4MCPA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyl-gamma-l-glutamic acid (pteroyldi-gamma-l-glutamic acid)
Total Genus 270
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
270
sequence length
695
structure length
692
Chain Sequence
HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 270
structure length 692
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcpA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcpA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcpA02
1Z2LA 5DS0A 4MHPA 2PJ8A 4UEFA 4C84A 2BOAA 2PJ6A 1NSAA 6CPAA 4OC0A 2PJ4A 4RUHA 4C9VA 4W9YA 2IJZA 4OC3A 4FAIA 5D8NA 5LRGA 4IK2A 4UF4A 2AFMA 2XEIA 1LCPA 1Z8LA 3K2KA 2GREA 2GLJA 5CBMA 3SJGA 4C8PA 1KWMA 1YSJA 2PRQA 3WT4A 2JBKA 2IMOA 4NGMA 4JYWA 1TKFA 4P4JA 3FECA 4PXCA 3PB9X 4NGNA 3QNVA 2XEGA 4EFDA 4LQGA 2EK9A 3I1UA 3NH4A 5LYLA 4DUKA 1ZG8A 3FX6A 1GYTA 4C8CA 1BLLE 2ZOGA 1CPSA 4B6ZA 3VTAA 4F8ZA 4MMOA 3IJ3A 2CTBA 4ZYQA 3NA6A 2ZEPA 4ZY1A 3KHZA 2JBJA 4P4FA 4NJRA 4X2TA 4P4DA 4NGPA 4MRIA 5K8OA 1XFOA 1TXRA 2AFZA 3KHXA 2JEWA 3B3VA 2F7VA 4X8IA 3ISZA 3PEIA 3LWUA 3ISXA 5HVFA 4A37A 3CPXA 3SI1A 4CDJA 1Q7LA 4OIWA 4OP4A 2OR4A 4FWUA 2ZEDA 1ELLP 4F9VA 2CF4A 2QVPA 3N5FA 3FMCA 2PJ5A 1BPNA 1Y9ZA 4UIAA 1LAPA 4Q7AA 1CX8A 4P4IA 2I3CA 2PVWA 1FNOA 3B3TA 1OBRA 4X3RA 3CPAA 5LRKA 2VL1A 4A39A 3RZAA 3KR4A 1VGYA 3PBEA 3H8FA 4MCSA 5CPAA 4C99A 1Y0YA 3S9NA 2ZEGA 2ZEEA 3D66A 3K9TA 4FBEA 2ZELA 2XEJA 5ELYA 3T8WA 3H8GA 5LRJA 5I4MA 3L2NA 2J9AA 4MHYA 2G9DA 3B2YA 3KI9A 2DEAA 3HLPA 2V8GA 4P10A 4NGQA 3I6SA 4MCQA 1QQ9A 1Y0RA 2EWBA 3H8EA 4R7MA 1RTQA 1LFWA 2PJCA 4PPZA 1TF9A 1ZLHA 3B35A 5J1QA 1PCAA 4TJVA 3IEHA 1WVMA 3PB6X 4H2KA 4WWVA 2PIYA 1YW6A 3KL9A 2EK8A 1HEEA 3D68A 3BXMA 3B3WA 1R3NA 4F9UA 1AYEA 2IQ6A 3B3CA 1BAVA 3KQXA 4TNUA 8CPAA 3D67A 4NFRA 3ICUA 1BPMA 2PJBA 5HVGA 2RFHA 1TF8A 3WC7A 1HDUA 3PRTA 1XRYA 1H8LA 1VHEA 4PXDA 1TKJA 1IGBA 4G1PA 4YWYA 3PFOA 3B7IA 2QYVA 2ZEOA 3IFEA 3D7GA 5JH9A 4C86A 2PJ3A 3SJXA 1YMEA 2ZOFA 1YW4A 1F57A 3KQZA 4C8AA 2RB7A 2C6GA 2C1CA 4TWEA 4C9EA 5HVHA 5F09A 3FVLA 4P6YA 2BO9A 3PB4X 2PJ1A 1CG2A 1LAMA 2OOTA 4IHMA 3WABA 3HUVA 3NH5A 4UIBA 3MN8A 2V8VA 1CBXA 2PJ0A 4P4EA 3SJEA 1ARMA 4DJLA 3PB7X 4YN3A 3KZWA 4PXBA 4C8TA 2PJ7A 1UWYA 2ANPA 4TJXA 1JQGA 1QMUA 4ZX8A 1LOKA 3BI1A 4CPAA 3DGVA 4GM5A 3FF3A 1Z5RA 2ZEHA 3SI2A 1ZG7A 4OKOA 4OC1A 3IIBA 2WZNA 1V6CA 1VIXA 1CP7A 3KGQA 3S9MA 5D29A 2QJ8A 3RBUA 2AFOA 4YU9A 2O53A 2Q43A 1FT7A 4IAVA 4ZX9A 2PIZA 1ZLIA 2AFXA 1PYTB 3EIFA 1XBUA 3V38A 3FH4A 5LYDA 4BD9A 4ZI6A 3GB0A 4ONWA 1AMPA 3TX8A 3CT9A 3SI0A 2NYQA 3S9LA 3I74A 4EMEA 1XMBA 4O23A 2AFSA 4KSIA 2V8DA 1TKHA 3RAMA 4OC5A 2BCOA 1ZG9A 2PJAA 2F8HA 2AFWA 3GUXA 4JZ0A 4MCPA 3WC6A 4K3NA 1IY7A 2CIJA 1HDQA 7CPAA 4C9UA 3PFEA 3LMSA 3B3SA 5K8MA 3GLJA 3JRUA 3FEDA 1ARLA 4NGSA 4NJQA 3VH9A 2V77A 5THWA 3BI0A 3D7FA 4R6TA 4P4BA 5K8PA 2Q4ZA 4MXUA 3TC8A 4A38A 5HXDA 5K8NA 2PE3A 2ABZA 4EWTA 4OC4A 2O4HA 3VARA 3D7HA 1CPXA 5LYFA 5JGFA 2ZEMA 4C9AA 2PCUA 3BHXA 2NSMA 4MHZA 2FVGA 4KNGE 2GLFA 4ZY0A 1VHOA 3PBBA 1DTDA 3V7ZA 4NGTA 1ELMP 1XF1A 4C8FA 3WC5A 4C9RA 4C85A 3PB8X 2C6CA 1F2PA 3KASA 4CDKA 4FUUA 4Z65A 3SJFA 3DLJA 3MRUA 2HB6A 3IO1A 1XJOA 3D7DA 4MCRA 2PJ2A 4R8FA 3D4UA 2POKA 1M4LA 2CTCA 1F2OA 1CP6A 3FEEA 2XEFA 3NFZA 4C8UA 2V8HA 5JM6A 4MHNA 4AXVA 3KR5A 2ZEFA 2PVVA 3FJUA 2WYRA 1Y7EA 4PQAA 2ZENA 1YLOA 3NH8A 3CDXA 4ZY2A 4PXEA 2GU2A 1LANA 4UEEA 4OIDA 1EE3P 2HC9A 1DE4C 3IWWA 2AFUA 4P44A 1R43A 4DYOA 3IC1A 2PJ9A 3VATA 4OC2A 4P45A 4OMEA 5IB9A 5LYIA 2Q51A 4A94A 4R76A 4NGRA 4UEZA 4WJBA 2C6PA
chains in the Genus database with same CATH superfamily
1Z2LA 2REEA 4R3LA 1NE9A 4MHPA 1Q2YA 2PJ8A 2YGWA 1S60A 3DR8A 4UEFA 2BOAA 2PJ6A 2D0PA 4UCPA 2HI6A 4KZTA 2D4PA 1NSAA 6CPAA 5AXIA 4C2YA 4OC0A 2EBJA 2PJ4A 2FE7A 4B12A 4CRZB 4CRYB 5BWAB 4ONUA 4RUHA 5A27A 4C9VA 3BUXB 3D3SA 4JXRA 2H5MA 1IB1E 4W9YA 1X12A 4XPLA 3EC4A 2IJZA 2VXKA 3OB1B 4OC3A 1EZBA 4FAIA 4NCZA 4BPWB 5D8NA 2P6EA 5GCNA 3LODA 4H6UA 4IK2A 4PSWA 4XNHC 5LRGA 4J3GA 4AVCA 4UFVA 2AFMA 4UF4A 4CGMA 2ATRA 4RN7A 3NE8A 2XEIA 2DPTA 4MJ8A 4PSXA 3PLFB 5J8CA 1LCPA 1Z8LA 1VHSA 2B0AA 3SR3A 3K2KA 2B4DB 2GREA 4A4BA 4C86A 2GLJA 5CBMA 3T5MA 3SJGA 1KUXA 5DWMA 1KWMA 1YSJA 5C82A 4C8PA 2PRQA 4XPDC 3WT4A 4QUSA 1QSNA 1XOVA 2G0BA 3EZBA 4RI1A 4M6GA 4B5PA 2JBKA 5KTAA 2IMOA 5CNPA 4NGMA 2Z3LA 4JYWA 2VBQA 1TKFA 4P4JA 3FECA 4IF5A 4JXQA 3R95A 3BLNA 4PXCA 1Z8TA 4CYOA 1BXRB 3PB9X 4NGNA 3QNVA 5KTDA 2XEGA 4EFDA 4B14A 4LQGA 2EK9A 3F9KC 3I1UA 3NH4A 4M6IA 5FVJA 2B5GA 2PCNA 1M6VB 5LYLA 4E5SA 4YGOA 4DUKA 3TO7A 1RO5A 1ZG8A 1GYTA 3FX6A 2B4JC 3VWDA 1Z8WA 4C8CA 3EO4A 4ORFA 1BLLE 4HNYB 2YNCC 2ZOGA 2J8MA 2B3VA 1CPSA 5F9MA 4B6ZA 3BUOB 3TCVA 3VTAA 3TOAA 4F8ZA 4NXYA 4R3KA 3BUWB 4MMOA 3T0TA 3IJ3A 1M1DA 2R8VA 2CTBA 4Y49B 5AG6A 1I1DA 3JTKA 4ZYQA 3TLAA 2GANA 3SHPA 4EYSA 3JVNA 1YVOA 1RXTA 4U9YA 3NA6A 2ZEPA 1VI4A 3RO0A 4HPSA 3KHZA 4L8AA 1P0HA 4ZY1A 1BOBA 2JBJA 4P4FA 4NJRA 4X2TA 4P4DA 4NGPA 4MRIA 3FXTA 4A32A 3HPHE 5K8OA 1XFOA 4BBHA 4XNHB 2PDOA 1TXRA 3ZJ0A 1CS0B 2CBLA 2VKZG 2AFZA 2VQYA 3KHXA 3IWGA 3TOBA 1C30B 2JEWA 4B5PB 3B3VA 4H1HA 2F7VA 3TLZA 3DNSA 3ISZA 3PEIA 4X8IA 3LWUA 4AG9A 2FIWA 3ISXA 5HVFA 3RYOA 4A37A 4B10A 5JPHA 3CPXA 1XMTA 3SI1A 2Z3PA 3D2PA 1XIXA 1YX0A 1Q7LA 2FCKA 2J8RA 2FS5A 4KOSA 4OIWA 2PR1A 4OP4A 2OR4A 3IGRA 4X5KA 2Q7BA 1GGOA 1YQEA 4FWUA 4L89A 4XPDB 4IUSA 5G1ZA 2ZEDA 3UY5A 2OU2A 3TFYA 2OZGA 3FBUA 1ELLP 4KSFA 4F9VA 1J3LA 1IOFA 2CF4A 2NMTA 1IICA 2N3AB 2QVPA 3G8WA 3JUWA 3N5FA 1KUYA 1MJAA 3FMCA 2PJ5A 3QAYA 4MFQA 1BPNA 1Y9ZA 4UIAA 2BL1A 1LAPA 4Q7AA 1IIDA 2E28A 1CX8A 4P4IA 1FY7A 3BUMB 2I3CA 3HMJG 2PVWA 1FNOA 3B3TA 2X0SA 4GPLB 2EZBA 4CGNA 4MFKA 4BTFA 1OBRA 3P2FA 1GHEA 2JDCA 4X3RA 3CPAA 3CXPA 4U9ZA 5LRKA 2VL1A 3VRNA 1YVKA 4NEXA 4A39A 2I79A 1XE4A 3LD2A 3MGDA 3KR4A 1VGYA 3RZAA 2CNSA 3C26A 4E2AA 3S6HA 4UFXA 3PBEA 3H8FA 4MCSA 5CPAA 2AUNA 1Y0YA 4C99A 3H5ZA 3S9NA 2DXQA 2ZEGA 2ZEEA 2OB0A 5EC4A 1N71A 3D66A 3K9TA 4FBEA 2ZELA 2XEJA 5ELYA 3C8OA 3I9SA 3T8WA 2VEZA 3H8GA 3FIXA 4KLWA 5LRJA 5I4MA 3L2NA 2J9AA 4KS9A 4FD4A 2Z0ZA 4NF1A 5F5XA 4MHYA 4CAVA 2G9DA 5AGEA 4Y49C 2CXAA 3B2YA 4A31A 4K30A 4XPKA 1IYLA 3S6GA 3KI9A 1QSTA 2DEAA 3HLPA 2V8GA 2GE3A 4UCMA 4INJA 4UBRA 4U5YA 3W91A 2ZW6A 1QSRA 4HKFA 2HQYA 2O28A 4NGQA 4P10A 2FSRA 3R9FA 1YVHA 3I6SA 4KOWA 4MCQA 1QQ9A 1Y0RA 2EWBA 1Z9EA 2PC1A 3H8EA 4CYNA 4F6AA 4R7MA 2VI7A 3CXSA 3ZNIA 3T07A 4GXHA 1RTQA 1LFWA 2PJCA 4PPZA 3GKRA 1TF9A 1ZLHA 3B35A 4GS4A 3EY5A 3SXOA 5J1QA 1CM0A 1PCAA 2CNTA 4BINA 5HH1A 2MP0A 2Y0MA 3IEHA 4TJVA 1WVMA 3PB6X 5A28A 2GP4A 4H2KA 4WWVA 2PIYA 1YW6A 5J8FA 3ZZIA 1CE8B 1NSLA 2FXFA 3R9EA 3KL9A 1B6BA 2OH1A 2BUEA 2EK8A 4PK2A 4C7IA 4E94A 3NFQA 3IU2A 5K99A 1HEEA 3D68A 4JVOA 3BXMA 2IL4A 3B3WA 1R3NA 4F9UA 2B58A 3BJ8A 4MY3A 4A95A 1AYEA 2IQ6A 3QAHA 1M4IA 4CGLA 4A4CA 3B8GA 3B3CA 1BAVA 3KQXA 4TNUA 1ZO0A 2P0WA 8CPAA 3D67A 5JYBA 4NFRA 1A9XB 3TO6A 3ICUA 1BPMA 5G21A 3I3GA 2DIKA 2PJBA 2C27A 2OZUA 5HVGA 3OP0A 1ZL0A 3FNCA 2RFHA 5F49A 3OAKA 1TF8A 3WC7A 2XPPA 1HDUA 2QMLA 3PRTA 1FBVA 1XRYA 5F47A 4M85A 1H8LA 1QSMA 2ODFA 4KUAA 1VHEA 3SXNA 4PXDA 2ZXVA 1TKJA 4A33A 2FM4A 4QB9A 1IGBA 2PSWA 4CS0B 1YREA 4G1PA 4COGA 4YWYA 3PFOA 4IIXA 3B7IA 2QYVA 3P2HA 2ZEOA 3IFEA 3D7GA 3NE7A 3DDDA 1Y7RA 3V8IA 4A2ZA 2F5IA 2PJ3A 3KKWA 3U88C 3CXQA 5JH9A 2FL4A 3SJXA 1YMEA 2ZOFA 3O8ZA 3FRMA 1YW4A 4UCNA 2HROA 1F57A 4M3SA 3KQZA 2I00A 4C8AA 3U1BA 2WPWA 2QIRA 2RB7A 4COBA 2C6GA 2C1CA 3TYXA 4ZGYB 4TWEA 1VBGA 1L0CA 1LRZA 4KOUA 3GIUA 1I21A 1QSOA 4LQ6A 4C9EA 4CYPA 5HVHA 5F09A 5J3XA 3VRQA 1Z4EA 3DSBA 3FVLA 3G23A 4P6YA 5JVLA 2BO9A 4C7HA 3T90A 3PB4X 2PJ1A 1CG2A 1LAMA 2CNMA 4B11A 4B5OA 5F48A 2OOTA 3N7ZA 4IHMA 2K5TA 3G3SA 3WABA 1NXJA 3HUVA 3GJZA 3NH5A 5F1YA 4UIBA 1EO0A 2EVNA 3MN8A 1KZFA 4C2ZA 5IX3A 3K4IA 1S7KA 2V8VA 4LUAA 4Q38A 2OLSA 1CBXA 1NMTA 2XPOA 4DNCA 4E0AA 2PJ0A 2B5GB 4P4EA 3SJEA 1ON0A 4R57A 1ARMA 2PRBA 1YGHA 3BUNB 4DJLA 1Q2DA 3PB7X 4YN3A 3GY9A 3KZWA 3T05A 4BPUB 3TLBA 4UWJA 1M4GA 4PXBA 1XEBA 2GFQA 2KCWA 4C8TA 1OZPA 4F0YA 3EZAA 2AE6A 1AUGA 2CY2A 2PJ7A 1DIKA 5F13A 1UWYA 4H6ZA 2ANPA 3LACA 1JQGA 4TJXA 1QMUA 2ZW4A 4ZX8A 4C2XA 3TLGA 3FYNA 1LOKA 3BI1A 1S7NA 4KOXA 1JDBC 4KORA 4CPAA 3DGVA 4GM5A 3FF3A 4PV6A 2RC4A 1MJ9A 2A4NA 4LX9A 1Z5RA 2ZEHA 5BY0A 2R7HA 3SI2A 1ZRSA 1ZG7A 2EUIA 4OKOA 4M8DA 4OC1A 4FD7A 3IIBA 2WZNA 2UV8G 1V6CA 1VIXA 3IU1A 2Y1NA 3TLEA 1CP7A 3KGQA 4PK3A 3PGPA 2ZW7A 4EVYA 3S9MA 5D29A 2QJ8A 2P6GA 2FIAA 2YNEA 4R9MA 4A30A 2D0OA 3RBUA 2AFOA 4KVOE 1Z8XA 4II9A 4YU9A 2O53A 1BO4A 2Q43A 1IYKA 1FT7A 2ZPAA 4IAVA 4ZX9A 2PIZA 1ZLIA 3OWCA 2AFXA 1PYTB 4UA3A 3PT1A 3EIFA 1XBUA 1VKCA 4CAWA 3V38A 3FH4A 5C88A 3D8PA 5EMIA 5LYDA 4BD9A 4ZI6A 3GB0A 4ONWA 1AMPA 3TX8A 4CAEA 3CT9A 4CYQA 3SI0A 2NYQA 3QB8A 3S9LA 2JDDA 1YK3A 3I74A 4AG7A 4EMEA 1EZAA 2HUZA 3TE4A 4JLYA 3VGOA 3T9YA 3EFAA 4MFLA 1XMBA 4O23A 2X7BA 1WWZA 1V0CA 2AFSA 4FD5A 3TTHA 3PFVA 3NOJA 2R1IA 4KSIA 2V8DA 4CZ1A 2Y1MA 4HNWB 4C68A 4I49A 1ZYMA 5FD8A 4CDJA 1TKHA 3RAMA 3TLGB 4OC5A 1WK4A 3K9UA 4CAXA 3F0AA 2BCOA 1ZG9A 3VROA 1JDEA 2PJAA 2F8HA 2AFWA 3GUXA 3VRPA 4JZ0A 4MCPA 5HKZA 2Q4VA 4K3NA 2PR8A 3WC6A 1CJWA 3W6XA 2Q4YA 4J0NA 1IY7A 2QECA 1JWQA 1VBHA 2CIJA 3R96A 2XPLA 1HDQA 1A2ZA 7CPAA 4C9UA 3PFEA 3LMSA 3B3SA 5K8MA 1NBWA 5G22A 4YRHA 3KRVA 3FEDA 1ARLA 2XPNA 2G3AA 4NGSA 1Q2CA 3GLJA 3JRUA 4NJQA 5AG4A 2R82A 3GYAA 3VH9A 2Z3OA 5F46A 5ISVA 5DS0A 2V77A 1B87A 3PZJA 2ZW5A 5H86A 5THWA 2B3UA 4OAEA 1Q5XA 4JD6A 4R87A 1PUAA 3BI0A 4FD6A 5AG7A 1I12A 1MK4A 1M44A 3D7FA 4JWPA 4P4BA 1Z4RA 4R6TA 5E96A 4YFJA 4CO9A 1P4NA 2Q7SA 2Q4ZA 1TIQA 4MXUA 3TC8A 4A38A 5HXDA 3S6FA 4AVBA 5K8PA 2DF5A 4KVME 4ZBGA 1YLEA 4MBUA 5K8NA 1WJTA 2ABZA 2PE3A 4OC4A 2O4HA 4EWTA 2C5QA 3VARA 3VRRA 3D7HA 5IV0A 1CPXA 5LYFA 5JGFA 4Q36A 5HKWA 2ZEMA 3F5BA 1R61A 4C9AA 2PCUA 1SQHA 3BHXA 2NSMA 1Z9UA 4CAFA 5I0CA 4MI4A 2R98A 4MHZA 2FVGA 2YJVA 3EZEA 1KC7A 5G20A 4KNGE 2GLFA 4KSAA 3DR6A 4ZY0A 1XF8A 1VHOA 1YR0A 3PBBA 4H89A 2AJ6A 2JLMA 2Q44A 4MFPA 3TLYA 1DTDA 3EXNA 3RNZA 3V7ZA 3TT2A 4IIYA 4NGTA 1ELMP 4OLLA 1XF1A 3WC5A 4C8FA 1S7LA 1J4JA 1PU9A 3CZXA 4C9RA 4C85A 4B13A 3PB8X 4MFZA 3H4QA 2C6CA 2HV2A 4KUBA 5HKYA 2JEVA 3R9GA 3VWEA 1F2PA 3KASA 5IB0A 4C84A 2DPSA 3E0KA 4JJXA 2Z3KA 4M6HA 2YNCA 1C3OB 4CDKA 2AUMA 4FUUA 4Z65A 2D4OA 3SJFA 3DLJA 1S7FA 3MRUA 2HB6A 4HNXB 2P6FA 1KBLA 1X10A 4CGOA 1XJOA 3D7DA 3IO1A 4MCRA 4KLVA 4MY0A 3W6SA 2PJ2A 2WUUA 2VZYA 3WR7A 4BMHA 2WPXA 5HMNA 5JQ4A 3TLCA 4R8FA 3D4UA 5IR2A 2POKA 1M4LA 1K4JA 1F2OA 2BEIA 2CTCA 1CP6A 3IWEA 3D2MA 2EZCA 2HWGA 2OZHA 2VZZA 2B4BA 3FEEA 2XEFA 3NFZA 4KOTA 5H84A 3A9LA 5KTCA 4C8UA 2V8HA 2REFA 3FB3A 5AG5A 3HPGG 2Q04A 5JM6A 4MJXA 1KUVA 4KOYA 3R1KA 4MHNA 4AXVA 3KR5A 3TO9A 2ZEFA 2J8NA 2Z11A 1KEEB 2PVVA 3FJUA 2YJTA 1Y9KA 1T36B 2Z3NA 1U6MA 2WYRA 1Y7EA 2FT0A 2ZENA 2G3TA 4PQAA 5EBVA 2DLAA 3OB2B 1S5KA 1YLOA 2Z3MA 3CDXA 3NH8A 1IOIA 2YNDA 4E8OA 2GIVA 4KVXA 4ZY2A 4AVAA 2WSAA 4PXEA 4UWIA 4QVTA 1S3ZA 1LANA 2BSWA 2GU2A 4UEEA 3S6KA 4MHDA 4OIDA 5DWNA 4QC6A 2EO8A 4F0XA 2B4DA 4KOVA 4RR2B 4BPXB 1EE3P 1M4DA 2HC9A 4OADA 1DE4C 3IWWA 2AFUA 4P44A 1R57A 1R43A 1Y9WA 1MJBA 2PQ8A 3F8KA 4NSQA 4MI1A 3PP9A 4DYOA 3IC1A 4UFWA 4RS2A 4AB7A 2PJ9A 3VATA 1B47A 4OC2A 4P45A 4OMEA 2Q0YA 4MFJA 1IU8A 4QBJA 5IB9A 5LYIA 2EZAA 2Q51A 2ARHA 4A94A 4CGPA 2Z10A 1UFHA 4R76A 4NGRA 4UEZA 4WJBA 2C6PA 3BJ7A
chains in the Genus database with same CATH topology
1Z2LA 5DS0A 4MHPA 2PJ8A 4UEFA 4C84A 2BOAA 2PJ6A 1NSAA 6CPAA 4OC0A 2PJ4A 4RUHA 4C9VA 4W9YA 2IJZA 4OC3A 4FAIA 5D8NA 5LRGA 4IK2A 4UF4A 2AFMA 2XEIA 1LCPA 1Z8LA 3K2KA 2GREA 2GLJA 5CBMA 3SJGA 4C8PA 1KWMA 1YSJA 2PRQA 3WT4A 2JBKA 2IMOA 4NGMA 4JYWA 1TKFA 4P4JA 3FECA 4PXCA 3PB9X 4NGNA 3QNVA 2XEGA 4EFDA 4LQGA 2EK9A 3I1UA 3NH4A 5LYLA 4DUKA 1ZG8A 3FX6A 1GYTA 4C8CA 1BLLE 2ZOGA 1CPSA 4B6ZA 3VTAA 4F8ZA 4MMOA 3IJ3A 2CTBA 4ZYQA 3NA6A 2ZEPA 4ZY1A 3KHZA 2JBJA 4P4FA 4NJRA 4X2TA 4P4DA 4NGPA 4MRIA 5K8OA 1XFOA 1TXRA 2AFZA 3KHXA 2JEWA 3B3VA 2F7VA 4X8IA 3ISZA 3PEIA 3LWUA 3ISXA 5HVFA 4A37A 3CPXA 3SI1A 4CDJA 1Q7LA 4OIWA 4OP4A 2OR4A 4FWUA 2ZEDA 1ELLP 4F9VA 2CF4A 2QVPA 3N5FA 3FMCA 2PJ5A 1BPNA 1Y9ZA 4UIAA 1LAPA 4Q7AA 1CX8A 4P4IA 2I3CA 2PVWA 1FNOA 3B3TA 1OBRA 4X3RA 3CPAA 5LRKA 2VL1A 4A39A 3RZAA 3KR4A 1VGYA 3PBEA 3H8FA 4MCSA 5CPAA 4C99A 1Y0YA 3S9NA 2ZEGA 2ZEEA 3D66A 3K9TA 4FBEA 2ZELA 2XEJA 5ELYA 3T8WA 3H8GA 5LRJA 5I4MA 3L2NA 2J9AA 4MHYA 2G9DA 3B2YA 3KI9A 2DEAA 3HLPA 2V8GA 4P10A 4NGQA 3I6SA 4MCQA 1QQ9A 1Y0RA 2EWBA 3H8EA 4R7MA 1RTQA 1LFWA 2PJCA 4PPZA 1TF9A 1ZLHA 3B35A 5J1QA 1PCAA 4TJVA 3IEHA 1WVMA 3PB6X 2GP4A 4H2KA 4WWVA 2PIYA 1YW6A 3KL9A 2EK8A 1HEEA 3D68A 3BXMA 3B3WA 1R3NA 4F9UA 1AYEA 2IQ6A 3B3CA 1BAVA 3KQXA 4TNUA 8CPAA 3D67A 4NFRA 3ICUA 1BPMA 2PJBA 5HVGA 2RFHA 1TF8A 3WC7A 1HDUA 3PRTA 1XRYA 1H8LA 1VHEA 4PXDA 1TKJA 1IGBA 4G1PA 4YWYA 3PFOA 3B7IA 2QYVA 2ZEOA 3IFEA 3D7GA 5JH9A 4C86A 2PJ3A 3SJXA 1YMEA 2ZOFA 1YW4A 1F57A 3KQZA 4C8AA 2RB7A 2C6GA 2C1CA 4TWEA 4C9EA 5HVHA 5F09A 3FVLA 4P6YA 2BO9A 3PB4X 2PJ1A 1CG2A 1LAMA 2OOTA 4IHMA 3WABA 3HUVA 3NH5A 4UIBA 3MN8A 2V8VA 1CBXA 2PJ0A 4P4EA 3SJEA 1ARMA 4DJLA 3PB7X 4YN3A 3KZWA 4PXBA 4C8TA 2PJ7A 1UWYA 2ANPA 4TJXA 1JQGA 1QMUA 4ZX8A 1LOKA 3BI1A 4CPAA 3DGVA 4GM5A 3FF3A 1Z5RA 2ZEHA 3SI2A 1ZG7A 4OKOA 4OC1A 3IIBA 2WZNA 1V6CA 1VIXA 1CP7A 3KGQA 3S9MA 5D29A 2QJ8A 3RBUA 2AFOA 4YU9A 2O53A 2Q43A 1FT7A 4IAVA 4ZX9A 2PIZA 1ZLIA 2AFXA 1PYTB 3EIFA 1XBUA 3V38A 3FH4A 5LYDA 4BD9A 4ZI6A 3GB0A 4ONWA 1AMPA 3TX8A 3CT9A 3SI0A 2NYQA 3S9LA 3I74A 4EMEA 1XMBA 4O23A 2AFSA 4KSIA 2V8DA 1TKHA 3RAMA 4OC5A 2BCOA 1ZG9A 2PJAA 2F8HA 2AFWA 3GUXA 4JZ0A 4MCPA 3WC6A 4K3NA 1IY7A 2CIJA 1HDQA 7CPAA 4C9UA 3PFEA 3LMSA 3B3SA 5K8MA 3GLJA 3JRUA 3FEDA 1ARLA 4NGSA 4NJQA 3VH9A 2V77A 5THWA 3BI0A 3D7FA 4R6TA 4P4BA 5K8PA 2Q4ZA 4MXUA 3TC8A 4A38A 5HXDA 5K8NA 2PE3A 2ABZA 4EWTA 4OC4A 2O4HA 2C5QA 3VARA 3D7HA 1CPXA 5LYFA 5JGFA 2ZEMA 4C9AA 2PCUA 3BHXA 2NSMA 4MHZA 2FVGA 4KNGE 2GLFA 4ZY0A 1VHOA 3PBBA 1DTDA 3V7ZA 4NGTA 1ELMP 1XF1A 4C8FA 3WC5A 4C9RA 4C85A 3PB8X 2C6CA 1F2PA 3KASA 4CDKA 4FUUA 4Z65A 3SJFA 3DLJA 3MRUA 2HB6A 3IO1A 1XJOA 3D7DA 4MCRA 2PJ2A 4R8FA 3D4UA 5IR2A 2POKA 1M4LA 2CTCA 1F2OA 1CP6A 3FEEA 2XEFA 3NFZA 4C8UA 2V8HA 5JM6A 4MHNA 4AXVA 3KR5A 2ZEFA 2PVVA 3FJUA 2WYRA 1Y7EA 4PQAA 2ZENA 1YLOA 3NH8A 3CDXA 4ZY2A 4PXEA 2GU2A 1LANA 4UEEA 4OIDA 1EE3P 2HC9A 1DE4C 3IWWA 2AFUA 4P44A 1R43A 4DYOA 3IC1A 2PJ9A 3VATA 4OC2A 4P45A 4OMEA 5IB9A 5LYIA 2Q51A 4A94A 4R76A 4NGRA 4UEZA 4WJBA 2C6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2L A;  5DS0 A;  4MHP A;  2PJ8 A;  4UEF A;  4C84 A;  2BOA A;  2PJ6 A;  1NSA A;  6CPA A;  4OC0 A;  2PJ4 A;  4RUH A;  4C9V A;  4W9Y A;  2IJZ A;  4OC3 A;  4FAI A;  5D8N A;  5LRG A;  4IK2 A;  4UF4 A;  2AFM A;  2XEI A;  1LCP A;  1Z8L A;  3K2K A;  2GRE A;  2GLJ A;  5CBM A;  3SJG A;  4C8P A;  1KWM A;  1YSJ A;  2PRQ A;  3WT4 A;  2JBK A;  2IMO A;  4NGM A;  4JYW A;  1TKF A;  4P4J A;  3FEC A;  4PXC A;  3PB9 X;  4NGN A;  3QNV A;  2XEG A;  4EFD A;  4LQG A;  2EK9 A;  3I1U A;  3NH4 A;  5LYL A;  4DUK A;  1ZG8 A;  3FX6 A;  1GYT A;  4C8C A;  1BLL E;  2ZOG A;  1CPS A;  4B6Z A;  3VTA A;  4F8Z A;  4MMO A;  3IJ3 A;  2CTB A;  4ZYQ A;  3NA6 A;  2ZEP A;  4ZY1 A;  3KHZ A;  2JBJ A;  4P4F A;  4NJR A;  4X2T A;  4P4D A;  4NGP A;  4MRI A;  5K8O A;  1XFO A;  1TXR A;  2AFZ A;  3KHX A;  2JEW A;  3B3V A;  2F7V A;  4X8I A;  3ISZ A;  3PEI A;  3LWU A;  3ISX A;  5HVF A;  4A37 A;  3CPX A;  3SI1 A;  4CDJ A;  1Q7L A;  4OIW A;  4OP4 A;  2OR4 A;  4FWU A;  2ZED A;  1ELL P;  4F9V A;  2CF4 A;  2QVP A;  3N5F A;  3FMC A;  2PJ5 A;  1BPN A;  1Y9Z A;  4UIA A;  1LAP A;  4Q7A A;  1CX8 A;  4P4I A;  2I3C A;  2PVW A;  1FNO A;  3B3T A;  1OBR A;  4X3R A;  3CPA A;  5LRK A;  2VL1 A;  4A39 A;  3RZA A;  3KR4 A;  1VGY A;  3PBE A;  3H8F A;  4MCS A;  5CPA A;  4C99 A;  1Y0Y A;  3S9N A;  2ZEG A;  2ZEE A;  3D66 A;  3K9T A;  4FBE A;  2ZEL A;  2XEJ A;  5ELY A;  3T8W A;  3H8G A;  5LRJ A;  5I4M A;  3L2N A;  2J9A A;  4MHY A;  2G9D A;  3B2Y A;  3KI9 A;  2DEA A;  3HLP A;  2V8G A;  4P10 A;  4NGQ A;  3I6S A;  4MCQ A;  1QQ9 A;  1Y0R A;  2EWB A;  3H8E A;  4R7M A;  1RTQ A;  1LFW A;  2PJC A;  4PPZ A;  1TF9 A;  1ZLH A;  3B35 A;  5J1Q A;  1PCA A;  4TJV A;  3IEH A;  1WVM A;  3PB6 X;  4H2K A;  4WWV A;  2PIY A;  1YW6 A;  3KL9 A;  2EK8 A;  1HEE A;  3D68 A;  3BXM A;  3B3W A;  1R3N A;  4F9U A;  1AYE A;  2IQ6 A;  3B3C A;  1BAV A;  3KQX A;  4TNU A;  8CPA A;  3D67 A;  4NFR A;  3ICU A;  1BPM A;  2PJB A;  5HVG A;  2RFH A;  1TF8 A;  3WC7 A;  1HDU A;  3PRT A;  1XRY A;  1H8L A;  1VHE A;  4PXD A;  1TKJ A;  1IGB A;  4G1P A;  4YWY A;  3PFO A;  3B7I A;  2QYV A;  2ZEO A;  3IFE A;  3D7G A;  5JH9 A;  4C86 A;  2PJ3 A;  3SJX A;  1YME A;  2ZOF A;  1YW4 A;  1F57 A;  3KQZ A;  4C8A A;  2RB7 A;  2C6G A;  2C1C A;  4TWE A;  4C9E A;  5HVH A;  5F09 A;  3FVL A;  4P6Y A;  2BO9 A;  3PB4 X;  2PJ1 A;  1CG2 A;  1LAM A;  2OOT A;  4IHM A;  3WAB A;  3HUV A;  3NH5 A;  4UIB A;  3MN8 A;  2V8V A;  1CBX A;  2PJ0 A;  4P4E A;  3SJE A;  1ARM A;  4DJL A;  3PB7 X;  4YN3 A;  3KZW A;  4PXB A;  4C8T A;  2PJ7 A;  1UWY A;  2ANP A;  4TJX A;  1JQG A;  1QMU A;  4ZX8 A;  1LOK A;  3BI1 A;  4CPA A;  3DGV A;  4GM5 A;  3FF3 A;  1Z5R A;  2ZEH A;  3SI2 A;  1ZG7 A;  4OKO A;  4OC1 A;  3IIB A;  2WZN A;  1V6C A;  1VIX A;  1CP7 A;  3KGQ A;  3S9M A;  5D29 A;  2QJ8 A;  3RBU A;  2AFO A;  4YU9 A;  2O53 A;  2Q43 A;  1FT7 A;  4IAV A;  4ZX9 A;  2PIZ A;  1ZLI A;  2AFX A;  1PYT B;  3EIF A;  1XBU A;  3V38 A;  3FH4 A;  5LYD A;  4BD9 A;  4ZI6 A;  3GB0 A;  4ONW A;  1AMP A;  3TX8 A;  3CT9 A;  3SI0 A;  2NYQ A;  3S9L A;  3I74 A;  4EME A;  1XMB A;  4O23 A;  2AFS A;  4KSI A;  2V8D A;  1TKH A;  3RAM A;  4OC5 A;  2BCO A;  1ZG9 A;  2PJA A;  2F8H A;  2AFW A;  3GUX A;  4JZ0 A;  4MCP A;  3WC6 A;  4K3N A;  1IY7 A;  2CIJ A;  1HDQ A;  7CPA A;  4C9U A;  3PFE A;  3LMS A;  3B3S A;  5K8M A;  3GLJ A;  3JRU A;  3FED A;  1ARL A;  4NGS A;  4NJQ A;  3VH9 A;  2V77 A;  5THW A;  3BI0 A;  3D7F A;  4R6T A;  4P4B A;  5K8P A;  2Q4Z A;  4MXU A;  3TC8 A;  4A38 A;  5HXD A;  5K8N A;  2PE3 A;  2ABZ A;  4EWT A;  4OC4 A;  2O4H A;  3VAR A;  3D7H A;  1CPX A;  5LYF A;  5JGF A;  2ZEM A;  4C9A A;  2PCU A;  3BHX A;  2NSM A;  4MHZ A;  2FVG A;  4KNG E;  2GLF A;  4ZY0 A;  1VHO A;  3PBB A;  1DTD A;  3V7Z A;  4NGT A;  1ELM P;  1XF1 A;  4C8F A;  3WC5 A;  4C9R A;  4C85 A;  3PB8 X;  2C6C A;  1F2P A;  3KAS A;  4CDK A;  4FUU A;  4Z65 A;  3SJF A;  3DLJ A;  3MRU A;  2HB6 A;  3IO1 A;  1XJO A;  3D7D A;  4MCR A;  2PJ2 A;  4R8F A;  3D4U A;  2POK A;  1M4L A;  2CTC A;  1F2O A;  1CP6 A;  3FEE A;  2XEF A;  3NFZ A;  4C8U A;  2V8H A;  5JM6 A;  4MHN A;  4AXV A;  3KR5 A;  2ZEF A;  2PVV A;  3FJU A;  2WYR A;  1Y7E A;  4PQA A;  2ZEN A;  1YLO A;  3NH8 A;  3CDX A;  4ZY2 A;  4PXE A;  2GU2 A;  1LAN A;  4UEE A;  4OID A;  1EE3 P;  2HC9 A;  1DE4 C;  3IWW A;  2AFU A;  4P44 A;  1R43 A;  4DYO A;  3IC1 A;  2PJ9 A;  3VAT A;  4OC2 A;  4P45 A;  4OME A;  5IB9 A;  5LYI A;  2Q51 A;  4A94 A;  4R76 A;  4NGR A;  4UEZ A;  4WJB A;  2C6P A; 
#chains in the Genus database with same CATH topology
 1Z2L A;  2REE A;  4R3L A;  1NE9 A;  4MHP A;  1Q2Y A;  2PJ8 A;  2YGW A;  1S60 A;  3DR8 A;  4UEF A;  2BOA A;  2PJ6 A;  2D0P A;  4UCP A;  2HI6 A;  4KZT A;  2D4P A;  1NSA A;  6CPA A;  5AXI A;  4C2Y A;  4OC0 A;  2EBJ A;  2PJ4 A;  2FE7 A;  4B12 A;  4CRZ B;  4CRY B;  5BWA B;  4ONU A;  4RUH A;  5A27 A;  4C9V A;  3BUX B;  3D3S A;  4JXR A;  2H5M A;  1IB1 E;  4W9Y A;  1X12 A;  4XPL A;  3EC4 A;  2IJZ A;  2VXK A;  3OB1 B;  4OC3 A;  1EZB A;  4FAI A;  4NCZ A;  4BPW B;  5D8N A;  2P6E A;  5GCN A;  3LOD A;  4H6U A;  4IK2 A;  4PSW A;  4XNH C;  5LRG A;  4J3G A;  4AVC A;  4UFV A;  2AFM A;  4UF4 A;  4CGM A;  2ATR A;  4RN7 A;  3NE8 A;  2XEI A;  2DPT A;  4MJ8 A;  4PSX A;  3PLF B;  5J8C A;  1LCP A;  1Z8L A;  1VHS A;  2B0A A;  3SR3 A;  3K2K A;  2B4D B;  2GRE A;  4A4B A;  4C86 A;  2GLJ A;  5CBM A;  3T5M A;  3SJG A;  1KUX A;  5DWM A;  1KWM A;  1YSJ A;  5C82 A;  4C8P A;  2PRQ A;  4XPD C;  3WT4 A;  4QUS A;  1QSN A;  1XOV A;  2G0B A;  3EZB A;  4RI1 A;  4M6G A;  4B5P A;  2JBK A;  5KTA A;  2IMO A;  5CNP A;  4NGM A;  2Z3L A;  4JYW A;  2VBQ A;  1TKF A;  4P4J A;  3FEC A;  4IF5 A;  4JXQ A;  3R95 A;  3BLN A;  4PXC A;  1Z8T A;  4CYO A;  1BXR B;  3PB9 X;  4NGN A;  3QNV A;  5KTD A;  2XEG A;  4EFD A;  4B14 A;  4LQG A;  2EK9 A;  3F9K C;  3I1U A;  3NH4 A;  4M6I A;  5FVJ A;  2B5G A;  2PCN A;  1M6V B;  5LYL A;  4E5S A;  4YGO A;  4DUK A;  3TO7 A;  1RO5 A;  1ZG8 A;  1GYT A;  3FX6 A;  2B4J C;  3VWD A;  1Z8W A;  4C8C A;  3EO4 A;  4ORF A;  1BLL E;  4HNY B;  2YNC C;  2ZOG A;  2J8M A;  2B3V A;  1CPS A;  5F9M A;  4B6Z A;  3BUO B;  3TCV A;  3VTA A;  3TOA A;  4F8Z A;  4NXY A;  4R3K A;  3BUW B;  4MMO A;  3T0T A;  3IJ3 A;  1M1D A;  2R8V A;  2CTB A;  4Y49 B;  5AG6 A;  1I1D A;  3JTK A;  4ZYQ A;  3TLA A;  2GAN A;  3SHP A;  4EYS A;  3JVN A;  1YVO A;  1RXT A;  4U9Y A;  3NA6 A;  2ZEP A;  1VI4 A;  3RO0 A;  4HPS A;  3KHZ A;  4L8A A;  1P0H A;  4ZY1 A;  1BOB A;  2JBJ A;  4P4F A;  4NJR A;  4X2T A;  4P4D A;  4NGP A;  4MRI A;  3FXT A;  4A32 A;  3HPH E;  5K8O A;  1XFO A;  4BBH A;  4XNH B;  2PDO A;  1TXR A;  3ZJ0 A;  1CS0 B;  2CBL A;  2VKZ G;  2AFZ A;  2VQY A;  3KHX A;  3IWG A;  3TOB A;  1C30 B;  2JEW A;  4B5P B;  3B3V A;  4H1H A;  2F7V A;  3TLZ A;  3DNS A;  3ISZ A;  3PEI A;  4X8I A;  3LWU A;  4AG9 A;  2FIW A;  3ISX A;  5HVF A;  3RYO A;  4A37 A;  4B10 A;  5JPH A;  3CPX A;  1XMT A;  3SI1 A;  2Z3P A;  3D2P A;  1XIX A;  1YX0 A;  1Q7L A;  2FCK A;  2J8R A;  2FS5 A;  4KOS A;  4OIW A;  2PR1 A;  4OP4 A;  2OR4 A;  3IGR A;  4X5K A;  2Q7B A;  1GGO A;  1YQE A;  4FWU A;  4L89 A;  4XPD B;  4IUS A;  5G1Z A;  2ZED A;  3UY5 A;  2OU2 A;  3TFY A;  2OZG A;  3FBU A;  1ELL P;  4KSF A;  4F9V A;  1J3L A;  1IOF A;  2CF4 A;  2NMT A;  1IIC A;  2N3A B;  2QVP A;  3G8W A;  3JUW A;  3N5F A;  1KUY A;  1MJA A;  3FMC A;  2PJ5 A;  3QAY A;  4MFQ A;  1BPN A;  1Y9Z A;  4UIA A;  2BL1 A;  1LAP A;  4Q7A A;  1IID A;  2E28 A;  1CX8 A;  4P4I A;  1FY7 A;  3BUM B;  2I3C A;  3HMJ G;  2PVW A;  1FNO A;  3B3T A;  2X0S A;  4GPL B;  2EZB A;  4CGN A;  4MFK A;  4BTF A;  1OBR A;  3P2F A;  1GHE A;  2JDC A;  4X3R A;  3CPA A;  3CXP A;  4U9Z A;  5LRK A;  2VL1 A;  3VRN A;  1YVK A;  4NEX A;  4A39 A;  2I79 A;  1XE4 A;  3LD2 A;  3MGD A;  3KR4 A;  1VGY A;  3RZA A;  2CNS A;  3C26 A;  4E2A A;  3S6H A;  4UFX A;  3PBE A;  3H8F A;  4MCS A;  5CPA A;  2AUN A;  1Y0Y A;  4C99 A;  3H5Z A;  3S9N A;  2DXQ A;  2ZEG A;  2ZEE A;  2OB0 A;  5EC4 A;  1N71 A;  3D66 A;  3K9T A;  4FBE A;  2ZEL A;  2XEJ A;  5ELY A;  3C8O A;  3I9S A;  3T8W A;  2VEZ A;  3H8G A;  3FIX A;  4KLW A;  5LRJ A;  5I4M A;  3L2N A;  2J9A A;  4KS9 A;  4FD4 A;  2Z0Z A;  4NF1 A;  5F5X A;  4MHY A;  4CAV A;  2G9D A;  5AGE A;  4Y49 C;  2CXA A;  3B2Y A;  4A31 A;  4K30 A;  4XPK A;  1IYL A;  3S6G A;  3KI9 A;  1QST A;  2DEA A;  3HLP A;  2V8G A;  2GE3 A;  4UCM A;  4INJ A;  4UBR A;  4U5Y A;  3W91 A;  2ZW6 A;  1QSR A;  4HKF A;  2HQY A;  2O28 A;  4NGQ A;  4P10 A;  2FSR A;  3R9F A;  1YVH A;  3I6S A;  4KOW A;  4MCQ A;  1QQ9 A;  1Y0R A;  2EWB A;  1Z9E A;  2PC1 A;  3H8E A;  4CYN A;  4F6A A;  4R7M A;  2VI7 A;  3CXS A;  3ZNI A;  3T07 A;  4GXH A;  1RTQ A;  1LFW A;  2PJC A;  4PPZ A;  3GKR A;  1TF9 A;  1ZLH A;  3B35 A;  4GS4 A;  3EY5 A;  3SXO A;  5J1Q A;  1CM0 A;  1PCA A;  2CNT A;  4BIN A;  5HH1 A;  2MP0 A;  2Y0M A;  3IEH A;  4TJV A;  1WVM A;  3PB6 X;  5A28 A;  2GP4 A;  4H2K A;  4WWV A;  2PIY A;  1YW6 A;  5J8F A;  3ZZI A;  1CE8 B;  1NSL A;  2FXF A;  3R9E A;  3KL9 A;  1B6B A;  2OH1 A;  2BUE A;  2EK8 A;  4PK2 A;  4C7I A;  4E94 A;  3NFQ A;  3IU2 A;  5K99 A;  1HEE A;  3D68 A;  4JVO A;  3BXM A;  2IL4 A;  3B3W A;  1R3N A;  4F9U A;  2B58 A;  3BJ8 A;  4MY3 A;  4A95 A;  1AYE A;  2IQ6 A;  3QAH A;  1M4I A;  4CGL A;  4A4C A;  3B8G A;  3B3C A;  1BAV A;  3KQX A;  4TNU A;  1ZO0 A;  2P0W A;  8CPA A;  3D67 A;  5JYB A;  4NFR A;  1A9X B;  3TO6 A;  3ICU A;  1BPM A;  5G21 A;  3I3G A;  2DIK A;  2PJB A;  2C27 A;  2OZU A;  5HVG A;  3OP0 A;  1ZL0 A;  3FNC A;  2RFH A;  5F49 A;  3OAK A;  1TF8 A;  3WC7 A;  2XPP A;  1HDU A;  2QML A;  3PRT A;  1FBV A;  1XRY A;  5F47 A;  4M85 A;  1H8L A;  1QSM A;  2ODF A;  4KUA A;  1VHE A;  3SXN A;  4PXD A;  2ZXV A;  1TKJ A;  4A33 A;  2FM4 A;  4QB9 A;  1IGB A;  2PSW A;  4CS0 B;  1YRE A;  4G1P A;  4COG A;  4YWY A;  3PFO A;  4IIX A;  3B7I A;  2QYV A;  3P2H A;  2ZEO A;  3IFE A;  3D7G A;  3NE7 A;  3DDD A;  1Y7R A;  3V8I A;  4A2Z A;  2F5I A;  2PJ3 A;  3KKW A;  3U88 C;  3CXQ A;  5JH9 A;  2FL4 A;  3SJX A;  1YME A;  2ZOF A;  3O8Z A;  3FRM A;  1YW4 A;  4UCN A;  2HRO A;  1F57 A;  4M3S A;  3KQZ A;  2I00 A;  4C8A A;  3U1B A;  2WPW A;  2QIR A;  2RB7 A;  4COB A;  2C6G A;  2C1C A;  3TYX A;  4ZGY B;  4TWE A;  1VBG A;  1L0C A;  1LRZ A;  4KOU A;  3GIU A;  1I21 A;  1QSO A;  4LQ6 A;  4C9E A;  4CYP A;  5HVH A;  5F09 A;  5J3X A;  3VRQ A;  1Z4E A;  3DSB A;  3FVL A;  3G23 A;  4P6Y A;  5JVL A;  2BO9 A;  4C7H A;  3T90 A;  3PB4 X;  2PJ1 A;  1CG2 A;  1LAM A;  2CNM A;  4B11 A;  4B5O A;  5F48 A;  2OOT A;  3N7Z A;  4IHM A;  2K5T A;  3G3S A;  3WAB A;  1NXJ A;  3HUV A;  3GJZ A;  3NH5 A;  5F1Y A;  4UIB A;  1EO0 A;  2EVN A;  3MN8 A;  1KZF A;  4C2Z A;  5IX3 A;  3K4I A;  1S7K A;  2V8V A;  4LUA A;  4Q38 A;  2OLS A;  1CBX A;  1NMT A;  2XPO A;  4DNC A;  4E0A A;  2PJ0 A;  2B5G B;  4P4E A;  3SJE A;  1ON0 A;  4R57 A;  1ARM A;  2PRB A;  1YGH A;  3BUN B;  4DJL A;  1Q2D A;  3PB7 X;  4YN3 A;  3GY9 A;  3KZW A;  3T05 A;  4BPU B;  3TLB A;  4UWJ A;  1M4G A;  4PXB A;  1XEB A;  2GFQ A;  2KCW A;  4C8T A;  1OZP A;  4F0Y A;  3EZA A;  2AE6 A;  1AUG A;  2CY2 A;  2PJ7 A;  1DIK A;  5F13 A;  1UWY A;  4H6Z A;  2ANP A;  3LAC A;  1JQG A;  4TJX A;  1QMU A;  2ZW4 A;  4ZX8 A;  4C2X A;  3TLG A;  3FYN A;  1LOK A;  3BI1 A;  1S7N A;  4KOX A;  1JDB C;  4KOR A;  4CPA A;  3DGV A;  4GM5 A;  3FF3 A;  4PV6 A;  2RC4 A;  1MJ9 A;  2A4N A;  4LX9 A;  1Z5R A;  2ZEH A;  5BY0 A;  2R7H A;  3SI2 A;  1ZRS A;  1ZG7 A;  2EUI A;  4OKO A;  4M8D A;  4OC1 A;  4FD7 A;  3IIB A;  2WZN A;  2UV8 G;  1V6C A;  1VIX A;  3IU1 A;  2Y1N A;  3TLE A;  1CP7 A;  3KGQ A;  4PK3 A;  3PGP A;  2ZW7 A;  4EVY A;  3S9M A;  5D29 A;  2QJ8 A;  2P6G A;  2FIA A;  2YNE A;  4R9M A;  4A30 A;  2D0O A;  3RBU A;  2AFO A;  4KVO E;  1Z8X A;  4II9 A;  4YU9 A;  2O53 A;  1BO4 A;  2Q43 A;  1IYK A;  1FT7 A;  2ZPA A;  4IAV A;  4ZX9 A;  2PIZ A;  1ZLI A;  3OWC A;  2AFX A;  1PYT B;  4UA3 A;  3PT1 A;  3EIF A;  1XBU A;  1VKC A;  4CAW A;  3V38 A;  3FH4 A;  5C88 A;  3D8P A;  5EMI A;  5LYD A;  4BD9 A;  4ZI6 A;  3GB0 A;  4ONW A;  1AMP A;  3TX8 A;  4CAE A;  3CT9 A;  4CYQ A;  3SI0 A;  2NYQ A;  3QB8 A;  3S9L A;  2JDD A;  1YK3 A;  3I74 A;  4AG7 A;  4EME A;  1EZA A;  2HUZ A;  3TE4 A;  4JLY A;  3VGO A;  3T9Y A;  3EFA A;  4MFL A;  1XMB A;  4O23 A;  2X7B A;  1WWZ A;  1V0C A;  2AFS A;  4FD5 A;  3TTH A;  3PFV A;  3NOJ A;  2R1I A;  4KSI A;  2V8D A;  4CZ1 A;  2Y1M A;  4HNW B;  4C68 A;  4I49 A;  1ZYM A;  5FD8 A;  4CDJ A;  1TKH A;  3RAM A;  3TLG B;  4OC5 A;  1WK4 A;  3K9U A;  4CAX A;  3F0A A;  2BCO A;  1ZG9 A;  3VRO A;  1JDE A;  2PJA A;  2F8H A;  2AFW A;  3GUX A;  3VRP A;  4JZ0 A;  4MCP A;  5HKZ A;  2Q4V A;  4K3N A;  2PR8 A;  3WC6 A;  1CJW A;  3W6X A;  2Q4Y A;  4J0N A;  1IY7 A;  2QEC A;  1JWQ A;  1VBH A;  2CIJ A;  3R96 A;  2XPL A;  1HDQ A;  1A2Z A;  7CPA A;  4C9U A;  3PFE A;  3LMS A;  3B3S A;  5K8M A;  1NBW A;  5G22 A;  4YRH A;  3KRV A;  3FED A;  1ARL A;  2XPN A;  2G3A A;  4NGS A;  1Q2C A;  3GLJ A;  3JRU A;  4NJQ A;  5AG4 A;  2R82 A;  3GYA A;  3VH9 A;  2Z3O A;  5F46 A;  5ISV A;  5DS0 A;  2V77 A;  1B87 A;  3PZJ A;  2ZW5 A;  5H86 A;  5THW A;  2B3U A;  4OAE A;  1Q5X A;  4JD6 A;  4R87 A;  1PUA A;  3BI0 A;  4FD6 A;  5AG7 A;  1I12 A;  1MK4 A;  1M44 A;  3D7F A;  4JWP A;  4P4B A;  1Z4R A;  4R6T A;  5E96 A;  4YFJ A;  4CO9 A;  1P4N A;  2Q7S A;  2Q4Z A;  1TIQ A;  4MXU A;  3TC8 A;  4A38 A;  5HXD A;  3S6F A;  4AVB A;  5K8P A;  2DF5 A;  4KVM E;  4ZBG A;  1YLE A;  4MBU A;  5K8N A;  1WJT A;  2ABZ A;  2PE3 A;  4OC4 A;  2O4H A;  4EWT A;  2C5Q A;  3VAR A;  3VRR A;  3D7H A;  5IV0 A;  1CPX A;  5LYF A;  5JGF A;  4Q36 A;  5HKW A;  2ZEM A;  3F5B A;  1R61 A;  4C9A A;  2PCU A;  1SQH A;  3BHX A;  2NSM A;  1Z9U A;  4CAF A;  5I0C A;  4MI4 A;  2R98 A;  4MHZ A;  2FVG A;  2YJV A;  3EZE A;  1KC7 A;  5G20 A;  4KNG E;  2GLF A;  4KSA A;  3DR6 A;  4ZY0 A;  1XF8 A;  1VHO A;  1YR0 A;  3PBB A;  4H89 A;  2AJ6 A;  2JLM A;  2Q44 A;  4MFP A;  3TLY A;  1DTD A;  3EXN A;  3RNZ A;  3V7Z A;  3TT2 A;  4IIY A;  4NGT A;  1ELM P;  4OLL A;  1XF1 A;  3WC5 A;  4C8F A;  1S7L A;  1J4J A;  1PU9 A;  3CZX A;  4C9R A;  4C85 A;  4B13 A;  3PB8 X;  4MFZ A;  3H4Q A;  2C6C A;  2HV2 A;  4KUB A;  5HKY A;  2JEV A;  3R9G A;  3VWE A;  1F2P A;  3KAS A;  5IB0 A;  4C84 A;  2DPS A;  3E0K A;  4JJX A;  2Z3K A;  4M6H A;  2YNC A;  1C3O B;  4CDK A;  2AUM A;  4FUU A;  4Z65 A;  2D4O A;  3SJF A;  3DLJ A;  1S7F A;  3MRU A;  2HB6 A;  4HNX B;  2P6F A;  1KBL A;  1X10 A;  4CGO A;  1XJO A;  3D7D A;  3IO1 A;  4MCR A;  4KLV A;  4MY0 A;  3W6S A;  2PJ2 A;  2WUU A;  2VZY A;  3WR7 A;  4BMH A;  2WPX A;  5HMN A;  5JQ4 A;  3TLC A;  4R8F A;  3D4U A;  5IR2 A;  2POK A;  1M4L A;  1K4J A;  1F2O A;  2BEI A;  2CTC A;  1CP6 A;  3IWE A;  3D2M A;  2EZC A;  2HWG A;  2OZH A;  2VZZ A;  2B4B A;  3FEE A;  2XEF A;  3NFZ A;  4KOT A;  5H84 A;  3A9L A;  5KTC A;  4C8U A;  2V8H A;  2REF A;  3FB3 A;  5AG5 A;  3HPG G;  2Q04 A;  5JM6 A;  4MJX A;  1KUV A;  4KOY A;  3R1K A;  4MHN A;  4AXV A;  3KR5 A;  3TO9 A;  2ZEF A;  2J8N A;  2Z11 A;  1KEE B;  2PVV A;  3FJU A;  2YJT A;  1Y9K A;  1T36 B;  2Z3N A;  1U6M A;  2WYR A;  1Y7E A;  2FT0 A;  2ZEN A;  2G3T A;  4PQA A;  5EBV A;  2DLA A;  3OB2 B;  1S5K A;  1YLO A;  2Z3M A;  3CDX A;  3NH8 A;  1IOI A;  2YND A;  4E8O A;  2GIV A;  4KVX A;  4ZY2 A;  4AVA A;  2WSA A;  4PXE A;  4UWI A;  4QVT A;  1S3Z A;  1LAN A;  2BSW A;  2GU2 A;  4UEE A;  3S6K A;  4MHD A;  4OID A;  5DWN A;  4QC6 A;  2EO8 A;  4F0X A;  2B4D A;  4KOV A;  4RR2 B;  4BPX B;  1EE3 P;  1M4D A;  2HC9 A;  4OAD A;  1DE4 C;  3IWW A;  2AFU A;  4P44 A;  1R57 A;  1R43 A;  1Y9W A;  1MJB A;  2PQ8 A;  3F8K A;  4NSQ A;  4MI1 A;  3PP9 A;  4DYO A;  3IC1 A;  4UFW A;  4RS2 A;  4AB7 A;  2PJ9 A;  3VAT A;  1B47 A;  4OC2 A;  4P45 A;  4OME A;  2Q0Y A;  4MFJ A;  1IU8 A;  4QBJ A;  5IB9 A;  5LYI A;  2EZA A;  2Q51 A;  2ARH A;  4A94 A;  4CGP A;  2Z10 A;  1UFH A;  4R76 A;  4NGR A;  4UEZ A;  4WJB A;  2C6P A;  3BJ7 A; 
#chains in the Genus database with same CATH homology
 1Z2L A;  5DS0 A;  4MHP A;  2PJ8 A;  4UEF A;  4C84 A;  2BOA A;  2PJ6 A;  1NSA A;  6CPA A;  4OC0 A;  2PJ4 A;  4RUH A;  4C9V A;  4W9Y A;  2IJZ A;  4OC3 A;  4FAI A;  5D8N A;  5LRG A;  4IK2 A;  4UF4 A;  2AFM A;  2XEI A;  1LCP A;  1Z8L A;  3K2K A;  2GRE A;  2GLJ A;  5CBM A;  3SJG A;  4C8P A;  1KWM A;  1YSJ A;  2PRQ A;  3WT4 A;  2JBK A;  2IMO A;  4NGM A;  4JYW A;  1TKF A;  4P4J A;  3FEC A;  4PXC A;  3PB9 X;  4NGN A;  3QNV A;  2XEG A;  4EFD A;  4LQG A;  2EK9 A;  3I1U A;  3NH4 A;  5LYL A;  4DUK A;  1ZG8 A;  3FX6 A;  1GYT A;  4C8C A;  1BLL E;  2ZOG A;  1CPS A;  4B6Z A;  3VTA A;  4F8Z A;  4MMO A;  3IJ3 A;  2CTB A;  4ZYQ A;  3NA6 A;  2ZEP A;  4ZY1 A;  3KHZ A;  2JBJ A;  4P4F A;  4NJR A;  4X2T A;  4P4D A;  4NGP A;  4MRI A;  5K8O A;  1XFO A;  1TXR A;  2AFZ A;  3KHX A;  2JEW A;  3B3V A;  2F7V A;  4X8I A;  3ISZ A;  3PEI A;  3LWU A;  3ISX A;  5HVF A;  4A37 A;  3CPX A;  3SI1 A;  4CDJ A;  1Q7L A;  4OIW A;  4OP4 A;  2OR4 A;  4FWU A;  2ZED A;  1ELL P;  4F9V A;  2CF4 A;  2QVP A;  3N5F A;  3FMC A;  2PJ5 A;  1BPN A;  1Y9Z A;  4UIA A;  1LAP A;  4Q7A A;  1CX8 A;  4P4I A;  2I3C A;  2PVW A;  1FNO A;  3B3T A;  1OBR A;  4X3R A;  3CPA A;  5LRK A;  2VL1 A;  4A39 A;  3RZA A;  3KR4 A;  1VGY A;  3PBE A;  3H8F A;  4MCS A;  5CPA A;  4C99 A;  1Y0Y A;  3S9N A;  2ZEG A;  2ZEE A;  3D66 A;  3K9T A;  4FBE A;  2ZEL A;  2XEJ A;  5ELY A;  3T8W A;  3H8G A;  5LRJ A;  5I4M A;  3L2N A;  2J9A A;  4MHY A;  2G9D A;  3B2Y A;  3KI9 A;  2DEA A;  3HLP A;  2V8G A;  4P10 A;  4NGQ A;  3I6S A;  4MCQ A;  1QQ9 A;  1Y0R A;  2EWB A;  3H8E A;  4R7M A;  1RTQ A;  1LFW A;  2PJC A;  4PPZ A;  1TF9 A;  1ZLH A;  3B35 A;  5J1Q A;  1PCA A;  4TJV A;  3IEH A;  1WVM A;  3PB6 X;  2GP4 A;  4H2K A;  4WWV A;  2PIY A;  1YW6 A;  3KL9 A;  2EK8 A;  1HEE A;  3D68 A;  3BXM A;  3B3W A;  1R3N A;  4F9U A;  1AYE A;  2IQ6 A;  3B3C A;  1BAV A;  3KQX A;  4TNU A;  8CPA A;  3D67 A;  4NFR A;  3ICU A;  1BPM A;  2PJB A;  5HVG A;  2RFH A;  1TF8 A;  3WC7 A;  1HDU A;  3PRT A;  1XRY A;  1H8L A;  1VHE A;  4PXD A;  1TKJ A;  1IGB A;  4G1P A;  4YWY A;  3PFO A;  3B7I A;  2QYV A;  2ZEO A;  3IFE A;  3D7G A;  5JH9 A;  4C86 A;  2PJ3 A;  3SJX A;  1YME A;  2ZOF A;  1YW4 A;  1F57 A;  3KQZ A;  4C8A A;  2RB7 A;  2C6G A;  2C1C A;  4TWE A;  4C9E A;  5HVH A;  5F09 A;  3FVL A;  4P6Y A;  2BO9 A;  3PB4 X;  2PJ1 A;  1CG2 A;  1LAM A;  2OOT A;  4IHM A;  3WAB A;  3HUV A;  3NH5 A;  4UIB A;  3MN8 A;  2V8V A;  1CBX A;  2PJ0 A;  4P4E A;  3SJE A;  1ARM A;  4DJL A;  3PB7 X;  4YN3 A;  3KZW A;  4PXB A;  4C8T A;  2PJ7 A;  1UWY A;  2ANP A;  4TJX A;  1JQG A;  1QMU A;  4ZX8 A;  1LOK A;  3BI1 A;  4CPA A;  3DGV A;  4GM5 A;  3FF3 A;  1Z5R A;  2ZEH A;  3SI2 A;  1ZG7 A;  4OKO A;  4OC1 A;  3IIB A;  2WZN A;  1V6C A;  1VIX A;  1CP7 A;  3KGQ A;  3S9M A;  5D29 A;  2QJ8 A;  3RBU A;  2AFO A;  4YU9 A;  2O53 A;  2Q43 A;  1FT7 A;  4IAV A;  4ZX9 A;  2PIZ A;  1ZLI A;  2AFX A;  1PYT B;  3EIF A;  1XBU A;  3V38 A;  3FH4 A;  5LYD A;  4BD9 A;  4ZI6 A;  3GB0 A;  4ONW A;  1AMP A;  3TX8 A;  3CT9 A;  3SI0 A;  2NYQ A;  3S9L A;  3I74 A;  4EME A;  1XMB A;  4O23 A;  2AFS A;  4KSI A;  2V8D A;  1TKH A;  3RAM A;  4OC5 A;  2BCO A;  1ZG9 A;  2PJA A;  2F8H A;  2AFW A;  3GUX A;  4JZ0 A;  4MCP A;  3WC6 A;  4K3N A;  1IY7 A;  2CIJ A;  1HDQ A;  7CPA A;  4C9U A;  3PFE A;  3LMS A;  3B3S A;  5K8M A;  3GLJ A;  3JRU A;  3FED A;  1ARL A;  4NGS A;  4NJQ A;  3VH9 A;  2V77 A;  5THW A;  3BI0 A;  3D7F A;  4R6T A;  4P4B A;  5K8P A;  2Q4Z A;  4MXU A;  3TC8 A;  4A38 A;  5HXD A;  5K8N A;  2PE3 A;  2ABZ A;  4EWT A;  4OC4 A;  2O4H A;  2C5Q A;  3VAR A;  3D7H A;  1CPX A;  5LYF A;  5JGF A;  2ZEM A;  4C9A A;  2PCU A;  3BHX A;  2NSM A;  4MHZ A;  2FVG A;  4KNG E;  2GLF A;  4ZY0 A;  1VHO A;  3PBB A;  1DTD A;  3V7Z A;  4NGT A;  1ELM P;  1XF1 A;  4C8F A;  3WC5 A;  4C9R A;  4C85 A;  3PB8 X;  2C6C A;  1F2P A;  3KAS A;  4CDK A;  4FUU A;  4Z65 A;  3SJF A;  3DLJ A;  3MRU A;  2HB6 A;  3IO1 A;  1XJO A;  3D7D A;  4MCR A;  2PJ2 A;  4R8F A;  3D4U A;  5IR2 A;  2POK A;  1M4L A;  2CTC A;  1F2O A;  1CP6 A;  3FEE A;  2XEF A;  3NFZ A;  4C8U A;  2V8H A;  5JM6 A;  4MHN A;  4AXV A;  3KR5 A;  2ZEF A;  2PVV A;  3FJU A;  2WYR A;  1Y7E A;  4PQA A;  2ZEN A;  1YLO A;  3NH8 A;  3CDX A;  4ZY2 A;  4PXE A;  2GU2 A;  1LAN A;  4UEE A;  4OID A;  1EE3 P;  2HC9 A;  1DE4 C;  3IWW A;  2AFU A;  4P44 A;  1R43 A;  4DYO A;  3IC1 A;  2PJ9 A;  3VAT A;  4OC2 A;  4P45 A;  4OME A;  5IB9 A;  5LYI A;  2Q51 A;  4A94 A;  4R76 A;  4NGR A;  4UEZ A;  4WJB A;  2C6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...