4MCPA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyl-gamma-l-glutamic acid (pteroyldi-gamma-l-glutamic acid)
Total Genus 270
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
270
sequence length
695
structure length
692
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 270
structure length 692
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcpA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcpA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcpA02
3ICUA 4R6TA 2JBJA 1VHOA 2PVWA 3RZAA 2BCOA 1XMBA 4A39A 2EK8A 3FECA 1YW4A 1R43A 2POKA 1QQ9A 2C6PA 2RFHA 3PB9X 1CBXA 4WWVA 3WT4A 1ZLHA 4TNUA 5I4MA 5CBMA 4PQAA 4C8PA 4C8UA 3KHZA 2I3CA 2PIYA 2C6GA 4A38A 3PB8X 1R3NA 4A37A 3NH5A 4NJRA 2V8DA 4ZX8A 2WZNA 3D7DA 1LAPA 5HVGA 4C9EA 3T8WA 1XFOA 1LFWA 2VL1A 5LRGA 1TKJA 4R8FA 2IJZA 3PFEA 4MHPA 4C9AA 5LYDA 1XRYA 3PBBA 5JH9A 2JBKA 3WC5A 1CP6A 3WABA 1PYTB 1YLOA 1DTDA 4JYWA 3I1UA 1Q7LA 5D8NA 3ISZA 3L2NA 5JGFA 4X2TA 4C8TA 1TKHA 1XF1A 3MRUA 4MCRA 3B7IA 1YW6A 4PXDA 4P44A 4TJXA 2ZEMA 2WYRA 3D7HA 5K8PA 4YWYA 5ELYA 1IGBA 5D29A 1ZLIA 4CPAA 3K2KA 3GLJA 3HLPA 3B3WA 3LMSA 4LQGA 2RB7A 1CPXA 4MCSA 2ZOFA 1VGYA 2AFOA 2ZENA 3IIBA 1BLLE 2PJAA 3B3VA 3DLJA 1DE4C 4DJLA 2AFSA 4MHYA 4R7MA 4NGMA 3BI1A 3BXMA 2ZELA 1V6CA 2OR4A 4FAIA 2V8HA 5HXDA 2CIJA 3SJGA 4NGNA 4CDKA 4IK2A 4PXCA 1TF8A 4OIWA 1HEEA 4ZY1A 2V77A 5IB9A 4UIBA 3WC6A 4ZY2A 4UIAA 4NGQA 2JEWA 1CP7A 4YN3A 3H8GA 1UWYA 2BOAA 2ZOGA 2AFMA 2PIZA 3KASA 4P4JA 2BO9A 4K3NA 2QYVA 3LWUA 3NH4A 4NFRA 3PRTA 1EE3P 2QVPA 2ZEPA 1F2PA 3KR5A 3VH9A 3IWWA 4BD9A 2ZEHA 2O4HA 4CDJA 3NH8A 3B3TA 3QNVA 2PRQA 3PBEA 3SI2A 4C85A 4KNGE 5LYLA 2FVGA 4UEEA 4MMOA 1Z8LA 4TWEA 3RAMA 2PE3A 4F8ZA 3KI9A 3RBUA 7CPAA 1ZG7A 4C9RA 1Y0YA 4ZYQA 1HDQA 4FBEA 5LYFA 1XJOA 4WJBA 4C8AA 1TKFA 4ZI6A 2PJ2A 2PVVA 2PJBA 4P4EA 3N5FA 4X8IA 2HB6A 2ZEGA 3IO1A 5K8NA 2ZEDA 2PJ0A 3PFOA 3V38A 3GB0A 3FJUA 4O23A 4MHNA 4OC1A 3KL9A 4ZY0A 2PJCA 4MHZA 1LANA 5THWA 4X3RA 2EK9A 2Q4ZA 4MCPA 4OC0A 4P4IA 4FUUA 4B6ZA 1LAMA 4P10A 3SI0A 4P45A 4OC2A 4PPZA 2PJ4A 5J1QA 3B3SA 2XEJA 1IY7A 3CPXA 5CPAA 4R76A 3D68A 3ISXA 2GU2A 3S9NA 4FWUA 1Y7EA 3D7GA 1FT7A 2GLJA 3NA6A 3FX6A 2V8GA 3D4UA 4UF4A 4NGTA 3B2YA 2XEGA 4OC4A 3SJEA 3D66A 3CPAA 4RUHA 4OMEA 4UEFA 4NGRA 2CTBA 2ZEOA 1Y0RA 2ABZA 2Q43A 1YSJA 4MXUA 1ARLA 1ELLP 2PJ5A 1XBUA 4AXVA 2IMOA 4PXEA 1BPNA 1F2OA 1TF9A 4TJVA 4C86A 2XEIA 4DUKA 1ARMA 3TX8A 2IQ6A 4C8CA 4OC3A 2G9DA 1ZG8A 4GM5A 4EWTA 2AFXA 3SI1A 3I74A 3BI0A 4OIDA 3PB6X 3HUVA 3D67A 2V8VA 2NYQA 4UEZA 4IAVA 5LRJA 2GREA 2O53A 4C9VA 3FEDA 2F7VA 4P4FA 1ELMP 3VARA 1QMUA 3PB4X 4G1PA 2DEAA 2QJ8A 3CDXA 3WC7A 3VTAA 3MN8A 4NGPA 1AYEA 4EFDA 2F8HA 4DYOA 1KWMA 3H8EA 4P4DA 3KGQA 2HC9A 2PCUA 3K9TA 4F9VA 5DS0A 4IHMA 4KSIA 4NJQA 3H8FA 2ANPA 1NSAA 3FMCA 4W9YA 3PEIA 4OC5A 4P4BA 1CX8A 2J9AA 4F9UA 3KZWA 1OBRA 4JZ0A 4ONWA 3CT9A 4C99A 5HVHA 3FF3A 3I6SA 4YU9A 3KQZA 3S9LA 1FNOA 3TC8A 3SJXA 3S9MA 1HDUA 2AFWA 1PCAA 1F57A 2GLFA 3EIFA 4NGSA 2PJ9A 3DGVA 2AFUA 4MRIA 4Q7AA 2PJ7A 2OOTA 5LRKA 3JRUA 3PB7X 1CG2A 3IFEA 3KQXA 3FH4A 4A94A 2CTCA 4EMEA 2Q51A 8CPAA 2NSMA 1JQGA 5K8MA 3IC1A 3D7FA 5F09A 1GYTA 3IJ3A 4ZX9A 2C1CA 4Z65A 4OP4A 4H2KA 1WVMA 1ZG9A 2CF4A 3B3CA 1AMPA 5HVFA 5LYIA 5K8OA 1BAVA 3V7ZA 2XEFA 3GUXA 1Y9ZA 4C8FA 2PJ3A 3BHXA 4C9UA 1M4LA 3SJFA 2PJ6A 1CPSA 1BPMA 1TXRA 4C84A 1LOKA 3NFZA 1YMEA 1RTQA 1Z2LA 3B35A 4P6YA 4PXBA 3FVLA 6CPAA 2AFZA 2PJ1A 3VATA 3KHXA 2ZEFA 1Z5RA 4MCQA 1VIXA 4OKOA 1VHEA 2EWBA 2C6CA 2PJ8A 3KR4A 3IEHA 1LCPA 1H8LA 5JM6A 2ZEEA 3FEEA
chains in the Genus database with same CATH superfamily
2DXQA 3TLGB 5K99A 1VHSA 3ICUA 4IIXA 4UBRA 2QMLA 4R6TA 2JBJA 3R9FA 1VHOA 2PVWA 2ARHA 3EO4A 4CZ1A 2FIWA 4H6UA 3RZAA 2OB0A 4NEXA 2BCOA 2OZHA 1I12A 1XMBA 4A39A 1S60A 2EK8A 3FECA 4DNCA 1YW4A 4BPUB 4KVXA 3TT2A 3T5MA 4CAEA 2DLAA 1JWQA 1R43A 4KOUA 2OU2A 5BWAB 2POKA 2VZZA 1QQ9A 2C6PA 1KZFA 2RFHA 1Z8WA 3PB9X 4KOYA 1CBXA 1U6MA 1Q5XA 2YJVA 1ZRSA 4WWVA 3BJ8A 1IYKA 2FSRA 4HNYB 3W6SA 3WT4A 1ZLHA 4CYNA 4TNUA 3JVNA 3T07A 2EBJA 2J8MA 1YK3A 3B8GA 3P2HA 5CBMA 4PQAA 4Q38A 1BO4A 5I4MA 4C8UA 4C8PA 4BINA 3KHZA 1UFHA 2I3CA 4XPDB 3PZJA 2PIYA 2C6GA 2FL4A 4A38A 4INJA 3PB8X 2RC4A 3BJ7A 4JXRA 1R3NA 5C88A 2HI6A 1RO5A 4A95A 4A37A 1CJWA 4KOWA 3NH5A 2OH1A 4NJRA 2V8DA 4ZX8A 2WZNA 3CZXA 3D7DA 1LAPA 3RO0A 5HVGA 1FY7A 4C9EA 3GIUA 1BOBA 2OZUA 4KSFA 2AUMA 2FM4A 4OADA 5BY0A 3T8WA 1XFOA 1NMTA 4AB7A 3TLYA 4CAFA 4QVTA 3TO9A 4E5SA 1LFWA 2VL1A 4KUAA 1C3OB 1Z8TA 4R3LA 1IOFA 5KTDA 5LRGA 1TKJA 2PQ8A 2IJZA 2VQYA 3PFEA 4R8FA 3GJZA 3PP9A 1DIKA 1KC7A 2QECA 4MHPA 1PU9A 2Z3KA 2BSWA 3T9YA 2B4DB 1YR0A 2G3AA 2GANA 4KOVA 2BL1A 4C9AA 3GY9A 5LYDA 3IWEA 1XRYA 1Z4EA 3PBBA 5JH9A 2JBKA 2Y1NA 3F0AA 3BUNB 4QUSA 4H89A 1N71A 1S7LA 2PSWA 1QSTA 4HKFA 3WC5A 1Y9KA 5F1YA 3S6KA 2REEA 3TO7A 2WSAA 3U1BA 1CP6A 3WABA 4FD4A 2ODFA 1PYTB 1YLOA 3TLCA 1DTDA 4JYWA 4NXYA 3I1UA 2CBLA 1Q7LA 4JWPA 4KLWA 3OAKA 5D8NA 1ZYMA 3EZAA 1XF8A 5HMNA 3OB2B 3ISZA 1YVHA 5JVLA 3L2NA 4C2XA 5JGFA 4X2TA 2VBQA 4CGMA 1TKHA 1IICA 3TOAA 4C8TA 4GPLB 1XF1A 1P0HA 1QSOA 2B58A 3MRUA 3HMJG 2G0BA 2FT0A 1YX0A 2HQYA 3T0TA 3R96A 3DDDA 5F48A 1X10A 4MCRA 1OZPA 3B7IA 4CGLA 5IV0A 3W6XA 3TTHA 2A4NA 1EO0A 3VRPA 1MJAA 1YW6A 4P44A 3OP0A 2PRBA 4KOTA 3H5ZA 1YLEA 2ZEMA 4MI4A 4PXDA 4TJXA 2D4OA 2WYRA 3D7HA 4UFVA 5K8PA 4YWYA 5ELYA 1IGBA 5D29A 1ZLIA 2IL4A 3K2KA 4CPAA 3GLJA 1I21A 3HLPA 3B3WA 3LMSA 3DSBA 3S6HA 1Q2YA 4R57A 3SHPA 4C7HA 4LQGA 2EO8A 3QAYA 2RB7A 4MY3A 4ZBGA 3JUWA 1WJTA 1CPXA 1VI4A 4ONUA 4MCSA 2ZOFA 1VGYA 4KORA 5F46A 2AFOA 2ZENA 3IIBA 3NFQA 4Y49B 2UV8G 2VI7A 1R61A 2XPOA 3G8WA 4QC6A 4PSWA 1BLLE 4KOSA 4B13A 2PJAA 1J4JA 5AGEA 2DIKA 3B3VA 3DLJA 4MFQA 1DE4C 4DJLA 1R57A 3U88C 2AFSA 4MHYA 4R7MA 4NGMA 2K5TA 3BI1A 4E0AA 3BXMA 2ZELA 4E94A 1V6CA 2OR4A 4FAIA 3PFVA 1KUXA 2V8HA 5EBVA 3IU2A 5HXDA 3KRVA 2PR1A 4CAWA 4UWIA 2AJ6A 2CIJA 3SJGA 1AUGA 2D0PA 3OB1B 2HV2A 4NGNA 1WK4A 2PC1A 2REFA 4MHDA 1VKCA 4AVBA 4IK2A 4CDKA 4PXCA 2Q44A 4J3GA 1TF8A 4OIWA 1HEEA 4ZY1A 2V77A 5IB9A 4UIBA 2R82A 4PSXA 2B5GA 1V0CA 4PK3A 3WC6A 4ZY2A 4UCPA 2HUZA 4UIAA 4RN7A 4NGQA 4MFJA 1KUYA 4YRHA 2JEWA 2FS5A 1ZL0A 1I1DA 3VGOA 1CP7A 2D4PA 1VBHA 4YN3A 1S3ZA 4UCMA 3H8GA 4F0YA 2B4JC 1B47A 2XPPA 2Z3MA 1UWYA 2BOAA 3N7ZA 5F13A 4NCZA 5CNPA 3TLAA 2PDOA 2ZOGA 5F9MA 2AFMA 2PIZA 2ZW7A 2YNCC 3KASA 4P4JA 2BO9A 5F5XA 2C27A 1M6VB 2I00A 4K3NA 2Q04A 2QYVA 3LWUA 2ZXVA 2R1IA 3NH4A 4FD5A 4NFRA 3PRTA 3BUXB 1XIXA 1EE3P 2GE3A 3QAHA 4HNXB 2H5MA 2QVPA 1F2PA 2ZEPA 3KR5A 4LQ6A 4F0XA 3R9EA 4IF5A 4MY0A 4ORFA 3VH9A 1J3LA 2DF5A 2CY2A 3TFYA 2Z11A 3IWWA 2PR8A 3CXPA 2ZEHA 4HPSA 1XE4A 4LUAA 4M85A 1RXTA 4BD9A 5E96A 2O4HA 4B12A 4U9YA 4CDJA 3GKRA 2JEVA 3TLZA 1Q2CA 3NH8A 2BUEA 3B3TA 3QNVA 2HROA 2PRQA 2R7HA 3C26A 3PBEA 3SI2A 2VKZG 4KNGE 4C85A 2Q4VA 3FNCA 1YGHA 5LYLA 1M4DA 4I49A 5IX3A 2QIRA 2FVGA 4B11A 2D0OA 2GP4A 4UEEA 4MMOA 1Z8LA 4TWEA 2B0AA 3RAMA 2PE3A 4F8ZA 1ON0A 3KI9A 1FBVA 3RBUA 2X7BA 7CPAA 5G20A 1ZG7A 4OAEA 4C9RA 1Y0YA 1KUVA 1QSNA 3OWCA 2Y1MA 4ZYQA 1HDQA 4BPXB 4UCNA 1M4IA 4FBEA 5LYFA 1XJOA 2ZW4A 4WJBA 4C8AA 1TKFA 4ZI6A 3G23A 2PJ2A 2PVVA 2PJBA 4P4EA 2VZYA 3EY5A 3N5FA 4FD7A 4MJXA 4X8IA 3R95A 4B5PB 4QBJA 1MK4A 2HB6A 4RS2A 2ZEGA 3IO1A 1Z4RA 3SXOA 5K8NA 2ZEDA 2PJ0A 3PFOA 2Z0ZA 4KUBA 2EVNA 3V38A 2ZPAA 4CAXA 2B4BA 3GB0A 3TLBA 3NOJA 2CNSA 2YNDA 3FJUA 4U5YA 4O23A 4CGPA 4MHNA 3TE4A 4OC1A 3KL9A 4E8OA 4ZY0A 2PJCA 2YJTA 3VROA 5HKYA 4MHZA 1LANA 3R1KA 5THWA 3F8KA 4X3RA 2EK9A 2Q4ZA 4Y49C 4RR2B 3LODA 5J8FA 4MCPA 4OC0A 4P4IA 4FUUA 4X5KA 2C5QA 5HH1A 3O8ZA 4B6ZA 5FVJA 3T90A 1LAMA 4A33A 4A30A 2EUIA 2Q4YA 4P10A 4KVME 1IOIA 1XEBA 1IYLA 1QSMA 3SI0A 4P45A 4OC2A 2YNEA 3FB3A 1A2ZA 3FXTA 3EZEA 4C2YA 3PGPA 3LACA 4PPZA 4MJ8A 2PJ4A 5J1QA 3BUMB 3EFAA 3B3SA 4UFXA 4AVAA 2XEJA 1IY7A 3IWGA 4M6GA 3CPXA 4KZTA 3TYXA 5CPAA 4R76A 4KVOE 1XOVA 3D68A 5G1ZA 1M4GA 2DPTA 3ISXA 2GU2A 4LX9A 3D2PA 4BBHA 2JLMA 4BPWB 3S9NA 4FWUA 1Z9UA 1Y7EA 4B5OA 1B6BA 2KCWA 2Z3OA 3D7GA 1FT7A 2GLJA 3NA6A 3FX6A 2V8GA 1ZO0A 3IU1A 2B5GB 3D4UA 1GGOA 4UF4A 5JPHA 1IB1E 1TIQA 2J8RA 4NGTA 4II9A 3B2YA 3VTAA 2XEGA 1NSLA 4GXHA 2ATRA 2Q7SA 4OC4A 3SJEA 3H4QA 3RNZA 3D66A 3S6GA 3CPAA 1IU8A 4XNHB 4OMEA 4RUHA 5IR2A 4M6IA 4UEFA 4NGRA 3F9KC 2CTBA 2ZEOA 3TOBA 1Y0RA 2ABZA 2VXKA 1CE8B 4R9MA 2Q43A 4AVCA 1YSJA 4MXUA 1ARLA 1ELLP 2PJ5A 1Y9WA 2F5IA 3LD2A 1XBUA 5A28A 4MFPA 4B14A 4AXVA 2IMOA 4PXEA 1BPNA 1F2OA 1TF9A 5DWMA 2PCNA 4TJVA 3PT1A 2DPSA 4C86A 5K8MA 2XPNA 4XPKA 2XEIA 4DUKA 3VRQA 1ARMA 2XPLA 4A4CA 2YGWA 3TX8A 4CRYB 2IQ6A 3K4IA 2GFQA 3EXNA 4OC3A 5AG7A 2G9DA 4ZGYB 5A27A 4C8CA 1IIDA 2R8VA 3NE8A 1ZG8A 4GM5A 4M3SA 4JLYA 2AFXA 3SI1A 4EWTA 3I74A 4XPLA 3BI0A 4OIDA 2EZAA 3D3SA 3PB6X 3S6FA 3D2MA 2I79A 2YNCA 3HUVA 3I9SA 4Q36A 5KTAA 2EZCA 2WPXA 2V8VA 3D67A 2NYQA 4UEZA 4IAVA 5LRJA 2GREA 4C7IA 4L8AA 1Y7RA 2O53A 4J0NA 4CAVA 4C9VA 3IGRA 3FEDA 1M1DA 2P0WA 4KSAA 3HPHE 1GHEA 2ZW5A 4MFZA 3VWDA 4COGA 2F7VA 4P4FA 1ELMP 3FBUA 2G3TA 3VARA 1QMUA 3PB4X 3I3GA 4G1PA 4JXQA 2DEAA 2QJ8A 3CDXA 3WC7A 5FD8A 3MN8A 4NGPA 4BTFA 4E2AA 2Z10A 1AYEA 4F6AA 4EFDA 2HWGA 4EYSA 3EC4A 4R3KA 3BUOB 2Y0MA 1EZBA 2B3UA 3CXSA 2F8HA 4DYOA 1K4JA 4K30A 1XMTA 4C68A 4GS4A 1KWMA 4H6ZA 4JJXA 2OLSA 2AE6A 4P4DA 2OZGA 3H8EA 3KGQA 4L89A 2HC9A 1CS0B 2PCUA 3K9TA 5F49A 4F9VA 1NE9A 4NF1A 5DS0A 1B87A 4IHMA 4KSIA 2FE7A 3H8FA 4NJQA 4CGNA 1YREA 3TLGA 1YQEA 2ANPA 1NSAA 3FMCA 5ISVA 4W9YA 3VRNA 5HKWA 4OC5A 2ZW6A 1P4NA 3NE7A 3CXQA 3PEIA 4CGOA 4IIYA 4P4BA 1CX8A 2J9AA 5HKZA 3UY5A 3DR6A 1OBRA 3KZWA 4MFKA 4JZ0A 4F9UA 3PLFB 4MI1A 4ONWA 4EVYA 4UFWA 3CT9A 5G22A 5H86A 2B4DA 4C99A 3MGDA 2FCKA 3FF3A 4XPDC 5HVHA 1JDBC 4YU9A 3KQZA 3TCVA 2AUNA 3I6SA 3S9LA 2GIVA 1FNOA 1LRZA 3TC8A 3SJXA 1MJBA 1Z9EA 1WWZA 3TO6A 3S9MA 4HNWB 1HDUA 1S7KA 2AFWA 2J8NA 3QB8A 1PCAA 1MJ9A 5DWNA 4CYPA 5KTCA 1F57A 1VBGA 5JYBA 4CYQA 3K9UA 2GLFA 3F5BA 5AG6A 3EIFA 4NGSA 3HPGG 1YVOA 2PJ9A 2AFUA 3BLNA 3DGVA 4MRIA 4Q7AA 2Q0YA 2PJ7A 2OOTA 5J3XA 5LRKA 3JRUA 3V8IA 2X0SA 3PB7X 2EZBA 4B10A 1CG2A 3IFEA 4AG9A 2FIAA 5I0CA 3KQXA 5GCNA 1QSRA 2P6GA 1X12A 3FH4A 4QB9A 4A94A 4CYOA 1JDEA 2MP0A 1M44A 2CTCA 4UWJA 3T05A 2R98A 3FYNA 4EMEA 1S5KA 4IUSA 4A4BA 2Q51A 8CPAA 2NSMA 1JQGA 5EMIA 2CNTA 2NMTA 3IC1A 3D7FA 5F09A 1GYTA 1L0CA 3IJ3A 5AG4A 1EZAA 4ZX9A 2N3AB 2C1CA 4Z65A 4OP4A 4H2KA 1C30B 3FRMA 1WVMA 1ZG9A 2CF4A 3SR3A 3B3CA 2Q7BA 2P6FA 2Z3PA 3RYOA 1AMPA 5HVFA 5LYIA 5K8OA 1BAVA 3V7ZA 2BEIA 3D8PA 2XEFA 1Q2DA 3GYAA 3GUXA 1Y9ZA 4C8FA 1YVKA 2PJ3A 3BHXA 3R9GA 4C9UA 4A32A 4U9ZA 3W91A 3BUWB 4JVOA 3A9LA 4COBA 5AXIA 1M4LA 3SXNA 3SJFA 5H84A 4M6HA 1BXRB 1NXJA 1KBLA 2WPWA 4FD6A 4CRZB 1CM0A 3JTKA 2PJ6A 1CPSA 1Z8XA 1T36B 2E28A 1BPMA 2B3VA 3FIXA 1TXRA 4A2ZA 4C84A 1LOKA 3NFZA 3VRRA 1KEEB 3ZNIA 1S7FA 3G3SA 5G21A 1S7NA 1YMEA 4A31A 1RTQA 1Z2LA 3B35A 4JD6A 4NSQA 4P6YA 4PXBA 1NBWA 2WUUA 4CS0B 3FVLA 4YFJA 6CPAA 2AFZA 2PJ1A 2Z3LA 4PV6A 4RI1A 4AG7A 2P6EA 5EC4A 3VATA 4B5PA 3KHXA 4C2ZA 5J8CA 4KS9A 4H1HA 4CO9A 3DNSA 2ZEFA 1Z5RA 3DR8A 4OLLA 5IB0A 4MCQA 4BMHA 3E0KA 3P2FA 2JDDA 1PUAA 4MBUA 3ZZIA 1VIXA 4KLVA 2FXFA 4OKOA 4XNHC 2CXAA 4PK2A 5AG5A 2VEZA 2Z3NA 3KKWA 3C8OA 1VHEA 2EWBA 2C6CA 3WR7A 4YGOA 2PJ8A 4R87A 3KR4A 3IEHA 3EZBA 1A9XB 4KOXA 1LCPA 1H8LA 4UA3A 5JM6A 2ZEEA 3VWEA 5F47A 3ZJ0A 2CNMA 4M8DA 4MFLA 3FEEA 1SQHA 2JDCA 3TLEA 5C82A 2O28A 5JQ4A
chains in the Genus database with same CATH topology
3ICUA 4R6TA 2JBJA 1VHOA 2PVWA 3RZAA 2BCOA 1XMBA 4A39A 2EK8A 3FECA 1YW4A 1R43A 2POKA 1QQ9A 2C6PA 2RFHA 3PB9X 1CBXA 4WWVA 3WT4A 1ZLHA 4TNUA 5I4MA 5CBMA 4PQAA 4C8PA 4C8UA 3KHZA 2I3CA 2PIYA 2C6GA 4A38A 3PB8X 1R3NA 4A37A 3NH5A 4NJRA 2V8DA 4ZX8A 2WZNA 3D7DA 1LAPA 5HVGA 4C9EA 3T8WA 1XFOA 1LFWA 2VL1A 5LRGA 1TKJA 4R8FA 2IJZA 3PFEA 4MHPA 4C9AA 5LYDA 1XRYA 3PBBA 5JH9A 2JBKA 3WC5A 1CP6A 3WABA 1PYTB 1YLOA 1DTDA 4JYWA 3I1UA 1Q7LA 5D8NA 3ISZA 3L2NA 5JGFA 4X2TA 4C8TA 1TKHA 1XF1A 3MRUA 4MCRA 3B7IA 1YW6A 4PXDA 4P44A 4TJXA 2ZEMA 2WYRA 3D7HA 5K8PA 4YWYA 5ELYA 1IGBA 5D29A 1ZLIA 4CPAA 3K2KA 3GLJA 3HLPA 3B3WA 3LMSA 4LQGA 2RB7A 1CPXA 4MCSA 2ZOFA 1VGYA 2AFOA 2ZENA 3IIBA 1BLLE 2PJAA 3B3VA 3DLJA 1DE4C 4DJLA 2AFSA 4MHYA 4R7MA 4NGMA 3BI1A 3BXMA 2ZELA 1V6CA 2OR4A 4FAIA 2V8HA 5HXDA 2CIJA 3SJGA 4NGNA 4CDKA 4IK2A 4PXCA 1TF8A 4OIWA 1HEEA 4ZY1A 2V77A 5IB9A 4UIBA 3WC6A 4ZY2A 4UIAA 4NGQA 2JEWA 1CP7A 4YN3A 3H8GA 1UWYA 2BOAA 2ZOGA 2AFMA 2PIZA 3KASA 4P4JA 2BO9A 4K3NA 2QYVA 3LWUA 3NH4A 4NFRA 3PRTA 1EE3P 2QVPA 2ZEPA 1F2PA 3KR5A 3VH9A 3IWWA 4BD9A 2ZEHA 2O4HA 4CDJA 3NH8A 3B3TA 3QNVA 2PRQA 3PBEA 3SI2A 4C85A 4KNGE 5LYLA 2FVGA 2GP4A 4UEEA 4MMOA 1Z8LA 4TWEA 3RAMA 2PE3A 4F8ZA 3KI9A 3RBUA 7CPAA 1ZG7A 4C9RA 1Y0YA 4ZYQA 1HDQA 4FBEA 5LYFA 1XJOA 4WJBA 4C8AA 1TKFA 4ZI6A 2PJ2A 2PVVA 2PJBA 4P4EA 3N5FA 4X8IA 2HB6A 2ZEGA 3IO1A 5K8NA 2ZEDA 2PJ0A 3PFOA 3V38A 3GB0A 3FJUA 4O23A 4MHNA 4OC1A 3KL9A 4ZY0A 2PJCA 4MHZA 1LANA 5THWA 4X3RA 2EK9A 2Q4ZA 4MCPA 4OC0A 4P4IA 4FUUA 2C5QA 4B6ZA 1LAMA 4P10A 3SI0A 4P45A 4OC2A 4PPZA 2PJ4A 5J1QA 3B3SA 2XEJA 1IY7A 3CPXA 5CPAA 4R76A 3D68A 3ISXA 2GU2A 3S9NA 4FWUA 1Y7EA 3D7GA 1FT7A 2GLJA 3NA6A 3FX6A 2V8GA 3D4UA 4UF4A 4NGTA 3B2YA 2XEGA 4OC4A 3SJEA 3D66A 3CPAA 4RUHA 5IR2A 4OMEA 4UEFA 4NGRA 2CTBA 2ZEOA 1Y0RA 2ABZA 2Q43A 1YSJA 4MXUA 1ARLA 1ELLP 2PJ5A 1XBUA 4AXVA 2IMOA 4PXEA 1BPNA 1F2OA 1TF9A 4TJVA 4C86A 2XEIA 4DUKA 1ARMA 3TX8A 2IQ6A 4C8CA 4OC3A 2G9DA 1ZG8A 4GM5A 4EWTA 2AFXA 3SI1A 3I74A 3BI0A 4OIDA 3PB6X 3HUVA 3D67A 2V8VA 2NYQA 4UEZA 4IAVA 5LRJA 2GREA 2O53A 4C9VA 3FEDA 2F7VA 4P4FA 1ELMP 3VARA 1QMUA 3PB4X 4G1PA 2DEAA 2QJ8A 3CDXA 3WC7A 3VTAA 3MN8A 4NGPA 1AYEA 4EFDA 2F8HA 4DYOA 1KWMA 3H8EA 4P4DA 3KGQA 2HC9A 2PCUA 3K9TA 4F9VA 5DS0A 4IHMA 4KSIA 4NJQA 3H8FA 2ANPA 1NSAA 3FMCA 4W9YA 3PEIA 4OC5A 4P4BA 1CX8A 2J9AA 4F9UA 3KZWA 1OBRA 4JZ0A 4ONWA 3CT9A 4C99A 5HVHA 3FF3A 3I6SA 4YU9A 3KQZA 3S9LA 1FNOA 3TC8A 3SJXA 3S9MA 1HDUA 2AFWA 1PCAA 1F57A 2GLFA 3EIFA 4NGSA 2PJ9A 3DGVA 2AFUA 4MRIA 4Q7AA 2PJ7A 2OOTA 5LRKA 3JRUA 3PB7X 1CG2A 3IFEA 3KQXA 3FH4A 4A94A 2CTCA 4EMEA 2Q51A 8CPAA 2NSMA 1JQGA 5K8MA 3IC1A 3D7FA 5F09A 1GYTA 3IJ3A 4ZX9A 2C1CA 4Z65A 4OP4A 4H2KA 1WVMA 1ZG9A 2CF4A 3B3CA 1AMPA 5HVFA 5LYIA 5K8OA 1BAVA 3V7ZA 2XEFA 3GUXA 1Y9ZA 4C8FA 2PJ3A 3BHXA 4C9UA 1M4LA 3SJFA 2PJ6A 1CPSA 1BPMA 1TXRA 4C84A 1LOKA 3NFZA 1YMEA 1RTQA 1Z2LA 3B35A 4P6YA 4PXBA 3FVLA 6CPAA 2AFZA 2PJ1A 3VATA 3KHXA 2ZEFA 1Z5RA 4MCQA 1VIXA 4OKOA 1VHEA 2EWBA 2C6CA 2PJ8A 3KR4A 3IEHA 1LCPA 1H8LA 5JM6A 2ZEEA 3FEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ICU A;  4R6T A;  2JBJ A;  1VHO A;  2PVW A;  3RZA A;  2BCO A;  1XMB A;  4A39 A;  2EK8 A;  3FEC A;  1YW4 A;  1R43 A;  2POK A;  1QQ9 A;  2C6P A;  2RFH A;  3PB9 X;  1CBX A;  4WWV A;  3WT4 A;  1ZLH A;  4TNU A;  5I4M A;  5CBM A;  4PQA A;  4C8P A;  4C8U A;  3KHZ A;  2I3C A;  2PIY A;  2C6G A;  4A38 A;  3PB8 X;  1R3N A;  4A37 A;  3NH5 A;  4NJR A;  2V8D A;  4ZX8 A;  2WZN A;  3D7D A;  1LAP A;  5HVG A;  4C9E A;  3T8W A;  1XFO A;  1LFW A;  2VL1 A;  5LRG A;  1TKJ A;  4R8F A;  2IJZ A;  3PFE A;  4MHP A;  4C9A A;  5LYD A;  1XRY A;  3PBB A;  5JH9 A;  2JBK A;  3WC5 A;  1CP6 A;  3WAB A;  1PYT B;  1YLO A;  1DTD A;  4JYW A;  3I1U A;  1Q7L A;  5D8N A;  3ISZ A;  3L2N A;  5JGF A;  4X2T A;  4C8T A;  1TKH A;  1XF1 A;  3MRU A;  4MCR A;  3B7I A;  1YW6 A;  4PXD A;  4P44 A;  4TJX A;  2ZEM A;  2WYR A;  3D7H A;  5K8P A;  4YWY A;  5ELY A;  1IGB A;  5D29 A;  1ZLI A;  4CPA A;  3K2K A;  3GLJ A;  3HLP A;  3B3W A;  3LMS A;  4LQG A;  2RB7 A;  1CPX A;  4MCS A;  2ZOF A;  1VGY A;  2AFO A;  2ZEN A;  3IIB A;  1BLL E;  2PJA A;  3B3V A;  3DLJ A;  1DE4 C;  4DJL A;  2AFS A;  4MHY A;  4R7M A;  4NGM A;  3BI1 A;  3BXM A;  2ZEL A;  1V6C A;  2OR4 A;  4FAI A;  2V8H A;  5HXD A;  2CIJ A;  3SJG A;  4NGN A;  4CDK A;  4IK2 A;  4PXC A;  1TF8 A;  4OIW A;  1HEE A;  4ZY1 A;  2V77 A;  5IB9 A;  4UIB A;  3WC6 A;  4ZY2 A;  4UIA A;  4NGQ A;  2JEW A;  1CP7 A;  4YN3 A;  3H8G A;  1UWY A;  2BOA A;  2ZOG A;  2AFM A;  2PIZ A;  3KAS A;  4P4J A;  2BO9 A;  4K3N A;  2QYV A;  3LWU A;  3NH4 A;  4NFR A;  3PRT A;  1EE3 P;  2QVP A;  2ZEP A;  1F2P A;  3KR5 A;  3VH9 A;  3IWW A;  4BD9 A;  2ZEH A;  2O4H A;  4CDJ A;  3NH8 A;  3B3T A;  3QNV A;  2PRQ A;  3PBE A;  3SI2 A;  4C85 A;  4KNG E;  5LYL A;  2FVG A;  4UEE A;  4MMO A;  1Z8L A;  4TWE A;  3RAM A;  2PE3 A;  4F8Z A;  3KI9 A;  3RBU A;  7CPA A;  1ZG7 A;  4C9R A;  1Y0Y A;  4ZYQ A;  1HDQ A;  4FBE A;  5LYF A;  1XJO A;  4WJB A;  4C8A A;  1TKF A;  4ZI6 A;  2PJ2 A;  2PVV A;  2PJB A;  4P4E A;  3N5F A;  4X8I A;  2HB6 A;  2ZEG A;  3IO1 A;  5K8N A;  2ZED A;  2PJ0 A;  3PFO A;  3V38 A;  3GB0 A;  3FJU A;  4O23 A;  4MHN A;  4OC1 A;  3KL9 A;  4ZY0 A;  2PJC A;  4MHZ A;  1LAN A;  5THW A;  4X3R A;  2EK9 A;  2Q4Z A;  4MCP A;  4OC0 A;  4P4I A;  4FUU A;  4B6Z A;  1LAM A;  4P10 A;  3SI0 A;  4P45 A;  4OC2 A;  4PPZ A;  2PJ4 A;  5J1Q A;  3B3S A;  2XEJ A;  1IY7 A;  3CPX A;  5CPA A;  4R76 A;  3D68 A;  3ISX A;  2GU2 A;  3S9N A;  4FWU A;  1Y7E A;  3D7G A;  1FT7 A;  2GLJ A;  3NA6 A;  3FX6 A;  2V8G A;  3D4U A;  4UF4 A;  4NGT A;  3B2Y A;  2XEG A;  4OC4 A;  3SJE A;  3D66 A;  3CPA A;  4RUH A;  4OME A;  4UEF A;  4NGR A;  2CTB A;  2ZEO A;  1Y0R A;  2ABZ A;  2Q43 A;  1YSJ A;  4MXU A;  1ARL A;  1ELL P;  2PJ5 A;  1XBU A;  4AXV A;  2IMO A;  4PXE A;  1BPN A;  1F2O A;  1TF9 A;  4TJV A;  4C86 A;  2XEI A;  4DUK A;  1ARM A;  3TX8 A;  2IQ6 A;  4C8C A;  4OC3 A;  2G9D A;  1ZG8 A;  4GM5 A;  4EWT A;  2AFX A;  3SI1 A;  3I74 A;  3BI0 A;  4OID A;  3PB6 X;  3HUV A;  3D67 A;  2V8V A;  2NYQ A;  4UEZ A;  4IAV A;  5LRJ A;  2GRE A;  2O53 A;  4C9V A;  3FED A;  2F7V A;  4P4F A;  1ELM P;  3VAR A;  1QMU A;  3PB4 X;  4G1P A;  2DEA A;  2QJ8 A;  3CDX A;  3WC7 A;  3VTA A;  3MN8 A;  4NGP A;  1AYE A;  4EFD A;  2F8H A;  4DYO A;  1KWM A;  3H8E A;  4P4D A;  3KGQ A;  2HC9 A;  2PCU A;  3K9T A;  4F9V A;  5DS0 A;  4IHM A;  4KSI A;  4NJQ A;  3H8F A;  2ANP A;  1NSA A;  3FMC A;  4W9Y A;  3PEI A;  4OC5 A;  4P4B A;  1CX8 A;  2J9A A;  4F9U A;  3KZW A;  1OBR A;  4JZ0 A;  4ONW A;  3CT9 A;  4C99 A;  5HVH A;  3FF3 A;  3I6S A;  4YU9 A;  3KQZ A;  3S9L A;  1FNO A;  3TC8 A;  3SJX A;  3S9M A;  1HDU A;  2AFW A;  1PCA A;  1F57 A;  2GLF A;  3EIF A;  4NGS A;  2PJ9 A;  3DGV A;  2AFU A;  4MRI A;  4Q7A A;  2PJ7 A;  2OOT A;  5LRK A;  3JRU A;  3PB7 X;  1CG2 A;  3IFE A;  3KQX A;  3FH4 A;  4A94 A;  2CTC A;  4EME A;  2Q51 A;  8CPA A;  2NSM A;  1JQG A;  5K8M A;  3IC1 A;  3D7F A;  5F09 A;  1GYT A;  3IJ3 A;  4ZX9 A;  2C1C A;  4Z65 A;  4OP4 A;  4H2K A;  1WVM A;  1ZG9 A;  2CF4 A;  3B3C A;  1AMP A;  5HVF A;  5LYI A;  5K8O A;  1BAV A;  3V7Z A;  2XEF A;  3GUX A;  1Y9Z A;  4C8F A;  2PJ3 A;  3BHX A;  4C9U A;  1M4L A;  3SJF A;  2PJ6 A;  1CPS A;  1BPM A;  1TXR A;  4C84 A;  1LOK A;  3NFZ A;  1YME A;  1RTQ A;  1Z2L A;  3B35 A;  4P6Y A;  4PXB A;  3FVL A;  6CPA A;  2AFZ A;  2PJ1 A;  3VAT A;  3KHX A;  2ZEF A;  1Z5R A;  4MCQ A;  1VIX A;  4OKO A;  1VHE A;  2EWB A;  2C6C A;  2PJ8 A;  3KR4 A;  3IEH A;  1LCP A;  1H8L A;  5JM6 A;  2ZEE A;  3FEE A; 
#chains in the Genus database with same CATH topology
 2DXQ A;  3TLG B;  5K99 A;  1VHS A;  3ICU A;  4IIX A;  4UBR A;  2QML A;  4R6T A;  2JBJ A;  3R9F A;  1VHO A;  2PVW A;  2ARH A;  3EO4 A;  4CZ1 A;  2FIW A;  4H6U A;  3RZA A;  2OB0 A;  4NEX A;  2BCO A;  2OZH A;  1I12 A;  1XMB A;  4A39 A;  1S60 A;  2EK8 A;  3FEC A;  4DNC A;  1YW4 A;  4BPU B;  4KVX A;  3TT2 A;  3T5M A;  4CAE A;  2DLA A;  1JWQ A;  1R43 A;  4KOU A;  2OU2 A;  5BWA B;  2POK A;  2VZZ A;  1QQ9 A;  2C6P A;  1KZF A;  2RFH A;  1Z8W A;  3PB9 X;  4KOY A;  1CBX A;  1U6M A;  1Q5X A;  2YJV A;  1ZRS A;  4WWV A;  3BJ8 A;  1IYK A;  2FSR A;  4HNY B;  3W6S A;  3WT4 A;  1ZLH A;  4CYN A;  4TNU A;  3JVN A;  3T07 A;  2EBJ A;  2J8M A;  1YK3 A;  3B8G A;  3P2H A;  5CBM A;  4PQA A;  4Q38 A;  1BO4 A;  5I4M A;  4C8U A;  4C8P A;  4BIN A;  3KHZ A;  1UFH A;  2I3C A;  4XPD B;  3PZJ A;  2PIY A;  2C6G A;  2FL4 A;  4A38 A;  4INJ A;  3PB8 X;  2RC4 A;  3BJ7 A;  4JXR A;  1R3N A;  5C88 A;  2HI6 A;  1RO5 A;  4A95 A;  4A37 A;  1CJW A;  4KOW A;  3NH5 A;  2OH1 A;  4NJR A;  2V8D A;  4ZX8 A;  2WZN A;  3CZX A;  3D7D A;  1LAP A;  3RO0 A;  5HVG A;  1FY7 A;  4C9E A;  3GIU A;  1BOB A;  2OZU A;  4KSF A;  2AUM A;  2FM4 A;  4OAD A;  5BY0 A;  3T8W A;  1XFO A;  1NMT A;  4AB7 A;  3TLY A;  4CAF A;  4QVT A;  3TO9 A;  4E5S A;  1LFW A;  2VL1 A;  4KUA A;  1C3O B;  1Z8T A;  4R3L A;  1IOF A;  5KTD A;  5LRG A;  1TKJ A;  2PQ8 A;  2IJZ A;  2VQY A;  3PFE A;  4R8F A;  3GJZ A;  3PP9 A;  1DIK A;  1KC7 A;  2QEC A;  4MHP A;  1PU9 A;  2Z3K A;  2BSW A;  3T9Y A;  2B4D B;  1YR0 A;  2G3A A;  2GAN A;  4KOV A;  2BL1 A;  4C9A A;  3GY9 A;  5LYD A;  3IWE A;  1XRY A;  1Z4E A;  3PBB A;  5JH9 A;  2JBK A;  2Y1N A;  3F0A A;  3BUN B;  4QUS A;  4H89 A;  1N71 A;  1S7L A;  2PSW A;  1QST A;  4HKF A;  3WC5 A;  1Y9K A;  5F1Y A;  3S6K A;  2REE A;  3TO7 A;  2WSA A;  3U1B A;  1CP6 A;  3WAB A;  4FD4 A;  2ODF A;  1PYT B;  1YLO A;  3TLC A;  1DTD A;  4JYW A;  4NXY A;  3I1U A;  2CBL A;  1Q7L A;  4JWP A;  4KLW A;  3OAK A;  5D8N A;  1ZYM A;  3EZA A;  1XF8 A;  5HMN A;  3OB2 B;  3ISZ A;  1YVH A;  5JVL A;  3L2N A;  4C2X A;  5JGF A;  4X2T A;  2VBQ A;  4CGM A;  1TKH A;  1IIC A;  3TOA A;  4C8T A;  4GPL B;  1XF1 A;  1P0H A;  1QSO A;  2B58 A;  3MRU A;  3HMJ G;  2G0B A;  2FT0 A;  1YX0 A;  2HQY A;  3T0T A;  3R96 A;  3DDD A;  5F48 A;  1X10 A;  4MCR A;  1OZP A;  3B7I A;  4CGL A;  5IV0 A;  3W6X A;  3TTH A;  2A4N A;  1EO0 A;  3VRP A;  1MJA A;  1YW6 A;  4P44 A;  3OP0 A;  2PRB A;  4KOT A;  3H5Z A;  1YLE A;  2ZEM A;  4MI4 A;  4PXD A;  4TJX A;  2D4O A;  2WYR A;  3D7H A;  4UFV A;  5K8P A;  4YWY A;  5ELY A;  1IGB A;  5D29 A;  1ZLI A;  2IL4 A;  3K2K A;  4CPA A;  3GLJ A;  1I21 A;  3HLP A;  3B3W A;  3LMS A;  3DSB A;  3S6H A;  1Q2Y A;  4R57 A;  3SHP A;  4C7H A;  4LQG A;  2EO8 A;  3QAY A;  2RB7 A;  4MY3 A;  4ZBG A;  3JUW A;  1WJT A;  1CPX A;  1VI4 A;  4ONU A;  4MCS A;  2ZOF A;  1VGY A;  4KOR A;  5F46 A;  2AFO A;  2ZEN A;  3IIB A;  3NFQ A;  4Y49 B;  2UV8 G;  2VI7 A;  1R61 A;  2XPO A;  3G8W A;  4QC6 A;  4PSW A;  1BLL E;  4KOS A;  4B13 A;  2PJA A;  1J4J A;  5AGE A;  2DIK A;  3B3V A;  3DLJ A;  4MFQ A;  1DE4 C;  4DJL A;  1R57 A;  3U88 C;  2AFS A;  4MHY A;  4R7M A;  4NGM A;  2K5T A;  3BI1 A;  4E0A A;  3BXM A;  2ZEL A;  4E94 A;  1V6C A;  2OR4 A;  4FAI A;  3PFV A;  1KUX A;  2V8H A;  5EBV A;  3IU2 A;  5HXD A;  3KRV A;  2PR1 A;  4CAW A;  4UWI A;  2AJ6 A;  2CIJ A;  3SJG A;  1AUG A;  2D0P A;  3OB1 B;  2HV2 A;  4NGN A;  1WK4 A;  2PC1 A;  2REF A;  4MHD A;  1VKC A;  4AVB A;  4IK2 A;  4CDK A;  4PXC A;  2Q44 A;  4J3G A;  1TF8 A;  4OIW A;  1HEE A;  4ZY1 A;  2V77 A;  5IB9 A;  4UIB A;  2R82 A;  4PSX A;  2B5G A;  1V0C A;  4PK3 A;  3WC6 A;  4ZY2 A;  4UCP A;  2HUZ A;  4UIA A;  4RN7 A;  4NGQ A;  4MFJ A;  1KUY A;  4YRH A;  2JEW A;  2FS5 A;  1ZL0 A;  1I1D A;  3VGO A;  1CP7 A;  2D4P A;  1VBH A;  4YN3 A;  1S3Z A;  4UCM A;  3H8G A;  4F0Y A;  2B4J C;  1B47 A;  2XPP A;  2Z3M A;  1UWY A;  2BOA A;  3N7Z A;  5F13 A;  4NCZ A;  5CNP A;  3TLA A;  2PDO A;  2ZOG A;  5F9M A;  2AFM A;  2PIZ A;  2ZW7 A;  2YNC C;  3KAS A;  4P4J A;  2BO9 A;  5F5X A;  2C27 A;  1M6V B;  2I00 A;  4K3N A;  2Q04 A;  2QYV A;  3LWU A;  2ZXV A;  2R1I A;  3NH4 A;  4FD5 A;  4NFR A;  3PRT A;  3BUX B;  1XIX A;  1EE3 P;  2GE3 A;  3QAH A;  4HNX B;  2H5M A;  2QVP A;  1F2P A;  2ZEP A;  3KR5 A;  4LQ6 A;  4F0X A;  3R9E A;  4IF5 A;  4MY0 A;  4ORF A;  3VH9 A;  1J3L A;  2DF5 A;  2CY2 A;  3TFY A;  2Z11 A;  3IWW A;  2PR8 A;  3CXP A;  2ZEH A;  4HPS A;  1XE4 A;  4LUA A;  4M85 A;  1RXT A;  4BD9 A;  5E96 A;  2O4H A;  4B12 A;  4U9Y A;  4CDJ A;  3GKR A;  2JEV A;  3TLZ A;  1Q2C A;  3NH8 A;  2BUE A;  3B3T A;  3QNV A;  2HRO A;  2PRQ A;  2R7H A;  3C26 A;  3PBE A;  3SI2 A;  2VKZ G;  4KNG E;  4C85 A;  2Q4V A;  3FNC A;  1YGH A;  5LYL A;  1M4D A;  4I49 A;  5IX3 A;  2QIR A;  2FVG A;  4B11 A;  2D0O A;  2GP4 A;  4UEE A;  4MMO A;  1Z8L A;  4TWE A;  2B0A A;  3RAM A;  2PE3 A;  4F8Z A;  1ON0 A;  3KI9 A;  1FBV A;  3RBU A;  2X7B A;  7CPA A;  5G20 A;  1ZG7 A;  4OAE A;  4C9R A;  1Y0Y A;  1KUV A;  1QSN A;  3OWC A;  2Y1M A;  4ZYQ A;  1HDQ A;  4BPX B;  4UCN A;  1M4I A;  4FBE A;  5LYF A;  1XJO A;  2ZW4 A;  4WJB A;  4C8A A;  1TKF A;  4ZI6 A;  3G23 A;  2PJ2 A;  2PVV A;  2PJB A;  4P4E A;  2VZY A;  3EY5 A;  3N5F A;  4FD7 A;  4MJX A;  4X8I A;  3R95 A;  4B5P B;  4QBJ A;  1MK4 A;  2HB6 A;  4RS2 A;  2ZEG A;  3IO1 A;  1Z4R A;  3SXO A;  5K8N A;  2ZED A;  2PJ0 A;  3PFO A;  2Z0Z A;  4KUB A;  2EVN A;  3V38 A;  2ZPA A;  4CAX A;  2B4B A;  3GB0 A;  3TLB A;  3NOJ A;  2CNS A;  2YND A;  3FJU A;  4U5Y A;  4O23 A;  4CGP A;  4MHN A;  3TE4 A;  4OC1 A;  3KL9 A;  4E8O A;  4ZY0 A;  2PJC A;  2YJT A;  3VRO A;  5HKY A;  4MHZ A;  1LAN A;  3R1K A;  5THW A;  3F8K A;  4X3R A;  2EK9 A;  2Q4Z A;  4Y49 C;  4RR2 B;  3LOD A;  5J8F A;  4MCP A;  4OC0 A;  4P4I A;  4FUU A;  4X5K A;  2C5Q A;  5HH1 A;  3O8Z A;  4B6Z A;  5FVJ A;  3T90 A;  1LAM A;  4A33 A;  4A30 A;  2EUI A;  2Q4Y A;  4P10 A;  4KVM E;  1IOI A;  1XEB A;  1IYL A;  1QSM A;  3SI0 A;  4P45 A;  4OC2 A;  2YNE A;  3FB3 A;  1A2Z A;  3FXT A;  3EZE A;  4C2Y A;  3PGP A;  3LAC A;  4PPZ A;  4MJ8 A;  2PJ4 A;  5J1Q A;  3BUM B;  3EFA A;  3B3S A;  4UFX A;  4AVA A;  2XEJ A;  1IY7 A;  3IWG A;  4M6G A;  3CPX A;  4KZT A;  3TYX A;  5CPA A;  4R76 A;  4KVO E;  1XOV A;  3D68 A;  5G1Z A;  1M4G A;  2DPT A;  3ISX A;  2GU2 A;  4LX9 A;  3D2P A;  4BBH A;  2JLM A;  4BPW B;  3S9N A;  4FWU A;  1Z9U A;  1Y7E A;  4B5O A;  1B6B A;  2KCW A;  2Z3O A;  3D7G A;  1FT7 A;  2GLJ A;  3NA6 A;  3FX6 A;  2V8G A;  1ZO0 A;  3IU1 A;  2B5G B;  3D4U A;  1GGO A;  4UF4 A;  5JPH A;  1IB1 E;  1TIQ A;  2J8R A;  4NGT A;  4II9 A;  3B2Y A;  3VTA A;  2XEG A;  1NSL A;  4GXH A;  2ATR A;  2Q7S A;  4OC4 A;  3SJE A;  3H4Q A;  3RNZ A;  3D66 A;  3S6G A;  3CPA A;  1IU8 A;  4XNH B;  4OME A;  4RUH A;  5IR2 A;  4M6I A;  4UEF A;  4NGR A;  3F9K C;  2CTB A;  2ZEO A;  3TOB A;  1Y0R A;  2ABZ A;  2VXK A;  1CE8 B;  4R9M A;  2Q43 A;  4AVC A;  1YSJ A;  4MXU A;  1ARL A;  1ELL P;  2PJ5 A;  1Y9W A;  2F5I A;  3LD2 A;  1XBU A;  5A28 A;  4MFP A;  4B14 A;  4AXV A;  2IMO A;  4PXE A;  1BPN A;  1F2O A;  1TF9 A;  5DWM A;  2PCN A;  4TJV A;  3PT1 A;  2DPS A;  4C86 A;  5K8M A;  2XPN A;  4XPK A;  2XEI A;  4DUK A;  3VRQ A;  1ARM A;  2XPL A;  4A4C A;  2YGW A;  3TX8 A;  4CRY B;  2IQ6 A;  3K4I A;  2GFQ A;  3EXN A;  4OC3 A;  5AG7 A;  2G9D A;  4ZGY B;  5A27 A;  4C8C A;  1IID A;  2R8V A;  3NE8 A;  1ZG8 A;  4GM5 A;  4M3S A;  4JLY A;  2AFX A;  3SI1 A;  4EWT A;  3I74 A;  4XPL A;  3BI0 A;  4OID A;  2EZA A;  3D3S A;  3PB6 X;  3S6F A;  3D2M A;  2I79 A;  2YNC A;  3HUV A;  3I9S A;  4Q36 A;  5KTA A;  2EZC A;  2WPX A;  2V8V A;  3D67 A;  2NYQ A;  4UEZ A;  4IAV A;  5LRJ A;  2GRE A;  4C7I A;  4L8A A;  1Y7R A;  2O53 A;  4J0N A;  4CAV A;  4C9V A;  3IGR A;  3FED A;  1M1D A;  2P0W A;  4KSA A;  3HPH E;  1GHE A;  2ZW5 A;  4MFZ A;  3VWD A;  4COG A;  2F7V A;  4P4F A;  1ELM P;  3FBU A;  2G3T A;  3VAR A;  1QMU A;  3PB4 X;  3I3G A;  4G1P A;  4JXQ A;  2DEA A;  2QJ8 A;  3CDX A;  3WC7 A;  5FD8 A;  3MN8 A;  4NGP A;  4BTF A;  4E2A A;  2Z10 A;  1AYE A;  4F6A A;  4EFD A;  2HWG A;  4EYS A;  3EC4 A;  4R3K A;  3BUO B;  2Y0M A;  1EZB A;  2B3U A;  3CXS A;  2F8H A;  4DYO A;  1K4J A;  4K30 A;  1XMT A;  4C68 A;  4GS4 A;  1KWM A;  4H6Z A;  4JJX A;  2OLS A;  2AE6 A;  4P4D A;  2OZG A;  3H8E A;  3KGQ A;  4L89 A;  2HC9 A;  1CS0 B;  2PCU A;  3K9T A;  5F49 A;  4F9V A;  1NE9 A;  4NF1 A;  5DS0 A;  1B87 A;  4IHM A;  4KSI A;  2FE7 A;  3H8F A;  4NJQ A;  4CGN A;  1YRE A;  3TLG A;  1YQE A;  2ANP A;  1NSA A;  3FMC A;  5ISV A;  4W9Y A;  3VRN A;  5HKW A;  4OC5 A;  2ZW6 A;  1P4N A;  3NE7 A;  3CXQ A;  3PEI A;  4CGO A;  4IIY A;  4P4B A;  1CX8 A;  2J9A A;  5HKZ A;  3UY5 A;  3DR6 A;  1OBR A;  3KZW A;  4MFK A;  4JZ0 A;  4F9U A;  3PLF B;  4MI1 A;  4ONW A;  4EVY A;  4UFW A;  3CT9 A;  5G22 A;  5H86 A;  2B4D A;  4C99 A;  3MGD A;  2FCK A;  3FF3 A;  4XPD C;  5HVH A;  1JDB C;  4YU9 A;  3KQZ A;  3TCV A;  2AUN A;  3I6S A;  3S9L A;  2GIV A;  1FNO A;  1LRZ A;  3TC8 A;  3SJX A;  1MJB A;  1Z9E A;  1WWZ A;  3TO6 A;  3S9M A;  4HNW B;  1HDU A;  1S7K A;  2AFW A;  2J8N A;  3QB8 A;  1PCA A;  1MJ9 A;  5DWN A;  4CYP A;  5KTC A;  1F57 A;  1VBG A;  5JYB A;  4CYQ A;  3K9U A;  2GLF A;  3F5B A;  5AG6 A;  3EIF A;  4NGS A;  3HPG G;  1YVO A;  2PJ9 A;  2AFU A;  3BLN A;  3DGV A;  4MRI A;  4Q7A A;  2Q0Y A;  2PJ7 A;  2OOT A;  5J3X A;  5LRK A;  3JRU A;  3V8I A;  2X0S A;  3PB7 X;  2EZB A;  4B10 A;  1CG2 A;  3IFE A;  4AG9 A;  2FIA A;  5I0C A;  3KQX A;  5GCN A;  1QSR A;  2P6G A;  1X12 A;  3FH4 A;  4QB9 A;  4A94 A;  4CYO A;  1JDE A;  2MP0 A;  1M44 A;  2CTC A;  4UWJ A;  3T05 A;  2R98 A;  3FYN A;  4EME A;  1S5K A;  4IUS A;  4A4B A;  2Q51 A;  8CPA A;  2NSM A;  1JQG A;  5EMI A;  2CNT A;  2NMT A;  3IC1 A;  3D7F A;  5F09 A;  1GYT A;  1L0C A;  3IJ3 A;  5AG4 A;  1EZA A;  4ZX9 A;  2N3A B;  2C1C A;  4Z65 A;  4OP4 A;  4H2K A;  1C30 B;  3FRM A;  1WVM A;  1ZG9 A;  2CF4 A;  3SR3 A;  3B3C A;  2Q7B A;  2P6F A;  2Z3P A;  3RYO A;  1AMP A;  5HVF A;  5LYI A;  5K8O A;  1BAV A;  3V7Z A;  2BEI A;  3D8P A;  2XEF A;  1Q2D A;  3GYA A;  3GUX A;  1Y9Z A;  4C8F A;  1YVK A;  2PJ3 A;  3BHX A;  3R9G A;  4C9U A;  4A32 A;  4U9Z A;  3W91 A;  3BUW B;  4JVO A;  3A9L A;  4COB A;  5AXI A;  1M4L A;  3SXN A;  3SJF A;  5H84 A;  4M6H A;  1BXR B;  1NXJ A;  1KBL A;  2WPW A;  4FD6 A;  4CRZ B;  1CM0 A;  3JTK A;  2PJ6 A;  1CPS A;  1Z8X A;  1T36 B;  2E28 A;  1BPM A;  2B3V A;  3FIX A;  1TXR A;  4A2Z A;  4C84 A;  1LOK A;  3NFZ A;  3VRR A;  1KEE B;  3ZNI A;  1S7F A;  3G3S A;  5G21 A;  1S7N A;  1YME A;  4A31 A;  1RTQ A;  1Z2L A;  3B35 A;  4JD6 A;  4NSQ A;  4P6Y A;  4PXB A;  1NBW A;  2WUU A;  4CS0 B;  3FVL A;  4YFJ A;  6CPA A;  2AFZ A;  2PJ1 A;  2Z3L A;  4PV6 A;  4RI1 A;  4AG7 A;  2P6E A;  5EC4 A;  3VAT A;  4B5P A;  3KHX A;  4C2Z A;  5J8C A;  4KS9 A;  4H1H A;  4CO9 A;  3DNS A;  2ZEF A;  1Z5R A;  3DR8 A;  4OLL A;  5IB0 A;  4MCQ A;  4BMH A;  3E0K A;  3P2F A;  2JDD A;  1PUA A;  4MBU A;  3ZZI A;  1VIX A;  4KLV A;  2FXF A;  4OKO A;  4XNH C;  2CXA A;  4PK2 A;  5AG5 A;  2VEZ A;  2Z3N A;  3KKW A;  3C8O A;  1VHE A;  2EWB A;  2C6C A;  3WR7 A;  4YGO A;  2PJ8 A;  4R87 A;  3KR4 A;  3IEH A;  3EZB A;  1A9X B;  4KOX A;  1LCP A;  1H8L A;  4UA3 A;  5JM6 A;  2ZEE A;  3VWE A;  5F47 A;  3ZJ0 A;  2CNM A;  4M8D A;  4MFL A;  3FEE A;  1SQH A;  2JDC A;  3TLE A;  5C82 A;  2O28 A;  5JQ4 A; 
#chains in the Genus database with same CATH homology
 3ICU A;  4R6T A;  2JBJ A;  1VHO A;  2PVW A;  3RZA A;  2BCO A;  1XMB A;  4A39 A;  2EK8 A;  3FEC A;  1YW4 A;  1R43 A;  2POK A;  1QQ9 A;  2C6P A;  2RFH A;  3PB9 X;  1CBX A;  4WWV A;  3WT4 A;  1ZLH A;  4TNU A;  5I4M A;  5CBM A;  4PQA A;  4C8P A;  4C8U A;  3KHZ A;  2I3C A;  2PIY A;  2C6G A;  4A38 A;  3PB8 X;  1R3N A;  4A37 A;  3NH5 A;  4NJR A;  2V8D A;  4ZX8 A;  2WZN A;  3D7D A;  1LAP A;  5HVG A;  4C9E A;  3T8W A;  1XFO A;  1LFW A;  2VL1 A;  5LRG A;  1TKJ A;  4R8F A;  2IJZ A;  3PFE A;  4MHP A;  4C9A A;  5LYD A;  1XRY A;  3PBB A;  5JH9 A;  2JBK A;  3WC5 A;  1CP6 A;  3WAB A;  1PYT B;  1YLO A;  1DTD A;  4JYW A;  3I1U A;  1Q7L A;  5D8N A;  3ISZ A;  3L2N A;  5JGF A;  4X2T A;  4C8T A;  1TKH A;  1XF1 A;  3MRU A;  4MCR A;  3B7I A;  1YW6 A;  4PXD A;  4P44 A;  4TJX A;  2ZEM A;  2WYR A;  3D7H A;  5K8P A;  4YWY A;  5ELY A;  1IGB A;  5D29 A;  1ZLI A;  4CPA A;  3K2K A;  3GLJ A;  3HLP A;  3B3W A;  3LMS A;  4LQG A;  2RB7 A;  1CPX A;  4MCS A;  2ZOF A;  1VGY A;  2AFO A;  2ZEN A;  3IIB A;  1BLL E;  2PJA A;  3B3V A;  3DLJ A;  1DE4 C;  4DJL A;  2AFS A;  4MHY A;  4R7M A;  4NGM A;  3BI1 A;  3BXM A;  2ZEL A;  1V6C A;  2OR4 A;  4FAI A;  2V8H A;  5HXD A;  2CIJ A;  3SJG A;  4NGN A;  4CDK A;  4IK2 A;  4PXC A;  1TF8 A;  4OIW A;  1HEE A;  4ZY1 A;  2V77 A;  5IB9 A;  4UIB A;  3WC6 A;  4ZY2 A;  4UIA A;  4NGQ A;  2JEW A;  1CP7 A;  4YN3 A;  3H8G A;  1UWY A;  2BOA A;  2ZOG A;  2AFM A;  2PIZ A;  3KAS A;  4P4J A;  2BO9 A;  4K3N A;  2QYV A;  3LWU A;  3NH4 A;  4NFR A;  3PRT A;  1EE3 P;  2QVP A;  2ZEP A;  1F2P A;  3KR5 A;  3VH9 A;  3IWW A;  4BD9 A;  2ZEH A;  2O4H A;  4CDJ A;  3NH8 A;  3B3T A;  3QNV A;  2PRQ A;  3PBE A;  3SI2 A;  4C85 A;  4KNG E;  5LYL A;  2FVG A;  2GP4 A;  4UEE A;  4MMO A;  1Z8L A;  4TWE A;  3RAM A;  2PE3 A;  4F8Z A;  3KI9 A;  3RBU A;  7CPA A;  1ZG7 A;  4C9R A;  1Y0Y A;  4ZYQ A;  1HDQ A;  4FBE A;  5LYF A;  1XJO A;  4WJB A;  4C8A A;  1TKF A;  4ZI6 A;  2PJ2 A;  2PVV A;  2PJB A;  4P4E A;  3N5F A;  4X8I A;  2HB6 A;  2ZEG A;  3IO1 A;  5K8N A;  2ZED A;  2PJ0 A;  3PFO A;  3V38 A;  3GB0 A;  3FJU A;  4O23 A;  4MHN A;  4OC1 A;  3KL9 A;  4ZY0 A;  2PJC A;  4MHZ A;  1LAN A;  5THW A;  4X3R A;  2EK9 A;  2Q4Z A;  4MCP A;  4OC0 A;  4P4I A;  4FUU A;  2C5Q A;  4B6Z A;  1LAM A;  4P10 A;  3SI0 A;  4P45 A;  4OC2 A;  4PPZ A;  2PJ4 A;  5J1Q A;  3B3S A;  2XEJ A;  1IY7 A;  3CPX A;  5CPA A;  4R76 A;  3D68 A;  3ISX A;  2GU2 A;  3S9N A;  4FWU A;  1Y7E A;  3D7G A;  1FT7 A;  2GLJ A;  3NA6 A;  3FX6 A;  2V8G A;  3D4U A;  4UF4 A;  4NGT A;  3B2Y A;  2XEG A;  4OC4 A;  3SJE A;  3D66 A;  3CPA A;  4RUH A;  5IR2 A;  4OME A;  4UEF A;  4NGR A;  2CTB A;  2ZEO A;  1Y0R A;  2ABZ A;  2Q43 A;  1YSJ A;  4MXU A;  1ARL A;  1ELL P;  2PJ5 A;  1XBU A;  4AXV A;  2IMO A;  4PXE A;  1BPN A;  1F2O A;  1TF9 A;  4TJV A;  4C86 A;  2XEI A;  4DUK A;  1ARM A;  3TX8 A;  2IQ6 A;  4C8C A;  4OC3 A;  2G9D A;  1ZG8 A;  4GM5 A;  4EWT A;  2AFX A;  3SI1 A;  3I74 A;  3BI0 A;  4OID A;  3PB6 X;  3HUV A;  3D67 A;  2V8V A;  2NYQ A;  4UEZ A;  4IAV A;  5LRJ A;  2GRE A;  2O53 A;  4C9V A;  3FED A;  2F7V A;  4P4F A;  1ELM P;  3VAR A;  1QMU A;  3PB4 X;  4G1P A;  2DEA A;  2QJ8 A;  3CDX A;  3WC7 A;  3VTA A;  3MN8 A;  4NGP A;  1AYE A;  4EFD A;  2F8H A;  4DYO A;  1KWM A;  3H8E A;  4P4D A;  3KGQ A;  2HC9 A;  2PCU A;  3K9T A;  4F9V A;  5DS0 A;  4IHM A;  4KSI A;  4NJQ A;  3H8F A;  2ANP A;  1NSA A;  3FMC A;  4W9Y A;  3PEI A;  4OC5 A;  4P4B A;  1CX8 A;  2J9A A;  4F9U A;  3KZW A;  1OBR A;  4JZ0 A;  4ONW A;  3CT9 A;  4C99 A;  5HVH A;  3FF3 A;  3I6S A;  4YU9 A;  3KQZ A;  3S9L A;  1FNO A;  3TC8 A;  3SJX A;  3S9M A;  1HDU A;  2AFW A;  1PCA A;  1F57 A;  2GLF A;  3EIF A;  4NGS A;  2PJ9 A;  3DGV A;  2AFU A;  4MRI A;  4Q7A A;  2PJ7 A;  2OOT A;  5LRK A;  3JRU A;  3PB7 X;  1CG2 A;  3IFE A;  3KQX A;  3FH4 A;  4A94 A;  2CTC A;  4EME A;  2Q51 A;  8CPA A;  2NSM A;  1JQG A;  5K8M A;  3IC1 A;  3D7F A;  5F09 A;  1GYT A;  3IJ3 A;  4ZX9 A;  2C1C A;  4Z65 A;  4OP4 A;  4H2K A;  1WVM A;  1ZG9 A;  2CF4 A;  3B3C A;  1AMP A;  5HVF A;  5LYI A;  5K8O A;  1BAV A;  3V7Z A;  2XEF A;  3GUX A;  1Y9Z A;  4C8F A;  2PJ3 A;  3BHX A;  4C9U A;  1M4L A;  3SJF A;  2PJ6 A;  1CPS A;  1BPM A;  1TXR A;  4C84 A;  1LOK A;  3NFZ A;  1YME A;  1RTQ A;  1Z2L A;  3B35 A;  4P6Y A;  4PXB A;  3FVL A;  6CPA A;  2AFZ A;  2PJ1 A;  3VAT A;  3KHX A;  2ZEF A;  1Z5R A;  4MCQ A;  1VIX A;  4OKO A;  1VHE A;  2EWB A;  2C6C A;  2PJ8 A;  3KR4 A;  3IEH A;  1LCP A;  1H8L A;  5JM6 A;  2ZEE A;  3FEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...