2XEIA

Human glutamate carboxypeptidase ii in complex with antibody- recruiting molecule arm-p2
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title A Remote Arene-Binding Site on Prostate Specific Membrane Antigen Revealed by Antibody-Recruiting Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 264
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2xeiA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2xeiA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2xeiA02
3SI2A 3KGQA 5JGFA 1AYEA 3FEEA 3I74A 1XRYA 2ZOFA 4LQGA 2QVPA 2GLFA 4WWVA 1JQGA 4MHZA 1NSAA 1IGBA 4OC0A 1HEEA 3LWUA 1R3NA 1V6CA 3HUVA 3D7HA 3B7IA 4F9VA 4C9EA 1H8LA 5D8NA 2Q43A 2F8HA 3H8FA 2NYQA 5LRKA 4YU9A 3D66A 3PFEA 5LRGA 3SI1A 3ICUA 3B35A 1FNOA 5CBMA 2RFHA 2PJ9A 4AXVA 1YLOA 1ZG7A 2EK8A 3S9LA 2RB7A 2ZENA 2PRQA 4OC3A 3SI0A 3IJ3A 4PQAA 3D7DA 3BI0A 1PYTB 3KHZA 5LYIA 4FBEA 7CPAA 3FEDA 1Y9ZA 3PFOA 2DEAA 2ZEHA 3NA6A 2PCUA 4P4DA 2J9AA 1VHEA 1ARLA 3PB7X 3JRUA 3B2YA 3FVLA 5K8MA 1Z2LA 5CPAA 2AFWA 2PJ0A 5I4MA 4JYWA 2ZEMA 4C9UA 2IMOA 2PJ6A 1R43A 3FMCA 5IB9A 3KI9A 1GYTA 1ELMP 5K8OA 2ZEDA 4Q7AA 2V8DA 4C9RA 4P44A 2PJ5A 2PVWA 4A38A 2VL1A 3DGVA 4MCRA 3B3VA 2F7VA 4P10A 1M4LA 5JH9A 1KWMA 4C99A 3LMSA 4P4FA 3PB9X 2GLJA 1TF8A 4EMEA 3NH4A 1CPSA 4IAVA 1VHOA 2BOAA 5F09A 3B3SA 2JBKA 3RZAA 3V7ZA 2IJZA 3PB6X 4R7MA 4OC4A 3CPAA 3SJGA 3CDXA 4C84A 2XEJA 2ZEFA 3KR5A 2ABZA 4GM5A 4MCQA 4MMOA 3WT4A 4ZY1A 4C8CA 3CT9A 4ONWA 2PJBA 3WC7A 2V77A 2CTCA 2WYRA 3SJXA 4NGTA 5LYLA 4TJVA 1EE3P 1OBRA 4NJQA 1ARMA 3ISXA 2WZNA 3WABA 1LAMA 1CG2A 4C8TA 3GUXA 4OC5A 3VATA 2AFXA 2PJ3A 2PJ8A 4X2TA 4R8FA 4DYOA 2I3CA 1ZG8A 3FH4A 5HVHA 2JEWA 2V8GA 1RTQA 2ZEOA 1ELLP 4MCPA 3D7GA 4DJLA 4MXUA 3NFZA 4UEFA 4R76A 4OP4A 2PJCA 3KASA 3ISZA 4FWUA 1XBUA 3B3WA 4C8UA 2C6GA 1F57A 2EWBA 4ZY2A 4G1PA 3PRTA 4TNUA 3FECA 3KQXA 4P45A 2C6CA 3BXMA 1LCPA 1BPNA 2JBJA 4NGNA 3SJEA 5HXDA 4NGRA 2O53A 2CIJA 1XFOA 1DE4C 4UIAA 2V8HA 2AFSA 3RAMA 4P4JA 1YMEA 1TKHA 4UEEA 4K3NA 1Z8LA 2QYVA 2XEGA 5HVGA 1CP6A 3RBUA 4P6YA 4NGQA 4H2KA 4IK2A 1ZLHA 3H8GA 1XMBA 2XEFA 3S9NA 2G9DA 3I1UA 3FF3A 4O23A 2ZEPA 3BI1A 2POKA 4X8IA 3WC6A 3PEIA 5LYDA 3KL9A 3GB0A 4IHMA 3T8WA 4C9AA 4OMEA 4OIDA 4PXDA 2XEIA 3KQZA 4NGPA 2NSMA 4C9VA 1QQ9A 5K8NA 5D29A 4A37A 2ZOGA 4MRIA 1LAPA 4RUHA 4FUUA 2V8VA 4TWEA 4EWTA 4R6TA 1XF1A 4TJXA 4ZI6A 4C8AA 4CPAA 4UIBA 4BD9A 3EIFA 2AFUA 4ZYQA 2CF4A 1UWYA 1YW4A 3PBBA 2PIYA 3VARA 2Q51A 1AMPA 5HVFA 4A39A 3IFEA 3V38A 1YSJA 3VH9A 1BAVA 2ZELA 4A94A 4OC2A 3H8EA 2BO9A 5ELYA 3VTAA 4F9UA 4OKOA 4MHNA 3IO1A 1Y0YA 3IIBA 1PCAA 3K2KA 5JM6A 1WVMA 2OOTA 4OIWA 4F8ZA 3KHXA 3MN8A 2CTBA 1TKJA 1Q7LA 2PJ4A 1Z5RA 1LFWA 3FX6A 2ZEGA 1TKFA 4MHPA 1Y7EA 3D7FA 3DLJA 5J1QA 3BHXA 4KNGE 4B6ZA 4P4EA 4NGMA 3HLPA 2C1CA 4CDJA 4UF4A 2PE3A 5K8PA 4NGSA 2O4HA 1VGYA 2AFZA 4W9YA 4YWYA 3IC1A 3D68A 1TXRA 2PIZA 4C8FA 4UEZA 4YN3A 4P4BA 1HDUA 2AFMA 3PB8X 4C8PA 3TC8A 4Z65A 4ZY0A 2QJ8A 1BPMA 4C85A 4PXBA 4PXCA 1CX8A 1HDQA 2ANPA 4JZ0A 4DUKA 4PXEA 8CPAA 3QNVA 4NJRA 3CPXA 3IWWA 3K9TA 3GLJA 5DS0A 4ZX8A 2ZEEA 2FVGA 5LRJA 4ZX9A 4KSIA 3D67A 1F2PA 4WJBA 3TX8A 3WC5A 1XJOA 3B3CA 4MHYA 3L2NA 1Y0RA 3MRUA 3NH8A 2Q4ZA 3PBEA 2PJ7A 4CDKA 2HB6A 4C86A 3S9MA 1FT7A 4OC1A 3NH5A 1CP7A 3KR4A 1TF9A 4PPZA 3N5FA 1IY7A 1LOKA 2IQ6A 4EFDA 1VIXA 2PJ1A 2C6PA 2GREA 1YW6A 2PJAA 1CBXA 3IEHA 3PB4X 3B3TA 2AFOA 3D4UA 2BCOA 4X3RA 2PVVA 2GU2A 1QMUA 2OR4A 2PJ2A 2HC9A 4P4IA 5THWA 2EK9A 3SJFA 1DTDA 1F2OA 6CPAA 4MCSA 3FJUA 1ZLIA 1CPXA 1ZG9A 4NFRA 4FAIA 5LYFA 3KZWA 1BLLE 1LANA 3I6SA
chains in the Genus database with same CATH superfamily
2B3UA 3SI2A 5ISVA 3KGQA 4C2ZA 4ZBGA 1Y7RA 2D0OA 5JGFA 4CAVA 1AYEA 3UY5A 3BLNA 5LRKA 1Q2DA 1MJ9A 1IB1E 5KTAA 3FEEA 2F5IA 2CBLA 1R61A 3I74A 3W6SA 1YVOA 2P6FA 3IWEA 2B4JC 4EYSA 1XOVA 1YX0A 2IL4A 4QC6A 5JYBA 3EZEA 1XRYA 2ZOFA 1I21A 4CGNA 1RXTA 1EZAA 2FT0A 4LQGA 2FE7A 2CXAA 2GLFA 2QVPA 4HPSA 4WWVA 1JQGA 3VGOA 1J3LA 2B5GA 1JDBC 4MHZA 2PRBA 1NSAA 1IGBA 4OC0A 1HEEA 3LWUA 1R3NA 2Z3MA 4MFKA 5J8CA 3O8ZA 1KC7A 3FIXA 1V6CA 3HUVA 1Q5XA 1NMTA 4NSQA 3EZAA 4KOYA 5F47A 3BUOB 1Z8WA 3D7HA 3B7IA 1XMTA 3I3GA 2DF5A 3I9SA 4F9VA 1M44A 3TFYA 4C9EA 1H8LA 5D8NA 4R57A 1YGHA 2R8VA 2Q43A 2F8HA 4JWPA 3F0AA 3TCVA 1QSOA 3H8FA 5I0CA 4E8OA 3D2PA 2EZCA 2NYQA 4KLVA 1Q2CA 4YU9A 5F49A 3LODA 3D66A 3E0KA 3PFEA 5G22A 5LRGA 4R3KA 3SI1A 4AVAA 3ICUA 5BY0A 1S5KA 2RC4A 1FNOA 3B35A 2ZW6A 3DNSA 4JXQA 2RFHA 5CBMA 2PJ9A 4AXVA 1TIQA 1YLOA 1S60A 1ZG7A 3S9LA 2EK8A 2RB7A 2ZENA 4CAEA 4MHDA 4CRZB 4KOWA 2PRQA 4OC3A 3SI0A 4CYQA 4AB7A 1VKCA 3PT1A 1P4NA 5EC4A 5C82A 4IIYA 3IJ3A 2EO8A 1XIXA 4PV6A 4PQAA 2R82A 3G8WA 4Y49C 3D7DA 5CNPA 4IUSA 3CZXA 4YRHA 1MK4A 5E96A 2P0WA 3BI0A 2REEA 1PYTB 2GIVA 5DWNA 5F48A 3TT2A 3KHZA 4KVME 5LYIA 3SR3A 4M3SA 4DNCA 4FBEA 1XE4A 4H6UA 7CPAA 3EXNA 3FEDA 2WSAA 1YVKA 4HKFA 4C2XA 4EVYA 1Y9ZA 3PFOA 1K4JA 1Z9EA 2DEAA 2ODFA 2ZEHA 4R87A 4AG7A 3NA6A 2PCUA 4P4DA 1MJAA 1VHEA 2J9AA 2OH1A 4U9YA 1YREA 1ARLA 1NXJA 4B12A 3TO6A 1B6BA 3PB7X 4CDJA 3JRUA 3PFVA 3B2YA 3FVLA 5K8MA 4BPWB 1Z2LA 5J3XA 3TE4A 5CPAA 2AFWA 2PJ0A 3SXOA 5I4MA 3FB3A 4JYWA 4A31A 3WC6A 2MP0A 5F1YA 2ZEMA 4C9UA 2IMOA 3TO7A 1YVHA 2PJ6A 1R43A 1ON0A 4BPUB 4UBRA 2Z3PA 2N3AB 5DWMA 4PK3A 3FMCA 1GHEA 5IB9A 2ZW4A 1GYTA 3KI9A 1ELMP 4AVCA 1Z8XA 1SQHA 2Z0ZA 5K8OA 4MBUA 2ZEDA 2VI7A 4Q7AA 2V8DA 4C9RA 4P44A 2OZGA 2DPSA 2VZYA 2PJ5A 4FD6A 4HNYB 4KOTA 2Q7BA 1M6VB 1ZRSA 4CZ1A 2OLSA 2PVWA 4BTFA 3RYOA 4A38A 4CGLA 3PGPA 2VL1A 3DGVA 4MCRA 3B3VA 2F7VA 2XPOA 4P10A 1M4LA 5JH9A 2X0SA 4KOSA 1B87A 4QVTA 4C68A 4INJA 3R9GA 3GY9A 1KZFA 1KWMA 4C99A 2R7HA 2PQ8A 3LMSA 4P4FA 3JVNA 3PB9X 3BUMB 2GLJA 1TF8A 4XPDB 4B11A 4EMEA 1AUGA 3NH4A 3T9YA 5F46A 1CPSA 1EZBA 4FD7A 3OB2B 1T36B 2B0AA 4F6AA 3VRPA 3TYXA 4IAVA 5AXIA 1VHOA 4I49A 2PDOA 2BOAA 2Z3LA 5F09A 3B3SA 1YQEA 1CS0B 4BPXB 4M8DA 2JDDA 1IU8A 4A2ZA 2JBKA 4GPLB 3RZAA 3PP9A 2IJZA 3V7ZA 1I1DA 3HMJG 3PB6X 4CRYB 2ATRA 4R7MA 4OC4A 3CPAA 3SJGA 3G3SA 3IWGA 5A27A 3CDXA 4NCZA 4OAEA 2B58A 1Z4RA 3DSBA 4C84A 4U9ZA 3HPGG 2XEJA 2WPWA 1BXRB 4XNHB 2ZEFA 3KR5A 2R98A 3T07A 1YLEA 2ZPAA 2ABZA 4GM5A 1FY7A 4MCQA 4KOVA 4MMOA 2FXFA 3H4QA 3F8KA 4KOXA 3WT4A 4ZY1A 5BWAB 1A9XB 4C8CA 4A95A 3CT9A 3FNCA 1DIKA 4ONWA 2FM4A 2PJBA 3WC7A 2V77A 3H5ZA 4UCPA 5IR2A 2CTCA 3U1BA 2WYRA 4LX9A 1LRZA 3SJXA 3TLBA 2PCNA 4NGTA 5LYLA 2G3TA 4TJVA 3K4IA 1EE3P 2FIAA 3PLFB 4KOUA 1OBRA 3W91A 5C88A 4J0NA 3U88C 4NJQA 1ARMA 5IX3A 3ISXA 3G23A 1PU9A 2WZNA 1LAMA 3C26A 3WABA 1CG2A 3PZJA 4C8TA 2G3AA 4JD6A 1VI4A 3GUXA 4OC5A 1Y9WA 3VATA 4M6HA 4CGPA 5HKYA 5HKZA 1RO5A 1S7FA 2AFXA 2PJ3A 2PJ8A 3EFAA 3OP0A 2P6GA 4IF5A 4MI4A 4X2TA 5G21A 5IB0A 2ZXVA 1JDEA 2HWGA 4R8FA 4F0YA 4DYOA 2GFQA 3WR7A 2I3CA 5HMNA 3B8GA 4R9MA 1ZG8A 2WPXA 3FH4A 3R9EA 1BOBA 1S3ZA 2EVNA 1QSNA 2Q04A 4MJXA 1U6MA 4UFXA 4CAXA 4PSXA 3CXSA 5HVHA 3ZJ0A 2YJTA 1P0HA 2JEWA 2DPTA 2V8GA 1RTQA 2Z3KA 2ZEOA 1ELLP 3FBUA 4MCPA 3D7GA 2PSWA 1S7KA 4DJLA 2D0PA 4KUBA 3DR8A 3NFQA 4CAWA 4E0AA 4MFPA 4MXUA 1CM0A 3NFZA 4KVXA 4R76A 4OP4A 4UEFA 2PJCA 4MFJA 1C30B 3KASA 2OZUA 3ISZA 2Y0MA 2Q4YA 4FWUA 1XBUA 3B3WA 4C8UA 2C6GA 2UV8G 1A2ZA 2Y1MA 1BO4A 1F57A 2B3VA 2EWBA 3N7ZA 4CGMA 4ZY2A 5GCNA 4Y49B 2A4NA 5F5XA 4G1PA 2VEZA 3PRTA 2D4PA 3BJ8A 4TNUA 3FECA 3K9UA 2FCKA 3KQXA 3LD2A 3HPHE 4P45A 2C6CA 1WK4A 1VHSA 1EO0A 3MGDA 3BXMA 2Q0YA 4MY3A 4MFZA 1S7NA 5AGEA 1LCPA 1BPNA 4RN7A 2JBJA 4NGNA 1I12A 3SJEA 4K30A 4A33A 1M4DA 4UFWA 5HXDA 4NGRA 2OB0A 3T05A 2O53A 1M4GA 2CIJA 3R1KA 1QSRA 2FS5A 4YGOA 1XFOA 1DE4C 5AG6A 4COBA 4CYPA 4UIAA 2B4DB 2AFSA 2V8HA 3DR6A 3RAMA 3BJ7A 4P4JA 1YMEA 4F0XA 2XPLA 2VQYA 3C8OA 2X7BA 4B5PB 1TKHA 4UEEA 4K3NA 1Z8LA 2QYVA 2XEGA 3BUXB 2J8NA 2PR1A 5HVGA 1CP6A 2B4BA 3EY5A 3RBUA 4KZTA 4OLLA 4P6YA 2XPNA 3RO0A 2Z3NA 3CXPA 4NGQA 4H2KA 4LQ6A 4QUSA 4IK2A 2EZAA 2BSWA 4BMHA 3TTHA 1CE8B 1ZLHA 1VBGA 3H8GA 4RR2B 2XEFA 1XMBA 3S9NA 2Q7SA 4CO9A 2AE6A 3BUNB 2G9DA 4CYOA 3I1UA 3FF3A 4O23A 5KTCA 2ZEPA 4B5PA 1WWZA 3BI1A 1Z4EA 2JEVA 2POKA 3IU1A 4X8IA 3DDDA 1KUVA 3PEIA 5LYDA 4JLYA 4AVBA 4E5SA 3KL9A 3GB0A 4IHMA 1ZYMA 3S6FA 3T8WA 2P6EA 3TLAA 3A9LA 4C9AA 4OMEA 2YGWA 4OIDA 3NE8A 4PXDA 2XEIA 2ZW7A 3KQZA 4NGPA 2NSMA 5FD8A 1R57A 1QQ9A 2ZW5A 4C9VA 5K99A 5K8NA 4Q36A 1Z8TA 1KEEB 4HNXB 4RS2A 4BBHA 4OADA 5D29A 3EC4A 3EO4A 3JUWA 4A37A 2ZOGA 3TLZA 1KUYA 4FD4A 4MRIA 4ONUA 1LAPA 4C7HA 3R9FA 4H6ZA 4GXHA 2CNTA 4RUHA 4FUUA 5JPHA 5IV0A 2V8VA 2YNCC 4TWEA 4EWTA 4R6TA 1M4IA 3OAKA 1XF1A 3FXTA 4A4BA 3VWDA 4ZI6A 4TJXA 4C8AA 4CPAA 4UIBA 2Q4VA 1XF8A 4A30A 1GGOA 4BD9A 4Q38A 3EIFA 2YJVA 5EBVA 4X5KA 2HUZA 2AFUA 3FYNA 4ZYQA 2CF4A 4B14A 4IIXA 2BL1A 4KUAA 2ARHA 1IICA 1UWYA 1YW4A 2G0BA 3CXQA 3PBBA 3BUWB 2PIYA 4M85A 2Q51A 4UCMA 3VARA 4UFVA 3VRRA 1AMPA 3VRQA 3QAHA 5HVFA 4A39A 4II9A 3NOJA 3IFEA 1FBVA 1IIDA 4B10A 5H86A 3V38A 1YSJA 4H1HA 3FRMA 1YK3A 2FIWA 1BAVA 2HQYA 2ZELA 3VH9A 4UCNA 4A32A 4A94A 1NBWA 4OC2A 3H8EA 3ZZIA 2BO9A 5ELYA 3VTAA 4JVOA 4F9UA 2J8MA 4OKOA 4KS9A 4MHNA 2Z10A 3IO1A 1Y0YA 3IIBA 2AUNA 3OB1B 1PCAA 3K2KA 2I00A 3D8PA 5JM6A 1WVMA 5JVLA 2OOTA 4OIWA 4F8ZA 3KHXA 1WJTA 1QSMA 3MN8A 3W6XA 4GS4A 2CTBA 2OZHA 1TKJA 2I79A 1Q7LA 1Z9UA 2PJ4A 1Z5RA 1LFWA 4B5OA 2HI6A 5JQ4A 4MI1A 2PR8A 4E94A 3FX6A 4MFQA 5HH1A 4MFLA 4YFJA 1KUXA 3GIUA 2ZEGA 4JJXA 1TKFA 4MHPA 1J4JA 1C3OB 1Y7EA 2H5MA 3D7FA 2Y1NA 1X10A 3DLJA 1Q2YA 3JTKA 2VKZG 1ZO0A 5J1QA 3BHXA 1X12A 3SHPA 2DIKA 5H84A 4B6ZA 4KNGE 3T5MA 1IYKA 4L89A 4P4EA 2HROA 1QSTA 4R3LA 4NGMA 3HLPA 3TLGB 2C1CA 1JWQA 2EUIA 3KRVA 3LACA 1MJBA 4UF4A 4XPKA 1IYLA 2PE3A 4NGSA 3GKRA 2O4HA 1NSLA 3D2MA 5K8PA 1M1DA 1NE9A 2Q44A 4U5YA 4ZGYB 1VGYA 2AFZA 4LUAA 4W9YA 3T90A 2JLMA 4YWYA 2R1IA 2D4OA 1S7LA 3IC1A 3D68A 1TXRA 2PIZA 4KLWA 3GJZA 1KBLA 2JDCA 2GP4A 3NE7A 4C8FA 4UEZA 2PC1A 3OWCA 4KSAA 4YN3A 4P4BA 1HDUA 2C27A 2XPPA 4L8AA 1B47A 2AFMA 3PB8X 5A28A 3EZBA 3TLCA 4C8PA 3TC8A 2Z3OA 3TLGA 4BINA 4Z65A 4M6IA 1ZL0A 2VZZA 3ZNIA 2QMLA 4ZY0A 4KSFA 2QJ8A 5AG7A 1BPMA 4C85A 4PXBA 4PXCA 1CX8A 1HDQA 4E2AA 2ANPA 2GE3A 4JZ0A 2J8RA 4PXEA 3QAYA 4DUKA 2QIRA 2YNEA 3IU2A 3GYAA 8CPAA 3R95A 3QNVA 4NJRA 2EZBA 2O28A 3CPXA 4NEXA 3TLEA 2YNDA 5F13A 3IWWA 3K9TA 4KVOE 2EBJA 2DXQA 3GLJA 4ORFA 5DS0A 4ZX8A 4C7IA 2ZEEA 5G1ZA 2AJ6A 5G20A 1XEBA 4CS0B 4MJ8A 4NXYA 4MY0A 2FVGA 4FD5A 2NMTA 1L0CA 4ZX9A 4NF1A 2KCWA 4KSIA 5LRJA 2OU2A 3D67A 3TO9A 5AG4A 1F2PA 4WJBA 2B4DA 3TX8A 3WC5A 4CGOA 1XJOA 3TOAA 2FL4A 3B3CA 4MHYA 1Y9KA 3L2NA 1Y0RA 3MRUA 3P2HA 3NH8A 2CY2A 2E28A 1YR0A 2Q4ZA 5EMIA 2VBQA 3PBEA 5AG5A 2PJ7A 3P2FA 1OZPA 4CDKA 2HB6A 4C86A 3S9MA 1FT7A 2CNSA 3F9KC 4OC1A 4UWIA 4CAFA 3S6HA 2VXKA 4PK2A 3NH5A 1UFHA 4A4CA 1CP7A 3KR4A 1TF9A 3IGRA 4AG9A 2QECA 4PPZA 3TOBA 2REFA 1CJWA 4PSWA 3N5FA 1IY7A 1LOKA 2IQ6A 2GANA 3KKWA 2HV2A 4XPDC 4C2YA 4EFDA 1VIXA 2K5TA 2C6PA 2PJ1A 2GREA 4CYNA 1YW6A 5J8FA 4HNWB 5HKWA 2FSRA 3TLYA 1IOFA 2PJAA 4KORA 4B13A 1CBXA 3IEHA 3PB4X 3B3TA 3QB8A 4QB9A 3RNZA 4UWJA 1V0CA 2AFOA 2DLAA 3D3SA 3D4UA 2BCOA 3VWEA 4X3RA 2PVVA 2GU2A 1QMUA 5FVJA 4COGA 2OR4A 2PJ2A 2HC9A 4P4IA 4M6GA 3SXNA 2CNMA 5THWA 4QBJA 2EK9A 3SJFA 1N71A 1PUAA 1DTDA 1F2OA 4JXRA 3VRNA 6CPAA 2AUMA 4MCSA 2Z11A 3R96A 3FJUA 1ZLIA 4RI1A 2C5QA 1CPXA 4XNHC 1ZG9A 4UA3A 3V8IA 1VBHA 4H89A 4NFRA 4FAIA 2BEIA 5LYFA 1IOIA 3KZWA 3VROA 3S6KA 2WUUA 4J3GA 2BUEA 4XPLA 5KTDA 5F9MA 1BLLE 2YNCA 1LANA 3S6GA 3F5BA 3T0TA 2B5GB 3I6SA
chains in the Genus database with same CATH topology
3SI2A 3KGQA 5JGFA 1AYEA 3FEEA 3I74A 1XRYA 2ZOFA 4LQGA 2QVPA 2GLFA 4WWVA 1JQGA 4MHZA 1NSAA 1IGBA 4OC0A 1HEEA 3LWUA 1R3NA 1V6CA 3HUVA 3D7HA 3B7IA 4F9VA 4C9EA 1H8LA 5D8NA 2Q43A 2F8HA 3H8FA 2NYQA 5LRKA 4YU9A 3D66A 3PFEA 5LRGA 3SI1A 3ICUA 3B35A 1FNOA 5CBMA 2RFHA 2PJ9A 4AXVA 1YLOA 1ZG7A 2EK8A 3S9LA 2RB7A 2ZENA 2PRQA 4OC3A 3SI0A 3IJ3A 4PQAA 3D7DA 3BI0A 1PYTB 3KHZA 5LYIA 4FBEA 7CPAA 3FEDA 1Y9ZA 3PFOA 2DEAA 2ZEHA 3NA6A 2PCUA 4P4DA 2J9AA 1VHEA 1ARLA 3PB7X 3JRUA 3B2YA 3FVLA 5K8MA 1Z2LA 5CPAA 2AFWA 2PJ0A 5I4MA 4JYWA 2ZEMA 4C9UA 2IMOA 2PJ6A 1R43A 3FMCA 5IB9A 3KI9A 1GYTA 1ELMP 5K8OA 2ZEDA 4Q7AA 2V8DA 4C9RA 4P44A 2PJ5A 2PVWA 4A38A 2VL1A 3DGVA 4MCRA 3B3VA 2F7VA 4P10A 1M4LA 5JH9A 1KWMA 4C99A 3LMSA 4P4FA 3PB9X 2GLJA 1TF8A 4EMEA 3NH4A 1CPSA 4IAVA 1VHOA 2BOAA 5F09A 3B3SA 2JBKA 3RZAA 3V7ZA 2IJZA 3PB6X 4R7MA 4OC4A 3CPAA 3SJGA 3CDXA 4C84A 2XEJA 2ZEFA 3KR5A 2ABZA 4GM5A 4MCQA 4MMOA 3WT4A 4ZY1A 4C8CA 3CT9A 4ONWA 2PJBA 3WC7A 2V77A 5IR2A 2CTCA 2WYRA 3SJXA 4NGTA 5LYLA 4TJVA 1EE3P 1OBRA 4NJQA 1ARMA 3ISXA 2WZNA 3WABA 1LAMA 1CG2A 4C8TA 3GUXA 4OC5A 3VATA 2AFXA 2PJ3A 2PJ8A 4X2TA 4R8FA 4DYOA 2I3CA 1ZG8A 3FH4A 5HVHA 2JEWA 2V8GA 1RTQA 2ZEOA 1ELLP 4MCPA 3D7GA 4DJLA 4MXUA 3NFZA 4UEFA 4R76A 4OP4A 2PJCA 3KASA 3ISZA 4FWUA 1XBUA 3B3WA 4C8UA 2C6GA 1F57A 2EWBA 4ZY2A 4G1PA 3PRTA 4TNUA 3FECA 3KQXA 4P45A 2C6CA 3BXMA 1LCPA 1BPNA 2JBJA 4NGNA 3SJEA 5HXDA 4NGRA 2O53A 2CIJA 1XFOA 1DE4C 4UIAA 2V8HA 2AFSA 3RAMA 4P4JA 1YMEA 1TKHA 4UEEA 4K3NA 1Z8LA 2QYVA 2XEGA 5HVGA 1CP6A 3RBUA 4P6YA 4NGQA 4H2KA 4IK2A 1ZLHA 3H8GA 1XMBA 2XEFA 3S9NA 2G9DA 3I1UA 3FF3A 4O23A 2ZEPA 3BI1A 2POKA 4X8IA 3WC6A 3PEIA 5LYDA 3KL9A 3GB0A 4IHMA 3T8WA 4C9AA 4OMEA 4OIDA 4PXDA 2XEIA 3KQZA 4NGPA 2NSMA 4C9VA 1QQ9A 5K8NA 5D29A 4A37A 2ZOGA 4MRIA 1LAPA 4RUHA 4FUUA 2V8VA 4TWEA 4EWTA 4R6TA 1XF1A 4TJXA 4ZI6A 4C8AA 4CPAA 4UIBA 4BD9A 3EIFA 2AFUA 4ZYQA 2CF4A 1UWYA 1YW4A 3PBBA 2PIYA 3VARA 2Q51A 1AMPA 5HVFA 4A39A 3IFEA 3V38A 1YSJA 3VH9A 1BAVA 2ZELA 4A94A 4OC2A 3H8EA 2BO9A 5ELYA 3VTAA 4F9UA 4OKOA 4MHNA 3IO1A 1Y0YA 3IIBA 1PCAA 3K2KA 5JM6A 1WVMA 2OOTA 4OIWA 4F8ZA 3KHXA 3MN8A 2CTBA 1TKJA 1Q7LA 2PJ4A 1Z5RA 1LFWA 3FX6A 2ZEGA 1TKFA 4MHPA 1Y7EA 3D7FA 3DLJA 5J1QA 3BHXA 4KNGE 4B6ZA 4P4EA 4NGMA 3HLPA 2C1CA 4CDJA 4UF4A 2PE3A 5K8PA 4NGSA 2O4HA 1VGYA 2AFZA 4W9YA 4YWYA 3IC1A 3D68A 1TXRA 2PIZA 2GP4A 4C8FA 4UEZA 4YN3A 4P4BA 1HDUA 2AFMA 3PB8X 4C8PA 3TC8A 4Z65A 4ZY0A 2QJ8A 1BPMA 4C85A 4PXBA 4PXCA 1CX8A 1HDQA 2ANPA 4JZ0A 4DUKA 4PXEA 8CPAA 3QNVA 4NJRA 3CPXA 3IWWA 3K9TA 3GLJA 5DS0A 4ZX8A 2ZEEA 2FVGA 5LRJA 4ZX9A 4KSIA 3D67A 1F2PA 4WJBA 3TX8A 3WC5A 1XJOA 3B3CA 4MHYA 3L2NA 1Y0RA 3MRUA 3NH8A 2Q4ZA 3PBEA 2PJ7A 4CDKA 2HB6A 4C86A 3S9MA 1FT7A 4OC1A 3NH5A 1CP7A 3KR4A 1TF9A 4PPZA 3N5FA 1IY7A 1LOKA 2IQ6A 4EFDA 1VIXA 2PJ1A 2C6PA 2GREA 1YW6A 2PJAA 1CBXA 3IEHA 3PB4X 3B3TA 2AFOA 3D4UA 2BCOA 4X3RA 2PVVA 2GU2A 1QMUA 2OR4A 2PJ2A 2HC9A 4P4IA 5THWA 2EK9A 3SJFA 1DTDA 1F2OA 6CPAA 4MCSA 3FJUA 1ZLIA 2C5QA 1CPXA 1ZG9A 4NFRA 4FAIA 5LYFA 3KZWA 1BLLE 1LANA 3I6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SI2 A;  3KGQ A;  5JGF A;  1AYE A;  3FEE A;  3I74 A;  1XRY A;  2ZOF A;  4LQG A;  2QVP A;  2GLF A;  4WWV A;  1JQG A;  4MHZ A;  1NSA A;  1IGB A;  4OC0 A;  1HEE A;  3LWU A;  1R3N A;  1V6C A;  3HUV A;  3D7H A;  3B7I A;  4F9V A;  4C9E A;  1H8L A;  5D8N A;  2Q43 A;  2F8H A;  3H8F A;  2NYQ A;  5LRK A;  4YU9 A;  3D66 A;  3PFE A;  5LRG A;  3SI1 A;  3ICU A;  3B35 A;  1FNO A;  5CBM A;  2RFH A;  2PJ9 A;  4AXV A;  1YLO A;  1ZG7 A;  2EK8 A;  3S9L A;  2RB7 A;  2ZEN A;  2PRQ A;  4OC3 A;  3SI0 A;  3IJ3 A;  4PQA A;  3D7D A;  3BI0 A;  1PYT B;  3KHZ A;  5LYI A;  4FBE A;  7CPA A;  3FED A;  1Y9Z A;  3PFO A;  2DEA A;  2ZEH A;  3NA6 A;  2PCU A;  4P4D A;  2J9A A;  1VHE A;  1ARL A;  3PB7 X;  3JRU A;  3B2Y A;  3FVL A;  5K8M A;  1Z2L A;  5CPA A;  2AFW A;  2PJ0 A;  5I4M A;  4JYW A;  2ZEM A;  4C9U A;  2IMO A;  2PJ6 A;  1R43 A;  3FMC A;  5IB9 A;  3KI9 A;  1GYT A;  1ELM P;  5K8O A;  2ZED A;  4Q7A A;  2V8D A;  4C9R A;  4P44 A;  2PJ5 A;  2PVW A;  4A38 A;  2VL1 A;  3DGV A;  4MCR A;  3B3V A;  2F7V A;  4P10 A;  1M4L A;  5JH9 A;  1KWM A;  4C99 A;  3LMS A;  4P4F A;  3PB9 X;  2GLJ A;  1TF8 A;  4EME A;  3NH4 A;  1CPS A;  4IAV A;  1VHO A;  2BOA A;  5F09 A;  3B3S A;  2JBK A;  3RZA A;  3V7Z A;  2IJZ A;  3PB6 X;  4R7M A;  4OC4 A;  3CPA A;  3SJG A;  3CDX A;  4C84 A;  2XEJ A;  2ZEF A;  3KR5 A;  2ABZ A;  4GM5 A;  4MCQ A;  4MMO A;  3WT4 A;  4ZY1 A;  4C8C A;  3CT9 A;  4ONW A;  2PJB A;  3WC7 A;  2V77 A;  2CTC A;  2WYR A;  3SJX A;  4NGT A;  5LYL A;  4TJV A;  1EE3 P;  1OBR A;  4NJQ A;  1ARM A;  3ISX A;  2WZN A;  3WAB A;  1LAM A;  1CG2 A;  4C8T A;  3GUX A;  4OC5 A;  3VAT A;  2AFX A;  2PJ3 A;  2PJ8 A;  4X2T A;  4R8F A;  4DYO A;  2I3C A;  1ZG8 A;  3FH4 A;  5HVH A;  2JEW A;  2V8G A;  1RTQ A;  2ZEO A;  1ELL P;  4MCP A;  3D7G A;  4DJL A;  4MXU A;  3NFZ A;  4UEF A;  4R76 A;  4OP4 A;  2PJC A;  3KAS A;  3ISZ A;  4FWU A;  1XBU A;  3B3W A;  4C8U A;  2C6G A;  1F57 A;  2EWB A;  4ZY2 A;  4G1P A;  3PRT A;  4TNU A;  3FEC A;  3KQX A;  4P45 A;  2C6C A;  3BXM A;  1LCP A;  1BPN A;  2JBJ A;  4NGN A;  3SJE A;  5HXD A;  4NGR A;  2O53 A;  2CIJ A;  1XFO A;  1DE4 C;  4UIA A;  2V8H A;  2AFS A;  3RAM A;  4P4J A;  1YME A;  1TKH A;  4UEE A;  4K3N A;  1Z8L A;  2QYV A;  2XEG A;  5HVG A;  1CP6 A;  3RBU A;  4P6Y A;  4NGQ A;  4H2K A;  4IK2 A;  1ZLH A;  3H8G A;  1XMB A;  2XEF A;  3S9N A;  2G9D A;  3I1U A;  3FF3 A;  4O23 A;  2ZEP A;  3BI1 A;  2POK A;  4X8I A;  3WC6 A;  3PEI A;  5LYD A;  3KL9 A;  3GB0 A;  4IHM A;  3T8W A;  4C9A A;  4OME A;  4OID A;  4PXD A;  2XEI A;  3KQZ A;  4NGP A;  2NSM A;  4C9V A;  1QQ9 A;  5K8N A;  5D29 A;  4A37 A;  2ZOG A;  4MRI A;  1LAP A;  4RUH A;  4FUU A;  2V8V A;  4TWE A;  4EWT A;  4R6T A;  1XF1 A;  4TJX A;  4ZI6 A;  4C8A A;  4CPA A;  4UIB A;  4BD9 A;  3EIF A;  2AFU A;  4ZYQ A;  2CF4 A;  1UWY A;  1YW4 A;  3PBB A;  2PIY A;  3VAR A;  2Q51 A;  1AMP A;  5HVF A;  4A39 A;  3IFE A;  3V38 A;  1YSJ A;  3VH9 A;  1BAV A;  2ZEL A;  4A94 A;  4OC2 A;  3H8E A;  2BO9 A;  5ELY A;  3VTA A;  4F9U A;  4OKO A;  4MHN A;  3IO1 A;  1Y0Y A;  3IIB A;  1PCA A;  3K2K A;  5JM6 A;  1WVM A;  2OOT A;  4OIW A;  4F8Z A;  3KHX A;  3MN8 A;  2CTB A;  1TKJ A;  1Q7L A;  2PJ4 A;  1Z5R A;  1LFW A;  3FX6 A;  2ZEG A;  1TKF A;  4MHP A;  1Y7E A;  3D7F A;  3DLJ A;  5J1Q A;  3BHX A;  4KNG E;  4B6Z A;  4P4E A;  4NGM A;  3HLP A;  2C1C A;  4CDJ A;  4UF4 A;  2PE3 A;  5K8P A;  4NGS A;  2O4H A;  1VGY A;  2AFZ A;  4W9Y A;  4YWY A;  3IC1 A;  3D68 A;  1TXR A;  2PIZ A;  4C8F A;  4UEZ A;  4YN3 A;  4P4B A;  1HDU A;  2AFM A;  3PB8 X;  4C8P A;  3TC8 A;  4Z65 A;  4ZY0 A;  2QJ8 A;  1BPM A;  4C85 A;  4PXB A;  4PXC A;  1CX8 A;  1HDQ A;  2ANP A;  4JZ0 A;  4DUK A;  4PXE A;  8CPA A;  3QNV A;  4NJR A;  3CPX A;  3IWW A;  3K9T A;  3GLJ A;  5DS0 A;  4ZX8 A;  2ZEE A;  2FVG A;  5LRJ A;  4ZX9 A;  4KSI A;  3D67 A;  1F2P A;  4WJB A;  3TX8 A;  3WC5 A;  1XJO A;  3B3C A;  4MHY A;  3L2N A;  1Y0R A;  3MRU A;  3NH8 A;  2Q4Z A;  3PBE A;  2PJ7 A;  4CDK A;  2HB6 A;  4C86 A;  3S9M A;  1FT7 A;  4OC1 A;  3NH5 A;  1CP7 A;  3KR4 A;  1TF9 A;  4PPZ A;  3N5F A;  1IY7 A;  1LOK A;  2IQ6 A;  4EFD A;  1VIX A;  2PJ1 A;  2C6P A;  2GRE A;  1YW6 A;  2PJA A;  1CBX A;  3IEH A;  3PB4 X;  3B3T A;  2AFO A;  3D4U A;  2BCO A;  4X3R A;  2PVV A;  2GU2 A;  1QMU A;  2OR4 A;  2PJ2 A;  2HC9 A;  4P4I A;  5THW A;  2EK9 A;  3SJF A;  1DTD A;  1F2O A;  6CPA A;  4MCS A;  3FJU A;  1ZLI A;  1CPX A;  1ZG9 A;  4NFR A;  4FAI A;  5LYF A;  3KZW A;  1BLL E;  1LAN A;  3I6S A; 
#chains in the Genus database with same CATH topology
 2B3U A;  3SI2 A;  5ISV A;  3KGQ A;  4C2Z A;  4ZBG A;  1Y7R A;  2D0O A;  5JGF A;  4CAV A;  1AYE A;  3UY5 A;  3BLN A;  5LRK A;  1Q2D A;  1MJ9 A;  1IB1 E;  5KTA A;  3FEE A;  2F5I A;  2CBL A;  1R61 A;  3I74 A;  3W6S A;  1YVO A;  2P6F A;  3IWE A;  2B4J C;  4EYS A;  1XOV A;  1YX0 A;  2IL4 A;  4QC6 A;  5JYB A;  3EZE A;  1XRY A;  2ZOF A;  1I21 A;  4CGN A;  1RXT A;  1EZA A;  2FT0 A;  4LQG A;  2FE7 A;  2CXA A;  2GLF A;  2QVP A;  4HPS A;  4WWV A;  1JQG A;  3VGO A;  1J3L A;  2B5G A;  1JDB C;  4MHZ A;  2PRB A;  1NSA A;  1IGB A;  4OC0 A;  1HEE A;  3LWU A;  1R3N A;  2Z3M A;  4MFK A;  5J8C A;  3O8Z A;  1KC7 A;  3FIX A;  1V6C A;  3HUV A;  1Q5X A;  1NMT A;  4NSQ A;  3EZA A;  4KOY A;  5F47 A;  3BUO B;  1Z8W A;  3D7H A;  3B7I A;  1XMT A;  3I3G A;  2DF5 A;  3I9S A;  4F9V A;  1M44 A;  3TFY A;  4C9E A;  1H8L A;  5D8N A;  4R57 A;  1YGH A;  2R8V A;  2Q43 A;  2F8H A;  4JWP A;  3F0A A;  3TCV A;  1QSO A;  3H8F A;  5I0C A;  4E8O A;  3D2P A;  2EZC A;  2NYQ A;  4KLV A;  1Q2C A;  4YU9 A;  5F49 A;  3LOD A;  3D66 A;  3E0K A;  3PFE A;  5G22 A;  5LRG A;  4R3K A;  3SI1 A;  4AVA A;  3ICU A;  5BY0 A;  1S5K A;  2RC4 A;  1FNO A;  3B35 A;  2ZW6 A;  3DNS A;  4JXQ A;  2RFH A;  5CBM A;  2PJ9 A;  4AXV A;  1TIQ A;  1YLO A;  1S60 A;  1ZG7 A;  3S9L A;  2EK8 A;  2RB7 A;  2ZEN A;  4CAE A;  4MHD A;  4CRZ B;  4KOW A;  2PRQ A;  4OC3 A;  3SI0 A;  4CYQ A;  4AB7 A;  1VKC A;  3PT1 A;  1P4N A;  5EC4 A;  5C82 A;  4IIY A;  3IJ3 A;  2EO8 A;  1XIX A;  4PV6 A;  4PQA A;  2R82 A;  3G8W A;  4Y49 C;  3D7D A;  5CNP A;  4IUS A;  3CZX A;  4YRH A;  1MK4 A;  5E96 A;  2P0W A;  3BI0 A;  2REE A;  1PYT B;  2GIV A;  5DWN A;  5F48 A;  3TT2 A;  3KHZ A;  4KVM E;  5LYI A;  3SR3 A;  4M3S A;  4DNC A;  4FBE A;  1XE4 A;  4H6U A;  7CPA A;  3EXN A;  3FED A;  2WSA A;  1YVK A;  4HKF A;  4C2X A;  4EVY A;  1Y9Z A;  3PFO A;  1K4J A;  1Z9E A;  2DEA A;  2ODF A;  2ZEH A;  4R87 A;  4AG7 A;  3NA6 A;  2PCU A;  4P4D A;  1MJA A;  1VHE A;  2J9A A;  2OH1 A;  4U9Y A;  1YRE A;  1ARL A;  1NXJ A;  4B12 A;  3TO6 A;  1B6B A;  3PB7 X;  4CDJ A;  3JRU A;  3PFV A;  3B2Y A;  3FVL A;  5K8M A;  4BPW B;  1Z2L A;  5J3X A;  3TE4 A;  5CPA A;  2AFW A;  2PJ0 A;  3SXO A;  5I4M A;  3FB3 A;  4JYW A;  4A31 A;  3WC6 A;  2MP0 A;  5F1Y A;  2ZEM A;  4C9U A;  2IMO A;  3TO7 A;  1YVH A;  2PJ6 A;  1R43 A;  1ON0 A;  4BPU B;  4UBR A;  2Z3P A;  2N3A B;  5DWM A;  4PK3 A;  3FMC A;  1GHE A;  5IB9 A;  2ZW4 A;  1GYT A;  3KI9 A;  1ELM P;  4AVC A;  1Z8X A;  1SQH A;  2Z0Z A;  5K8O A;  4MBU A;  2ZED A;  2VI7 A;  4Q7A A;  2V8D A;  4C9R A;  4P44 A;  2OZG A;  2DPS A;  2VZY A;  2PJ5 A;  4FD6 A;  4HNY B;  4KOT A;  2Q7B A;  1M6V B;  1ZRS A;  4CZ1 A;  2OLS A;  2PVW A;  4BTF A;  3RYO A;  4A38 A;  4CGL A;  3PGP A;  2VL1 A;  3DGV A;  4MCR A;  3B3V A;  2F7V A;  2XPO A;  4P10 A;  1M4L A;  5JH9 A;  2X0S A;  4KOS A;  1B87 A;  4QVT A;  4C68 A;  4INJ A;  3R9G A;  3GY9 A;  1KZF A;  1KWM A;  4C99 A;  2R7H A;  2PQ8 A;  3LMS A;  4P4F A;  3JVN A;  3PB9 X;  3BUM B;  2GLJ A;  1TF8 A;  4XPD B;  4B11 A;  4EME A;  1AUG A;  3NH4 A;  3T9Y A;  5F46 A;  1CPS A;  1EZB A;  4FD7 A;  3OB2 B;  1T36 B;  2B0A A;  4F6A A;  3VRP A;  3TYX A;  4IAV A;  5AXI A;  1VHO A;  4I49 A;  2PDO A;  2BOA A;  2Z3L A;  5F09 A;  3B3S A;  1YQE A;  1CS0 B;  4BPX B;  4M8D A;  2JDD A;  1IU8 A;  4A2Z A;  2JBK A;  4GPL B;  3RZA A;  3PP9 A;  2IJZ A;  3V7Z A;  1I1D A;  3HMJ G;  3PB6 X;  4CRY B;  2ATR A;  4R7M A;  4OC4 A;  3CPA A;  3SJG A;  3G3S A;  3IWG A;  5A27 A;  3CDX A;  4NCZ A;  4OAE A;  2B58 A;  1Z4R A;  3DSB A;  4C84 A;  4U9Z A;  3HPG G;  2XEJ A;  2WPW A;  1BXR B;  4XNH B;  2ZEF A;  3KR5 A;  2R98 A;  3T07 A;  1YLE A;  2ZPA A;  2ABZ A;  4GM5 A;  1FY7 A;  4MCQ A;  4KOV A;  4MMO A;  2FXF A;  3H4Q A;  3F8K A;  4KOX A;  3WT4 A;  4ZY1 A;  5BWA B;  1A9X B;  4C8C A;  4A95 A;  3CT9 A;  3FNC A;  1DIK A;  4ONW A;  2FM4 A;  2PJB A;  3WC7 A;  2V77 A;  3H5Z A;  4UCP A;  5IR2 A;  2CTC A;  3U1B A;  2WYR A;  4LX9 A;  1LRZ A;  3SJX A;  3TLB A;  2PCN A;  4NGT A;  5LYL A;  2G3T A;  4TJV A;  3K4I A;  1EE3 P;  2FIA A;  3PLF B;  4KOU A;  1OBR A;  3W91 A;  5C88 A;  4J0N A;  3U88 C;  4NJQ A;  1ARM A;  5IX3 A;  3ISX A;  3G23 A;  1PU9 A;  2WZN A;  1LAM A;  3C26 A;  3WAB A;  1CG2 A;  3PZJ A;  4C8T A;  2G3A A;  4JD6 A;  1VI4 A;  3GUX A;  4OC5 A;  1Y9W A;  3VAT A;  4M6H A;  4CGP A;  5HKY A;  5HKZ A;  1RO5 A;  1S7F A;  2AFX A;  2PJ3 A;  2PJ8 A;  3EFA A;  3OP0 A;  2P6G A;  4IF5 A;  4MI4 A;  4X2T A;  5G21 A;  5IB0 A;  2ZXV A;  1JDE A;  2HWG A;  4R8F A;  4F0Y A;  4DYO A;  2GFQ A;  3WR7 A;  2I3C A;  5HMN A;  3B8G A;  4R9M A;  1ZG8 A;  2WPX A;  3FH4 A;  3R9E A;  1BOB A;  1S3Z A;  2EVN A;  1QSN A;  2Q04 A;  4MJX A;  1U6M A;  4UFX A;  4CAX A;  4PSX A;  3CXS A;  5HVH A;  3ZJ0 A;  2YJT A;  1P0H A;  2JEW A;  2DPT A;  2V8G A;  1RTQ A;  2Z3K A;  2ZEO A;  1ELL P;  3FBU A;  4MCP A;  3D7G A;  2PSW A;  1S7K A;  4DJL A;  2D0P A;  4KUB A;  3DR8 A;  3NFQ A;  4CAW A;  4E0A A;  4MFP A;  4MXU A;  1CM0 A;  3NFZ A;  4KVX A;  4R76 A;  4OP4 A;  4UEF A;  2PJC A;  4MFJ A;  1C30 B;  3KAS A;  2OZU A;  3ISZ A;  2Y0M A;  2Q4Y A;  4FWU A;  1XBU A;  3B3W A;  4C8U A;  2C6G A;  2UV8 G;  1A2Z A;  2Y1M A;  1BO4 A;  1F57 A;  2B3V A;  2EWB A;  3N7Z A;  4CGM A;  4ZY2 A;  5GCN A;  4Y49 B;  2A4N A;  5F5X A;  4G1P A;  2VEZ A;  3PRT A;  2D4P A;  3BJ8 A;  4TNU A;  3FEC A;  3K9U A;  2FCK A;  3KQX A;  3LD2 A;  3HPH E;  4P45 A;  2C6C A;  1WK4 A;  1VHS A;  1EO0 A;  3MGD A;  3BXM A;  2Q0Y A;  4MY3 A;  4MFZ A;  1S7N A;  5AGE A;  1LCP A;  1BPN A;  4RN7 A;  2JBJ A;  4NGN A;  1I12 A;  3SJE A;  4K30 A;  4A33 A;  1M4D A;  4UFW A;  5HXD A;  4NGR A;  2OB0 A;  3T05 A;  2O53 A;  1M4G A;  2CIJ A;  3R1K A;  1QSR A;  2FS5 A;  4YGO A;  1XFO A;  1DE4 C;  5AG6 A;  4COB A;  4CYP A;  4UIA A;  2B4D B;  2AFS A;  2V8H A;  3DR6 A;  3RAM A;  3BJ7 A;  4P4J A;  1YME A;  4F0X A;  2XPL A;  2VQY A;  3C8O A;  2X7B A;  4B5P B;  1TKH A;  4UEE A;  4K3N A;  1Z8L A;  2QYV A;  2XEG A;  3BUX B;  2J8N A;  2PR1 A;  5HVG A;  1CP6 A;  2B4B A;  3EY5 A;  3RBU A;  4KZT A;  4OLL A;  4P6Y A;  2XPN A;  3RO0 A;  2Z3N A;  3CXP A;  4NGQ A;  4H2K A;  4LQ6 A;  4QUS A;  4IK2 A;  2EZA A;  2BSW A;  4BMH A;  3TTH A;  1CE8 B;  1ZLH A;  1VBG A;  3H8G A;  4RR2 B;  2XEF A;  1XMB A;  3S9N A;  2Q7S A;  4CO9 A;  2AE6 A;  3BUN B;  2G9D A;  4CYO A;  3I1U A;  3FF3 A;  4O23 A;  5KTC A;  2ZEP A;  4B5P A;  1WWZ A;  3BI1 A;  1Z4E A;  2JEV A;  2POK A;  3IU1 A;  4X8I A;  3DDD A;  1KUV A;  3PEI A;  5LYD A;  4JLY A;  4AVB A;  4E5S A;  3KL9 A;  3GB0 A;  4IHM A;  1ZYM A;  3S6F A;  3T8W A;  2P6E A;  3TLA A;  3A9L A;  4C9A A;  4OME A;  2YGW A;  4OID A;  3NE8 A;  4PXD A;  2XEI A;  2ZW7 A;  3KQZ A;  4NGP A;  2NSM A;  5FD8 A;  1R57 A;  1QQ9 A;  2ZW5 A;  4C9V A;  5K99 A;  5K8N A;  4Q36 A;  1Z8T A;  1KEE B;  4HNX B;  4RS2 A;  4BBH A;  4OAD A;  5D29 A;  3EC4 A;  3EO4 A;  3JUW A;  4A37 A;  2ZOG A;  3TLZ A;  1KUY A;  4FD4 A;  4MRI A;  4ONU A;  1LAP A;  4C7H A;  3R9F A;  4H6Z A;  4GXH A;  2CNT A;  4RUH A;  4FUU A;  5JPH A;  5IV0 A;  2V8V A;  2YNC C;  4TWE A;  4EWT A;  4R6T A;  1M4I A;  3OAK A;  1XF1 A;  3FXT A;  4A4B A;  3VWD A;  4ZI6 A;  4TJX A;  4C8A A;  4CPA A;  4UIB A;  2Q4V A;  1XF8 A;  4A30 A;  1GGO A;  4BD9 A;  4Q38 A;  3EIF A;  2YJV A;  5EBV A;  4X5K A;  2HUZ A;  2AFU A;  3FYN A;  4ZYQ A;  2CF4 A;  4B14 A;  4IIX A;  2BL1 A;  4KUA A;  2ARH A;  1IIC A;  1UWY A;  1YW4 A;  2G0B A;  3CXQ A;  3PBB A;  3BUW B;  2PIY A;  4M85 A;  2Q51 A;  4UCM A;  3VAR A;  4UFV A;  3VRR A;  1AMP A;  3VRQ A;  3QAH A;  5HVF A;  4A39 A;  4II9 A;  3NOJ A;  3IFE A;  1FBV A;  1IID A;  4B10 A;  5H86 A;  3V38 A;  1YSJ A;  4H1H A;  3FRM A;  1YK3 A;  2FIW A;  1BAV A;  2HQY A;  2ZEL A;  3VH9 A;  4UCN A;  4A32 A;  4A94 A;  1NBW A;  4OC2 A;  3H8E A;  3ZZI A;  2BO9 A;  5ELY A;  3VTA A;  4JVO A;  4F9U A;  2J8M A;  4OKO A;  4KS9 A;  4MHN A;  2Z10 A;  3IO1 A;  1Y0Y A;  3IIB A;  2AUN A;  3OB1 B;  1PCA A;  3K2K A;  2I00 A;  3D8P A;  5JM6 A;  1WVM A;  5JVL A;  2OOT A;  4OIW A;  4F8Z A;  3KHX A;  1WJT A;  1QSM A;  3MN8 A;  3W6X A;  4GS4 A;  2CTB A;  2OZH A;  1TKJ A;  2I79 A;  1Q7L A;  1Z9U A;  2PJ4 A;  1Z5R A;  1LFW A;  4B5O A;  2HI6 A;  5JQ4 A;  4MI1 A;  2PR8 A;  4E94 A;  3FX6 A;  4MFQ A;  5HH1 A;  4MFL A;  4YFJ A;  1KUX A;  3GIU A;  2ZEG A;  4JJX A;  1TKF A;  4MHP A;  1J4J A;  1C3O B;  1Y7E A;  2H5M A;  3D7F A;  2Y1N A;  1X10 A;  3DLJ A;  1Q2Y A;  3JTK A;  2VKZ G;  1ZO0 A;  5J1Q A;  3BHX A;  1X12 A;  3SHP A;  2DIK A;  5H84 A;  4B6Z A;  4KNG E;  3T5M A;  1IYK A;  4L89 A;  4P4E A;  2HRO A;  1QST A;  4R3L A;  4NGM A;  3HLP A;  3TLG B;  2C1C A;  1JWQ A;  2EUI A;  3KRV A;  3LAC A;  1MJB A;  4UF4 A;  4XPK A;  1IYL A;  2PE3 A;  4NGS A;  3GKR A;  2O4H A;  1NSL A;  3D2M A;  5K8P A;  1M1D A;  1NE9 A;  2Q44 A;  4U5Y A;  4ZGY B;  1VGY A;  2AFZ A;  4LUA A;  4W9Y A;  3T90 A;  2JLM A;  4YWY A;  2R1I A;  2D4O A;  1S7L A;  3IC1 A;  3D68 A;  1TXR A;  2PIZ A;  4KLW A;  3GJZ A;  1KBL A;  2JDC A;  2GP4 A;  3NE7 A;  4C8F A;  4UEZ A;  2PC1 A;  3OWC A;  4KSA A;  4YN3 A;  4P4B A;  1HDU A;  2C27 A;  2XPP A;  4L8A A;  1B47 A;  2AFM A;  3PB8 X;  5A28 A;  3EZB A;  3TLC A;  4C8P A;  3TC8 A;  2Z3O A;  3TLG A;  4BIN A;  4Z65 A;  4M6I A;  1ZL0 A;  2VZZ A;  3ZNI A;  2QML A;  4ZY0 A;  4KSF A;  2QJ8 A;  5AG7 A;  1BPM A;  4C85 A;  4PXB A;  4PXC A;  1CX8 A;  1HDQ A;  4E2A A;  2ANP A;  2GE3 A;  4JZ0 A;  2J8R A;  4PXE A;  3QAY A;  4DUK A;  2QIR A;  2YNE A;  3IU2 A;  3GYA A;  8CPA A;  3R95 A;  3QNV A;  4NJR A;  2EZB A;  2O28 A;  3CPX A;  4NEX A;  3TLE A;  2YND A;  5F13 A;  3IWW A;  3K9T A;  4KVO E;  2EBJ A;  2DXQ A;  3GLJ A;  4ORF A;  5DS0 A;  4ZX8 A;  4C7I A;  2ZEE A;  5G1Z A;  2AJ6 A;  5G20 A;  1XEB A;  4CS0 B;  4MJ8 A;  4NXY A;  4MY0 A;  2FVG A;  4FD5 A;  2NMT A;  1L0C A;  4ZX9 A;  4NF1 A;  2KCW A;  4KSI A;  5LRJ A;  2OU2 A;  3D67 A;  3TO9 A;  5AG4 A;  1F2P A;  4WJB A;  2B4D A;  3TX8 A;  3WC5 A;  4CGO A;  1XJO A;  3TOA A;  2FL4 A;  3B3C A;  4MHY A;  1Y9K A;  3L2N A;  1Y0R A;  3MRU A;  3P2H A;  3NH8 A;  2CY2 A;  2E28 A;  1YR0 A;  2Q4Z A;  5EMI A;  2VBQ A;  3PBE A;  5AG5 A;  2PJ7 A;  3P2F A;  1OZP A;  4CDK A;  2HB6 A;  4C86 A;  3S9M A;  1FT7 A;  2CNS A;  3F9K C;  4OC1 A;  4UWI A;  4CAF A;  3S6H A;  2VXK A;  4PK2 A;  3NH5 A;  1UFH A;  4A4C A;  1CP7 A;  3KR4 A;  1TF9 A;  3IGR A;  4AG9 A;  2QEC A;  4PPZ A;  3TOB A;  2REF A;  1CJW A;  4PSW A;  3N5F A;  1IY7 A;  1LOK A;  2IQ6 A;  2GAN A;  3KKW A;  2HV2 A;  4XPD C;  4C2Y A;  4EFD A;  1VIX A;  2K5T A;  2C6P A;  2PJ1 A;  2GRE A;  4CYN A;  1YW6 A;  5J8F A;  4HNW B;  5HKW A;  2FSR A;  3TLY A;  1IOF A;  2PJA A;  4KOR A;  4B13 A;  1CBX A;  3IEH A;  3PB4 X;  3B3T A;  3QB8 A;  4QB9 A;  3RNZ A;  4UWJ A;  1V0C A;  2AFO A;  2DLA A;  3D3S A;  3D4U A;  2BCO A;  3VWE A;  4X3R A;  2PVV A;  2GU2 A;  1QMU A;  5FVJ A;  4COG A;  2OR4 A;  2PJ2 A;  2HC9 A;  4P4I A;  4M6G A;  3SXN A;  2CNM A;  5THW A;  4QBJ A;  2EK9 A;  3SJF A;  1N71 A;  1PUA A;  1DTD A;  1F2O A;  4JXR A;  3VRN A;  6CPA A;  2AUM A;  4MCS A;  2Z11 A;  3R96 A;  3FJU A;  1ZLI A;  4RI1 A;  2C5Q A;  1CPX A;  4XNH C;  1ZG9 A;  4UA3 A;  3V8I A;  1VBH A;  4H89 A;  4NFR A;  4FAI A;  2BEI A;  5LYF A;  1IOI A;  3KZW A;  3VRO A;  3S6K A;  2WUU A;  4J3G A;  2BUE A;  4XPL A;  5KTD A;  5F9M A;  1BLL E;  2YNC A;  1LAN A;  3S6G A;  3F5B A;  3T0T A;  2B5G B;  3I6S A; 
#chains in the Genus database with same CATH homology
 3SI2 A;  3KGQ A;  5JGF A;  1AYE A;  3FEE A;  3I74 A;  1XRY A;  2ZOF A;  4LQG A;  2QVP A;  2GLF A;  4WWV A;  1JQG A;  4MHZ A;  1NSA A;  1IGB A;  4OC0 A;  1HEE A;  3LWU A;  1R3N A;  1V6C A;  3HUV A;  3D7H A;  3B7I A;  4F9V A;  4C9E A;  1H8L A;  5D8N A;  2Q43 A;  2F8H A;  3H8F A;  2NYQ A;  5LRK A;  4YU9 A;  3D66 A;  3PFE A;  5LRG A;  3SI1 A;  3ICU A;  3B35 A;  1FNO A;  5CBM A;  2RFH A;  2PJ9 A;  4AXV A;  1YLO A;  1ZG7 A;  2EK8 A;  3S9L A;  2RB7 A;  2ZEN A;  2PRQ A;  4OC3 A;  3SI0 A;  3IJ3 A;  4PQA A;  3D7D A;  3BI0 A;  1PYT B;  3KHZ A;  5LYI A;  4FBE A;  7CPA A;  3FED A;  1Y9Z A;  3PFO A;  2DEA A;  2ZEH A;  3NA6 A;  2PCU A;  4P4D A;  2J9A A;  1VHE A;  1ARL A;  3PB7 X;  3JRU A;  3B2Y A;  3FVL A;  5K8M A;  1Z2L A;  5CPA A;  2AFW A;  2PJ0 A;  5I4M A;  4JYW A;  2ZEM A;  4C9U A;  2IMO A;  2PJ6 A;  1R43 A;  3FMC A;  5IB9 A;  3KI9 A;  1GYT A;  1ELM P;  5K8O A;  2ZED A;  4Q7A A;  2V8D A;  4C9R A;  4P44 A;  2PJ5 A;  2PVW A;  4A38 A;  2VL1 A;  3DGV A;  4MCR A;  3B3V A;  2F7V A;  4P10 A;  1M4L A;  5JH9 A;  1KWM A;  4C99 A;  3LMS A;  4P4F A;  3PB9 X;  2GLJ A;  1TF8 A;  4EME A;  3NH4 A;  1CPS A;  4IAV A;  1VHO A;  2BOA A;  5F09 A;  3B3S A;  2JBK A;  3RZA A;  3V7Z A;  2IJZ A;  3PB6 X;  4R7M A;  4OC4 A;  3CPA A;  3SJG A;  3CDX A;  4C84 A;  2XEJ A;  2ZEF A;  3KR5 A;  2ABZ A;  4GM5 A;  4MCQ A;  4MMO A;  3WT4 A;  4ZY1 A;  4C8C A;  3CT9 A;  4ONW A;  2PJB A;  3WC7 A;  2V77 A;  5IR2 A;  2CTC A;  2WYR A;  3SJX A;  4NGT A;  5LYL A;  4TJV A;  1EE3 P;  1OBR A;  4NJQ A;  1ARM A;  3ISX A;  2WZN A;  3WAB A;  1LAM A;  1CG2 A;  4C8T A;  3GUX A;  4OC5 A;  3VAT A;  2AFX A;  2PJ3 A;  2PJ8 A;  4X2T A;  4R8F A;  4DYO A;  2I3C A;  1ZG8 A;  3FH4 A;  5HVH A;  2JEW A;  2V8G A;  1RTQ A;  2ZEO A;  1ELL P;  4MCP A;  3D7G A;  4DJL A;  4MXU A;  3NFZ A;  4UEF A;  4R76 A;  4OP4 A;  2PJC A;  3KAS A;  3ISZ A;  4FWU A;  1XBU A;  3B3W A;  4C8U A;  2C6G A;  1F57 A;  2EWB A;  4ZY2 A;  4G1P A;  3PRT A;  4TNU A;  3FEC A;  3KQX A;  4P45 A;  2C6C A;  3BXM A;  1LCP A;  1BPN A;  2JBJ A;  4NGN A;  3SJE A;  5HXD A;  4NGR A;  2O53 A;  2CIJ A;  1XFO A;  1DE4 C;  4UIA A;  2V8H A;  2AFS A;  3RAM A;  4P4J A;  1YME A;  1TKH A;  4UEE A;  4K3N A;  1Z8L A;  2QYV A;  2XEG A;  5HVG A;  1CP6 A;  3RBU A;  4P6Y A;  4NGQ A;  4H2K A;  4IK2 A;  1ZLH A;  3H8G A;  1XMB A;  2XEF A;  3S9N A;  2G9D A;  3I1U A;  3FF3 A;  4O23 A;  2ZEP A;  3BI1 A;  2POK A;  4X8I A;  3WC6 A;  3PEI A;  5LYD A;  3KL9 A;  3GB0 A;  4IHM A;  3T8W A;  4C9A A;  4OME A;  4OID A;  4PXD A;  2XEI A;  3KQZ A;  4NGP A;  2NSM A;  4C9V A;  1QQ9 A;  5K8N A;  5D29 A;  4A37 A;  2ZOG A;  4MRI A;  1LAP A;  4RUH A;  4FUU A;  2V8V A;  4TWE A;  4EWT A;  4R6T A;  1XF1 A;  4TJX A;  4ZI6 A;  4C8A A;  4CPA A;  4UIB A;  4BD9 A;  3EIF A;  2AFU A;  4ZYQ A;  2CF4 A;  1UWY A;  1YW4 A;  3PBB A;  2PIY A;  3VAR A;  2Q51 A;  1AMP A;  5HVF A;  4A39 A;  3IFE A;  3V38 A;  1YSJ A;  3VH9 A;  1BAV A;  2ZEL A;  4A94 A;  4OC2 A;  3H8E A;  2BO9 A;  5ELY A;  3VTA A;  4F9U A;  4OKO A;  4MHN A;  3IO1 A;  1Y0Y A;  3IIB A;  1PCA A;  3K2K A;  5JM6 A;  1WVM A;  2OOT A;  4OIW A;  4F8Z A;  3KHX A;  3MN8 A;  2CTB A;  1TKJ A;  1Q7L A;  2PJ4 A;  1Z5R A;  1LFW A;  3FX6 A;  2ZEG A;  1TKF A;  4MHP A;  1Y7E A;  3D7F A;  3DLJ A;  5J1Q A;  3BHX A;  4KNG E;  4B6Z A;  4P4E A;  4NGM A;  3HLP A;  2C1C A;  4CDJ A;  4UF4 A;  2PE3 A;  5K8P A;  4NGS A;  2O4H A;  1VGY A;  2AFZ A;  4W9Y A;  4YWY A;  3IC1 A;  3D68 A;  1TXR A;  2PIZ A;  2GP4 A;  4C8F A;  4UEZ A;  4YN3 A;  4P4B A;  1HDU A;  2AFM A;  3PB8 X;  4C8P A;  3TC8 A;  4Z65 A;  4ZY0 A;  2QJ8 A;  1BPM A;  4C85 A;  4PXB A;  4PXC A;  1CX8 A;  1HDQ A;  2ANP A;  4JZ0 A;  4DUK A;  4PXE A;  8CPA A;  3QNV A;  4NJR A;  3CPX A;  3IWW A;  3K9T A;  3GLJ A;  5DS0 A;  4ZX8 A;  2ZEE A;  2FVG A;  5LRJ A;  4ZX9 A;  4KSI A;  3D67 A;  1F2P A;  4WJB A;  3TX8 A;  3WC5 A;  1XJO A;  3B3C A;  4MHY A;  3L2N A;  1Y0R A;  3MRU A;  3NH8 A;  2Q4Z A;  3PBE A;  2PJ7 A;  4CDK A;  2HB6 A;  4C86 A;  3S9M A;  1FT7 A;  4OC1 A;  3NH5 A;  1CP7 A;  3KR4 A;  1TF9 A;  4PPZ A;  3N5F A;  1IY7 A;  1LOK A;  2IQ6 A;  4EFD A;  1VIX A;  2PJ1 A;  2C6P A;  2GRE A;  1YW6 A;  2PJA A;  1CBX A;  3IEH A;  3PB4 X;  3B3T A;  2AFO A;  3D4U A;  2BCO A;  4X3R A;  2PVV A;  2GU2 A;  1QMU A;  2OR4 A;  2PJ2 A;  2HC9 A;  4P4I A;  5THW A;  2EK9 A;  3SJF A;  1DTD A;  1F2O A;  6CPA A;  4MCS A;  3FJU A;  1ZLI A;  2C5Q A;  1CPX A;  1ZG9 A;  4NFR A;  4FAI A;  5LYF A;  3KZW A;  1BLL E;  1LAN A;  3I6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...