4MCPA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) in complex with folyl-gamma-l-glutamic acid (pteroyldi-gamma-l-glutamic acid)
Total Genus 270
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
270
sequence length
695
structure length
692
Chain Sequence
b'HNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAAEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 270
structure length 692
sequence length 695
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcpA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcpA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcpA02
1EE3P 5LYDA 2GREA 4MHNA 4OC0A 4G1PA 4MHYA 3PB4X 3KHXA 5K8MA 3RAMA 3H8FA 2ZENA 4A39A 3SJFA 3V7ZA 1TKJA 2WZNA 4JYWA 3VATA 3D7FA 4A38A 1ELMP 4Q7AA 3KR4A 6CPAA 4H2KA 4NGQA 1CP6A 1ZLHA 1Q7LA 1DTDA 3FEDA 1Y0YA 2F7VA 3ISZA 2PE3A 1KWMA 5K8NA 3SI0A 3B3SA 4PXBA 1LAPA 4FAIA 2C1CA 4MCQA 1LAMA 4ONWA 2HC9A 1CPSA 3CPAA 4OC4A 4R76A 4UF4A 4MCSA 3MN8A 4GM5A 3WT4A 1RTQA 2PRQA 5LRJA 2C6GA 2RB7A 2GLJA 1ARLA 1AYEA 4OC2A 4ZYQA 4NGNA 3HUVA 2PJ5A 4C8CA 3IC1A 2V8GA 3PBBA 3PRTA 4MXUA 3D67A 2PJ1A 3BI1A 4OIDA 1XRYA 5CBMA 2ZOGA 3S9MA 3B3CA 2C6PA 2XEFA 3I1UA 3JRUA 3WC5A 4MHZA 1VHOA 2RFHA 4C99A 2V77A 4MCRA 2GU2A 8CPAA 5K8OA 4W9YA 4P10A 5HVGA 3D68A 4B6ZA 3KASA 4C9AA 2ZEDA 1FT7A 4YWYA 3DGVA 1TF9A 2AFMA 3SJXA 3VTAA 1GYTA 4AXVA 5HVFA 4TJVA 2ANPA 4IK2A 2PJAA 4IHMA 1WVMA 3FX6A 2NYQA 4NGSA 2GLFA 4PXEA 4O23A 4KNGE 5JM6A 1CPXA 3B3VA 3IIBA 5LYIA 1CP7A 1HDQA 3SJGA 4X3RA 5LYLA 1Z8LA 3PEIA 1VHEA 3PB7X 5D8NA 4P45A 4PQAA 1ZG9A 1QMUA 4F8ZA 3KQXA 4R6TA 2O53A 2ZEHA 4NGRA 1BPNA 2OR4A 1F2PA 2AFUA 3EIFA 3FMCA 2IMOA 4NJRA 3DLJA 3KL9A 1OBRA 4P4FA 1NSAA 2I3CA 1ZLIA 4OC3A 1CG2A 1V6CA 2ABZA 1CX8A 3B35A 3PB8X 3B3WA 3FF3A 4UIBA 2EK8A 1VIXA 4UIAA 2BOAA 1PCAA 1XJOA 2QVPA 4C8TA 2V8VA 4CDKA 3PB6X 4PXCA 1LANA 2IJZA 4BD9A 4DYOA 5LYFA 4CPAA 2C6CA 3VH9A 2PIYA 4OIWA 4EMEA 1JQGA 2FVGA 4ZY1A 4C9EA 1ZG8A 2NSMA 3GB0A 2PIZA 2J9AA 4YU9A 5DS0A 4OKOA 2WYRA 7CPAA 2IQ6A 1BPMA 2ZEEA 4IAVA 3IEHA 2PVVA 1M4LA 4MHPA 3WABA 1YW6A 2PJ2A 3SI1A 1QQ9A 1Y0RA 3K9TA 3WC6A 4RUHA 1F2OA 2EWBA 5CPAA 4ZI6A 3B2YA 3GUXA 2AFXA 4TWEA 2ZEPA 4KSIA 4OMEA 3BXMA 3D66A 3RBUA 3I74A 2PJ8A 2PVWA 4NGMA 1HEEA 1YMEA 2PJ9A 2AFSA 4P6YA 2ZEMA 2Q4ZA 3RZAA 2AFWA 3SI2A 3CDXA 3SJEA 4C86A 3VARA 5LRKA 4OC1A 3KR5A 4FWUA 4C85A 4CDJA 3NH4A 4NJQA 1Y9ZA 4DJLA 3KI9A 3PFEA 2BO9A 3GLJA 4ZY2A 5D29A 1IGBA 1R43A 3D7HA 4OC5A 3S9LA 4P4JA 3B7IA 4PXDA 4P44A 2PJCA 4UEZA 1YW4A 3LMSA 3HLPA 1FNOA 3NFZA 2POKA 1Z5RA 1PYTB 2CF4A 4WWVA 4X8IA 2PCUA 3D4UA 3IJ3A 2DEAA 1TKFA 4PPZA 4NGPA 2BCOA 5I4MA 1AMPA 1YLOA 1LCPA 2AFZA 2PJ0A 3FECA 1ARMA 3B3TA 4C8UA 3BHXA 4NFRA 3KGQA 4P4IA 1Z2LA 4X2TA 2PJ6A 3V38A 3NA6A 4DUKA 3FEEA 3ISXA 3CPXA 2G9DA 2ZEOA 4FUUA 3KQZA 4P4DA 4ZX9A 4NGTA 2F8HA 3TC8A 2XEGA 2CTBA 3D7GA 2PJ4A 4R8FA 4P4EA 4P4BA 3PBEA 3FJUA 4TJXA 5JGFA 4YN3A 2V8DA 1DE4C 4K3NA 4JZ0A 1XFOA 1BLLE 2QJ8A 4C8AA 2O4HA 4F9VA 4C8PA 3I6SA 4C8FA 2CTCA 4C9UA 3IO1A 2JBKA 2Q51A 4UEEA 4C84A 4C9VA 4MCPA 2QYVA 1TXRA 1BAVA 5IB9A 4WJBA 1Y7EA 2V8HA 4ZX8A 2EK9A 4LQGA 1XF1A 1R3NA 4TNUA 3IWWA 3WC7A 1TKHA 3KHZA 5HVHA 4MRIA 3S9NA 2PJ7A 3LWUA 3KZWA 1YSJA 2Q43A 1ELLP 5K8PA 2AFOA 3NH5A 4EFDA 1ZG7A 3D7DA 4MMOA 2OOTA 3NH8A 1VGYA 1H8LA 2HB6A 5ELYA 2JBJA 3BI0A 2VL1A 4F9UA 1TF8A 5F09A 5J1QA 3ICUA 5HXDA 3QNVA 4A94A 2PJBA 1XMBA 3PB9X 2ZELA 4R7MA 4FBEA 1CBXA 1IY7A 5JH9A 3K2KA 2XEJA 1F57A 4OP4A 4ZY0A 5LRGA 2XEIA 4UEFA 3TX8A 3MRUA 3FH4A 1XBUA 3FVLA 3CT9A 3N5FA 2PJ3A 1LFWA 1LOKA 4Z65A 2JEWA 4C9RA 3IFEA 2ZEGA 5THWA 4A37A 3H8EA 3T8WA 3H8GA 2ZEFA 4EWTA 1UWYA 2ZOFA 1HDUA 3L2NA 3PFOA 2CIJA
chains in the Genus database with same CATH superfamily
1EE3P 5LYDA 3W91A 4GPLB 2GREA 5BWAB 4MHNA 4OC0A 4G1PA 4MHYA 3BJ8A 2DXQA 4L8AA 2WPXA 1I21A 3PB4X 3KHXA 4A32A 1TIQA 5K8MA 3RAMA 4AB7A 3H8FA 2CY2A 4QVTA 5EC4A 2HQYA 2ZENA 4A39A 2R98A 4FD6A 3SJFA 1P4NA 3V7ZA 5F5XA 1TKJA 2WZNA 2Y0MA 3U1BA 3P2HA 1KBLA 1J3LA 4JYWA 3VATA 2B5GA 3D7FA 3TLGB 4A38A 1ELMP 2Z3KA 4Q7AA 3KR4A 4H89A 3TO9A 6CPAA 4H2KA 3VRRA 2B0AA 4NGQA 1CP6A 5AGEA 1NSLA 1ZLHA 1Q7LA 4BMHA 1NBWA 1DTDA 1S3ZA 3FEDA 1Y0YA 1Q2YA 1MK4A 2F7VA 3ISZA 5HMNA 2PE3A 1KWMA 5K8NA 1IOFA 3SI0A 3B3SA 4PXBA 1C30B 4EYSA 1LAPA 4CGMA 2R7HA 4FAIA 2Y1NA 2C1CA 2REFA 4CAXA 1BXRB 4MCQA 1LAMA 4IUSA 4J3GA 4ONWA 2HC9A 1CPSA 3CPAA 1DIKA 1Z9UA 2J8NA 4OC4A 2R8VA 4R76A 2Q44A 2XPOA 3RO0A 1Y9WA 3A9LA 2EVNA 3DNSA 1BO4A 4UF4A 4MCSA 3MN8A 3TOBA 3UY5A 4CGPA 4GM5A 4KOYA 3EZEA 3WT4A 1RTQA 2PRQA 5LRJA 3OB2B 1PUAA 2C6GA 2RB7A 3HPHE 3B8GA 1M4IA 2A4NA 2GLJA 4HPSA 1ARLA 1AYEA 4OC2A 1XEBA 2P6GA 2Z10A 3LACA 5HKYA 4ZYQA 4NGNA 3FB3A 3HUVA 2BEIA 3T0TA 3R95A 4ONUA 1A9XB 3LD2A 4YFJA 3VRNA 2Q04A 4DNCA 2VKZG 2PJ5A 2ARHA 5F1YA 4Y49B 4C8CA 5AG5A 3IC1A 2O28A 2DPSA 2V8GA 3V8IA 2R82A 4CO9A 3IGRA 4JJXA 4CYNA 3PBBA 1KC7A 3PRTA 4MXUA 2F5IA 3D67A 2PJ1A 1LRZA 3BI1A 2WSAA 4OIDA 3P2FA 1XRYA 1I1DA 5CBMA 1QSNA 4A4CA 4ZBGA 4C9EA 4MFKA 2ZOGA 4FD5A 3T90A 3GJZA 1U6MA 4BPWB 1QSMA 3RYOA 4MJXA 3S9MA 3SR3A 3B3CA 2FT0A 3EFAA 2C6PA 3TOAA 1IYKA 2XEFA 3I1UA 4J0NA 2YNCA 3JRUA 3WC5A 4U9ZA 4MHZA 1MJAA 1VHOA 2RFHA 2Z3NA 3EO4A 4IF5A 2V77A 4MCRA 2GU2A 4A30A 8CPAA 5G21A 5K8OA 4C99A 4KSAA 4W9YA 4P10A 5DWMA 4BINA 2BUEA 5H86A 5HVGA 3D68A 5ISVA 4B6ZA 4UFVA 3KASA 4C9AA 1YQEA 4C2XA 2ZEDA 1FT7A 1K4JA 1IIDA 4E0AA 4B5OA 3E0KA 2Q4VA 1XMTA 1KUVA 4FD4A 4YWYA 5HKZA 3DGVA 1TF9A 2AFMA 3SJXA 3FRMA 3TTHA 1Z8WA 5IB0A 4IIXA 1GYTA 3VTAA 4AXVA 5HVFA 4TJVA 2ANPA 3VWEA 4IK2A 2PJAA 2YJTA 4IHMA 1WVMA 2FE7A 1WWZA 5AG6A 3SXOA 3TT2A 1KEEB 4JXQA 3FX6A 3VRPA 2NYQA 4NGSA 2FCKA 4E5SA 2GLFA 1OZPA 4PXEA 2WPWA 2X7BA 4JXRA 4O23A 4KNGE 1AUGA 1QSTA 1Q2CA 5JM6A 4RR2B 1CPXA 1P0HA 4XNHB 4AG7A 4Q36A 3B3VA 1NE9A 4MHDA 3IIBA 5LYIA 4A31A 2FSRA 2OLSA 2B4BA 2NMTA 4COGA 3JVNA 1Z4RA 1CP7A 4ORFA 4KOSA 1HDQA 3SJGA 4X3RA 1VHSA 5LYLA 4JWPA 1Z8LA 4ZGYB 3PEIA 2JDDA 1VHEA 3PB7X 1VBHA 5D8NA 4AVBA 4P45A 4PQAA 3G8WA 1ZG9A 3OP0A 1QMUA 2XPNA 3OAKA 3CXQA 4F8ZA 3KQXA 1RXTA 4QBJA 4R6TA 2O53A 2OZGA 3TO6A 3PZJA 2ZEHA 4NGRA 1BPNA 1XE4A 1S7KA 3PP9A 2B4DB 4AG9A 2OR4A 1F2PA 2AFUA 2DIKA 1GGOA 2OZUA 4R87A 3BJ7A 3T9YA 1X12A 2HI6A 3EIFA 1M1DA 2VZZA 1QSRA 3FMCA 5JYBA 3D8PA 2IMOA 2ZW6A 1ZRSA 5FD8A 4PK3A 1PU9A 1Q5XA 4NJRA 3I9SA 4C86A 3TLYA 3DLJA 3KL9A 2FXFA 1OBRA 3FYNA 1S7LA 3PLFB 1KUXA 2I79A 4P4FA 1NSAA 2I3CA 1ZLIA 4CGLA 1CJWA 4KLVA 4OC3A 1CG2A 2Z11A 2ZW4A 1V6CA 2ABZA 1CX8A 2AE6A 3B35A 4C9VA 3B3WA 3PB8X 4OADA 5F46A 3FF3A 4XPKA 1Z9EA 2EK8A 1VIXA 3EXNA 3IWEA 3HPGG 4KOUA 4UIBA 2BOAA 4UIAA 1NXJA 2CXAA 3TLZA 1PCAA 1XJOA 2QVPA 4B5PB 4C8TA 2PQ8A 2V8VA 1Y7RA 4UCPA 4CDKA 3PB6X 4PXCA 4CRZB 1LANA 1VKCA 2IJZA 4M85A 4BD9A 4DYOA 2HV2A 3TLGA 5LYFA 2YJVA 2J8MA 4CPAA 4CYQA 2C6CA 3VH9A 4M8DA 4JD6A 2FM4A 3MGDA 3ZNIA 2CBLA 2ZW7A 5HH1A 2PIYA 3LODA 4A2ZA 4OIWA 4EMEA 1JQGA 2FVGA 3ZZIA 1Z8TA 1Q2DA 4MY3A 1ZG8A 4ZY1A 2NSMA 3GB0A 2PIZA 3VROA 1IYLA 4M3SA 2P0WA 2J9AA 2X0SA 4IIYA 3F8KA 1BOBA 4NF1A 2IL4A 3TLAA 2P6FA 3BUXB 4YU9A 5DS0A 1VI4A 1V0CA 4OKOA 3S6FA 2WYRA 1YK3A 4JLYA 7CPAA 1IB1E 2IQ6A 1BPMA 2ZEEA 5EBVA 4IAVA 3IEHA 5F13A 1WJTA 3DDDA 4RN7A 3TCVA 2PVVA 2ZXVA 4AVCA 4E2AA 1WK4A 1M4LA 4MHPA 4I49A 5DWNA 3WABA 4MI4A 1YW6A 4MFLA 4CS0B 2H5MA 4OAEA 1M6VB 2Q0YA 4NEXA 4KUBA 2PJ2A 4RI1A 1RO5A 3F0AA 2AUNA 1MJ9A 3TFYA 3GKRA 2ZW5A 1S60A 3W6XA 5JVLA 1YVKA 2REEA 2G3TA 1QQ9A 1Y0RA 2VBQA 3K9TA 3RNZA 3SI1A 2Q7SA 5F49A 1YX0A 3WC6A 1F2OA 4RUHA 5JQ4A 2EWBA 3GY9A 5CPAA 4KVME 4ZI6A 3B2YA 3GUXA 1N71A 2QIRA 2AFXA 2GP4A 2OZHA 3U88C 4A33A 2VXKA 2QECA 4TWEA 2PC1A 3S6GA 2ZEPA 4KSIA 5JPHA 4OMEA 3BXMA 3D66A 2PR8A 3RBUA 2CNMA 3I74A 3DR6A 4X5KA 2YNCC 5H84A 1S5KA 4CGOA 3EZAA 2GE3A 2PVWA 2PJ8A 4R3KA 4UCMA 5E96A 4AVAA 4NGMA 3EY5A 4COBA 3KKWA 1HEEA 1YMEA 4R57A 2OU2A 2PJ9A 2AFSA 4P6YA 4LX9A 3SXNA 2ZEMA 5CNPA 4C85A 2Q4ZA 3RZAA 2MP0A 2AFWA 3SI2A 4H1HA 1SQHA 2B4JC 3CDXA 3FXTA 3SJEA 4CGNA 4MFQA 3VARA 4OC1A 1Z4EA 3KR5A 4FD7A 4FWUA 4HNWB 4KOTA 5LRKA 1ZO0A 3NH4A 4NJQA 2D4PA 3G23A 5C82A 3F5BA 1YREA 1Y9ZA 4DJLA 5IV0A 3EZBA 3KI9A 3PFEA 4R3LA 1L0CA 2BO9A 4PV6A 2YGWA 4CAVA 1CS0B 3GLJA 2CNTA 3CXSA 4ZY2A 3JTKA 5D29A 2VZYA 4MFPA 4KS9A 5F47A 1IGBA 1R43A 3D7HA 4OC5A 3S9LA 1EO0A 2B58A 4P4JA 1M44A 2B3UA 2Z0ZA 3B7IA 3NE8A 4P44A 4PXDA 4BPXB 3NOJA 4CZ1A 1YVOA 4NCZA 2PJCA 4UEZA 2PR1A 1YW4A 3LMSA 3HLPA 3PT1A 4MI1A 3TLEA 4KVXA 1FNOA 2GFQA 3NFZA 2PDOA 2POKA 1Z5RA 2Y1MA 1PYTB 3K9UA 2CF4A 2K5TA 2PSWA 2DLAA 3BUWB 4KOWA 4KZTA 2PCUA 3D4UA 4UFXA 3IJ3A 4WWVA 4X8IA 2DEAA 1FBVA 1TKFA 5F9MA 4XPDC 4LUAA 4XNHC 4PPZA 4NGPA 3O8ZA 2BCOA 2VI7A 1AMPA 1YLOA 5I4MA 1LCPA 4LQ6A 4C84A 1T36B 2AFZA 4NXYA 2HROA 5AXIA 4PSWA 2EUIA 2PJ0A 3FECA 1ARMA 2VEZA 3B3TA 3VWDA 4B12A 2C5QA 1QSOA 1S7FA 4C8UA 3BHXA 2JEVA 4NFRA 4XPLA 3KGQA 4C68A 4GXHA 4B11A 3NFQA 4UCNA 4P4IA 1Z2LA 2B4DA 3D3SA 4KSFA 4X2TA 2B5GB 2PJ6A 2YNDA 4UWIA 3V38A 2XPPA 2D0OA 3NA6A 2HWGA 3CZXA 4MFJA 4C7HA 1JDEA 5HKWA 2JLMA 3IU2A 1YLEA 4DUKA 2E28A 4INJA 4JVOA 2R1IA 2EZBA 5AG4A 3FEEA 3ISXA 1B47A 2G9DA 3CPXA 2OH1A 2ZEOA 4FUUA 4HKFA 3KQZA 4QC6A 4UBRA 4C2YA 4P4DA 3VRQA 4H6ZA 4ZX9A 4NGTA 3TLBA 4HNXB 1KZFA 2VQYA 2F8HA 3JUWA 3SHPA 3TC8A 2XEGA 3F9KC 1A2ZA 3D7GA 2BSWA 2CTBA 2PJ4A 4HNYB 4R8FA 4P4EA 4B10A 2UV8G 2Z3OA 4B5PA 4P4BA 4CAEA 4M6HA 3PBEA 1IU8A 2GANA 3FJUA 4NSQA 3IWGA 1VBGA 5JGFA 4TJXA 4PSXA 4YN3A 2V8DA 4QUSA 1M4GA 1DE4C 3ZJ0A 5C88A 2PRBA 4K3NA 4C2ZA 3D2MA 2B3VA 4JZ0A 5IX3A 4M6IA 4MJ8A 1XFOA 4QB9A 2KCWA 4L89A 1GHEA 1R57A 2I00A 4KLWA 1BLLE 1IICA 2QJ8A 3KRVA 4C8AA 2O4HA 4F9VA 3TO7A 3VGOA 4C8PA 2N3AB 3I6SA 5I0CA 4C8FA 2CTCA 3C26A 4C9UA 3BUMB 1YVHA 3IO1A 4U5YA 2JBKA 3S6KA 2D0PA 5KTAA 5A28A 2Q51A 1B87A 1IOIA 1CM0A 3H5ZA 4MCPA 2QYVA 4UEEA 4CRYB 1S7NA 2P6EA 1JDBC 3IU1A 2PCNA 1TXRA 4R9MA 2Z3MA 1BAVA 3DSBA 4MBUA 4MY0A 2Q7BA 4F0XA 2OB0A 3CXPA 4F0YA 1FY7A 3C8OA 2D4OA 4KOXA 5IB9A 4KORA 2EO8A 4UA3A 2Z3PA 4GS4A 3R9FA 4K30A 3S6HA 4WJBA 4C7IA 2ATRA 3N7ZA 1C3OB 1Y7EA 5F48A 2V8HA 3GIUA 4ZX8A 2EK9A 4E94A 2J8RA 4B14A 2AUMA 1ON0A 2DF5A 4LQGA 4CAWA 4E8OA 4BTFA 1XF1A 1EZAA 1R3NA 3T5MA 2JDCA 4TNUA 5J8FA 3BUNB 3IWWA 4Y49C 4Q38A 3G3SA 3WC7A 4MFZA 1TKHA 3KHZA 2FIAA 3PGPA 3R9EA 2FIWA 4CYPA 4F6AA 5HVHA 3TLCA 4MRIA 3PFVA 3T07A 4KOVA 3S9NA 3T05A 1I12A 2PJ7A 4A4BA 3LWUA 1YR0A 4U9YA 1CE8B 3KZWA 1YSJA 2Q43A 1ELLP 5K8PA 5J3XA 4KVOE 2AFOA 3NH5A 3W6SA 4EFDA 1ZG7A 3D7DA 4MMOA 2EZCA 2OOTA 5BY0A 2G0BA 3NH8A 1VGYA 4M6GA 4B13A 4CYOA 1H8LA 1NMTA 4UWJA 3I3GA 2GIVA 5G20A 1ZL0A 1MJBA 1J4JA 2HB6A 5ELYA 1EZBA 1Y9KA 2CNSA 5EMIA 2BL1A 4BBHA 2JBJA 3BI0A 3H4QA 1UFHA 4BPUB 2G3AA 3BLNA 2EBJA 5A27A 3WR7A 2C27A 5KTDA 2VL1A 4KUAA 4CDJA 4F9UA 3OB1B 1TF8A 2AJ6A 4PK2A 5F09A 3FBUA 5AG7A 2ZPAA 5J1QA 3ICUA 5KTCA 4H6UA 5HXDA 3BUOB 1YGHA 3QNVA 4A94A 2PJBA 1M4DA 1XMBA 2QMLA 3D2PA 3PB9X 1R61A 2ZELA 4R7MA 3HMJG 4FBEA 1XOVA 3FIXA 1CBXA 1IY7A 3QAYA 5JH9A 3K2KA 2XEJA 2YNEA 3R1KA 5IR2A 1X10A 1F57A 1XIXA 4OP4A 3NE7A 2RC4A 3OWCA 4ZY0A 1JWQA 3R96A 4OLLA 2XEIA 5LRGA 3FNCA 4UEFA 3TX8A 2FL4A 3MRUA 4EVYA 5J8CA 3FH4A 3QAHA 4XPDB 5GCNA 1XBUA 1Z8XA 3FVLA 3CT9A 2HUZA 1XF8A 1B6BA 3N5FA 2PJ3A 1LFWA 1LOKA 2FS5A 3GYAA 2JEWA 2ODFA 3QB8A 4Z65A 3TE4A 2WUUA 4UFWA 1ZYMA 3TYXA 2EZAA 4RS2A 4C9RA 3IFEA 2ZEGA 3EC4A 5THWA 4A37A 3H8EA 2Z3LA 3H8GA 2ZEFA 1KUYA 3T8WA 4EWTA 4A95A 1UWYA 3K4IA 2ZOFA 4YGOA 3R9GA 5K99A 1HDUA 2Q4YA 5G1ZA 3L2NA 3PFOA 5FVJA 2CIJA 2DPTA 3DR8A 2XPLA 5G22A 4CAFA 4II9A 4YRHA
chains in the Genus database with same CATH topology
1EE3P 5LYDA 2GREA 4MHNA 4OC0A 4G1PA 4MHYA 3PB4X 3KHXA 5K8MA 3RAMA 3H8FA 2ZENA 4A39A 3SJFA 3V7ZA 1TKJA 2WZNA 4JYWA 3VATA 3D7FA 4A38A 1ELMP 4Q7AA 3KR4A 6CPAA 4H2KA 4NGQA 1CP6A 1ZLHA 1Q7LA 1DTDA 3FEDA 1Y0YA 2F7VA 3ISZA 2PE3A 1KWMA 5K8NA 3SI0A 3B3SA 4PXBA 1LAPA 4FAIA 2C1CA 4MCQA 1LAMA 4ONWA 2HC9A 1CPSA 3CPAA 4OC4A 4R76A 4UF4A 4MCSA 3MN8A 4GM5A 3WT4A 1RTQA 2PRQA 5LRJA 2C6GA 2RB7A 2GLJA 1ARLA 1AYEA 4OC2A 4ZYQA 4NGNA 3HUVA 2PJ5A 4C8CA 3IC1A 2V8GA 3PBBA 3PRTA 4MXUA 3D67A 2PJ1A 3BI1A 4OIDA 1XRYA 5CBMA 2ZOGA 3S9MA 3B3CA 2C6PA 2XEFA 3I1UA 3JRUA 3WC5A 4MHZA 1VHOA 2RFHA 4C99A 2V77A 4MCRA 2GU2A 8CPAA 5K8OA 4W9YA 4P10A 5HVGA 3D68A 4B6ZA 3KASA 4C9AA 2ZEDA 1FT7A 4YWYA 3DGVA 1TF9A 2AFMA 3SJXA 3VTAA 1GYTA 4AXVA 5HVFA 4TJVA 2ANPA 4IK2A 2PJAA 4IHMA 1WVMA 3FX6A 2NYQA 4NGSA 2GLFA 4PXEA 4O23A 4KNGE 5JM6A 1CPXA 3B3VA 3IIBA 5LYIA 1CP7A 1HDQA 3SJGA 4X3RA 5LYLA 1Z8LA 3PEIA 1VHEA 3PB7X 5D8NA 4P45A 4PQAA 1ZG9A 1QMUA 4F8ZA 3KQXA 4R6TA 2O53A 2ZEHA 4NGRA 1BPNA 2OR4A 1F2PA 2AFUA 3EIFA 3FMCA 2IMOA 4NJRA 3DLJA 3KL9A 1OBRA 4P4FA 1NSAA 2I3CA 1ZLIA 4OC3A 1CG2A 1V6CA 2ABZA 1CX8A 3B35A 3PB8X 3B3WA 3FF3A 4UIBA 2EK8A 1VIXA 4UIAA 2BOAA 1PCAA 1XJOA 2QVPA 4C8TA 2V8VA 4CDKA 3PB6X 4PXCA 1LANA 2IJZA 4BD9A 4DYOA 5LYFA 4CPAA 2C6CA 3VH9A 2PIYA 4OIWA 4EMEA 1JQGA 2FVGA 4ZY1A 4C9EA 1ZG8A 2NSMA 3GB0A 2PIZA 2J9AA 4YU9A 5DS0A 4OKOA 2WYRA 7CPAA 2IQ6A 1BPMA 2ZEEA 4IAVA 3IEHA 2PVVA 1M4LA 4MHPA 3WABA 1YW6A 2PJ2A 3SI1A 1QQ9A 1Y0RA 3K9TA 3WC6A 4RUHA 1F2OA 2EWBA 5CPAA 4ZI6A 3B2YA 3GUXA 2AFXA 2GP4A 4TWEA 2ZEPA 4KSIA 4OMEA 3BXMA 3D66A 3RBUA 3I74A 2PJ8A 2PVWA 4NGMA 1HEEA 1YMEA 2PJ9A 2AFSA 4P6YA 2ZEMA 2Q4ZA 3RZAA 2AFWA 3SI2A 3CDXA 3SJEA 4C86A 3VARA 5LRKA 4OC1A 3KR5A 4FWUA 4C85A 4CDJA 3NH4A 4NJQA 1Y9ZA 4DJLA 3KI9A 3PFEA 2BO9A 3GLJA 4ZY2A 5D29A 1IGBA 1R43A 3D7HA 4OC5A 3S9LA 4P4JA 3B7IA 4PXDA 4P44A 2PJCA 4UEZA 1YW4A 3LMSA 3HLPA 1FNOA 3NFZA 2POKA 1Z5RA 1PYTB 2CF4A 4WWVA 4X8IA 2PCUA 3D4UA 3IJ3A 2DEAA 1TKFA 4PPZA 4NGPA 2BCOA 5I4MA 1AMPA 1YLOA 1LCPA 2AFZA 2PJ0A 3FECA 1ARMA 3B3TA 2C5QA 4C8UA 3BHXA 4NFRA 3KGQA 4P4IA 1Z2LA 4X2TA 2PJ6A 3V38A 3NA6A 4DUKA 3FEEA 3ISXA 3CPXA 2G9DA 2ZEOA 4FUUA 3KQZA 4P4DA 4ZX9A 4NGTA 2F8HA 3TC8A 2XEGA 2CTBA 3D7GA 2PJ4A 4R8FA 4P4EA 4P4BA 3PBEA 3FJUA 4TJXA 5JGFA 4YN3A 2V8DA 1DE4C 4K3NA 4JZ0A 1XFOA 1BLLE 2QJ8A 4C8AA 2O4HA 4F9VA 4C8PA 3I6SA 4C8FA 2CTCA 4C9UA 3IO1A 2JBKA 2Q51A 4UEEA 4C84A 4C9VA 4MCPA 2QYVA 1TXRA 1BAVA 5IB9A 4WJBA 1Y7EA 2V8HA 4ZX8A 2EK9A 4LQGA 1XF1A 1R3NA 4TNUA 3IWWA 3WC7A 1TKHA 3KHZA 5HVHA 4MRIA 3S9NA 2PJ7A 3LWUA 3KZWA 1YSJA 2Q43A 1ELLP 5K8PA 2AFOA 3NH5A 4EFDA 1ZG7A 3D7DA 4MMOA 2OOTA 3NH8A 1VGYA 1H8LA 2HB6A 5ELYA 2JBJA 3BI0A 2VL1A 4F9UA 1TF8A 5F09A 5J1QA 3ICUA 5HXDA 3QNVA 4A94A 2PJBA 1XMBA 3PB9X 2ZELA 4R7MA 4FBEA 1CBXA 1IY7A 5JH9A 3K2KA 2XEJA 5IR2A 1F57A 4OP4A 4ZY0A 5LRGA 2XEIA 4UEFA 3TX8A 3MRUA 3FH4A 1XBUA 3FVLA 3CT9A 3N5FA 2PJ3A 1LFWA 1LOKA 4Z65A 2JEWA 4C9RA 3IFEA 2ZEGA 5THWA 4A37A 3H8EA 3T8WA 3H8GA 2ZEFA 4EWTA 1UWYA 2ZOFA 1HDUA 3L2NA 3PFOA 2CIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EE3 P;  5LYD A;  2GRE A;  4MHN A;  4OC0 A;  4G1P A;  4MHY A;  3PB4 X;  3KHX A;  5K8M A;  3RAM A;  3H8F A;  2ZEN A;  4A39 A;  3SJF A;  3V7Z A;  1TKJ A;  2WZN A;  4JYW A;  3VAT A;  3D7F A;  4A38 A;  1ELM P;  4Q7A A;  3KR4 A;  6CPA A;  4H2K A;  4NGQ A;  1CP6 A;  1ZLH A;  1Q7L A;  1DTD A;  3FED A;  1Y0Y A;  2F7V A;  3ISZ A;  2PE3 A;  1KWM A;  5K8N A;  3SI0 A;  3B3S A;  4PXB A;  1LAP A;  4FAI A;  2C1C A;  4MCQ A;  1LAM A;  4ONW A;  2HC9 A;  1CPS A;  3CPA A;  4OC4 A;  4R76 A;  4UF4 A;  4MCS A;  3MN8 A;  4GM5 A;  3WT4 A;  1RTQ A;  2PRQ A;  5LRJ A;  2C6G A;  2RB7 A;  2GLJ A;  1ARL A;  1AYE A;  4OC2 A;  4ZYQ A;  4NGN A;  3HUV A;  2PJ5 A;  4C8C A;  3IC1 A;  2V8G A;  3PBB A;  3PRT A;  4MXU A;  3D67 A;  2PJ1 A;  3BI1 A;  4OID A;  1XRY A;  5CBM A;  2ZOG A;  3S9M A;  3B3C A;  2C6P A;  2XEF A;  3I1U A;  3JRU A;  3WC5 A;  4MHZ A;  1VHO A;  2RFH A;  4C99 A;  2V77 A;  4MCR A;  2GU2 A;  8CPA A;  5K8O A;  4W9Y A;  4P10 A;  5HVG A;  3D68 A;  4B6Z A;  3KAS A;  4C9A A;  2ZED A;  1FT7 A;  4YWY A;  3DGV A;  1TF9 A;  2AFM A;  3SJX A;  3VTA A;  1GYT A;  4AXV A;  5HVF A;  4TJV A;  2ANP A;  4IK2 A;  2PJA A;  4IHM A;  1WVM A;  3FX6 A;  2NYQ A;  4NGS A;  2GLF A;  4PXE A;  4O23 A;  4KNG E;  5JM6 A;  1CPX A;  3B3V A;  3IIB A;  5LYI A;  1CP7 A;  1HDQ A;  3SJG A;  4X3R A;  5LYL A;  1Z8L A;  3PEI A;  1VHE A;  3PB7 X;  5D8N A;  4P45 A;  4PQA A;  1ZG9 A;  1QMU A;  4F8Z A;  3KQX A;  4R6T A;  2O53 A;  2ZEH A;  4NGR A;  1BPN A;  2OR4 A;  1F2P A;  2AFU A;  3EIF A;  3FMC A;  2IMO A;  4NJR A;  3DLJ A;  3KL9 A;  1OBR A;  4P4F A;  1NSA A;  2I3C A;  1ZLI A;  4OC3 A;  1CG2 A;  1V6C A;  2ABZ A;  1CX8 A;  3B35 A;  3PB8 X;  3B3W A;  3FF3 A;  4UIB A;  2EK8 A;  1VIX A;  4UIA A;  2BOA A;  1PCA A;  1XJO A;  2QVP A;  4C8T A;  2V8V A;  4CDK A;  3PB6 X;  4PXC A;  1LAN A;  2IJZ A;  4BD9 A;  4DYO A;  5LYF A;  4CPA A;  2C6C A;  3VH9 A;  2PIY A;  4OIW A;  4EME A;  1JQG A;  2FVG A;  4ZY1 A;  4C9E A;  1ZG8 A;  2NSM A;  3GB0 A;  2PIZ A;  2J9A A;  4YU9 A;  5DS0 A;  4OKO A;  2WYR A;  7CPA A;  2IQ6 A;  1BPM A;  2ZEE A;  4IAV A;  3IEH A;  2PVV A;  1M4L A;  4MHP A;  3WAB A;  1YW6 A;  2PJ2 A;  3SI1 A;  1QQ9 A;  1Y0R A;  3K9T A;  3WC6 A;  4RUH A;  1F2O A;  2EWB A;  5CPA A;  4ZI6 A;  3B2Y A;  3GUX A;  2AFX A;  4TWE A;  2ZEP A;  4KSI A;  4OME A;  3BXM A;  3D66 A;  3RBU A;  3I74 A;  2PJ8 A;  2PVW A;  4NGM A;  1HEE A;  1YME A;  2PJ9 A;  2AFS A;  4P6Y A;  2ZEM A;  2Q4Z A;  3RZA A;  2AFW A;  3SI2 A;  3CDX A;  3SJE A;  4C86 A;  3VAR A;  5LRK A;  4OC1 A;  3KR5 A;  4FWU A;  4C85 A;  4CDJ A;  3NH4 A;  4NJQ A;  1Y9Z A;  4DJL A;  3KI9 A;  3PFE A;  2BO9 A;  3GLJ A;  4ZY2 A;  5D29 A;  1IGB A;  1R43 A;  3D7H A;  4OC5 A;  3S9L A;  4P4J A;  3B7I A;  4PXD A;  4P44 A;  2PJC A;  4UEZ A;  1YW4 A;  3LMS A;  3HLP A;  1FNO A;  3NFZ A;  2POK A;  1Z5R A;  1PYT B;  2CF4 A;  4WWV A;  4X8I A;  2PCU A;  3D4U A;  3IJ3 A;  2DEA A;  1TKF A;  4PPZ A;  4NGP A;  2BCO A;  5I4M A;  1AMP A;  1YLO A;  1LCP A;  2AFZ A;  2PJ0 A;  3FEC A;  1ARM A;  3B3T A;  4C8U A;  3BHX A;  4NFR A;  3KGQ A;  4P4I A;  1Z2L A;  4X2T A;  2PJ6 A;  3V38 A;  3NA6 A;  4DUK A;  3FEE A;  3ISX A;  3CPX A;  2G9D A;  2ZEO A;  4FUU A;  3KQZ A;  4P4D A;  4ZX9 A;  4NGT A;  2F8H A;  3TC8 A;  2XEG A;  2CTB A;  3D7G A;  2PJ4 A;  4R8F A;  4P4E A;  4P4B A;  3PBE A;  3FJU A;  4TJX A;  5JGF A;  4YN3 A;  2V8D A;  1DE4 C;  4K3N A;  4JZ0 A;  1XFO A;  1BLL E;  2QJ8 A;  4C8A A;  2O4H A;  4F9V A;  4C8P A;  3I6S A;  4C8F A;  2CTC A;  4C9U A;  3IO1 A;  2JBK A;  2Q51 A;  4UEE A;  4C84 A;  4C9V A;  4MCP A;  2QYV A;  1TXR A;  1BAV A;  5IB9 A;  4WJB A;  1Y7E A;  2V8H A;  4ZX8 A;  2EK9 A;  4LQG A;  1XF1 A;  1R3N A;  4TNU A;  3IWW A;  3WC7 A;  1TKH A;  3KHZ A;  5HVH A;  4MRI A;  3S9N A;  2PJ7 A;  3LWU A;  3KZW A;  1YSJ A;  2Q43 A;  1ELL P;  5K8P A;  2AFO A;  3NH5 A;  4EFD A;  1ZG7 A;  3D7D A;  4MMO A;  2OOT A;  3NH8 A;  1VGY A;  1H8L A;  2HB6 A;  5ELY A;  2JBJ A;  3BI0 A;  2VL1 A;  4F9U A;  1TF8 A;  5F09 A;  5J1Q A;  3ICU A;  5HXD A;  3QNV A;  4A94 A;  2PJB A;  1XMB A;  3PB9 X;  2ZEL A;  4R7M A;  4FBE A;  1CBX A;  1IY7 A;  5JH9 A;  3K2K A;  2XEJ A;  1F57 A;  4OP4 A;  4ZY0 A;  5LRG A;  2XEI A;  4UEF A;  3TX8 A;  3MRU A;  3FH4 A;  1XBU A;  3FVL A;  3CT9 A;  3N5F A;  2PJ3 A;  1LFW A;  1LOK A;  4Z65 A;  2JEW A;  4C9R A;  3IFE A;  2ZEG A;  5THW A;  4A37 A;  3H8E A;  3T8W A;  3H8G A;  2ZEF A;  4EWT A;  1UWY A;  2ZOF A;  1HDU A;  3L2N A;  3PFO A;  2CIJ A; 
#chains in the Genus database with same CATH topology
 1EE3 P;  5LYD A;  3W91 A;  4GPL B;  2GRE A;  5BWA B;  4MHN A;  4OC0 A;  4G1P A;  4MHY A;  3BJ8 A;  2DXQ A;  4L8A A;  2WPX A;  1I21 A;  3PB4 X;  3KHX A;  4A32 A;  1TIQ A;  5K8M A;  3RAM A;  4AB7 A;  3H8F A;  2CY2 A;  4QVT A;  5EC4 A;  2HQY A;  2ZEN A;  4A39 A;  2R98 A;  4FD6 A;  3SJF A;  1P4N A;  3V7Z A;  5F5X A;  1TKJ A;  2WZN A;  2Y0M A;  3U1B A;  3P2H A;  1KBL A;  1J3L A;  4JYW A;  3VAT A;  2B5G A;  3D7F A;  3TLG B;  4A38 A;  1ELM P;  2Z3K A;  4Q7A A;  3KR4 A;  4H89 A;  3TO9 A;  6CPA A;  4H2K A;  3VRR A;  2B0A A;  4NGQ A;  1CP6 A;  5AGE A;  1NSL A;  1ZLH A;  1Q7L A;  4BMH A;  1NBW A;  1DTD A;  1S3Z A;  3FED A;  1Y0Y A;  1Q2Y A;  1MK4 A;  2F7V A;  3ISZ A;  5HMN A;  2PE3 A;  1KWM A;  5K8N A;  1IOF A;  3SI0 A;  3B3S A;  4PXB A;  1C30 B;  4EYS A;  1LAP A;  4CGM A;  2R7H A;  4FAI A;  2Y1N A;  2C1C A;  2REF A;  4CAX A;  1BXR B;  4MCQ A;  1LAM A;  4IUS A;  4J3G A;  4ONW A;  2HC9 A;  1CPS A;  3CPA A;  1DIK A;  1Z9U A;  2J8N A;  4OC4 A;  2R8V A;  4R76 A;  2Q44 A;  2XPO A;  3RO0 A;  1Y9W A;  3A9L A;  2EVN A;  3DNS A;  1BO4 A;  4UF4 A;  4MCS A;  3MN8 A;  3TOB A;  3UY5 A;  4CGP A;  4GM5 A;  4KOY A;  3EZE A;  3WT4 A;  1RTQ A;  2PRQ A;  5LRJ A;  3OB2 B;  1PUA A;  2C6G A;  2RB7 A;  3HPH E;  3B8G A;  1M4I A;  2A4N A;  2GLJ A;  4HPS A;  1ARL A;  1AYE A;  4OC2 A;  1XEB A;  2P6G A;  2Z10 A;  3LAC A;  5HKY A;  4ZYQ A;  4NGN A;  3FB3 A;  3HUV A;  2BEI A;  3T0T A;  3R95 A;  4ONU A;  1A9X B;  3LD2 A;  4YFJ A;  3VRN A;  2Q04 A;  4DNC A;  2VKZ G;  2PJ5 A;  2ARH A;  5F1Y A;  4Y49 B;  4C8C A;  5AG5 A;  3IC1 A;  2O28 A;  2DPS A;  2V8G A;  3V8I A;  2R82 A;  4CO9 A;  3IGR A;  4JJX A;  4CYN A;  3PBB A;  1KC7 A;  3PRT A;  4MXU A;  2F5I A;  3D67 A;  2PJ1 A;  1LRZ A;  3BI1 A;  2WSA A;  4OID A;  3P2F A;  1XRY A;  1I1D A;  5CBM A;  1QSN A;  4A4C A;  4ZBG A;  4C9E A;  4MFK A;  2ZOG A;  4FD5 A;  3T90 A;  3GJZ A;  1U6M A;  4BPW B;  1QSM A;  3RYO A;  4MJX A;  3S9M A;  3SR3 A;  3B3C A;  2FT0 A;  3EFA A;  2C6P A;  3TOA A;  1IYK A;  2XEF A;  3I1U A;  4J0N A;  2YNC A;  3JRU A;  3WC5 A;  4U9Z A;  4MHZ A;  1MJA A;  1VHO A;  2RFH A;  2Z3N A;  3EO4 A;  4IF5 A;  2V77 A;  4MCR A;  2GU2 A;  4A30 A;  8CPA A;  5G21 A;  5K8O A;  4C99 A;  4KSA A;  4W9Y A;  4P10 A;  5DWM A;  4BIN A;  2BUE A;  5H86 A;  5HVG A;  3D68 A;  5ISV A;  4B6Z A;  4UFV A;  3KAS A;  4C9A A;  1YQE A;  4C2X A;  2ZED A;  1FT7 A;  1K4J A;  1IID A;  4E0A A;  4B5O A;  3E0K A;  2Q4V A;  1XMT A;  1KUV A;  4FD4 A;  4YWY A;  5HKZ A;  3DGV A;  1TF9 A;  2AFM A;  3SJX A;  3FRM A;  3TTH A;  1Z8W A;  5IB0 A;  4IIX A;  1GYT A;  3VTA A;  4AXV A;  5HVF A;  4TJV A;  2ANP A;  3VWE A;  4IK2 A;  2PJA A;  2YJT A;  4IHM A;  1WVM A;  2FE7 A;  1WWZ A;  5AG6 A;  3SXO A;  3TT2 A;  1KEE B;  4JXQ A;  3FX6 A;  3VRP A;  2NYQ A;  4NGS A;  2FCK A;  4E5S A;  2GLF A;  1OZP A;  4PXE A;  2WPW A;  2X7B A;  4JXR A;  4O23 A;  4KNG E;  1AUG A;  1QST A;  1Q2C A;  5JM6 A;  4RR2 B;  1CPX A;  1P0H A;  4XNH B;  4AG7 A;  4Q36 A;  3B3V A;  1NE9 A;  4MHD A;  3IIB A;  5LYI A;  4A31 A;  2FSR A;  2OLS A;  2B4B A;  2NMT A;  4COG A;  3JVN A;  1Z4R A;  1CP7 A;  4ORF A;  4KOS A;  1HDQ A;  3SJG A;  4X3R A;  1VHS A;  5LYL A;  4JWP A;  1Z8L A;  4ZGY B;  3PEI A;  2JDD A;  1VHE A;  3PB7 X;  1VBH A;  5D8N A;  4AVB A;  4P45 A;  4PQA A;  3G8W A;  1ZG9 A;  3OP0 A;  1QMU A;  2XPN A;  3OAK A;  3CXQ A;  4F8Z A;  3KQX A;  1RXT A;  4QBJ A;  4R6T A;  2O53 A;  2OZG A;  3TO6 A;  3PZJ A;  2ZEH A;  4NGR A;  1BPN A;  1XE4 A;  1S7K A;  3PP9 A;  2B4D B;  4AG9 A;  2OR4 A;  1F2P A;  2AFU A;  2DIK A;  1GGO A;  2OZU A;  4R87 A;  3BJ7 A;  3T9Y A;  1X12 A;  2HI6 A;  3EIF A;  1M1D A;  2VZZ A;  1QSR A;  3FMC A;  5JYB A;  3D8P A;  2IMO A;  2ZW6 A;  1ZRS A;  5FD8 A;  4PK3 A;  1PU9 A;  1Q5X A;  4NJR A;  3I9S A;  4C86 A;  3TLY A;  3DLJ A;  3KL9 A;  2FXF A;  1OBR A;  3FYN A;  1S7L A;  3PLF B;  1KUX A;  2I79 A;  4P4F A;  1NSA A;  2I3C A;  1ZLI A;  4CGL A;  1CJW A;  4KLV A;  4OC3 A;  1CG2 A;  2Z11 A;  2ZW4 A;  1V6C A;  2ABZ A;  1CX8 A;  2AE6 A;  3B35 A;  4C9V A;  3B3W A;  3PB8 X;  4OAD A;  5F46 A;  3FF3 A;  4XPK A;  1Z9E A;  2EK8 A;  1VIX A;  3EXN A;  3IWE A;  3HPG G;  4KOU A;  4UIB A;  2BOA A;  4UIA A;  1NXJ A;  2CXA A;  3TLZ A;  1PCA A;  1XJO A;  2QVP A;  4B5P B;  4C8T A;  2PQ8 A;  2V8V A;  1Y7R A;  4UCP A;  4CDK A;  3PB6 X;  4PXC A;  4CRZ B;  1LAN A;  1VKC A;  2IJZ A;  4M85 A;  4BD9 A;  4DYO A;  2HV2 A;  3TLG A;  5LYF A;  2YJV A;  2J8M A;  4CPA A;  4CYQ A;  2C6C A;  3VH9 A;  4M8D A;  4JD6 A;  2FM4 A;  3MGD A;  3ZNI A;  2CBL A;  2ZW7 A;  5HH1 A;  2PIY A;  3LOD A;  4A2Z A;  4OIW A;  4EME A;  1JQG A;  2FVG A;  3ZZI A;  1Z8T A;  1Q2D A;  4MY3 A;  1ZG8 A;  4ZY1 A;  2NSM A;  3GB0 A;  2PIZ A;  3VRO A;  1IYL A;  4M3S A;  2P0W A;  2J9A A;  2X0S A;  4IIY A;  3F8K A;  1BOB A;  4NF1 A;  2IL4 A;  3TLA A;  2P6F A;  3BUX B;  4YU9 A;  5DS0 A;  1VI4 A;  1V0C A;  4OKO A;  3S6F A;  2WYR A;  1YK3 A;  4JLY A;  7CPA A;  1IB1 E;  2IQ6 A;  1BPM A;  2ZEE A;  5EBV A;  4IAV A;  3IEH A;  5F13 A;  1WJT A;  3DDD A;  4RN7 A;  3TCV A;  2PVV A;  2ZXV A;  4AVC A;  4E2A A;  1WK4 A;  1M4L A;  4MHP A;  4I49 A;  5DWN A;  3WAB A;  4MI4 A;  1YW6 A;  4MFL A;  4CS0 B;  2H5M A;  4OAE A;  1M6V B;  2Q0Y A;  4NEX A;  4KUB A;  2PJ2 A;  4RI1 A;  1RO5 A;  3F0A A;  2AUN A;  1MJ9 A;  3TFY A;  3GKR A;  2ZW5 A;  1S60 A;  3W6X A;  5JVL A;  1YVK A;  2REE A;  2G3T A;  1QQ9 A;  1Y0R A;  2VBQ A;  3K9T A;  3RNZ A;  3SI1 A;  2Q7S A;  5F49 A;  1YX0 A;  3WC6 A;  1F2O A;  4RUH A;  5JQ4 A;  2EWB A;  3GY9 A;  5CPA A;  4KVM E;  4ZI6 A;  3B2Y A;  3GUX A;  1N71 A;  2QIR A;  2AFX A;  2GP4 A;  2OZH A;  3U88 C;  4A33 A;  2VXK A;  2QEC A;  4TWE A;  2PC1 A;  3S6G A;  2ZEP A;  4KSI A;  5JPH A;  4OME A;  3BXM A;  3D66 A;  2PR8 A;  3RBU A;  2CNM A;  3I74 A;  3DR6 A;  4X5K A;  2YNC C;  5H84 A;  1S5K A;  4CGO A;  3EZA A;  2GE3 A;  2PVW A;  2PJ8 A;  4R3K A;  4UCM A;  5E96 A;  4AVA A;  4NGM A;  3EY5 A;  4COB A;  3KKW A;  1HEE A;  1YME A;  4R57 A;  2OU2 A;  2PJ9 A;  2AFS A;  4P6Y A;  4LX9 A;  3SXN A;  2ZEM A;  5CNP A;  4C85 A;  2Q4Z A;  3RZA A;  2MP0 A;  2AFW A;  3SI2 A;  4H1H A;  1SQH A;  2B4J C;  3CDX A;  3FXT A;  3SJE A;  4CGN A;  4MFQ A;  3VAR A;  4OC1 A;  1Z4E A;  3KR5 A;  4FD7 A;  4FWU A;  4HNW B;  4KOT A;  5LRK A;  1ZO0 A;  3NH4 A;  4NJQ A;  2D4P A;  3G23 A;  5C82 A;  3F5B A;  1YRE A;  1Y9Z A;  4DJL A;  5IV0 A;  3EZB A;  3KI9 A;  3PFE A;  4R3L A;  1L0C A;  2BO9 A;  4PV6 A;  2YGW A;  4CAV A;  1CS0 B;  3GLJ A;  2CNT A;  3CXS A;  4ZY2 A;  3JTK A;  5D29 A;  2VZY A;  4MFP A;  4KS9 A;  5F47 A;  1IGB A;  1R43 A;  3D7H A;  4OC5 A;  3S9L A;  1EO0 A;  2B58 A;  4P4J A;  1M44 A;  2B3U A;  2Z0Z A;  3B7I A;  3NE8 A;  4P44 A;  4PXD A;  4BPX B;  3NOJ A;  4CZ1 A;  1YVO A;  4NCZ A;  2PJC A;  4UEZ A;  2PR1 A;  1YW4 A;  3LMS A;  3HLP A;  3PT1 A;  4MI1 A;  3TLE A;  4KVX A;  1FNO A;  2GFQ A;  3NFZ A;  2PDO A;  2POK A;  1Z5R A;  2Y1M A;  1PYT B;  3K9U A;  2CF4 A;  2K5T A;  2PSW A;  2DLA A;  3BUW B;  4KOW A;  4KZT A;  2PCU A;  3D4U A;  4UFX A;  3IJ3 A;  4WWV A;  4X8I A;  2DEA A;  1FBV A;  1TKF A;  5F9M A;  4XPD C;  4LUA A;  4XNH C;  4PPZ A;  4NGP A;  3O8Z A;  2BCO A;  2VI7 A;  1AMP A;  1YLO A;  5I4M A;  1LCP A;  4LQ6 A;  4C84 A;  1T36 B;  2AFZ A;  4NXY A;  2HRO A;  5AXI A;  4PSW A;  2EUI A;  2PJ0 A;  3FEC A;  1ARM A;  2VEZ A;  3B3T A;  3VWD A;  4B12 A;  2C5Q A;  1QSO A;  1S7F A;  4C8U A;  3BHX A;  2JEV A;  4NFR A;  4XPL A;  3KGQ A;  4C68 A;  4GXH A;  4B11 A;  3NFQ A;  4UCN A;  4P4I A;  1Z2L A;  2B4D A;  3D3S A;  4KSF A;  4X2T A;  2B5G B;  2PJ6 A;  2YND A;  4UWI A;  3V38 A;  2XPP A;  2D0O A;  3NA6 A;  2HWG A;  3CZX A;  4MFJ A;  4C7H A;  1JDE A;  5HKW A;  2JLM A;  3IU2 A;  1YLE A;  4DUK A;  2E28 A;  4INJ A;  4JVO A;  2R1I A;  2EZB A;  5AG4 A;  3FEE A;  3ISX A;  1B47 A;  2G9D A;  3CPX A;  2OH1 A;  2ZEO A;  4FUU A;  4HKF A;  3KQZ A;  4QC6 A;  4UBR A;  4C2Y A;  4P4D A;  3VRQ A;  4H6Z A;  4ZX9 A;  4NGT A;  3TLB A;  4HNX B;  1KZF A;  2VQY A;  2F8H A;  3JUW A;  3SHP A;  3TC8 A;  2XEG A;  3F9K C;  1A2Z A;  3D7G A;  2BSW A;  2CTB A;  2PJ4 A;  4HNY B;  4R8F A;  4P4E A;  4B10 A;  2UV8 G;  2Z3O A;  4B5P A;  4P4B A;  4CAE A;  4M6H A;  3PBE A;  1IU8 A;  2GAN A;  3FJU A;  4NSQ A;  3IWG A;  1VBG A;  5JGF A;  4TJX A;  4PSX A;  4YN3 A;  2V8D A;  4QUS A;  1M4G A;  1DE4 C;  3ZJ0 A;  5C88 A;  2PRB A;  4K3N A;  4C2Z A;  3D2M A;  2B3V A;  4JZ0 A;  5IX3 A;  4M6I A;  4MJ8 A;  1XFO A;  4QB9 A;  2KCW A;  4L89 A;  1GHE A;  1R57 A;  2I00 A;  4KLW A;  1BLL E;  1IIC A;  2QJ8 A;  3KRV A;  4C8A A;  2O4H A;  4F9V A;  3TO7 A;  3VGO A;  4C8P A;  2N3A B;  3I6S A;  5I0C A;  4C8F A;  2CTC A;  3C26 A;  4C9U A;  3BUM B;  1YVH A;  3IO1 A;  4U5Y A;  2JBK A;  3S6K A;  2D0P A;  5KTA A;  5A28 A;  2Q51 A;  1B87 A;  1IOI A;  1CM0 A;  3H5Z A;  4MCP A;  2QYV A;  4UEE A;  4CRY B;  1S7N A;  2P6E A;  1JDB C;  3IU1 A;  2PCN A;  1TXR A;  4R9M A;  2Z3M A;  1BAV A;  3DSB A;  4MBU A;  4MY0 A;  2Q7B A;  4F0X A;  2OB0 A;  3CXP A;  4F0Y A;  1FY7 A;  3C8O A;  2D4O A;  4KOX A;  5IB9 A;  4KOR A;  2EO8 A;  4UA3 A;  2Z3P A;  4GS4 A;  3R9F A;  4K30 A;  3S6H A;  4WJB A;  4C7I A;  2ATR A;  3N7Z A;  1C3O B;  1Y7E A;  5F48 A;  2V8H A;  3GIU A;  4ZX8 A;  2EK9 A;  4E94 A;  2J8R A;  4B14 A;  2AUM A;  1ON0 A;  2DF5 A;  4LQG A;  4CAW A;  4E8O A;  4BTF A;  1XF1 A;  1EZA A;  1R3N A;  3T5M A;  2JDC A;  4TNU A;  5J8F A;  3BUN B;  3IWW A;  4Y49 C;  4Q38 A;  3G3S A;  3WC7 A;  4MFZ A;  1TKH A;  3KHZ A;  2FIA A;  3PGP A;  3R9E A;  2FIW A;  4CYP A;  4F6A A;  5HVH A;  3TLC A;  4MRI A;  3PFV A;  3T07 A;  4KOV A;  3S9N A;  3T05 A;  1I12 A;  2PJ7 A;  4A4B A;  3LWU A;  1YR0 A;  4U9Y A;  1CE8 B;  3KZW A;  1YSJ A;  2Q43 A;  1ELL P;  5K8P A;  5J3X A;  4KVO E;  2AFO A;  3NH5 A;  3W6S A;  4EFD A;  1ZG7 A;  3D7D A;  4MMO A;  2EZC A;  2OOT A;  5BY0 A;  2G0B A;  3NH8 A;  1VGY A;  4M6G A;  4B13 A;  4CYO A;  1H8L A;  1NMT A;  4UWJ A;  3I3G A;  2GIV A;  5G20 A;  1ZL0 A;  1MJB A;  1J4J A;  2HB6 A;  5ELY A;  1EZB A;  1Y9K A;  2CNS A;  5EMI A;  2BL1 A;  4BBH A;  2JBJ A;  3BI0 A;  3H4Q A;  1UFH A;  4BPU B;  2G3A A;  3BLN A;  2EBJ A;  5A27 A;  3WR7 A;  2C27 A;  5KTD A;  2VL1 A;  4KUA A;  4CDJ A;  4F9U A;  3OB1 B;  1TF8 A;  2AJ6 A;  4PK2 A;  5F09 A;  3FBU A;  5AG7 A;  2ZPA A;  5J1Q A;  3ICU A;  5KTC A;  4H6U A;  5HXD A;  3BUO B;  1YGH A;  3QNV A;  4A94 A;  2PJB A;  1M4D A;  1XMB A;  2QML A;  3D2P A;  3PB9 X;  1R61 A;  2ZEL A;  4R7M A;  3HMJ G;  4FBE A;  1XOV A;  3FIX A;  1CBX A;  1IY7 A;  3QAY A;  5JH9 A;  3K2K A;  2XEJ A;  2YNE A;  3R1K A;  5IR2 A;  1X10 A;  1F57 A;  1XIX A;  4OP4 A;  3NE7 A;  2RC4 A;  3OWC A;  4ZY0 A;  1JWQ A;  3R96 A;  4OLL A;  2XEI A;  5LRG A;  3FNC A;  4UEF A;  3TX8 A;  2FL4 A;  3MRU A;  4EVY A;  5J8C A;  3FH4 A;  3QAH A;  4XPD B;  5GCN A;  1XBU A;  1Z8X A;  3FVL A;  3CT9 A;  2HUZ A;  1XF8 A;  1B6B A;  3N5F A;  2PJ3 A;  1LFW A;  1LOK A;  2FS5 A;  3GYA A;  2JEW A;  2ODF A;  3QB8 A;  4Z65 A;  3TE4 A;  2WUU A;  4UFW A;  1ZYM A;  3TYX A;  2EZA A;  4RS2 A;  4C9R A;  3IFE A;  2ZEG A;  3EC4 A;  5THW A;  4A37 A;  3H8E A;  2Z3L A;  3H8G A;  2ZEF A;  1KUY A;  3T8W A;  4EWT A;  4A95 A;  1UWY A;  3K4I A;  2ZOF A;  4YGO A;  3R9G A;  5K99 A;  1HDU A;  2Q4Y A;  5G1Z A;  3L2N A;  3PFO A;  5FVJ A;  2CIJ A;  2DPT A;  3DR8 A;  2XPL A;  5G22 A;  4CAF A;  4II9 A;  4YRH A; 
#chains in the Genus database with same CATH homology
 1EE3 P;  5LYD A;  2GRE A;  4MHN A;  4OC0 A;  4G1P A;  4MHY A;  3PB4 X;  3KHX A;  5K8M A;  3RAM A;  3H8F A;  2ZEN A;  4A39 A;  3SJF A;  3V7Z A;  1TKJ A;  2WZN A;  4JYW A;  3VAT A;  3D7F A;  4A38 A;  1ELM P;  4Q7A A;  3KR4 A;  6CPA A;  4H2K A;  4NGQ A;  1CP6 A;  1ZLH A;  1Q7L A;  1DTD A;  3FED A;  1Y0Y A;  2F7V A;  3ISZ A;  2PE3 A;  1KWM A;  5K8N A;  3SI0 A;  3B3S A;  4PXB A;  1LAP A;  4FAI A;  2C1C A;  4MCQ A;  1LAM A;  4ONW A;  2HC9 A;  1CPS A;  3CPA A;  4OC4 A;  4R76 A;  4UF4 A;  4MCS A;  3MN8 A;  4GM5 A;  3WT4 A;  1RTQ A;  2PRQ A;  5LRJ A;  2C6G A;  2RB7 A;  2GLJ A;  1ARL A;  1AYE A;  4OC2 A;  4ZYQ A;  4NGN A;  3HUV A;  2PJ5 A;  4C8C A;  3IC1 A;  2V8G A;  3PBB A;  3PRT A;  4MXU A;  3D67 A;  2PJ1 A;  3BI1 A;  4OID A;  1XRY A;  5CBM A;  2ZOG A;  3S9M A;  3B3C A;  2C6P A;  2XEF A;  3I1U A;  3JRU A;  3WC5 A;  4MHZ A;  1VHO A;  2RFH A;  4C99 A;  2V77 A;  4MCR A;  2GU2 A;  8CPA A;  5K8O A;  4W9Y A;  4P10 A;  5HVG A;  3D68 A;  4B6Z A;  3KAS A;  4C9A A;  2ZED A;  1FT7 A;  4YWY A;  3DGV A;  1TF9 A;  2AFM A;  3SJX A;  3VTA A;  1GYT A;  4AXV A;  5HVF A;  4TJV A;  2ANP A;  4IK2 A;  2PJA A;  4IHM A;  1WVM A;  3FX6 A;  2NYQ A;  4NGS A;  2GLF A;  4PXE A;  4O23 A;  4KNG E;  5JM6 A;  1CPX A;  3B3V A;  3IIB A;  5LYI A;  1CP7 A;  1HDQ A;  3SJG A;  4X3R A;  5LYL A;  1Z8L A;  3PEI A;  1VHE A;  3PB7 X;  5D8N A;  4P45 A;  4PQA A;  1ZG9 A;  1QMU A;  4F8Z A;  3KQX A;  4R6T A;  2O53 A;  2ZEH A;  4NGR A;  1BPN A;  2OR4 A;  1F2P A;  2AFU A;  3EIF A;  3FMC A;  2IMO A;  4NJR A;  3DLJ A;  3KL9 A;  1OBR A;  4P4F A;  1NSA A;  2I3C A;  1ZLI A;  4OC3 A;  1CG2 A;  1V6C A;  2ABZ A;  1CX8 A;  3B35 A;  3PB8 X;  3B3W A;  3FF3 A;  4UIB A;  2EK8 A;  1VIX A;  4UIA A;  2BOA A;  1PCA A;  1XJO A;  2QVP A;  4C8T A;  2V8V A;  4CDK A;  3PB6 X;  4PXC A;  1LAN A;  2IJZ A;  4BD9 A;  4DYO A;  5LYF A;  4CPA A;  2C6C A;  3VH9 A;  2PIY A;  4OIW A;  4EME A;  1JQG A;  2FVG A;  4ZY1 A;  4C9E A;  1ZG8 A;  2NSM A;  3GB0 A;  2PIZ A;  2J9A A;  4YU9 A;  5DS0 A;  4OKO A;  2WYR A;  7CPA A;  2IQ6 A;  1BPM A;  2ZEE A;  4IAV A;  3IEH A;  2PVV A;  1M4L A;  4MHP A;  3WAB A;  1YW6 A;  2PJ2 A;  3SI1 A;  1QQ9 A;  1Y0R A;  3K9T A;  3WC6 A;  4RUH A;  1F2O A;  2EWB A;  5CPA A;  4ZI6 A;  3B2Y A;  3GUX A;  2AFX A;  2GP4 A;  4TWE A;  2ZEP A;  4KSI A;  4OME A;  3BXM A;  3D66 A;  3RBU A;  3I74 A;  2PJ8 A;  2PVW A;  4NGM A;  1HEE A;  1YME A;  2PJ9 A;  2AFS A;  4P6Y A;  2ZEM A;  2Q4Z A;  3RZA A;  2AFW A;  3SI2 A;  3CDX A;  3SJE A;  4C86 A;  3VAR A;  5LRK A;  4OC1 A;  3KR5 A;  4FWU A;  4C85 A;  4CDJ A;  3NH4 A;  4NJQ A;  1Y9Z A;  4DJL A;  3KI9 A;  3PFE A;  2BO9 A;  3GLJ A;  4ZY2 A;  5D29 A;  1IGB A;  1R43 A;  3D7H A;  4OC5 A;  3S9L A;  4P4J A;  3B7I A;  4PXD A;  4P44 A;  2PJC A;  4UEZ A;  1YW4 A;  3LMS A;  3HLP A;  1FNO A;  3NFZ A;  2POK A;  1Z5R A;  1PYT B;  2CF4 A;  4WWV A;  4X8I A;  2PCU A;  3D4U A;  3IJ3 A;  2DEA A;  1TKF A;  4PPZ A;  4NGP A;  2BCO A;  5I4M A;  1AMP A;  1YLO A;  1LCP A;  2AFZ A;  2PJ0 A;  3FEC A;  1ARM A;  3B3T A;  2C5Q A;  4C8U A;  3BHX A;  4NFR A;  3KGQ A;  4P4I A;  1Z2L A;  4X2T A;  2PJ6 A;  3V38 A;  3NA6 A;  4DUK A;  3FEE A;  3ISX A;  3CPX A;  2G9D A;  2ZEO A;  4FUU A;  3KQZ A;  4P4D A;  4ZX9 A;  4NGT A;  2F8H A;  3TC8 A;  2XEG A;  2CTB A;  3D7G A;  2PJ4 A;  4R8F A;  4P4E A;  4P4B A;  3PBE A;  3FJU A;  4TJX A;  5JGF A;  4YN3 A;  2V8D A;  1DE4 C;  4K3N A;  4JZ0 A;  1XFO A;  1BLL E;  2QJ8 A;  4C8A A;  2O4H A;  4F9V A;  4C8P A;  3I6S A;  4C8F A;  2CTC A;  4C9U A;  3IO1 A;  2JBK A;  2Q51 A;  4UEE A;  4C84 A;  4C9V A;  4MCP A;  2QYV A;  1TXR A;  1BAV A;  5IB9 A;  4WJB A;  1Y7E A;  2V8H A;  4ZX8 A;  2EK9 A;  4LQG A;  1XF1 A;  1R3N A;  4TNU A;  3IWW A;  3WC7 A;  1TKH A;  3KHZ A;  5HVH A;  4MRI A;  3S9N A;  2PJ7 A;  3LWU A;  3KZW A;  1YSJ A;  2Q43 A;  1ELL P;  5K8P A;  2AFO A;  3NH5 A;  4EFD A;  1ZG7 A;  3D7D A;  4MMO A;  2OOT A;  3NH8 A;  1VGY A;  1H8L A;  2HB6 A;  5ELY A;  2JBJ A;  3BI0 A;  2VL1 A;  4F9U A;  1TF8 A;  5F09 A;  5J1Q A;  3ICU A;  5HXD A;  3QNV A;  4A94 A;  2PJB A;  1XMB A;  3PB9 X;  2ZEL A;  4R7M A;  4FBE A;  1CBX A;  1IY7 A;  5JH9 A;  3K2K A;  2XEJ A;  5IR2 A;  1F57 A;  4OP4 A;  4ZY0 A;  5LRG A;  2XEI A;  4UEF A;  3TX8 A;  3MRU A;  3FH4 A;  1XBU A;  3FVL A;  3CT9 A;  3N5F A;  2PJ3 A;  1LFW A;  1LOK A;  4Z65 A;  2JEW A;  4C9R A;  3IFE A;  2ZEG A;  5THW A;  4A37 A;  3H8E A;  3T8W A;  3H8G A;  2ZEF A;  4EWT A;  1UWY A;  2ZOF A;  1HDU A;  3L2N A;  3PFO A;  2CIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...