2PVVA

Structure of human glutamate carboxypeptidase ii (gcpii) in complex with l-serine-o-sulfate
Total Genus 258
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
258
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 258
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2pvvA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pvvA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2pvvA02
4DUKA 1LAMA 1EE3P 3GLJA 1BPNA 4MCQA 3VH9A 4MCRA 4FWUA 1XBUA 3ISXA 2I3CA 3NH5A 2ZEPA 3D7DA 3KZWA 4P44A 2PE3A 3RAMA 4TWEA 3IO1A 2Q51A 1ZLIA 3IIBA 4YU9A 2ZENA 1DTDA 4ZX8A 5F09A 2WZNA 3PFOA 1NSAA 3JRUA 5K8PA 4EWTA 2OR4A 4K3NA 4EFDA 4A37A 4ZY0A 4DJLA 4C8PA 3IC1A 2F8HA 4MHYA 4C9AA 4C86A 2QYVA 4DYOA 2EWBA 4IAVA 2O53A 2Q43A 2ANPA 2V8VA 3V7ZA 1CBXA 4YN3A 4R6TA 4TNUA 3D7HA 3IFEA 3NH4A 2QJ8A 3HLPA 2PIZA 1TKHA 5K8NA 2PJ0A 4WJBA 4A94A 5LYDA 2IQ6A 4KNGE 4C9VA 2OOTA 4GM5A 2PJ6A 4PXCA 4MCPA 2AFZA 3FVLA 3N5FA 3KHXA 1PYTB 3CPAA 3PBEA 3I1UA 3SJFA 2IMOA 2C6GA 3S9MA 4C9RA 1FT7A 2HB6A 3DGVA 1IGBA 3EIFA 3SJXA 4C9UA 2QVPA 3QNVA 4NGPA 1XJOA 4NGQA 1ZLHA 2RFHA 2PVWA 3D68A 2DEAA 4IK2A 2NSMA 5K8OA 2PJ7A 4IHMA 5CPAA 2EK9A 1ARLA 4R7MA 3PEIA 3B2YA 1JQGA 2NYQA 2PJBA 4C8FA 1QQ9A 4LQGA 1HDQA 3NH8A 5HVFA 4OMEA 2PJAA 3D66A 5D29A 1KWMA 5D8NA 5ELYA 2ZEMA 4UIAA 1QMUA 4X2TA 3KL9A 4A38A 3VTAA 2VL1A 4P4JA 1BLLE 3IJ3A 3WC7A 2V77A 2ZEHA 2GU2A 4PQAA 2PCUA 3D4UA 4JZ0A 4C8AA 1R43A 4JYWA 5CBMA 2RB7A 3IWWA 5THWA 4EMEA 2PJ8A 8CPAA 4UIBA 2AFWA 2F7VA 4A39A 2PVVA 5I4MA 1AMPA 3FEDA 4UEFA 4C8TA 2PJ3A 1LOKA 2V8DA 3BI0A 5DS0A 1Y9ZA 1Z5RA 1YMEA 5JH9A 1F2OA 4OP4A 1BPMA 4OIWA 2AFSA 1XF1A 3DLJA 4PXBA 4NGTA 3I74A 4FUUA 2BCOA 3NA6A 2PIYA 4NGNA 1ELLP 1F2PA 4OC2A 3WABA 5HVGA 2PRQA 4ZI6A 4C9EA 3SI0A 2PJ2A 3GUXA 4NGRA 1TXRA 4W9YA 2PJ5A 3S9LA 4C84A 4NFRA 2C1CA 3B3SA 4UF4A 1LAPA 4F8ZA 4ZYQA 1F57A 3KASA 3HUVA 3BHXA 3WC5A 1YW4A 4P45A 4MRIA 4AXVA 3KGQA 5JGFA 3PB6X 3WC6A 5HXDA 3ISZA 4F9VA 1BAVA 1VHOA 2GLJA 2GLFA 4BD9A 3FH4A 3KHZA 1TF8A 4MHZA 3TX8A 2FVGA 2JEWA 3BI1A 3ICUA 1LFWA 5LYFA 2EK8A 5K8MA 4TJVA 2V8GA 3TC8A 5J1QA 5JM6A 3B3TA 1CP7A 3RBUA 3SI1A 4PXDA 3KR4A 2ZEFA 4PPZA 2ZELA 1DE4C 3PB7X 3H8GA 1XFOA 1Y7EA 3IEHA 1XRYA 1CP6A 1Y0RA 4P6YA 3B3VA 4WWVA 3SJEA 3H8EA 1H8LA 2CTCA 3B7IA 4MCSA 1CG2A 4X3RA 4C99A 1WVMA 5LRJA 5LRGA 4CDKA 1CX8A 1HDUA 3NFZA 2AFMA 2ZOFA 1CPXA 3B3CA 2ZEGA 2XEJA 1ZG8A 4NJRA 3MN8A 1CPSA 2JBKA 5HVHA 3BXMA 3D7GA 4TJXA 1YLOA 3FECA 3VATA 3PB9X 3SI2A 3CDXA 1UWYA 4FAIA 2BO9A 2IJZA 3V38A 4OC5A 4MHNA 4P10A 2ZEDA 4R76A 3FF3A 1V6CA 3FMCA 4OC4A 4MHPA 4OIDA 4P4DA 4NGSA 4C85A 4MXUA 3GB0A 1LANA 3LWUA 2PJ1A 4ONWA 2AFUA 5IB9A 4NGMA 2BOAA 3PFEA 1ELMP 1Z8LA 3H8FA 4O23A 1HEEA 1TKJA 3FEEA 4RUHA 1VGYA 4UEZA 3D67A 4ZY2A 3LMSA 4UEEA 3FX6A 3CPXA 1ZG9A 4X8IA 4CPAA 4Q7AA 3D7FA 2O4HA 1RTQA 2XEFA 4B6ZA 3K2KA 3B3WA 3KI9A 4OKOA 4YWYA 4PXEA 4MMOA 4C8CA 3I6SA 3MRUA 4Z65A 3VARA 4G1PA 2CTBA 2V8HA 3FJUA 4OC0A 4CDJA 5LRKA 4C8UA 3SJGA 2WYRA 2G9DA 1R3NA 3L2NA 4KSIA 2GREA 1YW6A 4ZX9A 5LYIA 1FNOA 4F9UA 2CF4A 2C6PA 6CPAA 2HC9A 3CT9A 4P4FA 3KQZA 2ABZA 4OC1A 4OC3A 1Y0YA 4NJQA 2XEGA 1ZG7A 3KR5A 2XEIA 5LYLA 3B35A 1PCAA 3PB4X 3K9TA 1AYEA 1ARMA 2CIJA 4FBEA 2JBJA 3S9NA 3PBBA 2Q4ZA 3RZAA 4H2KA 1TKFA 4P4EA 2ZEEA 4P4BA 4ZY1A 1OBRA 1IY7A 2ZOGA 1M4LA 3PRTA 2C6CA 2PJ9A 1Q7LA 1LCPA 2PJCA 1VIXA 3T8WA 2AFXA 4P4IA 1YSJA 1VHEA 2ZEOA 2J9AA 3KQXA 3WT4A 1GYTA 2AFOA 1TF9A 4R8FA 3PB8X 7CPAA 1Z2LA 2POKA 1XMBA 2PJ4A
chains in the Genus database with same CATH superfamily
4DUKA 2DF5A 2Q04A 5IR2A 1Z8TA 4K30A 5A28A 1LAMA 1EE3P 3GLJA 3QB8A 1Z9UA 1BPNA 2D4OA 2B4JC 4MCQA 3VH9A 4E2AA 4M6HA 4UFXA 4MCRA 4UFVA 4U5YA 4FWUA 1XBUA 1B6BA 2FL4A 3CZXA 3ISXA 2I3CA 2PR8A 4HNYB 4KOXA 3NH5A 2ZEPA 3D7DA 2XPPA 3EZBA 2B58A 3S6HA 2WPXA 3KZWA 4P44A 3TT2A 1B87A 2PE3A 4FD7A 3RAMA 3F9KC 4TWEA 3CXSA 3IO1A 4CYNA 3FIXA 2CNMA 2Q51A 1ZLIA 3IIBA 4M3SA 4YU9A 2ZENA 3TO7A 1SQHA 4B12A 5KTAA 1DTDA 4ZX8A 3S6KA 5F09A 2WZNA 2J8NA 3VRRA 2P6FA 2Q0YA 3PFOA 4CGMA 2Z11A 3JUWA 2FIWA 2RC4A 1NSAA 4FD6A 3R95A 2ZW7A 3JRUA 4CGLA 5K8PA 3TLCA 4EWTA 3BUOB 1XE4A 2OR4A 4K3NA 4CYQA 1XF8A 4QBJA 1FBVA 4U9YA 4EFDA 4UFWA 4II9A 5E96A 1YVHA 4A4BA 4A37A 4ZY0A 1ZRSA 4DJLA 4C8PA 1L0CA 3HPGG 3IC1A 2F8HA 3LACA 4M8DA 4MHYA 1Y9WA 4C9AA 3SXNA 3FXTA 3T07A 4C86A 1NSLA 4B5PB 2QYVA 3I3GA 2EWBA 2YGWA 3ZNIA 1Q2CA 1ZO0A 3EO4A 3BJ8A 4IAVA 4R9MA 1NE9A 4ZBGA 3TCVA 2D0OA 1PUAA 2O53A 4PV6A 1X10A 2PQ8A 2AE6A 1V0CA 2ANPA 1CBXA 2Q43A 2V8VA 2ZXVA 3IWEA 4R6TA 3V7ZA 4YN3A 2R7HA 2VXKA 4U9ZA 3IU2A 4RR2B 4CGNA 3A9LA 4TNUA 3UY5A 2X7BA 3W6SA 2ARHA 1KUVA 1U6MA 3P2FA 1M44A 4LUAA 3D7HA 1JDEA 3IFEA 3NH4A 4CAVA 4KORA 3F8KA 4JXQA 3NOJA 4AB7A 2QJ8A 3HLPA 4CAEA 4IIXA 4CO9A 2OLSA 2PIZA 4UCMA 1TKHA 3P2HA 2VI7A 5K8NA 2FSRA 2NMTA 4CZ1A 1EZAA 1VBGA 3BUNB 4BPXB 2Y1NA 1ZYMA 1Y9KA 3PP9A 1A9XB 2PJ0A 4WJBA 4B10A 4B5OA 3TLBA 4E5SA 4A94A 4BTFA 2IQ6A 5LYDA 1M4GA 4F6AA 2OOTA 4KNGE 4GM5A 4C9VA 2PJ6A 3U88C 4PXCA 4MCPA 1TIQA 2AFZA 2Z3PA 3FVLA 3N5FA 1S5KA 3PGPA 4B6ZA 4A32A 3BUWB 2ZW4A 3KHXA 1PYTB 2Q7BA 3CPAA 1YK3A 1RO5A 3PBEA 3I1UA 4F0XA 4GXHA 5K99A 3SJFA 2IMOA 2C6GA 4JXRA 3S9MA 4C9RA 1FT7A 2HB6A 1YVOA 2P6EA 1M1DA 4RN7A 3DGVA 1T36B 4MI1A 1IGBA 3FBUA 1JDBC 3IGRA 3EIFA 4LX9A 3SJXA 4M85A 5FD8A 2QVPA 4C9UA 3QNVA 4KLWA 1VBHA 4NGPA 3TLAA 2B4BA 1XJOA 5I0CA 3RO0A 4NGQA 3T5MA 1ZLHA 2RFHA 2PVWA 1NBWA 3ZJ0A 4B14A 3D68A 3VRPA 2HWGA 4L8AA 2YJTA 2DEAA 4IK2A 2NSMA 4R57A 5K8OA 1C30B 4QUSA 2OZUA 1KUYA 2E28A 5JYBA 2PJ7A 2P0WA 3OWCA 4MJXA 4IHMA 5DWNA 5IX3A 4UBRA 2WUUA 2EK9A 1A2ZA 5CPAA 1CS0B 1ARLA 4R7MA 1YVKA 3PEIA 5KTDA 5F5XA 3MGDA 3B2YA 5AG7A 1JQGA 2FE7A 2NYQA 2PJBA 4NSQA 3R9GA 1QSMA 2PR1A 4J0NA 4C8FA 1QQ9A 1Y7RA 4LQGA 1HDQA 3NH8A 3W91A 3EZEA 4KUBA 5AG6A 4Y49B 2B4DA 4Y49C 5HVFA 4YFJA 5F49A 2REFA 4OMEA 2Z3OA 3T9YA 4NEXA 2PJAA 3D66A 2Z3LA 4AG7A 1JWQA 3E0KA 5D29A 1AUGA 1KWMA 2ZPAA 3F5BA 5D8NA 4B13A 2FM4A 5ELYA 2BSWA 2ZEMA 4UIAA 5IB0A 1QMUA 2P6GA 2FXFA 3TLGB 4KOYA 4X2TA 4HNWB 5J3XA 1WJTA 3F0AA 3KL9A 4HKFA 4A38A 3VTAA 1ON0A 2VL1A 4P4JA 4NCZA 1BLLE 3PLFB 4KSAA 2ATRA 3IJ3A 5G21A 4E8OA 4EYSA 3BUXB 2WPWA 3WC7A 3GJZA 2V77A 3FB3A 2X0SA 5F1YA 5HKYA 2ZEHA 2GU2A 3KKWA 4PQAA 3PZJA 2DPTA 2PCUA 4A4CA 3D4UA 3H5ZA 4L89A 2PC1A 2QECA 5EBVA 3OP0A 4JZ0A 5CNPA 4C68A 2PSWA 2JEVA 4C8AA 1R43A 3TOBA 1KZFA 2O28A 4JYWA 1S60A 3DSBA 4CAWA 2RB7A 3IWWA 5THWA 4CYPA 2A4NA 4EMEA 2PJ8A 3PFVA 4R87A 3TLYA 4KOVA 4XPKA 3VWEA 8CPAA 1Q5XA 3VROA 4UIBA 2AFWA 1VKCA 2F7VA 4ORFA 4A39A 4JWPA 2PVVA 5I4MA 1AMPA 3FEDA 4UEFA 4MFPA 2KCWA 2I79A 4A30A 3BJ7A 1S7NA 4C8TA 4PSXA 2OZHA 4PSWA 1M6VB 1YLEA 2PJ3A 2BL1A 5AXIA 3SHPA 4MJ8A 3R1KA 2EBJA 4R3LA 4B11A 1LOKA 1Z8XA 2V8DA 3BI0A 5DS0A 3R96A 1Y9ZA 1Z5RA 2Q4YA 1YMEA 2VKZG 3VRQA 2J8MA 4DNCA 5JH9A 1F2OA 1YR0A 3LD2A 4OP4A 4B5PA 4C2YA 4MFQA 1BPMA 4OIWA 2EZBA 3SR3A 4MFLA 2GANA 3BLNA 2AFSA 2AUNA 1XF1A 3G23A 2JDDA 3DLJA 3VRNA 4PXBA 3RYOA 2GP4A 2HV2A 2JLMA 2K5TA 2R1IA 3FNCA 1IU8A 4NGTA 2J8RA 5G20A 3CXPA 1VHSA 4FUUA 2YNCC 1ZL0A 3I74A 2DXQA 2BCOA 1Q2DA 3NA6A 4CRZB 2PIYA 4NGNA 4XNHB 4XNHC 4MFKA 1ELLP 1F2PA 4OC2A 4H6UA 5J8FA 1M4DA 1GGOA 2FCKA 2B5GB 3WABA 5HVGA 1KEEB 4KUAA 3QAYA 2PRQA 4ZI6A 4C9EA 2PRBA 3SI0A 2PJ2A 3GUXA 5H84A 3TLEA 3EC4A 4NGRA 1IICA 1TXRA 4UWJA 4W9YA 4RS2A 3N7ZA 2JDCA 2OB0A 5F13A 2PJ5A 2D0PA 3S9LA 4C84A 3LODA 4NFRA 1KBLA 3K9UA 2C1CA 3B3SA 1S7FA 4UF4A 1MJAA 1QSRA 5GCNA 1LAPA 3S6GA 4AG9A 4F8ZA 3D3SA 4ZYQA 1F57A 4PK2A 4CGPA 3KASA 3HUVA 3BHXA 2D4PA 2Q7SA 1YW4A 4UWIA 3R9EA 3WC5A 4P45A 2GE3A 3CXQA 4MRIA 5A27A 4AXVA 3KGQA 5ISVA 3H4QA 4MI4A 5JGFA 3IWGA 4R3KA 3PB6X 3WC6A 2QIRA 3NE7A 3ISZA 4A33A 4F9VA 1BAVA 5HXDA 2HROA 1VHOA 2GLJA 2GLFA 4A2ZA 3TFYA 4HNXB 5DWMA 4LQ6A 3VWDA 4BD9A 4KOWA 4KVME 3FH4A 4QC6A 3KHZA 1OZPA 4BINA 1TF8A 2VQYA 4F0YA 3JVNA 4MHZA 3TX8A 2XPOA 2FVGA 2JEWA 4KOSA 3BI1A 2F5IA 2BUEA 3ICUA 1LFWA 1Q2YA 2EK8A 5K8MA 4C2XA 4M6GA 5LYFA 4TJVA 2V8GA 3TC8A 2OZGA 5J1QA 5JVLA 1BOBA 3B3TA 1CP7A 5JM6A 2CNTA 4MHDA 1KC7A 3RBUA 4MFJA 3SI1A 2HUZA 4PXDA 3KR4A 1QSNA 3HPHE 5HH1A 2EZCA 1CJWA 1Z4RA 2ZEFA 4PPZA 4JVOA 2H5MA 4YGOA 4YRHA 2ZELA 1DE4C 2XPNA 1MK4A 2Z10A 3PB7X 3QAHA 4NF1A 3TO6A 3H8GA 1P0HA 1XFOA 1Y7EA 2C27A 3IEHA 1XRYA 1CP6A 1Y0RA 3TYXA 4P6YA 3B3VA 4PK3A 4WWVA 3WR7A 4CAXA 3KRVA 1R61A 1Z9EA 1IIDA 3SJEA 3HMJG 1H8LA 2G3TA 2R98A 2Z3KA 3H8EA 2CTCA 3B7IA 4KOUA 4KVOE 4MCSA 1CG2A 3GY9A 4X3RA 1QSOA 4J3GA 4KZTA 2VEZA 5AG5A 4C99A 3O8ZA 1WVMA 5BY0A 1X12A 1Z4EA 5LRJA 5LRGA 5CBMA 4CDKA 1CX8A 1XEBA 1HDUA 4H89A 4MBUA 3NFZA 4ONUA 1WK4A 4JLYA 4MFZA 3V8IA 4BMHA 2AFMA 2ZOFA 1CPXA 2ODFA 3B3CA 2G3AA 2GIVA 3EFAA 3I9SA 2EUIA 2ZEGA 4GS4A 3W6XA 2XEJA 1ZG8A 4NJRA 3MN8A 1CPSA 1MJ9A 2JBKA 5HVHA 3EXNA 3BXMA 2N3AB 3D7GA 3R9FA 4TJXA 2ZW6A 1YLOA 1YX0A 3FECA 3D8PA 3VATA 3PB9X 3SI2A 2AJ6A 3CDXA 1UWYA 4FAIA 2VZYA 4COGA 3FRMA 2BO9A 2Z3NA 2Z3MA 2MP0A 1Z8WA 2CBLA 2IJZA 3V38A 5C82A 4OC5A 2Z0ZA 4C7HA 2EO8A 3GYAA 1XMTA 2YNEA 2HI6A 4MHNA 4P10A 4A31A 2YNDA 2G0BA 2ZEDA 3DR8A 4R76A 4XPLA 1QSTA 3FF3A 1J3LA 1V6CA 3FMCA 4OC4A 4EVYA 1KUXA 4MHPA 3GKRA 4OIDA 2Y0MA 4P4DA 4NGSA 4C85A 2WSAA 4MXUA 3GB0A 2QMLA 3G3SA 1LANA 3LWUA 4CAFA 2PJ1A 1DIKA 2B3VA 2EZAA 1I1DA 1LRZA 2PDOA 5HKWA 1VI4A 4ONWA 2EVNA 2AFUA 1RXTA 4I49A 5F9MA 2FS5A 4H1HA 5IB9A 4MY0A 2YNCA 4NGMA 4GPLB 2BOAA 4IF5A 1S7KA 3PFEA 1ELMP 1J4JA 1N71A 1EO0A 2DIKA 2GFQA 1XOVA 3TTHA 3TE4A 2B5GA 1EZBA 2VZZA 4JJXA 3OB2B 4E94A 1Z8LA 3H8FA 3SXOA 1IYLA 2YJVA 1I21A 4O23A 3JTKA 2Q44A 3DR6A 4E0AA 1HEEA 1TKJA 3FEEA 3C26A 1VGYA 4RUHA 1IB1E 4UEZA 3ZZIA 3D67A 3PT1A 4AVAA 2CXAA 5BWAB 3BUMB 1NXJA 4KLVA 1P4NA 5JQ4A 4FD5A 4DYOA 2Q4VA 5F47A 4ZY2A 4M6IA 2UV8G 3LMSA 4UEEA 5AGEA 3S6FA 1FY7A 2HQYA 3FX6A 3CPXA 1ZG9A 4X8IA 4OADA 5HMNA 5G22A 2FT0A 4Q38A 4Q7AA 4CPAA 3D7FA 2O4HA 1RTQA 5J8CA 3TO9A 2XEFA 2FIAA 4KVXA 2REEA 3OAKA 2CNSA 1B47A 3B3WA 3K2KA 3KI9A 4OKOA 4FD4A 5G1ZA 4YWYA 4PXEA 5F46A 2OU2A 1BO4A 4KSFA 4MMOA 4C8CA 3I6SA 3MRUA 4CYOA 4Z65A 3VARA 5JPHA 3DNSA 2CTBA 4G1PA 4Q36A 2V8HA 3RNZA 1UFHA 4AVBA 3T0TA 4UA3A 4A95A 2PCNA 1YGHA 2I00A 3FJUA 1BXRB 4OC0A 1I12A 4CDJA 4BPWB 5F48A 5LRKA 3SJGA 4C8UA 2CY2A 1XIXA 1CE8B 2WYRA 4NXYA 2G9DA 4UCPA 4CGOA 4X5KA 1R3NA 3L2NA 1K4JA 4QVTA 1NMTA 1MJBA 1GHEA 1YW6A 2GREA 4HPSA 4KSIA 4UCNA 4ZX9A 4BBHA 3NE8A 5LYIA 1FNOA 1WWZA 1PU9A 4F9UA 2CF4A 2C6PA 6CPAA 1C3OB 4OAEA 2HC9A 1IYKA 3CT9A 4P4FA 3KQZA 2AUMA 2R82A 4JD6A 1YQEA 2ABZA 2B3UA 4OC1A 1S7LA 3C8OA 1IOFA 1CM0A 4OC3A 1Y0YA 4NJQA 2XEGA 2ZW5A 2XPLA 2BEIA 3TLZA 1ZG7A 3KR5A 4XPDB 2XEIA 5LYLA 4XPDC 3B35A 2B0AA 2C5QA 1PCAA 4KOTA 3PB4X 3K9TA 3B8GA 1IOIA 4RI1A 3TOAA 1AYEA 1ARMA 5H86A 2CIJA 4FBEA 1YREA 2JBJA 1S3ZA 2IL4A 3U1BA 3FYNA 5EC4A 3S9NA 4INJA 3K4IA 3GIUA 4IUSA 3PBBA 4C2ZA 4OLLA 2Q4ZA 2R8VA 3D2MA 1TKFA 4P4EA 2ZEEA 4H2KA 4P4BA 4MY3A 3RZAA 5KTCA 1M4IA 4ZY1A 4IIYA 3TLGA 1OBRA 4CS0B 4COBA 1IY7A 2VBQA 3VGOA 1M4LA 2ZOGA 3PRTA 4KS9A 5IV0A 2C6CA 3OB1B 1Q7LA 1LCPA 2DPSA 1VIXA 2PJ9A 2PJCA 3IU1A 3T8WA 5AG4A 5C88A 3EY5A 2AFXA 3NFQA 4P4IA 4ZGYB 1R57A 5FVJA 1YSJA 3D2PA 2Y1MA 5HKZA 1VHEA 2ZEOA 3T90A 2J9AA 3KQXA 3WT4A 1GYTA 2AFOA 4QB9A 3EZAA 1TF9A 4R8FA 2OH1A 3PB8X 7CPAA 2B4DB 1Z2LA 2POKA 4CRYB 4BPUB 4AVCA 1XMBA 3T05A 3G8WA 2DLAA 5EMIA 3DDDA 4H6ZA 2PJ4A 4C7IA
chains in the Genus database with same CATH topology
4DUKA 5IR2A 1LAMA 1EE3P 3GLJA 1BPNA 4MCQA 3VH9A 4MCRA 4FWUA 1XBUA 3ISXA 2I3CA 3NH5A 2ZEPA 3D7DA 3KZWA 4P44A 2PE3A 3RAMA 4TWEA 3IO1A 2Q51A 1ZLIA 3IIBA 4YU9A 2ZENA 1DTDA 4ZX8A 5F09A 2WZNA 3PFOA 1NSAA 3JRUA 5K8PA 4EWTA 2OR4A 4K3NA 4EFDA 4A37A 4ZY0A 4DJLA 4C8PA 3IC1A 2F8HA 4MHYA 4C9AA 4C86A 2QYVA 4DYOA 2EWBA 4IAVA 2O53A 2Q43A 2ANPA 2V8VA 3V7ZA 1CBXA 4YN3A 4R6TA 4TNUA 3D7HA 3IFEA 3NH4A 2QJ8A 3HLPA 2PIZA 1TKHA 5K8NA 2PJ0A 4WJBA 4A94A 5LYDA 2IQ6A 4KNGE 4C9VA 2OOTA 4GM5A 2PJ6A 4PXCA 4MCPA 2AFZA 3FVLA 3N5FA 3KHXA 1PYTB 3CPAA 3PBEA 3I1UA 3SJFA 2IMOA 2C6GA 3S9MA 4C9RA 1FT7A 2HB6A 3DGVA 1IGBA 3EIFA 3SJXA 4C9UA 2QVPA 3QNVA 4NGPA 1XJOA 4NGQA 1ZLHA 2RFHA 2PVWA 3D68A 2DEAA 4IK2A 2NSMA 5K8OA 2PJ7A 4IHMA 5CPAA 2EK9A 1ARLA 4R7MA 3PEIA 3B2YA 1JQGA 2NYQA 2PJBA 4C8FA 1QQ9A 4LQGA 1HDQA 3NH8A 5HVFA 4OMEA 2PJAA 3D66A 5D29A 1KWMA 5D8NA 5ELYA 2ZEMA 4UIAA 1QMUA 4X2TA 3KL9A 4A38A 3VTAA 2VL1A 4P4JA 1BLLE 3IJ3A 3WC7A 2V77A 2ZEHA 2GU2A 4PQAA 2PCUA 3D4UA 4JZ0A 4C8AA 1R43A 4JYWA 5CBMA 2RB7A 3IWWA 5THWA 4EMEA 2PJ8A 8CPAA 4UIBA 2AFWA 2F7VA 4A39A 2PVVA 5I4MA 1AMPA 3FEDA 4UEFA 4C8TA 2PJ3A 1LOKA 2V8DA 3BI0A 5DS0A 1Y9ZA 1Z5RA 1YMEA 5JH9A 1F2OA 4OP4A 1BPMA 4OIWA 2AFSA 1XF1A 3DLJA 4PXBA 2GP4A 4NGTA 3I74A 4FUUA 2BCOA 3NA6A 2PIYA 4NGNA 1ELLP 1F2PA 4OC2A 3WABA 5HVGA 2PRQA 4ZI6A 4C9EA 3SI0A 2PJ2A 3GUXA 4NGRA 1TXRA 4W9YA 2PJ5A 3S9LA 4C84A 4NFRA 2C1CA 3B3SA 4UF4A 1LAPA 4F8ZA 4ZYQA 1F57A 3KASA 3HUVA 3BHXA 3WC5A 1YW4A 4P45A 4MRIA 4AXVA 3KGQA 5JGFA 3PB6X 3WC6A 5HXDA 3ISZA 4F9VA 1BAVA 1VHOA 2GLJA 2GLFA 4BD9A 3FH4A 3KHZA 1TF8A 4MHZA 3TX8A 2FVGA 2JEWA 3BI1A 3ICUA 1LFWA 5LYFA 2EK8A 5K8MA 4TJVA 2V8GA 3TC8A 5J1QA 5JM6A 3B3TA 1CP7A 3RBUA 3SI1A 4PXDA 3KR4A 2ZEFA 4PPZA 2ZELA 1DE4C 3PB7X 3H8GA 1XFOA 1Y7EA 3IEHA 1XRYA 1CP6A 1Y0RA 4P6YA 3B3VA 4WWVA 3SJEA 3H8EA 1H8LA 2CTCA 3B7IA 4MCSA 1CG2A 4X3RA 4C99A 1WVMA 5LRJA 5LRGA 4CDKA 1CX8A 1HDUA 3NFZA 2AFMA 2ZOFA 1CPXA 3B3CA 2ZEGA 2XEJA 1ZG8A 4NJRA 3MN8A 1CPSA 2JBKA 5HVHA 3BXMA 3D7GA 4TJXA 1YLOA 3FECA 3VATA 3PB9X 3SI2A 3CDXA 1UWYA 4FAIA 2BO9A 2IJZA 3V38A 4OC5A 4MHNA 4P10A 2ZEDA 4R76A 3FF3A 1V6CA 3FMCA 4OC4A 4MHPA 4OIDA 4P4DA 4NGSA 4C85A 4MXUA 3GB0A 1LANA 3LWUA 2PJ1A 4ONWA 2AFUA 5IB9A 4NGMA 2BOAA 3PFEA 1ELMP 1Z8LA 3H8FA 4O23A 1HEEA 1TKJA 3FEEA 4RUHA 1VGYA 4UEZA 3D67A 4ZY2A 3LMSA 4UEEA 3FX6A 3CPXA 1ZG9A 4X8IA 4CPAA 4Q7AA 3D7FA 2O4HA 1RTQA 2XEFA 4B6ZA 3K2KA 3B3WA 3KI9A 4OKOA 4YWYA 4PXEA 4MMOA 4C8CA 3I6SA 3MRUA 4Z65A 3VARA 4G1PA 2CTBA 2V8HA 3FJUA 4OC0A 4CDJA 5LRKA 4C8UA 3SJGA 2WYRA 2G9DA 1R3NA 3L2NA 4KSIA 2GREA 1YW6A 4ZX9A 5LYIA 1FNOA 4F9UA 2CF4A 2C6PA 6CPAA 2HC9A 3CT9A 4P4FA 3KQZA 2ABZA 4OC1A 4OC3A 1Y0YA 4NJQA 2XEGA 1ZG7A 3KR5A 2XEIA 5LYLA 3B35A 2C5QA 1PCAA 3PB4X 3K9TA 1AYEA 1ARMA 2CIJA 4FBEA 2JBJA 3S9NA 3PBBA 2Q4ZA 3RZAA 4H2KA 1TKFA 4P4EA 2ZEEA 4P4BA 4ZY1A 1OBRA 1IY7A 2ZOGA 1M4LA 3PRTA 2C6CA 2PJ9A 1Q7LA 1LCPA 2PJCA 1VIXA 3T8WA 2AFXA 4P4IA 1YSJA 1VHEA 2ZEOA 2J9AA 3KQXA 3WT4A 1GYTA 2AFOA 1TF9A 4R8FA 3PB8X 7CPAA 1Z2LA 2POKA 1XMBA 2PJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUK A;  1LAM A;  1EE3 P;  3GLJ A;  1BPN A;  4MCQ A;  3VH9 A;  4MCR A;  4FWU A;  1XBU A;  3ISX A;  2I3C A;  3NH5 A;  2ZEP A;  3D7D A;  3KZW A;  4P44 A;  2PE3 A;  3RAM A;  4TWE A;  3IO1 A;  2Q51 A;  1ZLI A;  3IIB A;  4YU9 A;  2ZEN A;  1DTD A;  4ZX8 A;  5F09 A;  2WZN A;  3PFO A;  1NSA A;  3JRU A;  5K8P A;  4EWT A;  2OR4 A;  4K3N A;  4EFD A;  4A37 A;  4ZY0 A;  4DJL A;  4C8P A;  3IC1 A;  2F8H A;  4MHY A;  4C9A A;  4C86 A;  2QYV A;  4DYO A;  2EWB A;  4IAV A;  2O53 A;  2Q43 A;  2ANP A;  2V8V A;  3V7Z A;  1CBX A;  4YN3 A;  4R6T A;  4TNU A;  3D7H A;  3IFE A;  3NH4 A;  2QJ8 A;  3HLP A;  2PIZ A;  1TKH A;  5K8N A;  2PJ0 A;  4WJB A;  4A94 A;  5LYD A;  2IQ6 A;  4KNG E;  4C9V A;  2OOT A;  4GM5 A;  2PJ6 A;  4PXC A;  4MCP A;  2AFZ A;  3FVL A;  3N5F A;  3KHX A;  1PYT B;  3CPA A;  3PBE A;  3I1U A;  3SJF A;  2IMO A;  2C6G A;  3S9M A;  4C9R A;  1FT7 A;  2HB6 A;  3DGV A;  1IGB A;  3EIF A;  3SJX A;  4C9U A;  2QVP A;  3QNV A;  4NGP A;  1XJO A;  4NGQ A;  1ZLH A;  2RFH A;  2PVW A;  3D68 A;  2DEA A;  4IK2 A;  2NSM A;  5K8O A;  2PJ7 A;  4IHM A;  5CPA A;  2EK9 A;  1ARL A;  4R7M A;  3PEI A;  3B2Y A;  1JQG A;  2NYQ A;  2PJB A;  4C8F A;  1QQ9 A;  4LQG A;  1HDQ A;  3NH8 A;  5HVF A;  4OME A;  2PJA A;  3D66 A;  5D29 A;  1KWM A;  5D8N A;  5ELY A;  2ZEM A;  4UIA A;  1QMU A;  4X2T A;  3KL9 A;  4A38 A;  3VTA A;  2VL1 A;  4P4J A;  1BLL E;  3IJ3 A;  3WC7 A;  2V77 A;  2ZEH A;  2GU2 A;  4PQA A;  2PCU A;  3D4U A;  4JZ0 A;  4C8A A;  1R43 A;  4JYW A;  5CBM A;  2RB7 A;  3IWW A;  5THW A;  4EME A;  2PJ8 A;  8CPA A;  4UIB A;  2AFW A;  2F7V A;  4A39 A;  2PVV A;  5I4M A;  1AMP A;  3FED A;  4UEF A;  4C8T A;  2PJ3 A;  1LOK A;  2V8D A;  3BI0 A;  5DS0 A;  1Y9Z A;  1Z5R A;  1YME A;  5JH9 A;  1F2O A;  4OP4 A;  1BPM A;  4OIW A;  2AFS A;  1XF1 A;  3DLJ A;  4PXB A;  4NGT A;  3I74 A;  4FUU A;  2BCO A;  3NA6 A;  2PIY A;  4NGN A;  1ELL P;  1F2P A;  4OC2 A;  3WAB A;  5HVG A;  2PRQ A;  4ZI6 A;  4C9E A;  3SI0 A;  2PJ2 A;  3GUX A;  4NGR A;  1TXR A;  4W9Y A;  2PJ5 A;  3S9L A;  4C84 A;  4NFR A;  2C1C A;  3B3S A;  4UF4 A;  1LAP A;  4F8Z A;  4ZYQ A;  1F57 A;  3KAS A;  3HUV A;  3BHX A;  3WC5 A;  1YW4 A;  4P45 A;  4MRI A;  4AXV A;  3KGQ A;  5JGF A;  3PB6 X;  3WC6 A;  5HXD A;  3ISZ A;  4F9V A;  1BAV A;  1VHO A;  2GLJ A;  2GLF A;  4BD9 A;  3FH4 A;  3KHZ A;  1TF8 A;  4MHZ A;  3TX8 A;  2FVG A;  2JEW A;  3BI1 A;  3ICU A;  1LFW A;  5LYF A;  2EK8 A;  5K8M A;  4TJV A;  2V8G A;  3TC8 A;  5J1Q A;  5JM6 A;  3B3T A;  1CP7 A;  3RBU A;  3SI1 A;  4PXD A;  3KR4 A;  2ZEF A;  4PPZ A;  2ZEL A;  1DE4 C;  3PB7 X;  3H8G A;  1XFO A;  1Y7E A;  3IEH A;  1XRY A;  1CP6 A;  1Y0R A;  4P6Y A;  3B3V A;  4WWV A;  3SJE A;  3H8E A;  1H8L A;  2CTC A;  3B7I A;  4MCS A;  1CG2 A;  4X3R A;  4C99 A;  1WVM A;  5LRJ A;  5LRG A;  4CDK A;  1CX8 A;  1HDU A;  3NFZ A;  2AFM A;  2ZOF A;  1CPX A;  3B3C A;  2ZEG A;  2XEJ A;  1ZG8 A;  4NJR A;  3MN8 A;  1CPS A;  2JBK A;  5HVH A;  3BXM A;  3D7G A;  4TJX A;  1YLO A;  3FEC A;  3VAT A;  3PB9 X;  3SI2 A;  3CDX A;  1UWY A;  4FAI A;  2BO9 A;  2IJZ A;  3V38 A;  4OC5 A;  4MHN A;  4P10 A;  2ZED A;  4R76 A;  3FF3 A;  1V6C A;  3FMC A;  4OC4 A;  4MHP A;  4OID A;  4P4D A;  4NGS A;  4C85 A;  4MXU A;  3GB0 A;  1LAN A;  3LWU A;  2PJ1 A;  4ONW A;  2AFU A;  5IB9 A;  4NGM A;  2BOA A;  3PFE A;  1ELM P;  1Z8L A;  3H8F A;  4O23 A;  1HEE A;  1TKJ A;  3FEE A;  4RUH A;  1VGY A;  4UEZ A;  3D67 A;  4ZY2 A;  3LMS A;  4UEE A;  3FX6 A;  3CPX A;  1ZG9 A;  4X8I A;  4CPA A;  4Q7A A;  3D7F A;  2O4H A;  1RTQ A;  2XEF A;  4B6Z A;  3K2K A;  3B3W A;  3KI9 A;  4OKO A;  4YWY A;  4PXE A;  4MMO A;  4C8C A;  3I6S A;  3MRU A;  4Z65 A;  3VAR A;  4G1P A;  2CTB A;  2V8H A;  3FJU A;  4OC0 A;  4CDJ A;  5LRK A;  4C8U A;  3SJG A;  2WYR A;  2G9D A;  1R3N A;  3L2N A;  4KSI A;  2GRE A;  1YW6 A;  4ZX9 A;  5LYI A;  1FNO A;  4F9U A;  2CF4 A;  2C6P A;  6CPA A;  2HC9 A;  3CT9 A;  4P4F A;  3KQZ A;  2ABZ A;  4OC1 A;  4OC3 A;  1Y0Y A;  4NJQ A;  2XEG A;  1ZG7 A;  3KR5 A;  2XEI A;  5LYL A;  3B35 A;  1PCA A;  3PB4 X;  3K9T A;  1AYE A;  1ARM A;  2CIJ A;  4FBE A;  2JBJ A;  3S9N A;  3PBB A;  2Q4Z A;  3RZA A;  4H2K A;  1TKF A;  4P4E A;  2ZEE A;  4P4B A;  4ZY1 A;  1OBR A;  1IY7 A;  2ZOG A;  1M4L A;  3PRT A;  2C6C A;  2PJ9 A;  1Q7L A;  1LCP A;  2PJC A;  1VIX A;  3T8W A;  2AFX A;  4P4I A;  1YSJ A;  1VHE A;  2ZEO A;  2J9A A;  3KQX A;  3WT4 A;  1GYT A;  2AFO A;  1TF9 A;  4R8F A;  3PB8 X;  7CPA A;  1Z2L A;  2POK A;  1XMB A;  2PJ4 A; 
#chains in the Genus database with same CATH topology
 4DUK A;  2DF5 A;  2Q04 A;  5IR2 A;  1Z8T A;  4K30 A;  5A28 A;  1LAM A;  1EE3 P;  3GLJ A;  3QB8 A;  1Z9U A;  1BPN A;  2D4O A;  2B4J C;  4MCQ A;  3VH9 A;  4E2A A;  4M6H A;  4UFX A;  4MCR A;  4UFV A;  4U5Y A;  4FWU A;  1XBU A;  1B6B A;  2FL4 A;  3CZX A;  3ISX A;  2I3C A;  2PR8 A;  4HNY B;  4KOX A;  3NH5 A;  2ZEP A;  3D7D A;  2XPP A;  3EZB A;  2B58 A;  3S6H A;  2WPX A;  3KZW A;  4P44 A;  3TT2 A;  1B87 A;  2PE3 A;  4FD7 A;  3RAM A;  3F9K C;  4TWE A;  3CXS A;  3IO1 A;  4CYN A;  3FIX A;  2CNM A;  2Q51 A;  1ZLI A;  3IIB A;  4M3S A;  4YU9 A;  2ZEN A;  3TO7 A;  1SQH A;  4B12 A;  5KTA A;  1DTD A;  4ZX8 A;  3S6K A;  5F09 A;  2WZN A;  2J8N A;  3VRR A;  2P6F A;  2Q0Y A;  3PFO A;  4CGM A;  2Z11 A;  3JUW A;  2FIW A;  2RC4 A;  1NSA A;  4FD6 A;  3R95 A;  2ZW7 A;  3JRU A;  4CGL A;  5K8P A;  3TLC A;  4EWT A;  3BUO B;  1XE4 A;  2OR4 A;  4K3N A;  4CYQ A;  1XF8 A;  4QBJ A;  1FBV A;  4U9Y A;  4EFD A;  4UFW A;  4II9 A;  5E96 A;  1YVH A;  4A4B A;  4A37 A;  4ZY0 A;  1ZRS A;  4DJL A;  4C8P A;  1L0C A;  3HPG G;  3IC1 A;  2F8H A;  3LAC A;  4M8D A;  4MHY A;  1Y9W A;  4C9A A;  3SXN A;  3FXT A;  3T07 A;  4C86 A;  1NSL A;  4B5P B;  2QYV A;  3I3G A;  2EWB A;  2YGW A;  3ZNI A;  1Q2C A;  1ZO0 A;  3EO4 A;  3BJ8 A;  4IAV A;  4R9M A;  1NE9 A;  4ZBG A;  3TCV A;  2D0O A;  1PUA A;  2O53 A;  4PV6 A;  1X10 A;  2PQ8 A;  2AE6 A;  1V0C A;  2ANP A;  1CBX A;  2Q43 A;  2V8V A;  2ZXV A;  3IWE A;  4R6T A;  3V7Z A;  4YN3 A;  2R7H A;  2VXK A;  4U9Z A;  3IU2 A;  4RR2 B;  4CGN A;  3A9L A;  4TNU A;  3UY5 A;  2X7B A;  3W6S A;  2ARH A;  1KUV A;  1U6M A;  3P2F A;  1M44 A;  4LUA A;  3D7H A;  1JDE A;  3IFE A;  3NH4 A;  4CAV A;  4KOR A;  3F8K A;  4JXQ A;  3NOJ A;  4AB7 A;  2QJ8 A;  3HLP A;  4CAE A;  4IIX A;  4CO9 A;  2OLS A;  2PIZ A;  4UCM A;  1TKH A;  3P2H A;  2VI7 A;  5K8N A;  2FSR A;  2NMT A;  4CZ1 A;  1EZA A;  1VBG A;  3BUN B;  4BPX B;  2Y1N A;  1ZYM A;  1Y9K A;  3PP9 A;  1A9X B;  2PJ0 A;  4WJB A;  4B10 A;  4B5O A;  3TLB A;  4E5S A;  4A94 A;  4BTF A;  2IQ6 A;  5LYD A;  1M4G A;  4F6A A;  2OOT A;  4KNG E;  4GM5 A;  4C9V A;  2PJ6 A;  3U88 C;  4PXC A;  4MCP A;  1TIQ A;  2AFZ A;  2Z3P A;  3FVL A;  3N5F A;  1S5K A;  3PGP A;  4B6Z A;  4A32 A;  3BUW B;  2ZW4 A;  3KHX A;  1PYT B;  2Q7B A;  3CPA A;  1YK3 A;  1RO5 A;  3PBE A;  3I1U A;  4F0X A;  4GXH A;  5K99 A;  3SJF A;  2IMO A;  2C6G A;  4JXR A;  3S9M A;  4C9R A;  1FT7 A;  2HB6 A;  1YVO A;  2P6E A;  1M1D A;  4RN7 A;  3DGV A;  1T36 B;  4MI1 A;  1IGB A;  3FBU A;  1JDB C;  3IGR A;  3EIF A;  4LX9 A;  3SJX A;  4M85 A;  5FD8 A;  2QVP A;  4C9U A;  3QNV A;  4KLW A;  1VBH A;  4NGP A;  3TLA A;  2B4B A;  1XJO A;  5I0C A;  3RO0 A;  4NGQ A;  3T5M A;  1ZLH A;  2RFH A;  2PVW A;  1NBW A;  3ZJ0 A;  4B14 A;  3D68 A;  3VRP A;  2HWG A;  4L8A A;  2YJT A;  2DEA A;  4IK2 A;  2NSM A;  4R57 A;  5K8O A;  1C30 B;  4QUS A;  2OZU A;  1KUY A;  2E28 A;  5JYB A;  2PJ7 A;  2P0W A;  3OWC A;  4MJX A;  4IHM A;  5DWN A;  5IX3 A;  4UBR A;  2WUU A;  2EK9 A;  1A2Z A;  5CPA A;  1CS0 B;  1ARL A;  4R7M A;  1YVK A;  3PEI A;  5KTD A;  5F5X A;  3MGD A;  3B2Y A;  5AG7 A;  1JQG A;  2FE7 A;  2NYQ A;  2PJB A;  4NSQ A;  3R9G A;  1QSM A;  2PR1 A;  4J0N A;  4C8F A;  1QQ9 A;  1Y7R A;  4LQG A;  1HDQ A;  3NH8 A;  3W91 A;  3EZE A;  4KUB A;  5AG6 A;  4Y49 B;  2B4D A;  4Y49 C;  5HVF A;  4YFJ A;  5F49 A;  2REF A;  4OME A;  2Z3O A;  3T9Y A;  4NEX A;  2PJA A;  3D66 A;  2Z3L A;  4AG7 A;  1JWQ A;  3E0K A;  5D29 A;  1AUG A;  1KWM A;  2ZPA A;  3F5B A;  5D8N A;  4B13 A;  2FM4 A;  5ELY A;  2BSW A;  2ZEM A;  4UIA A;  5IB0 A;  1QMU A;  2P6G A;  2FXF A;  3TLG B;  4KOY A;  4X2T A;  4HNW B;  5J3X A;  1WJT A;  3F0A A;  3KL9 A;  4HKF A;  4A38 A;  3VTA A;  1ON0 A;  2VL1 A;  4P4J A;  4NCZ A;  1BLL E;  3PLF B;  4KSA A;  2ATR A;  3IJ3 A;  5G21 A;  4E8O A;  4EYS A;  3BUX B;  2WPW A;  3WC7 A;  3GJZ A;  2V77 A;  3FB3 A;  2X0S A;  5F1Y A;  5HKY A;  2ZEH A;  2GU2 A;  3KKW A;  4PQA A;  3PZJ A;  2DPT A;  2PCU A;  4A4C A;  3D4U A;  3H5Z A;  4L89 A;  2PC1 A;  2QEC A;  5EBV A;  3OP0 A;  4JZ0 A;  5CNP A;  4C68 A;  2PSW A;  2JEV A;  4C8A A;  1R43 A;  3TOB A;  1KZF A;  2O28 A;  4JYW A;  1S60 A;  3DSB A;  4CAW A;  2RB7 A;  3IWW A;  5THW A;  4CYP A;  2A4N A;  4EME A;  2PJ8 A;  3PFV A;  4R87 A;  3TLY A;  4KOV A;  4XPK A;  3VWE A;  8CPA A;  1Q5X A;  3VRO A;  4UIB A;  2AFW A;  1VKC A;  2F7V A;  4ORF A;  4A39 A;  4JWP A;  2PVV A;  5I4M A;  1AMP A;  3FED A;  4UEF A;  4MFP A;  2KCW A;  2I79 A;  4A30 A;  3BJ7 A;  1S7N A;  4C8T A;  4PSX A;  2OZH A;  4PSW A;  1M6V B;  1YLE A;  2PJ3 A;  2BL1 A;  5AXI A;  3SHP A;  4MJ8 A;  3R1K A;  2EBJ A;  4R3L A;  4B11 A;  1LOK A;  1Z8X A;  2V8D A;  3BI0 A;  5DS0 A;  3R96 A;  1Y9Z A;  1Z5R A;  2Q4Y A;  1YME A;  2VKZ G;  3VRQ A;  2J8M A;  4DNC A;  5JH9 A;  1F2O A;  1YR0 A;  3LD2 A;  4OP4 A;  4B5P A;  4C2Y A;  4MFQ A;  1BPM A;  4OIW A;  2EZB A;  3SR3 A;  4MFL A;  2GAN A;  3BLN A;  2AFS A;  2AUN A;  1XF1 A;  3G23 A;  2JDD A;  3DLJ A;  3VRN A;  4PXB A;  3RYO A;  2GP4 A;  2HV2 A;  2JLM A;  2K5T A;  2R1I A;  3FNC A;  1IU8 A;  4NGT A;  2J8R A;  5G20 A;  3CXP A;  1VHS A;  4FUU A;  2YNC C;  1ZL0 A;  3I74 A;  2DXQ A;  2BCO A;  1Q2D A;  3NA6 A;  4CRZ B;  2PIY A;  4NGN A;  4XNH B;  4XNH C;  4MFK A;  1ELL P;  1F2P A;  4OC2 A;  4H6U A;  5J8F A;  1M4D A;  1GGO A;  2FCK A;  2B5G B;  3WAB A;  5HVG A;  1KEE B;  4KUA A;  3QAY A;  2PRQ A;  4ZI6 A;  4C9E A;  2PRB A;  3SI0 A;  2PJ2 A;  3GUX A;  5H84 A;  3TLE A;  3EC4 A;  4NGR A;  1IIC A;  1TXR A;  4UWJ A;  4W9Y A;  4RS2 A;  3N7Z A;  2JDC A;  2OB0 A;  5F13 A;  2PJ5 A;  2D0P A;  3S9L A;  4C84 A;  3LOD A;  4NFR A;  1KBL A;  3K9U A;  2C1C A;  3B3S A;  1S7F A;  4UF4 A;  1MJA A;  1QSR A;  5GCN A;  1LAP A;  3S6G A;  4AG9 A;  4F8Z A;  3D3S A;  4ZYQ A;  1F57 A;  4PK2 A;  4CGP A;  3KAS A;  3HUV A;  3BHX A;  2D4P A;  2Q7S A;  1YW4 A;  4UWI A;  3R9E A;  3WC5 A;  4P45 A;  2GE3 A;  3CXQ A;  4MRI A;  5A27 A;  4AXV A;  3KGQ A;  5ISV A;  3H4Q A;  4MI4 A;  5JGF A;  3IWG A;  4R3K A;  3PB6 X;  3WC6 A;  2QIR A;  3NE7 A;  3ISZ A;  4A33 A;  4F9V A;  1BAV A;  5HXD A;  2HRO A;  1VHO A;  2GLJ A;  2GLF A;  4A2Z A;  3TFY A;  4HNX B;  5DWM A;  4LQ6 A;  3VWD A;  4BD9 A;  4KOW A;  4KVM E;  3FH4 A;  4QC6 A;  3KHZ A;  1OZP A;  4BIN A;  1TF8 A;  2VQY A;  4F0Y A;  3JVN A;  4MHZ A;  3TX8 A;  2XPO A;  2FVG A;  2JEW A;  4KOS A;  3BI1 A;  2F5I A;  2BUE A;  3ICU A;  1LFW A;  1Q2Y A;  2EK8 A;  5K8M A;  4C2X A;  4M6G A;  5LYF A;  4TJV A;  2V8G A;  3TC8 A;  2OZG A;  5J1Q A;  5JVL A;  1BOB A;  3B3T A;  1CP7 A;  5JM6 A;  2CNT A;  4MHD A;  1KC7 A;  3RBU A;  4MFJ A;  3SI1 A;  2HUZ A;  4PXD A;  3KR4 A;  1QSN A;  3HPH E;  5HH1 A;  2EZC A;  1CJW A;  1Z4R A;  2ZEF A;  4PPZ A;  4JVO A;  2H5M A;  4YGO A;  4YRH A;  2ZEL A;  1DE4 C;  2XPN A;  1MK4 A;  2Z10 A;  3PB7 X;  3QAH A;  4NF1 A;  3TO6 A;  3H8G A;  1P0H A;  1XFO A;  1Y7E A;  2C27 A;  3IEH A;  1XRY A;  1CP6 A;  1Y0R A;  3TYX A;  4P6Y A;  3B3V A;  4PK3 A;  4WWV A;  3WR7 A;  4CAX A;  3KRV A;  1R61 A;  1Z9E A;  1IID A;  3SJE A;  3HMJ G;  1H8L A;  2G3T A;  2R98 A;  2Z3K A;  3H8E A;  2CTC A;  3B7I A;  4KOU A;  4KVO E;  4MCS A;  1CG2 A;  3GY9 A;  4X3R A;  1QSO A;  4J3G A;  4KZT A;  2VEZ A;  5AG5 A;  4C99 A;  3O8Z A;  1WVM A;  5BY0 A;  1X12 A;  1Z4E A;  5LRJ A;  5LRG A;  5CBM A;  4CDK A;  1CX8 A;  1XEB A;  1HDU A;  4H89 A;  4MBU A;  3NFZ A;  4ONU A;  1WK4 A;  4JLY A;  4MFZ A;  3V8I A;  4BMH A;  2AFM A;  2ZOF A;  1CPX A;  2ODF A;  3B3C A;  2G3A A;  2GIV A;  3EFA A;  3I9S A;  2EUI A;  2ZEG A;  4GS4 A;  3W6X A;  2XEJ A;  1ZG8 A;  4NJR A;  3MN8 A;  1CPS A;  1MJ9 A;  2JBK A;  5HVH A;  3EXN A;  3BXM A;  2N3A B;  3D7G A;  3R9F A;  4TJX A;  2ZW6 A;  1YLO A;  1YX0 A;  3FEC A;  3D8P A;  3VAT A;  3PB9 X;  3SI2 A;  2AJ6 A;  3CDX A;  1UWY A;  4FAI A;  2VZY A;  4COG A;  3FRM A;  2BO9 A;  2Z3N A;  2Z3M A;  2MP0 A;  1Z8W A;  2CBL A;  2IJZ A;  3V38 A;  5C82 A;  4OC5 A;  2Z0Z A;  4C7H A;  2EO8 A;  3GYA A;  1XMT A;  2YNE A;  2HI6 A;  4MHN A;  4P10 A;  4A31 A;  2YND A;  2G0B A;  2ZED A;  3DR8 A;  4R76 A;  4XPL A;  1QST A;  3FF3 A;  1J3L A;  1V6C A;  3FMC A;  4OC4 A;  4EVY A;  1KUX A;  4MHP A;  3GKR A;  4OID A;  2Y0M A;  4P4D A;  4NGS A;  4C85 A;  2WSA A;  4MXU A;  3GB0 A;  2QML A;  3G3S A;  1LAN A;  3LWU A;  4CAF A;  2PJ1 A;  1DIK A;  2B3V A;  2EZA A;  1I1D A;  1LRZ A;  2PDO A;  5HKW A;  1VI4 A;  4ONW A;  2EVN A;  2AFU A;  1RXT A;  4I49 A;  5F9M A;  2FS5 A;  4H1H A;  5IB9 A;  4MY0 A;  2YNC A;  4NGM A;  4GPL B;  2BOA A;  4IF5 A;  1S7K A;  3PFE A;  1ELM P;  1J4J A;  1N71 A;  1EO0 A;  2DIK A;  2GFQ A;  1XOV A;  3TTH A;  3TE4 A;  2B5G A;  1EZB A;  2VZZ A;  4JJX A;  3OB2 B;  4E94 A;  1Z8L A;  3H8F A;  3SXO A;  1IYL A;  2YJV A;  1I21 A;  4O23 A;  3JTK A;  2Q44 A;  3DR6 A;  4E0A A;  1HEE A;  1TKJ A;  3FEE A;  3C26 A;  1VGY A;  4RUH A;  1IB1 E;  4UEZ A;  3ZZI A;  3D67 A;  3PT1 A;  4AVA A;  2CXA A;  5BWA B;  3BUM B;  1NXJ A;  4KLV A;  1P4N A;  5JQ4 A;  4FD5 A;  4DYO A;  2Q4V A;  5F47 A;  4ZY2 A;  4M6I A;  2UV8 G;  3LMS A;  4UEE A;  5AGE A;  3S6F A;  1FY7 A;  2HQY A;  3FX6 A;  3CPX A;  1ZG9 A;  4X8I A;  4OAD A;  5HMN A;  5G22 A;  2FT0 A;  4Q38 A;  4Q7A A;  4CPA A;  3D7F A;  2O4H A;  1RTQ A;  5J8C A;  3TO9 A;  2XEF A;  2FIA A;  4KVX A;  2REE A;  3OAK A;  2CNS A;  1B47 A;  3B3W A;  3K2K A;  3KI9 A;  4OKO A;  4FD4 A;  5G1Z A;  4YWY A;  4PXE A;  5F46 A;  2OU2 A;  1BO4 A;  4KSF A;  4MMO A;  4C8C A;  3I6S A;  3MRU A;  4CYO A;  4Z65 A;  3VAR A;  5JPH A;  3DNS A;  2CTB A;  4G1P A;  4Q36 A;  2V8H A;  3RNZ A;  1UFH A;  4AVB A;  3T0T A;  4UA3 A;  4A95 A;  2PCN A;  1YGH A;  2I00 A;  3FJU A;  1BXR B;  4OC0 A;  1I12 A;  4CDJ A;  4BPW B;  5F48 A;  5LRK A;  3SJG A;  4C8U A;  2CY2 A;  1XIX A;  1CE8 B;  2WYR A;  4NXY A;  2G9D A;  4UCP A;  4CGO A;  4X5K A;  1R3N A;  3L2N A;  1K4J A;  4QVT A;  1NMT A;  1MJB A;  1GHE A;  1YW6 A;  2GRE A;  4HPS A;  4KSI A;  4UCN A;  4ZX9 A;  4BBH A;  3NE8 A;  5LYI A;  1FNO A;  1WWZ A;  1PU9 A;  4F9U A;  2CF4 A;  2C6P A;  6CPA A;  1C3O B;  4OAE A;  2HC9 A;  1IYK A;  3CT9 A;  4P4F A;  3KQZ A;  2AUM A;  2R82 A;  4JD6 A;  1YQE A;  2ABZ A;  2B3U A;  4OC1 A;  1S7L A;  3C8O A;  1IOF A;  1CM0 A;  4OC3 A;  1Y0Y A;  4NJQ A;  2XEG A;  2ZW5 A;  2XPL A;  2BEI A;  3TLZ A;  1ZG7 A;  3KR5 A;  4XPD B;  2XEI A;  5LYL A;  4XPD C;  3B35 A;  2B0A A;  2C5Q A;  1PCA A;  4KOT A;  3PB4 X;  3K9T A;  3B8G A;  1IOI A;  4RI1 A;  3TOA A;  1AYE A;  1ARM A;  5H86 A;  2CIJ A;  4FBE A;  1YRE A;  2JBJ A;  1S3Z A;  2IL4 A;  3U1B A;  3FYN A;  5EC4 A;  3S9N A;  4INJ A;  3K4I A;  3GIU A;  4IUS A;  3PBB A;  4C2Z A;  4OLL A;  2Q4Z A;  2R8V A;  3D2M A;  1TKF A;  4P4E A;  2ZEE A;  4H2K A;  4P4B A;  4MY3 A;  3RZA A;  5KTC A;  1M4I A;  4ZY1 A;  4IIY A;  3TLG A;  1OBR A;  4CS0 B;  4COB A;  1IY7 A;  2VBQ A;  3VGO A;  1M4L A;  2ZOG A;  3PRT A;  4KS9 A;  5IV0 A;  2C6C A;  3OB1 B;  1Q7L A;  1LCP A;  2DPS A;  1VIX A;  2PJ9 A;  2PJC A;  3IU1 A;  3T8W A;  5AG4 A;  5C88 A;  3EY5 A;  2AFX A;  3NFQ A;  4P4I A;  4ZGY B;  1R57 A;  5FVJ A;  1YSJ A;  3D2P A;  2Y1M A;  5HKZ A;  1VHE A;  2ZEO A;  3T90 A;  2J9A A;  3KQX A;  3WT4 A;  1GYT A;  2AFO A;  4QB9 A;  3EZA A;  1TF9 A;  4R8F A;  2OH1 A;  3PB8 X;  7CPA A;  2B4D B;  1Z2L A;  2POK A;  4CRY B;  4BPU B;  4AVC A;  1XMB A;  3T05 A;  3G8W A;  2DLA A;  5EMI A;  3DDD A;  4H6Z A;  2PJ4 A;  4C7I A; 
#chains in the Genus database with same CATH homology
 4DUK A;  5IR2 A;  1LAM A;  1EE3 P;  3GLJ A;  1BPN A;  4MCQ A;  3VH9 A;  4MCR A;  4FWU A;  1XBU A;  3ISX A;  2I3C A;  3NH5 A;  2ZEP A;  3D7D A;  3KZW A;  4P44 A;  2PE3 A;  3RAM A;  4TWE A;  3IO1 A;  2Q51 A;  1ZLI A;  3IIB A;  4YU9 A;  2ZEN A;  1DTD A;  4ZX8 A;  5F09 A;  2WZN A;  3PFO A;  1NSA A;  3JRU A;  5K8P A;  4EWT A;  2OR4 A;  4K3N A;  4EFD A;  4A37 A;  4ZY0 A;  4DJL A;  4C8P A;  3IC1 A;  2F8H A;  4MHY A;  4C9A A;  4C86 A;  2QYV A;  4DYO A;  2EWB A;  4IAV A;  2O53 A;  2Q43 A;  2ANP A;  2V8V A;  3V7Z A;  1CBX A;  4YN3 A;  4R6T A;  4TNU A;  3D7H A;  3IFE A;  3NH4 A;  2QJ8 A;  3HLP A;  2PIZ A;  1TKH A;  5K8N A;  2PJ0 A;  4WJB A;  4A94 A;  5LYD A;  2IQ6 A;  4KNG E;  4C9V A;  2OOT A;  4GM5 A;  2PJ6 A;  4PXC A;  4MCP A;  2AFZ A;  3FVL A;  3N5F A;  3KHX A;  1PYT B;  3CPA A;  3PBE A;  3I1U A;  3SJF A;  2IMO A;  2C6G A;  3S9M A;  4C9R A;  1FT7 A;  2HB6 A;  3DGV A;  1IGB A;  3EIF A;  3SJX A;  4C9U A;  2QVP A;  3QNV A;  4NGP A;  1XJO A;  4NGQ A;  1ZLH A;  2RFH A;  2PVW A;  3D68 A;  2DEA A;  4IK2 A;  2NSM A;  5K8O A;  2PJ7 A;  4IHM A;  5CPA A;  2EK9 A;  1ARL A;  4R7M A;  3PEI A;  3B2Y A;  1JQG A;  2NYQ A;  2PJB A;  4C8F A;  1QQ9 A;  4LQG A;  1HDQ A;  3NH8 A;  5HVF A;  4OME A;  2PJA A;  3D66 A;  5D29 A;  1KWM A;  5D8N A;  5ELY A;  2ZEM A;  4UIA A;  1QMU A;  4X2T A;  3KL9 A;  4A38 A;  3VTA A;  2VL1 A;  4P4J A;  1BLL E;  3IJ3 A;  3WC7 A;  2V77 A;  2ZEH A;  2GU2 A;  4PQA A;  2PCU A;  3D4U A;  4JZ0 A;  4C8A A;  1R43 A;  4JYW A;  5CBM A;  2RB7 A;  3IWW A;  5THW A;  4EME A;  2PJ8 A;  8CPA A;  4UIB A;  2AFW A;  2F7V A;  4A39 A;  2PVV A;  5I4M A;  1AMP A;  3FED A;  4UEF A;  4C8T A;  2PJ3 A;  1LOK A;  2V8D A;  3BI0 A;  5DS0 A;  1Y9Z A;  1Z5R A;  1YME A;  5JH9 A;  1F2O A;  4OP4 A;  1BPM A;  4OIW A;  2AFS A;  1XF1 A;  3DLJ A;  4PXB A;  2GP4 A;  4NGT A;  3I74 A;  4FUU A;  2BCO A;  3NA6 A;  2PIY A;  4NGN A;  1ELL P;  1F2P A;  4OC2 A;  3WAB A;  5HVG A;  2PRQ A;  4ZI6 A;  4C9E A;  3SI0 A;  2PJ2 A;  3GUX A;  4NGR A;  1TXR A;  4W9Y A;  2PJ5 A;  3S9L A;  4C84 A;  4NFR A;  2C1C A;  3B3S A;  4UF4 A;  1LAP A;  4F8Z A;  4ZYQ A;  1F57 A;  3KAS A;  3HUV A;  3BHX A;  3WC5 A;  1YW4 A;  4P45 A;  4MRI A;  4AXV A;  3KGQ A;  5JGF A;  3PB6 X;  3WC6 A;  5HXD A;  3ISZ A;  4F9V A;  1BAV A;  1VHO A;  2GLJ A;  2GLF A;  4BD9 A;  3FH4 A;  3KHZ A;  1TF8 A;  4MHZ A;  3TX8 A;  2FVG A;  2JEW A;  3BI1 A;  3ICU A;  1LFW A;  5LYF A;  2EK8 A;  5K8M A;  4TJV A;  2V8G A;  3TC8 A;  5J1Q A;  5JM6 A;  3B3T A;  1CP7 A;  3RBU A;  3SI1 A;  4PXD A;  3KR4 A;  2ZEF A;  4PPZ A;  2ZEL A;  1DE4 C;  3PB7 X;  3H8G A;  1XFO A;  1Y7E A;  3IEH A;  1XRY A;  1CP6 A;  1Y0R A;  4P6Y A;  3B3V A;  4WWV A;  3SJE A;  3H8E A;  1H8L A;  2CTC A;  3B7I A;  4MCS A;  1CG2 A;  4X3R A;  4C99 A;  1WVM A;  5LRJ A;  5LRG A;  4CDK A;  1CX8 A;  1HDU A;  3NFZ A;  2AFM A;  2ZOF A;  1CPX A;  3B3C A;  2ZEG A;  2XEJ A;  1ZG8 A;  4NJR A;  3MN8 A;  1CPS A;  2JBK A;  5HVH A;  3BXM A;  3D7G A;  4TJX A;  1YLO A;  3FEC A;  3VAT A;  3PB9 X;  3SI2 A;  3CDX A;  1UWY A;  4FAI A;  2BO9 A;  2IJZ A;  3V38 A;  4OC5 A;  4MHN A;  4P10 A;  2ZED A;  4R76 A;  3FF3 A;  1V6C A;  3FMC A;  4OC4 A;  4MHP A;  4OID A;  4P4D A;  4NGS A;  4C85 A;  4MXU A;  3GB0 A;  1LAN A;  3LWU A;  2PJ1 A;  4ONW A;  2AFU A;  5IB9 A;  4NGM A;  2BOA A;  3PFE A;  1ELM P;  1Z8L A;  3H8F A;  4O23 A;  1HEE A;  1TKJ A;  3FEE A;  4RUH A;  1VGY A;  4UEZ A;  3D67 A;  4ZY2 A;  3LMS A;  4UEE A;  3FX6 A;  3CPX A;  1ZG9 A;  4X8I A;  4CPA A;  4Q7A A;  3D7F A;  2O4H A;  1RTQ A;  2XEF A;  4B6Z A;  3K2K A;  3B3W A;  3KI9 A;  4OKO A;  4YWY A;  4PXE A;  4MMO A;  4C8C A;  3I6S A;  3MRU A;  4Z65 A;  3VAR A;  4G1P A;  2CTB A;  2V8H A;  3FJU A;  4OC0 A;  4CDJ A;  5LRK A;  4C8U A;  3SJG A;  2WYR A;  2G9D A;  1R3N A;  3L2N A;  4KSI A;  2GRE A;  1YW6 A;  4ZX9 A;  5LYI A;  1FNO A;  4F9U A;  2CF4 A;  2C6P A;  6CPA A;  2HC9 A;  3CT9 A;  4P4F A;  3KQZ A;  2ABZ A;  4OC1 A;  4OC3 A;  1Y0Y A;  4NJQ A;  2XEG A;  1ZG7 A;  3KR5 A;  2XEI A;  5LYL A;  3B35 A;  2C5Q A;  1PCA A;  3PB4 X;  3K9T A;  1AYE A;  1ARM A;  2CIJ A;  4FBE A;  2JBJ A;  3S9N A;  3PBB A;  2Q4Z A;  3RZA A;  4H2K A;  1TKF A;  4P4E A;  2ZEE A;  4P4B A;  4ZY1 A;  1OBR A;  1IY7 A;  2ZOG A;  1M4L A;  3PRT A;  2C6C A;  2PJ9 A;  1Q7L A;  1LCP A;  2PJC A;  1VIX A;  3T8W A;  2AFX A;  4P4I A;  1YSJ A;  1VHE A;  2ZEO A;  2J9A A;  3KQX A;  3WT4 A;  1GYT A;  2AFO A;  1TF9 A;  4R8F A;  3PB8 X;  7CPA A;  1Z2L A;  2POK A;  1XMB A;  2PJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...