2C6GA

Membrane-bound glutamate carboxypeptidase ii (gcpii) with bound glutamate
Total Genus 240
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
240
sequence length
694
structure length
679
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
publication title Structure of glutamate carboxypeptidase II, a drug target in neuronal damage and prostate cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 240
structure length 679
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2c6gA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2c6gA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c6gA02
1AMPA 2G9DA 4F9UA 4FAIA 1FNOA 2FVGA 4K3NA 2ZEMA 4DJLA 1XF1A 4P4IA 2BOAA 5J1QA 1GYTA 5CPAA 3RAMA 2WZNA 3K9TA 2XEIA 2C6CA 2QVPA 4PQAA 5JM6A 1RTQA 4Q7AA 2F7VA 1F2OA 5IB9A 3KQXA 3NA6A 1XJOA 4OC1A 4C8UA 2PJBA 7CPAA 2GLFA 3WABA 1UWYA 2IQ6A 3D7HA 4P45A 3PBEA 1TKHA 1Y7EA 2ZELA 3VATA 5K8NA 3EIFA 3PRTA 3FJUA 3PB7X 2AFMA 1ZG7A 1QQ9A 4NGRA 4NGNA 3BHXA 3D7DA 2HC9A 3JRUA 3NH8A 1R3NA 3T8WA 4A39A 3PB4X 2BO9A 2PJCA 3KR4A 2C6PA 3VTAA 1PYTB 5ELYA 3I1UA 3B3SA 4NGMA 3ISXA 2PJ5A 3KHXA 4R7MA 3B3CA 1Q7LA 4IK2A 4C85A 5I4MA 2CTBA 2GREA 2I3CA 3CT9A 4C9AA 2ZEOA 3GUXA 3SJFA 4TJXA 2JBKA 1IGBA 3SJEA 1M4LA 4AXVA 1TF9A 4MMOA 1LANA 2O4HA 3NH4A 3V38A 1V6CA 4UEFA 5CBMA 2V8VA 4EFDA 2POKA 2Q43A 5F09A 2IJZA 4MCSA 3B35A 3KR5A 4OIWA 4NFRA 4KSIA 4LQGA 1F2PA 3HLPA 3WC5A 5DS0A 3FF3A 3D7FA 2RFHA 2WYRA 4NJRA 2ZOGA 4C8AA 1LAPA 4WWVA 3IIBA 4TJVA 3MN8A 4R76A 1LCPA 1PCAA 2ZEDA 2PVVA 4P4DA 2PJ8A 1HDQA 3PFOA 4MRIA 2AFOA 4DUKA 4C8TA 4UEEA 4C9VA 3D66A 2AFZA 4BD9A 2V77A 4MHYA 4EMEA 1DE4C 2PIYA 2PJ3A 2V8DA 2AFSA 2NSMA 1QMUA 3FX6A 4P4FA 3I74A 1ZG9A 3D68A 2PJ4A 1TKJA 3LWUA 4ZX8A 3IJ3A 1AYEA 4CDJA 1TXRA 4R8FA 4RUHA 4P6YA 4UF4A 2PJ0A 4ZYQA 2OR4A 4ONWA 2ZEEA 3RBUA 3B3WA 2V8HA 3B3VA 4YWYA 3SJGA 4UEZA 3V7ZA 2PE3A 3NFZA 4C8CA 2JEWA 3ISZA 3KL9A 3PB9X 4UIBA 4YU9A 1HEEA 2PJ6A 2EK8A 3VARA 2PRQA 4A38A 3D67A 3WT4A 1CPSA 2PIZA 1TF8A 1Z2LA 4KNGE 1ELLP 2O53A 5K8OA 4W9YA 4NGQA 8CPAA 2C1CA 2AFUA 4P10A 4C9EA 2DEAA 3PFEA 1VIXA 4C9UA 4MCQA 2VL1A 1ELMP 4JZ0A 4NGSA 4MHZA 3KHZA 4MCRA 3D4UA 4H2KA 5HVGA 4X3RA 2C6GA 4C86A 1CG2A 1ZG8A 5JH9A 2CTCA 4C84A 1YSJA 1TKFA 4OC3A 3S9MA 4C9RA 2EK9A 1VGYA 5THWA 4CPAA 4ZX9A 4X2TA 4OC5A 4P4BA 2ZENA 1F57A 2XEFA 3SJXA 4A94A 2PJ7A 1VHEA 3GB0A 1BPMA 2PJ2A 1OBRA 3H8EA 1CBXA 2ZEHA 3FH4A 3BI0A 2XEJA 3FECA 2RB7A 4EWTA 1ZLIA 4MXUA 3TX8A 3KASA 3N5FA 4P4JA 5LYDA 4ZY0A 1XMBA 2Q4ZA 2F8HA 2NYQA 4G1PA 4UIAA 1Z8LA 3IEHA 3KGQA 1CX8A 4OC0A 2Q51A 1DTDA 1KWMA 4IHMA 3PEIA 3IO1A 3KQZA 4F9VA 1XRYA 3PB8X 2PCUA 4ZY1A 3PB6X 4DYOA 3WC6A 3D7GA 4NGTA 4WJBA 1CPXA 3KZWA 4GM5A 1XBUA 3LMSA 3MRUA 5LRJA 5HVFA 4MHNA 1HDUA 2CF4A 4R6TA 4B6ZA 3FEDA 2QJ8A 5JGFA 3FEEA 3I6SA 1YW6A 2ANPA 5D8NA 3VH9A 4PXBA 4PXEA 4NGPA 5HXDA 5K8MA 2PJ1A 3QNVA 4CDKA 2QYVA 3B3TA 1BAVA 4C8FA 4O23A 4MHPA 4OP4A 3S9NA 1ARMA 1BLLE 5HVHA 1H8LA 2V8GA 4JYWA 3H8GA 2AFWA 1ARLA 1CP6A 1Y0YA 2J9AA 2EWBA 1VHOA 3BXMA 2XEGA 3IC1A 3WC7A 4P4EA 3L2NA 1WVMA 1JQGA 4Z65A 2GU2A 3NH5A 3B7IA 3HUVA 2ZEPA 3TC8A 4ZY2A 2GLJA 2ZEGA 1EE3P 1XFOA 3RZAA 2AFXA 3S9LA 4ZI6A 2ZEFA 4C99A 1LAMA 2ZOFA 2ABZA 1Z5RA 1R43A 4PXCA 4X8IA 1NSAA 4YN3A 3ICUA 5D29A 3KI9A 3SI2A 4OKOA 3FMCA 5LYFA 2BCOA 3IWWA 4TNUA 2OOTA 3IFEA 3CPXA 1LFWA 4FWUA 3CPAA 5LRGA 1BPNA 1YW4A 1ZLHA 1Y0RA 1FT7A 1Y9ZA 4MCPA 3GLJA 2CIJA 5LRKA 2JBJA 1LOKA 3DGVA 4OMEA 4TWEA 3PBBA 2IMOA 4OC2A 2PJAA 4OIDA 2PVWA 4A37A 4FUUA 3SI0A 1YLOA 3CDXA 1YMEA 4F8ZA 5LYLA 1CP7A 3H8FA 3K2KA 2HB6A 3SI1A 4FBEA 4C8PA 5K8PA 3B2YA 4IAVA 4PXDA 3DLJA 3FVLA 5LYIA 1IY7A 4NJQA 4P44A 3BI1A 6CPAA 2PJ9A 4OC4A 4PPZA
chains in the Genus database with same CATH superfamily
1AMPA 1CM0A 2G9DA 4JWPA 4UCMA 4Y49C 4F9UA 1MJBA 4FAIA 1FNOA 3VGOA 1IYKA 2I79A 2FVGA 4K3NA 4OLLA 4PV6A 4XPKA 3U88C 1VHSA 2ZEMA 2PR1A 2R1IA 1EZAA 4DJLA 4KOTA 2UV8G 2Q0YA 5AGEA 2EO8A 2H5MA 1XF1A 4P4IA 2B4JC 2FE7A 3VRNA 5HKYA 2BOAA 1KEEB 1P4NA 4MHDA 5J1QA 1GYTA 5CPAA 2AUNA 3RAMA 4RN7A 2JDCA 3EZEA 2HI6A 2WZNA 2Q4VA 1X10A 3LACA 3TFYA 3K9TA 2XEIA 2C6CA 3PT1A 1KUYA 2QVPA 4OADA 4PQAA 2Y1NA 1RTQA 5IX3A 2Y0MA 4Q7AA 1Y7RA 2F7VA 1F2OA 4E5SA 4MFQA 2J8RA 5IB9A 1X12A 4IIYA 3F5BA 2PQ8A 3SXNA 3KQXA 3NA6A 1XJOA 4OC1A 4C8UA 4MFLA 2Z3OA 2PJBA 7CPAA 4NXYA 2GLFA 5AXIA 3WABA 1AUGA 1UWYA 2IQ6A 3D7HA 4P45A 3RYOA 3PBEA 3SR3A 1YVOA 2KCWA 1TKHA 3NE8A 3OB2B 3R95A 1C30B 1Y7EA 2ZELA 3VATA 4FD6A 5K8NA 4PK3A 1DIKA 4B13A 3PRTA 4KUAA 5AG5A 2GE3A 2D0PA 4R9MA 1EZBA 3FJUA 1QSOA 3BLNA 3PB7X 4JD6A 2AFMA 1ZG7A 1QQ9A 4JXQA 5F9MA 1RO5A 3PFVA 4NGRA 1I1DA 1BO4A 4NGNA 2CXAA 4F0XA 1J4JA 1JDBC 1GGOA 3BHXA 3D7DA 3K9UA 5G21A 2HC9A 3JRUA 2YNEA 1FY7A 3FB3A 4KLVA 4I49A 3NH8A 4LQ6A 1R3NA 3T8WA 4A39A 4E8OA 3PB4X 3T5MA 1NXJA 3WR7A 2YGWA 2BO9A 3IU2A 3TCVA 4CAVA 2D4OA 2PJCA 3TYXA 3HPGG 1OZPA 3KR4A 1FBVA 2C6PA 3QB8A 4E0AA 3VTAA 1PYTB 3S6FA 5ELYA 2NMTA 3B3SA 3I1UA 2WPWA 3GYAA 4CAEA 4NGMA 4MJXA 3ISXA 2HROA 2PJ5A 1IICA 3KHXA 4BINA 4R7MA 1BXRB 1B87A 4RS2A 3I9SA 3B3CA 5GCNA 2G0BA 1Q7LA 3FYNA 5JM6A 2WUUA 4IK2A 4R3LA 3EZBA 4B5PA 2Q04A 3S6KA 3VRPA 1SQHA 4Q36A 4J3GA 5EMIA 4C85A 4C2YA 2CTBA 5I4MA 1KUXA 4ZGYB 1S7FA 5C88A 4L89A 2GREA 4UFWA 4E94A 2I3CA 3CT9A 5G20A 4B5PB 3EZAA 2REEA 2B3VA 1YREA 2F5IA 1NSLA 3EO4A 4C9AA 4R57A 2ZEOA 3GUXA 3SJFA 1I12A 5J8FA 5K99A 1RXTA 3FXTA 4MBUA 5E96A 2FIWA 4TJXA 4II9A 3DNSA 4IUSA 1A9XB 2XPNA 2JBKA 1IGBA 2I00A 2VEZA 3SJEA 3UY5A 4M85A 1M4LA 5JVLA 4AXVA 1YVKA 1TF9A 4A95A 3TLYA 4MMOA 1LANA 2O4HA 3NH4A 3V38A 1V6CA 4UEFA 5CBMA 2V8VA 4EFDA 2POKA 2MP0A 2Q43A 1ZRSA 2EZAA 5F09A 4UCPA 4UWJA 3HMJG 2IJZA 3LD2A 4MCSA 1XF8A 2B3UA 3B35A 3KR5A 4QVTA 2OLSA 4OIWA 2ARHA 4NFRA 4KSIA 3EY5A 2GP4A 1B47A 4LQGA 2RC4A 1F2PA 3HLPA 5JPHA 3WC5A 5DS0A 3GIUA 3FF3A 3D7FA 2RFHA 5DWNA 2WYRA 2EUIA 1QSMA 4NJRA 2ZOGA 4H6UA 5FVJA 2X0SA 4C8AA 1Q2YA 2FL4A 1LAPA 4WWVA 3IIBA 4TJVA 3MN8A 4R76A 1LCPA 2B58A 3OP0A 1ZL0A 1PCAA 2ZEDA 4U5YA 4EVYA 5A28A 3BJ8A 2PVVA 4P4DA 1MK4A 4MY0A 4CYNA 2XPPA 2JLMA 1Z4RA 2PJ8A 1WK4A 4J0NA 1HDQA 5BY0A 4CGLA 4B5OA 2CNSA 1MJAA 1IIDA 2Z0ZA 2QIRA 2AFOA 2ZW5A 3PFOA 4BTFA 4MRIA 3RNZA 4DUKA 4C8TA 4UEEA 2ZW7A 4BPWB 4M6IA 4C9VA 4COGA 2PR8A 2AFZA 2J8MA 1I21A 3D66A 4BD9A 4F6AA 3IU1A 4CO9A 2Y1MA 3BUXB 1YR0A 1JDEA 3TLGB 3R96A 2V77A 4XNHC 1EO0A 3D8PA 5ISVA 1M4DA 1YVHA 4MHYA 4EMEA 1DE4C 1WJTA 2FXFA 2PIYA 2PJ3A 1BOBA 2AFSA 2FS5A 2NSMA 1QMUA 2V8DA 3DDDA 3FX6A 3E0KA 4P4FA 4M6HA 1S7LA 3BUOB 3I74A 1ZG9A 3NFQA 3OAKA 2YNCA 3ZNIA 3D68A 5AG4A 5F5XA 2PJ4A 1TKJA 4CZ1A 4OAEA 3LWUA 4ZX8A 3IJ3A 3R9GA 1AYEA 2BUEA 4R3KA 4CDJA 1TXRA 2BL1A 4R8FA 3SXOA 4RUHA 2YJVA 4P6YA 3TOAA 4UF4A 4MFZA 2PJ0A 4ZYQA 1YX0A 2OR4A 3PP9A 2Z3MA 1MJ9A 4U9ZA 1UFHA 4KSAA 4ONWA 2ZEEA 3RBUA 2OZUA 4MI1A 2BSWA 1M1DA 4KLWA 4B12A 3B3WA 1VBHA 2V8HA 1S3ZA 3B3VA 4YWYA 3SJGA 2EBJA 1P0HA 2YNCC 2PE3A 4JXRA 3NFZA 4UEZA 3V7ZA 4AG9A 4C8CA 2JEWA 3ISZA 3KL9A 3PB9X 4KOXA 4UIBA 4YU9A 1IU8A 3RO0A 1HEEA 2PJ6A 5H84A 3TLBA 2FCKA 2EK8A 4CRZB 4RI1A 4FD5A 3VARA 2PRQA 4C7HA 4A38A 3D67A 3WT4A 4F0YA 1CPSA 2PIZA 1TF8A 1Z2LA 4KNGE 2CY2A 4AG7A 1XE4A 4M3SA 2R82A 1VBGA 1ELLP 2O53A 5K8OA 4JLYA 4W9YA 4NGQA 5J3XA 4JVOA 8CPAA 2Q4YA 2C1CA 2AFUA 4P10A 3T05A 4C9EA 2DEAA 1XMTA 4GPLB 4LUAA 1L0CA 2HWGA 1T36B 3VROA 5J8CA 2EVNA 2Q44A 3PFEA 1VIXA 2GFQA 4C68A 1S60A 4CYPA 3V8IA 4C9UA 3O8ZA 4KORA 2J8NA 4MCQA 1Z8TA 2VL1A 1ELMP 4UWIA 4M8DA 3TLZA 4JZ0A 4NGSA 5EBVA 3KKWA 4HNXB 2VBQA 3T07A 4MHZA 3KHZA 4H6ZA 4MY3A 2DPTA 4MCRA 3D4UA 4H2KA 2D4PA 3GJZA 1M6VB 4BPXB 2HV2A 2BEIA 3DR8A 3N7ZA 5HVGA 1J3LA 3TO7A 4X3RA 2A4NA 2C6GA 2YJTA 4KOVA 4C86A 1TIQA 4MFKA 1XEBA 1CG2A 2O28A 4COBA 1IOIA 2OU2A 1ZG8A 3JVNA 4Q38A 2XPOA 5JH9A 5G22A 2CTCA 2E28A 3CZXA 1M4GA 4B11A 3ZJ0A 4C84A 1Y9KA 2DXQA 2XPLA 1YQEA 1YSJA 3TLEA 1TKFA 4OC3A 3S9MA 2VZYA 3ZZIA 1QSNA 5F49A 4C9RA 5KTAA 1N71A 2EK9A 1VGYA 5THWA 3T90A 4XPDB 4CPAA 5HKZA 3S6HA 2D0OA 3C8OA 2PSWA 4ZX9A 4KZTA 4UFVA 3OWCA 4X2TA 1KUVA 2EZBA 4OC5A 1A2ZA 4P4BA 2JDDA 1IB1E 2ZENA 1YGHA 1F57A 2XEFA 2FIAA 4KOSA 3T0TA 3SJXA 5IB0A 4A94A 2QMLA 4CAXA 2VXKA 3PGPA 5AG7A 5FD8A 2OZHA 2VKZG 1Y9WA 4KUBA 5F1YA 3FBUA 3LODA 4IF5A 2PJ7A 1VI4A 3KRVA 1U6MA 4A32A 1VHEA 2Z3KA 4QB9A 3A9LA 3VRQA 3GB0A 1Z8XA 1BPMA 2C27A 2HUZA 2PJ2A 1OBRA 3IWGA 3CXSA 1KBLA 2FT0A 4KOUA 4KVME 3H8EA 1CBXA 3DR6A 4CAFA 1QSTA 3W91A 2ZEHA 3JTKA 4NCZA 1R61A 1QSRA 2GANA 3FH4A 4AB7A 3BI0A 2P6FA 2XEJA 1VKCA 2PC1A 3FECA 5DWMA 5BWAB 3W6SA 2JEVA 4K30A 2RB7A 4EWTA 1ZLIA 3VWEA 4MXUA 1YK3A 3R9FA 3TX8A 2OH1A 3KASA 2ATRA 3N5FA 4BMHA 4P4JA 4M6GA 5LYDA 3TO6A 2CNTA 4ZY0A 2QECA 1Q5XA 4UA3A 5F47A 1XMBA 2CBLA 2DPSA 2Q4ZA 1CJWA 2F8HA 2WSAA 2B5GA 2REFA 4HNYB 2NYQA 3QAHA 4G1PA 4UIAA 1Z8LA 3IEHA 3KGQA 4B14A 1CX8A 4OC0A 1KZFA 2Q51A 1DTDA 4CYOA 3TLAA 1KWMA 3G3SA 4IHMA 3PEIA 5F48A 3IO1A 3KQZA 4NSQA 4HKFA 1XRYA 2PCUA 3PB8X 4FD4A 4A30A 4F9VA 3PB6X 4L8AA 4DYOA 3B8GA 3D7GA 4NGTA 3WC6A 4AVBA 3FNCA 2Z11A 2ZPAA 3MGDA 2P0WA 2K5TA 4X5KA 4WJBA 1CPXA 3KZWA 4GM5A 1XBUA 3D2MA 3LMSA 3F8KA 3MRUA 4KOWA 5HVFA 4MHNA 2P6EA 5LRJA 4A33A 2R7HA 1HDUA 3D3SA 2Z3LA 3QAYA 4R87A 2HQYA 2CF4A 4R6TA 4B6ZA 4EYSA 3PZJA 3FEDA 1IOFA 2QJ8A 3TO9A 4CGOA 3FEEA 5JGFA 4CAWA 3I6SA 1YW6A 1Z9UA 1V0CA 2ANPA 5D8NA 5IR2A 3BUMB 2DF5A 3VH9A 3IGRA 2C5QA 4PXBA 2OB0A 4PXEA 4NGPA 4H1HA 5HXDA 1CS0B 5K8MA 3GY9A 1NE9A 2Z10A 1PUAA 2PJ1A 3QNVA 4QUSA 4XPLA 4CDKA 2VQYA 2QYVA 3JUWA 4UCNA 4CGNA 2VI7A 3PLFB 3B3TA 1YLEA 1Z9EA 2DLAA 1BAVA 2X7BA 4A31A 4A4CA 2CNMA 2Q7BA 4QBJA 4O23A 4C8FA 1JWQA 4MHPA 4YRHA 4OP4A 5HKWA 4A4BA 1GHEA 2B4DA 3T9YA 3W6XA 2R98A 3S9NA 1ARMA 1BLLE 4U9YA 5HVHA 1NBWA 2WPXA 1H8LA 2V8GA 4PSXA 5F13A 4JYWA 3H8GA 2P6GA 2B4DB 4KOYA 3TOBA 4CGMA 2AFWA 3H4QA 4MI4A 4C2ZA 4BPUB 1ARLA 3S6GA 5F46A 1CP6A 1Y0YA 4YFJA 2J9AA 2EWBA 3EC4A 3TE4A 4CRYB 2PRBA 2Q7SA 3FRMA 2Z3PA 4MJ8A 3TT2A 1VHOA 3NOJA 3BXMA 4CYQA 3HPHE 1ON0A 2XEGA 2G3TA 3IC1A 3F9KC 3P2FA 3WC7A 5IV0A 4P4EA 4FD7A 4PK2A 1B6BA 4GXHA 3L2NA 4RR2B 1M44A 2IL4A 2AJ6A 1WVMA 4QC6A 1JQGA 2PDOA 4Z65A 2GU2A 3NH5A 3B7IA 3DSBA 3HUVA 4KVXA 2ZEPA 5HH1A 1ZYMA 2ODFA 4ZY2A 3TC8A 2GLJA 4JJXA 2ZW6A 2ZEGA 1EE3P 1XFOA 4KS9A 5CNPA 2AFXA 3BJ7A 3RZAA 5A27A 3S9LA 4ZI6A 2ZEFA 3BUWB 4C99A 3R9EA 4MFPA 2DIKA 4BBHA 1LAMA 4UBRA 1NMTA 2ZOFA 2ABZA 1XIXA 3TLCA 1Z5RA 3K4IA 2VZZA 1R43A 2YNDA 1Z8WA 1S5KA 4C7IA 5EC4A 4PXCA 4ORFA 4X8IA 1NSAA 1IYLA 4KVOE 4GS4A 3D2PA 4YGOA 3EFAA 4NEXA 3ICUA 4YN3A 5D29A 3KI9A 3SI2A 3VRRA 5C82A 1PU9A 5HMNA 1KC7A 4OKOA 3FMCA 4XPDC 5LYFA 2BCOA 5KTCA 3IWWA 2PCNA 1S7KA 1K4JA 4TNUA 2Z3NA 4ONUA 2R8VA 2OOTA 3IFEA 3SHPA 2AE6A 2ZW4A 3CXPA 3NE7A 4ZY1A 4IIXA 3CPXA 1LFWA 4FWUA 4NF1A 3CPAA 1Q2CA 5LRGA 3TTHA 1C3OB 1BPNA 1YW4A 1ZLHA 1Y0RA 5JQ4A 1FT7A 4HNWB 1LRZA 1Y9ZA 4MCPA 3GLJA 2B0AA 5JYBA 2CIJA 5LRKA 2JBJA 1LOKA 3DGVA 4OMEA 3H5ZA 3PBBA 4MFJA 4H89A 3G8WA 4TWEA 2IMOA 4OC2A 4AVCA 2GIVA 2PJAA 3VWDA 5H86A 3FIXA 4OIDA 2PVWA 1ZO0A 1XOVA 4KSFA 4A37A 4FUUA 3SI0A 1YLOA 3CDXA 1YMEA 4F8ZA 5LYLA 4CS0B 2G3AA 3CXQA 3P2HA 1CP7A 3H8FA 2N3AB 4HPSA 3U1BA 3K2KA 2HB6A 3SI1A 4FBEA 4C2XA 4C8PA 4DNCA 5KTDA 5K8PA 4B10A 1S7NA 3B2YA 3C26A 3BUNB 4IAVA 2EZCA 2B4BA 1WWZA 2OZGA 3EIFA 3GKRA 4PSWA 4CGPA 4PXDA 5I0CA 3DLJA 1CE8B 3F0AA 3FVLA 2AUMA 3I3GA 4UFXA 5LYIA 4AVAA 1R57A 2B5GB 1IY7A 4Y49B 5G1ZA 4NJQA 3EXNA 4P44A 2ZXVA 4E2AA 3G23A 5AG6A 3BI1A 4XNHB 4A2ZA 6CPAA 2FSRA 2PJ9A 4OC4A 4ZBGA 4INJA 2FM4A 4PPZA 3TLGA 4LX9A 3OB1B 1M4IA 1Q2DA 1Z4EA 3R1KA 3IWEA
chains in the Genus database with same CATH topology
1AMPA 2G9DA 4F9UA 4FAIA 1FNOA 2FVGA 4K3NA 2ZEMA 4DJLA 1XF1A 4P4IA 2BOAA 5J1QA 1GYTA 5CPAA 3RAMA 2WZNA 3K9TA 2XEIA 2C6CA 2QVPA 4PQAA 5JM6A 1RTQA 4Q7AA 2F7VA 1F2OA 5IB9A 3KQXA 3NA6A 1XJOA 4OC1A 4C8UA 2PJBA 7CPAA 2GLFA 3WABA 1UWYA 2IQ6A 3D7HA 4P45A 3PBEA 1TKHA 1Y7EA 2ZELA 3VATA 5K8NA 3EIFA 3PRTA 3FJUA 3PB7X 2AFMA 1ZG7A 1QQ9A 4NGRA 4NGNA 3BHXA 3D7DA 2HC9A 3JRUA 3NH8A 1R3NA 3T8WA 4A39A 3PB4X 2BO9A 2PJCA 3KR4A 2C6PA 3VTAA 1PYTB 5ELYA 3I1UA 3B3SA 4NGMA 3ISXA 2PJ5A 3KHXA 4R7MA 3B3CA 1Q7LA 4IK2A 4C85A 5I4MA 2CTBA 2GREA 2I3CA 3CT9A 4C9AA 2ZEOA 3GUXA 3SJFA 4TJXA 2JBKA 1IGBA 3SJEA 1M4LA 4AXVA 1TF9A 4MMOA 1LANA 2O4HA 3NH4A 3V38A 1V6CA 4UEFA 5CBMA 2V8VA 4EFDA 2POKA 2Q43A 5F09A 2IJZA 4MCSA 3B35A 3KR5A 4OIWA 4NFRA 4KSIA 2GP4A 4LQGA 1F2PA 3HLPA 3WC5A 5DS0A 3FF3A 3D7FA 2RFHA 2WYRA 4NJRA 2ZOGA 4C8AA 1LAPA 4WWVA 3IIBA 4TJVA 3MN8A 4R76A 1LCPA 1PCAA 2ZEDA 2PVVA 4P4DA 2PJ8A 1HDQA 3PFOA 4MRIA 2AFOA 4DUKA 4C8TA 4UEEA 4C9VA 3D66A 2AFZA 4BD9A 2V77A 4MHYA 4EMEA 1DE4C 2PIYA 2PJ3A 2V8DA 2AFSA 2NSMA 1QMUA 3FX6A 4P4FA 3I74A 1ZG9A 3D68A 2PJ4A 1TKJA 3LWUA 4ZX8A 3IJ3A 1AYEA 4CDJA 1TXRA 4R8FA 4RUHA 4P6YA 4UF4A 2PJ0A 4ZYQA 2OR4A 4ONWA 2ZEEA 3RBUA 3B3WA 2V8HA 3B3VA 4YWYA 3SJGA 4UEZA 3V7ZA 2PE3A 3NFZA 4C8CA 2JEWA 3ISZA 3KL9A 3PB9X 4UIBA 4YU9A 1HEEA 2PJ6A 2EK8A 3VARA 2PRQA 4A38A 3D67A 3WT4A 1CPSA 2PIZA 1TF8A 1Z2LA 4KNGE 1ELLP 2O53A 5K8OA 4W9YA 4NGQA 8CPAA 2C1CA 2AFUA 4P10A 4C9EA 2DEAA 3PFEA 1VIXA 4C9UA 4MCQA 2VL1A 1ELMP 4JZ0A 4NGSA 4MHZA 3KHZA 4MCRA 3D4UA 4H2KA 5HVGA 4X3RA 2C6GA 4C86A 1CG2A 1ZG8A 5JH9A 2CTCA 4C84A 1YSJA 1TKFA 4OC3A 3S9MA 4C9RA 2EK9A 1VGYA 5THWA 4CPAA 4ZX9A 4X2TA 4OC5A 4P4BA 2ZENA 1F57A 2XEFA 3SJXA 4A94A 2PJ7A 1VHEA 3GB0A 1BPMA 2PJ2A 1OBRA 3H8EA 1CBXA 2ZEHA 3FH4A 3BI0A 2XEJA 3FECA 2RB7A 4EWTA 1ZLIA 4MXUA 3TX8A 3KASA 3N5FA 4P4JA 5LYDA 4ZY0A 1XMBA 2Q4ZA 2F8HA 2NYQA 4G1PA 4UIAA 1Z8LA 3IEHA 3KGQA 1CX8A 4OC0A 2Q51A 1DTDA 1KWMA 4IHMA 3PEIA 3IO1A 3KQZA 4F9VA 1XRYA 3PB8X 2PCUA 4ZY1A 3PB6X 4DYOA 3WC6A 3D7GA 4NGTA 4WJBA 1CPXA 3KZWA 4GM5A 1XBUA 3LMSA 3MRUA 5LRJA 5HVFA 4MHNA 1HDUA 2CF4A 4R6TA 4B6ZA 3FEDA 2QJ8A 5JGFA 3FEEA 3I6SA 1YW6A 2ANPA 5D8NA 5IR2A 3VH9A 2C5QA 4PXBA 4PXEA 4NGPA 5HXDA 5K8MA 2PJ1A 3QNVA 4CDKA 2QYVA 3B3TA 1BAVA 4C8FA 4O23A 4MHPA 4OP4A 3S9NA 1ARMA 1BLLE 5HVHA 1H8LA 2V8GA 4JYWA 3H8GA 2AFWA 1ARLA 1CP6A 1Y0YA 2J9AA 2EWBA 1VHOA 3BXMA 2XEGA 3IC1A 3WC7A 4P4EA 3L2NA 1WVMA 1JQGA 4Z65A 2GU2A 3NH5A 3B7IA 3HUVA 2ZEPA 3TC8A 4ZY2A 2GLJA 2ZEGA 1EE3P 1XFOA 3RZAA 2AFXA 3S9LA 4ZI6A 2ZEFA 4C99A 1LAMA 2ZOFA 2ABZA 1Z5RA 1R43A 4PXCA 4X8IA 1NSAA 4YN3A 3ICUA 5D29A 3KI9A 3SI2A 4OKOA 3FMCA 5LYFA 2BCOA 3IWWA 4TNUA 2OOTA 3IFEA 3CPXA 1LFWA 4FWUA 3CPAA 5LRGA 1BPNA 1YW4A 1ZLHA 1Y0RA 1FT7A 1Y9ZA 4MCPA 3GLJA 2CIJA 5LRKA 2JBJA 1LOKA 3DGVA 4OMEA 4TWEA 3PBBA 2IMOA 4OC2A 2PJAA 4OIDA 2PVWA 4A37A 4FUUA 3SI0A 1YLOA 3CDXA 1YMEA 4F8ZA 5LYLA 1CP7A 3H8FA 3K2KA 2HB6A 3SI1A 4FBEA 4C8PA 5K8PA 3B2YA 4IAVA 4PXDA 3DLJA 3FVLA 5LYIA 1IY7A 4NJQA 4P44A 3BI1A 6CPAA 2PJ9A 4OC4A 4PPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AMP A;  2G9D A;  4F9U A;  4FAI A;  1FNO A;  2FVG A;  4K3N A;  2ZEM A;  4DJL A;  1XF1 A;  4P4I A;  2BOA A;  5J1Q A;  1GYT A;  5CPA A;  3RAM A;  2WZN A;  3K9T A;  2XEI A;  2C6C A;  2QVP A;  4PQA A;  5JM6 A;  1RTQ A;  4Q7A A;  2F7V A;  1F2O A;  5IB9 A;  3KQX A;  3NA6 A;  1XJO A;  4OC1 A;  4C8U A;  2PJB A;  7CPA A;  2GLF A;  3WAB A;  1UWY A;  2IQ6 A;  3D7H A;  4P45 A;  3PBE A;  1TKH A;  1Y7E A;  2ZEL A;  3VAT A;  5K8N A;  3EIF A;  3PRT A;  3FJU A;  3PB7 X;  2AFM A;  1ZG7 A;  1QQ9 A;  4NGR A;  4NGN A;  3BHX A;  3D7D A;  2HC9 A;  3JRU A;  3NH8 A;  1R3N A;  3T8W A;  4A39 A;  3PB4 X;  2BO9 A;  2PJC A;  3KR4 A;  2C6P A;  3VTA A;  1PYT B;  5ELY A;  3I1U A;  3B3S A;  4NGM A;  3ISX A;  2PJ5 A;  3KHX A;  4R7M A;  3B3C A;  1Q7L A;  4IK2 A;  4C85 A;  5I4M A;  2CTB A;  2GRE A;  2I3C A;  3CT9 A;  4C9A A;  2ZEO A;  3GUX A;  3SJF A;  4TJX A;  2JBK A;  1IGB A;  3SJE A;  1M4L A;  4AXV A;  1TF9 A;  4MMO A;  1LAN A;  2O4H A;  3NH4 A;  3V38 A;  1V6C A;  4UEF A;  5CBM A;  2V8V A;  4EFD A;  2POK A;  2Q43 A;  5F09 A;  2IJZ A;  4MCS A;  3B35 A;  3KR5 A;  4OIW A;  4NFR A;  4KSI A;  4LQG A;  1F2P A;  3HLP A;  3WC5 A;  5DS0 A;  3FF3 A;  3D7F A;  2RFH A;  2WYR A;  4NJR A;  2ZOG A;  4C8A A;  1LAP A;  4WWV A;  3IIB A;  4TJV A;  3MN8 A;  4R76 A;  1LCP A;  1PCA A;  2ZED A;  2PVV A;  4P4D A;  2PJ8 A;  1HDQ A;  3PFO A;  4MRI A;  2AFO A;  4DUK A;  4C8T A;  4UEE A;  4C9V A;  3D66 A;  2AFZ A;  4BD9 A;  2V77 A;  4MHY A;  4EME A;  1DE4 C;  2PIY A;  2PJ3 A;  2V8D A;  2AFS A;  2NSM A;  1QMU A;  3FX6 A;  4P4F A;  3I74 A;  1ZG9 A;  3D68 A;  2PJ4 A;  1TKJ A;  3LWU A;  4ZX8 A;  3IJ3 A;  1AYE A;  4CDJ A;  1TXR A;  4R8F A;  4RUH A;  4P6Y A;  4UF4 A;  2PJ0 A;  4ZYQ A;  2OR4 A;  4ONW A;  2ZEE A;  3RBU A;  3B3W A;  2V8H A;  3B3V A;  4YWY A;  3SJG A;  4UEZ A;  3V7Z A;  2PE3 A;  3NFZ A;  4C8C A;  2JEW A;  3ISZ A;  3KL9 A;  3PB9 X;  4UIB A;  4YU9 A;  1HEE A;  2PJ6 A;  2EK8 A;  3VAR A;  2PRQ A;  4A38 A;  3D67 A;  3WT4 A;  1CPS A;  2PIZ A;  1TF8 A;  1Z2L A;  4KNG E;  1ELL P;  2O53 A;  5K8O A;  4W9Y A;  4NGQ A;  8CPA A;  2C1C A;  2AFU A;  4P10 A;  4C9E A;  2DEA A;  3PFE A;  1VIX A;  4C9U A;  4MCQ A;  2VL1 A;  1ELM P;  4JZ0 A;  4NGS A;  4MHZ A;  3KHZ A;  4MCR A;  3D4U A;  4H2K A;  5HVG A;  4X3R A;  2C6G A;  4C86 A;  1CG2 A;  1ZG8 A;  5JH9 A;  2CTC A;  4C84 A;  1YSJ A;  1TKF A;  4OC3 A;  3S9M A;  4C9R A;  2EK9 A;  1VGY A;  5THW A;  4CPA A;  4ZX9 A;  4X2T A;  4OC5 A;  4P4B A;  2ZEN A;  1F57 A;  2XEF A;  3SJX A;  4A94 A;  2PJ7 A;  1VHE A;  3GB0 A;  1BPM A;  2PJ2 A;  1OBR A;  3H8E A;  1CBX A;  2ZEH A;  3FH4 A;  3BI0 A;  2XEJ A;  3FEC A;  2RB7 A;  4EWT A;  1ZLI A;  4MXU A;  3TX8 A;  3KAS A;  3N5F A;  4P4J A;  5LYD A;  4ZY0 A;  1XMB A;  2Q4Z A;  2F8H A;  2NYQ A;  4G1P A;  4UIA A;  1Z8L A;  3IEH A;  3KGQ A;  1CX8 A;  4OC0 A;  2Q51 A;  1DTD A;  1KWM A;  4IHM A;  3PEI A;  3IO1 A;  3KQZ A;  4F9V A;  1XRY A;  3PB8 X;  2PCU A;  4ZY1 A;  3PB6 X;  4DYO A;  3WC6 A;  3D7G A;  4NGT A;  4WJB A;  1CPX A;  3KZW A;  4GM5 A;  1XBU A;  3LMS A;  3MRU A;  5LRJ A;  5HVF A;  4MHN A;  1HDU A;  2CF4 A;  4R6T A;  4B6Z A;  3FED A;  2QJ8 A;  5JGF A;  3FEE A;  3I6S A;  1YW6 A;  2ANP A;  5D8N A;  3VH9 A;  4PXB A;  4PXE A;  4NGP A;  5HXD A;  5K8M A;  2PJ1 A;  3QNV A;  4CDK A;  2QYV A;  3B3T A;  1BAV A;  4C8F A;  4O23 A;  4MHP A;  4OP4 A;  3S9N A;  1ARM A;  1BLL E;  5HVH A;  1H8L A;  2V8G A;  4JYW A;  3H8G A;  2AFW A;  1ARL A;  1CP6 A;  1Y0Y A;  2J9A A;  2EWB A;  1VHO A;  3BXM A;  2XEG A;  3IC1 A;  3WC7 A;  4P4E A;  3L2N A;  1WVM A;  1JQG A;  4Z65 A;  2GU2 A;  3NH5 A;  3B7I A;  3HUV A;  2ZEP A;  3TC8 A;  4ZY2 A;  2GLJ A;  2ZEG A;  1EE3 P;  1XFO A;  3RZA A;  2AFX A;  3S9L A;  4ZI6 A;  2ZEF A;  4C99 A;  1LAM A;  2ZOF A;  2ABZ A;  1Z5R A;  1R43 A;  4PXC A;  4X8I A;  1NSA A;  4YN3 A;  3ICU A;  5D29 A;  3KI9 A;  3SI2 A;  4OKO A;  3FMC A;  5LYF A;  2BCO A;  3IWW A;  4TNU A;  2OOT A;  3IFE A;  3CPX A;  1LFW A;  4FWU A;  3CPA A;  5LRG A;  1BPN A;  1YW4 A;  1ZLH A;  1Y0R A;  1FT7 A;  1Y9Z A;  4MCP A;  3GLJ A;  2CIJ A;  5LRK A;  2JBJ A;  1LOK A;  3DGV A;  4OME A;  4TWE A;  3PBB A;  2IMO A;  4OC2 A;  2PJA A;  4OID A;  2PVW A;  4A37 A;  4FUU A;  3SI0 A;  1YLO A;  3CDX A;  1YME A;  4F8Z A;  5LYL A;  1CP7 A;  3H8F A;  3K2K A;  2HB6 A;  3SI1 A;  4FBE A;  4C8P A;  5K8P A;  3B2Y A;  4IAV A;  4PXD A;  3DLJ A;  3FVL A;  5LYI A;  1IY7 A;  4NJQ A;  4P44 A;  3BI1 A;  6CPA A;  2PJ9 A;  4OC4 A;  4PPZ A; 
#chains in the Genus database with same CATH topology
 1AMP A;  1CM0 A;  2G9D A;  4JWP A;  4UCM A;  4Y49 C;  4F9U A;  1MJB A;  4FAI A;  1FNO A;  3VGO A;  1IYK A;  2I79 A;  2FVG A;  4K3N A;  4OLL A;  4PV6 A;  4XPK A;  3U88 C;  1VHS A;  2ZEM A;  2PR1 A;  2R1I A;  1EZA A;  4DJL A;  4KOT A;  2UV8 G;  2Q0Y A;  5AGE A;  2EO8 A;  2H5M A;  1XF1 A;  4P4I A;  2B4J C;  2FE7 A;  3VRN A;  5HKY A;  2BOA A;  1KEE B;  1P4N A;  4MHD A;  5J1Q A;  1GYT A;  5CPA A;  2AUN A;  3RAM A;  4RN7 A;  2JDC A;  3EZE A;  2HI6 A;  2WZN A;  2Q4V A;  1X10 A;  3LAC A;  3TFY A;  3K9T A;  2XEI A;  2C6C A;  3PT1 A;  1KUY A;  2QVP A;  4OAD A;  4PQA A;  2Y1N A;  1RTQ A;  5IX3 A;  2Y0M A;  4Q7A A;  1Y7R A;  2F7V A;  1F2O A;  4E5S A;  4MFQ A;  2J8R A;  5IB9 A;  1X12 A;  4IIY A;  3F5B A;  2PQ8 A;  3SXN A;  3KQX A;  3NA6 A;  1XJO A;  4OC1 A;  4C8U A;  4MFL A;  2Z3O A;  2PJB A;  7CPA A;  4NXY A;  2GLF A;  5AXI A;  3WAB A;  1AUG A;  1UWY A;  2IQ6 A;  3D7H A;  4P45 A;  3RYO A;  3PBE A;  3SR3 A;  1YVO A;  2KCW A;  1TKH A;  3NE8 A;  3OB2 B;  3R95 A;  1C30 B;  1Y7E A;  2ZEL A;  3VAT A;  4FD6 A;  5K8N A;  4PK3 A;  1DIK A;  4B13 A;  3PRT A;  4KUA A;  5AG5 A;  2GE3 A;  2D0P A;  4R9M A;  1EZB A;  3FJU A;  1QSO A;  3BLN A;  3PB7 X;  4JD6 A;  2AFM A;  1ZG7 A;  1QQ9 A;  4JXQ A;  5F9M A;  1RO5 A;  3PFV A;  4NGR A;  1I1D A;  1BO4 A;  4NGN A;  2CXA A;  4F0X A;  1J4J A;  1JDB C;  1GGO A;  3BHX A;  3D7D A;  3K9U A;  5G21 A;  2HC9 A;  3JRU A;  2YNE A;  1FY7 A;  3FB3 A;  4KLV A;  4I49 A;  3NH8 A;  4LQ6 A;  1R3N A;  3T8W A;  4A39 A;  4E8O A;  3PB4 X;  3T5M A;  1NXJ A;  3WR7 A;  2YGW A;  2BO9 A;  3IU2 A;  3TCV A;  4CAV A;  2D4O A;  2PJC A;  3TYX A;  3HPG G;  1OZP A;  3KR4 A;  1FBV A;  2C6P A;  3QB8 A;  4E0A A;  3VTA A;  1PYT B;  3S6F A;  5ELY A;  2NMT A;  3B3S A;  3I1U A;  2WPW A;  3GYA A;  4CAE A;  4NGM A;  4MJX A;  3ISX A;  2HRO A;  2PJ5 A;  1IIC A;  3KHX A;  4BIN A;  4R7M A;  1BXR B;  1B87 A;  4RS2 A;  3I9S A;  3B3C A;  5GCN A;  2G0B A;  1Q7L A;  3FYN A;  5JM6 A;  2WUU A;  4IK2 A;  4R3L A;  3EZB A;  4B5P A;  2Q04 A;  3S6K A;  3VRP A;  1SQH A;  4Q36 A;  4J3G A;  5EMI A;  4C85 A;  4C2Y A;  2CTB A;  5I4M A;  1KUX A;  4ZGY B;  1S7F A;  5C88 A;  4L89 A;  2GRE A;  4UFW A;  4E94 A;  2I3C A;  3CT9 A;  5G20 A;  4B5P B;  3EZA A;  2REE A;  2B3V A;  1YRE A;  2F5I A;  1NSL A;  3EO4 A;  4C9A A;  4R57 A;  2ZEO A;  3GUX A;  3SJF A;  1I12 A;  5J8F A;  5K99 A;  1RXT A;  3FXT A;  4MBU A;  5E96 A;  2FIW A;  4TJX A;  4II9 A;  3DNS A;  4IUS A;  1A9X B;  2XPN A;  2JBK A;  1IGB A;  2I00 A;  2VEZ A;  3SJE A;  3UY5 A;  4M85 A;  1M4L A;  5JVL A;  4AXV A;  1YVK A;  1TF9 A;  4A95 A;  3TLY A;  4MMO A;  1LAN A;  2O4H A;  3NH4 A;  3V38 A;  1V6C A;  4UEF A;  5CBM A;  2V8V A;  4EFD A;  2POK A;  2MP0 A;  2Q43 A;  1ZRS A;  2EZA A;  5F09 A;  4UCP A;  4UWJ A;  3HMJ G;  2IJZ A;  3LD2 A;  4MCS A;  1XF8 A;  2B3U A;  3B35 A;  3KR5 A;  4QVT A;  2OLS A;  4OIW A;  2ARH A;  4NFR A;  4KSI A;  3EY5 A;  2GP4 A;  1B47 A;  4LQG A;  2RC4 A;  1F2P A;  3HLP A;  5JPH A;  3WC5 A;  5DS0 A;  3GIU A;  3FF3 A;  3D7F A;  2RFH A;  5DWN A;  2WYR A;  2EUI A;  1QSM A;  4NJR A;  2ZOG A;  4H6U A;  5FVJ A;  2X0S A;  4C8A A;  1Q2Y A;  2FL4 A;  1LAP A;  4WWV A;  3IIB A;  4TJV A;  3MN8 A;  4R76 A;  1LCP A;  2B58 A;  3OP0 A;  1ZL0 A;  1PCA A;  2ZED A;  4U5Y A;  4EVY A;  5A28 A;  3BJ8 A;  2PVV A;  4P4D A;  1MK4 A;  4MY0 A;  4CYN A;  2XPP A;  2JLM A;  1Z4R A;  2PJ8 A;  1WK4 A;  4J0N A;  1HDQ A;  5BY0 A;  4CGL A;  4B5O A;  2CNS A;  1MJA A;  1IID A;  2Z0Z A;  2QIR A;  2AFO A;  2ZW5 A;  3PFO A;  4BTF A;  4MRI A;  3RNZ A;  4DUK A;  4C8T A;  4UEE A;  2ZW7 A;  4BPW B;  4M6I A;  4C9V A;  4COG A;  2PR8 A;  2AFZ A;  2J8M A;  1I21 A;  3D66 A;  4BD9 A;  4F6A A;  3IU1 A;  4CO9 A;  2Y1M A;  3BUX B;  1YR0 A;  1JDE A;  3TLG B;  3R96 A;  2V77 A;  4XNH C;  1EO0 A;  3D8P A;  5ISV A;  1M4D A;  1YVH A;  4MHY A;  4EME A;  1DE4 C;  1WJT A;  2FXF A;  2PIY A;  2PJ3 A;  1BOB A;  2AFS A;  2FS5 A;  2NSM A;  1QMU A;  2V8D A;  3DDD A;  3FX6 A;  3E0K A;  4P4F A;  4M6H A;  1S7L A;  3BUO B;  3I74 A;  1ZG9 A;  3NFQ A;  3OAK A;  2YNC A;  3ZNI A;  3D68 A;  5AG4 A;  5F5X A;  2PJ4 A;  1TKJ A;  4CZ1 A;  4OAE A;  3LWU A;  4ZX8 A;  3IJ3 A;  3R9G A;  1AYE A;  2BUE A;  4R3K A;  4CDJ A;  1TXR A;  2BL1 A;  4R8F A;  3SXO A;  4RUH A;  2YJV A;  4P6Y A;  3TOA A;  4UF4 A;  4MFZ A;  2PJ0 A;  4ZYQ A;  1YX0 A;  2OR4 A;  3PP9 A;  2Z3M A;  1MJ9 A;  4U9Z A;  1UFH A;  4KSA A;  4ONW A;  2ZEE A;  3RBU A;  2OZU A;  4MI1 A;  2BSW A;  1M1D A;  4KLW A;  4B12 A;  3B3W A;  1VBH A;  2V8H A;  1S3Z A;  3B3V A;  4YWY A;  3SJG A;  2EBJ A;  1P0H A;  2YNC C;  2PE3 A;  4JXR A;  3NFZ A;  4UEZ A;  3V7Z A;  4AG9 A;  4C8C A;  2JEW A;  3ISZ A;  3KL9 A;  3PB9 X;  4KOX A;  4UIB A;  4YU9 A;  1IU8 A;  3RO0 A;  1HEE A;  2PJ6 A;  5H84 A;  3TLB A;  2FCK A;  2EK8 A;  4CRZ B;  4RI1 A;  4FD5 A;  3VAR A;  2PRQ A;  4C7H A;  4A38 A;  3D67 A;  3WT4 A;  4F0Y A;  1CPS A;  2PIZ A;  1TF8 A;  1Z2L A;  4KNG E;  2CY2 A;  4AG7 A;  1XE4 A;  4M3S A;  2R82 A;  1VBG A;  1ELL P;  2O53 A;  5K8O A;  4JLY A;  4W9Y A;  4NGQ A;  5J3X A;  4JVO A;  8CPA A;  2Q4Y A;  2C1C A;  2AFU A;  4P10 A;  3T05 A;  4C9E A;  2DEA A;  1XMT A;  4GPL B;  4LUA A;  1L0C A;  2HWG A;  1T36 B;  3VRO A;  5J8C A;  2EVN A;  2Q44 A;  3PFE A;  1VIX A;  2GFQ A;  4C68 A;  1S60 A;  4CYP A;  3V8I A;  4C9U A;  3O8Z A;  4KOR A;  2J8N A;  4MCQ A;  1Z8T A;  2VL1 A;  1ELM P;  4UWI A;  4M8D A;  3TLZ A;  4JZ0 A;  4NGS A;  5EBV A;  3KKW A;  4HNX B;  2VBQ A;  3T07 A;  4MHZ A;  3KHZ A;  4H6Z A;  4MY3 A;  2DPT A;  4MCR A;  3D4U A;  4H2K A;  2D4P A;  3GJZ A;  1M6V B;  4BPX B;  2HV2 A;  2BEI A;  3DR8 A;  3N7Z A;  5HVG A;  1J3L A;  3TO7 A;  4X3R A;  2A4N A;  2C6G A;  2YJT A;  4KOV A;  4C86 A;  1TIQ A;  4MFK A;  1XEB A;  1CG2 A;  2O28 A;  4COB A;  1IOI A;  2OU2 A;  1ZG8 A;  3JVN A;  4Q38 A;  2XPO A;  5JH9 A;  5G22 A;  2CTC A;  2E28 A;  3CZX A;  1M4G A;  4B11 A;  3ZJ0 A;  4C84 A;  1Y9K A;  2DXQ A;  2XPL A;  1YQE A;  1YSJ A;  3TLE A;  1TKF A;  4OC3 A;  3S9M A;  2VZY A;  3ZZI A;  1QSN A;  5F49 A;  4C9R A;  5KTA A;  1N71 A;  2EK9 A;  1VGY A;  5THW A;  3T90 A;  4XPD B;  4CPA A;  5HKZ A;  3S6H A;  2D0O A;  3C8O A;  2PSW A;  4ZX9 A;  4KZT A;  4UFV A;  3OWC A;  4X2T A;  1KUV A;  2EZB A;  4OC5 A;  1A2Z A;  4P4B A;  2JDD A;  1IB1 E;  2ZEN A;  1YGH A;  1F57 A;  2XEF A;  2FIA A;  4KOS A;  3T0T A;  3SJX A;  5IB0 A;  4A94 A;  2QML A;  4CAX A;  2VXK A;  3PGP A;  5AG7 A;  5FD8 A;  2OZH A;  2VKZ G;  1Y9W A;  4KUB A;  5F1Y A;  3FBU A;  3LOD A;  4IF5 A;  2PJ7 A;  1VI4 A;  3KRV A;  1U6M A;  4A32 A;  1VHE A;  2Z3K A;  4QB9 A;  3A9L A;  3VRQ A;  3GB0 A;  1Z8X A;  1BPM A;  2C27 A;  2HUZ A;  2PJ2 A;  1OBR A;  3IWG A;  3CXS A;  1KBL A;  2FT0 A;  4KOU A;  4KVM E;  3H8E A;  1CBX A;  3DR6 A;  4CAF A;  1QST A;  3W91 A;  2ZEH A;  3JTK A;  4NCZ A;  1R61 A;  1QSR A;  2GAN A;  3FH4 A;  4AB7 A;  3BI0 A;  2P6F A;  2XEJ A;  1VKC A;  2PC1 A;  3FEC A;  5DWM A;  5BWA B;  3W6S A;  2JEV A;  4K30 A;  2RB7 A;  4EWT A;  1ZLI A;  3VWE A;  4MXU A;  1YK3 A;  3R9F A;  3TX8 A;  2OH1 A;  3KAS A;  2ATR A;  3N5F A;  4BMH A;  4P4J A;  4M6G A;  5LYD A;  3TO6 A;  2CNT A;  4ZY0 A;  2QEC A;  1Q5X A;  4UA3 A;  5F47 A;  1XMB A;  2CBL A;  2DPS A;  2Q4Z A;  1CJW A;  2F8H A;  2WSA A;  2B5G A;  2REF A;  4HNY B;  2NYQ A;  3QAH A;  4G1P A;  4UIA A;  1Z8L A;  3IEH A;  3KGQ A;  4B14 A;  1CX8 A;  4OC0 A;  1KZF A;  2Q51 A;  1DTD A;  4CYO A;  3TLA A;  1KWM A;  3G3S A;  4IHM A;  3PEI A;  5F48 A;  3IO1 A;  3KQZ A;  4NSQ A;  4HKF A;  1XRY A;  2PCU A;  3PB8 X;  4FD4 A;  4A30 A;  4F9V A;  3PB6 X;  4L8A A;  4DYO A;  3B8G A;  3D7G A;  4NGT A;  3WC6 A;  4AVB A;  3FNC A;  2Z11 A;  2ZPA A;  3MGD A;  2P0W A;  2K5T A;  4X5K A;  4WJB A;  1CPX A;  3KZW A;  4GM5 A;  1XBU A;  3D2M A;  3LMS A;  3F8K A;  3MRU A;  4KOW A;  5HVF A;  4MHN A;  2P6E A;  5LRJ A;  4A33 A;  2R7H A;  1HDU A;  3D3S A;  2Z3L A;  3QAY A;  4R87 A;  2HQY A;  2CF4 A;  4R6T A;  4B6Z A;  4EYS A;  3PZJ A;  3FED A;  1IOF A;  2QJ8 A;  3TO9 A;  4CGO A;  3FEE A;  5JGF A;  4CAW A;  3I6S A;  1YW6 A;  1Z9U A;  1V0C A;  2ANP A;  5D8N A;  5IR2 A;  3BUM B;  2DF5 A;  3VH9 A;  3IGR A;  2C5Q A;  4PXB A;  2OB0 A;  4PXE A;  4NGP A;  4H1H A;  5HXD A;  1CS0 B;  5K8M A;  3GY9 A;  1NE9 A;  2Z10 A;  1PUA A;  2PJ1 A;  3QNV A;  4QUS A;  4XPL A;  4CDK A;  2VQY A;  2QYV A;  3JUW A;  4UCN A;  4CGN A;  2VI7 A;  3PLF B;  3B3T A;  1YLE A;  1Z9E A;  2DLA A;  1BAV A;  2X7B A;  4A31 A;  4A4C A;  2CNM A;  2Q7B A;  4QBJ A;  4O23 A;  4C8F A;  1JWQ A;  4MHP A;  4YRH A;  4OP4 A;  5HKW A;  4A4B A;  1GHE A;  2B4D A;  3T9Y A;  3W6X A;  2R98 A;  3S9N A;  1ARM A;  1BLL E;  4U9Y A;  5HVH A;  1NBW A;  2WPX A;  1H8L A;  2V8G A;  4PSX A;  5F13 A;  4JYW A;  3H8G A;  2P6G A;  2B4D B;  4KOY A;  3TOB A;  4CGM A;  2AFW A;  3H4Q A;  4MI4 A;  4C2Z A;  4BPU B;  1ARL A;  3S6G A;  5F46 A;  1CP6 A;  1Y0Y A;  4YFJ A;  2J9A A;  2EWB A;  3EC4 A;  3TE4 A;  4CRY B;  2PRB A;  2Q7S A;  3FRM A;  2Z3P A;  4MJ8 A;  3TT2 A;  1VHO A;  3NOJ A;  3BXM A;  4CYQ A;  3HPH E;  1ON0 A;  2XEG A;  2G3T A;  3IC1 A;  3F9K C;  3P2F A;  3WC7 A;  5IV0 A;  4P4E A;  4FD7 A;  4PK2 A;  1B6B A;  4GXH A;  3L2N A;  4RR2 B;  1M44 A;  2IL4 A;  2AJ6 A;  1WVM A;  4QC6 A;  1JQG A;  2PDO A;  4Z65 A;  2GU2 A;  3NH5 A;  3B7I A;  3DSB A;  3HUV A;  4KVX A;  2ZEP A;  5HH1 A;  1ZYM A;  2ODF A;  4ZY2 A;  3TC8 A;  2GLJ A;  4JJX A;  2ZW6 A;  2ZEG A;  1EE3 P;  1XFO A;  4KS9 A;  5CNP A;  2AFX A;  3BJ7 A;  3RZA A;  5A27 A;  3S9L A;  4ZI6 A;  2ZEF A;  3BUW B;  4C99 A;  3R9E A;  4MFP A;  2DIK A;  4BBH A;  1LAM A;  4UBR A;  1NMT A;  2ZOF A;  2ABZ A;  1XIX A;  3TLC A;  1Z5R A;  3K4I A;  2VZZ A;  1R43 A;  2YND A;  1Z8W A;  1S5K A;  4C7I A;  5EC4 A;  4PXC A;  4ORF A;  4X8I A;  1NSA A;  1IYL A;  4KVO E;  4GS4 A;  3D2P A;  4YGO A;  3EFA A;  4NEX A;  3ICU A;  4YN3 A;  5D29 A;  3KI9 A;  3SI2 A;  3VRR A;  5C82 A;  1PU9 A;  5HMN A;  1KC7 A;  4OKO A;  3FMC A;  4XPD C;  5LYF A;  2BCO A;  5KTC A;  3IWW A;  2PCN A;  1S7K A;  1K4J A;  4TNU A;  2Z3N A;  4ONU A;  2R8V A;  2OOT A;  3IFE A;  3SHP A;  2AE6 A;  2ZW4 A;  3CXP A;  3NE7 A;  4ZY1 A;  4IIX A;  3CPX A;  1LFW A;  4FWU A;  4NF1 A;  3CPA A;  1Q2C A;  5LRG A;  3TTH A;  1C3O B;  1BPN A;  1YW4 A;  1ZLH A;  1Y0R A;  5JQ4 A;  1FT7 A;  4HNW B;  1LRZ A;  1Y9Z A;  4MCP A;  3GLJ A;  2B0A A;  5JYB A;  2CIJ A;  5LRK A;  2JBJ A;  1LOK A;  3DGV A;  4OME A;  3H5Z A;  3PBB A;  4MFJ A;  4H89 A;  3G8W A;  4TWE A;  2IMO A;  4OC2 A;  4AVC A;  2GIV A;  2PJA A;  3VWD A;  5H86 A;  3FIX A;  4OID A;  2PVW A;  1ZO0 A;  1XOV A;  4KSF A;  4A37 A;  4FUU A;  3SI0 A;  1YLO A;  3CDX A;  1YME A;  4F8Z A;  5LYL A;  4CS0 B;  2G3A A;  3CXQ A;  3P2H A;  1CP7 A;  3H8F A;  2N3A B;  4HPS A;  3U1B A;  3K2K A;  2HB6 A;  3SI1 A;  4FBE A;  4C2X A;  4C8P A;  4DNC A;  5KTD A;  5K8P A;  4B10 A;  1S7N A;  3B2Y A;  3C26 A;  3BUN B;  4IAV A;  2EZC A;  2B4B A;  1WWZ A;  2OZG A;  3EIF A;  3GKR A;  4PSW A;  4CGP A;  4PXD A;  5I0C A;  3DLJ A;  1CE8 B;  3F0A A;  3FVL A;  2AUM A;  3I3G A;  4UFX A;  5LYI A;  4AVA A;  1R57 A;  2B5G B;  1IY7 A;  4Y49 B;  5G1Z A;  4NJQ A;  3EXN A;  4P44 A;  2ZXV A;  4E2A A;  3G23 A;  5AG6 A;  3BI1 A;  4XNH B;  4A2Z A;  6CPA A;  2FSR A;  2PJ9 A;  4OC4 A;  4ZBG A;  4INJ A;  2FM4 A;  4PPZ A;  3TLG A;  4LX9 A;  3OB1 B;  1M4I A;  1Q2D A;  1Z4E A;  3R1K A;  3IWE A; 
#chains in the Genus database with same CATH homology
 1AMP A;  2G9D A;  4F9U A;  4FAI A;  1FNO A;  2FVG A;  4K3N A;  2ZEM A;  4DJL A;  1XF1 A;  4P4I A;  2BOA A;  5J1Q A;  1GYT A;  5CPA A;  3RAM A;  2WZN A;  3K9T A;  2XEI A;  2C6C A;  2QVP A;  4PQA A;  5JM6 A;  1RTQ A;  4Q7A A;  2F7V A;  1F2O A;  5IB9 A;  3KQX A;  3NA6 A;  1XJO A;  4OC1 A;  4C8U A;  2PJB A;  7CPA A;  2GLF A;  3WAB A;  1UWY A;  2IQ6 A;  3D7H A;  4P45 A;  3PBE A;  1TKH A;  1Y7E A;  2ZEL A;  3VAT A;  5K8N A;  3EIF A;  3PRT A;  3FJU A;  3PB7 X;  2AFM A;  1ZG7 A;  1QQ9 A;  4NGR A;  4NGN A;  3BHX A;  3D7D A;  2HC9 A;  3JRU A;  3NH8 A;  1R3N A;  3T8W A;  4A39 A;  3PB4 X;  2BO9 A;  2PJC A;  3KR4 A;  2C6P A;  3VTA A;  1PYT B;  5ELY A;  3I1U A;  3B3S A;  4NGM A;  3ISX A;  2PJ5 A;  3KHX A;  4R7M A;  3B3C A;  1Q7L A;  4IK2 A;  4C85 A;  5I4M A;  2CTB A;  2GRE A;  2I3C A;  3CT9 A;  4C9A A;  2ZEO A;  3GUX A;  3SJF A;  4TJX A;  2JBK A;  1IGB A;  3SJE A;  1M4L A;  4AXV A;  1TF9 A;  4MMO A;  1LAN A;  2O4H A;  3NH4 A;  3V38 A;  1V6C A;  4UEF A;  5CBM A;  2V8V A;  4EFD A;  2POK A;  2Q43 A;  5F09 A;  2IJZ A;  4MCS A;  3B35 A;  3KR5 A;  4OIW A;  4NFR A;  4KSI A;  2GP4 A;  4LQG A;  1F2P A;  3HLP A;  3WC5 A;  5DS0 A;  3FF3 A;  3D7F A;  2RFH A;  2WYR A;  4NJR A;  2ZOG A;  4C8A A;  1LAP A;  4WWV A;  3IIB A;  4TJV A;  3MN8 A;  4R76 A;  1LCP A;  1PCA A;  2ZED A;  2PVV A;  4P4D A;  2PJ8 A;  1HDQ A;  3PFO A;  4MRI A;  2AFO A;  4DUK A;  4C8T A;  4UEE A;  4C9V A;  3D66 A;  2AFZ A;  4BD9 A;  2V77 A;  4MHY A;  4EME A;  1DE4 C;  2PIY A;  2PJ3 A;  2V8D A;  2AFS A;  2NSM A;  1QMU A;  3FX6 A;  4P4F A;  3I74 A;  1ZG9 A;  3D68 A;  2PJ4 A;  1TKJ A;  3LWU A;  4ZX8 A;  3IJ3 A;  1AYE A;  4CDJ A;  1TXR A;  4R8F A;  4RUH A;  4P6Y A;  4UF4 A;  2PJ0 A;  4ZYQ A;  2OR4 A;  4ONW A;  2ZEE A;  3RBU A;  3B3W A;  2V8H A;  3B3V A;  4YWY A;  3SJG A;  4UEZ A;  3V7Z A;  2PE3 A;  3NFZ A;  4C8C A;  2JEW A;  3ISZ A;  3KL9 A;  3PB9 X;  4UIB A;  4YU9 A;  1HEE A;  2PJ6 A;  2EK8 A;  3VAR A;  2PRQ A;  4A38 A;  3D67 A;  3WT4 A;  1CPS A;  2PIZ A;  1TF8 A;  1Z2L A;  4KNG E;  1ELL P;  2O53 A;  5K8O A;  4W9Y A;  4NGQ A;  8CPA A;  2C1C A;  2AFU A;  4P10 A;  4C9E A;  2DEA A;  3PFE A;  1VIX A;  4C9U A;  4MCQ A;  2VL1 A;  1ELM P;  4JZ0 A;  4NGS A;  4MHZ A;  3KHZ A;  4MCR A;  3D4U A;  4H2K A;  5HVG A;  4X3R A;  2C6G A;  4C86 A;  1CG2 A;  1ZG8 A;  5JH9 A;  2CTC A;  4C84 A;  1YSJ A;  1TKF A;  4OC3 A;  3S9M A;  4C9R A;  2EK9 A;  1VGY A;  5THW A;  4CPA A;  4ZX9 A;  4X2T A;  4OC5 A;  4P4B A;  2ZEN A;  1F57 A;  2XEF A;  3SJX A;  4A94 A;  2PJ7 A;  1VHE A;  3GB0 A;  1BPM A;  2PJ2 A;  1OBR A;  3H8E A;  1CBX A;  2ZEH A;  3FH4 A;  3BI0 A;  2XEJ A;  3FEC A;  2RB7 A;  4EWT A;  1ZLI A;  4MXU A;  3TX8 A;  3KAS A;  3N5F A;  4P4J A;  5LYD A;  4ZY0 A;  1XMB A;  2Q4Z A;  2F8H A;  2NYQ A;  4G1P A;  4UIA A;  1Z8L A;  3IEH A;  3KGQ A;  1CX8 A;  4OC0 A;  2Q51 A;  1DTD A;  1KWM A;  4IHM A;  3PEI A;  3IO1 A;  3KQZ A;  4F9V A;  1XRY A;  3PB8 X;  2PCU A;  4ZY1 A;  3PB6 X;  4DYO A;  3WC6 A;  3D7G A;  4NGT A;  4WJB A;  1CPX A;  3KZW A;  4GM5 A;  1XBU A;  3LMS A;  3MRU A;  5LRJ A;  5HVF A;  4MHN A;  1HDU A;  2CF4 A;  4R6T A;  4B6Z A;  3FED A;  2QJ8 A;  5JGF A;  3FEE A;  3I6S A;  1YW6 A;  2ANP A;  5D8N A;  5IR2 A;  3VH9 A;  2C5Q A;  4PXB A;  4PXE A;  4NGP A;  5HXD A;  5K8M A;  2PJ1 A;  3QNV A;  4CDK A;  2QYV A;  3B3T A;  1BAV A;  4C8F A;  4O23 A;  4MHP A;  4OP4 A;  3S9N A;  1ARM A;  1BLL E;  5HVH A;  1H8L A;  2V8G A;  4JYW A;  3H8G A;  2AFW A;  1ARL A;  1CP6 A;  1Y0Y A;  2J9A A;  2EWB A;  1VHO A;  3BXM A;  2XEG A;  3IC1 A;  3WC7 A;  4P4E A;  3L2N A;  1WVM A;  1JQG A;  4Z65 A;  2GU2 A;  3NH5 A;  3B7I A;  3HUV A;  2ZEP A;  3TC8 A;  4ZY2 A;  2GLJ A;  2ZEG A;  1EE3 P;  1XFO A;  3RZA A;  2AFX A;  3S9L A;  4ZI6 A;  2ZEF A;  4C99 A;  1LAM A;  2ZOF A;  2ABZ A;  1Z5R A;  1R43 A;  4PXC A;  4X8I A;  1NSA A;  4YN3 A;  3ICU A;  5D29 A;  3KI9 A;  3SI2 A;  4OKO A;  3FMC A;  5LYF A;  2BCO A;  3IWW A;  4TNU A;  2OOT A;  3IFE A;  3CPX A;  1LFW A;  4FWU A;  3CPA A;  5LRG A;  1BPN A;  1YW4 A;  1ZLH A;  1Y0R A;  1FT7 A;  1Y9Z A;  4MCP A;  3GLJ A;  2CIJ A;  5LRK A;  2JBJ A;  1LOK A;  3DGV A;  4OME A;  4TWE A;  3PBB A;  2IMO A;  4OC2 A;  2PJA A;  4OID A;  2PVW A;  4A37 A;  4FUU A;  3SI0 A;  1YLO A;  3CDX A;  1YME A;  4F8Z A;  5LYL A;  1CP7 A;  3H8F A;  3K2K A;  2HB6 A;  3SI1 A;  4FBE A;  4C8P A;  5K8P A;  3B2Y A;  4IAV A;  4PXD A;  3DLJ A;  3FVL A;  5LYI A;  1IY7 A;  4NJQ A;  4P44 A;  3BI1 A;  6CPA A;  2PJ9 A;  4OC4 A;  4PPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...