3BI1A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of methotrexate-glu
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bi1A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bi1A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bi1A02
4NGMA 3FECA 3SJEA 1YMEA 1ARMA 2ZEHA 2PJ7A 4P10A 3B3TA 5D29A 4X8IA 4YWYA 3PB8X 2ZOFA 3EIFA 1F2PA 3NH5A 5HVGA 4PXEA 4OP4A 2PIZA 1PYTB 1BLLE 2PVVA 3K2KA 1H8LA 5LYIA 3IJ3A 3D7HA 4A37A 2OR4A 4Q7AA 3ICUA 1ARLA 2IMOA 8CPAA 3TX8A 1ELMP 4UEZA 2CIJA 4TJVA 1YLOA 4C8TA 4NGTA 1TKHA 4A39A 4LQGA 2I3CA 3GB0A 4C8CA 4PXCA 3FEDA 4P45A 1EE3P 5K8MA 1CP7A 3ISXA 2V77A 3DLJA 4MCSA 5K8NA 2XEIA 4UIAA 2QVPA 2PJ8A 2PVWA 1ELLP 4MHYA 4C8AA 3LWUA 3PBEA 3KHZA 1DTDA 1HDQA 4NGPA 2O4HA 3HLPA 3WABA 5LYFA 2AFWA 3H8FA 4TWEA 2PJ6A 4C8FA 4X2TA 1DE4C 2OOTA 1AMPA 4K3NA 2PJAA 2PJ3A 1XBUA 4OC3A 4ZY0A 1NSAA 3D7DA 4MCRA 2PJBA 3GLJA 4A38A 4ZX8A 2PJ2A 3B3VA 3B3WA 4MRIA 4MHPA 3VTAA 5K8OA 3B7IA 3B35A 4IHMA 3KI9A 4C99A 3KZWA 2HC9A 1FT7A 2NSMA 3KR5A 3WC5A 1Z2LA 1TF8A 2ZELA 1VHEA 7CPAA 3D66A 5HVHA 2F8HA 3BXMA 2NYQA 3IIBA 1M4LA 1ZG8A 3FVLA 1LAMA 1VIXA 3WT4A 4ZX9A 4C85A 5LYLA 4NGSA 3SI1A 2XEGA 3H8GA 3IEHA 3WC6A 1XJOA 3D67A 5I4MA 1ZLHA 4NJRA 2ZEFA 4MHZA 2PE3A 4MXUA 2XEJA 2V8HA 4UEEA 3MN8A 3S9MA 3TC8A 4A94A 4P44A 2ANPA 4MCQA 3FF3A 3KQZA 5THWA 2JBJA 3PB9X 1TF9A 4OC4A 1ZG9A 3L2NA 1CBXA 2ZEMA 3PBBA 3RAMA 3BHXA 2CTBA 2CF4A 5LYDA 3D7GA 2BCOA 4C9AA 1KWMA 4B6ZA 4C9EA 4FAIA 4NGRA 4X3RA 4IK2A 4OC0A 1QQ9A 2ZOGA 3BI0A 4WWVA 4ZI6A 4CDJA 3ISZA 2Q51A 4TJXA 3PB6X 4UIBA 1Y7EA 5IB9A 6CPAA 4F9UA 4AXVA 4ONWA 3I1UA 5JGFA 2GU2A 3PB7X 3HUVA 4WJBA 4OC1A 2GREA 2C6GA 5LRKA 1YSJA 1UWYA 2ZEOA 1FNOA 2IQ6A 3IO1A 3T8WA 1TXRA 2EK9A 1XMBA 4P4IA 4MMOA 4FWUA 2CTCA 3SI0A 3B3CA 2PCUA 1LOKA 3B3SA 2F7VA 4ZY2A 4R8FA 4MCPA 4UF4A 2G9DA 4OC5A 1GYTA 4UEFA 3V7ZA 1QMUA 2V8GA 4H2KA 1LFWA 4KSIA 4PPZA 1VGYA 2PIYA 3LMSA 3RZAA 5CBMA 1VHOA 3NH8A 2ZEDA 1ZG7A 3FEEA 1AYEA 1TKFA 2Q43A 4R7MA 1IY7A 2JEWA 4C9RA 2QJ8A 3IC1A 3NFZA 2C1CA 1Z5RA 4F8ZA 1Z8LA 2AFXA 4PXBA 4P4DA 5HVFA 2ABZA 3FH4A 4P4BA 2EK8A 4F9VA 5D8NA 4R76A 2ZEGA 3H8EA 3S9NA 3WC7A 2PRQA 2EWBA 3RBUA 3SI2A 3BI1A 1CP6A 2J9AA 2V8VA 3N5FA 2QYVA 4C9UA 2V8DA 1LCPA 4DJLA 4P4EA 1XF1A 3CPAA 5DS0A 3IFEA 3KGQA 3SJGA 4JZ0A 4P6YA 1LAPA 4OIWA 1WVMA 4NGQA 4RUHA 4YN3A 4MHNA 4P4FA 3PFEA 4FUUA 4FBEA 3I6SA 3CT9A 2PJ9A 2C6CA 2PJ4A 2O53A 2C6PA 3I74A 1F2OA 4EMEA 2AFUA 2WYRA 1Y0RA 4ZY1A 1R3NA 5JM6A 2AFOA 2GLFA 2AFMA 3VARA 1JQGA 2POKA 4YU9A 4EFDA 3PFOA 3MRUA 1XFOA 4EWTA 4OIDA 1YW4A 1R43A 4KNGE 3PRTA 4OKOA 1YW6A 2PJ1A 3IWWA 4C8UA 3CDXA 2BOAA 4W9YA 4NFRA 3VATA 1PCAA 4C84A 4OC2A 2VL1A 3SJFA 4P4JA 5J1QA 1CPXA 2ZENA 1CPSA 1BPNA 3SJXA 2ZEPA 3D4UA 3FJUA 3FX6A 3KR4A 1CX8A 3VH9A 4O23A 2PJCA 1F57A 2AFSA 4PQAA 4BD9A 5K8PA 1BPMA 3PB4X 5LRGA 3KQXA 1OBRA 4DUKA 4OMEA 2DEAA 5LRJA 5HXDA 4IAVA 1V6CA 1BAVA 3NA6A 3KASA 3D68A 1Y9ZA 1ZLIA 1Y0YA 3V38A 3FMCA 2PJ0A 4Z65A 1TKJA 2XEFA 2Q4ZA 4NGNA 2FVGA 4GM5A 2AFZA 4JYWA 3CPXA 1CG2A 4NJQA 4R6TA 4G1PA 1HEEA 1IGBA 2HB6A 3PEIA 3D7FA 3NH4A 2IJZA 3DGVA 3GUXA 2JBKA 5CPAA 4CPAA 3KHXA 2ZEEA 4PXDA 4TNUA 1RTQA 5F09A 5ELYA 3JRUA 4C8PA 4C86A 2RB7A 2RFHA 3B2YA 2GLJA 4DYOA 5JH9A 2WZNA 1LANA 4C9VA 4CDKA 4ZYQA 2PJ5A 1XRYA 1Q7LA 2BO9A 3S9LA 3K9TA 1HDUA 3KL9A 3QNVA
chains in the Genus database with same CATH superfamily
4NGMA 2JDDA 5H84A 4BPUB 1Q2DA 2Y1NA 4LX9A 1IYLA 3FECA 4J3GA 3BUNB 3SJEA 2FE7A 1YMEA 1ARMA 2ZEHA 4B11A 1ZYMA 2PJ7A 2Q4YA 1S3ZA 4P10A 3B3TA 3DR6A 5D29A 2C27A 5AGEA 2DPSA 1PU9A 2B3VA 4X8IA 4YWYA 2AUNA 3PB8X 2ZOFA 2OZGA 2ZW4A 3V8IA 4F6AA 4UFWA 3EIFA 2D4PA 1R57A 1F2PA 3NH5A 5HVGA 4PXEA 2ZW6A 2PIZA 1PYTB 1YQEA 2AJ6A 4OP4A 5AG6A 3TLEA 1BLLE 4A32A 4QVTA 5F49A 3VGOA 3BLNA 3C26A 2PVVA 3OB2B 3K2KA 1H8LA 5A27A 3IWGA 3IJ3A 5LYIA 2DLAA 3D7HA 1M44A 4A37A 2OR4A 4Q7AA 3VRPA 1ARLA 2IMOA 3ICUA 2YNEA 4K30A 3B8GA 4NCZA 4C2YA 3TX8A 4JXRA 4CYNA 8CPAA 1ELMP 4UEZA 2CIJA 4TJVA 2WPXA 2FM4A 3CXPA 3TLAA 1KBLA 4QB9A 3VRNA 3W6SA 2FCKA 3TLGB 4MFJA 1YLOA 4KSFA 4C8TA 2K5TA 2CNSA 4B5PB 2FXFA 5CNPA 4NGTA 1TKHA 2Q0YA 4A39A 4AG7A 3BUOB 5HKWA 4LQGA 2I3CA 4C68A 3GB0A 1U6MA 4C8CA 3SR3A 4PXCA 3FEDA 4P45A 4B13A 1EE3P 4U9YA 3VWEA 5K8MA 1CP7A 2WSAA 3ISXA 2V77A 3EZAA 1EZAA 4BTFA 3K9UA 3DLJA 3OAKA 4MFLA 4MCSA 5K8NA 2XEIA 4UIAA 1Z4EA 3GIUA 4FD6A 5FVJA 2QVPA 3WR7A 2PJ8A 2PVWA 3UY5A 4CYPA 1ELLP 4MBUA 1GGOA 3EZEA 3RYOA 4MHYA 2Z3LA 4KZTA 3FNCA 4PK3A 4UWJA 2AE6A 4C8AA 3K4IA 1DTDA 3KHZA 1HDQA 3LWUA 3PBEA 3QAYA 4F0XA 3GJZA 4NGPA 1X10A 1YVKA 3H5ZA 4LQ6A 1CM0A 2O4HA 3HLPA 4M3SA 4IUSA 3WABA 4CAFA 5A28A 5IB0A 2AFWA 3H8FA 3W6XA 5LYFA 4DNCA 4HNWB 1QSRA 2B0AA 1YREA 3N7ZA 3VWDA 4TWEA 2PJ6A 4AVBA 4C8FA 2Q4VA 4X2TA 1DE4C 2OOTA 2OZUA 3FIXA 3R9EA 1AMPA 4XNHB 3VRQA 3RO0A 4K3NA 2PJAA 4YRHA 2B3UA 3TFYA 2ATRA 1B87A 1JWQA 2PJ3A 5J8FA 2FT0A 4CO9A 1XBUA 4Q38A 1VBGA 5BY0A 4HNXB 5ISVA 4OC3A 1ZO0A 4QUSA 2HUZA 4ZY0A 1QSNA 4IIYA 2Q44A 4M85A 1NSAA 3D7DA 3ZNIA 4MCRA 1XMTA 4XPKA 5AG7A 3EZBA 2XPNA 2PJBA 3GLJA 4A38A 4KOVA 4ZX8A 1S7FA 3IWEA 2PJ2A 4JXQA 4B5OA 3I9SA 3B3VA 1XIXA 2QIRA 2CY2A 3B3WA 4MRIA 5IR2A 2BSWA 4XPDC 4MHPA 3F9KC 3VTAA 2VXKA 4CAXA 4RN7A 5C82A 5K8OA 2R7HA 3IU1A 3B7IA 3TT2A 3B35A 3R95A 4IHMA 5FD8A 2FL4A 2D0PA 4JWPA 2ZXVA 3KI9A 4YGOA 4C99A 4M8DA 1OZPA 3D2PA 3KZWA 5HMNA 3F8KA 3CXSA 1KZFA 2B4DA 2HC9A 1FT7A 4H1HA 5HVHA 3TOBA 2CBLA 2NSMA 3KR5A 2N3AB 4AVAA 3WC5A 1Z2LA 1TF8A 2JDCA 2ZELA 3FYNA 1VHEA 3TO7A 4AG9A 7CPAA 1P4NA 3D66A 2F8HA 3BXMA 2G3TA 2NYQA 3IIBA 1M4LA 4R87A 4UCMA 4UCPA 1M4GA 1M1DA 2CNTA 1YGHA 4B14A 4CGPA 1ZG8A 5KTDA 2B5GA 3FRMA 1LAMA 3FVLA 1VIXA 3WT4A 4BINA 2HV2A 1BOBA 1ZL0A 2HI6A 4ZX9A 4XPDB 4C85A 2I79A 5LYLA 3FBUA 5KTAA 4NGSA 4JJXA 3SI1A 1YR0A 4A31A 4PSWA 4MJXA 2PCNA 5JQ4A 5G20A 2XEGA 2DPTA 2PQ8A 3H8GA 2ZPAA 3IEHA 1RXTA 4H6UA 3WC6A 4KOXA 4CAVA 1XJOA 1Q5XA 3KRVA 3D67A 5I4MA 4MFPA 1ZLHA 2VBQA 2OH1A 2R82A 4NJRA 1V0CA 2ZEFA 4E94A 3HMJG 4AB7A 4OLLA 4MHZA 2Q7SA 2GE3A 4GXHA 2PE3A 2ODFA 2VKZG 4MXUA 4UFVA 5G1ZA 2XEJA 4LUAA 2V8HA 4UEEA 4U9ZA 4INJA 3MN8A 2J8RA 3JTKA 4JD6A 3S9MA 3TC8A 1JDBC 1S7NA 3EC4A 1CS0B 3CZXA 4A94A 4KOWA 4CGMA 1CJWA 1X12A 2G3AA 4P44A 2J8MA 3GYAA 1N71A 2ANPA 4CYQA 1FBVA 5I0CA 4MCQA 2G0BA 1J4JA 3HPGG 3FF3A 4M6IA 4MHDA 3S6GA 3NE8A 3KQZA 5G22A 4B12A 4KOTA 2CNMA 5THWA 2JBJA 2PSWA 3PB9X 2FIWA 5DWNA 1TF9A 2Z3KA 4OC4A 2HQYA 4NSQA 1ZRSA 2B4DB 1ZG9A 2B58A 3L2NA 3OB1B 1Z8WA 1CBXA 3T9YA 5AXIA 3KKWA 2ZEMA 3PBBA 4I49A 1TIQA 3RAMA 3BHXA 2CTBA 2R1IA 1KEEB 4CZ1A 2CF4A 5LYDA 1YLEA 5EBVA 3QB8A 3D7GA 2BCOA 4OAEA 2HROA 3G23A 2DF5A 1KWMA 4C9AA 4B6ZA 5IV0A 4BMHA 4COBA 4CGLA 2VI7A 3TLYA 5F5XA 4E2AA 4C9EA 4FAIA 5F13A 4NGRA 2Z3PA 3CXQA 1DIKA 4X3RA 3QAHA 4IK2A 4OC0A 1QQ9A 2ZOGA 3BI0A 1KUYA 2D4OA 4WWVA 4ZI6A 4CDJA 3ISZA 2B4JC 2Q51A 3DSBA 4CRYB 3GKRA 3OWCA 3PB6X 4TJXA 3PZJA 4UIBA 1Y7EA 5IB9A 3T90A 6CPAA 4BPXB 1IOIA 1LRZA 4F9UA 5G21A 1YVHA 3TLZA 3S6KA 4AXVA 2E28A 4A95A 4A33A 2EZCA 4ONWA 4PK2A 5F48A 3I1UA 5JGFA 2GU2A 3PB7X 1Z9UA 1EO0A 3NFQA 2DXQA 3HUVA 3R96A 4J0NA 4BPWB 4WJBA 4OC1A 2GREA 2C6GA 5LRKA 2JEVA 1Z9EA 1YSJA 4M6GA 1UWYA 2ZEOA 1FNOA 3EFAA 1WJTA 4RR2B 4EVYA 2IQ6A 3G8WA 2OU2A 3IO1A 3T8WA 1TXRA 4FD4A 2EK9A 4MFQA 1VKCA 1XMBA 3TO6A 4P4IA 1YK3A 4FWUA 2CTCA 4MMOA 3SI0A 4CGOA 3B3CA 2PCUA 4KUAA 1WK4A 2QMLA 1LOKA 2R98A 3B3SA 2OLSA 3T5MA 1IU8A 1B6BA 3BUWB 2F7VA 4ZY2A 2ZW5A 3P2HA 4E0AA 2AUMA 3U88C 4R8FA 5J8CA 4MCPA 3SXNA 4OADA 4UF4A 2G9DA 4A4BA 4H6ZA 2YNCA 4OC5A 3PT1A 1GYTA 1PUAA 2F5IA 4UA3A 1YVOA 5C88A 4UEFA 2O28A 3V7ZA 1AUGA 1QMUA 3VROA 3S6HA 2V8GA 1MJ9A 4B5PA 2FIAA 4HKFA 4H2KA 1R61A 2VZZA 1LFWA 4C2XA 4KSIA 4PPZA 3TLGA 2Q04A 1EZBA 2ARHA 1VGYA 2PDOA 4HNYB 1L0CA 2PIYA 1JDEA 3LMSA 4GS4A 4PV6A 3PFVA 3RZAA 5CBMA 1VHOA 3NH8A 4II9A 2ZEDA 5JVLA 1ZG7A 3FEEA 1AYEA 1TKFA 2Q43A 3T0TA 2R8VA 1KC7A 3LODA 4RI1A 4R7MA 1IY7A 2OB0A 3DDDA 4KLVA 4A4CA 2BEIA 2P6FA 5GCNA 1M6VB 1I21A 2PR1A 2JEWA 3PLFB 4R57A 4C9RA 2QJ8A 3IC1A 3LACA 3NFZA 2C1CA 4X5KA 1Z5RA 5AG5A 2HWGA 3TLCA 2REEA 4KVXA 1XE4A 1VBHA 3ZZIA 4E8OA 4F8ZA 1Z8LA 2AFXA 4PXBA 1S60A 4P4DA 4EYSA 2A4NA 5HVFA 3D3SA 4H89A 1NMTA 2ABZA 3FH4A 3W91A 4P4BA 2EK8A 3D8PA 4F9VA 4JLYA 2GP4A 3I3GA 1Y9WA 5D8NA 1XOVA 4R76A 1B47A 2EZBA 2ZEGA 1XEBA 3H8EA 3S9NA 3WC7A 2PRQA 2EWBA 3RBUA 3SI2A 3BI1A 1CP6A 2J9AA 1A9XB 2V8VA 1P0HA 1Q2YA 3TO9A 3N5FA 2QYVA 1Y7RA 1MJBA 2MP0A 2V8DA 1LCPA 4KUBA 2PRBA 4KOSA 4P4EA 4DJLA 4C9UA 2B5GB 3P2FA 1I1DA 3G3SA 4IF5A 1XF1A 1VI4A 3CPAA 3NOJA 1I12A 3U1BA 5DS0A 3RNZA 2Z0ZA 4QBJA 2YNCC 4KLWA 5HKYA 3IFEA 3O8ZA 2GFQA 5K99A 3T05A 3KGQA 3SJGA 4JZ0A 4P6YA 3TCVA 4CYOA 5J3XA 2XPOA 4PSXA 1LAPA 5IX3A 4AVCA 4OIWA 4NXYA 3R1KA 1WVMA 1Q2CA 1CE8B 4NGQA 5DWMA 4RUHA 3LD2A 4YN3A 1MJAA 4CAWA 2EZAA 2H5MA 2P0WA 4MHNA 4P4FA 2FSRA 3PFEA 4FUUA 4HPSA 4FBEA 4E5SA 4UFXA 3I6SA 4KVME 1RO5A 2Z11A 3CT9A 3MGDA 1SQHA 2PJ9A 2C6CA 2PJ4A 2YJVA 3R9GA 2O53A 2C6PA 2JLMA 2XPPA 2WUUA 3IGRA 1F2OA 2C5QA 3I74A 2OZHA 1NE9A 4UCNA 4EMEA 2AFUA 2UV8G 2WYRA 1Y0RA 1Z8TA 4NF1A 5EMIA 4ZY1A 2X7BA 4CAEA 2YGWA 1R3NA 4XNHC 5JM6A 3BJ8A 2AFOA 2PC1A 2ZW7A 2P6GA 1WWZA 2GLFA 4UWIA 2B4BA 2AFMA 3VARA 4MI1A 1JQGA 2POKA 4YU9A 4EFDA 3PFOA 1QSOA 2Z3MA 3MRUA 4L89A 1XFOA 4EWTA 4OIDA 1IICA 1YW4A 5E96A 1R43A 3OP0A 4CS0B 4CGNA 4KNGE 5HH1A 3PRTA 1QSMA 4OKOA 1IYKA 2YJTA 3BUXB 5JYBA 1YW6A 2PJ1A 4KOUA 3IWWA 3SXOA 1NSLA 4C8UA 4U5YA 4F0YA 1IB1E 3CDXA 4FD5A 4NEXA 2BOAA 4W9YA 4NFRA 1S7KA 3EXNA 3PP9A 1PCAA 3EO4A 3SHPA 4UBRA 1QSTA 1Z8XA 3VATA 3FB3A 4ZBGA 5F46A 2X0SA 5F9MA 4R3KA 4C84A 4OC2A 1Z4RA 2VL1A 4Y49C 3SJFA 4P4JA 5J1QA 1ON0A 1CPXA 2ZENA 1CPSA 2EBJA 3E0KA 4KORA 1BPNA 3SJXA 2ZEPA 3F0AA 2IL4A 3D4UA 5KTCA 4C7HA 3FJUA 2BL1A 1XF8A 3FX6A 1CX8A 3KR4A 3VH9A 1GHEA 1MK4A 4O23A 2EO8A 5AG4A 2PJCA 1F57A 1M4DA 2AFSA 3F5BA 4KOYA 5F47A 4PQAA 2FS5A 4ORFA 4BD9A 4RS2A 3NE7A 3DR8A 5BWAB 5K8PA 1BPMA 3PB4X 4MY0A 4L8AA 5LRGA 1KUVA 3KQXA 4KSAA 1OBRA 1IIDA 2BUEA 4M6HA 2D0OA 4DUKA 4OMEA 2DEAA 2WPWA 5LRJA 1C3OB 4JVOA 5HXDA 4IAVA 4MY3A 1BAVA 4A30A 1V6CA 3BUMB 1BO4A 3FXTA 4Y49B 2P6EA 4R3LA 3ZJ0A 4C2ZA 3T07A 4CRZB 4BBHA 3NA6A 3KASA 2RC4A 4MJ8A 3D68A 2PR8A 1Y9ZA 3H4QA 3S6FA 1BXRB 1M4IA 1ZLIA 1Y0YA 4ZGYB 3V38A 3VRRA 5EC4A 3FMCA 4ONUA 2PJ0A 1K4JA 1KUXA 4MI4A 4Z65A 1TKJA 2XEFA 2KCWA 2Q4ZA 4NGNA 4IIXA 4R9MA 2FVGA 2EUIA 4GM5A 2AFZA 4JYWA 2EVNA 3CPXA 1CG2A 4NJQA 4GPLB 1S7LA 3BJ7A 5HKZA 1HEEA 1IGBA 4G1PA 4R6TA 3TYXA 2VQYA 3TLBA 3JUWA 2J8NA 1C30B 2HB6A 4KVOE 2Z3OA 3PEIA 4KS9A 4YFJA 2Z10A 5JPHA 3D7FA 3NH4A 2IJZA 3DGVA 3GY9A 4MFKA 2GANA 3GUXA 4B10A 2JBKA 5CPAA 4CPAA 3KHXA 1S5KA 2ZEEA 4A2ZA 2QECA 4PXDA 4TNUA 3TE4A 3EY5A 1RTQA 2I00A 3TOAA 1UFHA 1NXJA 2NMTA 3IU2A 5F09A 5ELYA 2Y1MA 3D2MA 5F1YA 1YX0A 1A2ZA 1IOFA 3JRUA 2GIVA 4C7IA 1T36B 3C8OA 4C86A 4C8PA 3TTHA 3JVNA 1VHSA 2RB7A 4MFZA 2RFHA 4COGA 2Q7BA 1FY7A 1Y9KA 3B2YA 2GLJA 4Q36A 2VZYA 3DNSA 2VEZA 4DYOA 5JH9A 1NBWA 2Z3NA 2WZNA 3A9LA 2Y0MA 2DIKA 2YNDA 3PGPA 2XPLA 1LANA 1J3LA 2REFA 2CXAA 5H86A 4C9VA 4CDKA 3HPHE 4ZYQA 2PJ5A 4FD7A 1XRYA 1Q7LA 2BO9A 4XPLA 3S9LA 3K9TA 4QC6A 3R9FA 1HDUA 3KL9A 3QNVA
chains in the Genus database with same CATH topology
4NGMA 3FECA 3SJEA 1YMEA 1ARMA 2ZEHA 2PJ7A 4P10A 3B3TA 5D29A 4X8IA 4YWYA 3PB8X 2ZOFA 3EIFA 1F2PA 3NH5A 5HVGA 4PXEA 4OP4A 2PIZA 1PYTB 1BLLE 2PVVA 3K2KA 1H8LA 5LYIA 3IJ3A 3D7HA 4A37A 2OR4A 4Q7AA 3ICUA 1ARLA 2IMOA 8CPAA 3TX8A 1ELMP 4UEZA 2CIJA 4TJVA 1YLOA 4C8TA 4NGTA 1TKHA 4A39A 4LQGA 2I3CA 3GB0A 4C8CA 4PXCA 3FEDA 4P45A 1EE3P 5K8MA 1CP7A 3ISXA 2V77A 3DLJA 4MCSA 5K8NA 2XEIA 4UIAA 2QVPA 2PJ8A 2PVWA 1ELLP 4MHYA 4C8AA 3LWUA 3PBEA 3KHZA 1DTDA 1HDQA 4NGPA 2O4HA 3HLPA 3WABA 5LYFA 2AFWA 3H8FA 4TWEA 2PJ6A 4C8FA 4X2TA 1DE4C 2OOTA 1AMPA 4K3NA 2PJAA 2PJ3A 1XBUA 4OC3A 4ZY0A 1NSAA 3D7DA 4MCRA 2PJBA 3GLJA 4A38A 4ZX8A 2PJ2A 3B3VA 3B3WA 4MRIA 5IR2A 4MHPA 3VTAA 5K8OA 3B7IA 3B35A 4IHMA 3KI9A 4C99A 3KZWA 2HC9A 1FT7A 2NSMA 3KR5A 3WC5A 1Z2LA 1TF8A 2ZELA 1VHEA 7CPAA 3D66A 5HVHA 2F8HA 3BXMA 2NYQA 3IIBA 1M4LA 1ZG8A 3FVLA 1LAMA 1VIXA 3WT4A 4ZX9A 4C85A 5LYLA 4NGSA 3SI1A 2XEGA 3H8GA 3IEHA 3WC6A 1XJOA 3D67A 5I4MA 1ZLHA 4NJRA 2ZEFA 4MHZA 2PE3A 4MXUA 2XEJA 2V8HA 4UEEA 3MN8A 3S9MA 3TC8A 4A94A 4P44A 2ANPA 4MCQA 3FF3A 3KQZA 5THWA 2JBJA 3PB9X 1TF9A 4OC4A 1ZG9A 3L2NA 1CBXA 2ZEMA 3PBBA 3RAMA 3BHXA 2CTBA 2CF4A 5LYDA 3D7GA 2BCOA 4C9AA 1KWMA 4B6ZA 4C9EA 4FAIA 4NGRA 4X3RA 4IK2A 4OC0A 1QQ9A 2ZOGA 3BI0A 4WWVA 4ZI6A 4CDJA 3ISZA 2Q51A 4TJXA 3PB6X 4UIBA 1Y7EA 5IB9A 6CPAA 4F9UA 4AXVA 4ONWA 3I1UA 5JGFA 2GU2A 3PB7X 3HUVA 4WJBA 4OC1A 2GREA 2C6GA 5LRKA 1YSJA 1UWYA 2ZEOA 1FNOA 2IQ6A 3IO1A 3T8WA 1TXRA 2EK9A 1XMBA 4P4IA 4MMOA 4FWUA 2CTCA 3SI0A 3B3CA 2PCUA 1LOKA 3B3SA 2F7VA 4ZY2A 4R8FA 4MCPA 4UF4A 2G9DA 4OC5A 1GYTA 4UEFA 3V7ZA 1QMUA 2V8GA 4H2KA 1LFWA 4KSIA 4PPZA 1VGYA 2PIYA 3LMSA 3RZAA 5CBMA 1VHOA 3NH8A 2ZEDA 1ZG7A 3FEEA 1AYEA 1TKFA 2Q43A 4R7MA 1IY7A 2JEWA 4C9RA 2QJ8A 3IC1A 3NFZA 2C1CA 1Z5RA 4F8ZA 1Z8LA 2AFXA 4PXBA 4P4DA 5HVFA 2ABZA 3FH4A 4P4BA 2EK8A 4F9VA 2GP4A 5D8NA 4R76A 2ZEGA 3H8EA 3S9NA 3WC7A 2PRQA 2EWBA 3RBUA 3SI2A 3BI1A 1CP6A 2J9AA 2V8VA 3N5FA 2QYVA 4C9UA 2V8DA 1LCPA 4DJLA 4P4EA 1XF1A 3CPAA 5DS0A 3IFEA 3KGQA 3SJGA 4JZ0A 4P6YA 1LAPA 4OIWA 1WVMA 4NGQA 4RUHA 4YN3A 4MHNA 4P4FA 3PFEA 4FUUA 4FBEA 3I6SA 3CT9A 2PJ9A 2C6CA 2PJ4A 2O53A 2C6PA 2C5QA 3I74A 1F2OA 4EMEA 2AFUA 2WYRA 1Y0RA 4ZY1A 1R3NA 5JM6A 2AFOA 2GLFA 2AFMA 3VARA 1JQGA 2POKA 4YU9A 4EFDA 3PFOA 3MRUA 1XFOA 4EWTA 4OIDA 1YW4A 1R43A 4KNGE 3PRTA 4OKOA 1YW6A 2PJ1A 3IWWA 4C8UA 3CDXA 2BOAA 4W9YA 4NFRA 3VATA 1PCAA 4C84A 4OC2A 2VL1A 3SJFA 4P4JA 5J1QA 1CPXA 2ZENA 1CPSA 1BPNA 3SJXA 2ZEPA 3D4UA 3FJUA 3FX6A 3KR4A 1CX8A 3VH9A 4O23A 2PJCA 1F57A 2AFSA 4PQAA 4BD9A 5K8PA 1BPMA 3PB4X 5LRGA 3KQXA 1OBRA 4DUKA 4OMEA 2DEAA 5LRJA 5HXDA 4IAVA 1V6CA 1BAVA 3NA6A 3KASA 3D68A 1Y9ZA 1ZLIA 1Y0YA 3V38A 3FMCA 2PJ0A 4Z65A 1TKJA 2XEFA 2Q4ZA 4NGNA 2FVGA 4GM5A 2AFZA 4JYWA 3CPXA 1CG2A 4NJQA 4R6TA 4G1PA 1HEEA 1IGBA 2HB6A 3PEIA 3D7FA 3NH4A 2IJZA 3DGVA 3GUXA 2JBKA 5CPAA 4CPAA 3KHXA 2ZEEA 4PXDA 4TNUA 1RTQA 5F09A 5ELYA 3JRUA 4C8PA 4C86A 2RB7A 2RFHA 3B2YA 2GLJA 4DYOA 5JH9A 2WZNA 1LANA 4C9VA 4CDKA 4ZYQA 2PJ5A 1XRYA 1Q7LA 2BO9A 3S9LA 3K9TA 1HDUA 3KL9A 3QNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGM A;  3FEC A;  3SJE A;  1YME A;  1ARM A;  2ZEH A;  2PJ7 A;  4P10 A;  3B3T A;  5D29 A;  4X8I A;  4YWY A;  3PB8 X;  2ZOF A;  3EIF A;  1F2P A;  3NH5 A;  5HVG A;  4PXE A;  4OP4 A;  2PIZ A;  1PYT B;  1BLL E;  2PVV A;  3K2K A;  1H8L A;  5LYI A;  3IJ3 A;  3D7H A;  4A37 A;  2OR4 A;  4Q7A A;  3ICU A;  1ARL A;  2IMO A;  8CPA A;  3TX8 A;  1ELM P;  4UEZ A;  2CIJ A;  4TJV A;  1YLO A;  4C8T A;  4NGT A;  1TKH A;  4A39 A;  4LQG A;  2I3C A;  3GB0 A;  4C8C A;  4PXC A;  3FED A;  4P45 A;  1EE3 P;  5K8M A;  1CP7 A;  3ISX A;  2V77 A;  3DLJ A;  4MCS A;  5K8N A;  2XEI A;  4UIA A;  2QVP A;  2PJ8 A;  2PVW A;  1ELL P;  4MHY A;  4C8A A;  3LWU A;  3PBE A;  3KHZ A;  1DTD A;  1HDQ A;  4NGP A;  2O4H A;  3HLP A;  3WAB A;  5LYF A;  2AFW A;  3H8F A;  4TWE A;  2PJ6 A;  4C8F A;  4X2T A;  1DE4 C;  2OOT A;  1AMP A;  4K3N A;  2PJA A;  2PJ3 A;  1XBU A;  4OC3 A;  4ZY0 A;  1NSA A;  3D7D A;  4MCR A;  2PJB A;  3GLJ A;  4A38 A;  4ZX8 A;  2PJ2 A;  3B3V A;  3B3W A;  4MRI A;  4MHP A;  3VTA A;  5K8O A;  3B7I A;  3B35 A;  4IHM A;  3KI9 A;  4C99 A;  3KZW A;  2HC9 A;  1FT7 A;  2NSM A;  3KR5 A;  3WC5 A;  1Z2L A;  1TF8 A;  2ZEL A;  1VHE A;  7CPA A;  3D66 A;  5HVH A;  2F8H A;  3BXM A;  2NYQ A;  3IIB A;  1M4L A;  1ZG8 A;  3FVL A;  1LAM A;  1VIX A;  3WT4 A;  4ZX9 A;  4C85 A;  5LYL A;  4NGS A;  3SI1 A;  2XEG A;  3H8G A;  3IEH A;  3WC6 A;  1XJO A;  3D67 A;  5I4M A;  1ZLH A;  4NJR A;  2ZEF A;  4MHZ A;  2PE3 A;  4MXU A;  2XEJ A;  2V8H A;  4UEE A;  3MN8 A;  3S9M A;  3TC8 A;  4A94 A;  4P44 A;  2ANP A;  4MCQ A;  3FF3 A;  3KQZ A;  5THW A;  2JBJ A;  3PB9 X;  1TF9 A;  4OC4 A;  1ZG9 A;  3L2N A;  1CBX A;  2ZEM A;  3PBB A;  3RAM A;  3BHX A;  2CTB A;  2CF4 A;  5LYD A;  3D7G A;  2BCO A;  4C9A A;  1KWM A;  4B6Z A;  4C9E A;  4FAI A;  4NGR A;  4X3R A;  4IK2 A;  4OC0 A;  1QQ9 A;  2ZOG A;  3BI0 A;  4WWV A;  4ZI6 A;  4CDJ A;  3ISZ A;  2Q51 A;  4TJX A;  3PB6 X;  4UIB A;  1Y7E A;  5IB9 A;  6CPA A;  4F9U A;  4AXV A;  4ONW A;  3I1U A;  5JGF A;  2GU2 A;  3PB7 X;  3HUV A;  4WJB A;  4OC1 A;  2GRE A;  2C6G A;  5LRK A;  1YSJ A;  1UWY A;  2ZEO A;  1FNO A;  2IQ6 A;  3IO1 A;  3T8W A;  1TXR A;  2EK9 A;  1XMB A;  4P4I A;  4MMO A;  4FWU A;  2CTC A;  3SI0 A;  3B3C A;  2PCU A;  1LOK A;  3B3S A;  2F7V A;  4ZY2 A;  4R8F A;  4MCP A;  4UF4 A;  2G9D A;  4OC5 A;  1GYT A;  4UEF A;  3V7Z A;  1QMU A;  2V8G A;  4H2K A;  1LFW A;  4KSI A;  4PPZ A;  1VGY A;  2PIY A;  3LMS A;  3RZA A;  5CBM A;  1VHO A;  3NH8 A;  2ZED A;  1ZG7 A;  3FEE A;  1AYE A;  1TKF A;  2Q43 A;  4R7M A;  1IY7 A;  2JEW A;  4C9R A;  2QJ8 A;  3IC1 A;  3NFZ A;  2C1C A;  1Z5R A;  4F8Z A;  1Z8L A;  2AFX A;  4PXB A;  4P4D A;  5HVF A;  2ABZ A;  3FH4 A;  4P4B A;  2EK8 A;  4F9V A;  5D8N A;  4R76 A;  2ZEG A;  3H8E A;  3S9N A;  3WC7 A;  2PRQ A;  2EWB A;  3RBU A;  3SI2 A;  3BI1 A;  1CP6 A;  2J9A A;  2V8V A;  3N5F A;  2QYV A;  4C9U A;  2V8D A;  1LCP A;  4DJL A;  4P4E A;  1XF1 A;  3CPA A;  5DS0 A;  3IFE A;  3KGQ A;  3SJG A;  4JZ0 A;  4P6Y A;  1LAP A;  4OIW A;  1WVM A;  4NGQ A;  4RUH A;  4YN3 A;  4MHN A;  4P4F A;  3PFE A;  4FUU A;  4FBE A;  3I6S A;  3CT9 A;  2PJ9 A;  2C6C A;  2PJ4 A;  2O53 A;  2C6P A;  3I74 A;  1F2O A;  4EME A;  2AFU A;  2WYR A;  1Y0R A;  4ZY1 A;  1R3N A;  5JM6 A;  2AFO A;  2GLF A;  2AFM A;  3VAR A;  1JQG A;  2POK A;  4YU9 A;  4EFD A;  3PFO A;  3MRU A;  1XFO A;  4EWT A;  4OID A;  1YW4 A;  1R43 A;  4KNG E;  3PRT A;  4OKO A;  1YW6 A;  2PJ1 A;  3IWW A;  4C8U A;  3CDX A;  2BOA A;  4W9Y A;  4NFR A;  3VAT A;  1PCA A;  4C84 A;  4OC2 A;  2VL1 A;  3SJF A;  4P4J A;  5J1Q A;  1CPX A;  2ZEN A;  1CPS A;  1BPN A;  3SJX A;  2ZEP A;  3D4U A;  3FJU A;  3FX6 A;  3KR4 A;  1CX8 A;  3VH9 A;  4O23 A;  2PJC A;  1F57 A;  2AFS A;  4PQA A;  4BD9 A;  5K8P A;  1BPM A;  3PB4 X;  5LRG A;  3KQX A;  1OBR A;  4DUK A;  4OME A;  2DEA A;  5LRJ A;  5HXD A;  4IAV A;  1V6C A;  1BAV A;  3NA6 A;  3KAS A;  3D68 A;  1Y9Z A;  1ZLI A;  1Y0Y A;  3V38 A;  3FMC A;  2PJ0 A;  4Z65 A;  1TKJ A;  2XEF A;  2Q4Z A;  4NGN A;  2FVG A;  4GM5 A;  2AFZ A;  4JYW A;  3CPX A;  1CG2 A;  4NJQ A;  4R6T A;  4G1P A;  1HEE A;  1IGB A;  2HB6 A;  3PEI A;  3D7F A;  3NH4 A;  2IJZ A;  3DGV A;  3GUX A;  2JBK A;  5CPA A;  4CPA A;  3KHX A;  2ZEE A;  4PXD A;  4TNU A;  1RTQ A;  5F09 A;  5ELY A;  3JRU A;  4C8P A;  4C86 A;  2RB7 A;  2RFH A;  3B2Y A;  2GLJ A;  4DYO A;  5JH9 A;  2WZN A;  1LAN A;  4C9V A;  4CDK A;  4ZYQ A;  2PJ5 A;  1XRY A;  1Q7L A;  2BO9 A;  3S9L A;  3K9T A;  1HDU A;  3KL9 A;  3QNV A; 
#chains in the Genus database with same CATH topology
 4NGM A;  2JDD A;  5H84 A;  4BPU B;  1Q2D A;  2Y1N A;  4LX9 A;  1IYL A;  3FEC A;  4J3G A;  3BUN B;  3SJE A;  2FE7 A;  1YME A;  1ARM A;  2ZEH A;  4B11 A;  1ZYM A;  2PJ7 A;  2Q4Y A;  1S3Z A;  4P10 A;  3B3T A;  3DR6 A;  5D29 A;  2C27 A;  5AGE A;  2DPS A;  1PU9 A;  2B3V A;  4X8I A;  4YWY A;  2AUN A;  3PB8 X;  2ZOF A;  2OZG A;  2ZW4 A;  3V8I A;  4F6A A;  4UFW A;  3EIF A;  2D4P A;  1R57 A;  1F2P A;  3NH5 A;  5HVG A;  4PXE A;  2ZW6 A;  2PIZ A;  1PYT B;  1YQE A;  2AJ6 A;  4OP4 A;  5AG6 A;  3TLE A;  1BLL E;  4A32 A;  4QVT A;  5F49 A;  3VGO A;  3BLN A;  3C26 A;  2PVV A;  3OB2 B;  3K2K A;  1H8L A;  5A27 A;  3IWG A;  3IJ3 A;  5LYI A;  2DLA A;  3D7H A;  1M44 A;  4A37 A;  2OR4 A;  4Q7A A;  3VRP A;  1ARL A;  2IMO A;  3ICU A;  2YNE A;  4K30 A;  3B8G A;  4NCZ A;  4C2Y A;  3TX8 A;  4JXR A;  4CYN A;  8CPA A;  1ELM P;  4UEZ A;  2CIJ A;  4TJV A;  2WPX A;  2FM4 A;  3CXP A;  3TLA A;  1KBL A;  4QB9 A;  3VRN A;  3W6S A;  2FCK A;  3TLG B;  4MFJ A;  1YLO A;  4KSF A;  4C8T A;  2K5T A;  2CNS A;  4B5P B;  2FXF A;  5CNP A;  4NGT A;  1TKH A;  2Q0Y A;  4A39 A;  4AG7 A;  3BUO B;  5HKW A;  4LQG A;  2I3C A;  4C68 A;  3GB0 A;  1U6M A;  4C8C A;  3SR3 A;  4PXC A;  3FED A;  4P45 A;  4B13 A;  1EE3 P;  4U9Y A;  3VWE A;  5K8M A;  1CP7 A;  2WSA A;  3ISX A;  2V77 A;  3EZA A;  1EZA A;  4BTF A;  3K9U A;  3DLJ A;  3OAK A;  4MFL A;  4MCS A;  5K8N A;  2XEI A;  4UIA A;  1Z4E A;  3GIU A;  4FD6 A;  5FVJ A;  2QVP A;  3WR7 A;  2PJ8 A;  2PVW A;  3UY5 A;  4CYP A;  1ELL P;  4MBU A;  1GGO A;  3EZE A;  3RYO A;  4MHY A;  2Z3L A;  4KZT A;  3FNC A;  4PK3 A;  4UWJ A;  2AE6 A;  4C8A A;  3K4I A;  1DTD A;  3KHZ A;  1HDQ A;  3LWU A;  3PBE A;  3QAY A;  4F0X A;  3GJZ A;  4NGP A;  1X10 A;  1YVK A;  3H5Z A;  4LQ6 A;  1CM0 A;  2O4H A;  3HLP A;  4M3S A;  4IUS A;  3WAB A;  4CAF A;  5A28 A;  5IB0 A;  2AFW A;  3H8F A;  3W6X A;  5LYF A;  4DNC A;  4HNW B;  1QSR A;  2B0A A;  1YRE A;  3N7Z A;  3VWD A;  4TWE A;  2PJ6 A;  4AVB A;  4C8F A;  2Q4V A;  4X2T A;  1DE4 C;  2OOT A;  2OZU A;  3FIX A;  3R9E A;  1AMP A;  4XNH B;  3VRQ A;  3RO0 A;  4K3N A;  2PJA A;  4YRH A;  2B3U A;  3TFY A;  2ATR A;  1B87 A;  1JWQ A;  2PJ3 A;  5J8F A;  2FT0 A;  4CO9 A;  1XBU A;  4Q38 A;  1VBG A;  5BY0 A;  4HNX B;  5ISV A;  4OC3 A;  1ZO0 A;  4QUS A;  2HUZ A;  4ZY0 A;  1QSN A;  4IIY A;  2Q44 A;  4M85 A;  1NSA A;  3D7D A;  3ZNI A;  4MCR A;  1XMT A;  4XPK A;  5AG7 A;  3EZB A;  2XPN A;  2PJB A;  3GLJ A;  4A38 A;  4KOV A;  4ZX8 A;  1S7F A;  3IWE A;  2PJ2 A;  4JXQ A;  4B5O A;  3I9S A;  3B3V A;  1XIX A;  2QIR A;  2CY2 A;  3B3W A;  4MRI A;  5IR2 A;  2BSW A;  4XPD C;  4MHP A;  3F9K C;  3VTA A;  2VXK A;  4CAX A;  4RN7 A;  5C82 A;  5K8O A;  2R7H A;  3IU1 A;  3B7I A;  3TT2 A;  3B35 A;  3R95 A;  4IHM A;  5FD8 A;  2FL4 A;  2D0P A;  4JWP A;  2ZXV A;  3KI9 A;  4YGO A;  4C99 A;  4M8D A;  1OZP A;  3D2P A;  3KZW A;  5HMN A;  3F8K A;  3CXS A;  1KZF A;  2B4D A;  2HC9 A;  1FT7 A;  4H1H A;  5HVH A;  3TOB A;  2CBL A;  2NSM A;  3KR5 A;  2N3A B;  4AVA A;  3WC5 A;  1Z2L A;  1TF8 A;  2JDC A;  2ZEL A;  3FYN A;  1VHE A;  3TO7 A;  4AG9 A;  7CPA A;  1P4N A;  3D66 A;  2F8H A;  3BXM A;  2G3T A;  2NYQ A;  3IIB A;  1M4L A;  4R87 A;  4UCM A;  4UCP A;  1M4G A;  1M1D A;  2CNT A;  1YGH A;  4B14 A;  4CGP A;  1ZG8 A;  5KTD A;  2B5G A;  3FRM A;  1LAM A;  3FVL A;  1VIX A;  3WT4 A;  4BIN A;  2HV2 A;  1BOB A;  1ZL0 A;  2HI6 A;  4ZX9 A;  4XPD B;  4C85 A;  2I79 A;  5LYL A;  3FBU A;  5KTA A;  4NGS A;  4JJX A;  3SI1 A;  1YR0 A;  4A31 A;  4PSW A;  4MJX A;  2PCN A;  5JQ4 A;  5G20 A;  2XEG A;  2DPT A;  2PQ8 A;  3H8G A;  2ZPA A;  3IEH A;  1RXT A;  4H6U A;  3WC6 A;  4KOX A;  4CAV A;  1XJO A;  1Q5X A;  3KRV A;  3D67 A;  5I4M A;  4MFP A;  1ZLH A;  2VBQ A;  2OH1 A;  2R82 A;  4NJR A;  1V0C A;  2ZEF A;  4E94 A;  3HMJ G;  4AB7 A;  4OLL A;  4MHZ A;  2Q7S A;  2GE3 A;  4GXH A;  2PE3 A;  2ODF A;  2VKZ G;  4MXU A;  4UFV A;  5G1Z A;  2XEJ A;  4LUA A;  2V8H A;  4UEE A;  4U9Z A;  4INJ A;  3MN8 A;  2J8R A;  3JTK A;  4JD6 A;  3S9M A;  3TC8 A;  1JDB C;  1S7N A;  3EC4 A;  1CS0 B;  3CZX A;  4A94 A;  4KOW A;  4CGM A;  1CJW A;  1X12 A;  2G3A A;  4P44 A;  2J8M A;  3GYA A;  1N71 A;  2ANP A;  4CYQ A;  1FBV A;  5I0C A;  4MCQ A;  2G0B A;  1J4J A;  3HPG G;  3FF3 A;  4M6I A;  4MHD A;  3S6G A;  3NE8 A;  3KQZ A;  5G22 A;  4B12 A;  4KOT A;  2CNM A;  5THW A;  2JBJ A;  2PSW A;  3PB9 X;  2FIW A;  5DWN A;  1TF9 A;  2Z3K A;  4OC4 A;  2HQY A;  4NSQ A;  1ZRS A;  2B4D B;  1ZG9 A;  2B58 A;  3L2N A;  3OB1 B;  1Z8W A;  1CBX A;  3T9Y A;  5AXI A;  3KKW A;  2ZEM A;  3PBB A;  4I49 A;  1TIQ A;  3RAM A;  3BHX A;  2CTB A;  2R1I A;  1KEE B;  4CZ1 A;  2CF4 A;  5LYD A;  1YLE A;  5EBV A;  3QB8 A;  3D7G A;  2BCO A;  4OAE A;  2HRO A;  3G23 A;  2DF5 A;  1KWM A;  4C9A A;  4B6Z A;  5IV0 A;  4BMH A;  4COB A;  4CGL A;  2VI7 A;  3TLY A;  5F5X A;  4E2A A;  4C9E A;  4FAI A;  5F13 A;  4NGR A;  2Z3P A;  3CXQ A;  1DIK A;  4X3R A;  3QAH A;  4IK2 A;  4OC0 A;  1QQ9 A;  2ZOG A;  3BI0 A;  1KUY A;  2D4O A;  4WWV A;  4ZI6 A;  4CDJ A;  3ISZ A;  2B4J C;  2Q51 A;  3DSB A;  4CRY B;  3GKR A;  3OWC A;  3PB6 X;  4TJX A;  3PZJ A;  4UIB A;  1Y7E A;  5IB9 A;  3T90 A;  6CPA A;  4BPX B;  1IOI A;  1LRZ A;  4F9U A;  5G21 A;  1YVH A;  3TLZ A;  3S6K A;  4AXV A;  2E28 A;  4A95 A;  4A33 A;  2EZC A;  4ONW A;  4PK2 A;  5F48 A;  3I1U A;  5JGF A;  2GU2 A;  3PB7 X;  1Z9U A;  1EO0 A;  3NFQ A;  2DXQ A;  3HUV A;  3R96 A;  4J0N A;  4BPW B;  4WJB A;  4OC1 A;  2GRE A;  2C6G A;  5LRK A;  2JEV A;  1Z9E A;  1YSJ A;  4M6G A;  1UWY A;  2ZEO A;  1FNO A;  3EFA A;  1WJT A;  4RR2 B;  4EVY A;  2IQ6 A;  3G8W A;  2OU2 A;  3IO1 A;  3T8W A;  1TXR A;  4FD4 A;  2EK9 A;  4MFQ A;  1VKC A;  1XMB A;  3TO6 A;  4P4I A;  1YK3 A;  4FWU A;  2CTC A;  4MMO A;  3SI0 A;  4CGO A;  3B3C A;  2PCU A;  4KUA A;  1WK4 A;  2QML A;  1LOK A;  2R98 A;  3B3S A;  2OLS A;  3T5M A;  1IU8 A;  1B6B A;  3BUW B;  2F7V A;  4ZY2 A;  2ZW5 A;  3P2H A;  4E0A A;  2AUM A;  3U88 C;  4R8F A;  5J8C A;  4MCP A;  3SXN A;  4OAD A;  4UF4 A;  2G9D A;  4A4B A;  4H6Z A;  2YNC A;  4OC5 A;  3PT1 A;  1GYT A;  1PUA A;  2F5I A;  4UA3 A;  1YVO A;  5C88 A;  4UEF A;  2O28 A;  3V7Z A;  1AUG A;  1QMU A;  3VRO A;  3S6H A;  2V8G A;  1MJ9 A;  4B5P A;  2FIA A;  4HKF A;  4H2K A;  1R61 A;  2VZZ A;  1LFW A;  4C2X A;  4KSI A;  4PPZ A;  3TLG A;  2Q04 A;  1EZB A;  2ARH A;  1VGY A;  2PDO A;  4HNY B;  1L0C A;  2PIY A;  1JDE A;  3LMS A;  4GS4 A;  4PV6 A;  3PFV A;  3RZA A;  5CBM A;  1VHO A;  3NH8 A;  4II9 A;  2ZED A;  5JVL A;  1ZG7 A;  3FEE A;  1AYE A;  1TKF A;  2Q43 A;  3T0T A;  2R8V A;  1KC7 A;  3LOD A;  4RI1 A;  4R7M A;  1IY7 A;  2OB0 A;  3DDD A;  4KLV A;  4A4C A;  2BEI A;  2P6F A;  5GCN A;  1M6V B;  1I21 A;  2PR1 A;  2JEW A;  3PLF B;  4R57 A;  4C9R A;  2QJ8 A;  3IC1 A;  3LAC A;  3NFZ A;  2C1C A;  4X5K A;  1Z5R A;  5AG5 A;  2HWG A;  3TLC A;  2REE A;  4KVX A;  1XE4 A;  1VBH A;  3ZZI A;  4E8O A;  4F8Z A;  1Z8L A;  2AFX A;  4PXB A;  1S60 A;  4P4D A;  4EYS A;  2A4N A;  5HVF A;  3D3S A;  4H89 A;  1NMT A;  2ABZ A;  3FH4 A;  3W91 A;  4P4B A;  2EK8 A;  3D8P A;  4F9V A;  4JLY A;  2GP4 A;  3I3G A;  1Y9W A;  5D8N A;  1XOV A;  4R76 A;  1B47 A;  2EZB A;  2ZEG A;  1XEB A;  3H8E A;  3S9N A;  3WC7 A;  2PRQ A;  2EWB A;  3RBU A;  3SI2 A;  3BI1 A;  1CP6 A;  2J9A A;  1A9X B;  2V8V A;  1P0H A;  1Q2Y A;  3TO9 A;  3N5F A;  2QYV A;  1Y7R A;  1MJB A;  2MP0 A;  2V8D A;  1LCP A;  4KUB A;  2PRB A;  4KOS A;  4P4E A;  4DJL A;  4C9U A;  2B5G B;  3P2F A;  1I1D A;  3G3S A;  4IF5 A;  1XF1 A;  1VI4 A;  3CPA A;  3NOJ A;  1I12 A;  3U1B A;  5DS0 A;  3RNZ A;  2Z0Z A;  4QBJ A;  2YNC C;  4KLW A;  5HKY A;  3IFE A;  3O8Z A;  2GFQ A;  5K99 A;  3T05 A;  3KGQ A;  3SJG A;  4JZ0 A;  4P6Y A;  3TCV A;  4CYO A;  5J3X A;  2XPO A;  4PSX A;  1LAP A;  5IX3 A;  4AVC A;  4OIW A;  4NXY A;  3R1K A;  1WVM A;  1Q2C A;  1CE8 B;  4NGQ A;  5DWM A;  4RUH A;  3LD2 A;  4YN3 A;  1MJA A;  4CAW A;  2EZA A;  2H5M A;  2P0W A;  4MHN A;  4P4F A;  2FSR A;  3PFE A;  4FUU A;  4HPS A;  4FBE A;  4E5S A;  4UFX A;  3I6S A;  4KVM E;  1RO5 A;  2Z11 A;  3CT9 A;  3MGD A;  1SQH A;  2PJ9 A;  2C6C A;  2PJ4 A;  2YJV A;  3R9G A;  2O53 A;  2C6P A;  2JLM A;  2XPP A;  2WUU A;  3IGR A;  1F2O A;  2C5Q A;  3I74 A;  2OZH A;  1NE9 A;  4UCN A;  4EME A;  2AFU A;  2UV8 G;  2WYR A;  1Y0R A;  1Z8T A;  4NF1 A;  5EMI A;  4ZY1 A;  2X7B A;  4CAE A;  2YGW A;  1R3N A;  4XNH C;  5JM6 A;  3BJ8 A;  2AFO A;  2PC1 A;  2ZW7 A;  2P6G A;  1WWZ A;  2GLF A;  4UWI A;  2B4B A;  2AFM A;  3VAR A;  4MI1 A;  1JQG A;  2POK A;  4YU9 A;  4EFD A;  3PFO A;  1QSO A;  2Z3M A;  3MRU A;  4L89 A;  1XFO A;  4EWT A;  4OID A;  1IIC A;  1YW4 A;  5E96 A;  1R43 A;  3OP0 A;  4CS0 B;  4CGN A;  4KNG E;  5HH1 A;  3PRT A;  1QSM A;  4OKO A;  1IYK A;  2YJT A;  3BUX B;  5JYB A;  1YW6 A;  2PJ1 A;  4KOU A;  3IWW A;  3SXO A;  1NSL A;  4C8U A;  4U5Y A;  4F0Y A;  1IB1 E;  3CDX A;  4FD5 A;  4NEX A;  2BOA A;  4W9Y A;  4NFR A;  1S7K A;  3EXN A;  3PP9 A;  1PCA A;  3EO4 A;  3SHP A;  4UBR A;  1QST A;  1Z8X A;  3VAT A;  3FB3 A;  4ZBG A;  5F46 A;  2X0S A;  5F9M A;  4R3K A;  4C84 A;  4OC2 A;  1Z4R A;  2VL1 A;  4Y49 C;  3SJF A;  4P4J A;  5J1Q A;  1ON0 A;  1CPX A;  2ZEN A;  1CPS A;  2EBJ A;  3E0K A;  4KOR A;  1BPN A;  3SJX A;  2ZEP A;  3F0A A;  2IL4 A;  3D4U A;  5KTC A;  4C7H A;  3FJU A;  2BL1 A;  1XF8 A;  3FX6 A;  1CX8 A;  3KR4 A;  3VH9 A;  1GHE A;  1MK4 A;  4O23 A;  2EO8 A;  5AG4 A;  2PJC A;  1F57 A;  1M4D A;  2AFS A;  3F5B A;  4KOY A;  5F47 A;  4PQA A;  2FS5 A;  4ORF A;  4BD9 A;  4RS2 A;  3NE7 A;  3DR8 A;  5BWA B;  5K8P A;  1BPM A;  3PB4 X;  4MY0 A;  4L8A A;  5LRG A;  1KUV A;  3KQX A;  4KSA A;  1OBR A;  1IID A;  2BUE A;  4M6H A;  2D0O A;  4DUK A;  4OME A;  2DEA A;  2WPW A;  5LRJ A;  1C3O B;  4JVO A;  5HXD A;  4IAV A;  4MY3 A;  1BAV A;  4A30 A;  1V6C A;  3BUM B;  1BO4 A;  3FXT A;  4Y49 B;  2P6E A;  4R3L A;  3ZJ0 A;  4C2Z A;  3T07 A;  4CRZ B;  4BBH A;  3NA6 A;  3KAS A;  2RC4 A;  4MJ8 A;  3D68 A;  2PR8 A;  1Y9Z A;  3H4Q A;  3S6F A;  1BXR B;  1M4I A;  1ZLI A;  1Y0Y A;  4ZGY B;  3V38 A;  3VRR A;  5EC4 A;  3FMC A;  4ONU A;  2PJ0 A;  1K4J A;  1KUX A;  4MI4 A;  4Z65 A;  1TKJ A;  2XEF A;  2KCW A;  2Q4Z A;  4NGN A;  4IIX A;  4R9M A;  2FVG A;  2EUI A;  4GM5 A;  2AFZ A;  4JYW A;  2EVN A;  3CPX A;  1CG2 A;  4NJQ A;  4GPL B;  1S7L A;  3BJ7 A;  5HKZ A;  1HEE A;  1IGB A;  4G1P A;  4R6T A;  3TYX A;  2VQY A;  3TLB A;  3JUW A;  2J8N A;  1C30 B;  2HB6 A;  4KVO E;  2Z3O A;  3PEI A;  4KS9 A;  4YFJ A;  2Z10 A;  5JPH A;  3D7F A;  3NH4 A;  2IJZ A;  3DGV A;  3GY9 A;  4MFK A;  2GAN A;  3GUX A;  4B10 A;  2JBK A;  5CPA A;  4CPA A;  3KHX A;  1S5K A;  2ZEE A;  4A2Z A;  2QEC A;  4PXD A;  4TNU A;  3TE4 A;  3EY5 A;  1RTQ A;  2I00 A;  3TOA A;  1UFH A;  1NXJ A;  2NMT A;  3IU2 A;  5F09 A;  5ELY A;  2Y1M A;  3D2M A;  5F1Y A;  1YX0 A;  1A2Z A;  1IOF A;  3JRU A;  2GIV A;  4C7I A;  1T36 B;  3C8O A;  4C86 A;  4C8P A;  3TTH A;  3JVN A;  1VHS A;  2RB7 A;  4MFZ A;  2RFH A;  4COG A;  2Q7B A;  1FY7 A;  1Y9K A;  3B2Y A;  2GLJ A;  4Q36 A;  2VZY A;  3DNS A;  2VEZ A;  4DYO A;  5JH9 A;  1NBW A;  2Z3N A;  2WZN A;  3A9L A;  2Y0M A;  2DIK A;  2YND A;  3PGP A;  2XPL A;  1LAN A;  1J3L A;  2REF A;  2CXA A;  5H86 A;  4C9V A;  4CDK A;  3HPH E;  4ZYQ A;  2PJ5 A;  4FD7 A;  1XRY A;  1Q7L A;  2BO9 A;  4XPL A;  3S9L A;  3K9T A;  4QC6 A;  3R9F A;  1HDU A;  3KL9 A;  3QNV A; 
#chains in the Genus database with same CATH homology
 4NGM A;  3FEC A;  3SJE A;  1YME A;  1ARM A;  2ZEH A;  2PJ7 A;  4P10 A;  3B3T A;  5D29 A;  4X8I A;  4YWY A;  3PB8 X;  2ZOF A;  3EIF A;  1F2P A;  3NH5 A;  5HVG A;  4PXE A;  4OP4 A;  2PIZ A;  1PYT B;  1BLL E;  2PVV A;  3K2K A;  1H8L A;  5LYI A;  3IJ3 A;  3D7H A;  4A37 A;  2OR4 A;  4Q7A A;  3ICU A;  1ARL A;  2IMO A;  8CPA A;  3TX8 A;  1ELM P;  4UEZ A;  2CIJ A;  4TJV A;  1YLO A;  4C8T A;  4NGT A;  1TKH A;  4A39 A;  4LQG A;  2I3C A;  3GB0 A;  4C8C A;  4PXC A;  3FED A;  4P45 A;  1EE3 P;  5K8M A;  1CP7 A;  3ISX A;  2V77 A;  3DLJ A;  4MCS A;  5K8N A;  2XEI A;  4UIA A;  2QVP A;  2PJ8 A;  2PVW A;  1ELL P;  4MHY A;  4C8A A;  3LWU A;  3PBE A;  3KHZ A;  1DTD A;  1HDQ A;  4NGP A;  2O4H A;  3HLP A;  3WAB A;  5LYF A;  2AFW A;  3H8F A;  4TWE A;  2PJ6 A;  4C8F A;  4X2T A;  1DE4 C;  2OOT A;  1AMP A;  4K3N A;  2PJA A;  2PJ3 A;  1XBU A;  4OC3 A;  4ZY0 A;  1NSA A;  3D7D A;  4MCR A;  2PJB A;  3GLJ A;  4A38 A;  4ZX8 A;  2PJ2 A;  3B3V A;  3B3W A;  4MRI A;  5IR2 A;  4MHP A;  3VTA A;  5K8O A;  3B7I A;  3B35 A;  4IHM A;  3KI9 A;  4C99 A;  3KZW A;  2HC9 A;  1FT7 A;  2NSM A;  3KR5 A;  3WC5 A;  1Z2L A;  1TF8 A;  2ZEL A;  1VHE A;  7CPA A;  3D66 A;  5HVH A;  2F8H A;  3BXM A;  2NYQ A;  3IIB A;  1M4L A;  1ZG8 A;  3FVL A;  1LAM A;  1VIX A;  3WT4 A;  4ZX9 A;  4C85 A;  5LYL A;  4NGS A;  3SI1 A;  2XEG A;  3H8G A;  3IEH A;  3WC6 A;  1XJO A;  3D67 A;  5I4M A;  1ZLH A;  4NJR A;  2ZEF A;  4MHZ A;  2PE3 A;  4MXU A;  2XEJ A;  2V8H A;  4UEE A;  3MN8 A;  3S9M A;  3TC8 A;  4A94 A;  4P44 A;  2ANP A;  4MCQ A;  3FF3 A;  3KQZ A;  5THW A;  2JBJ A;  3PB9 X;  1TF9 A;  4OC4 A;  1ZG9 A;  3L2N A;  1CBX A;  2ZEM A;  3PBB A;  3RAM A;  3BHX A;  2CTB A;  2CF4 A;  5LYD A;  3D7G A;  2BCO A;  4C9A A;  1KWM A;  4B6Z A;  4C9E A;  4FAI A;  4NGR A;  4X3R A;  4IK2 A;  4OC0 A;  1QQ9 A;  2ZOG A;  3BI0 A;  4WWV A;  4ZI6 A;  4CDJ A;  3ISZ A;  2Q51 A;  4TJX A;  3PB6 X;  4UIB A;  1Y7E A;  5IB9 A;  6CPA A;  4F9U A;  4AXV A;  4ONW A;  3I1U A;  5JGF A;  2GU2 A;  3PB7 X;  3HUV A;  4WJB A;  4OC1 A;  2GRE A;  2C6G A;  5LRK A;  1YSJ A;  1UWY A;  2ZEO A;  1FNO A;  2IQ6 A;  3IO1 A;  3T8W A;  1TXR A;  2EK9 A;  1XMB A;  4P4I A;  4MMO A;  4FWU A;  2CTC A;  3SI0 A;  3B3C A;  2PCU A;  1LOK A;  3B3S A;  2F7V A;  4ZY2 A;  4R8F A;  4MCP A;  4UF4 A;  2G9D A;  4OC5 A;  1GYT A;  4UEF A;  3V7Z A;  1QMU A;  2V8G A;  4H2K A;  1LFW A;  4KSI A;  4PPZ A;  1VGY A;  2PIY A;  3LMS A;  3RZA A;  5CBM A;  1VHO A;  3NH8 A;  2ZED A;  1ZG7 A;  3FEE A;  1AYE A;  1TKF A;  2Q43 A;  4R7M A;  1IY7 A;  2JEW A;  4C9R A;  2QJ8 A;  3IC1 A;  3NFZ A;  2C1C A;  1Z5R A;  4F8Z A;  1Z8L A;  2AFX A;  4PXB A;  4P4D A;  5HVF A;  2ABZ A;  3FH4 A;  4P4B A;  2EK8 A;  4F9V A;  2GP4 A;  5D8N A;  4R76 A;  2ZEG A;  3H8E A;  3S9N A;  3WC7 A;  2PRQ A;  2EWB A;  3RBU A;  3SI2 A;  3BI1 A;  1CP6 A;  2J9A A;  2V8V A;  3N5F A;  2QYV A;  4C9U A;  2V8D A;  1LCP A;  4DJL A;  4P4E A;  1XF1 A;  3CPA A;  5DS0 A;  3IFE A;  3KGQ A;  3SJG A;  4JZ0 A;  4P6Y A;  1LAP A;  4OIW A;  1WVM A;  4NGQ A;  4RUH A;  4YN3 A;  4MHN A;  4P4F A;  3PFE A;  4FUU A;  4FBE A;  3I6S A;  3CT9 A;  2PJ9 A;  2C6C A;  2PJ4 A;  2O53 A;  2C6P A;  2C5Q A;  3I74 A;  1F2O A;  4EME A;  2AFU A;  2WYR A;  1Y0R A;  4ZY1 A;  1R3N A;  5JM6 A;  2AFO A;  2GLF A;  2AFM A;  3VAR A;  1JQG A;  2POK A;  4YU9 A;  4EFD A;  3PFO A;  3MRU A;  1XFO A;  4EWT A;  4OID A;  1YW4 A;  1R43 A;  4KNG E;  3PRT A;  4OKO A;  1YW6 A;  2PJ1 A;  3IWW A;  4C8U A;  3CDX A;  2BOA A;  4W9Y A;  4NFR A;  3VAT A;  1PCA A;  4C84 A;  4OC2 A;  2VL1 A;  3SJF A;  4P4J A;  5J1Q A;  1CPX A;  2ZEN A;  1CPS A;  1BPN A;  3SJX A;  2ZEP A;  3D4U A;  3FJU A;  3FX6 A;  3KR4 A;  1CX8 A;  3VH9 A;  4O23 A;  2PJC A;  1F57 A;  2AFS A;  4PQA A;  4BD9 A;  5K8P A;  1BPM A;  3PB4 X;  5LRG A;  3KQX A;  1OBR A;  4DUK A;  4OME A;  2DEA A;  5LRJ A;  5HXD A;  4IAV A;  1V6C A;  1BAV A;  3NA6 A;  3KAS A;  3D68 A;  1Y9Z A;  1ZLI A;  1Y0Y A;  3V38 A;  3FMC A;  2PJ0 A;  4Z65 A;  1TKJ A;  2XEF A;  2Q4Z A;  4NGN A;  2FVG A;  4GM5 A;  2AFZ A;  4JYW A;  3CPX A;  1CG2 A;  4NJQ A;  4R6T A;  4G1P A;  1HEE A;  1IGB A;  2HB6 A;  3PEI A;  3D7F A;  3NH4 A;  2IJZ A;  3DGV A;  3GUX A;  2JBK A;  5CPA A;  4CPA A;  3KHX A;  2ZEE A;  4PXD A;  4TNU A;  1RTQ A;  5F09 A;  5ELY A;  3JRU A;  4C8P A;  4C86 A;  2RB7 A;  2RFH A;  3B2Y A;  2GLJ A;  4DYO A;  5JH9 A;  2WZN A;  1LAN A;  4C9V A;  4CDK A;  4ZYQ A;  2PJ5 A;  1XRY A;  1Q7L A;  2BO9 A;  3S9L A;  3K9T A;  1HDU A;  3KL9 A;  3QNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...