2C6GA

Membrane-bound glutamate carboxypeptidase ii (gcpii) with bound glutamate
Total Genus 240
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
240
sequence length
694
structure length
679
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
publication title Structure of glutamate carboxypeptidase II, a drug target in neuronal damage and prostate cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 240
structure length 679
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2c6gA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2c6gA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c6gA02
3WABA 4OC0A 3ISZA 2AFMA 2BCOA 4P6YA 2CF4A 4C84A 4P44A 2QVPA 2PJAA 4P4IA 4MCPA 4C9UA 3D68A 2PJ9A 4C8CA 2Q4ZA 4C9VA 4A37A 1YSJA 2NYQA 3KR4A 1VGYA 3FF3A 3FMCA 2CIJA 2CTBA 1XFOA 3D67A 2ZEFA 5JGFA 4TWEA 2RFHA 4R8FA 4NGMA 4FWUA 4RUHA 1ZLIA 2PIYA 5D29A 5JH9A 2AFSA 2J9AA 3DGVA 1Q7LA 4TJXA 3PBEA 4OKOA 2AFXA 4NGRA 2PJBA 1TF8A 3B3TA 4FUUA 3JRUA 1FT7A 1R43A 3KI9A 2V77A 4DUKA 3WC5A 2PJ5A 3PFOA 4PQAA 3SJXA 2PJ8A 3WC7A 5J1QA 4OC5A 3IEHA 3ICUA 2GREA 2PJ1A 3KGQA 4P4JA 2ZOGA 4Q7AA 1TXRA 1YLOA 1ZG9A 2C6GA 3LWUA 2PJ0A 2HB6A 3GB0A 3IWWA 1LCPA 4ONWA 4PXCA 3IC1A 4NGSA 2PJ7A 3PB8X 3V38A 4C8PA 1XMBA 3D7GA 4A38A 4NJRA 1TF9A 4X3RA 1M4LA 4C86A 1ELLP 3LMSA 4EFDA 4GM5A 3IO1A 2WZNA 2EK9A 1ELMP 2ZOFA 2OR4A 4DYOA 2HC9A 2F7VA 5HVFA 2Q43A 4P4EA 2PJCA 2VL1A 4OC1A 4IHMA 1RTQA 3D7FA 2Q51A 3I74A 3T8WA 1F2PA 4F9VA 3PBBA 3DLJA 5LYLA 2XEGA 3KL9A 4DJLA 4ZY0A 4G1PA 5ELYA 4NGQA 3B3WA 2IMOA 4YU9A 4C99A 1VIXA 5JM6A 7CPAA 1QMUA 1VHEA 4H2KA 2ZEOA 3FECA 3TX8A 1BAVA 4NFRA 1LANA 4ZY1A 2O53A 3FX6A 2BO9A 3KQXA 3ISXA 4Z65A 4JYWA 3KHZA 3PFEA 4ZI6A 5D8NA 2GU2A 2IJZA 3GUXA 3NH8A 4B6ZA 2XEFA 3H8GA 4LQGA 4P4BA 4TJVA 1Z8LA 1LAMA 2PCUA 5CPAA 2ZEMA 3VATA 4C9EA 2PJ3A 4P45A 4MHZA 3WT4A 1QQ9A 2V8HA 4P4FA 3B35A 4WWVA 1PCAA 4MHPA 3KZWA 1HDQA 3B3VA 5CBMA 4UF4A 2CTCA 4NGPA 1CP7A 3SI1A 3FVLA 5LYIA 3BI0A 3SJGA 4OP4A 3K9TA 4NJQA 2PE3A 1DE4C 4OC3A 4P10A 3MRUA 5LYDA 3SJEA 3FJUA 1F2OA 2NSMA 2C6CA 3N5FA 4C8AA 1ZG8A 5LRJA 4R7MA 4W9YA 2PJ6A 4CDJA 1UWYA 2PJ4A 3FEDA 3PB6X 4OMEA 4K3NA 4FBEA 4MHNA 3VARA 4A94A 3SJFA 8CPAA 1HEEA 1CPSA 2XEJA 3VTAA 3KR5A 3FEEA 1KWMA 3HUVA 4OC4A 4R76A 1CPXA 3BHXA 1NSAA 3HLPA 2XEIA 2ANPA 1V6CA 4C85A 2OOTA 5K8PA 1F57A 2ZEPA 3D7HA 2AFUA 3V7ZA 1TKJA 4UIAA 2ZENA 5DS0A 3B2YA 4YWYA 2FVGA 3H8EA 1DTDA 4FAIA 1WVMA 4R6TA 2PRQA 2WYRA 1GYTA 4C8UA 5LYFA 4UEEA 2BOAA 2AFZA 2V8DA 2QYVA 1YMEA 2AFWA 3QNVA 2GLJA 4OIDA 2DEAA 4F8ZA 3NH5A 1Z5RA 3WC6A 4PXEA 1ARLA 4IK2A 3CPAA 1XJOA 1YW4A 4MCQA 1XBUA 3GLJA 4ZY2A 2C1CA 3RAMA 4MMOA 3KASA 4WJBA 1R3NA 3B7IA 4MHYA 3PB9X 1FNOA 4X2TA 1XRYA 2ZEEA 1BPMA 3RZAA 2JBJA 4YN3A 2GLFA 3CT9A 5LRKA 4MCRA 1ZG7A 1CP6A 3SI2A 4MXUA 3D4UA 3BXMA 2EK8A 1JQGA 3D66A 1CBXA 1H8LA 2POKA 3I6SA 4NGTA 1Y0YA 4EMEA 3PRTA 1VHOA 3NFZA 2I3CA 4C9RA 2EWBA 2O4HA 3CDXA 1LAPA 4PPZA 3I1UA 5F09A 1OBRA 1TKHA 1BLLE 4NGNA 4C8FA 3B3SA 1CX8A 3L2NA 3S9NA 5IB9A 4MRIA 4P4DA 2PIZA 3IJ3A 4AXVA 2ABZA 4CDKA 4ZYQA 3CPXA 2QJ8A 2C6PA 4O23A 4UEZA 2JEWA 1ZLHA 4KSIA 1Y7EA 2RB7A 2V8VA 4BD9A 1IY7A 2F8HA 5K8OA 4PXBA 2JBKA 1Y0RA 1YW6A 3KHXA 4UEFA 1IGBA 3PEIA 3K2KA 3KQZA 1EE3P 1XF1A 4ZX9A 3NH4A 1BPNA 2AFOA 3PB7X 5I4MA 4C8TA 1AYEA 3TC8A 1PYTB 3RBUA 1ARMA 4TNUA 1LOKA 5HVGA 2G9DA 5HVHA 4EWTA 3EIFA 5THWA 3MN8A 1HDUA 4F9UA 4X8IA 4OC2A 2IQ6A 2PJ2A 1LFWA 1Y9ZA 4ZX8A 4CPAA 3BI1A 3FH4A 1Z2LA 2V8GA 3IIBA 1TKFA 2PVWA 4A39A 5K8NA 1CG2A 3S9LA 2ZEGA 5HXDA 6CPAA 2ZELA 3B3CA 2ZEDA 3VH9A 3NA6A 3H8FA 3S9MA 3D7DA 4C9AA 4IAVA 3PB4X 4JZ0A 4KNGE 5K8MA 4PXDA 3SI0A 1AMPA 4MCSA 3IFEA 4OIWA 4UIBA 5LRGA 2PVVA 2ZEHA
chains in the Genus database with same CATH superfamily
3G3SA 3WABA 4OC0A 3ISZA 2AFMA 2EO8A 4FD5A 1M6VB 4BTFA 4XPDB 2BCOA 2G0BA 2R8VA 4H6UA 4Q38A 1ZYMA 4COBA 4P6YA 2P6FA 2CF4A 3D3SA 4X5KA 3S6GA 3H4QA 3H5ZA 4C84A 4P44A 3NE7A 2B4BA 2PJAA 2QVPA 4P4IA 1EO0A 4MCPA 1VKCA 4ZBGA 1OZPA 2EZBA 4ORFA 3P2HA 5FVJA 2QMLA 4C9UA 4RS2A 3D68A 2PJ9A 3V8IA 4I49A 2Q4ZA 3EFAA 4C8CA 4C9VA 3OP0A 4HKFA 1YSJA 2NYQA 2RC4A 1VGYA 3KR4A 4A37A 4CS0B 3FF3A 3FMCA 4MFLA 2CIJA 2CTBA 2ODFA 3VGOA 1XFOA 1B47A 3D67A 2PC1A 2ZEFA 3ZNIA 4TWEA 5JGFA 4XNHC 1AUGA 3IU1A 2RFHA 2VKZG 4R8FA 3I9SA 4NGMA 4FWUA 3PP9A 1MJAA 4E94A 2B4JC 1A9XB 4RUHA 4JXQA 2Z3KA 1ZLIA 2PIYA 3IWEA 5D29A 3S6HA 4BPWB 5JH9A 2AFSA 2J9AA 2YNEA 2Q7SA 3DGVA 1Q7LA 2QIRA 1IICA 5KTDA 2BL1A 2REFA 4TJXA 2ZXVA 4JJXA 1YVKA 3PBEA 4OKOA 4MFZA 3B8GA 1YVOA 4KVOE 2AFXA 1M4GA 4NGRA 2OZGA 4M8DA 5J8CA 2HWGA 4KZTA 2CNSA 3QAHA 2PJBA 2XPOA 2R7HA 1TF8A 5DWNA 3VROA 2VQYA 4L89A 3B3TA 2GFQA 3RO0A 2D0PA 1Z9UA 1XEBA 3NFQA 3T0TA 2D0OA 4FUUA 3JRUA 1FT7A 1R43A 2CY2A 2V77A 3KI9A 3T5MA 3ZZIA 4DUKA 3WC5A 2PJ5A 2B5GB 3DSBA 3PFOA 3W91A 4PQAA 4CGPA 2Z3LA 3TT2A 3SJXA 1YREA 2PJ8A 2YNDA 3DDDA 4RN7A 3WC7A 5J1QA 1C3OB 4OC5A 2IL4A 3IEHA 2ZW5A 5C88A 2GREA 3ICUA 1PU9A 4HNYB 2PJ1A 3FBUA 3KGQA 3W6XA 4F0XA 4EYSA 4P4JA 2ZOGA 4Q7AA 2B58A 1TXRA 4A4CA 3EY5A 3F9KC 1S3ZA 1XF8A 4EVYA 3DR6A 1YLOA 2EZCA 1ZG9A 2C6GA 3LWUA 1S5KA 2CXAA 2PJ0A 3PT1A 2HB6A 3GB0A 1CM0A 4H89A 2Q44A 3ZJ0A 2EZAA 4CO9A 3IWWA 2Z3MA 3KRVA 2VXKA 4AVAA 4AVCA 4CAWA 2BEIA 2DF5A 1LCPA 1WK4A 4ONWA 3F8KA 4PXCA 4A95A 3IC1A 3D2PA 4NGSA 2PJ7A 3PB8X 3BUXB 3V38A 3W6SA 4C8PA 3R9GA 4LX9A 1XMBA 3D7GA 1Y7RA 5DWMA 4A38A 4KLVA 4NJRA 4XPLA 1TF9A 4X3RA 1M4LA 2FIWA 4C86A 3VWEA 1ELLP 3LMSA 4PSWA 2Z0ZA 4HNXB 2KCWA 1VHSA 2F5IA 5F48A 4EFDA 2AUMA 1NMTA 4INJA 5F1YA 3PFVA 1YGHA 4GM5A 2Q0YA 2Q7BA 4CGLA 5EMIA 1YR0A 3GY9A 2WPWA 2P6GA 4CAFA 2JDCA 2WZNA 3IO1A 2EK9A 1EZAA 2AUNA 1ELMP 5EC4A 2AE6A 2ZOFA 2OR4A 2B4DA 3E0KA 4DYOA 2HC9A 2F7VA 2OZHA 5HVFA 2QECA 2Q43A 4P4EA 2PJCA 4JWPA 2R82A 2VL1A 3GIUA 4OC1A 5H84A 4IHMA 1RTQA 3D7FA 2Q51A 4BBHA 3T8WA 4A32A 1VBHA 3I74A 1F2PA 4F9VA 3PBBA 1YQEA 4COGA 5BWAB 3DLJA 5LYLA 2XEGA 2ZW6A 4CGNA 3IGRA 4Y49C 5G21A 2PQ8A 3KL9A 1M1DA 4DJLA 3GKRA 4G1PA 5ELYA 4ZY0A 4NGQA 3B3WA 1T36B 1Z9EA 1IYKA 2H5MA 2IMOA 1FBVA 1VIXA 4IF5A 4YU9A 4C99A 4IIYA 5JM6A 7CPAA 4ZGYB 1QMUA 1VHEA 4H2KA 2Z10A 4R3LA 5J3XA 2ZEOA 1A2ZA 5FD8A 3FECA 4KVME 3OAKA 3TX8A 1P4NA 1BAVA 4NFRA 4B10A 3TOAA 4QBJA 4IIXA 4CYNA 1LANA 2WPXA 4MBUA 4MFKA 2EVNA 4MFJA 3LACA 2VEZA 3TTHA 4XPDC 4ZY1A 1X10A 3R95A 2O53A 3FX6A 3OWCA 2BO9A 3VRPA 3QAYA 3KQXA 3T9YA 4RI1A 4GXHA 3ISXA 5F5XA 4Z65A 4GPLB 4JYWA 4OADA 3KHZA 4R87A 5IX3A 3EZEA 3PFEA 5I0CA 3I3GA 4ZI6A 3VRQA 1IIDA 2GU2A 2R98A 4MJ8A 5D8NA 4C7IA 2OH1A 2IJZA 3GUXA 3NH8A 2NMTA 4JXRA 1B6BA 2XEFA 4B6ZA 4IUSA 3U88C 1KZFA 3H8GA 4NSQA 4LQGA 4P4BA 2D4OA 3VRRA 1RXTA 4C2YA 2K5TA 1Z8LA 1LAMA 2FCKA 2PCUA 4J3GA 4UCNA 5CPAA 2ZEMA 2ARHA 3R96A 3VATA 5KTCA 4C9EA 2PJ3A 4P45A 4MHZA 3WT4A 3OB2B 1NXJA 3C8OA 4CYQA 5HKZA 1QSOA 1QQ9A 2V8HA 4P4FA 2GE3A 3B35A 4M6IA 4M6HA 4WWVA 1PCAA 2VZZA 4AG7A 1BXRB 4MHPA 4MJXA 4A33A 2DLAA 3KZWA 1B87A 1HDQA 1P0HA 3B3VA 4UF4A 4CRZB 5CBMA 1ZL0A 4KOSA 2G3AA 4B5OA 2CTCA 4NGPA 1CP7A 3SI1A 3FVLA 5LYIA 5HMNA 3BI0A 1X12A 3C26A 5C82A 3SJGA 4OP4A 3K9TA 2Z3NA 2Y1MA 3FYNA 2PE3A 1DE4C 4NJQA 5AGEA 1CJWA 4BMHA 4OC3A 2B5GA 3SI0A 4GS4A 3T90A 5G22A 1Z8TA 2OU2A 4P10A 4UCMA 4C68A 3MRUA 1NE9A 5LYDA 2Y1NA 5JQ4A 1VI4A 3SJEA 4KUAA 2PRBA 3FJUA 1FY7A 4MI4A 1F2OA 2NSMA 3HPGG 4OAEA 2C6CA 4B12A 3N5FA 1JDEA 4KS9A 4C8AA 1ZG8A 5LRJA 4R7MA 4CGOA 1Q5XA 2FL4A 5JVLA 4W9YA 2D4PA 2FIAA 4BINA 4TJVA 2PJ6A 3G8WA 4U9YA 4CDJA 3TLEA 4CRYB 1UWYA 1TIQA 2PJ4A 3FEDA 1M44A 3PB6X 3TE4A 4OMEA 3TLZA 4K3NA 4FD7A 4MFQA 4FBEA 2YJTA 1V0CA 4BPUB 2WSAA 4MHNA 3VARA 2P6EA 4A94A 3SJFA 3WR7A 8CPAA 1HEEA 1CPSA 2XEJA 3VTAA 3KR5A 4CAVA 4R3KA 3FEEA 4KOTA 2DXQA 2PCNA 1KWMA 3HUVA 4OC4A 2PDOA 4R76A 4AG9A 3TLAA 3K4IA 1CPXA 3BHXA 3JVNA 4H1HA 1NSAA 1M4DA 3HLPA 4B14A 4Q36A 4CYPA 2XEIA 2A4NA 1SQHA 2ANPA 3QB8A 2Q4VA 1V6CA 4JVOA 2HQYA 4C85A 2OOTA 5K8PA 1F57A 2ZEPA 1QSMA 3FIXA 4PV6A 2OZUA 2FXFA 1DIKA 3D7HA 1NSLA 2AFUA 3V7ZA 3O8ZA 4AVBA 2EUIA 1YK3A 3BJ7A 4UA3A 2E28A 3NOJA 1Y9WA 1TKJA 4UIAA 1ZO0A 4XPKA 5A27A 4QUSA 5JPHA 4CAEA 3CXSA 4NEXA 2ZENA 5DS0A 3B2YA 1Z4RA 4YWYA 5A28A 2DPTA 2FVGA 3H8EA 2GP4A 2XPPA 1KUVA 4M3SA 1DTDA 2JDDA 1Q2DA 4FAIA 5ISVA 2YJVA 1WVMA 4R6TA 5F47A 2I00A 1UFHA 4M6GA 4UCPA 2PRQA 1YVHA 3HMJG 1MJ9A 2WYRA 2CNTA 4MY0A 1GYTA 2UV8G 1GGOA 3EO4A 1XE4A 1J4JA 4C8UA 5LYFA 4UEEA 2BOAA 2AFZA 2V8DA 2J8MA 2QYVA 1YMEA 2AFWA 2JLMA 3SHPA 3QNVA 1GHEA 5E96A 2GLJA 4MY3A 4OIDA 4C7HA 1MK4A 4II9A 2MP0A 3JUWA 2VBQA 4E5SA 2DEAA 4F8ZA 3NH5A 2G3TA 4HNWB 1XMTA 2WUUA 1Z5RA 4UFXA 4MFPA 4PXEA 3WC6A 1ARLA 4IK2A 4Y49B 3CPAA 1XJOA 2N3AB 3FXTA 3KKWA 5H86A 1KC7A 1YW4A 4BPXB 4C2XA 2FS5A 4MCQA 2GANA 3T07A 1XBUA 2ZW7A 4UFWA 1K4JA 4U9ZA 3GLJA 4ZY2A 3BUMB 2OLSA 1Z8XA 2C1CA 4U5YA 3RAMA 4MMOA 3KASA 4KOVA 4CYOA 4DNCA 4KSAA 5AXIA 4WJBA 3TFYA 1R3NA 1CS0B 1J3LA 3B7IA 4MHYA 3PB9X 1FNOA 4X2TA 1XRYA 2ZEEA 1BPMA 3RZAA 1JWQA 1S7LA 3TO6A 4B5PA 2JBJA 3VRNA 4YN3A 1XIXA 2GLFA 3CT9A 4UWJA 5LRKA 3MGDA 3OB1B 1BO4A 4MCRA 1ZG7A 3DNSA 4JLYA 1CP6A 3SI2A 4MXUA 3N7ZA 3D4UA 3BXMA 2EK8A 1JQGA 3D66A 3TLGA 3VWDA 4UWIA 2BUEA 1CBXA 2FSRA 1H8LA 2B3UA 1KBLA 1I12A 5J8FA 3FB3A 4B5PB 2POKA 2ZPAA 1KUXA 3UY5A 3I6SA 4LUAA 2CBLA 5AG7A 4PSXA 1LRZA 4NGTA 3TLBA 3GJZA 3TLGB 4PK2A 4XNHB 1XOVA 4QVTA 1Y0YA 5HKWA 2C27A 1QSTA 3PRTA 1VHOA 3NFZA 4EMEA 2B0AA 2DIKA 2J8RA 4KVXA 3S6FA 4B11A 2I3CA 1R61A 4C9RA 2EWBA 2HUZA 3A9LA 2EBJA 2PR1A 3D8PA 2O4HA 3CDXA 1YLEA 1N71A 2I79A 3D2MA 4R57A 1IYLA 1LAPA 4PPZA 5IR2A 3TOBA 3RYOA 4A2ZA 2Z11A 3I1UA 5F09A 3RNZA 1OBRA 2ZW4A 1TKHA 4OLLA 4UBRA 4E8OA 3G23A 3T05A 3IWGA 4YRHA 4NF1A 1M4IA 2OB0A 1BLLE 3JTKA 5G1ZA 3R9EA 2HI6A 1Z8WA 1WJTA 4NGNA 4C8FA 3B3SA 3K9UA 4KOUA 1CX8A 3L2NA 3GYAA 4YFJA 4A30A 5IB0A 3S9NA 2Z3PA 4F6AA 5IB9A 4MRIA 3EZBA 4P4DA 2PIZA 3IJ3A 3EZAA 4AXVA 2ABZA 4KORA 4ONUA 4C2ZA 4CDKA 2JEVA 1S7NA 3R9FA 1Y9KA 2Y0MA 3CPXA 4E2AA 4ZYQA 2QJ8A 2C6PA 5KTAA 3R1KA 4O23A 3F0AA 4UEZA 2JEWA 1ZLHA 1MJBA 3BJ8A 4KSIA 1Y7EA 4MHDA 1YX0A 4CAXA 3PLFB 1BOBA 2REEA 2RB7A 2V8VA 3CXPA 4H6ZA 1IY7A 4BD9A 2F8HA 3S6KA 3SXNA 5IV0A 4A4BA 4LQ6A 3BUOB 5K8OA 4PXBA 2JBKA 1Y0RA 1YW6A 2VZYA 1Q2CA 2YNCA 2P0WA 3EXNA 3KHXA 4FD6A 3TCVA 1IOFA 2YGWA 3TO9A 5F13A 1IGBA 3PGPA 3PEIA 3K2KA 4M85A 4NCZA 3KQZA 4UEFA 1EE3P 4FD4A 4KOXA 1XF1A 4ZX9A 3NH4A 1S7KA 1BPNA 2AFOA 3BLNA 3PB7X 3SXOA 2R1IA 5I4MA 1JDBC 1L0CA 5HKYA 1NBWA 3TLCA 1AYEA 1RO5A 3TC8A 5AG4A 4J0NA 4KLWA 4C8TA 1KUYA 4B13A 1PYTB 3CZXA 3RBUA 1IU8A 1ARMA 4TNUA 2YNCC 3F5BA 2CNMA 2VI7A 1LOKA 1S7FA 2FT0A 4RR2B 2G9DA 2Q04A 2Q4YA 1U6MA 4R9MA 4EWTA 4KOYA 5HVGA 5HVHA 2C5QA 3EIFA 2X0SA 3HPHE 5THWA 5F46A 1CE8B 2B3VA 3MN8A 1HDUA 5F9MA 3CXQA 1QSRA 4X8IA 4F9UA 1ZRSA 4OC2A 5BY0A 2PSWA 2IQ6A 1I21A 2GIVA 2PJ2A 2XPLA 5GCNA 1LFWA 4CGMA 1Y9ZA 4HPSA 2HROA 3TYXA 4ZX8A 4CPAA 4KUBA 1ON0A 3BI1A 3FH4A 2ATRA 1Z2LA 2V8GA 2AJ6A 1KEEB 3IIBA 1TKFA 3PZJA 5AG5A 4A31A 1QSNA 2XPNA 3SR3A 2PVWA 3TO7A 4YGOA 3TLYA 4F0YA 4QB9A 5CNPA 4K30A 4A39A 1I1DA 3LD2A 2O28A 2X7BA 4QC6A 5K8NA 1CG2A 1C30B 5F49A 3FNCA 3LODA 3S9LA 2J8NA 2ZEGA 5HXDA 6CPAA 1R57A 2ZELA 3FRMA 2FE7A 5JYBA 5EBVA 2PR8A 5K99A 3B3CA 1EZBA 4PK3A 2ZEDA 4NXYA 3VH9A 3U1BA 3EC4A 5G20A 3NA6A 3H8FA 3P2FA 1S60A 1IB1E 4E0AA 3S9MA 4KSFA 5HH1A 2HV2A 3BUWB 1Q2YA 3D7DA 2B4DB 4UFVA 4C9AA 4IAVA 3PB4X 3IU2A 3DR8A 4MI1A 2FM4A 2Z3OA 1IOIA 4JZ0A 4AB7A 4KNGE 5K8MA 3NE8A 4KOWA 4L8AA 1PUAA 1Z4EA 2BSWA 4MCSA 1AMPA 3IFEA 4OIWA 4PXDA 2DPSA 4JD6A 4UIBA 5LRGA 2PVVA 1VBGA 1WWZA 4CZ1A 3BUNB 2ZEHA 5AG6A
chains in the Genus database with same CATH topology
3WABA 4OC0A 3ISZA 2AFMA 2BCOA 4P6YA 2CF4A 4C84A 4P44A 2QVPA 2PJAA 4P4IA 4MCPA 4C9UA 3D68A 2PJ9A 4C8CA 2Q4ZA 4C9VA 4A37A 1YSJA 2NYQA 3KR4A 1VGYA 3FF3A 3FMCA 2CIJA 2CTBA 1XFOA 3D67A 2ZEFA 5JGFA 4TWEA 2RFHA 4R8FA 4NGMA 4FWUA 4RUHA 1ZLIA 2PIYA 5D29A 5JH9A 2AFSA 2J9AA 3DGVA 1Q7LA 4TJXA 3PBEA 4OKOA 2AFXA 4NGRA 2PJBA 1TF8A 3B3TA 4FUUA 3JRUA 1FT7A 1R43A 3KI9A 2V77A 4DUKA 3WC5A 2PJ5A 3PFOA 4PQAA 3SJXA 2PJ8A 3WC7A 5J1QA 4OC5A 3IEHA 3ICUA 2GREA 2PJ1A 3KGQA 4P4JA 2ZOGA 4Q7AA 1TXRA 1YLOA 1ZG9A 2C6GA 3LWUA 2PJ0A 2HB6A 3GB0A 3IWWA 1LCPA 4ONWA 4PXCA 3IC1A 4NGSA 2PJ7A 3PB8X 3V38A 4C8PA 1XMBA 3D7GA 4A38A 4NJRA 1TF9A 4X3RA 1M4LA 4C86A 1ELLP 3LMSA 4EFDA 4GM5A 3IO1A 2WZNA 2EK9A 1ELMP 2ZOFA 2OR4A 4DYOA 2HC9A 2F7VA 5HVFA 2Q43A 4P4EA 2PJCA 2VL1A 4OC1A 4IHMA 1RTQA 3D7FA 2Q51A 3I74A 3T8WA 1F2PA 4F9VA 3PBBA 3DLJA 5LYLA 2XEGA 3KL9A 4DJLA 4ZY0A 4G1PA 5ELYA 4NGQA 3B3WA 2IMOA 4YU9A 4C99A 1VIXA 5JM6A 7CPAA 1QMUA 1VHEA 4H2KA 2ZEOA 3FECA 3TX8A 1BAVA 4NFRA 1LANA 4ZY1A 2O53A 3FX6A 2BO9A 3KQXA 3ISXA 4Z65A 4JYWA 3KHZA 3PFEA 4ZI6A 5D8NA 2GU2A 2IJZA 3GUXA 3NH8A 4B6ZA 2XEFA 3H8GA 4LQGA 4P4BA 4TJVA 1Z8LA 1LAMA 2PCUA 5CPAA 2ZEMA 3VATA 4C9EA 2PJ3A 4P45A 4MHZA 3WT4A 1QQ9A 2V8HA 4P4FA 3B35A 4WWVA 1PCAA 4MHPA 3KZWA 1HDQA 3B3VA 5CBMA 4UF4A 2CTCA 4NGPA 1CP7A 3SI1A 3FVLA 5LYIA 3BI0A 3SJGA 4OP4A 3K9TA 4NJQA 2PE3A 1DE4C 4OC3A 4P10A 3MRUA 5LYDA 3SJEA 3FJUA 1F2OA 2NSMA 2C6CA 3N5FA 4C8AA 1ZG8A 5LRJA 4R7MA 4W9YA 2PJ6A 4CDJA 1UWYA 2PJ4A 3FEDA 3PB6X 4OMEA 4K3NA 4FBEA 4MHNA 3VARA 4A94A 3SJFA 8CPAA 1HEEA 1CPSA 2XEJA 3VTAA 3KR5A 3FEEA 1KWMA 3HUVA 4OC4A 4R76A 1CPXA 3BHXA 1NSAA 3HLPA 2XEIA 2ANPA 1V6CA 4C85A 2OOTA 5K8PA 1F57A 2ZEPA 3D7HA 2AFUA 3V7ZA 1TKJA 4UIAA 2ZENA 5DS0A 3B2YA 4YWYA 2FVGA 3H8EA 2GP4A 1DTDA 4FAIA 1WVMA 4R6TA 2PRQA 2WYRA 1GYTA 4C8UA 5LYFA 4UEEA 2BOAA 2AFZA 2V8DA 2QYVA 1YMEA 2AFWA 3QNVA 2GLJA 4OIDA 2DEAA 4F8ZA 3NH5A 1Z5RA 3WC6A 4PXEA 1ARLA 4IK2A 3CPAA 1XJOA 1YW4A 4MCQA 1XBUA 3GLJA 4ZY2A 2C1CA 3RAMA 4MMOA 3KASA 4WJBA 1R3NA 3B7IA 4MHYA 3PB9X 1FNOA 4X2TA 1XRYA 2ZEEA 1BPMA 3RZAA 2JBJA 4YN3A 2GLFA 3CT9A 5LRKA 4MCRA 1ZG7A 1CP6A 3SI2A 4MXUA 3D4UA 3BXMA 2EK8A 1JQGA 3D66A 1CBXA 1H8LA 2POKA 3I6SA 4NGTA 1Y0YA 4EMEA 3PRTA 1VHOA 3NFZA 2I3CA 4C9RA 2EWBA 2O4HA 3CDXA 1LAPA 4PPZA 5IR2A 3I1UA 5F09A 1OBRA 1TKHA 1BLLE 4NGNA 4C8FA 3B3SA 1CX8A 3L2NA 3S9NA 5IB9A 4MRIA 4P4DA 2PIZA 3IJ3A 4AXVA 2ABZA 4CDKA 4ZYQA 3CPXA 2QJ8A 2C6PA 4O23A 4UEZA 2JEWA 1ZLHA 4KSIA 1Y7EA 2RB7A 2V8VA 4BD9A 1IY7A 2F8HA 5K8OA 4PXBA 2JBKA 1Y0RA 1YW6A 3KHXA 4UEFA 1IGBA 3PEIA 3K2KA 3KQZA 1EE3P 1XF1A 4ZX9A 3NH4A 1BPNA 2AFOA 3PB7X 5I4MA 4C8TA 1AYEA 3TC8A 1PYTB 3RBUA 1ARMA 4TNUA 1LOKA 5HVGA 2G9DA 5HVHA 4EWTA 2C5QA 3EIFA 5THWA 3MN8A 1HDUA 4F9UA 4X8IA 4OC2A 2IQ6A 2PJ2A 1LFWA 1Y9ZA 4ZX8A 4CPAA 3BI1A 3FH4A 1Z2LA 2V8GA 3IIBA 1TKFA 2PVWA 4A39A 5K8NA 1CG2A 3S9LA 2ZEGA 5HXDA 6CPAA 2ZELA 3B3CA 2ZEDA 3VH9A 3NA6A 3H8FA 3S9MA 3D7DA 4C9AA 4IAVA 3PB4X 4JZ0A 4KNGE 5K8MA 4PXDA 3SI0A 1AMPA 4MCSA 3IFEA 4OIWA 4UIBA 5LRGA 2PVVA 2ZEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAB A;  4OC0 A;  3ISZ A;  2AFM A;  2BCO A;  4P6Y A;  2CF4 A;  4C84 A;  4P44 A;  2QVP A;  2PJA A;  4P4I A;  4MCP A;  4C9U A;  3D68 A;  2PJ9 A;  4C8C A;  2Q4Z A;  4C9V A;  4A37 A;  1YSJ A;  2NYQ A;  3KR4 A;  1VGY A;  3FF3 A;  3FMC A;  2CIJ A;  2CTB A;  1XFO A;  3D67 A;  2ZEF A;  5JGF A;  4TWE A;  2RFH A;  4R8F A;  4NGM A;  4FWU A;  4RUH A;  1ZLI A;  2PIY A;  5D29 A;  5JH9 A;  2AFS A;  2J9A A;  3DGV A;  1Q7L A;  4TJX A;  3PBE A;  4OKO A;  2AFX A;  4NGR A;  2PJB A;  1TF8 A;  3B3T A;  4FUU A;  3JRU A;  1FT7 A;  1R43 A;  3KI9 A;  2V77 A;  4DUK A;  3WC5 A;  2PJ5 A;  3PFO A;  4PQA A;  3SJX A;  2PJ8 A;  3WC7 A;  5J1Q A;  4OC5 A;  3IEH A;  3ICU A;  2GRE A;  2PJ1 A;  3KGQ A;  4P4J A;  2ZOG A;  4Q7A A;  1TXR A;  1YLO A;  1ZG9 A;  2C6G A;  3LWU A;  2PJ0 A;  2HB6 A;  3GB0 A;  3IWW A;  1LCP A;  4ONW A;  4PXC A;  3IC1 A;  4NGS A;  2PJ7 A;  3PB8 X;  3V38 A;  4C8P A;  1XMB A;  3D7G A;  4A38 A;  4NJR A;  1TF9 A;  4X3R A;  1M4L A;  4C86 A;  1ELL P;  3LMS A;  4EFD A;  4GM5 A;  3IO1 A;  2WZN A;  2EK9 A;  1ELM P;  2ZOF A;  2OR4 A;  4DYO A;  2HC9 A;  2F7V A;  5HVF A;  2Q43 A;  4P4E A;  2PJC A;  2VL1 A;  4OC1 A;  4IHM A;  1RTQ A;  3D7F A;  2Q51 A;  3I74 A;  3T8W A;  1F2P A;  4F9V A;  3PBB A;  3DLJ A;  5LYL A;  2XEG A;  3KL9 A;  4DJL A;  4ZY0 A;  4G1P A;  5ELY A;  4NGQ A;  3B3W A;  2IMO A;  4YU9 A;  4C99 A;  1VIX A;  5JM6 A;  7CPA A;  1QMU A;  1VHE A;  4H2K A;  2ZEO A;  3FEC A;  3TX8 A;  1BAV A;  4NFR A;  1LAN A;  4ZY1 A;  2O53 A;  3FX6 A;  2BO9 A;  3KQX A;  3ISX A;  4Z65 A;  4JYW A;  3KHZ A;  3PFE A;  4ZI6 A;  5D8N A;  2GU2 A;  2IJZ A;  3GUX A;  3NH8 A;  4B6Z A;  2XEF A;  3H8G A;  4LQG A;  4P4B A;  4TJV A;  1Z8L A;  1LAM A;  2PCU A;  5CPA A;  2ZEM A;  3VAT A;  4C9E A;  2PJ3 A;  4P45 A;  4MHZ A;  3WT4 A;  1QQ9 A;  2V8H A;  4P4F A;  3B35 A;  4WWV A;  1PCA A;  4MHP A;  3KZW A;  1HDQ A;  3B3V A;  5CBM A;  4UF4 A;  2CTC A;  4NGP A;  1CP7 A;  3SI1 A;  3FVL A;  5LYI A;  3BI0 A;  3SJG A;  4OP4 A;  3K9T A;  4NJQ A;  2PE3 A;  1DE4 C;  4OC3 A;  4P10 A;  3MRU A;  5LYD A;  3SJE A;  3FJU A;  1F2O A;  2NSM A;  2C6C A;  3N5F A;  4C8A A;  1ZG8 A;  5LRJ A;  4R7M A;  4W9Y A;  2PJ6 A;  4CDJ A;  1UWY A;  2PJ4 A;  3FED A;  3PB6 X;  4OME A;  4K3N A;  4FBE A;  4MHN A;  3VAR A;  4A94 A;  3SJF A;  8CPA A;  1HEE A;  1CPS A;  2XEJ A;  3VTA A;  3KR5 A;  3FEE A;  1KWM A;  3HUV A;  4OC4 A;  4R76 A;  1CPX A;  3BHX A;  1NSA A;  3HLP A;  2XEI A;  2ANP A;  1V6C A;  4C85 A;  2OOT A;  5K8P A;  1F57 A;  2ZEP A;  3D7H A;  2AFU A;  3V7Z A;  1TKJ A;  4UIA A;  2ZEN A;  5DS0 A;  3B2Y A;  4YWY A;  2FVG A;  3H8E A;  1DTD A;  4FAI A;  1WVM A;  4R6T A;  2PRQ A;  2WYR A;  1GYT A;  4C8U A;  5LYF A;  4UEE A;  2BOA A;  2AFZ A;  2V8D A;  2QYV A;  1YME A;  2AFW A;  3QNV A;  2GLJ A;  4OID A;  2DEA A;  4F8Z A;  3NH5 A;  1Z5R A;  3WC6 A;  4PXE A;  1ARL A;  4IK2 A;  3CPA A;  1XJO A;  1YW4 A;  4MCQ A;  1XBU A;  3GLJ A;  4ZY2 A;  2C1C A;  3RAM A;  4MMO A;  3KAS A;  4WJB A;  1R3N A;  3B7I A;  4MHY A;  3PB9 X;  1FNO A;  4X2T A;  1XRY A;  2ZEE A;  1BPM A;  3RZA A;  2JBJ A;  4YN3 A;  2GLF A;  3CT9 A;  5LRK A;  4MCR A;  1ZG7 A;  1CP6 A;  3SI2 A;  4MXU A;  3D4U A;  3BXM A;  2EK8 A;  1JQG A;  3D66 A;  1CBX A;  1H8L A;  2POK A;  3I6S A;  4NGT A;  1Y0Y A;  4EME A;  3PRT A;  1VHO A;  3NFZ A;  2I3C A;  4C9R A;  2EWB A;  2O4H A;  3CDX A;  1LAP A;  4PPZ A;  3I1U A;  5F09 A;  1OBR A;  1TKH A;  1BLL E;  4NGN A;  4C8F A;  3B3S A;  1CX8 A;  3L2N A;  3S9N A;  5IB9 A;  4MRI A;  4P4D A;  2PIZ A;  3IJ3 A;  4AXV A;  2ABZ A;  4CDK A;  4ZYQ A;  3CPX A;  2QJ8 A;  2C6P A;  4O23 A;  4UEZ A;  2JEW A;  1ZLH A;  4KSI A;  1Y7E A;  2RB7 A;  2V8V A;  4BD9 A;  1IY7 A;  2F8H A;  5K8O A;  4PXB A;  2JBK A;  1Y0R A;  1YW6 A;  3KHX A;  4UEF A;  1IGB A;  3PEI A;  3K2K A;  3KQZ A;  1EE3 P;  1XF1 A;  4ZX9 A;  3NH4 A;  1BPN A;  2AFO A;  3PB7 X;  5I4M A;  4C8T A;  1AYE A;  3TC8 A;  1PYT B;  3RBU A;  1ARM A;  4TNU A;  1LOK A;  5HVG A;  2G9D A;  5HVH A;  4EWT A;  3EIF A;  5THW A;  3MN8 A;  1HDU A;  4F9U A;  4X8I A;  4OC2 A;  2IQ6 A;  2PJ2 A;  1LFW A;  1Y9Z A;  4ZX8 A;  4CPA A;  3BI1 A;  3FH4 A;  1Z2L A;  2V8G A;  3IIB A;  1TKF A;  2PVW A;  4A39 A;  5K8N A;  1CG2 A;  3S9L A;  2ZEG A;  5HXD A;  6CPA A;  2ZEL A;  3B3C A;  2ZED A;  3VH9 A;  3NA6 A;  3H8F A;  3S9M A;  3D7D A;  4C9A A;  4IAV A;  3PB4 X;  4JZ0 A;  4KNG E;  5K8M A;  4PXD A;  3SI0 A;  1AMP A;  4MCS A;  3IFE A;  4OIW A;  4UIB A;  5LRG A;  2PVV A;  2ZEH A; 
#chains in the Genus database with same CATH topology
 3G3S A;  3WAB A;  4OC0 A;  3ISZ A;  2AFM A;  2EO8 A;  4FD5 A;  1M6V B;  4BTF A;  4XPD B;  2BCO A;  2G0B A;  2R8V A;  4H6U A;  4Q38 A;  1ZYM A;  4COB A;  4P6Y A;  2P6F A;  2CF4 A;  3D3S A;  4X5K A;  3S6G A;  3H4Q A;  3H5Z A;  4C84 A;  4P44 A;  3NE7 A;  2B4B A;  2PJA A;  2QVP A;  4P4I A;  1EO0 A;  4MCP A;  1VKC A;  4ZBG A;  1OZP A;  2EZB A;  4ORF A;  3P2H A;  5FVJ A;  2QML A;  4C9U A;  4RS2 A;  3D68 A;  2PJ9 A;  3V8I A;  4I49 A;  2Q4Z A;  3EFA A;  4C8C A;  4C9V A;  3OP0 A;  4HKF A;  1YSJ A;  2NYQ A;  2RC4 A;  1VGY A;  3KR4 A;  4A37 A;  4CS0 B;  3FF3 A;  3FMC A;  4MFL A;  2CIJ A;  2CTB A;  2ODF A;  3VGO A;  1XFO A;  1B47 A;  3D67 A;  2PC1 A;  2ZEF A;  3ZNI A;  4TWE A;  5JGF A;  4XNH C;  1AUG A;  3IU1 A;  2RFH A;  2VKZ G;  4R8F A;  3I9S A;  4NGM A;  4FWU A;  3PP9 A;  1MJA A;  4E94 A;  2B4J C;  1A9X B;  4RUH A;  4JXQ A;  2Z3K A;  1ZLI A;  2PIY A;  3IWE A;  5D29 A;  3S6H A;  4BPW B;  5JH9 A;  2AFS A;  2J9A A;  2YNE A;  2Q7S A;  3DGV A;  1Q7L A;  2QIR A;  1IIC A;  5KTD A;  2BL1 A;  2REF A;  4TJX A;  2ZXV A;  4JJX A;  1YVK A;  3PBE A;  4OKO A;  4MFZ A;  3B8G A;  1YVO A;  4KVO E;  2AFX A;  1M4G A;  4NGR A;  2OZG A;  4M8D A;  5J8C A;  2HWG A;  4KZT A;  2CNS A;  3QAH A;  2PJB A;  2XPO A;  2R7H A;  1TF8 A;  5DWN A;  3VRO A;  2VQY A;  4L89 A;  3B3T A;  2GFQ A;  3RO0 A;  2D0P A;  1Z9U A;  1XEB A;  3NFQ A;  3T0T A;  2D0O A;  4FUU A;  3JRU A;  1FT7 A;  1R43 A;  2CY2 A;  2V77 A;  3KI9 A;  3T5M A;  3ZZI A;  4DUK A;  3WC5 A;  2PJ5 A;  2B5G B;  3DSB A;  3PFO A;  3W91 A;  4PQA A;  4CGP A;  2Z3L A;  3TT2 A;  3SJX A;  1YRE A;  2PJ8 A;  2YND A;  3DDD A;  4RN7 A;  3WC7 A;  5J1Q A;  1C3O B;  4OC5 A;  2IL4 A;  3IEH A;  2ZW5 A;  5C88 A;  2GRE A;  3ICU A;  1PU9 A;  4HNY B;  2PJ1 A;  3FBU A;  3KGQ A;  3W6X A;  4F0X A;  4EYS A;  4P4J A;  2ZOG A;  4Q7A A;  2B58 A;  1TXR A;  4A4C A;  3EY5 A;  3F9K C;  1S3Z A;  1XF8 A;  4EVY A;  3DR6 A;  1YLO A;  2EZC A;  1ZG9 A;  2C6G A;  3LWU A;  1S5K A;  2CXA A;  2PJ0 A;  3PT1 A;  2HB6 A;  3GB0 A;  1CM0 A;  4H89 A;  2Q44 A;  3ZJ0 A;  2EZA A;  4CO9 A;  3IWW A;  2Z3M A;  3KRV A;  2VXK A;  4AVA A;  4AVC A;  4CAW A;  2BEI A;  2DF5 A;  1LCP A;  1WK4 A;  4ONW A;  3F8K A;  4PXC A;  4A95 A;  3IC1 A;  3D2P A;  4NGS A;  2PJ7 A;  3PB8 X;  3BUX B;  3V38 A;  3W6S A;  4C8P A;  3R9G A;  4LX9 A;  1XMB A;  3D7G A;  1Y7R A;  5DWM A;  4A38 A;  4KLV A;  4NJR A;  4XPL A;  1TF9 A;  4X3R A;  1M4L A;  2FIW A;  4C86 A;  3VWE A;  1ELL P;  3LMS A;  4PSW A;  2Z0Z A;  4HNX B;  2KCW A;  1VHS A;  2F5I A;  5F48 A;  4EFD A;  2AUM A;  1NMT A;  4INJ A;  5F1Y A;  3PFV A;  1YGH A;  4GM5 A;  2Q0Y A;  2Q7B A;  4CGL A;  5EMI A;  1YR0 A;  3GY9 A;  2WPW A;  2P6G A;  4CAF A;  2JDC A;  2WZN A;  3IO1 A;  2EK9 A;  1EZA A;  2AUN A;  1ELM P;  5EC4 A;  2AE6 A;  2ZOF A;  2OR4 A;  2B4D A;  3E0K A;  4DYO A;  2HC9 A;  2F7V A;  2OZH A;  5HVF A;  2QEC A;  2Q43 A;  4P4E A;  2PJC A;  4JWP A;  2R82 A;  2VL1 A;  3GIU A;  4OC1 A;  5H84 A;  4IHM A;  1RTQ A;  3D7F A;  2Q51 A;  4BBH A;  3T8W A;  4A32 A;  1VBH A;  3I74 A;  1F2P A;  4F9V A;  3PBB A;  1YQE A;  4COG A;  5BWA B;  3DLJ A;  5LYL A;  2XEG A;  2ZW6 A;  4CGN A;  3IGR A;  4Y49 C;  5G21 A;  2PQ8 A;  3KL9 A;  1M1D A;  4DJL A;  3GKR A;  4G1P A;  5ELY A;  4ZY0 A;  4NGQ A;  3B3W A;  1T36 B;  1Z9E A;  1IYK A;  2H5M A;  2IMO A;  1FBV A;  1VIX A;  4IF5 A;  4YU9 A;  4C99 A;  4IIY A;  5JM6 A;  7CPA A;  4ZGY B;  1QMU A;  1VHE A;  4H2K A;  2Z10 A;  4R3L A;  5J3X A;  2ZEO A;  1A2Z A;  5FD8 A;  3FEC A;  4KVM E;  3OAK A;  3TX8 A;  1P4N A;  1BAV A;  4NFR A;  4B10 A;  3TOA A;  4QBJ A;  4IIX A;  4CYN A;  1LAN A;  2WPX A;  4MBU A;  4MFK A;  2EVN A;  4MFJ A;  3LAC A;  2VEZ A;  3TTH A;  4XPD C;  4ZY1 A;  1X10 A;  3R95 A;  2O53 A;  3FX6 A;  3OWC A;  2BO9 A;  3VRP A;  3QAY A;  3KQX A;  3T9Y A;  4RI1 A;  4GXH A;  3ISX A;  5F5X A;  4Z65 A;  4GPL B;  4JYW A;  4OAD A;  3KHZ A;  4R87 A;  5IX3 A;  3EZE A;  3PFE A;  5I0C A;  3I3G A;  4ZI6 A;  3VRQ A;  1IID A;  2GU2 A;  2R98 A;  4MJ8 A;  5D8N A;  4C7I A;  2OH1 A;  2IJZ A;  3GUX A;  3NH8 A;  2NMT A;  4JXR A;  1B6B A;  2XEF A;  4B6Z A;  4IUS A;  3U88 C;  1KZF A;  3H8G A;  4NSQ A;  4LQG A;  4P4B A;  2D4O A;  3VRR A;  1RXT A;  4C2Y A;  2K5T A;  1Z8L A;  1LAM A;  2FCK A;  2PCU A;  4J3G A;  4UCN A;  5CPA A;  2ZEM A;  2ARH A;  3R96 A;  3VAT A;  5KTC A;  4C9E A;  2PJ3 A;  4P45 A;  4MHZ A;  3WT4 A;  3OB2 B;  1NXJ A;  3C8O A;  4CYQ A;  5HKZ A;  1QSO A;  1QQ9 A;  2V8H A;  4P4F A;  2GE3 A;  3B35 A;  4M6I A;  4M6H A;  4WWV A;  1PCA A;  2VZZ A;  4AG7 A;  1BXR B;  4MHP A;  4MJX A;  4A33 A;  2DLA A;  3KZW A;  1B87 A;  1HDQ A;  1P0H A;  3B3V A;  4UF4 A;  4CRZ B;  5CBM A;  1ZL0 A;  4KOS A;  2G3A A;  4B5O A;  2CTC A;  4NGP A;  1CP7 A;  3SI1 A;  3FVL A;  5LYI A;  5HMN A;  3BI0 A;  1X12 A;  3C26 A;  5C82 A;  3SJG A;  4OP4 A;  3K9T A;  2Z3N A;  2Y1M A;  3FYN A;  2PE3 A;  1DE4 C;  4NJQ A;  5AGE A;  1CJW A;  4BMH A;  4OC3 A;  2B5G A;  3SI0 A;  4GS4 A;  3T90 A;  5G22 A;  1Z8T A;  2OU2 A;  4P10 A;  4UCM A;  4C68 A;  3MRU A;  1NE9 A;  5LYD A;  2Y1N A;  5JQ4 A;  1VI4 A;  3SJE A;  4KUA A;  2PRB A;  3FJU A;  1FY7 A;  4MI4 A;  1F2O A;  2NSM A;  3HPG G;  4OAE A;  2C6C A;  4B12 A;  3N5F A;  1JDE A;  4KS9 A;  4C8A A;  1ZG8 A;  5LRJ A;  4R7M A;  4CGO A;  1Q5X A;  2FL4 A;  5JVL A;  4W9Y A;  2D4P A;  2FIA A;  4BIN A;  4TJV A;  2PJ6 A;  3G8W A;  4U9Y A;  4CDJ A;  3TLE A;  4CRY B;  1UWY A;  1TIQ A;  2PJ4 A;  3FED A;  1M44 A;  3PB6 X;  3TE4 A;  4OME A;  3TLZ A;  4K3N A;  4FD7 A;  4MFQ A;  4FBE A;  2YJT A;  1V0C A;  4BPU B;  2WSA A;  4MHN A;  3VAR A;  2P6E A;  4A94 A;  3SJF A;  3WR7 A;  8CPA A;  1HEE A;  1CPS A;  2XEJ A;  3VTA A;  3KR5 A;  4CAV A;  4R3K A;  3FEE A;  4KOT A;  2DXQ A;  2PCN A;  1KWM A;  3HUV A;  4OC4 A;  2PDO A;  4R76 A;  4AG9 A;  3TLA A;  3K4I A;  1CPX A;  3BHX A;  3JVN A;  4H1H A;  1NSA A;  1M4D A;  3HLP A;  4B14 A;  4Q36 A;  4CYP A;  2XEI A;  2A4N A;  1SQH A;  2ANP A;  3QB8 A;  2Q4V A;  1V6C A;  4JVO A;  2HQY A;  4C85 A;  2OOT A;  5K8P A;  1F57 A;  2ZEP A;  1QSM A;  3FIX A;  4PV6 A;  2OZU A;  2FXF A;  1DIK A;  3D7H A;  1NSL A;  2AFU A;  3V7Z A;  3O8Z A;  4AVB A;  2EUI A;  1YK3 A;  3BJ7 A;  4UA3 A;  2E28 A;  3NOJ A;  1Y9W A;  1TKJ A;  4UIA A;  1ZO0 A;  4XPK A;  5A27 A;  4QUS A;  5JPH A;  4CAE A;  3CXS A;  4NEX A;  2ZEN A;  5DS0 A;  3B2Y A;  1Z4R A;  4YWY A;  5A28 A;  2DPT A;  2FVG A;  3H8E A;  2GP4 A;  2XPP A;  1KUV A;  4M3S A;  1DTD A;  2JDD A;  1Q2D A;  4FAI A;  5ISV A;  2YJV A;  1WVM A;  4R6T A;  5F47 A;  2I00 A;  1UFH A;  4M6G A;  4UCP A;  2PRQ A;  1YVH A;  3HMJ G;  1MJ9 A;  2WYR A;  2CNT A;  4MY0 A;  1GYT A;  2UV8 G;  1GGO A;  3EO4 A;  1XE4 A;  1J4J A;  4C8U A;  5LYF A;  4UEE A;  2BOA A;  2AFZ A;  2V8D A;  2J8M A;  2QYV A;  1YME A;  2AFW A;  2JLM A;  3SHP A;  3QNV A;  1GHE A;  5E96 A;  2GLJ A;  4MY3 A;  4OID A;  4C7H A;  1MK4 A;  4II9 A;  2MP0 A;  3JUW A;  2VBQ A;  4E5S A;  2DEA A;  4F8Z A;  3NH5 A;  2G3T A;  4HNW B;  1XMT A;  2WUU A;  1Z5R A;  4UFX A;  4MFP A;  4PXE A;  3WC6 A;  1ARL A;  4IK2 A;  4Y49 B;  3CPA A;  1XJO A;  2N3A B;  3FXT A;  3KKW A;  5H86 A;  1KC7 A;  1YW4 A;  4BPX B;  4C2X A;  2FS5 A;  4MCQ A;  2GAN A;  3T07 A;  1XBU A;  2ZW7 A;  4UFW A;  1K4J A;  4U9Z A;  3GLJ A;  4ZY2 A;  3BUM B;  2OLS A;  1Z8X A;  2C1C A;  4U5Y A;  3RAM A;  4MMO A;  3KAS A;  4KOV A;  4CYO A;  4DNC A;  4KSA A;  5AXI A;  4WJB A;  3TFY A;  1R3N A;  1CS0 B;  1J3L A;  3B7I A;  4MHY A;  3PB9 X;  1FNO A;  4X2T A;  1XRY A;  2ZEE A;  1BPM A;  3RZA A;  1JWQ A;  1S7L A;  3TO6 A;  4B5P A;  2JBJ A;  3VRN A;  4YN3 A;  1XIX A;  2GLF A;  3CT9 A;  4UWJ A;  5LRK A;  3MGD A;  3OB1 B;  1BO4 A;  4MCR A;  1ZG7 A;  3DNS A;  4JLY A;  1CP6 A;  3SI2 A;  4MXU A;  3N7Z A;  3D4U A;  3BXM A;  2EK8 A;  1JQG A;  3D66 A;  3TLG A;  3VWD A;  4UWI A;  2BUE A;  1CBX A;  2FSR A;  1H8L A;  2B3U A;  1KBL A;  1I12 A;  5J8F A;  3FB3 A;  4B5P B;  2POK A;  2ZPA A;  1KUX A;  3UY5 A;  3I6S A;  4LUA A;  2CBL A;  5AG7 A;  4PSX A;  1LRZ A;  4NGT A;  3TLB A;  3GJZ A;  3TLG B;  4PK2 A;  4XNH B;  1XOV A;  4QVT A;  1Y0Y A;  5HKW A;  2C27 A;  1QST A;  3PRT A;  1VHO A;  3NFZ A;  4EME A;  2B0A A;  2DIK A;  2J8R A;  4KVX A;  3S6F A;  4B11 A;  2I3C A;  1R61 A;  4C9R A;  2EWB A;  2HUZ A;  3A9L A;  2EBJ A;  2PR1 A;  3D8P A;  2O4H A;  3CDX A;  1YLE A;  1N71 A;  2I79 A;  3D2M A;  4R57 A;  1IYL A;  1LAP A;  4PPZ A;  5IR2 A;  3TOB A;  3RYO A;  4A2Z A;  2Z11 A;  3I1U A;  5F09 A;  3RNZ A;  1OBR A;  2ZW4 A;  1TKH A;  4OLL A;  4UBR A;  4E8O A;  3G23 A;  3T05 A;  3IWG A;  4YRH A;  4NF1 A;  1M4I A;  2OB0 A;  1BLL E;  3JTK A;  5G1Z A;  3R9E A;  2HI6 A;  1Z8W A;  1WJT A;  4NGN A;  4C8F A;  3B3S A;  3K9U A;  4KOU A;  1CX8 A;  3L2N A;  3GYA A;  4YFJ A;  4A30 A;  5IB0 A;  3S9N A;  2Z3P A;  4F6A A;  5IB9 A;  4MRI A;  3EZB A;  4P4D A;  2PIZ A;  3IJ3 A;  3EZA A;  4AXV A;  2ABZ A;  4KOR A;  4ONU A;  4C2Z A;  4CDK A;  2JEV A;  1S7N A;  3R9F A;  1Y9K A;  2Y0M A;  3CPX A;  4E2A A;  4ZYQ A;  2QJ8 A;  2C6P A;  5KTA A;  3R1K A;  4O23 A;  3F0A A;  4UEZ A;  2JEW A;  1ZLH A;  1MJB A;  3BJ8 A;  4KSI A;  1Y7E A;  4MHD A;  1YX0 A;  4CAX A;  3PLF B;  1BOB A;  2REE A;  2RB7 A;  2V8V A;  3CXP A;  4H6Z A;  1IY7 A;  4BD9 A;  2F8H A;  3S6K A;  3SXN A;  5IV0 A;  4A4B A;  4LQ6 A;  3BUO B;  5K8O A;  4PXB A;  2JBK A;  1Y0R A;  1YW6 A;  2VZY A;  1Q2C A;  2YNC A;  2P0W A;  3EXN A;  3KHX A;  4FD6 A;  3TCV A;  1IOF A;  2YGW A;  3TO9 A;  5F13 A;  1IGB A;  3PGP A;  3PEI A;  3K2K A;  4M85 A;  4NCZ A;  3KQZ A;  4UEF A;  1EE3 P;  4FD4 A;  4KOX A;  1XF1 A;  4ZX9 A;  3NH4 A;  1S7K A;  1BPN A;  2AFO A;  3BLN A;  3PB7 X;  3SXO A;  2R1I A;  5I4M A;  1JDB C;  1L0C A;  5HKY A;  1NBW A;  3TLC A;  1AYE A;  1RO5 A;  3TC8 A;  5AG4 A;  4J0N A;  4KLW A;  4C8T A;  1KUY A;  4B13 A;  1PYT B;  3CZX A;  3RBU A;  1IU8 A;  1ARM A;  4TNU A;  2YNC C;  3F5B A;  2CNM A;  2VI7 A;  1LOK A;  1S7F A;  2FT0 A;  4RR2 B;  2G9D A;  2Q04 A;  2Q4Y A;  1U6M A;  4R9M A;  4EWT A;  4KOY A;  5HVG A;  5HVH A;  2C5Q A;  3EIF A;  2X0S A;  3HPH E;  5THW A;  5F46 A;  1CE8 B;  2B3V A;  3MN8 A;  1HDU A;  5F9M A;  3CXQ A;  1QSR A;  4X8I A;  4F9U A;  1ZRS A;  4OC2 A;  5BY0 A;  2PSW A;  2IQ6 A;  1I21 A;  2GIV A;  2PJ2 A;  2XPL A;  5GCN A;  1LFW A;  4CGM A;  1Y9Z A;  4HPS A;  2HRO A;  3TYX A;  4ZX8 A;  4CPA A;  4KUB A;  1ON0 A;  3BI1 A;  3FH4 A;  2ATR A;  1Z2L A;  2V8G A;  2AJ6 A;  1KEE B;  3IIB A;  1TKF A;  3PZJ A;  5AG5 A;  4A31 A;  1QSN A;  2XPN A;  3SR3 A;  2PVW A;  3TO7 A;  4YGO A;  3TLY A;  4F0Y A;  4QB9 A;  5CNP A;  4K30 A;  4A39 A;  1I1D A;  3LD2 A;  2O28 A;  2X7B A;  4QC6 A;  5K8N A;  1CG2 A;  1C30 B;  5F49 A;  3FNC A;  3LOD A;  3S9L A;  2J8N A;  2ZEG A;  5HXD A;  6CPA A;  1R57 A;  2ZEL A;  3FRM A;  2FE7 A;  5JYB A;  5EBV A;  2PR8 A;  5K99 A;  3B3C A;  1EZB A;  4PK3 A;  2ZED A;  4NXY A;  3VH9 A;  3U1B A;  3EC4 A;  5G20 A;  3NA6 A;  3H8F A;  3P2F A;  1S60 A;  1IB1 E;  4E0A A;  3S9M A;  4KSF A;  5HH1 A;  2HV2 A;  3BUW B;  1Q2Y A;  3D7D A;  2B4D B;  4UFV A;  4C9A A;  4IAV A;  3PB4 X;  3IU2 A;  3DR8 A;  4MI1 A;  2FM4 A;  2Z3O A;  1IOI A;  4JZ0 A;  4AB7 A;  4KNG E;  5K8M A;  3NE8 A;  4KOW A;  4L8A A;  1PUA A;  1Z4E A;  2BSW A;  4MCS A;  1AMP A;  3IFE A;  4OIW A;  4PXD A;  2DPS A;  4JD6 A;  4UIB A;  5LRG A;  2PVV A;  1VBG A;  1WWZ A;  4CZ1 A;  3BUN B;  2ZEH A;  5AG6 A; 
#chains in the Genus database with same CATH homology
 3WAB A;  4OC0 A;  3ISZ A;  2AFM A;  2BCO A;  4P6Y A;  2CF4 A;  4C84 A;  4P44 A;  2QVP A;  2PJA A;  4P4I A;  4MCP A;  4C9U A;  3D68 A;  2PJ9 A;  4C8C A;  2Q4Z A;  4C9V A;  4A37 A;  1YSJ A;  2NYQ A;  3KR4 A;  1VGY A;  3FF3 A;  3FMC A;  2CIJ A;  2CTB A;  1XFO A;  3D67 A;  2ZEF A;  5JGF A;  4TWE A;  2RFH A;  4R8F A;  4NGM A;  4FWU A;  4RUH A;  1ZLI A;  2PIY A;  5D29 A;  5JH9 A;  2AFS A;  2J9A A;  3DGV A;  1Q7L A;  4TJX A;  3PBE A;  4OKO A;  2AFX A;  4NGR A;  2PJB A;  1TF8 A;  3B3T A;  4FUU A;  3JRU A;  1FT7 A;  1R43 A;  3KI9 A;  2V77 A;  4DUK A;  3WC5 A;  2PJ5 A;  3PFO A;  4PQA A;  3SJX A;  2PJ8 A;  3WC7 A;  5J1Q A;  4OC5 A;  3IEH A;  3ICU A;  2GRE A;  2PJ1 A;  3KGQ A;  4P4J A;  2ZOG A;  4Q7A A;  1TXR A;  1YLO A;  1ZG9 A;  2C6G A;  3LWU A;  2PJ0 A;  2HB6 A;  3GB0 A;  3IWW A;  1LCP A;  4ONW A;  4PXC A;  3IC1 A;  4NGS A;  2PJ7 A;  3PB8 X;  3V38 A;  4C8P A;  1XMB A;  3D7G A;  4A38 A;  4NJR A;  1TF9 A;  4X3R A;  1M4L A;  4C86 A;  1ELL P;  3LMS A;  4EFD A;  4GM5 A;  3IO1 A;  2WZN A;  2EK9 A;  1ELM P;  2ZOF A;  2OR4 A;  4DYO A;  2HC9 A;  2F7V A;  5HVF A;  2Q43 A;  4P4E A;  2PJC A;  2VL1 A;  4OC1 A;  4IHM A;  1RTQ A;  3D7F A;  2Q51 A;  3I74 A;  3T8W A;  1F2P A;  4F9V A;  3PBB A;  3DLJ A;  5LYL A;  2XEG A;  3KL9 A;  4DJL A;  4ZY0 A;  4G1P A;  5ELY A;  4NGQ A;  3B3W A;  2IMO A;  4YU9 A;  4C99 A;  1VIX A;  5JM6 A;  7CPA A;  1QMU A;  1VHE A;  4H2K A;  2ZEO A;  3FEC A;  3TX8 A;  1BAV A;  4NFR A;  1LAN A;  4ZY1 A;  2O53 A;  3FX6 A;  2BO9 A;  3KQX A;  3ISX A;  4Z65 A;  4JYW A;  3KHZ A;  3PFE A;  4ZI6 A;  5D8N A;  2GU2 A;  2IJZ A;  3GUX A;  3NH8 A;  4B6Z A;  2XEF A;  3H8G A;  4LQG A;  4P4B A;  4TJV A;  1Z8L A;  1LAM A;  2PCU A;  5CPA A;  2ZEM A;  3VAT A;  4C9E A;  2PJ3 A;  4P45 A;  4MHZ A;  3WT4 A;  1QQ9 A;  2V8H A;  4P4F A;  3B35 A;  4WWV A;  1PCA A;  4MHP A;  3KZW A;  1HDQ A;  3B3V A;  5CBM A;  4UF4 A;  2CTC A;  4NGP A;  1CP7 A;  3SI1 A;  3FVL A;  5LYI A;  3BI0 A;  3SJG A;  4OP4 A;  3K9T A;  4NJQ A;  2PE3 A;  1DE4 C;  4OC3 A;  4P10 A;  3MRU A;  5LYD A;  3SJE A;  3FJU A;  1F2O A;  2NSM A;  2C6C A;  3N5F A;  4C8A A;  1ZG8 A;  5LRJ A;  4R7M A;  4W9Y A;  2PJ6 A;  4CDJ A;  1UWY A;  2PJ4 A;  3FED A;  3PB6 X;  4OME A;  4K3N A;  4FBE A;  4MHN A;  3VAR A;  4A94 A;  3SJF A;  8CPA A;  1HEE A;  1CPS A;  2XEJ A;  3VTA A;  3KR5 A;  3FEE A;  1KWM A;  3HUV A;  4OC4 A;  4R76 A;  1CPX A;  3BHX A;  1NSA A;  3HLP A;  2XEI A;  2ANP A;  1V6C A;  4C85 A;  2OOT A;  5K8P A;  1F57 A;  2ZEP A;  3D7H A;  2AFU A;  3V7Z A;  1TKJ A;  4UIA A;  2ZEN A;  5DS0 A;  3B2Y A;  4YWY A;  2FVG A;  3H8E A;  2GP4 A;  1DTD A;  4FAI A;  1WVM A;  4R6T A;  2PRQ A;  2WYR A;  1GYT A;  4C8U A;  5LYF A;  4UEE A;  2BOA A;  2AFZ A;  2V8D A;  2QYV A;  1YME A;  2AFW A;  3QNV A;  2GLJ A;  4OID A;  2DEA A;  4F8Z A;  3NH5 A;  1Z5R A;  3WC6 A;  4PXE A;  1ARL A;  4IK2 A;  3CPA A;  1XJO A;  1YW4 A;  4MCQ A;  1XBU A;  3GLJ A;  4ZY2 A;  2C1C A;  3RAM A;  4MMO A;  3KAS A;  4WJB A;  1R3N A;  3B7I A;  4MHY A;  3PB9 X;  1FNO A;  4X2T A;  1XRY A;  2ZEE A;  1BPM A;  3RZA A;  2JBJ A;  4YN3 A;  2GLF A;  3CT9 A;  5LRK A;  4MCR A;  1ZG7 A;  1CP6 A;  3SI2 A;  4MXU A;  3D4U A;  3BXM A;  2EK8 A;  1JQG A;  3D66 A;  1CBX A;  1H8L A;  2POK A;  3I6S A;  4NGT A;  1Y0Y A;  4EME A;  3PRT A;  1VHO A;  3NFZ A;  2I3C A;  4C9R A;  2EWB A;  2O4H A;  3CDX A;  1LAP A;  4PPZ A;  5IR2 A;  3I1U A;  5F09 A;  1OBR A;  1TKH A;  1BLL E;  4NGN A;  4C8F A;  3B3S A;  1CX8 A;  3L2N A;  3S9N A;  5IB9 A;  4MRI A;  4P4D A;  2PIZ A;  3IJ3 A;  4AXV A;  2ABZ A;  4CDK A;  4ZYQ A;  3CPX A;  2QJ8 A;  2C6P A;  4O23 A;  4UEZ A;  2JEW A;  1ZLH A;  4KSI A;  1Y7E A;  2RB7 A;  2V8V A;  4BD9 A;  1IY7 A;  2F8H A;  5K8O A;  4PXB A;  2JBK A;  1Y0R A;  1YW6 A;  3KHX A;  4UEF A;  1IGB A;  3PEI A;  3K2K A;  3KQZ A;  1EE3 P;  1XF1 A;  4ZX9 A;  3NH4 A;  1BPN A;  2AFO A;  3PB7 X;  5I4M A;  4C8T A;  1AYE A;  3TC8 A;  1PYT B;  3RBU A;  1ARM A;  4TNU A;  1LOK A;  5HVG A;  2G9D A;  5HVH A;  4EWT A;  2C5Q A;  3EIF A;  5THW A;  3MN8 A;  1HDU A;  4F9U A;  4X8I A;  4OC2 A;  2IQ6 A;  2PJ2 A;  1LFW A;  1Y9Z A;  4ZX8 A;  4CPA A;  3BI1 A;  3FH4 A;  1Z2L A;  2V8G A;  3IIB A;  1TKF A;  2PVW A;  4A39 A;  5K8N A;  1CG2 A;  3S9L A;  2ZEG A;  5HXD A;  6CPA A;  2ZEL A;  3B3C A;  2ZED A;  3VH9 A;  3NA6 A;  3H8F A;  3S9M A;  3D7D A;  4C9A A;  4IAV A;  3PB4 X;  4JZ0 A;  4KNG E;  5K8M A;  4PXD A;  3SI0 A;  1AMP A;  4MCS A;  3IFE A;  4OIW A;  4UIB A;  5LRG A;  2PVV A;  2ZEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...