2PVVA

Structure of human glutamate carboxypeptidase ii (gcpii) in complex with l-serine-o-sulfate
Total Genus 258
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
258
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 258
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2pvvA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pvvA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2pvvA02
5LRGA 4OC3A 2JBKA 1Y9ZA 4A94A 3JRUA 1IY7A 4X3RA 2PJ4A 2Q51A 4O23A 1ZG7A 4JYWA 2FVGA 4DYOA 5I4MA 3IJ3A 4C9VA 3KI9A 1M4LA 4P4FA 4TNUA 2XEFA 3PFOA 3SJEA 2AFMA 4ZX8A 4C9AA 3IFEA 2G9DA 4Z65A 4UEZA 1BPMA 3LWUA 2PCUA 3V7ZA 4OP4A 5LYIA 2ANPA 2V8VA 4TWEA 4ZY2A 3FH4A 5IB9A 1R3NA 2CIJA 2ZEOA 1F2PA 1TF9A 1CG2A 1FNOA 4C8TA 1TKJA 3RBUA 1AYEA 5D29A 1DE4C 2PJBA 3D68A 4FAIA 3WC7A 3NH5A 3ISXA 4MHYA 2PVWA 3BHXA 3KQXA 5LRJA 3SI1A 3N5FA 4NGQA 4NGSA 4P4BA 3WT4A 3D7GA 4OC2A 4OIWA 2JBJA 4MRIA 3MN8A 3ISZA 1LAPA 4NGPA 1Q7LA 2PJCA 3H8GA 2GREA 4EWTA 4YU9A 4MCRA 2PJ5A 3IO1A 5K8MA 3IIBA 4NGNA 3KR5A 4KNGE 5LYFA 2ZEHA 2PIZA 2BOAA 1Y7EA 4DJLA 1XMBA 5LRKA 1AMPA 1ELMP 3KL9A 2EK8A 4EMEA 3FJUA 4H2KA 4IHMA 3PBBA 3PEIA 4PXBA 5JGFA 4K3NA 4C85A 2C6CA 1R43A 4PXCA 2PJ8A 7CPAA 3CDXA 1ARLA 4P4JA 1LANA 3BI1A 2VL1A 3B2YA 4OC1A 4NFRA 4C8PA 3KHZA 3S9MA 4NJRA 2ZEGA 1Z2LA 4C9UA 1TF8A 3TC8A 4A39A 2CTBA 3DGVA 2PE3A 1Y0RA 3FVLA 5CBMA 4YN3A 2ZEDA 1PYTB 1Y0YA 1F2OA 5CPAA 1XBUA 2AFWA 4YWYA 5ELYA 3FECA 3S9LA 1CPSA 3I1UA 3T8WA 3D7HA 3RZAA 1ZLIA 4R76A 1YW6A 5J1QA 5LYLA 4F9VA 3WC6A 1TXRA 4X2TA 2XEJA 4R8FA 4BD9A 4P4DA 1DTDA 2XEGA 3B3WA 2V8GA 1NSAA 1RTQA 4PPZA 4P6YA 3H8FA 3GLJA 2GLFA 2XEIA 5F09A 3CPAA 3DLJA 4C99A 4OC4A 2J9AA 1BAVA 1ZG9A 2RFHA 2ZEFA 1CP7A 3I6SA 4P45A 2BCOA 3FX6A 4FBEA 4P4IA 2F7VA 4P44A 3TX8A 3CT9A 4PXDA 1QMUA 1YSJA 1H8LA 2ZEEA 1LAMA 3IEHA 1FT7A 1YW4A 3KASA 2PJ0A 4NGRA 4AXVA 4ZYQA 5HXDA 4JZ0A 1VHOA 3HUVA 1XRYA 3B3TA 3B7IA 3KZWA 4TJXA 2V77A 2C1CA 4CDJA 1Z5RA 3ICUA 3PB6X 3NFZA 4B6ZA 4NGMA 1YLOA 2PIYA 4OKOA 4NJQA 3WABA 4CPAA 4ZY1A 4R7MA 3LMSA 2DEAA 3SI2A 2PRQA 4ONWA 4MCPA 4C84A 2PJ7A 4C8FA 4TJVA 3FEDA 4MXUA 2QJ8A 1JQGA 2V8HA 3CPXA 3B3SA 4OMEA 1BLLE 1IGBA 4OIDA 4WJBA 4C9RA 1F57A 4R6TA 4P10A 1OBRA 3PB7X 1KWMA 3L2NA 3V38A 4NGTA 1TKFA 4C9EA 1LOKA 3H8EA 4UIAA 3IWWA 2I3CA 2NSMA 4C8CA 1VIXA 2GLJA 3NH8A 1BPNA 4FUUA 1LFWA 2CTCA 4C8AA 3FMCA 2V8DA 3NA6A 3WC5A 4EFDA 4RUHA 4C8UA 3S9NA 3K2KA 1CP6A 1XJOA 2EK9A 2ZOGA 2O4HA 1HEEA 1VHEA 3KGQA 1Z8LA 4IK2A 2POKA 5K8PA 4F8ZA 3EIFA 2GU2A 2WYRA 3B35A 4A38A 1VGYA 2PVVA 3RAMA 3I74A 4P4EA 1YMEA 4PQAA 4OC5A 2ABZA 1EE3P 2BO9A 2ZELA 5JH9A 2EWBA 2HB6A 4KSIA 3MRUA 3KHXA 3HLPA 2PJ3A 3SJGA 2ZEMA 2PJAA 3NH4A 2OOTA 1QQ9A 2QVPA 1ZG8A 4FWUA 3VH9A 3GB0A 2AFXA 4X8IA 2PJ1A 3D7FA 1PCAA 3IC1A 3D4UA 2WZNA 3PB8X 3BI0A 2HC9A 4ZI6A 5HVGA 2IQ6A 4MHZA 4UEFA 4G1PA 2O53A 3PB9X 2C6PA 2CF4A 2Q4ZA 4UIBA 3VARA 1XFOA 4IAVA 2AFZA 3PFEA 3KR4A 2ZENA 4Q7AA 5HVHA 3SJXA 3D66A 1TKHA 1ELLP 1LCPA 4GM5A 4MMOA 4A37A 3D67A 4OC0A 3PRTA 2NYQA 2ZOFA 1CX8A 1UWYA 3KQZA 3SI0A 1ARMA 4ZX9A 1CPXA 3FEEA 3PBEA 5DS0A 4LQGA 3GUXA 3D7DA 2F8HA 3K9TA 3QNVA 3BXMA 5K8OA 4W9YA 3B3VA 1CBXA 4ZY0A 1ZLHA 2AFUA 4MHNA 4UEEA 5LYDA 1HDQA 2PJ2A 4WWVA 1HDUA 4DUKA 2IMOA 4PXEA 5HVFA 3PB4X 4MHPA 3SJFA 2JEWA 2Q43A 2QYVA 2PJ9A 5JM6A 1GYTA 5THWA 4F9UA 1WVMA 3VTAA 2IJZA 3FF3A 4MCSA 1XF1A 2ZEPA 8CPAA 2RB7A 1V6CA 3VATA 3B3CA 4CDKA 4C86A 2AFOA 4UF4A 2AFSA 5D8NA 2PJ6A 2C6GA 4MCQA 5K8NA 2OR4A 6CPAA
chains in the Genus database with same CATH superfamily
1C30B 1IICA 5LRGA 4OC3A 2EBJA 2JBKA 2Z10A 1Y9ZA 3WR7A 4MY3A 4A94A 2CNSA 3GY9A 1IY7A 3G3SA 3JRUA 4MBUA 4F6AA 4X3RA 2PJ4A 2Q51A 3GIUA 4O23A 1NXJA 4RI1A 3BUWB 1ZG7A 4JYWA 1QSNA 2DXQA 3PGPA 5IV0A 3TLAA 3HPHE 4HNYB 2FVGA 4CYPA 2MP0A 1Y9WA 4DYOA 1TIQA 4KOXA 5I4MA 3IJ3A 1Q2DA 4C9VA 3KI9A 4LQ6A 1M4LA 4COBA 4QBJA 3E0KA 4P4FA 4TNUA 3KRVA 2XEFA 2FS5A 3PFOA 4YGOA 4QC6A 3T90A 3SJEA 4A2ZA 4F0YA 4KORA 5KTDA 1IOIA 2HQYA 2AFMA 4FD7A 2VZYA 1JDBC 1JDEA 4ZX8A 5F13A 4E94A 3OP0A 4C9AA 4CAWA 3T07A 4C99A 4L8AA 2HUZA 4B5PB 3EC4A 3IFEA 2G9DA 4Z65A 4B5OA 2VEZA 4UEZA 1BPMA 5JQ4A 2VKZG 3VWDA 5ISVA 4AG9A 1J4JA 2DF5A 3LWUA 2YJVA 1FBVA 3R96A 1WJTA 2PCUA 4KZTA 3V7ZA 3F0AA 3R9GA 3K4IA 1YREA 1I1DA 4OP4A 5LYIA 1WK4A 2ANPA 1B87A 3F5BA 3RO0A 2V8VA 2B4BA 4EVYA 4Q36A 4TWEA 4ZY2A 3FH4A 5IB9A 4UFVA 2E28A 3ZNIA 4OADA 1R3NA 4CAVA 2CIJA 2ZEOA 1F2PA 1S7FA 2B5GB 2FT0A 2EUIA 5BY0A 4UBRA 4CO9A 2OH1A 3O8ZA 4KOVA 1TF9A 4M6IA 4YRHA 1CG2A 1FNOA 4B13A 5DWNA 1I12A 2EZAA 5K99A 4B10A 4C8TA 1TKJA 3W6XA 3RBUA 1AYEA 4DNCA 3BJ8A 5D29A 2FSRA 1Y7RA 1DE4C 1ZO0A 2PJBA 4COGA 5JYBA 2ZW4A 3D68A 3WC7A 4FAIA 1X12A 3NH5A 3ISXA 4MHYA 2PVWA 1EZAA 3BHXA 3KQXA 5LRJA 3SI1A 4NGQA 4NGSA 2WPWA 4P4BA 3N5FA 3WT4A 5IX3A 3D7GA 4OC2A 3H5ZA 4OIWA 3SXNA 3TLEA 5HH1A 2HWGA 2JBJA 3G8WA 2OB0A 2OZUA 3MN8A 2GIVA 3ISZA 1LAPA 2FL4A 4MRIA 4AG7A 1S7LA 4NGPA 3K9UA 1CJWA 1Q7LA 2PJCA 1UFHA 4A30A 3H8GA 2GREA 4LX9A 1XOVA 2B4DA 3R9FA 1KUYA 2FXFA 2PSWA 4YU9A 4EWTA 3VWEA 4ZGYB 4MCRA 2PJ5A 4UFWA 3IO1A 4C2XA 2Y0MA 4PK3A 5K8MA 1EO0A 3PZJA 2X0SA 3IIBA 4CGOA 3S6FA 4NGNA 2Z0ZA 3KR5A 1P0HA 4AVAA 2Z3NA 5LYFA 2IL4A 4MHDA 2ZEHA 4KNGE 2EVNA 2PIZA 2BOAA 4XNHC 5A27A 3W91A 1BO4A 1U6MA 1Y7EA 1JWQA 4DJLA 1XMBA 3CZXA 2VXKA 5LRKA 1AMPA 1XIXA 5I0CA 1ELMP 2D4PA 3KL9A 2CBLA 2X7BA 4KOWA 4QUSA 2EK8A 1Z4RA 4KVME 4NXYA 2VI7A 1XMTA 4EMEA 5JPHA 3FJUA 4E5SA 1PU9A 4H2KA 3IWGA 4E2AA 3I9SA 4IHMA 3PBBA 3PEIA 4KLVA 4MY0A 2O28A 4PXBA 5JGFA 2JDDA 4C2ZA 4K3NA 4C85A 2C6CA 1R43A 4PXCA 4JXRA 2PJ8A 7CPAA 5IB0A 3CDXA 5E96A 4A4CA 1ARLA 4MFKA 4P4JA 1LANA 3QB8A 3BI1A 2VL1A 3B2YA 3HMJG 4MFQA 2P6FA 2HROA 3DSBA 4OC1A 4KSAA 4UWIA 1IOFA 4II9A 3D2MA 4NFRA 4C8PA 3TO9A 4Y49B 1ON0A 3KHZA 2QIRA 3GJZA 3S9MA 3OWCA 4A4BA 4JLYA 2ZEGA 4NJRA 2Q4VA 1YGHA 5H86A 1Z2LA 1DIKA 1K4JA 4C9UA 4PSWA 3TT2A 1TF8A 3TC8A 1KEEB 1NBWA 4MJXA 4A39A 1L0CA 2CTBA 3DGVA 2PE3A 1Y0RA 5G22A 4A31A 4FD4A 2R7HA 1GHEA 5AG4A 3C8OA 3BUOB 3FVLA 1VHSA 4KVOE 2G0BA 5CBMA 4YN3A 3EZEA 1N71A 1PYTB 1Y0YA 2G3TA 2ZEDA 3IWEA 2HI6A 3FBUA 1F2OA 4A33A 5CPAA 1XBUA 2AFWA 4R3KA 4YWYA 3TTHA 1A2ZA 3TO7A 4EYSA 2D0PA 3U1BA 4QB9A 1KUVA 5ELYA 2ZW6A 4UCNA 2WUUA 3FECA 3GYAA 3S9LA 4IF5A 5AG7A 5IR2A 2B58A 1CPSA 3I1UA 1XE4A 3T8WA 4M6GA 3D7HA 4MJ8A 1YQEA 2PR1A 3S6GA 3RZAA 1ZLIA 1YVKA 3NFQA 2A4NA 2Q4YA 4R76A 1YW6A 4H6ZA 2ARHA 5J1QA 1IYLA 1S3ZA 1Y9KA 5LYLA 4F9VA 2B0AA 1Z8TA 3W6SA 1P4NA 2XPNA 1TXRA 2NMTA 3D3SA 4X2TA 5EBVA 2XEJA 3FYNA 3VRRA 3TLYA 4R8FA 1C3OB 5HKWA 4GPLB 4BD9A 2I79A 4NSQA 5FVJA 4P4DA 2AUMA 1S5KA 3EXNA 2J8NA 2PC1A 1DTDA 2XEGA 3B3WA 2V8GA 2Q7BA 4KSFA 4BPXB 1Z9EA 1NSAA 4R57A 2FIWA 2DIKA 1RTQA 4U9YA 4PPZA 4UWJA 5KTCA 1MJAA 1Z9UA 2I00A 4P6YA 3H8FA 3GLJA 2CY2A 3R1KA 2B4JC 2GLFA 2XEIA 2BL1A 2WPXA 5F09A 1QSOA 3CPAA 3DLJA 3RYOA 4OC4A 2J9AA 5F49A 4UCMA 1BAVA 1ZG9A 1NSLA 2RFHA 2ZEFA 1CP7A 1BXRB 3I6SA 4P45A 2BCOA 2D4OA 2P6GA 3FX6A 4FBEA 4P4IA 3FXTA 2F7VA 4P44A 5C82A 2YNDA 3FB3A 4RS2A 2C5QA 2YNCC 2B4DB 4CYQA 1VKCA 3CXPA 1VBHA 3T05A 4CGLA 2G3AA 3TX8A 3CT9A 3TCVA 1R61A 5G20A 4KS9A 1M1DA 4A32A 4R3LA 4PXDA 1QMUA 1YSJA 3TYXA 1H8LA 1IIDA 2B3UA 3BLNA 4CGNA 2ZEEA 3NOJA 1LAMA 3IEHA 2EZBA 4J3GA 4KOTA 1FT7A 4BMHA 3PP9A 1T36B 1YW4A 2P6EA 1Z8WA 4B11A 3KASA 4KVXA 2PJ0A 5HMNA 5F47A 3PFVA 3S6HA 4NGRA 1YR0A 2P0WA 4AXVA 1V0CA 4ZYQA 5HXDA 4JZ0A 1VHOA 5KTAA 2QECA 4BPWB 3HUVA 4CAXA 1VBGA 2YNCA 4H1HA 1Z4EA 1XRYA 3B3TA 3B7IA 3KZWA 4TJXA 2V77A 2C1CA 4CDJA 1Z5RA 4FD5A 1MJBA 1XF1A 3ICUA 2YNEA 1KZFA 3C26A 3NFZA 3PB6X 4B6ZA 4NGMA 1YLOA 2JDCA 2PIYA 3CXSA 1YLEA 2ATRA 3LACA 4NJQA 4OKOA 3WABA 5GCNA 2KCWA 1RXTA 1PUAA 1X10A 4XNHB 4CPAA 2J8RA 3UY5A 4R7MA 4ZY1A 1M44A 5F48A 3FIXA 3LMSA 4B14A 2DEAA 5H84A 2BEIA 1S7NA 2EO8A 1MK4A 2DPTA 4LUAA 3OB2B 2PRQA 3SI2A 3B8GA 4ONWA 4MCPA 4C84A 2PJ7A 3MGDA 4C8FA 4TJVA 2N3AB 3FEDA 4MXUA 4CYOA 3OAKA 1YX0A 2QJ8A 2DPSA 1JQGA 4E8OA 2XPPA 2V8HA 3CPXA 4C7HA 3B3SA 4OMEA 1BLLE 4JD6A 1IGBA 4KUBA 4OIDA 5F46A 4WJBA 2PR8A 4C9RA 1GGOA 3BUMB 1F57A 4R6TA 3VRPA 2H5MA 3GKRA 4P10A 1OBRA 1EZBA 3PB7X 4KUAA 1KWMA 2YGWA 4XPDC 3L2NA 3V38A 4NGTA 1TKFA 2PCNA 4C9EA 4R87A 1LOKA 3H8EA 4UIAA 5F9MA 3IWWA 2I3CA 2Y1NA 3DR8A 2NSMA 4IUSA 3EY5A 3TE4A 3TOBA 4C8CA 1B6BA 1CM0A 1VIXA 1BPNA 2GLJA 3NH8A 3QAYA 4FUUA 4KLWA 1LFWA 2CTCA 3TLCA 1ZYMA 3H4QA 4C8AA 3FMCA 2Z3LA 2V8DA 3NA6A 3WC5A 4EFDA 2CNTA 4RUHA 3TLGA 2OLSA 4C8UA 1NMTA 3SR3A 1S7KA 3R9EA 2VBQA 3I3GA 3S9NA 3K2KA 1CP6A 1XF8A 4UCPA 2EZCA 1XJOA 4IIXA 3HPGG 5HKZA 4CAEA 2EK9A 1WWZA 2ZOGA 2Z3KA 1J3LA 1BOBA 2O4HA 1HEEA 1VHEA 3KGQA 1Z8LA 4IK2A 2POKA 3IU2A 4MFJA 1M4GA 2CXAA 5K8PA 3PT1A 2ODFA 4F8ZA 3EIFA 2GU2A 4CYNA 2WYRA 5J8CA 5CNPA 3B35A 4A38A 3ZJ0A 4YFJA 2VQYA 3TO6A 2OU2A 1VGYA 2GP4A 2PVVA 4X5KA 3RAMA 3A9LA 3I74A 2GFQA 4P4EA 4K30A 1YMEA 4PQAA 4OC5A 2ABZA 3F8KA 4PV6A 1EE3P 2BO9A 2Q44A 1S60A 2ZELA 3JVNA 4PK2A 2EWBA 2HB6A 3BJ7A 5EC4A 4AB7A 4KSIA 5JH9A 2AUNA 3MRUA 3KHXA 3QAHA 3RNZA 2ZXVA 3NE7A 1CS0B 1CE8B 3HLPA 3P2HA 3EFAA 2PRBA 2PJ3A 3SJGA 1LRZA 2R98A 2ZEMA 4MFLA 2PJAA 3NH4A 2OOTA 1QQ9A 2FIAA 3VRNA 2PQ8A 1KC7A 4J0NA 4U5YA 1QSRA 2QVPA 1ZG8A 4ZBGA 4FWUA 1VI4A 3VH9A 4UA3A 3EZBA 2REFA 1IYKA 4GS4A 2F5IA 2Q7SA 2CNMA 1M4DA 3GB0A 2AFXA 3DNSA 4CS0B 4X8IA 5C88A 2PJ1A 3D7FA 2XPOA 1PCAA 3IC1A 3F9KC 3D4UA 2WZNA 3PB8X 2BSWA 3BI0A 2HC9A 2RC4A 4ZI6A 5HVGA 2IQ6A 3VRQA 4MHZA 2AJ6A 4UEFA 3FNCA 4G1PA 2O53A 4GXHA 4C2YA 5G1ZA 2Y1MA 5G21A 3CXQA 2UV8G 3PB9X 2C6PA 2CF4A 2Q4ZA 4M8DA 4UIBA 3VARA 4AVCA 3TLBA 2Q0YA 2Q04A 2XPLA 4OAEA 2Z11A 3IGRA 1XFOA 4IAVA 3TLZA 2AFZA 4CZ1A 1QSMA 2JEVA 3PFEA 2AE6A 3KR4A 4JVOA 3KKWA 3R95A 4CRYB 2ZENA 1QSTA 4QVTA 3PLFB 4Q7AA 4AVBA 3SJXA 3D66A 4M6HA 5HVHA 2Z3PA 2DLAA 4MFPA 1TKHA 3D8PA 1ELLP 4NF1A 1LCPA 4GM5A 2K5TA 4C68A 4CAFA 4MMOA 4A37A 1YK3A 3D67A 4B5PA 3IU1A 4A95A 4INJA 4M85A 4OC0A 4UFXA 3ZZIA 4HKFA 3JTKA 5AG5A 3N7ZA 1KUXA 1MJ9A 4H89A 5J8FA 2R1IA 3PRTA 4PSXA 3TOAA 2NYQA 4HNWB 3U88C 2R82A 1OZPA 1CX8A 2J8MA 1UWYA 2ZOFA 4HNXB 4JWPA 4XPKA 3WC6A 1M6VB 3S6KA 2Z3MA 4IIYA 3KQZA 2ZW5A 3SI0A 2FCKA 5EMIA 1R57A 1ARMA 5AXIA 3OB1B 1CPXA 3FEEA 4ZX9A 3PBEA 1Q2YA 5DS0A 4MI1A 4LQGA 1NE9A 2B5GA 3D7DA 2F8HA 1B47A 3GUXA 5DWMA 4E0AA 3K9TA 3QNVA 4JJXA 5BWAB 2FE7A 3BXMA 2R8VA 3LODA 5K8OA 4W9YA 2B3VA 3TLGB 2ZW7A 3B3VA 4F0XA 1CBXA 4L89A 4ONUA 4ZY0A 5F1YA 2JLMA 4R9MA 1ZLHA 2VZZA 4XPLA 2AFUA 1FY7A 1RO5A 3VGOA 3DR6A 3JUWA 4MHNA 4OLLA 4UEEA 4RN7A 4C7IA 3BUNB 2Z3OA 1IB1E 1IU8A 4KOSA 2C27A 3VROA 2YJTA 4XPDB 5LYDA 1HDQA 1XEBA 2PJ2A 2ZPAA 4KOUA 3V8IA 3EZAA 3T0TA 1Q2CA 4H6UA 4WWVA 2GE3A 1HDUA 4HPSA 4DUKA 1Q5XA 2IMOA 4CGMA 4PXEA 5HVFA 3P2FA 2OZHA 3PB4X 5AG6A 3T9YA 3D2PA 4MHPA 5F5XA 4BINA 5JVLA 3SJFA 2JEWA 4MFZA 1YVOA 2Q43A 1YVHA 2BUEA 3EO4A 4M3SA 1A9XB 2D0OA 2QYVA 2PJ9A 2FM4A 5JM6A 1GYTA 5THWA 5FD8A 2PDOA 4F9UA 1WVMA 3VTAA 5HKYA 1I21A 4FD6A 3T5MA 2HV2A 3TFYA 2WSAA 2IJZA 4Q38A 3FF3A 4MCSA 4NCZA 4Y49C 1SQHA 2GANA 1AUGA 2ZEPA 4U9ZA 4BPUB 1Z8XA 2RB7A 3BUXB 4I49A 3SHPA 8CPAA 4BTFA 1ZL0A 1V6CA 1M4IA 1KBLA 3DDDA 3SXOA 4NEXA 4B12A 3FRMA 3VATA 4BBHA 3B3CA 4CDKA 4C86A 3LD2A 4RR2B 2OZGA 2REEA 2AFOA 3G23A 4MI4A 2AFSA 4JXQA 4UF4A 5AGEA 4CGPA 4KOYA 2PJ6A 5D8NA 2C6GA 4MCQA 5K8NA 2OR4A 2QMLA 5J3XA 4CRZB 5A28A 1ZRSA 4ORFA 3NE8A 6CPAA
chains in the Genus database with same CATH topology
5LRGA 4OC3A 2JBKA 1Y9ZA 4A94A 3JRUA 1IY7A 4X3RA 2PJ4A 2Q51A 4O23A 1ZG7A 4JYWA 2FVGA 4DYOA 5I4MA 3IJ3A 4C9VA 3KI9A 1M4LA 4P4FA 4TNUA 2XEFA 3PFOA 3SJEA 2AFMA 4ZX8A 4C9AA 3IFEA 2G9DA 4Z65A 4UEZA 1BPMA 3LWUA 2PCUA 3V7ZA 4OP4A 5LYIA 2ANPA 2V8VA 4TWEA 4ZY2A 3FH4A 5IB9A 1R3NA 2CIJA 2ZEOA 1F2PA 1TF9A 1CG2A 1FNOA 4C8TA 1TKJA 3RBUA 1AYEA 5D29A 1DE4C 2PJBA 3D68A 4FAIA 3WC7A 3NH5A 3ISXA 4MHYA 2PVWA 3BHXA 3KQXA 5LRJA 3SI1A 3N5FA 4NGQA 4NGSA 4P4BA 3WT4A 3D7GA 4OC2A 4OIWA 2JBJA 4MRIA 3MN8A 3ISZA 1LAPA 4NGPA 1Q7LA 2PJCA 3H8GA 2GREA 4EWTA 4YU9A 4MCRA 2PJ5A 3IO1A 5K8MA 3IIBA 4NGNA 3KR5A 4KNGE 5LYFA 2ZEHA 2PIZA 2BOAA 1Y7EA 4DJLA 1XMBA 5LRKA 1AMPA 1ELMP 3KL9A 2EK8A 4EMEA 3FJUA 4H2KA 4IHMA 3PBBA 3PEIA 4PXBA 5JGFA 4K3NA 4C85A 2C6CA 1R43A 4PXCA 2PJ8A 7CPAA 3CDXA 1ARLA 4P4JA 1LANA 3BI1A 2VL1A 3B2YA 4OC1A 4NFRA 4C8PA 3KHZA 3S9MA 4NJRA 2ZEGA 1Z2LA 4C9UA 1TF8A 3TC8A 4A39A 2CTBA 3DGVA 2PE3A 1Y0RA 3FVLA 5CBMA 4YN3A 2ZEDA 1PYTB 1Y0YA 1F2OA 5CPAA 1XBUA 2AFWA 4YWYA 5ELYA 3FECA 5IR2A 3S9LA 1CPSA 3I1UA 3T8WA 3D7HA 3RZAA 1ZLIA 4R76A 1YW6A 5J1QA 5LYLA 4F9VA 3WC6A 1TXRA 4X2TA 2XEJA 4R8FA 4BD9A 4P4DA 1DTDA 2XEGA 3B3WA 2V8GA 1NSAA 1RTQA 4PPZA 4P6YA 3H8FA 3GLJA 2GLFA 2XEIA 5F09A 3CPAA 3DLJA 4C99A 4OC4A 2J9AA 1BAVA 1ZG9A 2RFHA 2ZEFA 1CP7A 3I6SA 4P45A 2BCOA 3FX6A 4FBEA 4P4IA 2F7VA 4P44A 2C5QA 3TX8A 3CT9A 4PXDA 1QMUA 1YSJA 1H8LA 2ZEEA 1LAMA 3IEHA 1FT7A 1YW4A 3KASA 2PJ0A 4NGRA 4AXVA 4ZYQA 5HXDA 4JZ0A 1VHOA 3HUVA 1XRYA 3B3TA 3B7IA 3KZWA 4TJXA 2V77A 2C1CA 4CDJA 1Z5RA 3ICUA 3PB6X 3NFZA 4B6ZA 4NGMA 1YLOA 2PIYA 4OKOA 4NJQA 3WABA 4CPAA 4ZY1A 4R7MA 3LMSA 2DEAA 3SI2A 2PRQA 4ONWA 4MCPA 4C84A 2PJ7A 4C8FA 4TJVA 3FEDA 4MXUA 2QJ8A 1JQGA 2V8HA 3CPXA 3B3SA 4OMEA 1BLLE 1IGBA 4OIDA 4WJBA 4C9RA 1F57A 4R6TA 4P10A 1OBRA 3PB7X 1KWMA 3L2NA 3V38A 4NGTA 1TKFA 4C9EA 1LOKA 3H8EA 4UIAA 3IWWA 2I3CA 2NSMA 4C8CA 1VIXA 2GLJA 3NH8A 1BPNA 4FUUA 1LFWA 2CTCA 4C8AA 3FMCA 2V8DA 3NA6A 3WC5A 4EFDA 4RUHA 4C8UA 3S9NA 3K2KA 1CP6A 1XJOA 2EK9A 2ZOGA 2O4HA 1HEEA 1VHEA 3KGQA 1Z8LA 4IK2A 2POKA 5K8PA 4F8ZA 3EIFA 2GU2A 2WYRA 3B35A 4A38A 1VGYA 2GP4A 2PVVA 3RAMA 3I74A 4P4EA 1YMEA 4PQAA 4OC5A 2ABZA 1EE3P 2BO9A 2ZELA 5JH9A 2EWBA 2HB6A 4KSIA 3MRUA 3KHXA 3HLPA 2PJ3A 3SJGA 2ZEMA 2PJAA 3NH4A 2OOTA 1QQ9A 2QVPA 1ZG8A 4FWUA 3VH9A 3GB0A 2AFXA 4X8IA 2PJ1A 3D7FA 1PCAA 3IC1A 3D4UA 2WZNA 3PB8X 3BI0A 2HC9A 4ZI6A 5HVGA 2IQ6A 4MHZA 4UEFA 4G1PA 2O53A 3PB9X 2C6PA 2CF4A 2Q4ZA 4UIBA 3VARA 1XFOA 4IAVA 2AFZA 3PFEA 3KR4A 2ZENA 4Q7AA 5HVHA 3SJXA 3D66A 1TKHA 1ELLP 1LCPA 4GM5A 4MMOA 4A37A 3D67A 4OC0A 3PRTA 2NYQA 2ZOFA 1CX8A 1UWYA 3KQZA 3SI0A 1ARMA 4ZX9A 1CPXA 3FEEA 3PBEA 5DS0A 4LQGA 3GUXA 3D7DA 2F8HA 3K9TA 3QNVA 3BXMA 5K8OA 4W9YA 3B3VA 1CBXA 4ZY0A 1ZLHA 2AFUA 4MHNA 4UEEA 5LYDA 1HDQA 2PJ2A 4WWVA 1HDUA 4DUKA 2IMOA 4PXEA 5HVFA 3PB4X 4MHPA 3SJFA 2JEWA 2Q43A 2QYVA 2PJ9A 5JM6A 1GYTA 5THWA 4F9UA 1WVMA 3VTAA 2IJZA 3FF3A 4MCSA 1XF1A 2ZEPA 8CPAA 2RB7A 1V6CA 3VATA 3B3CA 4CDKA 4C86A 2AFOA 4UF4A 2AFSA 5D8NA 2PJ6A 2C6GA 4MCQA 5K8NA 2OR4A 6CPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LRG A;  4OC3 A;  2JBK A;  1Y9Z A;  4A94 A;  3JRU A;  1IY7 A;  4X3R A;  2PJ4 A;  2Q51 A;  4O23 A;  1ZG7 A;  4JYW A;  2FVG A;  4DYO A;  5I4M A;  3IJ3 A;  4C9V A;  3KI9 A;  1M4L A;  4P4F A;  4TNU A;  2XEF A;  3PFO A;  3SJE A;  2AFM A;  4ZX8 A;  4C9A A;  3IFE A;  2G9D A;  4Z65 A;  4UEZ A;  1BPM A;  3LWU A;  2PCU A;  3V7Z A;  4OP4 A;  5LYI A;  2ANP A;  2V8V A;  4TWE A;  4ZY2 A;  3FH4 A;  5IB9 A;  1R3N A;  2CIJ A;  2ZEO A;  1F2P A;  1TF9 A;  1CG2 A;  1FNO A;  4C8T A;  1TKJ A;  3RBU A;  1AYE A;  5D29 A;  1DE4 C;  2PJB A;  3D68 A;  4FAI A;  3WC7 A;  3NH5 A;  3ISX A;  4MHY A;  2PVW A;  3BHX A;  3KQX A;  5LRJ A;  3SI1 A;  3N5F A;  4NGQ A;  4NGS A;  4P4B A;  3WT4 A;  3D7G A;  4OC2 A;  4OIW A;  2JBJ A;  4MRI A;  3MN8 A;  3ISZ A;  1LAP A;  4NGP A;  1Q7L A;  2PJC A;  3H8G A;  2GRE A;  4EWT A;  4YU9 A;  4MCR A;  2PJ5 A;  3IO1 A;  5K8M A;  3IIB A;  4NGN A;  3KR5 A;  4KNG E;  5LYF A;  2ZEH A;  2PIZ A;  2BOA A;  1Y7E A;  4DJL A;  1XMB A;  5LRK A;  1AMP A;  1ELM P;  3KL9 A;  2EK8 A;  4EME A;  3FJU A;  4H2K A;  4IHM A;  3PBB A;  3PEI A;  4PXB A;  5JGF A;  4K3N A;  4C85 A;  2C6C A;  1R43 A;  4PXC A;  2PJ8 A;  7CPA A;  3CDX A;  1ARL A;  4P4J A;  1LAN A;  3BI1 A;  2VL1 A;  3B2Y A;  4OC1 A;  4NFR A;  4C8P A;  3KHZ A;  3S9M A;  4NJR A;  2ZEG A;  1Z2L A;  4C9U A;  1TF8 A;  3TC8 A;  4A39 A;  2CTB A;  3DGV A;  2PE3 A;  1Y0R A;  3FVL A;  5CBM A;  4YN3 A;  2ZED A;  1PYT B;  1Y0Y A;  1F2O A;  5CPA A;  1XBU A;  2AFW A;  4YWY A;  5ELY A;  3FEC A;  3S9L A;  1CPS A;  3I1U A;  3T8W A;  3D7H A;  3RZA A;  1ZLI A;  4R76 A;  1YW6 A;  5J1Q A;  5LYL A;  4F9V A;  3WC6 A;  1TXR A;  4X2T A;  2XEJ A;  4R8F A;  4BD9 A;  4P4D A;  1DTD A;  2XEG A;  3B3W A;  2V8G A;  1NSA A;  1RTQ A;  4PPZ A;  4P6Y A;  3H8F A;  3GLJ A;  2GLF A;  2XEI A;  5F09 A;  3CPA A;  3DLJ A;  4C99 A;  4OC4 A;  2J9A A;  1BAV A;  1ZG9 A;  2RFH A;  2ZEF A;  1CP7 A;  3I6S A;  4P45 A;  2BCO A;  3FX6 A;  4FBE A;  4P4I A;  2F7V A;  4P44 A;  3TX8 A;  3CT9 A;  4PXD A;  1QMU A;  1YSJ A;  1H8L A;  2ZEE A;  1LAM A;  3IEH A;  1FT7 A;  1YW4 A;  3KAS A;  2PJ0 A;  4NGR A;  4AXV A;  4ZYQ A;  5HXD A;  4JZ0 A;  1VHO A;  3HUV A;  1XRY A;  3B3T A;  3B7I A;  3KZW A;  4TJX A;  2V77 A;  2C1C A;  4CDJ A;  1Z5R A;  3ICU A;  3PB6 X;  3NFZ A;  4B6Z A;  4NGM A;  1YLO A;  2PIY A;  4OKO A;  4NJQ A;  3WAB A;  4CPA A;  4ZY1 A;  4R7M A;  3LMS A;  2DEA A;  3SI2 A;  2PRQ A;  4ONW A;  4MCP A;  4C84 A;  2PJ7 A;  4C8F A;  4TJV A;  3FED A;  4MXU A;  2QJ8 A;  1JQG A;  2V8H A;  3CPX A;  3B3S A;  4OME A;  1BLL E;  1IGB A;  4OID A;  4WJB A;  4C9R A;  1F57 A;  4R6T A;  4P10 A;  1OBR A;  3PB7 X;  1KWM A;  3L2N A;  3V38 A;  4NGT A;  1TKF A;  4C9E A;  1LOK A;  3H8E A;  4UIA A;  3IWW A;  2I3C A;  2NSM A;  4C8C A;  1VIX A;  2GLJ A;  3NH8 A;  1BPN A;  4FUU A;  1LFW A;  2CTC A;  4C8A A;  3FMC A;  2V8D A;  3NA6 A;  3WC5 A;  4EFD A;  4RUH A;  4C8U A;  3S9N A;  3K2K A;  1CP6 A;  1XJO A;  2EK9 A;  2ZOG A;  2O4H A;  1HEE A;  1VHE A;  3KGQ A;  1Z8L A;  4IK2 A;  2POK A;  5K8P A;  4F8Z A;  3EIF A;  2GU2 A;  2WYR A;  3B35 A;  4A38 A;  1VGY A;  2PVV A;  3RAM A;  3I74 A;  4P4E A;  1YME A;  4PQA A;  4OC5 A;  2ABZ A;  1EE3 P;  2BO9 A;  2ZEL A;  5JH9 A;  2EWB A;  2HB6 A;  4KSI A;  3MRU A;  3KHX A;  3HLP A;  2PJ3 A;  3SJG A;  2ZEM A;  2PJA A;  3NH4 A;  2OOT A;  1QQ9 A;  2QVP A;  1ZG8 A;  4FWU A;  3VH9 A;  3GB0 A;  2AFX A;  4X8I A;  2PJ1 A;  3D7F A;  1PCA A;  3IC1 A;  3D4U A;  2WZN A;  3PB8 X;  3BI0 A;  2HC9 A;  4ZI6 A;  5HVG A;  2IQ6 A;  4MHZ A;  4UEF A;  4G1P A;  2O53 A;  3PB9 X;  2C6P A;  2CF4 A;  2Q4Z A;  4UIB A;  3VAR A;  1XFO A;  4IAV A;  2AFZ A;  3PFE A;  3KR4 A;  2ZEN A;  4Q7A A;  5HVH A;  3SJX A;  3D66 A;  1TKH A;  1ELL P;  1LCP A;  4GM5 A;  4MMO A;  4A37 A;  3D67 A;  4OC0 A;  3PRT A;  2NYQ A;  2ZOF A;  1CX8 A;  1UWY A;  3KQZ A;  3SI0 A;  1ARM A;  4ZX9 A;  1CPX A;  3FEE A;  3PBE A;  5DS0 A;  4LQG A;  3GUX A;  3D7D A;  2F8H A;  3K9T A;  3QNV A;  3BXM A;  5K8O A;  4W9Y A;  3B3V A;  1CBX A;  4ZY0 A;  1ZLH A;  2AFU A;  4MHN A;  4UEE A;  5LYD A;  1HDQ A;  2PJ2 A;  4WWV A;  1HDU A;  4DUK A;  2IMO A;  4PXE A;  5HVF A;  3PB4 X;  4MHP A;  3SJF A;  2JEW A;  2Q43 A;  2QYV A;  2PJ9 A;  5JM6 A;  1GYT A;  5THW A;  4F9U A;  1WVM A;  3VTA A;  2IJZ A;  3FF3 A;  4MCS A;  1XF1 A;  2ZEP A;  8CPA A;  2RB7 A;  1V6C A;  3VAT A;  3B3C A;  4CDK A;  4C86 A;  2AFO A;  4UF4 A;  2AFS A;  5D8N A;  2PJ6 A;  2C6G A;  4MCQ A;  5K8N A;  2OR4 A;  6CPA A; 
#chains in the Genus database with same CATH topology
 1C30 B;  1IIC A;  5LRG A;  4OC3 A;  2EBJ A;  2JBK A;  2Z10 A;  1Y9Z A;  3WR7 A;  4MY3 A;  4A94 A;  2CNS A;  3GY9 A;  1IY7 A;  3G3S A;  3JRU A;  4MBU A;  4F6A A;  4X3R A;  2PJ4 A;  2Q51 A;  3GIU A;  4O23 A;  1NXJ A;  4RI1 A;  3BUW B;  1ZG7 A;  4JYW A;  1QSN A;  2DXQ A;  3PGP A;  5IV0 A;  3TLA A;  3HPH E;  4HNY B;  2FVG A;  4CYP A;  2MP0 A;  1Y9W A;  4DYO A;  1TIQ A;  4KOX A;  5I4M A;  3IJ3 A;  1Q2D A;  4C9V A;  3KI9 A;  4LQ6 A;  1M4L A;  4COB A;  4QBJ A;  3E0K A;  4P4F A;  4TNU A;  3KRV A;  2XEF A;  2FS5 A;  3PFO A;  4YGO A;  4QC6 A;  3T90 A;  3SJE A;  4A2Z A;  4F0Y A;  4KOR A;  5KTD A;  1IOI A;  2HQY A;  2AFM A;  4FD7 A;  2VZY A;  1JDB C;  1JDE A;  4ZX8 A;  5F13 A;  4E94 A;  3OP0 A;  4C9A A;  4CAW A;  3T07 A;  4C99 A;  4L8A A;  2HUZ A;  4B5P B;  3EC4 A;  3IFE A;  2G9D A;  4Z65 A;  4B5O A;  2VEZ A;  4UEZ A;  1BPM A;  5JQ4 A;  2VKZ G;  3VWD A;  5ISV A;  4AG9 A;  1J4J A;  2DF5 A;  3LWU A;  2YJV A;  1FBV A;  3R96 A;  1WJT A;  2PCU A;  4KZT A;  3V7Z A;  3F0A A;  3R9G A;  3K4I A;  1YRE A;  1I1D A;  4OP4 A;  5LYI A;  1WK4 A;  2ANP A;  1B87 A;  3F5B A;  3RO0 A;  2V8V A;  2B4B A;  4EVY A;  4Q36 A;  4TWE A;  4ZY2 A;  3FH4 A;  5IB9 A;  4UFV A;  2E28 A;  3ZNI A;  4OAD A;  1R3N A;  4CAV A;  2CIJ A;  2ZEO A;  1F2P A;  1S7F A;  2B5G B;  2FT0 A;  2EUI A;  5BY0 A;  4UBR A;  4CO9 A;  2OH1 A;  3O8Z A;  4KOV A;  1TF9 A;  4M6I A;  4YRH A;  1CG2 A;  1FNO A;  4B13 A;  5DWN A;  1I12 A;  2EZA A;  5K99 A;  4B10 A;  4C8T A;  1TKJ A;  3W6X A;  3RBU A;  1AYE A;  4DNC A;  3BJ8 A;  5D29 A;  2FSR A;  1Y7R A;  1DE4 C;  1ZO0 A;  2PJB A;  4COG A;  5JYB A;  2ZW4 A;  3D68 A;  3WC7 A;  4FAI A;  1X12 A;  3NH5 A;  3ISX A;  4MHY A;  2PVW A;  1EZA A;  3BHX A;  3KQX A;  5LRJ A;  3SI1 A;  4NGQ A;  4NGS A;  2WPW A;  4P4B A;  3N5F A;  3WT4 A;  5IX3 A;  3D7G A;  4OC2 A;  3H5Z A;  4OIW A;  3SXN A;  3TLE A;  5HH1 A;  2HWG A;  2JBJ A;  3G8W A;  2OB0 A;  2OZU A;  3MN8 A;  2GIV A;  3ISZ A;  1LAP A;  2FL4 A;  4MRI A;  4AG7 A;  1S7L A;  4NGP A;  3K9U A;  1CJW A;  1Q7L A;  2PJC A;  1UFH A;  4A30 A;  3H8G A;  2GRE A;  4LX9 A;  1XOV A;  2B4D A;  3R9F A;  1KUY A;  2FXF A;  2PSW A;  4YU9 A;  4EWT A;  3VWE A;  4ZGY B;  4MCR A;  2PJ5 A;  4UFW A;  3IO1 A;  4C2X A;  2Y0M A;  4PK3 A;  5K8M A;  1EO0 A;  3PZJ A;  2X0S A;  3IIB A;  4CGO A;  3S6F A;  4NGN A;  2Z0Z A;  3KR5 A;  1P0H A;  4AVA A;  2Z3N A;  5LYF A;  2IL4 A;  4MHD A;  2ZEH A;  4KNG E;  2EVN A;  2PIZ A;  2BOA A;  4XNH C;  5A27 A;  3W91 A;  1BO4 A;  1U6M A;  1Y7E A;  1JWQ A;  4DJL A;  1XMB A;  3CZX A;  2VXK A;  5LRK A;  1AMP A;  1XIX A;  5I0C A;  1ELM P;  2D4P A;  3KL9 A;  2CBL A;  2X7B A;  4KOW A;  4QUS A;  2EK8 A;  1Z4R A;  4KVM E;  4NXY A;  2VI7 A;  1XMT A;  4EME A;  5JPH A;  3FJU A;  4E5S A;  1PU9 A;  4H2K A;  3IWG A;  4E2A A;  3I9S A;  4IHM A;  3PBB A;  3PEI A;  4KLV A;  4MY0 A;  2O28 A;  4PXB A;  5JGF A;  2JDD A;  4C2Z A;  4K3N A;  4C85 A;  2C6C A;  1R43 A;  4PXC A;  4JXR A;  2PJ8 A;  7CPA A;  5IB0 A;  3CDX A;  5E96 A;  4A4C A;  1ARL A;  4MFK A;  4P4J A;  1LAN A;  3QB8 A;  3BI1 A;  2VL1 A;  3B2Y A;  3HMJ G;  4MFQ A;  2P6F A;  2HRO A;  3DSB A;  4OC1 A;  4KSA A;  4UWI A;  1IOF A;  4II9 A;  3D2M A;  4NFR A;  4C8P A;  3TO9 A;  4Y49 B;  1ON0 A;  3KHZ A;  2QIR A;  3GJZ A;  3S9M A;  3OWC A;  4A4B A;  4JLY A;  2ZEG A;  4NJR A;  2Q4V A;  1YGH A;  5H86 A;  1Z2L A;  1DIK A;  1K4J A;  4C9U A;  4PSW A;  3TT2 A;  1TF8 A;  3TC8 A;  1KEE B;  1NBW A;  4MJX A;  4A39 A;  1L0C A;  2CTB A;  3DGV A;  2PE3 A;  1Y0R A;  5G22 A;  4A31 A;  4FD4 A;  2R7H A;  1GHE A;  5AG4 A;  3C8O A;  3BUO B;  3FVL A;  1VHS A;  4KVO E;  2G0B A;  5CBM A;  4YN3 A;  3EZE A;  1N71 A;  1PYT B;  1Y0Y A;  2G3T A;  2ZED A;  3IWE A;  2HI6 A;  3FBU A;  1F2O A;  4A33 A;  5CPA A;  1XBU A;  2AFW A;  4R3K A;  4YWY A;  3TTH A;  1A2Z A;  3TO7 A;  4EYS A;  2D0P A;  3U1B A;  4QB9 A;  1KUV A;  5ELY A;  2ZW6 A;  4UCN A;  2WUU A;  3FEC A;  3GYA A;  3S9L A;  4IF5 A;  5AG7 A;  5IR2 A;  2B58 A;  1CPS A;  3I1U A;  1XE4 A;  3T8W A;  4M6G A;  3D7H A;  4MJ8 A;  1YQE A;  2PR1 A;  3S6G A;  3RZA A;  1ZLI A;  1YVK A;  3NFQ A;  2A4N A;  2Q4Y A;  4R76 A;  1YW6 A;  4H6Z A;  2ARH A;  5J1Q A;  1IYL A;  1S3Z A;  1Y9K A;  5LYL A;  4F9V A;  2B0A A;  1Z8T A;  3W6S A;  1P4N A;  2XPN A;  1TXR A;  2NMT A;  3D3S A;  4X2T A;  5EBV A;  2XEJ A;  3FYN A;  3VRR A;  3TLY A;  4R8F A;  1C3O B;  5HKW A;  4GPL B;  4BD9 A;  2I79 A;  4NSQ A;  5FVJ A;  4P4D A;  2AUM A;  1S5K A;  3EXN A;  2J8N A;  2PC1 A;  1DTD A;  2XEG A;  3B3W A;  2V8G A;  2Q7B A;  4KSF A;  4BPX B;  1Z9E A;  1NSA A;  4R57 A;  2FIW A;  2DIK A;  1RTQ A;  4U9Y A;  4PPZ A;  4UWJ A;  5KTC A;  1MJA A;  1Z9U A;  2I00 A;  4P6Y A;  3H8F A;  3GLJ A;  2CY2 A;  3R1K A;  2B4J C;  2GLF A;  2XEI A;  2BL1 A;  2WPX A;  5F09 A;  1QSO A;  3CPA A;  3DLJ A;  3RYO A;  4OC4 A;  2J9A A;  5F49 A;  4UCM A;  1BAV A;  1ZG9 A;  1NSL A;  2RFH A;  2ZEF A;  1CP7 A;  1BXR B;  3I6S A;  4P45 A;  2BCO A;  2D4O A;  2P6G A;  3FX6 A;  4FBE A;  4P4I A;  3FXT A;  2F7V A;  4P44 A;  5C82 A;  2YND A;  3FB3 A;  4RS2 A;  2C5Q A;  2YNC C;  2B4D B;  4CYQ A;  1VKC A;  3CXP A;  1VBH A;  3T05 A;  4CGL A;  2G3A A;  3TX8 A;  3CT9 A;  3TCV A;  1R61 A;  5G20 A;  4KS9 A;  1M1D A;  4A32 A;  4R3L A;  4PXD A;  1QMU A;  1YSJ A;  3TYX A;  1H8L A;  1IID A;  2B3U A;  3BLN A;  4CGN A;  2ZEE A;  3NOJ A;  1LAM A;  3IEH A;  2EZB A;  4J3G A;  4KOT A;  1FT7 A;  4BMH A;  3PP9 A;  1T36 B;  1YW4 A;  2P6E A;  1Z8W A;  4B11 A;  3KAS A;  4KVX A;  2PJ0 A;  5HMN A;  5F47 A;  3PFV A;  3S6H A;  4NGR A;  1YR0 A;  2P0W A;  4AXV A;  1V0C A;  4ZYQ A;  5HXD A;  4JZ0 A;  1VHO A;  5KTA A;  2QEC A;  4BPW B;  3HUV A;  4CAX A;  1VBG A;  2YNC A;  4H1H A;  1Z4E A;  1XRY A;  3B3T A;  3B7I A;  3KZW A;  4TJX A;  2V77 A;  2C1C A;  4CDJ A;  1Z5R A;  4FD5 A;  1MJB A;  1XF1 A;  3ICU A;  2YNE A;  1KZF A;  3C26 A;  3NFZ A;  3PB6 X;  4B6Z A;  4NGM A;  1YLO A;  2JDC A;  2PIY A;  3CXS A;  1YLE A;  2ATR A;  3LAC A;  4NJQ A;  4OKO A;  3WAB A;  5GCN A;  2KCW A;  1RXT A;  1PUA A;  1X10 A;  4XNH B;  4CPA A;  2J8R A;  3UY5 A;  4R7M A;  4ZY1 A;  1M44 A;  5F48 A;  3FIX A;  3LMS A;  4B14 A;  2DEA A;  5H84 A;  2BEI A;  1S7N A;  2EO8 A;  1MK4 A;  2DPT A;  4LUA A;  3OB2 B;  2PRQ A;  3SI2 A;  3B8G A;  4ONW A;  4MCP A;  4C84 A;  2PJ7 A;  3MGD A;  4C8F A;  4TJV A;  2N3A B;  3FED A;  4MXU A;  4CYO A;  3OAK A;  1YX0 A;  2QJ8 A;  2DPS A;  1JQG A;  4E8O A;  2XPP A;  2V8H A;  3CPX A;  4C7H A;  3B3S A;  4OME A;  1BLL E;  4JD6 A;  1IGB A;  4KUB A;  4OID A;  5F46 A;  4WJB A;  2PR8 A;  4C9R A;  1GGO A;  3BUM B;  1F57 A;  4R6T A;  3VRP A;  2H5M A;  3GKR A;  4P10 A;  1OBR A;  1EZB A;  3PB7 X;  4KUA A;  1KWM A;  2YGW A;  4XPD C;  3L2N A;  3V38 A;  4NGT A;  1TKF A;  2PCN A;  4C9E A;  4R87 A;  1LOK A;  3H8E A;  4UIA A;  5F9M A;  3IWW A;  2I3C A;  2Y1N A;  3DR8 A;  2NSM A;  4IUS A;  3EY5 A;  3TE4 A;  3TOB A;  4C8C A;  1B6B A;  1CM0 A;  1VIX A;  1BPN A;  2GLJ A;  3NH8 A;  3QAY A;  4FUU A;  4KLW A;  1LFW A;  2CTC A;  3TLC A;  1ZYM A;  3H4Q A;  4C8A A;  3FMC A;  2Z3L A;  2V8D A;  3NA6 A;  3WC5 A;  4EFD A;  2CNT A;  4RUH A;  3TLG A;  2OLS A;  4C8U A;  1NMT A;  3SR3 A;  1S7K A;  3R9E A;  2VBQ A;  3I3G A;  3S9N A;  3K2K A;  1CP6 A;  1XF8 A;  4UCP A;  2EZC A;  1XJO A;  4IIX A;  3HPG G;  5HKZ A;  4CAE A;  2EK9 A;  1WWZ A;  2ZOG A;  2Z3K A;  1J3L A;  1BOB A;  2O4H A;  1HEE A;  1VHE A;  3KGQ A;  1Z8L A;  4IK2 A;  2POK A;  3IU2 A;  4MFJ A;  1M4G A;  2CXA A;  5K8P A;  3PT1 A;  2ODF A;  4F8Z A;  3EIF A;  2GU2 A;  4CYN A;  2WYR A;  5J8C A;  5CNP A;  3B35 A;  4A38 A;  3ZJ0 A;  4YFJ A;  2VQY A;  3TO6 A;  2OU2 A;  1VGY A;  2GP4 A;  2PVV A;  4X5K A;  3RAM A;  3A9L A;  3I74 A;  2GFQ A;  4P4E A;  4K30 A;  1YME A;  4PQA A;  4OC5 A;  2ABZ A;  3F8K A;  4PV6 A;  1EE3 P;  2BO9 A;  2Q44 A;  1S60 A;  2ZEL A;  3JVN A;  4PK2 A;  2EWB A;  2HB6 A;  3BJ7 A;  5EC4 A;  4AB7 A;  4KSI A;  5JH9 A;  2AUN A;  3MRU A;  3KHX A;  3QAH A;  3RNZ A;  2ZXV A;  3NE7 A;  1CS0 B;  1CE8 B;  3HLP A;  3P2H A;  3EFA A;  2PRB A;  2PJ3 A;  3SJG A;  1LRZ A;  2R98 A;  2ZEM A;  4MFL A;  2PJA A;  3NH4 A;  2OOT A;  1QQ9 A;  2FIA A;  3VRN A;  2PQ8 A;  1KC7 A;  4J0N A;  4U5Y A;  1QSR A;  2QVP A;  1ZG8 A;  4ZBG A;  4FWU A;  1VI4 A;  3VH9 A;  4UA3 A;  3EZB A;  2REF A;  1IYK A;  4GS4 A;  2F5I A;  2Q7S A;  2CNM A;  1M4D A;  3GB0 A;  2AFX A;  3DNS A;  4CS0 B;  4X8I A;  5C88 A;  2PJ1 A;  3D7F A;  2XPO A;  1PCA A;  3IC1 A;  3F9K C;  3D4U A;  2WZN A;  3PB8 X;  2BSW A;  3BI0 A;  2HC9 A;  2RC4 A;  4ZI6 A;  5HVG A;  2IQ6 A;  3VRQ A;  4MHZ A;  2AJ6 A;  4UEF A;  3FNC A;  4G1P A;  2O53 A;  4GXH A;  4C2Y A;  5G1Z A;  2Y1M A;  5G21 A;  3CXQ A;  2UV8 G;  3PB9 X;  2C6P A;  2CF4 A;  2Q4Z A;  4M8D A;  4UIB A;  3VAR A;  4AVC A;  3TLB A;  2Q0Y A;  2Q04 A;  2XPL A;  4OAE A;  2Z11 A;  3IGR A;  1XFO A;  4IAV A;  3TLZ A;  2AFZ A;  4CZ1 A;  1QSM A;  2JEV A;  3PFE A;  2AE6 A;  3KR4 A;  4JVO A;  3KKW A;  3R95 A;  4CRY B;  2ZEN A;  1QST A;  4QVT A;  3PLF B;  4Q7A A;  4AVB A;  3SJX A;  3D66 A;  4M6H A;  5HVH A;  2Z3P A;  2DLA A;  4MFP A;  1TKH A;  3D8P A;  1ELL P;  4NF1 A;  1LCP A;  4GM5 A;  2K5T A;  4C68 A;  4CAF A;  4MMO A;  4A37 A;  1YK3 A;  3D67 A;  4B5P A;  3IU1 A;  4A95 A;  4INJ A;  4M85 A;  4OC0 A;  4UFX A;  3ZZI A;  4HKF A;  3JTK A;  5AG5 A;  3N7Z A;  1KUX A;  1MJ9 A;  4H89 A;  5J8F A;  2R1I A;  3PRT A;  4PSX A;  3TOA A;  2NYQ A;  4HNW B;  3U88 C;  2R82 A;  1OZP A;  1CX8 A;  2J8M A;  1UWY A;  2ZOF A;  4HNX B;  4JWP A;  4XPK A;  3WC6 A;  1M6V B;  3S6K A;  2Z3M A;  4IIY A;  3KQZ A;  2ZW5 A;  3SI0 A;  2FCK A;  5EMI A;  1R57 A;  1ARM A;  5AXI A;  3OB1 B;  1CPX A;  3FEE A;  4ZX9 A;  3PBE A;  1Q2Y A;  5DS0 A;  4MI1 A;  4LQG A;  1NE9 A;  2B5G A;  3D7D A;  2F8H A;  1B47 A;  3GUX A;  5DWM A;  4E0A A;  3K9T A;  3QNV A;  4JJX A;  5BWA B;  2FE7 A;  3BXM A;  2R8V A;  3LOD A;  5K8O A;  4W9Y A;  2B3V A;  3TLG B;  2ZW7 A;  3B3V A;  4F0X A;  1CBX A;  4L89 A;  4ONU A;  4ZY0 A;  5F1Y A;  2JLM A;  4R9M A;  1ZLH A;  2VZZ A;  4XPL A;  2AFU A;  1FY7 A;  1RO5 A;  3VGO A;  3DR6 A;  3JUW A;  4MHN A;  4OLL A;  4UEE A;  4RN7 A;  4C7I A;  3BUN B;  2Z3O A;  1IB1 E;  1IU8 A;  4KOS A;  2C27 A;  3VRO A;  2YJT A;  4XPD B;  5LYD A;  1HDQ A;  1XEB A;  2PJ2 A;  2ZPA A;  4KOU A;  3V8I A;  3EZA A;  3T0T A;  1Q2C A;  4H6U A;  4WWV A;  2GE3 A;  1HDU A;  4HPS A;  4DUK A;  1Q5X A;  2IMO A;  4CGM A;  4PXE A;  5HVF A;  3P2F A;  2OZH A;  3PB4 X;  5AG6 A;  3T9Y A;  3D2P A;  4MHP A;  5F5X A;  4BIN A;  5JVL A;  3SJF A;  2JEW A;  4MFZ A;  1YVO A;  2Q43 A;  1YVH A;  2BUE A;  3EO4 A;  4M3S A;  1A9X B;  2D0O A;  2QYV A;  2PJ9 A;  2FM4 A;  5JM6 A;  1GYT A;  5THW A;  5FD8 A;  2PDO A;  4F9U A;  1WVM A;  3VTA A;  5HKY A;  1I21 A;  4FD6 A;  3T5M A;  2HV2 A;  3TFY A;  2WSA A;  2IJZ A;  4Q38 A;  3FF3 A;  4MCS A;  4NCZ A;  4Y49 C;  1SQH A;  2GAN A;  1AUG A;  2ZEP A;  4U9Z A;  4BPU B;  1Z8X A;  2RB7 A;  3BUX B;  4I49 A;  3SHP A;  8CPA A;  4BTF A;  1ZL0 A;  1V6C A;  1M4I A;  1KBL A;  3DDD A;  3SXO A;  4NEX A;  4B12 A;  3FRM A;  3VAT A;  4BBH A;  3B3C A;  4CDK A;  4C86 A;  3LD2 A;  4RR2 B;  2OZG A;  2REE A;  2AFO A;  3G23 A;  4MI4 A;  2AFS A;  4JXQ A;  4UF4 A;  5AGE A;  4CGP A;  4KOY A;  2PJ6 A;  5D8N A;  2C6G A;  4MCQ A;  5K8N A;  2OR4 A;  2QML A;  5J3X A;  4CRZ B;  5A28 A;  1ZRS A;  4ORF A;  3NE8 A;  6CPA A; 
#chains in the Genus database with same CATH homology
 5LRG A;  4OC3 A;  2JBK A;  1Y9Z A;  4A94 A;  3JRU A;  1IY7 A;  4X3R A;  2PJ4 A;  2Q51 A;  4O23 A;  1ZG7 A;  4JYW A;  2FVG A;  4DYO A;  5I4M A;  3IJ3 A;  4C9V A;  3KI9 A;  1M4L A;  4P4F A;  4TNU A;  2XEF A;  3PFO A;  3SJE A;  2AFM A;  4ZX8 A;  4C9A A;  3IFE A;  2G9D A;  4Z65 A;  4UEZ A;  1BPM A;  3LWU A;  2PCU A;  3V7Z A;  4OP4 A;  5LYI A;  2ANP A;  2V8V A;  4TWE A;  4ZY2 A;  3FH4 A;  5IB9 A;  1R3N A;  2CIJ A;  2ZEO A;  1F2P A;  1TF9 A;  1CG2 A;  1FNO A;  4C8T A;  1TKJ A;  3RBU A;  1AYE A;  5D29 A;  1DE4 C;  2PJB A;  3D68 A;  4FAI A;  3WC7 A;  3NH5 A;  3ISX A;  4MHY A;  2PVW A;  3BHX A;  3KQX A;  5LRJ A;  3SI1 A;  3N5F A;  4NGQ A;  4NGS A;  4P4B A;  3WT4 A;  3D7G A;  4OC2 A;  4OIW A;  2JBJ A;  4MRI A;  3MN8 A;  3ISZ A;  1LAP A;  4NGP A;  1Q7L A;  2PJC A;  3H8G A;  2GRE A;  4EWT A;  4YU9 A;  4MCR A;  2PJ5 A;  3IO1 A;  5K8M A;  3IIB A;  4NGN A;  3KR5 A;  4KNG E;  5LYF A;  2ZEH A;  2PIZ A;  2BOA A;  1Y7E A;  4DJL A;  1XMB A;  5LRK A;  1AMP A;  1ELM P;  3KL9 A;  2EK8 A;  4EME A;  3FJU A;  4H2K A;  4IHM A;  3PBB A;  3PEI A;  4PXB A;  5JGF A;  4K3N A;  4C85 A;  2C6C A;  1R43 A;  4PXC A;  2PJ8 A;  7CPA A;  3CDX A;  1ARL A;  4P4J A;  1LAN A;  3BI1 A;  2VL1 A;  3B2Y A;  4OC1 A;  4NFR A;  4C8P A;  3KHZ A;  3S9M A;  4NJR A;  2ZEG A;  1Z2L A;  4C9U A;  1TF8 A;  3TC8 A;  4A39 A;  2CTB A;  3DGV A;  2PE3 A;  1Y0R A;  3FVL A;  5CBM A;  4YN3 A;  2ZED A;  1PYT B;  1Y0Y A;  1F2O A;  5CPA A;  1XBU A;  2AFW A;  4YWY A;  5ELY A;  3FEC A;  5IR2 A;  3S9L A;  1CPS A;  3I1U A;  3T8W A;  3D7H A;  3RZA A;  1ZLI A;  4R76 A;  1YW6 A;  5J1Q A;  5LYL A;  4F9V A;  3WC6 A;  1TXR A;  4X2T A;  2XEJ A;  4R8F A;  4BD9 A;  4P4D A;  1DTD A;  2XEG A;  3B3W A;  2V8G A;  1NSA A;  1RTQ A;  4PPZ A;  4P6Y A;  3H8F A;  3GLJ A;  2GLF A;  2XEI A;  5F09 A;  3CPA A;  3DLJ A;  4C99 A;  4OC4 A;  2J9A A;  1BAV A;  1ZG9 A;  2RFH A;  2ZEF A;  1CP7 A;  3I6S A;  4P45 A;  2BCO A;  3FX6 A;  4FBE A;  4P4I A;  2F7V A;  4P44 A;  2C5Q A;  3TX8 A;  3CT9 A;  4PXD A;  1QMU A;  1YSJ A;  1H8L A;  2ZEE A;  1LAM A;  3IEH A;  1FT7 A;  1YW4 A;  3KAS A;  2PJ0 A;  4NGR A;  4AXV A;  4ZYQ A;  5HXD A;  4JZ0 A;  1VHO A;  3HUV A;  1XRY A;  3B3T A;  3B7I A;  3KZW A;  4TJX A;  2V77 A;  2C1C A;  4CDJ A;  1Z5R A;  3ICU A;  3PB6 X;  3NFZ A;  4B6Z A;  4NGM A;  1YLO A;  2PIY A;  4OKO A;  4NJQ A;  3WAB A;  4CPA A;  4ZY1 A;  4R7M A;  3LMS A;  2DEA A;  3SI2 A;  2PRQ A;  4ONW A;  4MCP A;  4C84 A;  2PJ7 A;  4C8F A;  4TJV A;  3FED A;  4MXU A;  2QJ8 A;  1JQG A;  2V8H A;  3CPX A;  3B3S A;  4OME A;  1BLL E;  1IGB A;  4OID A;  4WJB A;  4C9R A;  1F57 A;  4R6T A;  4P10 A;  1OBR A;  3PB7 X;  1KWM A;  3L2N A;  3V38 A;  4NGT A;  1TKF A;  4C9E A;  1LOK A;  3H8E A;  4UIA A;  3IWW A;  2I3C A;  2NSM A;  4C8C A;  1VIX A;  2GLJ A;  3NH8 A;  1BPN A;  4FUU A;  1LFW A;  2CTC A;  4C8A A;  3FMC A;  2V8D A;  3NA6 A;  3WC5 A;  4EFD A;  4RUH A;  4C8U A;  3S9N A;  3K2K A;  1CP6 A;  1XJO A;  2EK9 A;  2ZOG A;  2O4H A;  1HEE A;  1VHE A;  3KGQ A;  1Z8L A;  4IK2 A;  2POK A;  5K8P A;  4F8Z A;  3EIF A;  2GU2 A;  2WYR A;  3B35 A;  4A38 A;  1VGY A;  2GP4 A;  2PVV A;  3RAM A;  3I74 A;  4P4E A;  1YME A;  4PQA A;  4OC5 A;  2ABZ A;  1EE3 P;  2BO9 A;  2ZEL A;  5JH9 A;  2EWB A;  2HB6 A;  4KSI A;  3MRU A;  3KHX A;  3HLP A;  2PJ3 A;  3SJG A;  2ZEM A;  2PJA A;  3NH4 A;  2OOT A;  1QQ9 A;  2QVP A;  1ZG8 A;  4FWU A;  3VH9 A;  3GB0 A;  2AFX A;  4X8I A;  2PJ1 A;  3D7F A;  1PCA A;  3IC1 A;  3D4U A;  2WZN A;  3PB8 X;  3BI0 A;  2HC9 A;  4ZI6 A;  5HVG A;  2IQ6 A;  4MHZ A;  4UEF A;  4G1P A;  2O53 A;  3PB9 X;  2C6P A;  2CF4 A;  2Q4Z A;  4UIB A;  3VAR A;  1XFO A;  4IAV A;  2AFZ A;  3PFE A;  3KR4 A;  2ZEN A;  4Q7A A;  5HVH A;  3SJX A;  3D66 A;  1TKH A;  1ELL P;  1LCP A;  4GM5 A;  4MMO A;  4A37 A;  3D67 A;  4OC0 A;  3PRT A;  2NYQ A;  2ZOF A;  1CX8 A;  1UWY A;  3KQZ A;  3SI0 A;  1ARM A;  4ZX9 A;  1CPX A;  3FEE A;  3PBE A;  5DS0 A;  4LQG A;  3GUX A;  3D7D A;  2F8H A;  3K9T A;  3QNV A;  3BXM A;  5K8O A;  4W9Y A;  3B3V A;  1CBX A;  4ZY0 A;  1ZLH A;  2AFU A;  4MHN A;  4UEE A;  5LYD A;  1HDQ A;  2PJ2 A;  4WWV A;  1HDU A;  4DUK A;  2IMO A;  4PXE A;  5HVF A;  3PB4 X;  4MHP A;  3SJF A;  2JEW A;  2Q43 A;  2QYV A;  2PJ9 A;  5JM6 A;  1GYT A;  5THW A;  4F9U A;  1WVM A;  3VTA A;  2IJZ A;  3FF3 A;  4MCS A;  1XF1 A;  2ZEP A;  8CPA A;  2RB7 A;  1V6C A;  3VAT A;  3B3C A;  4CDK A;  4C86 A;  2AFO A;  4UF4 A;  2AFS A;  5D8N A;  2PJ6 A;  2C6G A;  4MCQ A;  5K8N A;  2OR4 A;  6CPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...