4MCPA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyl-gamma-l-glutamic acid (pteroyldi-gamma-l-glutamic acid)
Total Genus 270
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
270
sequence length
695
structure length
692
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 270
structure length 692
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcpA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcpA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcpA02
1KWMA 2ZEEA 4X2TA 3D7DA 2AFUA 4WJBA 3D4UA 1Y0YA 4R6TA 2PJBA 4P45A 3FX6A 1CP6A 3HLPA 3SJGA 4ZYQA 1VGYA 3SJXA 3KQXA 2WYRA 2XEJA 1Z5RA 4R8FA 2BO9A 5D29A 3MRUA 3RZAA 6CPAA 4MMOA 4IHMA 3L2NA 4OC4A 4P6YA 4TJXA 4A94A 1XRYA 2QJ8A 5CBMA 4OKOA 4ZY0A 1ELMP 1CX8A 3CPXA 3B2YA 1RTQA 4P4BA 3SI0A 4FBEA 3VH9A 4YN3A 2AFXA 2BCOA 2PJ3A 4PXDA 3FEDA 3VATA 2OOTA 2PJ6A 2POKA 4TWEA 4A38A 2GLFA 1TKHA 4OIDA 1TF8A 3PB4X 5LRGA 5JGFA 5CPAA 1XJOA 2Q4ZA 1EE3P 4A37A 3WC6A 4UIBA 3V38A 4OC0A 5LYFA 3KQZA 1CG2A 3IC1A 3SI2A 1Z8LA 1ZG8A 3IEHA 4OIWA 2ABZA 4ZY1A 4C86A 4C8UA 1YW6A 1BPMA 2BOAA 1F2PA 2ZEHA 4UIAA 2PJ4A 2GREA 4YU9A 2V8DA 1R43A 4NGQA 4NJQA 2NYQA 3DLJA 4R76A 1NSAA 1H8LA 4P4IA 2F7VA 3SJFA 1FT7A 3PB6X 1XMBA 4C8TA 3S9NA 1AMPA 3D67A 4P10A 1HEEA 3KHZA 3I74A 1WVMA 4DYOA 1FNOA 4ONWA 1CPXA 4UEZA 3RAMA 4TJVA 4Q7AA 4IAVA 2WZNA 2JEWA 3N5FA 4PQAA 4IK2A 2PE3A 3TC8A 1BAVA 4LQGA 1QMUA 4ZI6A 2V8HA 2RFHA 4P4FA 3NH8A 5K8OA 4MCSA 4C9RA 3KHXA 1ELLP 2PCUA 4EFDA 3K2KA 3BXMA 3B3SA 1QQ9A 3CPAA 1Y0RA 3MN8A 1VIXA 2PJ8A 2XEFA 1R3NA 4C9EA 1ARMA 2PVWA 2C1CA 2NSMA 2ZEPA 4OP4A 2PVVA 4MHPA 4F8ZA 1LAMA 4ZX8A 2G9DA 2ZOGA 1TKFA 4MCRA 1GYTA 4ZY2A 2F8HA 2ZEGA 2ZEDA 5JM6A 1F57A 1LANA 3B3TA 4MHNA 4UEFA 2GU2A 2C6PA 3KL9A 4NGTA 3RBUA 1VHOA 2FVGA 1XFOA 1XBUA 3FJUA 3S9MA 3QNVA 2PJ2A 4MCPA 2AFMA 2IQ6A 3EIFA 1TXRA 2ZEFA 3PFOA 1LFWA 1V6CA 1TKJA 2CF4A 4RUHA 3WC5A 4PPZA 4PXBA 3WABA 2PJ0A 4CDJA 3B3VA 4C9AA 2ANPA 4CPAA 4DJLA 3FECA 2J9AA 4F9VA 3IWWA 1YW4A 3KR4A 4BD9A 5HVHA 4NJRA 4DUKA 4MXUA 2PRQA 3NA6A 4OC2A 3FEEA 4K3NA 1PYTB 1F2OA 1BPNA 4H2KA 2V8VA 3PB7X 1OBRA 2DEAA 5LRJA 4MCQA 5DS0A 4JZ0A 3CDXA 1LOKA 3BHXA 3WC7A 8CPAA 4C9UA 4NGNA 3FF3A 4WWVA 2CIJA 4UF4A 1DTDA 5JH9A 1CBXA 4GM5A 4P4JA 1PCAA 1ZLIA 2HB6A 4MHYA 5J1QA 2ZELA 2VL1A 1HDUA 3H8FA 4KSIA 2ZOFA 4C84A 4AXVA 2RB7A 3TX8A 3SI1A 3PB8X 3T8WA 4F9UA 1LAPA 1IGBA 3ICUA 4G1PA 2IMOA 2PJ5A 4C8PA 5LYLA 3K9TA 3I6SA 3LMSA 3V7ZA 5IB9A 3PBBA 3B3CA 3D66A 4P4DA 3B35A 1CP7A 2PJ9A 2PJ7A 3DGVA 3GB0A 3D7FA 3VARA 2Q43A 4C9VA 4C8CA 5D8NA 2XEGA 1ZG7A 3PB9X 2O4HA 4JYWA 4CDKA 3S9LA 2OR4A 2HC9A 1Y9ZA 2GLJA 4P4EA 4OC3A 1TF9A 5LYDA 3NH5A 3KZWA 1VHEA 4P44A 2PJAA 5LRKA 5F09A 2JBJA 2PJCA 2O53A 1ZG9A 4PXEA 4B6ZA 3VTAA 3GUXA 4NFRA 3FVLA 1ARLA 4MRIA 3PFEA 2EWBA 1Y7EA 4FWUA 1YLOA 3ISZA 1YMEA 5HXDA 4UEEA 4Z65A 5K8PA 1ZLHA 2V77A 1Q7LA 2AFSA 3KI9A 4TNUA 4EMEA 4NGSA 1UWYA 2V8GA 3D7HA 3H8GA 1CPSA 7CPAA 3I1UA 4NGMA 3IIBA 1AYEA 3PEIA 2PIYA 4YWYA 4C99A 5K8MA 3B3WA 1YSJA 5THWA 2C6CA 2AFZA 4A39A 2I3CA 4PXCA 4MHZA 3H8EA 2PIZA 2ZEMA 4FUUA 3D68A 3NFZA 1M4LA 3KASA 1Z2LA 4OC1A 1LCPA 4R7MA 4X3RA 3ISXA 2CTBA 2AFOA 1XF1A 4OMEA 3IO1A 4EWTA 3D7GA 1IY7A 2Q51A 4NGRA 5LYIA 4O23A 5HVFA 2C6GA 3HUVA 5HVGA 2IJZA 3LWUA 2ZENA 4C85A 3IJ3A 3KR5A 2PJ1A 3PBEA 4X8IA 4OC5A 3IFEA 1BLLE 5K8NA 3BI0A 3PRTA 3KGQA 1JQGA 4ZX9A 5ELYA 3CT9A 3GLJA 4KNGE 4W9YA 3NH4A 3FMCA 4C8AA 2AFWA 5I4MA 2XEIA 4NGPA 4C8FA 1DE4C 2EK9A 2CTCA 1HDQA 2JBKA 3SJEA 2QVPA 4FAIA 3JRUA 3WT4A 2QYVA 2EK8A 3B7IA 3FH4A 2ZEOA 3BI1A
chains in the Genus database with same CATH superfamily
4ZGYB 1KWMA 2ZEEA 3HMJG 2PR1A 4M3SA 4X2TA 5FVJA 3D7DA 3BUXB 2AFUA 2Q7BA 4WJBA 3LODA 3D4UA 1Y0YA 4C2YA 4R6TA 2PJBA 4P45A 5KTDA 3B8GA 4HPSA 3FX6A 3W91A 2ZW4A 1MK4A 3RYOA 4RN7A 2G0BA 2Q7SA 1CP6A 3HLPA 1EO0A 3SJGA 4UCNA 1EZAA 4ZYQA 3D8PA 4KOWA 4B5PA 1P4NA 1VGYA 3SJXA 3FYNA 3KQXA 2FS5A 2WYRA 3QAHA 4HNWB 2XEJA 1Z5RA 4R8FA 2BO9A 5D29A 3BUNB 4BPXB 1J4JA 1PU9A 2P6GA 2ZW7A 3MRUA 4MMOA 4PV6A 3RZAA 4KSAA 6CPAA 1QSNA 2Z3OA 1VBGA 4HNXB 4IHMA 3NOJA 3L2NA 3OAKA 3SXNA 4OC4A 1B6BA 3TOAA 4P6YA 4I49A 4U9YA 5BWAB 5H86A 3EZAA 2GFQA 4TJXA 4A94A 1XRYA 3H4QA 2VI7A 2QJ8A 5CBMA 1ZL0A 2DLAA 4OKOA 3GIUA 3JVNA 4ZY0A 5H84A 1ELMP 2FL4A 5EMIA 1CX8A 3CPXA 3B2YA 1RTQA 4R3KA 4P4BA 3SI0A 4FBEA 1S7NA 4RR2B 2B5GB 3VH9A 4YN3A 3EC4A 3TLBA 2Z0ZA 2AFXA 2BCOA 2BSWA 2EUIA 2PJ3A 3GY9A 3QB8A 4FD5A 3FEDA 4PXDA 2YJVA 2JEVA 3VATA 2OOTA 2VBQA 2PJ6A 2H5MA 2POKA 4KOUA 4TWEA 3P2HA 5GCNA 3W6SA 2DXQA 4A38A 3GKRA 2GLFA 1TKHA 4OIDA 4RS2A 4A31A 1TF8A 3PB4X 1XEBA 4COBA 2Q0YA 2FXFA 2PCNA 5LRGA 2DPSA 5I0CA 4CAXA 5JGFA 5CPAA 4MHDA 1QSOA 4AB7A 2ATRA 1XJOA 2Q4ZA 3GYAA 1EE3P 3TTHA 4A37A 3WC6A 1M4GA 2P6EA 2JDDA 4FD6A 4OC0A 4UIBA 5DWMA 3KQZA 4A4BA 3V38A 5LYFA 2P6FA 4F0XA 2CNMA 2AJ6A 1CG2A 3IC1A 3QAYA 3SI2A 1Y7RA 1Z8LA 2Q44A 1ZG8A 3VRNA 3IEHA 4KUBA 4OIWA 1TIQA 2ABZA 1V0CA 2EVNA 4ZY1A 4C86A 4C8UA 4M6IA 1FBVA 3H5ZA 4Y49C 1YW6A 2HV2A 3IU1A 2CNTA 1BPMA 1WJTA 3R95A 4B5PB 2ZXVA 2BOAA 4UWJA 3TT2A 1F2PA 5KTCA 4JLYA 2ZEHA 2X7BA 4RI1A 4UIAA 4Y49B 2PJ4A 5F1YA 2GREA 4YU9A 2V8DA 1CE8B 1R43A 4MFZA 2RC4A 4NGQA 2R82A 4KSFA 4NJQA 2NYQA 3DLJA 4R76A 4MI1A 1NSAA 1H8LA 3E0KA 4P4IA 2F7VA 2YNDA 4KOYA 5A27A 1MJ9A 3SJFA 2PRBA 2YGWA 5ISVA 1GGOA 1ZO0A 3HPGG 4HNYB 3RNZA 1Q2CA 3F9KC 1Z9EA 1QSRA 2Q4VA 3CZXA 5HH1A 2QIRA 1Q5XA 2AUNA 1FT7A 3PB6X 3TLEA 5G20A 2YNEA 1XMBA 3S6HA 2WPWA 2A4NA 4C8TA 1S3ZA 3S9NA 3FNCA 1AMPA 3D67A 4P10A 4CGMA 5F9MA 1KUXA 4F6AA 4A95A 4X5KA 3T07A 1JDBC 3FB3A 1HEEA 4M8DA 4C7HA 3KHZA 1ON0A 4JD6A 1KEEB 3I74A 2UV8G 1WVMA 4DYOA 2X0SA 1FNOA 2EO8A 3DDDA 4GS4A 4ONWA 3SXOA 1CPXA 4UEZA 3RAMA 1M6VB 4TJVA 4Q7AA 4H6ZA 4IAVA 2WZNA 5F47A 2VZYA 2E28A 2D4PA 2JEWA 3N5FA 2Y1NA 4PQAA 5AG5A 4IK2A 4BINA 4CGNA 2PE3A 4AVAA 3R9FA 3TC8A 1ZYMA 4CAFA 1BAVA 2FIAA 4LQGA 2ARHA 3NE7A 1QMUA 2WUUA 2REEA 4R3LA 4UBRA 4ZI6A 2V8HA 2RFHA 1GHEA 4P4FA 4XNHC 2QMLA 3NH8A 5K8OA 3R9EA 3TLAA 4MCSA 2OH1A 2Q4YA 4C9RA 4UFWA 2P0WA 3KHXA 4C68A 1ELLP 2PCUA 4Q36A 4EFDA 2J8RA 2I00A 4H89A 3K2KA 3BXMA 2JLMA 3JUWA 4IUSA 1CM0A 3B3SA 5EC4A 4NEXA 3TYXA 2CXAA 4XNHB 1YK3A 1QQ9A 3CPAA 4M6GA 1K4JA 1WK4A 1Y0RA 3MN8A 1VIXA 2PJ8A 3V8IA 2XEFA 1YREA 2Z3NA 2VQYA 1R3NA 2VEZA 4B11A 1A9XB 4C9EA 1QSMA 1NMTA 1Z4RA 3PP9A 1ARMA 3I9SA 2PVWA 1M1DA 1Q2YA 2C1CA 2NSMA 5AG7A 1Y9WA 2ZEPA 5IV0A 3ZNIA 4OP4A 4XPDC 3T0TA 2PVVA 1I1DA 5F48A 4MHPA 2Y1MA 2PR8A 2IL4A 4F8ZA 1LAMA 4ZX8A 2G9DA 4AG7A 4MBUA 4L89A 4QVTA 1LRZA 3SR3A 1SQHA 3PFVA 2ZOGA 3HPHE 1YQEA 3BJ8A 4B5OA 1TKFA 5J3XA 1YX0A 4XPDB 4MCRA 1GYTA 4AG9A 4ZY2A 4CYPA 4NF1A 5HKWA 1MJAA 2F8HA 2ZEGA 1M44A 2ZEDA 3F0AA 4A32A 5JM6A 1F57A 1B47A 3U88C 2F5IA 4KORA 2FIWA 1YVKA 4YRHA 1LANA 1R61A 4R9MA 2Z3LA 5G22A 3B3TA 4MHNA 2D0PA 4KS9A 3D2PA 4UEFA 5BY0A 2GU2A 2ODFA 4MJ8A 2C6PA 2KCWA 1KZFA 3KL9A 4AVBA 3LACA 2EZAA 4NGTA 1S7LA 4BTFA 3NE8A 4GPLB 3RBUA 1VHOA 3VWEA 2D4OA 2FVGA 4E0AA 1XFOA 1KBLA 4CS0B 1XBUA 3DNSA 3FJUA 3FRMA 3S9MA 3S6KA 2FSRA 1IYLA 4E2AA 1I21A 3VRRA 2BUEA 2PJ2A 2C27A 3PGPA 3QNVA 4E94A 3LD2A 4INJA 5K99A 3JTKA 4PSWA 3T5MA 4MCPA 2AFMA 2IQ6A 1QSTA 2HWGA 3EIFA 1TXRA 4MFKA 1YVOA 2B3UA 2ZEFA 3PFOA 5JPHA 1J3LA 1LFWA 4MJXA 4C7IA 3U1BA 5AG6A 3BUMB 1V6CA 3G23A 1TKJA 1RO5A 1XOVA 4KOXA 2CF4A 4RUHA 1BOBA 3UY5A 3WC5A 5IB0A 4PPZA 4PXBA 3WABA 2PJ0A 2PSWA 3B3VA 3EXNA 4UA3A 3SHPA 4MI4A 3K9UA 2N3AB 3TO9A 3TLCA 4C9AA 2QECA 3KRVA 2ANPA 2B4DA 2REFA 2HQYA 3TLZA 2B3VA 2ZW6A 4CPAA 4DJLA 3R9GA 4MFLA 1JDEA 4II9A 3T05A 3FECA 2J9AA 3EO4A 2VKZG 3CXSA 5DWNA 4F9VA 3C8OA 2GANA 1VI4A 3IWWA 1YW4A 3VRPA 3KR4A 4BD9A 3VROA 4NJRA 5HVHA 2C5QA 4A2ZA 1OZPA 1AUGA 4DUKA 4MFJA 2AE6A 4CRZB 2HI6A 5HKYA 4MXUA 2PRQA 2YJTA 2PC1A 1C30B 2GP4A 3OWCA 3NA6A 4OC2A 3FEEA 4K3NA 3EFAA 1VKCA 4IIYA 1PYTB 1F2OA 1BPNA 3EY5A 4H2KA 2V8VA 3PB7X 3VRQA 1OBRA 2DEAA 2G3AA 5LRJA 4CAWA 4B13A 2FCKA 4LUAA 4C2ZA 2WPXA 4MCQA 5DS0A 4PK3A 4JZ0A 1S60A 1LOKA 2BL1A 3CDXA 4CGOA 3BHXA 3G8WA 1X10A 4ONUA 3WC7A 8CPAA 2OZGA 4C9UA 5KTAA 3TOBA 2XPOA 4NGNA 3FF3A 2R8VA 3CXQA 4K30A 4NCZA 4L8AA 4LX9A 4MFQA 4WWVA 4F0YA 2CIJA 1S5KA 4EYSA 4IF5A 3DR8A 4UF4A 1BXRB 1DTDA 1VHSA 1CBXA 2Z10A 4P4JA 1PCAA 1ZLIA 2HB6A 4GM5A 4C2XA 4MHYA 5J1QA 2ZELA 2VL1A 5EBVA 1HDUA 3H8FA 3ZJ0A 4OADA 4KSIA 2OZHA 2DIKA 2ZOFA 2B5GA 2ZPAA 2JDCA 3S6FA 4CYQA 4C84A 5JYBA 1B87A 5J8FA 3TE4A 4AXVA 2RB7A 1NE9A 3TX8A 3SI1A 3PB8X 3KKWA 3T8WA 3FXTA 4F9UA 3R96A 1LAPA 4FD4A 3VWDA 3R1KA 2GIVA 2PQ8A 4CYOA 1IGBA 3ICUA 4G1PA 2IMOA 2PJ5A 4CYNA 4C8PA 3C26A 4KLVA 5LYLA 2OB0A 3K9TA 3I6SA 3G3SA 3LMSA 2B4DB 1IICA 3V7ZA 4EVYA 3F8KA 1Q2DA 2VXKA 1FY7A 1KUYA 5IB9A 4OAEA 3PBBA 1XIXA 3B3CA 3D66A 4COGA 4P4DA 3B35A 1CP7A 1M4DA 4MY0A 2DPTA 2PJ7A 2PJ9A 3DGVA 3GB0A 3PLFB 3D7FA 2GE3A 3FBUA 5JVLA 3VARA 3DR6A 4KZTA 2Q43A 4C9VA 2Z11A 3OP0A 4J0NA 2B58A 5F46A 4C8CA 1Z9UA 2XEGA 5D8NA 1ZG7A 1BO4A 3PB9X 4B10A 1NSLA 1Z4EA 5F13A 3VGOA 3EZBA 2O4HA 2B4JC 3I3GA 5F5XA 4U9ZA 4JYWA 1DIKA 4QB9A 4JVOA 3S9LA 4CDKA 2J8MA 2OR4A 3BUWB 3F5BA 2XPLA 2HC9A 1KUVA 4UFXA 5F49A 2GLJA 1Y9ZA 4P4EA 4OC3A 1TF9A 3OB2B 5LYDA 4CO9A 1MJBA 3NH5A 4BBHA 4FD7A 4JXRA 3O8ZA 3KZWA 1VHEA 2R1IA 4P44A 2PJAA 3BLNA 4M6HA 4UCMA 3TO7A 3WR7A 5LRKA 5F09A 2JBJA 1NBWA 2PJCA 4ORFA 3D2MA 4BPUB 4HKFA 4Q38A 3ZZIA 1XE4A 1ZG9A 2O53A 3CXPA 4PXEA 2Y0MA 4B6ZA 4QBJA 2PDOA 4LQ6A 3VTAA 5JQ4A 3PZJA 4NXYA 1IIDA 4GXHA 2FT0A 3A9LA 1P0HA 1PUAA 3GUXA 3IU2A 2AUMA 3NFQA 5A28A 5C88A 4NFRA 3FVLA 2HROA 3PT1A 1ARLA 2J8NA 4CRYB 5HMNA 1XMTA 2MP0A 4UFVA 4B12A 1Z8TA 4MRIA 4CAVA 3PFEA 2EWBA 1Y7EA 5AG4A 2BEIA 2XPNA 3GJZA 1R57A 4R57A 4FWUA 4JWPA 5IX3A 1YLOA 1VBHA 2CY2A 3ISZA 4OLLA 1C3OB 2OU2A 1YMEA 2O28A 4KVXA 5FD8A 5HXDA 4UEEA 4Z65A 1X12A 2CNSA 4A30A 1CJWA 4MFPA 5K8PA 1ZLHA 2V77A 4U5YA 4BMHA 1Q7LA 1I12A 2AFSA 3KI9A 4PSXA 4TNUA 5AGEA 2R98A 4EMEA 4PK2A 4NGSA 3P2FA 2YNCA 4J3GA 2D0OA 4CZ1A 1UWYA 2V8GA 3D7HA 3H8GA 1S7KA 5JH9A 4JJXA 5AXIA 1N71A 1IU8A 4QC6A 4CAEA 4QUSA 1CPSA 1RXTA 7CPAA 3I1UA 4NGMA 4NSQA 3S6GA 4AVCA 1EZBA 3IIBA 1AYEA 3BJ7A 4A4CA 3D3SA 3PEIA 5G1ZA 2PIYA 4YWYA 3TLGA 4C99A 4DNCA 5K8MA 4CDJA 1IYKA 4UCPA 3TCVA 3B3WA 1YSJA 5THWA 2C6CA 2AFZA 4A39A 2NMTA 3T9YA 5CNPA 1YGHA 2I3CA 2FE7A 4PXCA 4MHZA 3H8EA 2PIZA 2Z3KA 2OLSA 1KC7A 2I79A 4KVME 2ZEMA 2HUZA 4FUUA 4UWIA 1IB1E 1WWZA 2VZZA 3D68A 5J8CA 3NFZA 1NXJA 1L0CA 1M4LA 3KASA 1Z8XA 1YR0A 1Z2LA 4OC1A 4YGOA 3DSBA 4KOVA 3K4IA 1LCPA 4R7MA 4X3RA 3ISXA 2Z3MA 4E8OA 5HKZA 4CGPA 2B4BA 2EZCA 2CTBA 2AFOA 2ZW5A 1XF1A 4KOTA 1Y9KA 4BPWB 4KVOE 4OMEA 3IO1A 2R7HA 3D7GA 1IY7A 2Q51A 4EWTA 3TFYA 1T36B 2FM4A 4NGRA 1YLEA 5LYIA 2CBLA 2EBJA 3IWGA 4YFJA 4O23A 4H1HA 4KUAA 5HVFA 2C6GA 1A2ZA 2DF5A 3HUVA 5C82A 5HVGA 2IJZA 3TLYA 3LWUA 3W6XA 2ZENA 4C85A 4IIXA 3IJ3A 2XPPA 1S7FA 2PJ1A 3KR5A 3PBEA 4X8IA 5IR2A 4OC5A 3IFEA 3BUOB 1YVHA 1BLLE 3TO6A 5K8NA 3BI0A 1CS0B 4E5SA 2G3TA 3PRTA 4ZBGA 3KGQA 4KLWA 4B14A 2YNCC 1JQGA 4M85A 4H6UA 1Z8WA 4ZX9A 5ELYA 1IOFA 3CT9A 3GLJA 4KNGE 1UFHA 1XF8A 1M4IA 2K5TA 4CGLA 2B0AA 4W9YA 3NH4A 3FMCA 4C8AA 4R87A 2AFWA 1U6MA 2XEIA 5I4MA 4NGPA 4XPKA 2Z3PA 2Q04A 1DE4C 5G21A 2EK9A 3T90A 2EZBA 4C8FA 4MY3A 2OZUA 2WSAA 3MGDA 3N7ZA 1ZRSA 4JXQA 3IGRA 4XPLA 2CTCA 1HDQA 4A33A 2JBKA 3SJEA 2QVPA 4KOSA 3RO0A 4FAIA 3JRUA 5E96A 3OB1B 3FIXA 1JWQA 3WT4A 1IOIA 2QYVA 2EK8A 3EZEA 3TLGB 3B7IA 3FH4A 2ZEOA 3IWEA 3BI1A
chains in the Genus database with same CATH topology
1KWMA 2ZEEA 4X2TA 3D7DA 2AFUA 4WJBA 3D4UA 1Y0YA 4R6TA 2PJBA 4P45A 3FX6A 1CP6A 3HLPA 3SJGA 4ZYQA 1VGYA 3SJXA 3KQXA 2WYRA 2XEJA 1Z5RA 4R8FA 2BO9A 5D29A 3MRUA 3RZAA 6CPAA 4MMOA 4IHMA 3L2NA 4OC4A 4P6YA 4TJXA 4A94A 1XRYA 2QJ8A 5CBMA 4OKOA 4ZY0A 1ELMP 1CX8A 3CPXA 3B2YA 1RTQA 4P4BA 3SI0A 4FBEA 3VH9A 4YN3A 2AFXA 2BCOA 2PJ3A 4PXDA 3FEDA 3VATA 2OOTA 2PJ6A 2POKA 4TWEA 4A38A 2GLFA 1TKHA 4OIDA 1TF8A 3PB4X 5LRGA 5JGFA 5CPAA 1XJOA 2Q4ZA 1EE3P 4A37A 3WC6A 4UIBA 3V38A 4OC0A 5LYFA 3KQZA 1CG2A 3IC1A 3SI2A 1Z8LA 1ZG8A 3IEHA 4OIWA 2ABZA 4ZY1A 4C86A 4C8UA 1YW6A 1BPMA 2BOAA 1F2PA 2ZEHA 4UIAA 2PJ4A 2GREA 4YU9A 2V8DA 1R43A 4NGQA 4NJQA 2NYQA 3DLJA 4R76A 1NSAA 1H8LA 4P4IA 2F7VA 3SJFA 1FT7A 3PB6X 1XMBA 4C8TA 3S9NA 1AMPA 3D67A 4P10A 1HEEA 3KHZA 3I74A 1WVMA 4DYOA 1FNOA 4ONWA 1CPXA 4UEZA 3RAMA 4TJVA 4Q7AA 4IAVA 2WZNA 2JEWA 3N5FA 4PQAA 4IK2A 2PE3A 3TC8A 1BAVA 4LQGA 1QMUA 4ZI6A 2V8HA 2RFHA 4P4FA 3NH8A 5K8OA 4MCSA 4C9RA 3KHXA 1ELLP 2PCUA 4EFDA 3K2KA 3BXMA 3B3SA 1QQ9A 3CPAA 1Y0RA 3MN8A 1VIXA 2PJ8A 2XEFA 1R3NA 4C9EA 1ARMA 2PVWA 2C1CA 2NSMA 2ZEPA 4OP4A 2PVVA 4MHPA 4F8ZA 1LAMA 4ZX8A 2G9DA 2ZOGA 1TKFA 4MCRA 1GYTA 4ZY2A 2F8HA 2ZEGA 2ZEDA 5JM6A 1F57A 1LANA 3B3TA 4MHNA 4UEFA 2GU2A 2C6PA 3KL9A 4NGTA 3RBUA 1VHOA 2FVGA 1XFOA 1XBUA 3FJUA 3S9MA 3QNVA 2PJ2A 4MCPA 2AFMA 2IQ6A 3EIFA 1TXRA 2ZEFA 3PFOA 1LFWA 1V6CA 1TKJA 2CF4A 4RUHA 3WC5A 4PPZA 4PXBA 3WABA 2PJ0A 4CDJA 3B3VA 4C9AA 2ANPA 4CPAA 4DJLA 3FECA 2J9AA 4F9VA 3IWWA 1YW4A 3KR4A 4BD9A 5HVHA 4NJRA 2C5QA 4DUKA 4MXUA 2PRQA 2GP4A 3NA6A 4OC2A 3FEEA 4K3NA 1PYTB 1F2OA 1BPNA 4H2KA 2V8VA 3PB7X 1OBRA 2DEAA 5LRJA 4MCQA 5DS0A 4JZ0A 3CDXA 1LOKA 3BHXA 3WC7A 8CPAA 4C9UA 4NGNA 3FF3A 4WWVA 2CIJA 4UF4A 1DTDA 5JH9A 1CBXA 4GM5A 4P4JA 1PCAA 1ZLIA 2HB6A 4MHYA 5J1QA 2ZELA 2VL1A 1HDUA 3H8FA 4KSIA 2ZOFA 4C84A 4AXVA 2RB7A 3TX8A 3SI1A 3PB8X 3T8WA 4F9UA 1LAPA 1IGBA 3ICUA 4G1PA 2IMOA 2PJ5A 4C8PA 5LYLA 3K9TA 3I6SA 3LMSA 3V7ZA 5IB9A 3PBBA 3B3CA 3D66A 4P4DA 3B35A 1CP7A 2PJ9A 2PJ7A 3DGVA 3GB0A 3D7FA 3VARA 2Q43A 4C9VA 4C8CA 5D8NA 2XEGA 1ZG7A 3PB9X 2O4HA 4JYWA 4CDKA 3S9LA 2OR4A 2HC9A 1Y9ZA 2GLJA 4P4EA 4OC3A 1TF9A 5LYDA 3NH5A 3KZWA 1VHEA 4P44A 2PJAA 5LRKA 5F09A 2JBJA 2PJCA 2O53A 1ZG9A 4PXEA 4B6ZA 3VTAA 3GUXA 4NFRA 3FVLA 1ARLA 4MRIA 3PFEA 2EWBA 1Y7EA 4FWUA 1YLOA 3ISZA 1YMEA 5HXDA 4UEEA 4Z65A 5K8PA 1ZLHA 2V77A 1Q7LA 2AFSA 3KI9A 4TNUA 4EMEA 4NGSA 1UWYA 2V8GA 3D7HA 3H8GA 1CPSA 7CPAA 3I1UA 4NGMA 3IIBA 1AYEA 3PEIA 2PIYA 4YWYA 4C99A 5K8MA 3B3WA 1YSJA 5THWA 2C6CA 2AFZA 4A39A 2I3CA 4PXCA 4MHZA 3H8EA 2PIZA 2ZEMA 4FUUA 3D68A 3NFZA 1M4LA 3KASA 1Z2LA 4OC1A 1LCPA 4R7MA 4X3RA 3ISXA 2CTBA 2AFOA 1XF1A 4OMEA 3IO1A 4EWTA 3D7GA 1IY7A 2Q51A 4NGRA 5LYIA 4O23A 5HVFA 2C6GA 3HUVA 5HVGA 2IJZA 3LWUA 2ZENA 4C85A 5IR2A 3IJ3A 3KR5A 2PJ1A 3PBEA 4X8IA 4OC5A 3IFEA 1BLLE 5K8NA 3BI0A 3PRTA 3KGQA 1JQGA 4ZX9A 5ELYA 3CT9A 3GLJA 4KNGE 4W9YA 3NH4A 3FMCA 4C8AA 2AFWA 5I4MA 2XEIA 4NGPA 4C8FA 1DE4C 2EK9A 2CTCA 1HDQA 2JBKA 3SJEA 2QVPA 4FAIA 3JRUA 3WT4A 2QYVA 2EK8A 3B7IA 3FH4A 2ZEOA 3BI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KWM A;  2ZEE A;  4X2T A;  3D7D A;  2AFU A;  4WJB A;  3D4U A;  1Y0Y A;  4R6T A;  2PJB A;  4P45 A;  3FX6 A;  1CP6 A;  3HLP A;  3SJG A;  4ZYQ A;  1VGY A;  3SJX A;  3KQX A;  2WYR A;  2XEJ A;  1Z5R A;  4R8F A;  2BO9 A;  5D29 A;  3MRU A;  3RZA A;  6CPA A;  4MMO A;  4IHM A;  3L2N A;  4OC4 A;  4P6Y A;  4TJX A;  4A94 A;  1XRY A;  2QJ8 A;  5CBM A;  4OKO A;  4ZY0 A;  1ELM P;  1CX8 A;  3CPX A;  3B2Y A;  1RTQ A;  4P4B A;  3SI0 A;  4FBE A;  3VH9 A;  4YN3 A;  2AFX A;  2BCO A;  2PJ3 A;  4PXD A;  3FED A;  3VAT A;  2OOT A;  2PJ6 A;  2POK A;  4TWE A;  4A38 A;  2GLF A;  1TKH A;  4OID A;  1TF8 A;  3PB4 X;  5LRG A;  5JGF A;  5CPA A;  1XJO A;  2Q4Z A;  1EE3 P;  4A37 A;  3WC6 A;  4UIB A;  3V38 A;  4OC0 A;  5LYF A;  3KQZ A;  1CG2 A;  3IC1 A;  3SI2 A;  1Z8L A;  1ZG8 A;  3IEH A;  4OIW A;  2ABZ A;  4ZY1 A;  4C86 A;  4C8U A;  1YW6 A;  1BPM A;  2BOA A;  1F2P A;  2ZEH A;  4UIA A;  2PJ4 A;  2GRE A;  4YU9 A;  2V8D A;  1R43 A;  4NGQ A;  4NJQ A;  2NYQ A;  3DLJ A;  4R76 A;  1NSA A;  1H8L A;  4P4I A;  2F7V A;  3SJF A;  1FT7 A;  3PB6 X;  1XMB A;  4C8T A;  3S9N A;  1AMP A;  3D67 A;  4P10 A;  1HEE A;  3KHZ A;  3I74 A;  1WVM A;  4DYO A;  1FNO A;  4ONW A;  1CPX A;  4UEZ A;  3RAM A;  4TJV A;  4Q7A A;  4IAV A;  2WZN A;  2JEW A;  3N5F A;  4PQA A;  4IK2 A;  2PE3 A;  3TC8 A;  1BAV A;  4LQG A;  1QMU A;  4ZI6 A;  2V8H A;  2RFH A;  4P4F A;  3NH8 A;  5K8O A;  4MCS A;  4C9R A;  3KHX A;  1ELL P;  2PCU A;  4EFD A;  3K2K A;  3BXM A;  3B3S A;  1QQ9 A;  3CPA A;  1Y0R A;  3MN8 A;  1VIX A;  2PJ8 A;  2XEF A;  1R3N A;  4C9E A;  1ARM A;  2PVW A;  2C1C A;  2NSM A;  2ZEP A;  4OP4 A;  2PVV A;  4MHP A;  4F8Z A;  1LAM A;  4ZX8 A;  2G9D A;  2ZOG A;  1TKF A;  4MCR A;  1GYT A;  4ZY2 A;  2F8H A;  2ZEG A;  2ZED A;  5JM6 A;  1F57 A;  1LAN A;  3B3T A;  4MHN A;  4UEF A;  2GU2 A;  2C6P A;  3KL9 A;  4NGT A;  3RBU A;  1VHO A;  2FVG A;  1XFO A;  1XBU A;  3FJU A;  3S9M A;  3QNV A;  2PJ2 A;  4MCP A;  2AFM A;  2IQ6 A;  3EIF A;  1TXR A;  2ZEF A;  3PFO A;  1LFW A;  1V6C A;  1TKJ A;  2CF4 A;  4RUH A;  3WC5 A;  4PPZ A;  4PXB A;  3WAB A;  2PJ0 A;  4CDJ A;  3B3V A;  4C9A A;  2ANP A;  4CPA A;  4DJL A;  3FEC A;  2J9A A;  4F9V A;  3IWW A;  1YW4 A;  3KR4 A;  4BD9 A;  5HVH A;  4NJR A;  4DUK A;  4MXU A;  2PRQ A;  3NA6 A;  4OC2 A;  3FEE A;  4K3N A;  1PYT B;  1F2O A;  1BPN A;  4H2K A;  2V8V A;  3PB7 X;  1OBR A;  2DEA A;  5LRJ A;  4MCQ A;  5DS0 A;  4JZ0 A;  3CDX A;  1LOK A;  3BHX A;  3WC7 A;  8CPA A;  4C9U A;  4NGN A;  3FF3 A;  4WWV A;  2CIJ A;  4UF4 A;  1DTD A;  5JH9 A;  1CBX A;  4GM5 A;  4P4J A;  1PCA A;  1ZLI A;  2HB6 A;  4MHY A;  5J1Q A;  2ZEL A;  2VL1 A;  1HDU A;  3H8F A;  4KSI A;  2ZOF A;  4C84 A;  4AXV A;  2RB7 A;  3TX8 A;  3SI1 A;  3PB8 X;  3T8W A;  4F9U A;  1LAP A;  1IGB A;  3ICU A;  4G1P A;  2IMO A;  2PJ5 A;  4C8P A;  5LYL A;  3K9T A;  3I6S A;  3LMS A;  3V7Z A;  5IB9 A;  3PBB A;  3B3C A;  3D66 A;  4P4D A;  3B35 A;  1CP7 A;  2PJ9 A;  2PJ7 A;  3DGV A;  3GB0 A;  3D7F A;  3VAR A;  2Q43 A;  4C9V A;  4C8C A;  5D8N A;  2XEG A;  1ZG7 A;  3PB9 X;  2O4H A;  4JYW A;  4CDK A;  3S9L A;  2OR4 A;  2HC9 A;  1Y9Z A;  2GLJ A;  4P4E A;  4OC3 A;  1TF9 A;  5LYD A;  3NH5 A;  3KZW A;  1VHE A;  4P44 A;  2PJA A;  5LRK A;  5F09 A;  2JBJ A;  2PJC A;  2O53 A;  1ZG9 A;  4PXE A;  4B6Z A;  3VTA A;  3GUX A;  4NFR A;  3FVL A;  1ARL A;  4MRI A;  3PFE A;  2EWB A;  1Y7E A;  4FWU A;  1YLO A;  3ISZ A;  1YME A;  5HXD A;  4UEE A;  4Z65 A;  5K8P A;  1ZLH A;  2V77 A;  1Q7L A;  2AFS A;  3KI9 A;  4TNU A;  4EME A;  4NGS A;  1UWY A;  2V8G A;  3D7H A;  3H8G A;  1CPS A;  7CPA A;  3I1U A;  4NGM A;  3IIB A;  1AYE A;  3PEI A;  2PIY A;  4YWY A;  4C99 A;  5K8M A;  3B3W A;  1YSJ A;  5THW A;  2C6C A;  2AFZ A;  4A39 A;  2I3C A;  4PXC A;  4MHZ A;  3H8E A;  2PIZ A;  2ZEM A;  4FUU A;  3D68 A;  3NFZ A;  1M4L A;  3KAS A;  1Z2L A;  4OC1 A;  1LCP A;  4R7M A;  4X3R A;  3ISX A;  2CTB A;  2AFO A;  1XF1 A;  4OME A;  3IO1 A;  4EWT A;  3D7G A;  1IY7 A;  2Q51 A;  4NGR A;  5LYI A;  4O23 A;  5HVF A;  2C6G A;  3HUV A;  5HVG A;  2IJZ A;  3LWU A;  2ZEN A;  4C85 A;  3IJ3 A;  3KR5 A;  2PJ1 A;  3PBE A;  4X8I A;  4OC5 A;  3IFE A;  1BLL E;  5K8N A;  3BI0 A;  3PRT A;  3KGQ A;  1JQG A;  4ZX9 A;  5ELY A;  3CT9 A;  3GLJ A;  4KNG E;  4W9Y A;  3NH4 A;  3FMC A;  4C8A A;  2AFW A;  5I4M A;  2XEI A;  4NGP A;  4C8F A;  1DE4 C;  2EK9 A;  2CTC A;  1HDQ A;  2JBK A;  3SJE A;  2QVP A;  4FAI A;  3JRU A;  3WT4 A;  2QYV A;  2EK8 A;  3B7I A;  3FH4 A;  2ZEO A;  3BI1 A; 
#chains in the Genus database with same CATH topology
 4ZGY B;  1KWM A;  2ZEE A;  3HMJ G;  2PR1 A;  4M3S A;  4X2T A;  5FVJ A;  3D7D A;  3BUX B;  2AFU A;  2Q7B A;  4WJB A;  3LOD A;  3D4U A;  1Y0Y A;  4C2Y A;  4R6T A;  2PJB A;  4P45 A;  5KTD A;  3B8G A;  4HPS A;  3FX6 A;  3W91 A;  2ZW4 A;  1MK4 A;  3RYO A;  4RN7 A;  2G0B A;  2Q7S A;  1CP6 A;  3HLP A;  1EO0 A;  3SJG A;  4UCN A;  1EZA A;  4ZYQ A;  3D8P A;  4KOW A;  4B5P A;  1P4N A;  1VGY A;  3SJX A;  3FYN A;  3KQX A;  2FS5 A;  2WYR A;  3QAH A;  4HNW B;  2XEJ A;  1Z5R A;  4R8F A;  2BO9 A;  5D29 A;  3BUN B;  4BPX B;  1J4J A;  1PU9 A;  2P6G A;  2ZW7 A;  3MRU A;  4MMO A;  4PV6 A;  3RZA A;  4KSA A;  6CPA A;  1QSN A;  2Z3O A;  1VBG A;  4HNX B;  4IHM A;  3NOJ A;  3L2N A;  3OAK A;  3SXN A;  4OC4 A;  1B6B A;  3TOA A;  4P6Y A;  4I49 A;  4U9Y A;  5BWA B;  5H86 A;  3EZA A;  2GFQ A;  4TJX A;  4A94 A;  1XRY A;  3H4Q A;  2VI7 A;  2QJ8 A;  5CBM A;  1ZL0 A;  2DLA A;  4OKO A;  3GIU A;  3JVN A;  4ZY0 A;  5H84 A;  1ELM P;  2FL4 A;  5EMI A;  1CX8 A;  3CPX A;  3B2Y A;  1RTQ A;  4R3K A;  4P4B A;  3SI0 A;  4FBE A;  1S7N A;  4RR2 B;  2B5G B;  3VH9 A;  4YN3 A;  3EC4 A;  3TLB A;  2Z0Z A;  2AFX A;  2BCO A;  2BSW A;  2EUI A;  2PJ3 A;  3GY9 A;  3QB8 A;  4FD5 A;  3FED A;  4PXD A;  2YJV A;  2JEV A;  3VAT A;  2OOT A;  2VBQ A;  2PJ6 A;  2H5M A;  2POK A;  4KOU A;  4TWE A;  3P2H A;  5GCN A;  3W6S A;  2DXQ A;  4A38 A;  3GKR A;  2GLF A;  1TKH A;  4OID A;  4RS2 A;  4A31 A;  1TF8 A;  3PB4 X;  1XEB A;  4COB A;  2Q0Y A;  2FXF A;  2PCN A;  5LRG A;  2DPS A;  5I0C A;  4CAX A;  5JGF A;  5CPA A;  4MHD A;  1QSO A;  4AB7 A;  2ATR A;  1XJO A;  2Q4Z A;  3GYA A;  1EE3 P;  3TTH A;  4A37 A;  3WC6 A;  1M4G A;  2P6E A;  2JDD A;  4FD6 A;  4OC0 A;  4UIB A;  5DWM A;  3KQZ A;  4A4B A;  3V38 A;  5LYF A;  2P6F A;  4F0X A;  2CNM A;  2AJ6 A;  1CG2 A;  3IC1 A;  3QAY A;  3SI2 A;  1Y7R A;  1Z8L A;  2Q44 A;  1ZG8 A;  3VRN A;  3IEH A;  4KUB A;  4OIW A;  1TIQ A;  2ABZ A;  1V0C A;  2EVN A;  4ZY1 A;  4C86 A;  4C8U A;  4M6I A;  1FBV A;  3H5Z A;  4Y49 C;  1YW6 A;  2HV2 A;  3IU1 A;  2CNT A;  1BPM A;  1WJT A;  3R95 A;  4B5P B;  2ZXV A;  2BOA A;  4UWJ A;  3TT2 A;  1F2P A;  5KTC A;  4JLY A;  2ZEH A;  2X7B A;  4RI1 A;  4UIA A;  4Y49 B;  2PJ4 A;  5F1Y A;  2GRE A;  4YU9 A;  2V8D A;  1CE8 B;  1R43 A;  4MFZ A;  2RC4 A;  4NGQ A;  2R82 A;  4KSF A;  4NJQ A;  2NYQ A;  3DLJ A;  4R76 A;  4MI1 A;  1NSA A;  1H8L A;  3E0K A;  4P4I A;  2F7V A;  2YND A;  4KOY A;  5A27 A;  1MJ9 A;  3SJF A;  2PRB A;  2YGW A;  5ISV A;  1GGO A;  1ZO0 A;  3HPG G;  4HNY B;  3RNZ A;  1Q2C A;  3F9K C;  1Z9E A;  1QSR A;  2Q4V A;  3CZX A;  5HH1 A;  2QIR A;  1Q5X A;  2AUN A;  1FT7 A;  3PB6 X;  3TLE A;  5G20 A;  2YNE A;  1XMB A;  3S6H A;  2WPW A;  2A4N A;  4C8T A;  1S3Z A;  3S9N A;  3FNC A;  1AMP A;  3D67 A;  4P10 A;  4CGM A;  5F9M A;  1KUX A;  4F6A A;  4A95 A;  4X5K A;  3T07 A;  1JDB C;  3FB3 A;  1HEE A;  4M8D A;  4C7H A;  3KHZ A;  1ON0 A;  4JD6 A;  1KEE B;  3I74 A;  2UV8 G;  1WVM A;  4DYO A;  2X0S A;  1FNO A;  2EO8 A;  3DDD A;  4GS4 A;  4ONW A;  3SXO A;  1CPX A;  4UEZ A;  3RAM A;  1M6V B;  4TJV A;  4Q7A A;  4H6Z A;  4IAV A;  2WZN A;  5F47 A;  2VZY A;  2E28 A;  2D4P A;  2JEW A;  3N5F A;  2Y1N A;  4PQA A;  5AG5 A;  4IK2 A;  4BIN A;  4CGN A;  2PE3 A;  4AVA A;  3R9F A;  3TC8 A;  1ZYM A;  4CAF A;  1BAV A;  2FIA A;  4LQG A;  2ARH A;  3NE7 A;  1QMU A;  2WUU A;  2REE A;  4R3L A;  4UBR A;  4ZI6 A;  2V8H A;  2RFH A;  1GHE A;  4P4F A;  4XNH C;  2QML A;  3NH8 A;  5K8O A;  3R9E A;  3TLA A;  4MCS A;  2OH1 A;  2Q4Y A;  4C9R A;  4UFW A;  2P0W A;  3KHX A;  4C68 A;  1ELL P;  2PCU A;  4Q36 A;  4EFD A;  2J8R A;  2I00 A;  4H89 A;  3K2K A;  3BXM A;  2JLM A;  3JUW A;  4IUS A;  1CM0 A;  3B3S A;  5EC4 A;  4NEX A;  3TYX A;  2CXA A;  4XNH B;  1YK3 A;  1QQ9 A;  3CPA A;  4M6G A;  1K4J A;  1WK4 A;  1Y0R A;  3MN8 A;  1VIX A;  2PJ8 A;  3V8I A;  2XEF A;  1YRE A;  2Z3N A;  2VQY A;  1R3N A;  2VEZ A;  4B11 A;  1A9X B;  4C9E A;  1QSM A;  1NMT A;  1Z4R A;  3PP9 A;  1ARM A;  3I9S A;  2PVW A;  1M1D A;  1Q2Y A;  2C1C A;  2NSM A;  5AG7 A;  1Y9W A;  2ZEP A;  5IV0 A;  3ZNI A;  4OP4 A;  4XPD C;  3T0T A;  2PVV A;  1I1D A;  5F48 A;  4MHP A;  2Y1M A;  2PR8 A;  2IL4 A;  4F8Z A;  1LAM A;  4ZX8 A;  2G9D A;  4AG7 A;  4MBU A;  4L89 A;  4QVT A;  1LRZ A;  3SR3 A;  1SQH A;  3PFV A;  2ZOG A;  3HPH E;  1YQE A;  3BJ8 A;  4B5O A;  1TKF A;  5J3X A;  1YX0 A;  4XPD B;  4MCR A;  1GYT A;  4AG9 A;  4ZY2 A;  4CYP A;  4NF1 A;  5HKW A;  1MJA A;  2F8H A;  2ZEG A;  1M44 A;  2ZED A;  3F0A A;  4A32 A;  5JM6 A;  1F57 A;  1B47 A;  3U88 C;  2F5I A;  4KOR A;  2FIW A;  1YVK A;  4YRH A;  1LAN A;  1R61 A;  4R9M A;  2Z3L A;  5G22 A;  3B3T A;  4MHN A;  2D0P A;  4KS9 A;  3D2P A;  4UEF A;  5BY0 A;  2GU2 A;  2ODF A;  4MJ8 A;  2C6P A;  2KCW A;  1KZF A;  3KL9 A;  4AVB A;  3LAC A;  2EZA A;  4NGT A;  1S7L A;  4BTF A;  3NE8 A;  4GPL B;  3RBU A;  1VHO A;  3VWE A;  2D4O A;  2FVG A;  4E0A A;  1XFO A;  1KBL A;  4CS0 B;  1XBU A;  3DNS A;  3FJU A;  3FRM A;  3S9M A;  3S6K A;  2FSR A;  1IYL A;  4E2A A;  1I21 A;  3VRR A;  2BUE A;  2PJ2 A;  2C27 A;  3PGP A;  3QNV A;  4E94 A;  3LD2 A;  4INJ A;  5K99 A;  3JTK A;  4PSW A;  3T5M A;  4MCP A;  2AFM A;  2IQ6 A;  1QST A;  2HWG A;  3EIF A;  1TXR A;  4MFK A;  1YVO A;  2B3U A;  2ZEF A;  3PFO A;  5JPH A;  1J3L A;  1LFW A;  4MJX A;  4C7I A;  3U1B A;  5AG6 A;  3BUM B;  1V6C A;  3G23 A;  1TKJ A;  1RO5 A;  1XOV A;  4KOX A;  2CF4 A;  4RUH A;  1BOB A;  3UY5 A;  3WC5 A;  5IB0 A;  4PPZ A;  4PXB A;  3WAB A;  2PJ0 A;  2PSW A;  3B3V A;  3EXN A;  4UA3 A;  3SHP A;  4MI4 A;  3K9U A;  2N3A B;  3TO9 A;  3TLC A;  4C9A A;  2QEC A;  3KRV A;  2ANP A;  2B4D A;  2REF A;  2HQY A;  3TLZ A;  2B3V A;  2ZW6 A;  4CPA A;  4DJL A;  3R9G A;  4MFL A;  1JDE A;  4II9 A;  3T05 A;  3FEC A;  2J9A A;  3EO4 A;  2VKZ G;  3CXS A;  5DWN A;  4F9V A;  3C8O A;  2GAN A;  1VI4 A;  3IWW A;  1YW4 A;  3VRP A;  3KR4 A;  4BD9 A;  3VRO A;  4NJR A;  5HVH A;  2C5Q A;  4A2Z A;  1OZP A;  1AUG A;  4DUK A;  4MFJ A;  2AE6 A;  4CRZ B;  2HI6 A;  5HKY A;  4MXU A;  2PRQ A;  2YJT A;  2PC1 A;  1C30 B;  2GP4 A;  3OWC A;  3NA6 A;  4OC2 A;  3FEE A;  4K3N A;  3EFA A;  1VKC A;  4IIY A;  1PYT B;  1F2O A;  1BPN A;  3EY5 A;  4H2K A;  2V8V A;  3PB7 X;  3VRQ A;  1OBR A;  2DEA A;  2G3A A;  5LRJ A;  4CAW A;  4B13 A;  2FCK A;  4LUA A;  4C2Z A;  2WPX A;  4MCQ A;  5DS0 A;  4PK3 A;  4JZ0 A;  1S60 A;  1LOK A;  2BL1 A;  3CDX A;  4CGO A;  3BHX A;  3G8W A;  1X10 A;  4ONU A;  3WC7 A;  8CPA A;  2OZG A;  4C9U A;  5KTA A;  3TOB A;  2XPO A;  4NGN A;  3FF3 A;  2R8V A;  3CXQ A;  4K30 A;  4NCZ A;  4L8A A;  4LX9 A;  4MFQ A;  4WWV A;  4F0Y A;  2CIJ A;  1S5K A;  4EYS A;  4IF5 A;  3DR8 A;  4UF4 A;  1BXR B;  1DTD A;  1VHS A;  1CBX A;  2Z10 A;  4P4J A;  1PCA A;  1ZLI A;  2HB6 A;  4GM5 A;  4C2X A;  4MHY A;  5J1Q A;  2ZEL A;  2VL1 A;  5EBV A;  1HDU A;  3H8F A;  3ZJ0 A;  4OAD A;  4KSI A;  2OZH A;  2DIK A;  2ZOF A;  2B5G A;  2ZPA A;  2JDC A;  3S6F A;  4CYQ A;  4C84 A;  5JYB A;  1B87 A;  5J8F A;  3TE4 A;  4AXV A;  2RB7 A;  1NE9 A;  3TX8 A;  3SI1 A;  3PB8 X;  3KKW A;  3T8W A;  3FXT A;  4F9U A;  3R96 A;  1LAP A;  4FD4 A;  3VWD A;  3R1K A;  2GIV A;  2PQ8 A;  4CYO A;  1IGB A;  3ICU A;  4G1P A;  2IMO A;  2PJ5 A;  4CYN A;  4C8P A;  3C26 A;  4KLV A;  5LYL A;  2OB0 A;  3K9T A;  3I6S A;  3G3S A;  3LMS A;  2B4D B;  1IIC A;  3V7Z A;  4EVY A;  3F8K A;  1Q2D A;  2VXK A;  1FY7 A;  1KUY A;  5IB9 A;  4OAE A;  3PBB A;  1XIX A;  3B3C A;  3D66 A;  4COG A;  4P4D A;  3B35 A;  1CP7 A;  1M4D A;  4MY0 A;  2DPT A;  2PJ7 A;  2PJ9 A;  3DGV A;  3GB0 A;  3PLF B;  3D7F A;  2GE3 A;  3FBU A;  5JVL A;  3VAR A;  3DR6 A;  4KZT A;  2Q43 A;  4C9V A;  2Z11 A;  3OP0 A;  4J0N A;  2B58 A;  5F46 A;  4C8C A;  1Z9U A;  2XEG A;  5D8N A;  1ZG7 A;  1BO4 A;  3PB9 X;  4B10 A;  1NSL A;  1Z4E A;  5F13 A;  3VGO A;  3EZB A;  2O4H A;  2B4J C;  3I3G A;  5F5X A;  4U9Z A;  4JYW A;  1DIK A;  4QB9 A;  4JVO A;  3S9L A;  4CDK A;  2J8M A;  2OR4 A;  3BUW B;  3F5B A;  2XPL A;  2HC9 A;  1KUV A;  4UFX A;  5F49 A;  2GLJ A;  1Y9Z A;  4P4E A;  4OC3 A;  1TF9 A;  3OB2 B;  5LYD A;  4CO9 A;  1MJB A;  3NH5 A;  4BBH A;  4FD7 A;  4JXR A;  3O8Z A;  3KZW A;  1VHE A;  2R1I A;  4P44 A;  2PJA A;  3BLN A;  4M6H A;  4UCM A;  3TO7 A;  3WR7 A;  5LRK A;  5F09 A;  2JBJ A;  1NBW A;  2PJC A;  4ORF A;  3D2M A;  4BPU B;  4HKF A;  4Q38 A;  3ZZI A;  1XE4 A;  1ZG9 A;  2O53 A;  3CXP A;  4PXE A;  2Y0M A;  4B6Z A;  4QBJ A;  2PDO A;  4LQ6 A;  3VTA A;  5JQ4 A;  3PZJ A;  4NXY A;  1IID A;  4GXH A;  2FT0 A;  3A9L A;  1P0H A;  1PUA A;  3GUX A;  3IU2 A;  2AUM A;  3NFQ A;  5A28 A;  5C88 A;  4NFR A;  3FVL A;  2HRO A;  3PT1 A;  1ARL A;  2J8N A;  4CRY B;  5HMN A;  1XMT A;  2MP0 A;  4UFV A;  4B12 A;  1Z8T A;  4MRI A;  4CAV A;  3PFE A;  2EWB A;  1Y7E A;  5AG4 A;  2BEI A;  2XPN A;  3GJZ A;  1R57 A;  4R57 A;  4FWU A;  4JWP A;  5IX3 A;  1YLO A;  1VBH A;  2CY2 A;  3ISZ A;  4OLL A;  1C3O B;  2OU2 A;  1YME A;  2O28 A;  4KVX A;  5FD8 A;  5HXD A;  4UEE A;  4Z65 A;  1X12 A;  2CNS A;  4A30 A;  1CJW A;  4MFP A;  5K8P A;  1ZLH A;  2V77 A;  4U5Y A;  4BMH A;  1Q7L A;  1I12 A;  2AFS A;  3KI9 A;  4PSX A;  4TNU A;  5AGE A;  2R98 A;  4EME A;  4PK2 A;  4NGS A;  3P2F A;  2YNC A;  4J3G A;  2D0O A;  4CZ1 A;  1UWY A;  2V8G A;  3D7H A;  3H8G A;  1S7K A;  5JH9 A;  4JJX A;  5AXI A;  1N71 A;  1IU8 A;  4QC6 A;  4CAE A;  4QUS A;  1CPS A;  1RXT A;  7CPA A;  3I1U A;  4NGM A;  4NSQ A;  3S6G A;  4AVC A;  1EZB A;  3IIB A;  1AYE A;  3BJ7 A;  4A4C A;  3D3S A;  3PEI A;  5G1Z A;  2PIY A;  4YWY A;  3TLG A;  4C99 A;  4DNC A;  5K8M A;  4CDJ A;  1IYK A;  4UCP A;  3TCV A;  3B3W A;  1YSJ A;  5THW A;  2C6C A;  2AFZ A;  4A39 A;  2NMT A;  3T9Y A;  5CNP A;  1YGH A;  2I3C A;  2FE7 A;  4PXC A;  4MHZ A;  3H8E A;  2PIZ A;  2Z3K A;  2OLS A;  1KC7 A;  2I79 A;  4KVM E;  2ZEM A;  2HUZ A;  4FUU A;  4UWI A;  1IB1 E;  1WWZ A;  2VZZ A;  3D68 A;  5J8C A;  3NFZ A;  1NXJ A;  1L0C A;  1M4L A;  3KAS A;  1Z8X A;  1YR0 A;  1Z2L A;  4OC1 A;  4YGO A;  3DSB A;  4KOV A;  3K4I A;  1LCP A;  4R7M A;  4X3R A;  3ISX A;  2Z3M A;  4E8O A;  5HKZ A;  4CGP A;  2B4B A;  2EZC A;  2CTB A;  2AFO A;  2ZW5 A;  1XF1 A;  4KOT A;  1Y9K A;  4BPW B;  4KVO E;  4OME A;  3IO1 A;  2R7H A;  3D7G A;  1IY7 A;  2Q51 A;  4EWT A;  3TFY A;  1T36 B;  2FM4 A;  4NGR A;  1YLE A;  5LYI A;  2CBL A;  2EBJ A;  3IWG A;  4YFJ A;  4O23 A;  4H1H A;  4KUA A;  5HVF A;  2C6G A;  1A2Z A;  2DF5 A;  3HUV A;  5C82 A;  5HVG A;  2IJZ A;  3TLY A;  3LWU A;  3W6X A;  2ZEN A;  4C85 A;  4IIX A;  3IJ3 A;  2XPP A;  1S7F A;  2PJ1 A;  3KR5 A;  3PBE A;  4X8I A;  5IR2 A;  4OC5 A;  3IFE A;  3BUO B;  1YVH A;  1BLL E;  3TO6 A;  5K8N A;  3BI0 A;  1CS0 B;  4E5S A;  2G3T A;  3PRT A;  4ZBG A;  3KGQ A;  4KLW A;  4B14 A;  2YNC C;  1JQG A;  4M85 A;  4H6U A;  1Z8W A;  4ZX9 A;  5ELY A;  1IOF A;  3CT9 A;  3GLJ A;  4KNG E;  1UFH A;  1XF8 A;  1M4I A;  2K5T A;  4CGL A;  2B0A A;  4W9Y A;  3NH4 A;  3FMC A;  4C8A A;  4R87 A;  2AFW A;  1U6M A;  2XEI A;  5I4M A;  4NGP A;  4XPK A;  2Z3P A;  2Q04 A;  1DE4 C;  5G21 A;  2EK9 A;  3T90 A;  2EZB A;  4C8F A;  4MY3 A;  2OZU A;  2WSA A;  3MGD A;  3N7Z A;  1ZRS A;  4JXQ A;  3IGR A;  4XPL A;  2CTC A;  1HDQ A;  4A33 A;  2JBK A;  3SJE A;  2QVP A;  4KOS A;  3RO0 A;  4FAI A;  3JRU A;  5E96 A;  3OB1 B;  3FIX A;  1JWQ A;  3WT4 A;  1IOI A;  2QYV A;  2EK8 A;  3EZE A;  3TLG B;  3B7I A;  3FH4 A;  2ZEO A;  3IWE A;  3BI1 A; 
#chains in the Genus database with same CATH homology
 1KWM A;  2ZEE A;  4X2T A;  3D7D A;  2AFU A;  4WJB A;  3D4U A;  1Y0Y A;  4R6T A;  2PJB A;  4P45 A;  3FX6 A;  1CP6 A;  3HLP A;  3SJG A;  4ZYQ A;  1VGY A;  3SJX A;  3KQX A;  2WYR A;  2XEJ A;  1Z5R A;  4R8F A;  2BO9 A;  5D29 A;  3MRU A;  3RZA A;  6CPA A;  4MMO A;  4IHM A;  3L2N A;  4OC4 A;  4P6Y A;  4TJX A;  4A94 A;  1XRY A;  2QJ8 A;  5CBM A;  4OKO A;  4ZY0 A;  1ELM P;  1CX8 A;  3CPX A;  3B2Y A;  1RTQ A;  4P4B A;  3SI0 A;  4FBE A;  3VH9 A;  4YN3 A;  2AFX A;  2BCO A;  2PJ3 A;  4PXD A;  3FED A;  3VAT A;  2OOT A;  2PJ6 A;  2POK A;  4TWE A;  4A38 A;  2GLF A;  1TKH A;  4OID A;  1TF8 A;  3PB4 X;  5LRG A;  5JGF A;  5CPA A;  1XJO A;  2Q4Z A;  1EE3 P;  4A37 A;  3WC6 A;  4UIB A;  3V38 A;  4OC0 A;  5LYF A;  3KQZ A;  1CG2 A;  3IC1 A;  3SI2 A;  1Z8L A;  1ZG8 A;  3IEH A;  4OIW A;  2ABZ A;  4ZY1 A;  4C86 A;  4C8U A;  1YW6 A;  1BPM A;  2BOA A;  1F2P A;  2ZEH A;  4UIA A;  2PJ4 A;  2GRE A;  4YU9 A;  2V8D A;  1R43 A;  4NGQ A;  4NJQ A;  2NYQ A;  3DLJ A;  4R76 A;  1NSA A;  1H8L A;  4P4I A;  2F7V A;  3SJF A;  1FT7 A;  3PB6 X;  1XMB A;  4C8T A;  3S9N A;  1AMP A;  3D67 A;  4P10 A;  1HEE A;  3KHZ A;  3I74 A;  1WVM A;  4DYO A;  1FNO A;  4ONW A;  1CPX A;  4UEZ A;  3RAM A;  4TJV A;  4Q7A A;  4IAV A;  2WZN A;  2JEW A;  3N5F A;  4PQA A;  4IK2 A;  2PE3 A;  3TC8 A;  1BAV A;  4LQG A;  1QMU A;  4ZI6 A;  2V8H A;  2RFH A;  4P4F A;  3NH8 A;  5K8O A;  4MCS A;  4C9R A;  3KHX A;  1ELL P;  2PCU A;  4EFD A;  3K2K A;  3BXM A;  3B3S A;  1QQ9 A;  3CPA A;  1Y0R A;  3MN8 A;  1VIX A;  2PJ8 A;  2XEF A;  1R3N A;  4C9E A;  1ARM A;  2PVW A;  2C1C A;  2NSM A;  2ZEP A;  4OP4 A;  2PVV A;  4MHP A;  4F8Z A;  1LAM A;  4ZX8 A;  2G9D A;  2ZOG A;  1TKF A;  4MCR A;  1GYT A;  4ZY2 A;  2F8H A;  2ZEG A;  2ZED A;  5JM6 A;  1F57 A;  1LAN A;  3B3T A;  4MHN A;  4UEF A;  2GU2 A;  2C6P A;  3KL9 A;  4NGT A;  3RBU A;  1VHO A;  2FVG A;  1XFO A;  1XBU A;  3FJU A;  3S9M A;  3QNV A;  2PJ2 A;  4MCP A;  2AFM A;  2IQ6 A;  3EIF A;  1TXR A;  2ZEF A;  3PFO A;  1LFW A;  1V6C A;  1TKJ A;  2CF4 A;  4RUH A;  3WC5 A;  4PPZ A;  4PXB A;  3WAB A;  2PJ0 A;  4CDJ A;  3B3V A;  4C9A A;  2ANP A;  4CPA A;  4DJL A;  3FEC A;  2J9A A;  4F9V A;  3IWW A;  1YW4 A;  3KR4 A;  4BD9 A;  5HVH A;  4NJR A;  2C5Q A;  4DUK A;  4MXU A;  2PRQ A;  2GP4 A;  3NA6 A;  4OC2 A;  3FEE A;  4K3N A;  1PYT B;  1F2O A;  1BPN A;  4H2K A;  2V8V A;  3PB7 X;  1OBR A;  2DEA A;  5LRJ A;  4MCQ A;  5DS0 A;  4JZ0 A;  3CDX A;  1LOK A;  3BHX A;  3WC7 A;  8CPA A;  4C9U A;  4NGN A;  3FF3 A;  4WWV A;  2CIJ A;  4UF4 A;  1DTD A;  5JH9 A;  1CBX A;  4GM5 A;  4P4J A;  1PCA A;  1ZLI A;  2HB6 A;  4MHY A;  5J1Q A;  2ZEL A;  2VL1 A;  1HDU A;  3H8F A;  4KSI A;  2ZOF A;  4C84 A;  4AXV A;  2RB7 A;  3TX8 A;  3SI1 A;  3PB8 X;  3T8W A;  4F9U A;  1LAP A;  1IGB A;  3ICU A;  4G1P A;  2IMO A;  2PJ5 A;  4C8P A;  5LYL A;  3K9T A;  3I6S A;  3LMS A;  3V7Z A;  5IB9 A;  3PBB A;  3B3C A;  3D66 A;  4P4D A;  3B35 A;  1CP7 A;  2PJ9 A;  2PJ7 A;  3DGV A;  3GB0 A;  3D7F A;  3VAR A;  2Q43 A;  4C9V A;  4C8C A;  5D8N A;  2XEG A;  1ZG7 A;  3PB9 X;  2O4H A;  4JYW A;  4CDK A;  3S9L A;  2OR4 A;  2HC9 A;  1Y9Z A;  2GLJ A;  4P4E A;  4OC3 A;  1TF9 A;  5LYD A;  3NH5 A;  3KZW A;  1VHE A;  4P44 A;  2PJA A;  5LRK A;  5F09 A;  2JBJ A;  2PJC A;  2O53 A;  1ZG9 A;  4PXE A;  4B6Z A;  3VTA A;  3GUX A;  4NFR A;  3FVL A;  1ARL A;  4MRI A;  3PFE A;  2EWB A;  1Y7E A;  4FWU A;  1YLO A;  3ISZ A;  1YME A;  5HXD A;  4UEE A;  4Z65 A;  5K8P A;  1ZLH A;  2V77 A;  1Q7L A;  2AFS A;  3KI9 A;  4TNU A;  4EME A;  4NGS A;  1UWY A;  2V8G A;  3D7H A;  3H8G A;  1CPS A;  7CPA A;  3I1U A;  4NGM A;  3IIB A;  1AYE A;  3PEI A;  2PIY A;  4YWY A;  4C99 A;  5K8M A;  3B3W A;  1YSJ A;  5THW A;  2C6C A;  2AFZ A;  4A39 A;  2I3C A;  4PXC A;  4MHZ A;  3H8E A;  2PIZ A;  2ZEM A;  4FUU A;  3D68 A;  3NFZ A;  1M4L A;  3KAS A;  1Z2L A;  4OC1 A;  1LCP A;  4R7M A;  4X3R A;  3ISX A;  2CTB A;  2AFO A;  1XF1 A;  4OME A;  3IO1 A;  4EWT A;  3D7G A;  1IY7 A;  2Q51 A;  4NGR A;  5LYI A;  4O23 A;  5HVF A;  2C6G A;  3HUV A;  5HVG A;  2IJZ A;  3LWU A;  2ZEN A;  4C85 A;  5IR2 A;  3IJ3 A;  3KR5 A;  2PJ1 A;  3PBE A;  4X8I A;  4OC5 A;  3IFE A;  1BLL E;  5K8N A;  3BI0 A;  3PRT A;  3KGQ A;  1JQG A;  4ZX9 A;  5ELY A;  3CT9 A;  3GLJ A;  4KNG E;  4W9Y A;  3NH4 A;  3FMC A;  4C8A A;  2AFW A;  5I4M A;  2XEI A;  4NGP A;  4C8F A;  1DE4 C;  2EK9 A;  2CTC A;  1HDQ A;  2JBK A;  3SJE A;  2QVP A;  4FAI A;  3JRU A;  3WT4 A;  2QYV A;  2EK8 A;  3B7I A;  3FH4 A;  2ZEO A;  3BI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...