  4TJX A;  2F5I A;  1XEB A;  3FEC A;  2FVG A;  4YFJ A;  2AFO A;  4PK2 A;  1HDQ A;  3VRN A;  1Q2D A;  3JTK A;  4NFR A;  4R6T A;  4Y49 C;  3TC8 A;  2CIJ A;  3EIF A;  5HKY A;  2CY2 A;  2ZEF A;  3KAS A;  5G20 A;  3KI9 A;  4GS4 A;  4ZI6 A;  3D2P A;  3EXN A;  4MBU A;  3R9E A;  2B4D A;  2BL1 A;  3DR8 A;  2BOA A;  1Q2Y A;  3CPA A;  1BAV A;  1CBX A;  4C9R A;  2GRE A;  4MFQ A;  4QUS A;  4AG9 A;  2DLA A;  2FIA A;  4B5O A;  4C8C A;  4M6G A;  3C26 A;  2Y0M A;  4YGO A;  4C2X A;  5LRJ A;  4YRH A;  4C68 A;  4FD4 A;  4HNX B;  5F47 A;  1BO4 A;  1NBW A;  2CTC A;  4UIA A;  2AUM A;  1Z4E A;  4MRI A;  2XEF A;  4WWV A;  3JVN A;  1EE3 P;  4XNH B;  2ZEL A;  1KWM A;  2V8G A;  2PJ8 A;  4RN7 A;  4MI1 A;  4COG A;  3T90 A;  3U1B A;  3F9K C;  1Y9K A;  4P45 A;  1J4J A;  4IF5 A;  4X2T A;  4MFZ A;  3IGR A;  2AFU A;  1JDE A;  3U88 C;  4PV6 A;  5KTD A;  3B3W A;  1Y0R A;  2PR1 A;  1QSR A;  3S9L A;  3FJU A;  4EVY A;  2DIK A;  3OP0 A;  1NXJ A;  3BHX A;  4A37 A;  2OH1 A;  2FXF A;  2Q7B A;  4F9V A;  1KUY A;  3VRQ A;  1M4G A;  1S5K A;  2Z3N A;  2HI6 A;  4EME A;  4Q38 A;  2OZU A;  4ZY1 A;  3B3V A;  1S7N A;  4NSQ A;  1I12 A;  4DUK A;  3G8W A;  3VGO A;  5BWA B;  4YU9 A;  3ZJ0 A;  4UEZ A;  3D8P A;  4JD6 A;  2XEI A;  2C27 A;  4MMO A;  1YVO A;  2R98 A;  3IU2 A;  4PQA A;  4R9M A;  2PQ8 A;  4DNC A;  4E8O A;  4LUA A;  2AUN A;  2PR8 A;  1GGO A;  4A4B A;  1ZLH A;  3GIU A;  1YX0 A;  1DIK A;  3D7G A;  4BBH A;  3IIB A;  3ZZI A;  1ZO0 A;  4M6I A;  4MY0 A;  1QMU A;  2Q4Z A;  3PGP A;  3VWD A;  4CGN A;  4PSX A;  2I3C A;  4B11 A;  2GE3 A;  3B35 A;  3FXT A;  3VAT A;  4OKO A;  4U5Y A;  2WYR A;  2JEV A;  3RYO A;  4NF1 A;  1RTQ A;  2ZEO A;  2Y1N A;  1KUV A;  4I49 A;  2EK9 A;  2G3A A;  4HPS A;  4U9Y A;  4A32 A;  4QBJ A;  4OLL A;  2REF A;  2J9A A;  1R3N A;  2VZY A;  2PRQ A;  2R7H A;  2RFH A;  2ZEM A;  4XPK A;  4ZX8 A;  2GP4 A;  1VKC A;  5G21 A;  2REE A;  2C6G A;  2V8H A;  2CNT A;  1C30 B;  1CX8 A;  4TWE A;  3SI1 A;  5JH9 A;  4AVA A;  1QST A;  5LRG A;  4LX9 A;  4W9Y A;  2P6E A;  3OAK A;  1WK4 A;  4UF4 A;  3NE7 A;  3TLG B;  1QSM A;  4PXB A;  2Q4Y A;  3WC5 A;  3IJ3 A;  3OB2 B;  2PVV A;  3W6S A;  1CM0 A;  4NGN A;  3WT4 A;  4BD9 A;  1ARM A;  2PSW A;  4PK3 A;  3ISX A;  2A4N A;  4MCR A;  2I00 A;  1IU8 A;  3TLC A;  1TKF A;  4X5K A;  4RI1 A;  5AG7 A;  4JWP A;  3GY9 A;  3TX8 A;  2QVP A;  1EZB A;  2QIR A;  1Z9E A;  2WPW A;  2X0S A;  3B3C A;  4CGP A;  3JRU A;  2Q04 A;  2RC4 A;  3PZJ A;  4B5P B;  3FED A;  3BUO B;  4KOV A;  1FNO A;  4MFL A;  3PB9 X;  2N3A B;  1KZF A;  3BUW B;  3B8G A;  3CT9 A;  4NGR A;  1XF8 A;  4K30 A;  5IX3 A;  5IB0 A;  5J8C A;  1SQH A;  4A31 A;  2PDO A;  2B4J C;  5J3X A;  2PJ3 A;  3B3S A;  3QNV A;  1S60 A;  2YNC C;  4B12 A;  4C86 A;  5LRK A;  4INJ A;  2IQ6 A;  3R9F A;  2PC1 A;  3H4Q A;  2FSR A;  4P4I A;  2VL1 A;  4B10 A;  1OBR A;  4KUA A;  3GUX A;  4R8F A;  4R76 A;  2C6P A;  5EMI A;  3KKW A;  2Z3K A;  3H8F A;  4FWU A;  3VRO A;  1TF8 A;  4M85 A;  4P4E A;  1I1D A;  1K4J A;  4UWJ A;  4CAV A;  2Q4V A;  4IIX A;  5FD8 A;  4AB7 A;  2ZOF A;  4CGO A;  5JPH A;  4P6Y A;  1F57 A;  3BUX B;  2PJ2 A;  3EY5 A;  3RZA A;  1VBG A;  1WVM A;  4KVX A;  1CPX A;  1YSJ A;  4UIB A;  1I21 A;  1MK4 A;  2FS5 A;  1PYT B;  3NFZ A;  2GFQ A;  1KEE B;  4CDK A;  1S3Z A;  2EO8 A;  3CXP A;  3DNS A;  2Q0Y A;  2EK8 A;  3QAH A;  2DPT A;  4NCZ A;  1MJA A;  4TNU A;  3TTH A;  5CNP A;  2R1I A;  4Q7A A;  3BUN B;  3VRR A;  1ZRS A;  3GJZ A;  5F48 A;  2FL4 A;  5I4M A;  3FVL A;  1BPN A;  2JEW A;  2GLJ A;  2XPP A;  1M4L A;  3PB8 X;  2ARH A;  3OWC A;  4J3G A;  4BPX B;  3CXS A;  1Z9U A;  3FH4 A;  5DWM A;  5F5X A;  4BTF A;  1QQ9 A;  1ZG7 A;  2PVW A;  2Q44 A;  2XPO A;  1Q7L A;  2VQY A;  4F8Z A;  1YW6 A;  4ZYQ A;  1TXR A;  4CAW A;  1Y7R A;  3DSB A;  2Q51 A;  5HVG A;  3T05 A;  4P10 A;  2DEA A;  5JM6 A;  3C8O A;  2OZG A;  3CZX A;  1PUA A;  1UFH A;  2Y1M A;  3DLJ A;  5H84 A;  5F46 A;  4P4D A;  1P4N A;  1OZP A;  4KZT A;  4PXD A;  3SXN A;  1Z4R A;  1Z5R A;  2ZEG A;  3FYN A;  3FEE A;  1IIC A;  4A2Z A;  1YVK A;  1B47 A;  4XNH C;  3FIX A;  2AJ6 A;  2B3U A;  4JXR A;  3TOB A;  4C9U A;  5FVJ A;  1VGY A;  3GLJ A;  2EZB A;  1CPS A;  3SJG A;  3S6K A;  3I3G A;  2YNE A;  3VTA A;  2ZW6 A;  4MXU A;  3SHP A;  4PXE A;  2IJZ A;  4PSW A;  4C9V A;  3G23 A;  5AGE A;  4NGT A;  3R96 A;  2ZW4 A;  4H6Z A;  2B5G B;  1TKJ A;  5JYB A;  4X3R A;  4KOR A;  3KR4 A;  4KNG E;  3BJ7 A;  1A2Z A;  2AFZ A;  3FMC A;  4MCS A;  2D4O A;  2EUI A;  3RO0 A;  3SR3 A;  3S6H A;  1YLO A;  3ICU A;  5K8M A;  4M6H A;  3EO4 A;  4GM5 A;  4BPU B;  2HV2 A;  1V6C A;  1YVH A;  5CBM A;  4MHN A;  4JVO A;  2HB6 A;  3A9L A;  4YWY A;  4FUU A;  1Q2C A;  4CRZ B;  1AMP A;  3PRT A;  2F7V A;  1YGH A;  2AFW A;  4JLY A;  4FD6 A;  2PJ1 A;  3MN8 A;  3BJ8 A;  2CXA A;  2QEC A;  2B4B A;  2VBQ A;  1NSL A;  3TOA A;  4A39 A;  2B4D B;  2NMT A;  2ZOG A;  3KQZ A;  3RNZ A;  4CZ1 A;  1XF1 A;  4C8P A;  4AXV A;  1Z8X A;  3KGQ A;  5HKW A;  3W6X A;  2PIZ A;  4MI4 A;  2EZA A;  4C99 A;  4C84 A;  5JVL A;  3IWW A;  1VI4 A;  5C88 A;  1CE8 B;  4EYS A;  4C8T A;  1NE9 A;  2PE3 A;  5LYI A;  2VXK A;  3TT2 A;  2WPX A;  3D68 A;  2V8D A;  3EZB A;  1WWZ A;  4AVB A;  4IK2 A;  1M4I A;  4ZX9 A;  3PB7 X;  1JWQ A;  2YND A;  1AYE A;  3IWG A;  4X8I A;  1M44 A;  3WC6 A;  1YRE A;  3NOJ A;  2CBL A;  3HUV A;  1FY7 A;  2HUZ A;  3NH4 A;  4B13 A;  3TLB A;  1ZYM A;  4NXY A;  3D4U A;  2JDC A;  1YR0 A;  4H89 A;  4KUB A;  2EZC A;  2HRO A;  5F1Y A;  3PFE A;  4OAD A;  4KOX A;  1H8L A;  1LAN A;  2ANP A;  2BCO A;  3TLE A;  4IHM A;  3TO9 A;  3PBE A;  5HKZ A;  4OME A;  2YJT A;  3SI0 A;  1IGB A;  3TO7 A;  3VAR A;  4C9E A;  4H1H A;  2V8V A;  2PJC A;  2JLM A;  2RB7 A;  4U9Z A;  4C2Z A;  2YNC A;  2C1C A;  4KSI A;  3E0K A;  5G22 A;  4ZY2 A;  3EFA A;  1BLL E;  1CS0 B;  2B0A A;  1IYK A;  1B87 A;  3IWE A;  3LMS A;  4H2K A;  4KOU A;  5CPA A;  3PBB A;  4KOS A;  4C2Y A;  2NSM A;  1XBU A;  4J0N A;  1DE4 C;  2OOT A;  1GYT A;  3V38 A;  4DJL A;  4CGM A;  4F9U A;  3DGV A;  2AE6 A;  3MRU A;  3FNC A;  4KVO E;  4E2A A;  1M1D A;  2ZEH A;  3D7F A;  3EC4 A;  5HVH A;  2XEJ A;  4KLV A;  4MHY A;  3KHX A;  4C9A A;  5LYD A;  4WJB A;  3PEI A;  5EC4 A;  1BOB A;  3JUW A;  3GKR A;  5AG6 A;  4FBE A;  2XEG A;  4UEE A;  2YJV A;  4NGQ A;  3FF3 A;  1RXT A;  1YW4 A;  3F8K A;  4JXQ A;  1Z2L A;  2PJ4 A;  2PRB A;  5F09 A;  3WAB A;  3BXM A;  3G3S A;  3S6F A;  4C8F A;  3RBU A;  2ZXV A;  1VBH A;  1LOK A;  3PFO A;  1R43 A;  4QC6 A;  4F0X A;  5HXD A;  2J8R A;  3B2Y A;  1Y9W A;  3K9T A;  3VRP A;  5EBV A;  4A33 A;  5AG4 A;  1CJW A;  2JDD A;  2ZEN A;  1JQG A;  3SXO A;  1F2O A;  2G0B A;  3PB4 X;  5I0C A;  1NMT A;  4UA3 A;  1LAM A;  2DXQ A;  3ISZ A;  2CTB A;  2ZW5 A;  4MJX A;  2ABZ A;  3IC1 A;  3PB6 X;  1CP6 A;  4OIW A;  1XFO A;  4FD7 A;  5ISV A;  1J3L A;  3KQX A;  4OC1 A;  5F9M A;  1R57 A;  2J8N A;  1EO0 A;  2F8H A;  4CPA A;  2XPN A;  2H5M A;  1M4D A;  4DYO A;  4CAF A;  3LAC A;  3PP9 A;  3NH8 A;  4R87 A;  2FT0 A;  7CPA A;  4LQ6 A;  3DR6 A;  5J1Q A;  1FBV A;  4MHZ A;  4ONU A;  1IOF A;  2BUE A;  3FB3 A;  4HNW B;  4OC5 A;  4M3S A;  4E0A A;  3B3T A;  1X12 A;  4KOW A;  5E96 A;  3QB8 A;  2NYQ A;  2PCU A;  3P2F A;  2B58 A;  4K3N A;  2PCN A;  4A38 A;  3FBU A;  3UY5 A;  1NSA A;  2J8M A;  3R95 A;  1AUG A;  2POK A;  4XPL A;  8CPA A;  4COB A;  2Z3P A;  3F5B A;  1M6V B;  3CPX A;  3TCV A;  4MFK A;  4ZBG A;  1YME A;  3O8Z A;  1DTD A;  2QYV A;  3GB0 A;  5JGF A;  5A28 A;  1IYL A;  3GYA A;  2G3T A;  2CNS A;  1IID A;  1ON0 A;  2VKZ G;  2PJ5 A;  3D3S A;  3QAY A;  3VWE A;  2OZH A;  3TYX A;  3F0A A;  1IOI A;  4XPD B;  3EZA A;  1TF9 A;  4FAI A;  1S7F A;  1YLE A;  1Y0Y A;  3NE8 A;  4EFD A;  6CPA A;  3D67 A;  4NEX A;  2OB0 A;  4A4C A;  1LCP A;  2PJ9 A;  2ZEE A;  4ORF A;  4B6Z A;  4CS0 B;  2Q43 A;  1VHE A;  3T5M A;  3P2H A;  4Y49 B;  4HKF A;  2D4P A;  2IMO A;  3S6G A;  2E28 A;  1XMB A;  2VEZ A;  2Z0Z A;  2HWG A;  2ATR A;  2O28 A;  5ELY A;  1R61 A;  1VHO A;  3BI1 A;  2PJB A;  3L2N A;  1Q5X A;  3TLY A;  4UFV A;  2OR4 A;  4QVT A;  3TLA A;  2FE7 A;  1L0C A;  1LFW A;  3CXQ A;  2PJ6 A;  2UV8 G;  3LOD A;  5J8F A;  1ELL P;  1U6M A;  1Z8W A;  4R3K A;  2R82 A;  4P4J A;  4CAX A;  5H86 A;  4OC0 A;  1Y9Z A;  4P4F A;  4C8U A;  1RO5 A;  3V8I A;  2HQY A;  1IY7 A;  1V0C A;  3K2K A;  2B3V A;  4CRY B;  4C85 A;  4RR2 B;  5K8P A;  2FM4 A;  3HMJ G;  3OB1 B;  2IL4 A;  3FRM A;  1Z8T A;  4CGL A;  1A9X B;  1Z8L A;  5D8N A;  4CAE A;  2AFS A;  4P44 A;  4PPZ A;  2MP0 A;  1S7L A;  4KOT A;  4LQG A;  1XIX A;  3KRV A;  3SJX A;  2Z11 A;  2OU2 A;  4UCM A;  4MFJ A;  2FIW A;  3PT1 A;  2ODF A;  2DPS A;  2BSW A;  4UWI A;  4AG7 A;  2KCW A;  3H8G A;  3IFE A;  3TLG A;  2ZED A;  4RUH A;  2AFM A;  1IB1 E;  2WSA A;  4YN3 A;  3W91 A;  2G9D A;  5HVF A;  2FCK A;  2O4H A;  2C6C A;  4AVC A;  5LYL A;  4NJQ A;  4NGS A;  4BPW B;  5GCN A;  2GU2 A;  4H6U A;  4HNY B;  3PLF B;  1MJ9 A;  1F2P A;  3I1U A;  4C7H A;  1MJB A;  4CYO A;  1CP7 A;  2QJ8 A;  3TFY A;  3PFV A;  3BUM B;  1EZA A;  3K4I A;  2OLS A;  1ELM P;  3TE4 A;  1JDB C;  3WC7 A;  4IUS A;  4MCP A;  1PU9 A;  3BLN A;  2EVN A;  5F49 A;  2D0O A;  4B5P A;  1WJT A;  2V77 A;  5THW A;  4NJR A;  5HH1 A;  4ZGY B;  3EZE A;  3CDX A;  5DS0 A;  3LWU A;  5C82 A;  4A30 A;  2D0P A;  3I74 A;  4NGM A;  1XMT A;  1XRY A;  3D2M A;  4GXH A;  4RS2 A;  4UCN A;  3I6S A;  5JQ4 A;  3NH5 A;  1N71 A;  3H5Z A;  4CDJ A;  4UCP A;  4ONW A;  4UBR A;  2DF5 A;  3T07 A;  4BIN A;  4UFX A;  2Z3O A;  3TO6 A;  2YGW A;  3RAM A;  5BY0 A;  2Z3L A;  2BEI A;  4MY3 A;  1Y7E A;  2Z10 A;  3NA6 A;  2EWB A;  2GAN A;  2GLF A;  4IIY A;  4L8A A;  4EWT A;  1KBL A;  4R3L A;  4QB9 A;  2K5T A;  1KUX A;  4MHD A;  4ZY0 A;  4OAE A;  1BPM A;  3H8E A;  3R1K A;  3N7Z A;  2JBJ A;  1VIX A;  4JZ0 A;  4OC4 A;  4NGP A;  2VI7 A;  3IU1 A;  4O23 A;  1TIQ A;  1ZG9 A;  3HPH E;  3T0T A;  2CNM A;  1X10 A;  1S7K A;  3B7I A;  3IEH A;  5F13 A;  4JJX A;  4L89 A;  4KSF A;  4BMH A;  4R57 A;  5A27 A;  4II9 A;  3SJE A;  4A94 A;  1TKH A;  4P4B A;  4MFP A;  1ZLI A;  3VH9 A;  4E5S A;  1B6B A;  4KS9 A;  5LYF A;  2ZW7 A;  2X7B A;  1P0H A;  4E94 A;  2ZPA A;  3T9Y A;  5IV0 A;  1KC7 A;  3HLP A;  1VHS A;  4GPL B;  3S9M A;  1HDU A;  4UEF A;  4R7M A;  4Z65 A;  3DDD A;  1QSN A;  1PCA A;  1QSO A;  2PJ0 A;  3FX6 A;  4JYW A;  4MHP A;  3R9G A;  3V7Z A;  2BO9 A;  1CG2 A;  2EBJ A;  3LD2 A;  3KZW A;  4CO9 A;  4PXC A;  3D7H A;  4M8D A;  3BI0 A;  2GIV A;  2I79 A;  2Q7S A;  5DWN A;  4KVM E;  1T36 B;  2CF4 A;  1ZL0 A;  3IO1 A;  5AXI A;  3TLZ A;  3KL9 A;  1YQE A;  1XOV A;  1UWY A;  1XE4 A;  3S9N A;  1LRZ A;  4FD5 A;  3KHZ A;  3D7D A;  1GHE A;  1ARL A;  2PJA A;  2WUU A;  5K8O A;  2PIY A;  4TJV A;  5KTC A;  4MCQ A;  3N5F A;  5IB9 A;  2O53 A;  4B14 A;  3HPG G;  3D66 A;  5K8N A;  4OC2 A;  4MJ8 A;  4C7I A;  1FT7 A;  4CYP A;  2JBK A;  1HEE A;  3MGD A;  4KSA A;  5K99 A;  3K9U A;  2HC9 A;  1BXR B;  4KOY A;  2WZN A;  5HMN A;  4UFW A;  2AFX A;  5KTA A; 
#chains in the Genus database with same CATH homology
 3SJF A;  2PJ7 A;  3KR5 A;  5IR2 A;  4G1P A;  4OP4 A;  1LAP A;  4OID A;  4C8A A;  2C5Q A;  1ZG8 A;  2ZEP A;  3T8W A;  1XJO A;  4OC3 A;  5D29 A;  3SI2 A;  4IAV A;  4TJX A;  3FEC A;  2FVG A;  2AFO A;  1HDQ A;  4NFR A;  4R6T A;  3TC8 A;  2CIJ A;  3EIF A;  2ZEF A;  3KAS A;  3KI9 A;  4ZI6 A;  2BOA A;  3CPA A;  1BAV A;  1CBX A;  4C9R A;  2GRE A;  4C8C A;  5LRJ A;  2CTC A;  4UIA A;  4MRI A;  4WWV A;  2XEF A;  1EE3 P;  2ZEL A;  1KWM A;  2V8G A;  2PJ8 A;  4P45 A;  4X2T A;  2AFU A;  3B3W A;  1Y0R A;  3FJU A;  3S9L A;  3BHX A;  4A37 A;  4F9V A;  4EME A;  4ZY1 A;  3B3V A;  4DUK A;  4YU9 A;  4UEZ A;  2XEI A;  4MMO A;  4PQA A;  1ZLH A;  3D7G A;  3IIB A;  1QMU A;  2Q4Z A;  2I3C A;  3VAT A;  3B35 A;  4OKO A;  2WYR A;  1RTQ A;  2ZEO A;  2EK9 A;  2J9A A;  1R3N A;  2PRQ A;  4ZX8 A;  2RFH A;  2ZEM A;  2GP4 A;  2V8H A;  2C6G A;  1CX8 A;  4TWE A;  3SI1 A;  5JH9 A;  5LRG A;  4W9Y A;  4UF4 A;  4PXB A;  3WC5 A;  3IJ3 A;  2PVV A;  4NGN A;  3WT4 A;  4BD9 A;  1ARM A;  3ISX A;  4MCR A;  1TKF A;  3TX8 A;  2QVP A;  3B3C A;  3JRU A;  3FED A;  1FNO A;  3PB9 X;  3CT9 A;  4NGR A;  2PJ3 A;  3B3S A;  3QNV A;  4C86 A;  5LRK A;  2IQ6 A;  4P4I A;  2VL1 A;  1OBR A;  3GUX A;  4R8F A;  4R76 A;  2C6P A;  3H8F A;  4FWU A;  1TF8 A;  4P4E A;  2ZOF A;  4P6Y A;  1F57 A;  2PJ2 A;  3RZA A;  1WVM A;  1CPX A;  1YSJ A;  4UIB A;  1PYT B;  3NFZ A;  4CDK A;  2EK8 A;  4TNU A;  4Q7A A;  5I4M A;  3FVL A;  1BPN A;  2JEW A;  2GLJ A;  1M4L A;  4C9V A;  3PB8 X;  3FH4 A;  1QQ9 A;  1ZG7 A;  2PVW A;  1Q7L A;  4F8Z A;  4ZYQ A;  1YW6 A;  1TXR A;  2Q51 A;  5HVG A;  4P10 A;  2DEA A;  5JM6 A;  3DLJ A;  4P4D A;  4PXD A;  1Z5R A;  2ZEG A;  3FEE A;  4C9U A;  1VGY A;  3GLJ A;  1CPS A;  3SJG A;  3VTA A;  4MXU A;  4PXE A;  2IJZ A;  4NGT A;  1TKJ A;  4X3R A;  3KR4 A;  4KNG E;  2AFZ A;  3FMC A;  4MCS A;  1YLO A;  3ICU A;  5K8M A;  4GM5 A;  1V6C A;  5CBM A;  4MHN A;  2HB6 A;  4YWY A;  4FUU A;  1AMP A;  3PRT A;  2F7V A;  2AFW A;  2PJ1 A;  3MN8 A;  4A39 A;  3KQZ A;  2ZOG A;  1XF1 A;  4C8P A;  4AXV A;  3KGQ A;  2PIZ A;  4C99 A;  4C84 A;  3IWW A;  4C8T A;  2PE3 A;  5LYI A;  3D68 A;  2V8D A;  4IK2 A;  4ZX9 A;  3PB7 X;  1AYE A;  4X8I A;  3WC6 A;  3HUV A;  3NH4 A;  3D4U A;  3PFE A;  1H8L A;  1LAN A;  2ANP A;  2BCO A;  4IHM A;  3PBE A;  4OME A;  3SI0 A;  1IGB A;  3VAR A;  4C9E A;  2V8V A;  2PJC A;  2RB7 A;  2C1C A;  4KSI A;  4ZY2 A;  1BLL E;  3LMS A;  4H2K A;  5CPA A;  3PBB A;  2NSM A;  1XBU A;  1DE4 C;  2OOT A;  1GYT A;  3V38 A;  4DJL A;  4F9U A;  3DGV A;  3MRU A;  2ZEH A;  3D7F A;  5HVH A;  2XEJ A;  4MHY A;  4C9A A;  3KHX A;  5LYD A;  4WJB A;  3PEI A;  4FBE A;  2XEG A;  4UEE A;  4NGQ A;  3FF3 A;  1YW4 A;  1Z2L A;  2PJ4 A;  5F09 A;  3WAB A;  3BXM A;  4C8F A;  3RBU A;  1LOK A;  3PFO A;  1R43 A;  5HXD A;  3B2Y A;  3K9T A;  2ZEN A;  1JQG A;  1F2O A;  3PB4 X;  1LAM A;  3ISZ A;  2CTB A;  2ABZ A;  3IC1 A;  3PB6 X;  1CP6 A;  4OIW A;  1XFO A;  3KQX A;  4OC1 A;  2F8H A;  4CPA A;  4DYO A;  3NH8 A;  7CPA A;  5J1Q A;  4MHZ A;  4OC5 A;  3B3T A;  2NYQ A;  2PCU A;  4K3N A;  4A38 A;  1NSA A;  2POK A;  8CPA A;  3CPX A;  1YME A;  1DTD A;  2QYV A;  3GB0 A;  5JGF A;  5LYF A;  2PJ5 A;  1TF9 A;  4FAI A;  1Y0Y A;  4EFD A;  6CPA A;  3D67 A;  4B6Z A;  1LCP A;  2PJ9 A;  2ZEE A;  2Q43 A;  1VHE A;  2IMO A;  1XMB A;  5ELY A;  1VHO A;  2PJB A;  3L2N A;  3BI1 A;  2OR4 A;  1LFW A;  2PJ6 A;  1ELL P;  4P4J A;  4OC0 A;  1Y9Z A;  4P4F A;  4C8U A;  1IY7 A;  3K2K A;  4C85 A;  5K8P A;  1Z8L A;  5D8N A;  2AFS A;  4P44 A;  4PPZ A;  4LQG A;  3SJX A;  3H8G A;  3IFE A;  2ZED A;  4RUH A;  2AFM A;  4YN3 A;  2G9D A;  5HVF A;  2O4H A;  2C6C A;  5LYL A;  4NJQ A;  4NGS A;  2GU2 A;  1F2P A;  3I1U A;  1CP7 A;  2QJ8 A;  1ELM P;  3WC7 A;  4MCP A;  2V77 A;  5THW A;  4NJR A;  3CDX A;  5DS0 A;  3LWU A;  3I74 A;  4NGM A;  1XRY A;  3I6S A;  3NH5 A;  4CDJ A;  4ONW A;  3RAM A;  1Y7E A;  3NA6 A;  2EWB A;  2GLF A;  4EWT A;  4ZY0 A;  1BPM A;  3H8E A;  2JBJ A;  1VIX A;  4JZ0 A;  4OC4 A;  4NGP A;  4O23 A;  1ZG9 A;  3B7I A;  3IEH A;  3SJE A;  4A94 A;  1TKH A;  4P4B A;  3VH9 A;  1ZLI A;  3HLP A;  1HDU A;  3S9M A;  4UEF A;  4Z65 A;  4R7M A;  2PJ0 A;  1PCA A;  3FX6 A;  4MHP A;  4JYW A;  3V7Z A;  2BO9 A;  1CG2 A;  3KZW A;  4PXC A;  3D7H A;  3BI0 A;  2CF4 A;  3IO1 A;  3KL9 A;  1UWY A;  3S9N A;  3KHZ A;  3D7D A;  4TJV A;  1ARL A;  2PJA A;  5K8O A;  2PIY A;  4MCQ A;  3N5F A;  5IB9 A;  2O53 A;  5K8N A;  3D66 A;  4OC2 A;  1FT7 A;  2JBK A;  1HEE A;  2HC9 A;  2WZN A;  2AFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...