3BI1A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of methotrexate-glu
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bi1A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bi1A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bi1A02
3H8GA 3KHXA 4NGRA 1LANA 4A39A 3KR5A 1EE3P 3BI0A 2IJZA 1Z8LA 4FBEA 3KASA 5K8MA 3PB8X 4C99A 1XFOA 5CBMA 3KL9A 1Y0RA 1Z2LA 4FUUA 1F57A 1TKFA 4P4DA 4P4BA 2BO9A 2PJBA 5K8NA 4DUKA 4ZYQA 3ISXA 4W9YA 2CTCA 2IQ6A 4NJRA 4UIAA 3MN8A 4PXBA 2WYRA 4O23A 3VH9A 4ZY0A 3LWUA 3KI9A 1CG2A 3FH4A 4IHMA 4JYWA 2PJ0A 3SJFA 2ZEPA 4A94A 4NGPA 1IY7A 4X2TA 4EFDA 1CPXA 1TKJA 4NFRA 4LQGA 1XRYA 2WZNA 1CPSA 3V38A 3FEDA 2XEFA 2PJ4A 3CT9A 2OR4A 1QMUA 4OC2A 2DEAA 3RBUA 1QQ9A 1TKHA 4F9VA 2HB6A 4ZX9A 3HLPA 4ZY1A 8CPAA 3PB7X 3VTAA 3N5FA 3B35A 1ELMP 2GU2A 3SI0A 5D8NA 4X8IA 4BD9A 4PXEA 4C86A 4F9UA 4FAIA 5LYIA 2EK9A 7CPAA 3FEEA 4Z65A 2IMOA 5I4MA 1BLLE 1UWYA 2ZELA 2G9DA 2BCOA 3FJUA 2PVWA 4ZX8A 4PXDA 2O4HA 4NGQA 2PJ8A 3VARA 3I74A 4OC0A 5DS0A 3IWWA 4MMOA 4R76A 2JBKA 4MCQA 3LMSA 1XJOA 3ISZA 4P10A 2GREA 2ZEMA 4A37A 1F2OA 5LYFA 1FNOA 4NGMA 4Q7AA 2GLFA 2AFWA 3CPXA 3B3SA 4WWVA 3SJXA 2QYVA 4MHNA 5JGFA 1XF1A 1R3NA 2JEWA 3PRTA 4H2KA 2C6PA 5D29A 3IFEA 1YLOA 4OP4A 2NSMA 5IB9A 3S9LA 4C8PA 1Q7LA 3GB0A 4C8AA 1ARLA 5THWA 4B6ZA 4K3NA 4OC1A 4OKOA 4NGNA 4P44A 1OBRA 4C9RA 2Q43A 4ZI6A 4IK2A 2FVGA 4YN3A 2JBJA 1YMEA 2OOTA 2PE3A 4CDKA 3PFEA 4IAVA 2ZEOA 3NH5A 4P4EA 4CPAA 2ZEDA 3D7GA 1CX8A 2PJ9A 4MCSA 6CPAA 1F2PA 1Y9ZA 2PVVA 4R7MA 3SI2A 2PIYA 3D67A 3NH4A 3I1UA 5HXDA 3IO1A 1CP7A 3PFOA 3WABA 1BAVA 3RAMA 3BHXA 4UIBA 4YU9A 2QJ8A 2AFZA 4R8FA 2PJCA 2V8GA 2ZOFA 4OIDA 4KSIA 2CIJA 3IJ3A 3PEIA 5ELYA 1VIXA 1DTDA 5J1QA 2AFMA 5CPAA 2PJ3A 4CDJA 3PBBA 4MXUA 2ZOGA 2PJAA 1KWMA 3B3VA 3B3CA 2GLJA 1LOKA 3BI1A 4P6YA 4DJLA 3TC8A 4TJXA 4MRIA 1ELLP 2HC9A 4TNUA 3D7FA 5JM6A 1XMBA 3I6SA 2V8VA 3D4UA 3H8EA 3BXMA 2VL1A 4TWEA 3B3TA 4P4FA 1ARMA 5JH9A 3D68A 2ABZA 3JRUA 3QNVA 4OMEA 3FVLA 3S9NA 2EK8A 4A38A 1TF9A 3KHZA 4NGTA 3S9MA 4YWYA 1LAPA 4P4IA 3KQZA 3WC6A 3K2KA 4C8CA 3CPAA 5LYLA 2I3CA 4FWUA 2ZEEA 3KGQA 1RTQA 4DYOA 1WVMA 4JZ0A 3SJEA 3H8FA 5K8OA 4R6TA 3GUXA 5LRJA 4C9EA 4AXVA 2ZENA 1FT7A 4C85A 2PJ5A 4C8FA 1M4LA 1PYTB 2CTBA 2ZEHA 3NH8A 2AFXA 2POKA 1HEEA 4UF4A 3FECA 3PB6X 5LRGA 2Q51A 2F7VA 3V7ZA 1VHEA 4PXCA 3HUVA 4TJVA 2C6GA 1NSAA 3WC7A 4F8ZA 4X3RA 2J9AA 4OC4A 2XEIA 5HVHA 1VHOA 2Q4ZA 4NJQA 4P45A 2QVPA 4MHYA 2XEGA 1R43A 2C6CA 3B7IA 2PJ7A 3MRUA 2PRQA 4UEFA 4EMEA 1HDUA 4MCRA 4RUHA 3PB4X 3KR4A 1CBXA 3B2YA 2PCUA 1V6CA 3FMCA 3IEHA 2XEJA 1YW6A 4UEEA 1DE4C 1TXRA 4C9VA 1JQGA 3PB9X 2C1CA 3T8WA 3KQXA 1LCPA 4C84A 4OC5A 2F8HA 2V8DA 1BPNA 5F09A 3FF3A 4KNGE 3SJGA 4PPZA 1CP6A 3L2NA 3D7HA 3IC1A 3WC5A 1LAMA 5LRKA 1AMPA 4MCPA 1VGYA 1ZG8A 4OIWA 1Z5RA 5HVFA 1BPMA 1ZG9A 3K9TA 1YW4A 3B3WA 2ANPA 3VATA 3EIFA 3DGVA 4MHPA 1H8LA 3PBEA 3FX6A 1PCAA 2PIZA 4GM5A 2PJ1A 2PJ6A 1ZLHA 3ICUA 1LFWA 4P4JA 1ZG7A 2EWBA 4UEZA 3DLJA 2NYQA 3IIBA 1IGBA 2AFOA 2ZEGA 5LYDA 2V77A 4C8UA 3CDXA 1ZLIA 3SI1A 2PJ2A 5HVGA 1Y7EA 1TF8A 4OC3A 2AFSA 3D66A 2O53A 3NFZA 3NA6A 2CF4A 1AYEA 4EWTA 2ZEFA 3KZWA 4C9AA 5K8PA 3GLJA 3D7DA 3TX8A 4ONWA 1YSJA 2V8HA 4G1PA 2RB7A 4MHZA 4C8TA 1XBUA 2BOAA 4PQAA 1Y0YA 4C9UA 2RFHA 1GYTA 3RZAA 3WT4A 1HDQA 4NGSA 2AFUA 4ZY2A 4WJBA
chains in the Genus database with same CATH superfamily
3H8GA 3KHXA 2Q4YA 3TYXA 2Q7SA 1KZFA 2DF5A 1PUAA 2AUMA 4QB9A 2Z3MA 3HMJG 1Q2DA 1NE9A 1KUXA 2BL1A 4NGRA 1LANA 4KVOE 2AJ6A 3OWCA 3LD2A 4A39A 3TLGA 3NFQA 3VGOA 2I79A 3KR5A 4HNWB 3EZEA 1EE3P 3BI0A 1Y7RA 2IJZA 1Z8LA 4FBEA 3KASA 5K8MA 1V0CA 3TTHA 3ZNIA 4MY0A 2VEZA 3PB8X 5BWAB 1XFOA 3IEHA 3KL9A 5CBMA 4C99A 1IYLA 1Y0RA 1Z2LA 4FUUA 4CAWA 4EVYA 4E5SA 1F57A 1TKFA 4P4DA 4P4BA 3ZZIA 4C7HA 4ZGYB 4CYOA 2BO9A 4QC6A 2PJBA 4C7IA 5K8NA 3T0TA 4DUKA 2ATRA 4ZYQA 3ISXA 4ORFA 5KTAA 4W9YA 1GHEA 2CTCA 2H5MA 2IQ6A 4M6HA 3F5BA 4NJRA 4UIAA 3MN8A 2HROA 2EO8A 2WYRA 1B6BA 2PQ8A 4LUAA 4PXBA 2CY2A 5F13A 3K9UA 2CNSA 1TIQA 4O23A 3VH9A 4ZY0A 3LWUA 4MFLA 1ZYMA 3KI9A 4XPDC 4MJXA 2WSAA 2Z3PA 2Z3KA 1CG2A 3FH4A 1ZO0A 4IHMA 4JYWA 2PJ0A 3EC4A 2Y1NA 3KRVA 3FYNA 3GIUA 5G1ZA 2I00A 4MI1A 2FSRA 3SJFA 4CO9A 4KOWA 3VRRA 4CZ1A 2ZEPA 3ZJ0A 3P2HA 4KVME 4RR2B 2BUEA 2J8NA 4L8AA 1CJWA 1YVOA 4NGPA 4A94A 4U9ZA 5F46A 1IY7A 4X2TA 1M4IA 2OU2A 2ZW4A 3EZBA 4EFDA 1CPXA 2R98A 1TKJA 1VI4A 2YNCC 4NFRA 4NF1A 1NMTA 4C2YA 1VHSA 4LQGA 1XRYA 2WZNA 1CPSA 4H6UA 3V38A 3FEDA 2XEFA 2JLMA 2PJ4A 3TE4A 3CT9A 2OR4A 4LX9A 1QMUA 4OC2A 2DEAA 4A32A 4RI1A 2P6GA 3RBUA 1QQ9A 1J4JA 1TKHA 4F9VA 2HB6A 1UFHA 3BUNB 4ZX9A 3HLPA 2BSWA 1M4GA 4ZY1A 8CPAA 2EZAA 3PB7X 1XE4A 3RYOA 3N5FA 4KOTA 1FY7A 1NBWA 3VTAA 4A4BA 3B35A 1ELMP 3PP9A 2GU2A 4L89A 2Q4VA 2YGWA 3H4QA 3SI0A 4BINA 1OZPA 4E0AA 5D8NA 4JXRA 2ARHA 4X8IA 4BD9A 4PXEA 4YFJA 5FD8A 2P0WA 2FE7A 1IOIA 2CBLA 4NCZA 4UFVA 4Y49B 4PV6A 4CAEA 4C86A 4F9UA 1S7NA 2C27A 3W6SA 4FAIA 2D0OA 5LYIA 4KOSA 2CXAA 2EK9A 4ONUA 3CXQA 2GFQA 1IIDA 2P6FA 1R57A 7CPAA 4KOUA 3FEEA 4Z65A 2IMOA 2HWGA 1EZBA 5I4MA 1BLLE 1UWYA 2ZELA 2GP4A 2G9DA 3A9LA 4JVOA 3JVNA 2BCOA 3FJUA 2PVWA 5EC4A 2Q7BA 4J0NA 4XNHB 4ZX8A 4PXDA 3R9FA 2O4HA 3KKWA 4NGQA 2PJ8A 2Z0ZA 3VARA 2JDCA 4ZBGA 2DXQA 3I74A 4OC0A 2X7BA 5DS0A 3NOJA 3IWWA 1YK3A 1GGOA 3S6FA 4MMOA 4R76A 2JBKA 4MCQA 4F6AA 3HPGG 3LMSA 5EMIA 4QBJA 4EYSA 2GE3A 4MBUA 1XJOA 4MI4A 4IIXA 3OP0A 2B5GB 3ISZA 4P10A 2GREA 2ZEMA 4A37A 1F2OA 5LYFA 1FNOA 2DLAA 3PFVA 4E8OA 4UWIA 2Z3NA 4NGMA 4Q7AA 1CS0B 2GLFA 2ZW6A 1NSLA 2VZYA 3TT2A 4OADA 3CZXA 5FVJA 4MFZA 4JXQA 2AFWA 4AVBA 3CPXA 4JWPA 3B3SA 2K5TA 5G20A 4WWVA 3SJXA 2D0PA 3R1KA 5IR2A 4KOYA 5AXIA 1P4NA 2PSWA 4KSAA 3T9YA 2QYVA 4CRYB 4MHNA 5JGFA 3HPHE 4PK2A 4CGMA 1XF1A 1R3NA 2JEWA 3EY5A 3PRTA 4H2KA 2C6PA 5D29A 2B4JC 1YLOA 3IFEA 4OP4A 4A2ZA 2NSMA 3U88C 3O8ZA 4BPWB 3S9LA 4Y49C 2OZUA 4MHDA 1Q7LA 1JWQA 3GB0A 1IOFA 5G22A 4F0YA 5KTDA 4C8AA 1ARLA 5THWA 4M6IA 4B6ZA 4K3NA 2VZZA 4JJXA 4CGPA 4OC1A 1WK4A 4PSXA 1I12A 4A30A 2B0AA 3TLCA 4Q36A 5IX3A 4OKOA 2REFA 4NGNA 4P44A 3LACA 4IF5A 1Q2CA 4XNHC 5DWNA 3EXNA 1OBRA 4PK3A 1ZL0A 4C9RA 2FT0A 4UBRA 5G21A 1KUVA 1MJ9A 1A2ZA 1Z4EA 2Q43A 4ZI6A 4IK2A 1Y9WA 1QSTA 2FVGA 4KORA 3BLNA 4YN3A 3R96A 3EO4A 2QMLA 4H89A 2JBJA 1YMEA 1YR0A 4C68A 4QVTA 4E2AA 2G3AA 4CGOA 2OH1A 4BTFA 4II9A 2OOTA 2PE3A 3TO6A 4CDKA 3PFEA 4IAVA 3TOBA 1XMTA 4UCPA 4H1HA 3T5MA 3IU2A 2ZEOA 3NH5A 3QB8A 1BOBA 2FIWA 4KVXA 3T07A 5H86A 4P4EA 3FIXA 2WUUA 4CPAA 1AUGA 4FD6A 1VBGA 5JYBA 2ZEDA 3D7GA 5C88A 1CX8A 4CYPA 2PJ9A 4MCSA 3TLGB 6CPAA 1B87A 2QIRA 3BUWB 4B11A 3PLFB 1F2PA 4MY3A 1Y9ZA 1IU8A 1BO4A 3TFYA 3TLEA 2PVVA 3MGDA 4R7MA 3SI2A 2PIYA 3D67A 3DR8A 3NH4A 4X5KA 3SHPA 3I1UA 1YLEA 2FXFA 5F48A 2XPOA 4BPXB 5HXDA 3IO1A 1CP7A 4COBA 5J8FA 3PFOA 5IB0A 2FL4A 2Z10A 3F0AA 3G8WA 1BAVA 1PU9A 3BHXA 4RN7A 3RAMA 3WABA 4INJA 4UIBA 4YU9A 4A4CA 2QJ8A 3V8IA 5JQ4A 2D4PA 2AFZA 2FM4A 4R8FA 1ON0A 2EZBA 4XPKA 2PJCA 4QUSA 2V8GA 2ZOFA 3DSBA 4OIDA 4KSIA 3DR6A 3GYAA 2CIJA 3IJ3A 1KUYA 2F5IA 3PEIA 3PZJA 2X0SA 4KS9A 5ELYA 3SR3A 2RC4A 1ZRSA 3OB2B 1VIXA 1CE8B 5F1YA 1DTDA 2VI7A 4MFPA 4JLYA 4JD6A 3WR7A 5J1QA 2AFMA 1I21A 4KUBA 2XPPA 5CPAA 2PJ3A 4CDJA 3PBBA 4MXUA 5A28A 3PGPA 4R87A 3K4IA 3BJ7A 2ZOGA 2PJAA 4UA3A 2NMTA 1KWMA 3B3VA 4B5OA 3B3CA 2GLJA 4YRHA 3BUXB 1LOKA 4NEXA 3BI1A 3TLBA 4P6YA 1YVKA 2OZHA 1RXTA 4FD5A 4NXYA 4DJLA 2G0BA 4FD7A 3TC8A 4TJXA 5GCNA 2EBJA 4IUSA 4MRIA 1M6VB 1ELLP 3PT1A 3S6KA 1MK4A 4M85A 4C2ZA 3R9EA 2HUZA 5CNPA 1YQEA 1IYKA 2HC9A 2Z3LA 3P2FA 4TNUA 2VKZG 4CGLA 5AG5A 3D7FA 2B3VA 4R9MA 5JM6A 2DIKA 3N7ZA 1XMBA 3QAYA 3I6SA 1MJAA 1QSOA 2V8VA 3D4UA 3H8EA 3BXMA 3F9KC 4KZTA 2VL1A 4TWEA 2BEIA 4BMHA 4K30A 4CAXA 2B4DA 3B3TA 1KC7A 4P4FA 1ARMA 5JH9A 3D68A 2ABZA 3JRUA 4E94A 4I49A 2PRBA 3QNVA 4OMEA 2N3AB 3FVLA 2FIAA 1FBVA 3S9NA 2EK8A 4Q38A 1DIKA 2HI6A 4B5PA 3S6HA 4A38A 1TF9A 3SXOA 5ISVA 1S7FA 1XIXA 3KHZA 4NGTA 3FRMA 3S9MA 4GPLB 4YWYA 2Y0MA 1KBLA 4R3LA 4M3SA 1LAPA 5F49A 3EZAA 5DWMA 5AG6A 4P4IA 3KQZA 5K99A 3C8OA 3WC6A 3K2KA 1KEEB 2REEA 4CRZB 3CPAA 2YNCA 3FB3A 3DNSA 5LYLA 1NXJA 2I3CA 2ZPAA 4GS4A 2C5QA 4FWUA 4NSQA 2ZEEA 2JDDA 2O28A 3EFAA 1RTQA 3KGQA 5C82A 1M4DA 4DYOA 1WVMA 1XEBA 4JZ0A 3SJEA 5A27A 3H8FA 4FD4A 2EVNA 5K8OA 4R6TA 3GUXA 5LRJA 4KOXA 3IIBA 4C9EA 1EZAA 4KUAA 3NE8A 3I3GA 4AXVA 4B10A 2ZENA 1FT7A 4GXHA 4C85A 4B5PB 2ZW7A 3D3SA 2PJ5A 4CYNA 4C8FA 4UCNA 3VRNA 5HKZA 1M4LA 2D4OA 1PYTB 2CTBA 2ZEHA 2UV8G 4HNYB 2Z11A 3T05A 3NH8A 2AFXA 3OB1B 3F8KA 1Z9EA 1HEEA 2POKA 4H6ZA 4CGNA 4UF4A 3FECA 3PB6X 5LRGA 2A4NA 4R3KA 3FXTA 2Q51A 2F7VA 3V7ZA 5F9MA 3TLZA 5F47A 1VHEA 2PCNA 4PXCA 3HUVA 1S3ZA 4TJVA 2Q04A 2C6GA 1NSAA 1LRZA 3WC7A 4F8ZA 4X3RA 2J9AA 1YGHA 4OC4A 5EBVA 2XEIA 5HH1A 2JEVA 5HVHA 3OAKA 4COGA 2MP0A 4F0XA 1VHOA 2Q4ZA 3IGRA 4NJQA 4RS2A 4U5YA 3JTKA 4P45A 4HPSA 3FNCA 2QVPA 4CAFA 2AUNA 4MHYA 3RNZA 4CAVA 2XEGA 2WPWA 1R43A 5AGEA 3VWDA 1M44A 3U1BA 1YVHA 1I1DA 1R61A 1YREA 2C6CA 1C30B 1Z4RA 2VXKA 2P6EA 3B7IA 3IU1A 2QECA 3BJ8A 2YNDA 2PJ7A 2HQYA 3MRUA 4BPUB 2PRQA 2ZXVA 3IWGA 4UEFA 4EMEA 3JUWA 1HDUA 4MCRA 1Q2YA 1IB1E 1XOVA 2ODFA 3KR4A 3PB4X 4LQ6A 4RUHA 1CBXA 2CNMA 3B2YA 3B8GA 2PCUA 4KLWA 1V6CA 4UFXA 3FMCA 1S5KA 2XEJA 3VRPA 1YW6A 1DE4C 1QSRA 1TXRA 1WJTA 1XF8A 2CNTA 2OZGA 5IV0A 4C9VA 1JQGA 1X12A 3S6GA 5BY0A 4CS0B 2ZW5A 3PB9X 2C1CA 4IIYA 2FCKA 2HV2A 2WPXA 3T8WA 3KQXA 1LCPA 4XPLA 4C84A 4OC5A 3VROA 1WWZA 2F8HA 2R8VA 1BPNA 2V8DA 3I9SA 5F09A 3FF3A 3TOAA 4KNGE 4UCMA 3SJGA 4PPZA 3W6XA 4B12A 1A9XB 1J3LA 1CP6A 4MFQA 2PC1A 3GY9A 3L2NA 4DNCA 3CXSA 2B3UA 4UFWA 4A95A 4KLVA 4KSFA 1T36B 5I0CA 2GIVA 3IWEA 3D7HA 2KCWA 3IC1A 4M6GA 3TCVA 3WC5A 1LAMA 5LRKA 1AMPA 4R57A 3SXNA 1SQHA 3GKRA 3R95A 3TO7A 4MCPA 1VGYA 3E0KA 1ZG8A 5H84A 4OIWA 2B58A 1Z5RA 3D2MA 2G3TA 3DDDA 4MFJA 1U6MA 3G3SA 3TLYA 2EZCA 5HVFA 2YJTA 1BPMA 1ZG9A 1IICA 3VWEA 2AE6A 1C3OB 3K9TA 3R9GA 5HKYA 1YW4A 2B5GA 3B3WA 3T90A 2ANPA 1Z8TA 3VATA 2OB0A 3EIFA 3DGVA 4MHPA 1H8LA 3PBEA 4AVCA 3BUOB 2R1IA 2J8MA 3FX6A 1PCAA 1EO0A 4CYQA 5J3XA 1B47A 5JPHA 2YJVA 4A33A 2PIZA 2Y1MA 2Q0YA 2PJ1A 4GM5A 2R82A 2PJ6A 4YGOA 1BXRB 1ZLHA 3ICUA 4MFKA 4B14A 5IB9A 1LFWA 2EUIA 1M1DA 1CM0A 4P4JA 1ZG7A 2EWBA 4UEZA 1S7LA 3DLJA 4C8PA 1Z9UA 4OAEA 1L0CA 2NYQA 2R7HA 1Z8WA 1IGBA 2PR1A 3BUMB 3CXPA 1N71A 2AFOA 1S7KA 2ZEGA 5LYDA 4C2XA 2V77A 4C8UA 4HKFA 3D8PA 1K4JA 4J3GA 2DPSA 3CDXA 4UWJA 1JDEA 2E28A 1X10A 1ZLIA 2GANA 4MJ8A 3W91A 2FS5A 3NE7A 4OLLA 3SI1A 2PJ2A 1Y9KA 1P0HA 4A31A 5HVGA 5F5XA 1Y7EA 1TF8A 4HNXB 4OC3A 4AG7A 2AFSA 3D66A 1QSMA 1Q5XA 4AB7A 3G23A 2J8RA 3D2PA 3FBUA 2O53A 3H5ZA 4AG9A 3NFZA 3NA6A 3TO9A 2CF4A 1AYEA 4EWTA 3QAHA 5HMNA 2ZEFA 4U9YA 2B4DB 3KZWA 5KTCA 4M8DA 4C9AA 2OLSA 5K8PA 3GLJA 4PSWA 3D7DA 1VKCA 1VBHA 2YNEA 3RO0A 4ONWA 5AG7A 3TX8A 5AG4A 1YSJA 1JDBC 1RO5A 2V8HA 2IL4A 2RB7A 4G1PA 2DPTA 4MHZA 2B4BA 4XPDB 1QSNA 4C8TA 1XBUA 4AVAA 5HKWA 2BOAA 2VQYA 2Q44A 4B13A 1YX0A 2PDOA 4PQAA 1Y0YA 4C8CA 5E96A 2VBQA 4C9UA 3VRQA 2RFHA 4UEEA 4BBHA 1Z8XA 3C26A 3LODA 1GYTA 5JVLA 2PR8A 2XPLA 4KOVA 1MJBA 3RZAA 3WT4A 1HDQA 2XPNA 4NGSA 3TLAA 2AFUA 4ZY2A 4WJBA 3UY5A 1S60A 2Z3OA 5J8CA 3GJZA
chains in the Genus database with same CATH topology
3H8GA 3KHXA 4NGRA 1LANA 4A39A 3KR5A 1EE3P 3BI0A 2IJZA 1Z8LA 4FBEA 3KASA 5K8MA 3PB8X 4C99A 1XFOA 5CBMA 3KL9A 1Y0RA 1Z2LA 4FUUA 1F57A 1TKFA 4P4DA 4P4BA 2BO9A 2PJBA 5K8NA 4DUKA 4ZYQA 3ISXA 4W9YA 2CTCA 2IQ6A 4NJRA 4UIAA 3MN8A 4PXBA 2WYRA 4O23A 3VH9A 4ZY0A 3LWUA 3KI9A 1CG2A 3FH4A 4IHMA 4JYWA 2PJ0A 3SJFA 2ZEPA 4A94A 4NGPA 1IY7A 4X2TA 4EFDA 1CPXA 1TKJA 4NFRA 4LQGA 1XRYA 2WZNA 1CPSA 3V38A 3FEDA 2XEFA 2PJ4A 3CT9A 2OR4A 1QMUA 4OC2A 2DEAA 3RBUA 1QQ9A 1TKHA 4F9VA 2HB6A 4ZX9A 3HLPA 4ZY1A 8CPAA 3PB7X 3VTAA 3N5FA 3B35A 1ELMP 2GU2A 3SI0A 5D8NA 4X8IA 4BD9A 4PXEA 4C86A 4F9UA 4FAIA 5LYIA 2EK9A 7CPAA 3FEEA 4Z65A 2IMOA 5I4MA 1BLLE 1UWYA 2ZELA 2GP4A 2G9DA 2BCOA 3FJUA 2PVWA 4ZX8A 4PXDA 2O4HA 4NGQA 2PJ8A 3VARA 3I74A 4OC0A 5DS0A 3IWWA 4MMOA 4R76A 2JBKA 4MCQA 3LMSA 1XJOA 3ISZA 4P10A 2GREA 2ZEMA 4A37A 1F2OA 5LYFA 1FNOA 4NGMA 4Q7AA 2GLFA 2AFWA 3CPXA 3B3SA 4WWVA 3SJXA 5IR2A 2QYVA 4MHNA 5JGFA 1XF1A 1R3NA 2JEWA 3PRTA 4H2KA 2C6PA 5D29A 3IFEA 1YLOA 4OP4A 2NSMA 5IB9A 3S9LA 4C8PA 1Q7LA 3GB0A 4C8AA 1ARLA 5THWA 4B6ZA 4K3NA 4OC1A 4OKOA 4NGNA 4P44A 1OBRA 4C9RA 2Q43A 4ZI6A 4IK2A 2FVGA 4YN3A 2JBJA 1YMEA 2OOTA 2PE3A 4CDKA 3PFEA 4IAVA 2ZEOA 3NH5A 4P4EA 4CPAA 2ZEDA 3D7GA 1CX8A 2PJ9A 4MCSA 6CPAA 1F2PA 1Y9ZA 2PVVA 4R7MA 3SI2A 2PIYA 3D67A 3NH4A 3I1UA 5HXDA 3IO1A 1CP7A 3PFOA 3WABA 1BAVA 3RAMA 3BHXA 4UIBA 4YU9A 2QJ8A 2AFZA 4R8FA 2PJCA 2V8GA 2ZOFA 4OIDA 4KSIA 2CIJA 3IJ3A 3PEIA 5ELYA 1VIXA 1DTDA 5J1QA 2AFMA 5CPAA 2PJ3A 4CDJA 3PBBA 4MXUA 2ZOGA 2PJAA 1KWMA 3B3VA 3B3CA 2GLJA 1LOKA 3BI1A 4P6YA 4DJLA 3TC8A 4TJXA 4MRIA 1ELLP 2HC9A 4TNUA 3D7FA 5JM6A 1XMBA 3I6SA 2V8VA 3D4UA 3H8EA 3BXMA 2VL1A 4TWEA 3B3TA 4P4FA 1ARMA 5JH9A 3D68A 2ABZA 3JRUA 3QNVA 4OMEA 3FVLA 3S9NA 2EK8A 4A38A 1TF9A 3KHZA 4NGTA 3S9MA 4YWYA 1LAPA 4P4IA 3KQZA 3WC6A 3K2KA 4C8CA 3CPAA 5LYLA 2C5QA 2I3CA 4FWUA 2ZEEA 3KGQA 1RTQA 4DYOA 1WVMA 4JZ0A 3SJEA 3H8FA 5K8OA 4R6TA 3GUXA 5LRJA 4C9EA 4AXVA 2ZENA 1FT7A 4C85A 2PJ5A 4C8FA 1M4LA 1PYTB 2CTBA 2ZEHA 3NH8A 2AFXA 2POKA 1HEEA 4UF4A 3FECA 3PB6X 5LRGA 2Q51A 2F7VA 3V7ZA 1VHEA 4PXCA 3HUVA 4TJVA 2C6GA 1NSAA 3WC7A 4F8ZA 4X3RA 2J9AA 4OC4A 2XEIA 5HVHA 1VHOA 2Q4ZA 4NJQA 4P45A 2QVPA 4MHYA 2XEGA 1R43A 2C6CA 3B7IA 2PJ7A 3MRUA 2PRQA 4UEFA 4EMEA 1HDUA 4MCRA 4RUHA 3PB4X 3KR4A 1CBXA 3B2YA 2PCUA 1V6CA 3FMCA 3IEHA 2XEJA 1YW6A 4UEEA 1DE4C 1TXRA 4C9VA 1JQGA 3PB9X 2C1CA 3T8WA 3KQXA 1LCPA 4C84A 4OC5A 2F8HA 2V8DA 1BPNA 5F09A 3FF3A 4KNGE 3SJGA 4PPZA 1CP6A 3L2NA 3D7HA 3IC1A 3WC5A 1LAMA 5LRKA 1AMPA 4MCPA 1VGYA 1ZG8A 4OIWA 1Z5RA 5HVFA 1BPMA 1ZG9A 3K9TA 1YW4A 3B3WA 2ANPA 3VATA 3EIFA 3DGVA 4MHPA 1H8LA 3PBEA 3FX6A 1PCAA 2PIZA 4GM5A 2PJ1A 2PJ6A 1ZLHA 3ICUA 1LFWA 4P4JA 1ZG7A 2EWBA 4UEZA 3DLJA 2NYQA 3IIBA 1IGBA 2AFOA 2ZEGA 5LYDA 2V77A 4C8UA 3CDXA 1ZLIA 3SI1A 2PJ2A 5HVGA 1Y7EA 1TF8A 4OC3A 2AFSA 3D66A 2O53A 3NFZA 3NA6A 2CF4A 1AYEA 4EWTA 2ZEFA 3KZWA 4C9AA 5K8PA 3GLJA 3D7DA 3TX8A 4ONWA 1YSJA 2V8HA 4G1PA 2RB7A 4MHZA 4C8TA 1XBUA 2BOAA 4PQAA 1Y0YA 4C9UA 2RFHA 1GYTA 3RZAA 3WT4A 1HDQA 4NGSA 2AFUA 4ZY2A 4WJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8G A;  3KHX A;  4NGR A;  1LAN A;  4A39 A;  3KR5 A;  1EE3 P;  3BI0 A;  2IJZ A;  1Z8L A;  4FBE A;  3KAS A;  5K8M A;  3PB8 X;  4C99 A;  1XFO A;  5CBM A;  3KL9 A;  1Y0R A;  1Z2L A;  4FUU A;  1F57 A;  1TKF A;  4P4D A;  4P4B A;  2BO9 A;  2PJB A;  5K8N A;  4DUK A;  4ZYQ A;  3ISX A;  4W9Y A;  2CTC A;  2IQ6 A;  4NJR A;  4UIA A;  3MN8 A;  4PXB A;  2WYR A;  4O23 A;  3VH9 A;  4ZY0 A;  3LWU A;  3KI9 A;  1CG2 A;  3FH4 A;  4IHM A;  4JYW A;  2PJ0 A;  3SJF A;  2ZEP A;  4A94 A;  4NGP A;  1IY7 A;  4X2T A;  4EFD A;  1CPX A;  1TKJ A;  4NFR A;  4LQG A;  1XRY A;  2WZN A;  1CPS A;  3V38 A;  3FED A;  2XEF A;  2PJ4 A;  3CT9 A;  2OR4 A;  1QMU A;  4OC2 A;  2DEA A;  3RBU A;  1QQ9 A;  1TKH A;  4F9V A;  2HB6 A;  4ZX9 A;  3HLP A;  4ZY1 A;  8CPA A;  3PB7 X;  3VTA A;  3N5F A;  3B35 A;  1ELM P;  2GU2 A;  3SI0 A;  5D8N A;  4X8I A;  4BD9 A;  4PXE A;  4C86 A;  4F9U A;  4FAI A;  5LYI A;  2EK9 A;  7CPA A;  3FEE A;  4Z65 A;  2IMO A;  5I4M A;  1BLL E;  1UWY A;  2ZEL A;  2G9D A;  2BCO A;  3FJU A;  2PVW A;  4ZX8 A;  4PXD A;  2O4H A;  4NGQ A;  2PJ8 A;  3VAR A;  3I74 A;  4OC0 A;  5DS0 A;  3IWW A;  4MMO A;  4R76 A;  2JBK A;  4MCQ A;  3LMS A;  1XJO A;  3ISZ A;  4P10 A;  2GRE A;  2ZEM A;  4A37 A;  1F2O A;  5LYF A;  1FNO A;  4NGM A;  4Q7A A;  2GLF A;  2AFW A;  3CPX A;  3B3S A;  4WWV A;  3SJX A;  2QYV A;  4MHN A;  5JGF A;  1XF1 A;  1R3N A;  2JEW A;  3PRT A;  4H2K A;  2C6P A;  5D29 A;  3IFE A;  1YLO A;  4OP4 A;  2NSM A;  5IB9 A;  3S9L A;  4C8P A;  1Q7L A;  3GB0 A;  4C8A A;  1ARL A;  5THW A;  4B6Z A;  4K3N A;  4OC1 A;  4OKO A;  4NGN A;  4P44 A;  1OBR A;  4C9R A;  2Q43 A;  4ZI6 A;  4IK2 A;  2FVG A;  4YN3 A;  2JBJ A;  1YME A;  2OOT A;  2PE3 A;  4CDK A;  3PFE A;  4IAV A;  2ZEO A;  3NH5 A;  4P4E A;  4CPA A;  2ZED A;  3D7G A;  1CX8 A;  2PJ9 A;  4MCS A;  6CPA A;  1F2P A;  1Y9Z A;  2PVV A;  4R7M A;  3SI2 A;  2PIY A;  3D67 A;  3NH4 A;  3I1U A;  5HXD A;  3IO1 A;  1CP7 A;  3PFO A;  3WAB A;  1BAV A;  3RAM A;  3BHX A;  4UIB A;  4YU9 A;  2QJ8 A;  2AFZ A;  4R8F A;  2PJC A;  2V8G A;  2ZOF A;  4OID A;  4KSI A;  2CIJ A;  3IJ3 A;  3PEI A;  5ELY A;  1VIX A;  1DTD A;  5J1Q A;  2AFM A;  5CPA A;  2PJ3 A;  4CDJ A;  3PBB A;  4MXU A;  2ZOG A;  2PJA A;  1KWM A;  3B3V A;  3B3C A;  2GLJ A;  1LOK A;  3BI1 A;  4P6Y A;  4DJL A;  3TC8 A;  4TJX A;  4MRI A;  1ELL P;  2HC9 A;  4TNU A;  3D7F A;  5JM6 A;  1XMB A;  3I6S A;  2V8V A;  3D4U A;  3H8E A;  3BXM A;  2VL1 A;  4TWE A;  3B3T A;  4P4F A;  1ARM A;  5JH9 A;  3D68 A;  2ABZ A;  3JRU A;  3QNV A;  4OME A;  3FVL A;  3S9N A;  2EK8 A;  4A38 A;  1TF9 A;  3KHZ A;  4NGT A;  3S9M A;  4YWY A;  1LAP A;  4P4I A;  3KQZ A;  3WC6 A;  3K2K A;  4C8C A;  3CPA A;  5LYL A;  2I3C A;  4FWU A;  2ZEE A;  3KGQ A;  1RTQ A;  4DYO A;  1WVM A;  4JZ0 A;  3SJE A;  3H8F A;  5K8O A;  4R6T A;  3GUX A;  5LRJ A;  4C9E A;  4AXV A;  2ZEN A;  1FT7 A;  4C85 A;  2PJ5 A;  4C8F A;  1M4L A;  1PYT B;  2CTB A;  2ZEH A;  3NH8 A;  2AFX A;  2POK A;  1HEE A;  4UF4 A;  3FEC A;  3PB6 X;  5LRG A;  2Q51 A;  2F7V A;  3V7Z A;  1VHE A;  4PXC A;  3HUV A;  4TJV A;  2C6G A;  1NSA A;  3WC7 A;  4F8Z A;  4X3R A;  2J9A A;  4OC4 A;  2XEI A;  5HVH A;  1VHO A;  2Q4Z A;  4NJQ A;  4P45 A;  2QVP A;  4MHY A;  2XEG A;  1R43 A;  2C6C A;  3B7I A;  2PJ7 A;  3MRU A;  2PRQ A;  4UEF A;  4EME A;  1HDU A;  4MCR A;  4RUH A;  3PB4 X;  3KR4 A;  1CBX A;  3B2Y A;  2PCU A;  1V6C A;  3FMC A;  3IEH A;  2XEJ A;  1YW6 A;  4UEE A;  1DE4 C;  1TXR A;  4C9V A;  1JQG A;  3PB9 X;  2C1C A;  3T8W A;  3KQX A;  1LCP A;  4C84 A;  4OC5 A;  2F8H A;  2V8D A;  1BPN A;  5F09 A;  3FF3 A;  4KNG E;  3SJG A;  4PPZ A;  1CP6 A;  3L2N A;  3D7H A;  3IC1 A;  3WC5 A;  1LAM A;  5LRK A;  1AMP A;  4MCP A;  1VGY A;  1ZG8 A;  4OIW A;  1Z5R A;  5HVF A;  1BPM A;  1ZG9 A;  3K9T A;  1YW4 A;  3B3W A;  2ANP A;  3VAT A;  3EIF A;  3DGV A;  4MHP A;  1H8L A;  3PBE A;  3FX6 A;  1PCA A;  2PIZ A;  4GM5 A;  2PJ1 A;  2PJ6 A;  1ZLH A;  3ICU A;  1LFW A;  4P4J A;  1ZG7 A;  2EWB A;  4UEZ A;  3DLJ A;  2NYQ A;  3IIB A;  1IGB A;  2AFO A;  2ZEG A;  5LYD A;  2V77 A;  4C8U A;  3CDX A;  1ZLI A;  3SI1 A;  2PJ2 A;  5HVG A;  1Y7E A;  1TF8 A;  4OC3 A;  2AFS A;  3D66 A;  2O53 A;  3NFZ A;  3NA6 A;  2CF4 A;  1AYE A;  4EWT A;  2ZEF A;  3KZW A;  4C9A A;  5K8P A;  3GLJ A;  3D7D A;  3TX8 A;  4ONW A;  1YSJ A;  2V8H A;  4G1P A;  2RB7 A;  4MHZ A;  4C8T A;  1XBU A;  2BOA A;  4PQA A;  1Y0Y A;  4C9U A;  2RFH A;  1GYT A;  3RZA A;  3WT4 A;  1HDQ A;  4NGS A;  2AFU A;  4ZY2 A;  4WJB A; 
#chains in the Genus database with same CATH topology
 3H8G A;  3KHX A;  2Q4Y A;  3TYX A;  2Q7S A;  1KZF A;  2DF5 A;  1PUA A;  2AUM A;  4QB9 A;  2Z3M A;  3HMJ G;  1Q2D A;  1NE9 A;  1KUX A;  2BL1 A;  4NGR A;  1LAN A;  4KVO E;  2AJ6 A;  3OWC A;  3LD2 A;  4A39 A;  3TLG A;  3NFQ A;  3VGO A;  2I79 A;  3KR5 A;  4HNW B;  3EZE A;  1EE3 P;  3BI0 A;  1Y7R A;  2IJZ A;  1Z8L A;  4FBE A;  3KAS A;  5K8M A;  1V0C A;  3TTH A;  3ZNI A;  4MY0 A;  2VEZ A;  3PB8 X;  5BWA B;  1XFO A;  3IEH A;  3KL9 A;  5CBM A;  4C99 A;  1IYL A;  1Y0R A;  1Z2L A;  4FUU A;  4CAW A;  4EVY A;  4E5S A;  1F57 A;  1TKF A;  4P4D A;  4P4B A;  3ZZI A;  4C7H A;  4ZGY B;  4CYO A;  2BO9 A;  4QC6 A;  2PJB A;  4C7I A;  5K8N A;  3T0T A;  4DUK A;  2ATR A;  4ZYQ A;  3ISX A;  4ORF A;  5KTA A;  4W9Y A;  1GHE A;  2CTC A;  2H5M A;  2IQ6 A;  4M6H A;  3F5B A;  4NJR A;  4UIA A;  3MN8 A;  2HRO A;  2EO8 A;  2WYR A;  1B6B A;  2PQ8 A;  4LUA A;  4PXB A;  2CY2 A;  5F13 A;  3K9U A;  2CNS A;  1TIQ A;  4O23 A;  3VH9 A;  4ZY0 A;  3LWU A;  4MFL A;  1ZYM A;  3KI9 A;  4XPD C;  4MJX A;  2WSA A;  2Z3P A;  2Z3K A;  1CG2 A;  3FH4 A;  1ZO0 A;  4IHM A;  4JYW A;  2PJ0 A;  3EC4 A;  2Y1N A;  3KRV A;  3FYN A;  3GIU A;  5G1Z A;  2I00 A;  4MI1 A;  2FSR A;  3SJF A;  4CO9 A;  4KOW A;  3VRR A;  4CZ1 A;  2ZEP A;  3ZJ0 A;  3P2H A;  4KVM E;  4RR2 B;  2BUE A;  2J8N A;  4L8A A;  1CJW A;  1YVO A;  4NGP A;  4A94 A;  4U9Z A;  5F46 A;  1IY7 A;  4X2T A;  1M4I A;  2OU2 A;  2ZW4 A;  3EZB A;  4EFD A;  1CPX A;  2R98 A;  1TKJ A;  1VI4 A;  2YNC C;  4NFR A;  4NF1 A;  1NMT A;  4C2Y A;  1VHS A;  4LQG A;  1XRY A;  2WZN A;  1CPS A;  4H6U A;  3V38 A;  3FED A;  2XEF A;  2JLM A;  2PJ4 A;  3TE4 A;  3CT9 A;  2OR4 A;  4LX9 A;  1QMU A;  4OC2 A;  2DEA A;  4A32 A;  4RI1 A;  2P6G A;  3RBU A;  1QQ9 A;  1J4J A;  1TKH A;  4F9V A;  2HB6 A;  1UFH A;  3BUN B;  4ZX9 A;  3HLP A;  2BSW A;  1M4G A;  4ZY1 A;  8CPA A;  2EZA A;  3PB7 X;  1XE4 A;  3RYO A;  3N5F A;  4KOT A;  1FY7 A;  1NBW A;  3VTA A;  4A4B A;  3B35 A;  1ELM P;  3PP9 A;  2GU2 A;  4L89 A;  2Q4V A;  2YGW A;  3H4Q A;  3SI0 A;  4BIN A;  1OZP A;  4E0A A;  5D8N A;  4JXR A;  2ARH A;  4X8I A;  4BD9 A;  4PXE A;  4YFJ A;  5FD8 A;  2P0W A;  2FE7 A;  1IOI A;  2CBL A;  4NCZ A;  4UFV A;  4Y49 B;  4PV6 A;  4CAE A;  4C86 A;  4F9U A;  1S7N A;  2C27 A;  3W6S A;  4FAI A;  2D0O A;  5LYI A;  4KOS A;  2CXA A;  2EK9 A;  4ONU A;  3CXQ A;  2GFQ A;  1IID A;  2P6F A;  1R57 A;  7CPA A;  4KOU A;  3FEE A;  4Z65 A;  2IMO A;  2HWG A;  1EZB A;  5I4M A;  1BLL E;  1UWY A;  2ZEL A;  2GP4 A;  2G9D A;  3A9L A;  4JVO A;  3JVN A;  2BCO A;  3FJU A;  2PVW A;  5EC4 A;  2Q7B A;  4J0N A;  4XNH B;  4ZX8 A;  4PXD A;  3R9F A;  2O4H A;  3KKW A;  4NGQ A;  2PJ8 A;  2Z0Z A;  3VAR A;  2JDC A;  4ZBG A;  2DXQ A;  3I74 A;  4OC0 A;  2X7B A;  5DS0 A;  3NOJ A;  3IWW A;  1YK3 A;  1GGO A;  3S6F A;  4MMO A;  4R76 A;  2JBK A;  4MCQ A;  4F6A A;  3HPG G;  3LMS A;  5EMI A;  4QBJ A;  4EYS A;  2GE3 A;  4MBU A;  1XJO A;  4MI4 A;  4IIX A;  3OP0 A;  2B5G B;  3ISZ A;  4P10 A;  2GRE A;  2ZEM A;  4A37 A;  1F2O A;  5LYF A;  1FNO A;  2DLA A;  3PFV A;  4E8O A;  4UWI A;  2Z3N A;  4NGM A;  4Q7A A;  1CS0 B;  2GLF A;  2ZW6 A;  1NSL A;  2VZY A;  3TT2 A;  4OAD A;  3CZX A;  5FVJ A;  4MFZ A;  4JXQ A;  2AFW A;  4AVB A;  3CPX A;  4JWP A;  3B3S A;  2K5T A;  5G20 A;  4WWV A;  3SJX A;  2D0P A;  3R1K A;  5IR2 A;  4KOY A;  5AXI A;  1P4N A;  2PSW A;  4KSA A;  3T9Y A;  2QYV A;  4CRY B;  4MHN A;  5JGF A;  3HPH E;  4PK2 A;  4CGM A;  1XF1 A;  1R3N A;  2JEW A;  3EY5 A;  3PRT A;  4H2K A;  2C6P A;  5D29 A;  2B4J C;  1YLO A;  3IFE A;  4OP4 A;  4A2Z A;  2NSM A;  3U88 C;  3O8Z A;  4BPW B;  3S9L A;  4Y49 C;  2OZU A;  4MHD A;  1Q7L A;  1JWQ A;  3GB0 A;  1IOF A;  5G22 A;  4F0Y A;  5KTD A;  4C8A A;  1ARL A;  5THW A;  4M6I A;  4B6Z A;  4K3N A;  2VZZ A;  4JJX A;  4CGP A;  4OC1 A;  1WK4 A;  4PSX A;  1I12 A;  4A30 A;  2B0A A;  3TLC A;  4Q36 A;  5IX3 A;  4OKO A;  2REF A;  4NGN A;  4P44 A;  3LAC A;  4IF5 A;  1Q2C A;  4XNH C;  5DWN A;  3EXN A;  1OBR A;  4PK3 A;  1ZL0 A;  4C9R A;  2FT0 A;  4UBR A;  5G21 A;  1KUV A;  1MJ9 A;  1A2Z A;  1Z4E A;  2Q43 A;  4ZI6 A;  4IK2 A;  1Y9W A;  1QST A;  2FVG A;  4KOR A;  3BLN A;  4YN3 A;  3R96 A;  3EO4 A;  2QML A;  4H89 A;  2JBJ A;  1YME A;  1YR0 A;  4C68 A;  4QVT A;  4E2A A;  2G3A A;  4CGO A;  2OH1 A;  4BTF A;  4II9 A;  2OOT A;  2PE3 A;  3TO6 A;  4CDK A;  3PFE A;  4IAV A;  3TOB A;  1XMT A;  4UCP A;  4H1H A;  3T5M A;  3IU2 A;  2ZEO A;  3NH5 A;  3QB8 A;  1BOB A;  2FIW A;  4KVX A;  3T07 A;  5H86 A;  4P4E A;  3FIX A;  2WUU A;  4CPA A;  1AUG A;  4FD6 A;  1VBG A;  5JYB A;  2ZED A;  3D7G A;  5C88 A;  1CX8 A;  4CYP A;  2PJ9 A;  4MCS A;  3TLG B;  6CPA A;  1B87 A;  2QIR A;  3BUW B;  4B11 A;  3PLF B;  1F2P A;  4MY3 A;  1Y9Z A;  1IU8 A;  1BO4 A;  3TFY A;  3TLE A;  2PVV A;  3MGD A;  4R7M A;  3SI2 A;  2PIY A;  3D67 A;  3DR8 A;  3NH4 A;  4X5K A;  3SHP A;  3I1U A;  1YLE A;  2FXF A;  5F48 A;  2XPO A;  4BPX B;  5HXD A;  3IO1 A;  1CP7 A;  4COB A;  5J8F A;  3PFO A;  5IB0 A;  2FL4 A;  2Z10 A;  3F0A A;  3G8W A;  1BAV A;  1PU9 A;  3BHX A;  4RN7 A;  3RAM A;  3WAB A;  4INJ A;  4UIB A;  4YU9 A;  4A4C A;  2QJ8 A;  3V8I A;  5JQ4 A;  2D4P A;  2AFZ A;  2FM4 A;  4R8F A;  1ON0 A;  2EZB A;  4XPK A;  2PJC A;  4QUS A;  2V8G A;  2ZOF A;  3DSB A;  4OID A;  4KSI A;  3DR6 A;  3GYA A;  2CIJ A;  3IJ3 A;  1KUY A;  2F5I A;  3PEI A;  3PZJ A;  2X0S A;  4KS9 A;  5ELY A;  3SR3 A;  2RC4 A;  1ZRS A;  3OB2 B;  1VIX A;  1CE8 B;  5F1Y A;  1DTD A;  2VI7 A;  4MFP A;  4JLY A;  4JD6 A;  3WR7 A;  5J1Q A;  2AFM A;  1I21 A;  4KUB A;  2XPP A;  5CPA A;  2PJ3 A;  4CDJ A;  3PBB A;  4MXU A;  5A28 A;  3PGP A;  4R87 A;  3K4I A;  3BJ7 A;  2ZOG A;  2PJA A;  4UA3 A;  2NMT A;  1KWM A;  3B3V A;  4B5O A;  3B3C A;  2GLJ A;  4YRH A;  3BUX B;  1LOK A;  4NEX A;  3BI1 A;  3TLB A;  4P6Y A;  1YVK A;  2OZH A;  1RXT A;  4FD5 A;  4NXY A;  4DJL A;  2G0B A;  4FD7 A;  3TC8 A;  4TJX A;  5GCN A;  2EBJ A;  4IUS A;  4MRI A;  1M6V B;  1ELL P;  3PT1 A;  3S6K A;  1MK4 A;  4M85 A;  4C2Z A;  3R9E A;  2HUZ A;  5CNP A;  1YQE A;  1IYK A;  2HC9 A;  2Z3L A;  3P2F A;  4TNU A;  2VKZ G;  4CGL A;  5AG5 A;  3D7F A;  2B3V A;  4R9M A;  5JM6 A;  2DIK A;  3N7Z A;  1XMB A;  3QAY A;  3I6S A;  1MJA A;  1QSO A;  2V8V A;  3D4U A;  3H8E A;  3BXM A;  3F9K C;  4KZT A;  2VL1 A;  4TWE A;  2BEI A;  4BMH A;  4K30 A;  4CAX A;  2B4D A;  3B3T A;  1KC7 A;  4P4F A;  1ARM A;  5JH9 A;  3D68 A;  2ABZ A;  3JRU A;  4E94 A;  4I49 A;  2PRB A;  3QNV A;  4OME A;  2N3A B;  3FVL A;  2FIA A;  1FBV A;  3S9N A;  2EK8 A;  4Q38 A;  1DIK A;  2HI6 A;  4B5P A;  3S6H A;  4A38 A;  1TF9 A;  3SXO A;  5ISV A;  1S7F A;  1XIX A;  3KHZ A;  4NGT A;  3FRM A;  3S9M A;  4GPL B;  4YWY A;  2Y0M A;  1KBL A;  4R3L A;  4M3S A;  1LAP A;  5F49 A;  3EZA A;  5DWM A;  5AG6 A;  4P4I A;  3KQZ A;  5K99 A;  3C8O A;  3WC6 A;  3K2K A;  1KEE B;  2REE A;  4CRZ B;  3CPA A;  2YNC A;  3FB3 A;  3DNS A;  5LYL A;  1NXJ A;  2I3C A;  2ZPA A;  4GS4 A;  2C5Q A;  4FWU A;  4NSQ A;  2ZEE A;  2JDD A;  2O28 A;  3EFA A;  1RTQ A;  3KGQ A;  5C82 A;  1M4D A;  4DYO A;  1WVM A;  1XEB A;  4JZ0 A;  3SJE A;  5A27 A;  3H8F A;  4FD4 A;  2EVN A;  5K8O A;  4R6T A;  3GUX A;  5LRJ A;  4KOX A;  3IIB A;  4C9E A;  1EZA A;  4KUA A;  3NE8 A;  3I3G A;  4AXV A;  4B10 A;  2ZEN A;  1FT7 A;  4GXH A;  4C85 A;  4B5P B;  2ZW7 A;  3D3S A;  2PJ5 A;  4CYN A;  4C8F A;  4UCN A;  3VRN A;  5HKZ A;  1M4L A;  2D4O A;  1PYT B;  2CTB A;  2ZEH A;  2UV8 G;  4HNY B;  2Z11 A;  3T05 A;  3NH8 A;  2AFX A;  3OB1 B;  3F8K A;  1Z9E A;  1HEE A;  2POK A;  4H6Z A;  4CGN A;  4UF4 A;  3FEC A;  3PB6 X;  5LRG A;  2A4N A;  4R3K A;  3FXT A;  2Q51 A;  2F7V A;  3V7Z A;  5F9M A;  3TLZ A;  5F47 A;  1VHE A;  2PCN A;  4PXC A;  3HUV A;  1S3Z A;  4TJV A;  2Q04 A;  2C6G A;  1NSA A;  1LRZ A;  3WC7 A;  4F8Z A;  4X3R A;  2J9A A;  1YGH A;  4OC4 A;  5EBV A;  2XEI A;  5HH1 A;  2JEV A;  5HVH A;  3OAK A;  4COG A;  2MP0 A;  4F0X A;  1VHO A;  2Q4Z A;  3IGR A;  4NJQ A;  4RS2 A;  4U5Y A;  3JTK A;  4P45 A;  4HPS A;  3FNC A;  2QVP A;  4CAF A;  2AUN A;  4MHY A;  3RNZ A;  4CAV A;  2XEG A;  2WPW A;  1R43 A;  5AGE A;  3VWD A;  1M44 A;  3U1B A;  1YVH A;  1I1D A;  1R61 A;  1YRE A;  2C6C A;  1C30 B;  1Z4R A;  2VXK A;  2P6E A;  3B7I A;  3IU1 A;  2QEC A;  3BJ8 A;  2YND A;  2PJ7 A;  2HQY A;  3MRU A;  4BPU B;  2PRQ A;  2ZXV A;  3IWG A;  4UEF A;  4EME A;  3JUW A;  1HDU A;  4MCR A;  1Q2Y A;  1IB1 E;  1XOV A;  2ODF A;  3KR4 A;  3PB4 X;  4LQ6 A;  4RUH A;  1CBX A;  2CNM A;  3B2Y A;  3B8G A;  2PCU A;  4KLW A;  1V6C A;  4UFX A;  3FMC A;  1S5K A;  2XEJ A;  3VRP A;  1YW6 A;  1DE4 C;  1QSR A;  1TXR A;  1WJT A;  1XF8 A;  2CNT A;  2OZG A;  5IV0 A;  4C9V A;  1JQG A;  1X12 A;  3S6G A;  5BY0 A;  4CS0 B;  2ZW5 A;  3PB9 X;  2C1C A;  4IIY A;  2FCK A;  2HV2 A;  2WPX A;  3T8W A;  3KQX A;  1LCP A;  4XPL A;  4C84 A;  4OC5 A;  3VRO A;  1WWZ A;  2F8H A;  2R8V A;  1BPN A;  2V8D A;  3I9S A;  5F09 A;  3FF3 A;  3TOA A;  4KNG E;  4UCM A;  3SJG A;  4PPZ A;  3W6X A;  4B12 A;  1A9X B;  1J3L A;  1CP6 A;  4MFQ A;  2PC1 A;  3GY9 A;  3L2N A;  4DNC A;  3CXS A;  2B3U A;  4UFW A;  4A95 A;  4KLV A;  4KSF A;  1T36 B;  5I0C A;  2GIV A;  3IWE A;  3D7H A;  2KCW A;  3IC1 A;  4M6G A;  3TCV A;  3WC5 A;  1LAM A;  5LRK A;  1AMP A;  4R57 A;  3SXN A;  1SQH A;  3GKR A;  3R95 A;  3TO7 A;  4MCP A;  1VGY A;  3E0K A;  1ZG8 A;  5H84 A;  4OIW A;  2B58 A;  1Z5R A;  3D2M A;  2G3T A;  3DDD A;  4MFJ A;  1U6M A;  3G3S A;  3TLY A;  2EZC A;  5HVF A;  2YJT A;  1BPM A;  1ZG9 A;  1IIC A;  3VWE A;  2AE6 A;  1C3O B;  3K9T A;  3R9G A;  5HKY A;  1YW4 A;  2B5G A;  3B3W A;  3T90 A;  2ANP A;  1Z8T A;  3VAT A;  2OB0 A;  3EIF A;  3DGV A;  4MHP A;  1H8L A;  3PBE A;  4AVC A;  3BUO B;  2R1I A;  2J8M A;  3FX6 A;  1PCA A;  1EO0 A;  4CYQ A;  5J3X A;  1B47 A;  5JPH A;  2YJV A;  4A33 A;  2PIZ A;  2Y1M A;  2Q0Y A;  2PJ1 A;  4GM5 A;  2R82 A;  2PJ6 A;  4YGO A;  1BXR B;  1ZLH A;  3ICU A;  4MFK A;  4B14 A;  5IB9 A;  1LFW A;  2EUI A;  1M1D A;  1CM0 A;  4P4J A;  1ZG7 A;  2EWB A;  4UEZ A;  1S7L A;  3DLJ A;  4C8P A;  1Z9U A;  4OAE A;  1L0C A;  2NYQ A;  2R7H A;  1Z8W A;  1IGB A;  2PR1 A;  3BUM B;  3CXP A;  1N71 A;  2AFO A;  1S7K A;  2ZEG A;  5LYD A;  4C2X A;  2V77 A;  4C8U A;  4HKF A;  3D8P A;  1K4J A;  4J3G A;  2DPS A;  3CDX A;  4UWJ A;  1JDE A;  2E28 A;  1X10 A;  1ZLI A;  2GAN A;  4MJ8 A;  3W91 A;  2FS5 A;  3NE7 A;  4OLL A;  3SI1 A;  2PJ2 A;  1Y9K A;  1P0H A;  4A31 A;  5HVG A;  5F5X A;  1Y7E A;  1TF8 A;  4HNX B;  4OC3 A;  4AG7 A;  2AFS A;  3D66 A;  1QSM A;  1Q5X A;  4AB7 A;  3G23 A;  2J8R A;  3D2P A;  3FBU A;  2O53 A;  3H5Z A;  4AG9 A;  3NFZ A;  3NA6 A;  3TO9 A;  2CF4 A;  1AYE A;  4EWT A;  3QAH A;  5HMN A;  2ZEF A;  4U9Y A;  2B4D B;  3KZW A;  5KTC A;  4M8D A;  4C9A A;  2OLS A;  5K8P A;  3GLJ A;  4PSW A;  3D7D A;  1VKC A;  1VBH A;  2YNE A;  3RO0 A;  4ONW A;  5AG7 A;  3TX8 A;  5AG4 A;  1YSJ A;  1JDB C;  1RO5 A;  2V8H A;  2IL4 A;  2RB7 A;  4G1P A;  2DPT A;  4MHZ A;  2B4B A;  4XPD B;  1QSN A;  4C8T A;  1XBU A;  4AVA A;  5HKW A;  2BOA A;  2VQY A;  2Q44 A;  4B13 A;  1YX0 A;  2PDO A;  4PQA A;  1Y0Y A;  4C8C A;  5E96 A;  2VBQ A;  4C9U A;  3VRQ A;  2RFH A;  4UEE A;  4BBH A;  1Z8X A;  3C26 A;  3LOD A;  1GYT A;  5JVL A;  2PR8 A;  2XPL A;  4KOV A;  1MJB A;  3RZA A;  3WT4 A;  1HDQ A;  2XPN A;  4NGS A;  3TLA A;  2AFU A;  4ZY2 A;  4WJB A;  3UY5 A;  1S60 A;  2Z3O A;  5J8C A;  3GJZ A; 
#chains in the Genus database with same CATH homology
 3H8G A;  3KHX A;  4NGR A;  1LAN A;  4A39 A;  3KR5 A;  1EE3 P;  3BI0 A;  2IJZ A;  1Z8L A;  4FBE A;  3KAS A;  5K8M A;  3PB8 X;  4C99 A;  1XFO A;  5CBM A;  3KL9 A;  1Y0R A;  1Z2L A;  4FUU A;  1F57 A;  1TKF A;  4P4D A;  4P4B A;  2BO9 A;  2PJB A;  5K8N A;  4DUK A;  4ZYQ A;  3ISX A;  4W9Y A;  2CTC A;  2IQ6 A;  4NJR A;  4UIA A;  3MN8 A;  4PXB A;  2WYR A;  4O23 A;  3VH9 A;  4ZY0 A;  3LWU A;  3KI9 A;  1CG2 A;  3FH4 A;  4IHM A;  4JYW A;  2PJ0 A;  3SJF A;  2ZEP A;  4A94 A;  4NGP A;  1IY7 A;  4X2T A;  4EFD A;  1CPX A;  1TKJ A;  4NFR A;  4LQG A;  1XRY A;  2WZN A;  1CPS A;  3V38 A;  3FED A;  2XEF A;  2PJ4 A;  3CT9 A;  2OR4 A;  1QMU A;  4OC2 A;  2DEA A;  3RBU A;  1QQ9 A;  1TKH A;  4F9V A;  2HB6 A;  4ZX9 A;  3HLP A;  4ZY1 A;  8CPA A;  3PB7 X;  3VTA A;  3N5F A;  3B35 A;  1ELM P;  2GU2 A;  3SI0 A;  5D8N A;  4X8I A;  4BD9 A;  4PXE A;  4C86 A;  4F9U A;  4FAI A;  5LYI A;  2EK9 A;  7CPA A;  3FEE A;  4Z65 A;  2IMO A;  5I4M A;  1BLL E;  1UWY A;  2ZEL A;  2GP4 A;  2G9D A;  2BCO A;  3FJU A;  2PVW A;  4ZX8 A;  4PXD A;  2O4H A;  4NGQ A;  2PJ8 A;  3VAR A;  3I74 A;  4OC0 A;  5DS0 A;  3IWW A;  4MMO A;  4R76 A;  2JBK A;  4MCQ A;  3LMS A;  1XJO A;  3ISZ A;  4P10 A;  2GRE A;  2ZEM A;  4A37 A;  1F2O A;  5LYF A;  1FNO A;  4NGM A;  4Q7A A;  2GLF A;  2AFW A;  3CPX A;  3B3S A;  4WWV A;  3SJX A;  5IR2 A;  2QYV A;  4MHN A;  5JGF A;  1XF1 A;  1R3N A;  2JEW A;  3PRT A;  4H2K A;  2C6P A;  5D29 A;  3IFE A;  1YLO A;  4OP4 A;  2NSM A;  5IB9 A;  3S9L A;  4C8P A;  1Q7L A;  3GB0 A;  4C8A A;  1ARL A;  5THW A;  4B6Z A;  4K3N A;  4OC1 A;  4OKO A;  4NGN A;  4P44 A;  1OBR A;  4C9R A;  2Q43 A;  4ZI6 A;  4IK2 A;  2FVG A;  4YN3 A;  2JBJ A;  1YME A;  2OOT A;  2PE3 A;  4CDK A;  3PFE A;  4IAV A;  2ZEO A;  3NH5 A;  4P4E A;  4CPA A;  2ZED A;  3D7G A;  1CX8 A;  2PJ9 A;  4MCS A;  6CPA A;  1F2P A;  1Y9Z A;  2PVV A;  4R7M A;  3SI2 A;  2PIY A;  3D67 A;  3NH4 A;  3I1U A;  5HXD A;  3IO1 A;  1CP7 A;  3PFO A;  3WAB A;  1BAV A;  3RAM A;  3BHX A;  4UIB A;  4YU9 A;  2QJ8 A;  2AFZ A;  4R8F A;  2PJC A;  2V8G A;  2ZOF A;  4OID A;  4KSI A;  2CIJ A;  3IJ3 A;  3PEI A;  5ELY A;  1VIX A;  1DTD A;  5J1Q A;  2AFM A;  5CPA A;  2PJ3 A;  4CDJ A;  3PBB A;  4MXU A;  2ZOG A;  2PJA A;  1KWM A;  3B3V A;  3B3C A;  2GLJ A;  1LOK A;  3BI1 A;  4P6Y A;  4DJL A;  3TC8 A;  4TJX A;  4MRI A;  1ELL P;  2HC9 A;  4TNU A;  3D7F A;  5JM6 A;  1XMB A;  3I6S A;  2V8V A;  3D4U A;  3H8E A;  3BXM A;  2VL1 A;  4TWE A;  3B3T A;  4P4F A;  1ARM A;  5JH9 A;  3D68 A;  2ABZ A;  3JRU A;  3QNV A;  4OME A;  3FVL A;  3S9N A;  2EK8 A;  4A38 A;  1TF9 A;  3KHZ A;  4NGT A;  3S9M A;  4YWY A;  1LAP A;  4P4I A;  3KQZ A;  3WC6 A;  3K2K A;  4C8C A;  3CPA A;  5LYL A;  2C5Q A;  2I3C A;  4FWU A;  2ZEE A;  3KGQ A;  1RTQ A;  4DYO A;  1WVM A;  4JZ0 A;  3SJE A;  3H8F A;  5K8O A;  4R6T A;  3GUX A;  5LRJ A;  4C9E A;  4AXV A;  2ZEN A;  1FT7 A;  4C85 A;  2PJ5 A;  4C8F A;  1M4L A;  1PYT B;  2CTB A;  2ZEH A;  3NH8 A;  2AFX A;  2POK A;  1HEE A;  4UF4 A;  3FEC A;  3PB6 X;  5LRG A;  2Q51 A;  2F7V A;  3V7Z A;  1VHE A;  4PXC A;  3HUV A;  4TJV A;  2C6G A;  1NSA A;  3WC7 A;  4F8Z A;  4X3R A;  2J9A A;  4OC4 A;  2XEI A;  5HVH A;  1VHO A;  2Q4Z A;  4NJQ A;  4P45 A;  2QVP A;  4MHY A;  2XEG A;  1R43 A;  2C6C A;  3B7I A;  2PJ7 A;  3MRU A;  2PRQ A;  4UEF A;  4EME A;  1HDU A;  4MCR A;  4RUH A;  3PB4 X;  3KR4 A;  1CBX A;  3B2Y A;  2PCU A;  1V6C A;  3FMC A;  3IEH A;  2XEJ A;  1YW6 A;  4UEE A;  1DE4 C;  1TXR A;  4C9V A;  1JQG A;  3PB9 X;  2C1C A;  3T8W A;  3KQX A;  1LCP A;  4C84 A;  4OC5 A;  2F8H A;  2V8D A;  1BPN A;  5F09 A;  3FF3 A;  4KNG E;  3SJG A;  4PPZ A;  1CP6 A;  3L2N A;  3D7H A;  3IC1 A;  3WC5 A;  1LAM A;  5LRK A;  1AMP A;  4MCP A;  1VGY A;  1ZG8 A;  4OIW A;  1Z5R A;  5HVF A;  1BPM A;  1ZG9 A;  3K9T A;  1YW4 A;  3B3W A;  2ANP A;  3VAT A;  3EIF A;  3DGV A;  4MHP A;  1H8L A;  3PBE A;  3FX6 A;  1PCA A;  2PIZ A;  4GM5 A;  2PJ1 A;  2PJ6 A;  1ZLH A;  3ICU A;  1LFW A;  4P4J A;  1ZG7 A;  2EWB A;  4UEZ A;  3DLJ A;  2NYQ A;  3IIB A;  1IGB A;  2AFO A;  2ZEG A;  5LYD A;  2V77 A;  4C8U A;  3CDX A;  1ZLI A;  3SI1 A;  2PJ2 A;  5HVG A;  1Y7E A;  1TF8 A;  4OC3 A;  2AFS A;  3D66 A;  2O53 A;  3NFZ A;  3NA6 A;  2CF4 A;  1AYE A;  4EWT A;  2ZEF A;  3KZW A;  4C9A A;  5K8P A;  3GLJ A;  3D7D A;  3TX8 A;  4ONW A;  1YSJ A;  2V8H A;  4G1P A;  2RB7 A;  4MHZ A;  4C8T A;  1XBU A;  2BOA A;  4PQA A;  1Y0Y A;  4C9U A;  2RFH A;  1GYT A;  3RZA A;  3WT4 A;  1HDQ A;  4NGS A;  2AFU A;  4ZY2 A;  4WJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...