3BI1A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of methotrexate-glu
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bi1A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bi1A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bi1A02
4DJLA 3I74A 4NJQA 2XEIA 2PJ1A 3VARA 1CPXA 1JQGA 4P6YA 2HC9A 4OP4A 3NH5A 5CPAA 1LANA 2PVWA 2JEWA 3CPXA 3D68A 3FEDA 4MMOA 3SI1A 4BD9A 3PEIA 3WABA 2ZEMA 4DUKA 4NGSA 1TKFA 1FNOA 4C8TA 2POKA 2EWBA 1ARLA 2AFSA 2BOAA 4OC4A 4F8ZA 1PYTB 1Z5RA 4IAVA 2ZEGA 2I3CA 3TC8A 2WZNA 3B7IA 3FX6A 3NH8A 4MHZA 2IMOA 1H8LA 3K9TA 2CF4A 5K8OA 2CTCA 3PB9X 4CDJA 4CDKA 4MXUA 3IEHA 1LCPA 5HVGA 2AFUA 1DE4C 3IIBA 4MCRA 2Q4ZA 5F09A 3FEEA 4C9UA 3PRTA 2PJ6A 4O23A 3IFEA 3PB7X 5LYIA 1PCAA 3RBUA 2PJ9A 3GLJA 3KZWA 1Z8LA 2VL1A 4OKOA 3N5FA 2CIJA 3DLJA 4P4JA 2ZEHA 2RFHA 4C8FA 5ELYA 4OMEA 4GM5A 5K8NA 3FJUA 1CPSA 3NA6A 4P10A 2XEJA 1F57A 3PFOA 1VHOA 5LYFA 4KSIA 3CDXA 2RB7A 4C86A 2PJ4A 1HDQA 2QYVA 1QQ9A 1CP6A 4ZI6A 1YLOA 2O4HA 4LQGA 4PQAA 3QNVA 1ZLHA 4NFRA 4EFDA 1VIXA 3B3TA 3PB6X 1WVMA 2C6PA 2EK8A 3H8FA 4PXDA 1HEEA 5D29A 3LWUA 4MCPA 1LAMA 2WYRA 4R6TA 4P4FA 2IJZA 2OOTA 1YMEA 1XF1A 3IO1A 4ZY0A 4C9AA 3MRUA 1KWMA 1TF9A 4P4EA 2PJ3A 4NGMA 4P4BA 1FT7A 3KQXA 3I6SA 4CPAA 4IK2A 3VATA 4MHNA 3SJFA 2ZENA 2ZEDA 4OIWA 3B2YA 1HDUA 3S9NA 3ISZA 4MHPA 3KI9A 2ZELA 5I4MA 4C8UA 2G9DA 4NGQA 1IY7A 2XEFA 3H8GA 1LFWA 1OBRA 3SJGA 3KQZA 4FAIA 4C8PA 2ZEEA 1ELMP 4A39A 2AFXA 6CPAA 4R7MA 4X8IA 3SJXA 7CPAA 4NGPA 2IQ6A 3B35A 1BLLE 2C6GA 3CT9A 4F9VA 3MN8A 2C1CA 3NFZA 1VHEA 3BI1A 1LAPA 4C8AA 4PPZA 5K8PA 5K8MA 3KHXA 4C9RA 4WJBA 1QMUA 4WWVA 3SI0A 2PCUA 2J9AA 4ZYQA 3VH9A 2F8HA 3WC7A 1AYEA 3B3CA 1UWYA 3I1UA 4Q7AA 4OC3A 3KR4A 3PB8X 4FWUA 4RUHA 4FUUA 4FBEA 3NH4A 4A94A 3PFEA 3BXMA 1M4LA 4IHMA 1R3NA 4H2KA 3PB4X 3FH4A 2ANPA 2PRQA 4UEEA 3TX8A 4YU9A 5HVFA 3GUXA 2V77A 2AFOA 5LRGA 3IC1A 3H8EA 3VTAA 1YSJA 4TNUA 1DTDA 2QVPA 3FF3A 2PIYA 1YW4A 3WC5A 3V7ZA 8CPAA 3S9MA 4OC2A 5LYDA 1TXRA 2PJ0A 2BCOA 1Y0RA 4G1PA 3PBEA 2PJCA 4C9VA 1ZG9A 1RTQA 2GU2A 3D66A 4TWEA 4MCQA 4C84A 2GREA 4EWTA 3WT4A 4B6ZA 1V6CA 5LYLA 2V8DA 2Q43A 3DGVA 4ZX8A 1NSAA 4OC0A 3V38A 2GLJA 4PXCA 5JGFA 2AFWA 3KGQA 3D4UA 1Z2LA 4UIBA 5JM6A 4R8FA 4NJRA 4NGNA 1ELLP 2ZOFA 4MRIA 4ZX9A 2PE3A 2V8HA 2CTBA 4C9EA 4TJXA 4A38A 4P4IA 4UIAA 1ZG8A 4X2TA 2V8GA 3KL9A 1R43A 5THWA 1TF8A 5D8NA 3SJEA 3FMCA 3KASA 3D7FA 2PJ8A 5DS0A 3RAMA 4KNGE 3B3VA 3S9LA 4YN3A 4OC5A 4OIDA 2PJ5A 3CPAA 2NSMA 2PJ7A 2FVGA 4UEZA 3GB0A 4OC1A 4X3RA 3EIFA 3L2NA 5HVHA 5J1QA 2HB6A 1ZLIA 1F2OA 2C6CA 2QJ8A 4UEFA 1BPMA 1TKHA 3FVLA 4DYOA 1IGBA 1XBUA 4Z65A 1XMBA 4AXVA 3PBBA 1CX8A 5LRKA 3SI2A 4EMEA 1ZG7A 3WC6A 5JH9A 2DEAA 5HXDA 2ZEPA 4C85A 3HLPA 4F9UA 1GYTA 3IJ3A 2PJBA 3D7DA 1TKJA 4ONWA 4YWYA 4W9YA 2PVVA 2ZEOA 2JBJA 1EE3P 2ZEFA 3KHZA 5CBMA 3BI0A 3LMSA 4P4DA 2Q51A 1CBXA 2ABZA 3D7GA 3KR5A 4NGTA 4A37A 4JYWA 5LRJA 4P45A 4MCSA 4K3NA 1YW6A 4PXEA 2JBKA 3B3SA 3ICUA 1CP7A 2AFZA 4PXBA 2OR4A 5IB9A 1XFOA 1CG2A 4C99A 1VGYA 2BO9A 4JZ0A 1XJOA 2PIZA 4R76A 1AMPA 1ARMA 1Y0YA 3JRUA 2ZOGA 3IWWA 2V8VA 4C8CA 3D7HA 1LOKA 1F2PA 3K2KA 3RZAA 4NGRA 1BAVA 2AFMA 3ISXA 4TJVA 3D67A 2F7VA 2GLFA 2PJAA 3BHXA 1Y7EA 2NYQA 3FECA 1XRYA 2EK9A 4MHYA 2XEGA 3T8WA 1Y9ZA 4ZY2A 1BPNA 2PJ2A 4P44A 2O53A 3B3WA 4UF4A 3HUVA 1Q7LA 4ZY1A
chains in the Genus database with same CATH superfamily
2F5IA 4DJLA 3I74A 1P0HA 4NJQA 2XEIA 2PJ1A 2ZPAA 3VARA 1YVKA 3TLEA 1CPXA 1JQGA 4NEXA 4P6YA 4A33A 2HC9A 5HKYA 1VKCA 3S6HA 1NMTA 4R87A 4OP4A 3NH5A 5CPAA 1C3OB 1M1DA 1LANA 2PVWA 2JEWA 3CPXA 3D68A 3FEDA 4MMOA 4XPDB 1V0CA 2JDCA 5F47A 3SI1A 2I00A 3PEIA 1I1DA 2OB0A 4KSAA 2A4NA 2AJ6A 2ZEMA 3WABA 4NGSA 3TTHA 4B10A 4DUKA 4KZTA 3RYOA 1TKFA 4CYQA 3KRVA 1FNOA 4C8TA 1SQHA 1IICA 1KUXA 1S7FA 2OZHA 1M4IA 2EWBA 2POKA 4CRZB 1ARLA 4YRHA 2AFSA 2BOAA 2FM4A 4R9MA 3VWEA 4OC4A 4UA3A 3TLAA 4COGA 4F8ZA 1Z5RA 1PYTB 4F0XA 1KZFA 4IAVA 5AG7A 3TO7A 4KS9A 4U5YA 2ZEGA 3S6FA 5HMNA 3GIUA 3DNSA 2FSRA 2I3CA 4BMHA 4H1HA 3TC8A 2D4PA 2Z0ZA 2MP0A 2WZNA 2X7BA 3U1BA 4L89A 3PFVA 3B7IA 2EZAA 5AG5A 3O8ZA 2K5TA 5EC4A 1WJTA 3TLBA 2Q7SA 3FX6A 3NH8A 3H4QA 2D0OA 2R8VA 4M3SA 2R98A 4K30A 1Z4RA 3F5BA 2IMOA 4MHZA 1H8LA 2GE3A 2XPPA 2ZW7A 3K9TA 5HKWA 5H86A 2CF4A 5KTDA 1RXTA 4OLLA 1Z4EA 2B3UA 4MBUA 5K8OA 5ISVA 2VI7A 2OZGA 2CTCA 3PB9X 5CNPA 4CDJA 4C68A 4CDKA 5HKZA 3IEHA 1LCPA 4MXUA 4CYNA 5HVGA 2AFUA 1OZPA 5AXIA 1QSRA 1DE4C 4CRYB 3IIBA 4MCRA 4CS0B 2Q4ZA 3GKRA 3R95A 1VHSA 5F09A 3FEEA 2OZUA 3SXNA 4Q36A 4C9UA 3TLZA 2WUUA 3FYNA 4MFZA 2C5QA 3PRTA 2PJ6A 1Z8TA 4O23A 1R61A 1A9XB 4CGPA 2Z3MA 3IFEA 3VRPA 3PB7X 4PK3A 1LRZA 3NE8A 5LYIA 5A27A 1PCAA 1TIQA 4ORFA 3RBUA 2J8RA 3DR6A 3MGDA 3F8KA 3VWDA 4CGOA 3EZBA 2PJ9A 4E94A 5G22A 3OB2B 2CNSA 4H6UA 1KC7A 2DLAA 3GLJA 2ATRA 3KZWA 2PSWA 3PGPA 1Z8LA 2VL1A 3PZJA 4OKOA 3N5FA 4M6IA 2FIWA 2CIJA 2ZW6A 4XNHB 3DLJA 3EZAA 4P4JA 4CGNA 2ZEHA 3I3GA 2RFHA 2HROA 3GY9A 4MHDA 4C8FA 5ELYA 2Z3LA 4JJXA 4OMEA 4GM5A 5K8NA 2X0SA 1Z9EA 3FJUA 1CPSA 4Q38A 3NA6A 4MY3A 4P10A 2XEJA 3D2MA 1F57A 2ZW4A 1UFHA 1VHOA 3PFOA 3T9YA 3TO9A 4JXRA 4KSIA 3TOBA 5LYFA 3CDXA 3SR3A 1CJWA 2PC1A 1B87A 2BEIA 3EY5A 2RB7A 2Q04A 4C86A 2PJ4A 1Y9WA 1HDQA 2QYVA 1QQ9A 1CP6A 3U88C 4ZI6A 4XNHC 2EBJA 2G0BA 1YLOA 2ODFA 2O4HA 3QAHA 4LQGA 1ZO0A 2Z3KA 1RO5A 4PQAA 4YGOA 3QNVA 1ZLHA 3EFAA 4BBHA 3VROA 1ZRSA 4NFRA 4AVBA 3DDDA 4KOUA 4EFDA 1VIXA 1C30B 3B3TA 2JDDA 3V8IA 4C2YA 1J3LA 3PB6X 4KOTA 4A32A 4M8DA 1WVMA 2C6PA 3R1KA 2EK8A 4MFPA 3W6XA 4QBJA 3PLFB 5F5XA 4AB7A 3JVNA 4CGLA 3TO6A 3H8FA 4PXDA 1HEEA 2FE7A 1XOVA 5D29A 5F46A 3LWUA 3BUXB 4MCPA 4J0NA 2VBQA 1LAMA 2R82A 2WYRA 4R6TA 2DPTA 5F49A 4P4FA 2IJZA 4YFJA 4M85A 4A4CA 3JUWA 2PCNA 2OOTA 2REFA 3CXSA 1YMEA 3FIXA 4H89A 4J3GA 1XF1A 4BPWB 3BLNA 4AG7A 3IO1A 4CO9A 4ZY0A 4PV6A 3MRUA 1KWMA 4MFQA 2GP4A 1TF9A 3T07A 4C9AA 1EZBA 3N7ZA 4LQ6A 4P4EA 2CNMA 2PJ3A 4NGMA 4P4BA 1FT7A 4UCMA 4FD4A 3NE7A 5AGEA 1Y7RA 3TYXA 3FNCA 4E5SA 3KQXA 4GXHA 3I6SA 3CXPA 4IK2A 4CPAA 3VATA 3DSBA 3OWCA 3B8GA 4MFKA 4MHNA 3BJ8A 3SJFA 4LUAA 1CS0B 2ZENA 1IOIA 2ZEDA 3F9KC 4JD6A 4M6HA 5AG6A 2JEVA 3HMJG 4OIWA 4H6ZA 4EYSA 1XMTA 2B5GB 2Z3PA 3B2YA 3R9EA 1T36B 1HDUA 3S9NA 1MJBA 3ISZA 2G3TA 4MHPA 4UFWA 3DR8A 3KI9A 2ZELA 1BO4A 3TLCA 3BUMB 4KOWA 5I4MA 2G9DA 4C8UA 4NGQA 1IY7A 3CXQA 4CAVA 2XEFA 3H8GA 3NOJA 1WK4A 1ZL0A 1LFWA 1OBRA 3SJGA 3KQZA 1S3ZA 4QB9A 2OH1A 4KOYA 4XPKA 3NFQA 1M6VB 4FAIA 2Y1MA 4C8PA 1AUGA 2ZEEA 1ELMP 3IWEA 2BSWA 4A39A 2YJVA 2AFXA 3QB8A 1L0CA 2P0WA 2XPLA 5F13A 1BOBA 4R7MA 5G21A 1KUVA 2CY2A 3LODA 4CAEA 5JYBA 1WWZA 2Z3NA 1J4JA 2KCWA 1XF8A 3SJXA 4X5KA 4X8IA 4BPXB 2Z3OA 4NGPA 2IQ6A 2Y0MA 3JTKA 4KUBA 7CPAA 2EZCA 1GGOA 2Z11A 2Q4YA 3B35A 4AVAA 3VRNA 1BLLE 1IOFA 4QUSA 3HPGG 2C6GA 3CT9A 3R96A 4F9VA 1CE8B 4COBA 2VZYA 1Z8WA 1CM0A 1IYKA 2VEZA 1Y9KA 3P2FA 1YR0A 3MN8A 2C1CA 3K4IA 1M44A 3NFZA 1NBWA 1VHEA 3BI1A 2B4JC 1LAPA 4C8AA 4PPZA 4NCZA 5K8PA 5K8MA 3EC4A 3KHXA 4MI1A 4C9RA 4WJBA 1QMUA 4WWVA 3SI0A 5EMIA 5IB0A 4JVOA 2REEA 2PCUA 2J9AA 4ZYQA 2D0PA 2OLSA 3S6KA 3VH9A 3VRQA 2F8HA 2WPWA 1AYEA 2VQYA 3WC7A 4CGMA 4MJ8A 3HPHE 2FCKA 3B3CA 1UWYA 3I1UA 4Q7AA 4OC3A 1JWQA 2QIRA 3KR4A 3PB8X 4B11A 4CAWA 2DXQA 2FIAA 4FWUA 2YNCA 4MI4A 4RUHA 4FUUA 4FBEA 2QMLA 3NH4A 4A94A 2FT0A 3PFEA 3BXMA 1M4LA 2B4BA 1NE9A 4IHMA 4HNXB 1R3NA 4PSWA 4H2KA 2ZW5A 5J3XA 3FBUA 3PB4X 4B14A 3FH4A 3G8WA 2VKZG 3CZXA 3TCVA 2ANPA 3TE4A 4B12A 2AE6A 2PRQA 4UEEA 3OP0A 3TX8A 2I79A 4YU9A 5HVFA 1S7LA 3GUXA 4KVME 4ZBGA 1K4JA 2PRBA 5F48A 2C27A 1U6MA 2AFOA 2V77A 4JXQA 4OADA 4Y49C 3IC1A 5LRGA 3H8EA 3RNZA 4A30A 1NXJA 1VBGA 5F1YA 3VTAA 2VXKA 1YSJA 4TNUA 5F9MA 3EO4A 2YNDA 1DTDA 5JVLA 2UV8G 2QVPA 3FF3A 2YGWA 2D4OA 2PIYA 3UY5A 1YGHA 1FBVA 1YW4A 4UFXA 3IGRA 4UWJA 5DWMA 5FVJA 3TT2A 2ZXVA 3WC5A 4EVYA 5KTAA 4M6GA 4IIYA 4RN7A 4KORA 1YX0A 3A9LA 4R3KA 4XPLA 3V7ZA 8CPAA 4BINA 4ONUA 3ZZIA 1GHEA 3PP9A 4A4BA 3S9MA 5G1ZA 4CZ1A 3P2HA 4OC2A 5LYDA 1TXRA 2PJ0A 2EZBA 2BCOA 1Y0RA 4G1PA 4BPUB 3PBEA 3SHPA 4CAFA 4E8OA 2P6EA 1EO0A 3D8PA 3LACA 2PJCA 4OAEA 1ZG9A 4NF1A 3WR7A 4CYPA 4C9VA 1RTQA 3G3SA 2GU2A 3D66A 4TWEA 3T90A 5J8CA 4KVOE 3K9UA 4B5PA 5IX3A 4MCQA 2B0AA 2GREA 4UFVA 4C84A 4EWTA 3BJ7A 4KLWA 4QC6A 2PR8A 3WT4A 2Q0YA 1VBHA 4B6ZA 2HI6A 3W91A 1JDEA 3IU2A 1KBLA 2R7HA 4LX9A 1V6CA 5LYLA 3T05A 2YJTA 2YNEA 4GS4A 4GPLB 3IWGA 4MJXA 2V8DA 3BUNB 2Q43A 3DGVA 4ZX8A 2H5MA 3QAYA 3R9GA 1NSAA 4C2ZA 1JDBC 4BD9A 4OC0A 3V38A 2EO8A 2GLJA 4PXCA 5JGFA 2AFWA 3KGQA 3D4UA 1Z2LA 2YNCC 1KUYA 1IYLA 2QECA 2XPNA 4UIBA 4R8FA 3TOAA 4NJRA 4C7HA 5JM6A 5IR2A 4KUAA 4NGNA 1ELLP 4IIXA 3VRRA 1FY7A 2ZOFA 4MRIA 4KSFA 4UCNA 3VGOA 4ZX9A 1VI4A 2WSAA 2PR1A 2E28A 2PE3A 2V8HA 2CTBA 5BY0A 4FD7A 5C82A 4U9ZA 5E96A 4TJXA 1IB1E 4A38A 4C9EA 3BUWB 4P4IA 4UIAA 1XEBA 1ZG8A 1Q2CA 3GYAA 4X2TA 5EBVA 2V8GA 3KL9A 1R43A 2EUIA 4PK2A 3I9SA 1TF8A 5THWA 5D8NA 1S60A 3SJEA 1Q2YA 1YQEA 3FMCA 4B5OA 4B13A 3KASA 3D7FA 5BWAB 1XE4A 2PJ8A 1ON0A 5DS0A 3RAMA 1A2ZA 2BUEA 4KNGE 3TLYA 2AUNA 3D3SA 3B3VA 4RI1A 3RO0A 4UBRA 4B5PB 2ARHA 2R1IA 1IIDA 3S9LA 5JPHA 4YN3A 4OC5A 4OIDA 1PU9A 1R57A 1B47A 2PJ5A 3CPAA 2NSMA 2PJ7A 4F6AA 3BUOB 2FVGA 4HKFA 4KOVA 3TFYA 4UEZA 4XPDC 2BL1A 3GB0A 1BXRB 4OC1A 1I12A 2PDOA 3TLGA 2DPSA 2PQ8A 5FD8A 4X3RA 4R57A 3EIFA 3L2NA 4KOSA 4L8AA 5HVHA 5J8FA 4HPSA 5J1QA 3IU1A 2HB6A 1ZLIA 4KLVA 4MFJA 2FL4A 3OAKA 1F2OA 2C6CA 2QJ8A 4UEFA 4INJA 1NSLA 2FS5A 4FD6A 1BPMA 1TKHA 3FVLA 4DYOA 1P4NA 1S7KA 6CPAA 4RS2A 2CXAA 1IGBA 1X12A 1XBUA 1XMBA 3EXNA 4AXVA 4Z65A 4FD5A 5AG4A 3PBBA 4KVXA 4A95A 5I0CA 2B3VA 3F0AA 1CX8A 3FXTA 1S5KA 5LRKA 1Q5XA 3SI2A 2Y1NA 4EMEA 1ZG7A 4CAXA 3WC6A 5JH9A 2DEAA 5HXDA 2ZEPA 4C85A 3HLPA 4F9UA 2N3AB 1GYTA 3IJ3A 1YLEA 2PJBA 2FXFA 4A31A 3PT1A 3C8OA 3D7DA 1XIXA 1N71A 1MK4A 5C88A 3H5ZA 1TKJA 4ONWA 4YWYA 1MJAA 4U9YA 4Y49B 4RR2B 4W9YA 4AG9A 4AVCA 2P6FA 1PUAA 2PVVA 2O28A 2ZEOA 3S6GA 2JBJA 1EE3P 2ZEFA 4BTFA 3KHZA 1ZYMA 1QSMA 1QSTA 4MFLA 3T5MA 5CBMA 3BI0A 2Q44A 3E0KA 3LMSA 1S7NA 2B4DA 2VZZA 2XPOA 4I49A 4KOXA 5DWNA 4C2XA 3C26A 5GCNA 4C7IA 4P4DA 4JWPA 2Q51A 2Z10A 3EZEA 1CBXA 2ABZA 2DF5A 3GJZA 4A2ZA 3D7GA 3TLGB 2NMTA 3KR5A 4NGTA 4UWIA 4II9A 4F0YA 2CNTA 4JYWA 4A37A 5LRJA 4P45A 3ZJ0A 1Z9UA 3LD2A 4MCSA 4K3NA 1YW6A 4PXEA 2JBKA 1QSNA 3B3SA 1I21A 1M4GA 5HH1A 3G23A 4PSXA 1CP7A 3OB1B 4QVTA 3ICUA 2HQYA 2AFZA 4HNWB 4PXBA 4UCPA 4E0AA 2OR4A 5IB9A 2Q7BA 1YVHA 1IU8A 1XFOA 1CG2A 3KKWA 4JLYA 5KTCA 1VGYA 2BO9A 4C99A 2AUMA 4JZ0A 4NXYA 1XJOA 2PIZA 2EVNA 3D2PA 4R76A 4IF5A 2WPXA 3FB3A 4HNYB 1AMPA 3T0TA 1ARMA 1Y0YA 1Q2DA 3JRUA 2J8MA 4NSQA 4R3LA 4DNCA 2ZOGA 1Z8XA 3IWWA 2V8VA 2P6GA 1YK3A 1MJ9A 4C8CA 3D7HA 1LOKA 5K99A 2GIVA 4CYOA 1F2PA 2B5GA 3K2KA 3RZAA 4NGRA 1X10A 1QSOA 3R9FA 1BAVA 2AFMA 3ISXA 4TJVA 3D67A 1YREA 3FRMA 4E2AA 1DIKA 2F7VA 2GLFA 2PJAA 4IUSA 3ZNIA 3SXOA 3BHXA 2B58A 1KEEB 1Y7EA 2HUZA 2NYQA 2Q4VA 1EZAA 3FECA 1XRYA 2EK9A 4MHYA 2JLMA 2B4DB 2RC4A 2XEGA 4MY0A 5A28A 2CBLA 5G20A 3T8WA 2J8NA 2IL4A 4ZY2A 1Y9ZA 3W6SA 1BPNA 1B6BA 1YVOA 4ZGYB 2PJ2A 2HV2A 4P44A 2G3AA 2O53A 2OU2A 2GFQA 1M4DA 5JQ4A 2HWGA 3B3WA 4UF4A 3HUVA 5H84A 1Q7LA 4ZY1A 2DIKA 2GANA 5IV0A
chains in the Genus database with same CATH topology
4DJLA 3I74A 4NJQA 2XEIA 2PJ1A 3VARA 1CPXA 1JQGA 4P6YA 2HC9A 4OP4A 3NH5A 5CPAA 1LANA 2PVWA 2JEWA 3CPXA 3D68A 3FEDA 4MMOA 3SI1A 4BD9A 3PEIA 3WABA 2ZEMA 4DUKA 4NGSA 1TKFA 1FNOA 4C8TA 2POKA 2EWBA 1ARLA 2AFSA 2BOAA 4OC4A 4F8ZA 1PYTB 1Z5RA 4IAVA 2ZEGA 2I3CA 3TC8A 2WZNA 3B7IA 3FX6A 3NH8A 4MHZA 2IMOA 1H8LA 3K9TA 2CF4A 5K8OA 2CTCA 3PB9X 4CDJA 4CDKA 4MXUA 3IEHA 1LCPA 5HVGA 2AFUA 1DE4C 3IIBA 4MCRA 2Q4ZA 5F09A 3FEEA 4C9UA 2C5QA 3PRTA 2PJ6A 4O23A 3IFEA 3PB7X 5LYIA 1PCAA 3RBUA 2PJ9A 3GLJA 3KZWA 1Z8LA 2VL1A 4OKOA 3N5FA 2CIJA 3DLJA 4P4JA 2ZEHA 2RFHA 4C8FA 5ELYA 4OMEA 4GM5A 5K8NA 3FJUA 1CPSA 3NA6A 4P10A 2XEJA 1F57A 3PFOA 1VHOA 5LYFA 4KSIA 3CDXA 2RB7A 4C86A 2PJ4A 1HDQA 2QYVA 1QQ9A 1CP6A 4ZI6A 1YLOA 2O4HA 4LQGA 4PQAA 3QNVA 1ZLHA 4NFRA 4EFDA 1VIXA 3B3TA 3PB6X 1WVMA 2C6PA 2EK8A 3H8FA 4PXDA 1HEEA 5D29A 3LWUA 4MCPA 1LAMA 2WYRA 4R6TA 4P4FA 2IJZA 2OOTA 1YMEA 1XF1A 3IO1A 4ZY0A 4C9AA 3MRUA 1KWMA 2GP4A 1TF9A 4P4EA 2PJ3A 4NGMA 4P4BA 1FT7A 3KQXA 3I6SA 4CPAA 4IK2A 3VATA 4MHNA 3SJFA 2ZENA 2ZEDA 4OIWA 3B2YA 1HDUA 3S9NA 3ISZA 4MHPA 3KI9A 2ZELA 5I4MA 4C8UA 2G9DA 4NGQA 1IY7A 2XEFA 3H8GA 1LFWA 1OBRA 3SJGA 3KQZA 4FAIA 4C8PA 2ZEEA 1ELMP 4A39A 2AFXA 6CPAA 4R7MA 4X8IA 3SJXA 7CPAA 4NGPA 2IQ6A 3B35A 1BLLE 2C6GA 3CT9A 4F9VA 3MN8A 2C1CA 3NFZA 1VHEA 3BI1A 1LAPA 4C8AA 4PPZA 5K8PA 5K8MA 3KHXA 4C9RA 4WJBA 1QMUA 4WWVA 3SI0A 2PCUA 2J9AA 4ZYQA 3VH9A 2F8HA 3WC7A 1AYEA 3B3CA 1UWYA 3I1UA 4Q7AA 4OC3A 3KR4A 3PB8X 4FWUA 4RUHA 4FUUA 4FBEA 3NH4A 4A94A 3PFEA 3BXMA 1M4LA 4IHMA 1R3NA 4H2KA 3PB4X 3FH4A 2ANPA 2PRQA 4UEEA 3TX8A 4YU9A 5HVFA 3GUXA 2V77A 2AFOA 5LRGA 3IC1A 3H8EA 3VTAA 1YSJA 4TNUA 1DTDA 2QVPA 3FF3A 2PIYA 1YW4A 3WC5A 3V7ZA 8CPAA 3S9MA 4OC2A 5LYDA 1TXRA 2PJ0A 2BCOA 1Y0RA 4G1PA 3PBEA 2PJCA 4C9VA 1ZG9A 1RTQA 2GU2A 3D66A 4TWEA 4MCQA 4C84A 2GREA 4EWTA 3WT4A 4B6ZA 1V6CA 5LYLA 2V8DA 2Q43A 3DGVA 4ZX8A 1NSAA 4OC0A 3V38A 2GLJA 4PXCA 5JGFA 2AFWA 3KGQA 3D4UA 1Z2LA 4UIBA 5JM6A 4R8FA 5IR2A 4NJRA 4NGNA 1ELLP 2ZOFA 4MRIA 4ZX9A 2PE3A 2V8HA 2CTBA 4C9EA 4TJXA 4A38A 4P4IA 4UIAA 1ZG8A 4X2TA 2V8GA 3KL9A 1R43A 5THWA 1TF8A 5D8NA 3SJEA 3FMCA 3KASA 3D7FA 2PJ8A 5DS0A 3RAMA 4KNGE 3B3VA 3S9LA 4YN3A 4OC5A 4OIDA 2PJ5A 3CPAA 2NSMA 2PJ7A 2FVGA 4UEZA 3GB0A 4OC1A 4X3RA 3EIFA 3L2NA 5HVHA 5J1QA 2HB6A 1ZLIA 1F2OA 2C6CA 2QJ8A 4UEFA 1BPMA 1TKHA 3FVLA 4DYOA 1IGBA 1XBUA 4Z65A 1XMBA 4AXVA 3PBBA 1CX8A 5LRKA 3SI2A 4EMEA 1ZG7A 3WC6A 5JH9A 2DEAA 5HXDA 2ZEPA 4C85A 3HLPA 4F9UA 1GYTA 3IJ3A 2PJBA 3D7DA 1TKJA 4ONWA 4YWYA 4W9YA 2PVVA 2ZEOA 2JBJA 1EE3P 2ZEFA 3KHZA 5CBMA 3BI0A 3LMSA 4P4DA 2Q51A 1CBXA 2ABZA 3D7GA 3KR5A 4NGTA 4A37A 4JYWA 5LRJA 4P45A 4MCSA 4K3NA 1YW6A 4PXEA 2JBKA 3B3SA 3ICUA 1CP7A 2AFZA 4PXBA 2OR4A 5IB9A 1XFOA 1CG2A 4C99A 1VGYA 2BO9A 4JZ0A 1XJOA 2PIZA 4R76A 1AMPA 1ARMA 1Y0YA 3JRUA 2ZOGA 3IWWA 2V8VA 4C8CA 3D7HA 1LOKA 1F2PA 3K2KA 3RZAA 4NGRA 1BAVA 2AFMA 3ISXA 4TJVA 3D67A 2F7VA 2GLFA 2PJAA 3BHXA 1Y7EA 2NYQA 3FECA 1XRYA 2EK9A 4MHYA 2XEGA 3T8WA 1Y9ZA 4ZY2A 1BPNA 2PJ2A 4P44A 2O53A 3B3WA 4UF4A 3HUVA 1Q7LA 4ZY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DJL A;  3I74 A;  4NJQ A;  2XEI A;  2PJ1 A;  3VAR A;  1CPX A;  1JQG A;  4P6Y A;  2HC9 A;  4OP4 A;  3NH5 A;  5CPA A;  1LAN A;  2PVW A;  2JEW A;  3CPX A;  3D68 A;  3FED A;  4MMO A;  3SI1 A;  4BD9 A;  3PEI A;  3WAB A;  2ZEM A;  4DUK A;  4NGS A;  1TKF A;  1FNO A;  4C8T A;  2POK A;  2EWB A;  1ARL A;  2AFS A;  2BOA A;  4OC4 A;  4F8Z A;  1PYT B;  1Z5R A;  4IAV A;  2ZEG A;  2I3C A;  3TC8 A;  2WZN A;  3B7I A;  3FX6 A;  3NH8 A;  4MHZ A;  2IMO A;  1H8L A;  3K9T A;  2CF4 A;  5K8O A;  2CTC A;  3PB9 X;  4CDJ A;  4CDK A;  4MXU A;  3IEH A;  1LCP A;  5HVG A;  2AFU A;  1DE4 C;  3IIB A;  4MCR A;  2Q4Z A;  5F09 A;  3FEE A;  4C9U A;  3PRT A;  2PJ6 A;  4O23 A;  3IFE A;  3PB7 X;  5LYI A;  1PCA A;  3RBU A;  2PJ9 A;  3GLJ A;  3KZW A;  1Z8L A;  2VL1 A;  4OKO A;  3N5F A;  2CIJ A;  3DLJ A;  4P4J A;  2ZEH A;  2RFH A;  4C8F A;  5ELY A;  4OME A;  4GM5 A;  5K8N A;  3FJU A;  1CPS A;  3NA6 A;  4P10 A;  2XEJ A;  1F57 A;  3PFO A;  1VHO A;  5LYF A;  4KSI A;  3CDX A;  2RB7 A;  4C86 A;  2PJ4 A;  1HDQ A;  2QYV A;  1QQ9 A;  1CP6 A;  4ZI6 A;  1YLO A;  2O4H A;  4LQG A;  4PQA A;  3QNV A;  1ZLH A;  4NFR A;  4EFD A;  1VIX A;  3B3T A;  3PB6 X;  1WVM A;  2C6P A;  2EK8 A;  3H8F A;  4PXD A;  1HEE A;  5D29 A;  3LWU A;  4MCP A;  1LAM A;  2WYR A;  4R6T A;  4P4F A;  2IJZ A;  2OOT A;  1YME A;  1XF1 A;  3IO1 A;  4ZY0 A;  4C9A A;  3MRU A;  1KWM A;  1TF9 A;  4P4E A;  2PJ3 A;  4NGM A;  4P4B A;  1FT7 A;  3KQX A;  3I6S A;  4CPA A;  4IK2 A;  3VAT A;  4MHN A;  3SJF A;  2ZEN A;  2ZED A;  4OIW A;  3B2Y A;  1HDU A;  3S9N A;  3ISZ A;  4MHP A;  3KI9 A;  2ZEL A;  5I4M A;  4C8U A;  2G9D A;  4NGQ A;  1IY7 A;  2XEF A;  3H8G A;  1LFW A;  1OBR A;  3SJG A;  3KQZ A;  4FAI A;  4C8P A;  2ZEE A;  1ELM P;  4A39 A;  2AFX A;  6CPA A;  4R7M A;  4X8I A;  3SJX A;  7CPA A;  4NGP A;  2IQ6 A;  3B35 A;  1BLL E;  2C6G A;  3CT9 A;  4F9V A;  3MN8 A;  2C1C A;  3NFZ A;  1VHE A;  3BI1 A;  1LAP A;  4C8A A;  4PPZ A;  5K8P A;  5K8M A;  3KHX A;  4C9R A;  4WJB A;  1QMU A;  4WWV A;  3SI0 A;  2PCU A;  2J9A A;  4ZYQ A;  3VH9 A;  2F8H A;  3WC7 A;  1AYE A;  3B3C A;  1UWY A;  3I1U A;  4Q7A A;  4OC3 A;  3KR4 A;  3PB8 X;  4FWU A;  4RUH A;  4FUU A;  4FBE A;  3NH4 A;  4A94 A;  3PFE A;  3BXM A;  1M4L A;  4IHM A;  1R3N A;  4H2K A;  3PB4 X;  3FH4 A;  2ANP A;  2PRQ A;  4UEE A;  3TX8 A;  4YU9 A;  5HVF A;  3GUX A;  2V77 A;  2AFO A;  5LRG A;  3IC1 A;  3H8E A;  3VTA A;  1YSJ A;  4TNU A;  1DTD A;  2QVP A;  3FF3 A;  2PIY A;  1YW4 A;  3WC5 A;  3V7Z A;  8CPA A;  3S9M A;  4OC2 A;  5LYD A;  1TXR A;  2PJ0 A;  2BCO A;  1Y0R A;  4G1P A;  3PBE A;  2PJC A;  4C9V A;  1ZG9 A;  1RTQ A;  2GU2 A;  3D66 A;  4TWE A;  4MCQ A;  4C84 A;  2GRE A;  4EWT A;  3WT4 A;  4B6Z A;  1V6C A;  5LYL A;  2V8D A;  2Q43 A;  3DGV A;  4ZX8 A;  1NSA A;  4OC0 A;  3V38 A;  2GLJ A;  4PXC A;  5JGF A;  2AFW A;  3KGQ A;  3D4U A;  1Z2L A;  4UIB A;  5JM6 A;  4R8F A;  4NJR A;  4NGN A;  1ELL P;  2ZOF A;  4MRI A;  4ZX9 A;  2PE3 A;  2V8H A;  2CTB A;  4C9E A;  4TJX A;  4A38 A;  4P4I A;  4UIA A;  1ZG8 A;  4X2T A;  2V8G A;  3KL9 A;  1R43 A;  5THW A;  1TF8 A;  5D8N A;  3SJE A;  3FMC A;  3KAS A;  3D7F A;  2PJ8 A;  5DS0 A;  3RAM A;  4KNG E;  3B3V A;  3S9L A;  4YN3 A;  4OC5 A;  4OID A;  2PJ5 A;  3CPA A;  2NSM A;  2PJ7 A;  2FVG A;  4UEZ A;  3GB0 A;  4OC1 A;  4X3R A;  3EIF A;  3L2N A;  5HVH A;  5J1Q A;  2HB6 A;  1ZLI A;  1F2O A;  2C6C A;  2QJ8 A;  4UEF A;  1BPM A;  1TKH A;  3FVL A;  4DYO A;  1IGB A;  1XBU A;  4Z65 A;  1XMB A;  4AXV A;  3PBB A;  1CX8 A;  5LRK A;  3SI2 A;  4EME A;  1ZG7 A;  3WC6 A;  5JH9 A;  2DEA A;  5HXD A;  2ZEP A;  4C85 A;  3HLP A;  4F9U A;  1GYT A;  3IJ3 A;  2PJB A;  3D7D A;  1TKJ A;  4ONW A;  4YWY A;  4W9Y A;  2PVV A;  2ZEO A;  2JBJ A;  1EE3 P;  2ZEF A;  3KHZ A;  5CBM A;  3BI0 A;  3LMS A;  4P4D A;  2Q51 A;  1CBX A;  2ABZ A;  3D7G A;  3KR5 A;  4NGT A;  4A37 A;  4JYW A;  5LRJ A;  4P45 A;  4MCS A;  4K3N A;  1YW6 A;  4PXE A;  2JBK A;  3B3S A;  3ICU A;  1CP7 A;  2AFZ A;  4PXB A;  2OR4 A;  5IB9 A;  1XFO A;  1CG2 A;  4C99 A;  1VGY A;  2BO9 A;  4JZ0 A;  1XJO A;  2PIZ A;  4R76 A;  1AMP A;  1ARM A;  1Y0Y A;  3JRU A;  2ZOG A;  3IWW A;  2V8V A;  4C8C A;  3D7H A;  1LOK A;  1F2P A;  3K2K A;  3RZA A;  4NGR A;  1BAV A;  2AFM A;  3ISX A;  4TJV A;  3D67 A;  2F7V A;  2GLF A;  2PJA A;  3BHX A;  1Y7E A;  2NYQ A;  3FEC A;  1XRY A;  2EK9 A;  4MHY A;  2XEG A;  3T8W A;  1Y9Z A;  4ZY2 A;  1BPN A;  2PJ2 A;  4P44 A;  2O53 A;  3B3W A;  4UF4 A;  3HUV A;  1Q7L A;  4ZY1 A; 
#chains in the Genus database with same CATH topology
 2F5I A;  4DJL A;  3I74 A;  1P0H A;  4NJQ A;  2XEI A;  2PJ1 A;  2ZPA A;  3VAR A;  1YVK A;  3TLE A;  1CPX A;  1JQG A;  4NEX A;  4P6Y A;  4A33 A;  2HC9 A;  5HKY A;  1VKC A;  3S6H A;  1NMT A;  4R87 A;  4OP4 A;  3NH5 A;  5CPA A;  1C3O B;  1M1D A;  1LAN A;  2PVW A;  2JEW A;  3CPX A;  3D68 A;  3FED A;  4MMO A;  4XPD B;  1V0C A;  2JDC A;  5F47 A;  3SI1 A;  2I00 A;  3PEI A;  1I1D A;  2OB0 A;  4KSA A;  2A4N A;  2AJ6 A;  2ZEM A;  3WAB A;  4NGS A;  3TTH A;  4B10 A;  4DUK A;  4KZT A;  3RYO A;  1TKF A;  4CYQ A;  3KRV A;  1FNO A;  4C8T A;  1SQH A;  1IIC A;  1KUX A;  1S7F A;  2OZH A;  1M4I A;  2EWB A;  2POK A;  4CRZ B;  1ARL A;  4YRH A;  2AFS A;  2BOA A;  2FM4 A;  4R9M A;  3VWE A;  4OC4 A;  4UA3 A;  3TLA A;  4COG A;  4F8Z A;  1Z5R A;  1PYT B;  4F0X A;  1KZF A;  4IAV A;  5AG7 A;  3TO7 A;  4KS9 A;  4U5Y A;  2ZEG A;  3S6F A;  5HMN A;  3GIU A;  3DNS A;  2FSR A;  2I3C A;  4BMH A;  4H1H A;  3TC8 A;  2D4P A;  2Z0Z A;  2MP0 A;  2WZN A;  2X7B A;  3U1B A;  4L89 A;  3PFV A;  3B7I A;  2EZA A;  5AG5 A;  3O8Z A;  2K5T A;  5EC4 A;  1WJT A;  3TLB A;  2Q7S A;  3FX6 A;  3NH8 A;  3H4Q A;  2D0O A;  2R8V A;  4M3S A;  2R98 A;  4K30 A;  1Z4R A;  3F5B A;  2IMO A;  4MHZ A;  1H8L A;  2GE3 A;  2XPP A;  2ZW7 A;  3K9T A;  5HKW A;  5H86 A;  2CF4 A;  5KTD A;  1RXT A;  4OLL A;  1Z4E A;  2B3U A;  4MBU A;  5K8O A;  5ISV A;  2VI7 A;  2OZG A;  2CTC A;  3PB9 X;  5CNP A;  4CDJ A;  4C68 A;  4CDK A;  5HKZ A;  3IEH A;  1LCP A;  4MXU A;  4CYN A;  5HVG A;  2AFU A;  1OZP A;  5AXI A;  1QSR A;  1DE4 C;  4CRY B;  3IIB A;  4MCR A;  4CS0 B;  2Q4Z A;  3GKR A;  3R95 A;  1VHS A;  5F09 A;  3FEE A;  2OZU A;  3SXN A;  4Q36 A;  4C9U A;  3TLZ A;  2WUU A;  3FYN A;  4MFZ A;  2C5Q A;  3PRT A;  2PJ6 A;  1Z8T A;  4O23 A;  1R61 A;  1A9X B;  4CGP A;  2Z3M A;  3IFE A;  3VRP A;  3PB7 X;  4PK3 A;  1LRZ A;  3NE8 A;  5LYI A;  5A27 A;  1PCA A;  1TIQ A;  4ORF A;  3RBU A;  2J8R A;  3DR6 A;  3MGD A;  3F8K A;  3VWD A;  4CGO A;  3EZB A;  2PJ9 A;  4E94 A;  5G22 A;  3OB2 B;  2CNS A;  4H6U A;  1KC7 A;  2DLA A;  3GLJ A;  2ATR A;  3KZW A;  2PSW A;  3PGP A;  1Z8L A;  2VL1 A;  3PZJ A;  4OKO A;  3N5F A;  4M6I A;  2FIW A;  2CIJ A;  2ZW6 A;  4XNH B;  3DLJ A;  3EZA A;  4P4J A;  4CGN A;  2ZEH A;  3I3G A;  2RFH A;  2HRO A;  3GY9 A;  4MHD A;  4C8F A;  5ELY A;  2Z3L A;  4JJX A;  4OME A;  4GM5 A;  5K8N A;  2X0S A;  1Z9E A;  3FJU A;  1CPS A;  4Q38 A;  3NA6 A;  4MY3 A;  4P10 A;  2XEJ A;  3D2M A;  1F57 A;  2ZW4 A;  1UFH A;  1VHO A;  3PFO A;  3T9Y A;  3TO9 A;  4JXR A;  4KSI A;  3TOB A;  5LYF A;  3CDX A;  3SR3 A;  1CJW A;  2PC1 A;  1B87 A;  2BEI A;  3EY5 A;  2RB7 A;  2Q04 A;  4C86 A;  2PJ4 A;  1Y9W A;  1HDQ A;  2QYV A;  1QQ9 A;  1CP6 A;  3U88 C;  4ZI6 A;  4XNH C;  2EBJ A;  2G0B A;  1YLO A;  2ODF A;  2O4H A;  3QAH A;  4LQG A;  1ZO0 A;  2Z3K A;  1RO5 A;  4PQA A;  4YGO A;  3QNV A;  1ZLH A;  3EFA A;  4BBH A;  3VRO A;  1ZRS A;  4NFR A;  4AVB A;  3DDD A;  4KOU A;  4EFD A;  1VIX A;  1C30 B;  3B3T A;  2JDD A;  3V8I A;  4C2Y A;  1J3L A;  3PB6 X;  4KOT A;  4A32 A;  4M8D A;  1WVM A;  2C6P A;  3R1K A;  2EK8 A;  4MFP A;  3W6X A;  4QBJ A;  3PLF B;  5F5X A;  4AB7 A;  3JVN A;  4CGL A;  3TO6 A;  3H8F A;  4PXD A;  1HEE A;  2FE7 A;  1XOV A;  5D29 A;  5F46 A;  3LWU A;  3BUX B;  4MCP A;  4J0N A;  2VBQ A;  1LAM A;  2R82 A;  2WYR A;  4R6T A;  2DPT A;  5F49 A;  4P4F A;  2IJZ A;  4YFJ A;  4M85 A;  4A4C A;  3JUW A;  2PCN A;  2OOT A;  2REF A;  3CXS A;  1YME A;  3FIX A;  4H89 A;  4J3G A;  1XF1 A;  4BPW B;  3BLN A;  4AG7 A;  3IO1 A;  4CO9 A;  4ZY0 A;  4PV6 A;  3MRU A;  1KWM A;  4MFQ A;  2GP4 A;  1TF9 A;  3T07 A;  4C9A A;  1EZB A;  3N7Z A;  4LQ6 A;  4P4E A;  2CNM A;  2PJ3 A;  4NGM A;  4P4B A;  1FT7 A;  4UCM A;  4FD4 A;  3NE7 A;  5AGE A;  1Y7R A;  3TYX A;  3FNC A;  4E5S A;  3KQX A;  4GXH A;  3I6S A;  3CXP A;  4IK2 A;  4CPA A;  3VAT A;  3DSB A;  3OWC A;  3B8G A;  4MFK A;  4MHN A;  3BJ8 A;  3SJF A;  4LUA A;  1CS0 B;  2ZEN A;  1IOI A;  2ZED A;  3F9K C;  4JD6 A;  4M6H A;  5AG6 A;  2JEV A;  3HMJ G;  4OIW A;  4H6Z A;  4EYS A;  1XMT A;  2B5G B;  2Z3P A;  3B2Y A;  3R9E A;  1T36 B;  1HDU A;  3S9N A;  1MJB A;  3ISZ A;  2G3T A;  4MHP A;  4UFW A;  3DR8 A;  3KI9 A;  2ZEL A;  1BO4 A;  3TLC A;  3BUM B;  4KOW A;  5I4M A;  2G9D A;  4C8U A;  4NGQ A;  1IY7 A;  3CXQ A;  4CAV A;  2XEF A;  3H8G A;  3NOJ A;  1WK4 A;  1ZL0 A;  1LFW A;  1OBR A;  3SJG A;  3KQZ A;  1S3Z A;  4QB9 A;  2OH1 A;  4KOY A;  4XPK A;  3NFQ A;  1M6V B;  4FAI A;  2Y1M A;  4C8P A;  1AUG A;  2ZEE A;  1ELM P;  3IWE A;  2BSW A;  4A39 A;  2YJV A;  2AFX A;  3QB8 A;  1L0C A;  2P0W A;  2XPL A;  5F13 A;  1BOB A;  4R7M A;  5G21 A;  1KUV A;  2CY2 A;  3LOD A;  4CAE A;  5JYB A;  1WWZ A;  2Z3N A;  1J4J A;  2KCW A;  1XF8 A;  3SJX A;  4X5K A;  4X8I A;  4BPX B;  2Z3O A;  4NGP A;  2IQ6 A;  2Y0M A;  3JTK A;  4KUB A;  7CPA A;  2EZC A;  1GGO A;  2Z11 A;  2Q4Y A;  3B35 A;  4AVA A;  3VRN A;  1BLL E;  1IOF A;  4QUS A;  3HPG G;  2C6G A;  3CT9 A;  3R96 A;  4F9V A;  1CE8 B;  4COB A;  2VZY A;  1Z8W A;  1CM0 A;  1IYK A;  2VEZ A;  1Y9K A;  3P2F A;  1YR0 A;  3MN8 A;  2C1C A;  3K4I A;  1M44 A;  3NFZ A;  1NBW A;  1VHE A;  3BI1 A;  2B4J C;  1LAP A;  4C8A A;  4PPZ A;  4NCZ A;  5K8P A;  5K8M A;  3EC4 A;  3KHX A;  4MI1 A;  4C9R A;  4WJB A;  1QMU A;  4WWV A;  3SI0 A;  5EMI A;  5IB0 A;  4JVO A;  2REE A;  2PCU A;  2J9A A;  4ZYQ A;  2D0P A;  2OLS A;  3S6K A;  3VH9 A;  3VRQ A;  2F8H A;  2WPW A;  1AYE A;  2VQY A;  3WC7 A;  4CGM A;  4MJ8 A;  3HPH E;  2FCK A;  3B3C A;  1UWY A;  3I1U A;  4Q7A A;  4OC3 A;  1JWQ A;  2QIR A;  3KR4 A;  3PB8 X;  4B11 A;  4CAW A;  2DXQ A;  2FIA A;  4FWU A;  2YNC A;  4MI4 A;  4RUH A;  4FUU A;  4FBE A;  2QML A;  3NH4 A;  4A94 A;  2FT0 A;  3PFE A;  3BXM A;  1M4L A;  2B4B A;  1NE9 A;  4IHM A;  4HNX B;  1R3N A;  4PSW A;  4H2K A;  2ZW5 A;  5J3X A;  3FBU A;  3PB4 X;  4B14 A;  3FH4 A;  3G8W A;  2VKZ G;  3CZX A;  3TCV A;  2ANP A;  3TE4 A;  4B12 A;  2AE6 A;  2PRQ A;  4UEE A;  3OP0 A;  3TX8 A;  2I79 A;  4YU9 A;  5HVF A;  1S7L A;  3GUX A;  4KVM E;  4ZBG A;  1K4J A;  2PRB A;  5F48 A;  2C27 A;  1U6M A;  2AFO A;  2V77 A;  4JXQ A;  4OAD A;  4Y49 C;  3IC1 A;  5LRG A;  3H8E A;  3RNZ A;  4A30 A;  1NXJ A;  1VBG A;  5F1Y A;  3VTA A;  2VXK A;  1YSJ A;  4TNU A;  5F9M A;  3EO4 A;  2YND A;  1DTD A;  5JVL A;  2UV8 G;  2QVP A;  3FF3 A;  2YGW A;  2D4O A;  2PIY A;  3UY5 A;  1YGH A;  1FBV A;  1YW4 A;  4UFX A;  3IGR A;  4UWJ A;  5DWM A;  5FVJ A;  3TT2 A;  2ZXV A;  3WC5 A;  4EVY A;  5KTA A;  4M6G A;  4IIY A;  4RN7 A;  4KOR A;  1YX0 A;  3A9L A;  4R3K A;  4XPL A;  3V7Z A;  8CPA A;  4BIN A;  4ONU A;  3ZZI A;  1GHE A;  3PP9 A;  4A4B A;  3S9M A;  5G1Z A;  4CZ1 A;  3P2H A;  4OC2 A;  5LYD A;  1TXR A;  2PJ0 A;  2EZB A;  2BCO A;  1Y0R A;  4G1P A;  4BPU B;  3PBE A;  3SHP A;  4CAF A;  4E8O A;  2P6E A;  1EO0 A;  3D8P A;  3LAC A;  2PJC A;  4OAE A;  1ZG9 A;  4NF1 A;  3WR7 A;  4CYP A;  4C9V A;  1RTQ A;  3G3S A;  2GU2 A;  3D66 A;  4TWE A;  3T90 A;  5J8C A;  4KVO E;  3K9U A;  4B5P A;  5IX3 A;  4MCQ A;  2B0A A;  2GRE A;  4UFV A;  4C84 A;  4EWT A;  3BJ7 A;  4KLW A;  4QC6 A;  2PR8 A;  3WT4 A;  2Q0Y A;  1VBH A;  4B6Z A;  2HI6 A;  3W91 A;  1JDE A;  3IU2 A;  1KBL A;  2R7H A;  4LX9 A;  1V6C A;  5LYL A;  3T05 A;  2YJT A;  2YNE A;  4GS4 A;  4GPL B;  3IWG A;  4MJX A;  2V8D A;  3BUN B;  2Q43 A;  3DGV A;  4ZX8 A;  2H5M A;  3QAY A;  3R9G A;  1NSA A;  4C2Z A;  1JDB C;  4BD9 A;  4OC0 A;  3V38 A;  2EO8 A;  2GLJ A;  4PXC A;  5JGF A;  2AFW A;  3KGQ A;  3D4U A;  1Z2L A;  2YNC C;  1KUY A;  1IYL A;  2QEC A;  2XPN A;  4UIB A;  4R8F A;  3TOA A;  4NJR A;  4C7H A;  5JM6 A;  5IR2 A;  4KUA A;  4NGN A;  1ELL P;  4IIX A;  3VRR A;  1FY7 A;  2ZOF A;  4MRI A;  4KSF A;  4UCN A;  3VGO A;  4ZX9 A;  1VI4 A;  2WSA A;  2PR1 A;  2E28 A;  2PE3 A;  2V8H A;  2CTB A;  5BY0 A;  4FD7 A;  5C82 A;  4U9Z A;  5E96 A;  4TJX A;  1IB1 E;  4A38 A;  4C9E A;  3BUW B;  4P4I A;  4UIA A;  1XEB A;  1ZG8 A;  1Q2C A;  3GYA A;  4X2T A;  5EBV A;  2V8G A;  3KL9 A;  1R43 A;  2EUI A;  4PK2 A;  3I9S A;  1TF8 A;  5THW A;  5D8N A;  1S60 A;  3SJE A;  1Q2Y A;  1YQE A;  3FMC A;  4B5O A;  4B13 A;  3KAS A;  3D7F A;  5BWA B;  1XE4 A;  2PJ8 A;  1ON0 A;  5DS0 A;  3RAM A;  1A2Z A;  2BUE A;  4KNG E;  3TLY A;  2AUN A;  3D3S A;  3B3V A;  4RI1 A;  3RO0 A;  4UBR A;  4B5P B;  2ARH A;  2R1I A;  1IID A;  3S9L A;  5JPH A;  4YN3 A;  4OC5 A;  4OID A;  1PU9 A;  1R57 A;  1B47 A;  2PJ5 A;  3CPA A;  2NSM A;  2PJ7 A;  4F6A A;  3BUO B;  2FVG A;  4HKF A;  4KOV A;  3TFY A;  4UEZ A;  4XPD C;  2BL1 A;  3GB0 A;  1BXR B;  4OC1 A;  1I12 A;  2PDO A;  3TLG A;  2DPS A;  2PQ8 A;  5FD8 A;  4X3R A;  4R57 A;  3EIF A;  3L2N A;  4KOS A;  4L8A A;  5HVH A;  5J8F A;  4HPS A;  5J1Q A;  3IU1 A;  2HB6 A;  1ZLI A;  4KLV A;  4MFJ A;  2FL4 A;  3OAK A;  1F2O A;  2C6C A;  2QJ8 A;  4UEF A;  4INJ A;  1NSL A;  2FS5 A;  4FD6 A;  1BPM A;  1TKH A;  3FVL A;  4DYO A;  1P4N A;  1S7K A;  6CPA A;  4RS2 A;  2CXA A;  1IGB A;  1X12 A;  1XBU A;  1XMB A;  3EXN A;  4AXV A;  4Z65 A;  4FD5 A;  5AG4 A;  3PBB A;  4KVX A;  4A95 A;  5I0C A;  2B3V A;  3F0A A;  1CX8 A;  3FXT A;  1S5K A;  5LRK A;  1Q5X A;  3SI2 A;  2Y1N A;  4EME A;  1ZG7 A;  4CAX A;  3WC6 A;  5JH9 A;  2DEA A;  5HXD A;  2ZEP A;  4C85 A;  3HLP A;  4F9U A;  2N3A B;  1GYT A;  3IJ3 A;  1YLE A;  2PJB A;  2FXF A;  4A31 A;  3PT1 A;  3C8O A;  3D7D A;  1XIX A;  1N71 A;  1MK4 A;  5C88 A;  3H5Z A;  1TKJ A;  4ONW A;  4YWY A;  1MJA A;  4U9Y A;  4Y49 B;  4RR2 B;  4W9Y A;  4AG9 A;  4AVC A;  2P6F A;  1PUA A;  2PVV A;  2O28 A;  2ZEO A;  3S6G A;  2JBJ A;  1EE3 P;  2ZEF A;  4BTF A;  3KHZ A;  1ZYM A;  1QSM A;  1QST A;  4MFL A;  3T5M A;  5CBM A;  3BI0 A;  2Q44 A;  3E0K A;  3LMS A;  1S7N A;  2B4D A;  2VZZ A;  2XPO A;  4I49 A;  4KOX A;  5DWN A;  4C2X A;  3C26 A;  5GCN A;  4C7I A;  4P4D A;  4JWP A;  2Q51 A;  2Z10 A;  3EZE A;  1CBX A;  2ABZ A;  2DF5 A;  3GJZ A;  4A2Z A;  3D7G A;  3TLG B;  2NMT A;  3KR5 A;  4NGT A;  4UWI A;  4II9 A;  4F0Y A;  2CNT A;  4JYW A;  4A37 A;  5LRJ A;  4P45 A;  3ZJ0 A;  1Z9U A;  3LD2 A;  4MCS A;  4K3N A;  1YW6 A;  4PXE A;  2JBK A;  1QSN A;  3B3S A;  1I21 A;  1M4G A;  5HH1 A;  3G23 A;  4PSX A;  1CP7 A;  3OB1 B;  4QVT A;  3ICU A;  2HQY A;  2AFZ A;  4HNW B;  4PXB A;  4UCP A;  4E0A A;  2OR4 A;  5IB9 A;  2Q7B A;  1YVH A;  1IU8 A;  1XFO A;  1CG2 A;  3KKW A;  4JLY A;  5KTC A;  1VGY A;  2BO9 A;  4C99 A;  2AUM A;  4JZ0 A;  4NXY A;  1XJO A;  2PIZ A;  2EVN A;  3D2P A;  4R76 A;  4IF5 A;  2WPX A;  3FB3 A;  4HNY B;  1AMP A;  3T0T A;  1ARM A;  1Y0Y A;  1Q2D A;  3JRU A;  2J8M A;  4NSQ A;  4R3L A;  4DNC A;  2ZOG A;  1Z8X A;  3IWW A;  2V8V A;  2P6G A;  1YK3 A;  1MJ9 A;  4C8C A;  3D7H A;  1LOK A;  5K99 A;  2GIV A;  4CYO A;  1F2P A;  2B5G A;  3K2K A;  3RZA A;  4NGR A;  1X10 A;  1QSO A;  3R9F A;  1BAV A;  2AFM A;  3ISX A;  4TJV A;  3D67 A;  1YRE A;  3FRM A;  4E2A A;  1DIK A;  2F7V A;  2GLF A;  2PJA A;  4IUS A;  3ZNI A;  3SXO A;  3BHX A;  2B58 A;  1KEE B;  1Y7E A;  2HUZ A;  2NYQ A;  2Q4V A;  1EZA A;  3FEC A;  1XRY A;  2EK9 A;  4MHY A;  2JLM A;  2B4D B;  2RC4 A;  2XEG A;  4MY0 A;  5A28 A;  2CBL A;  5G20 A;  3T8W A;  2J8N A;  2IL4 A;  4ZY2 A;  1Y9Z A;  3W6S A;  1BPN A;  1B6B A;  1YVO A;  4ZGY B;  2PJ2 A;  2HV2 A;  4P44 A;  2G3A A;  2O53 A;  2OU2 A;  2GFQ A;  1M4D A;  5JQ4 A;  2HWG A;  3B3W A;  4UF4 A;  3HUV A;  5H84 A;  1Q7L A;  4ZY1 A;  2DIK A;  2GAN A;  5IV0 A; 
#chains in the Genus database with same CATH homology
 4DJL A;  3I74 A;  4NJQ A;  2XEI A;  2PJ1 A;  3VAR A;  1CPX A;  1JQG A;  4P6Y A;  2HC9 A;  4OP4 A;  3NH5 A;  5CPA A;  1LAN A;  2PVW A;  2JEW A;  3CPX A;  3D68 A;  3FED A;  4MMO A;  3SI1 A;  4BD9 A;  3PEI A;  3WAB A;  2ZEM A;  4DUK A;  4NGS A;  1TKF A;  1FNO A;  4C8T A;  2POK A;  2EWB A;  1ARL A;  2AFS A;  2BOA A;  4OC4 A;  4F8Z A;  1PYT B;  1Z5R A;  4IAV A;  2ZEG A;  2I3C A;  3TC8 A;  2WZN A;  3B7I A;  3FX6 A;  3NH8 A;  4MHZ A;  2IMO A;  1H8L A;  3K9T A;  2CF4 A;  5K8O A;  2CTC A;  3PB9 X;  4CDJ A;  4CDK A;  4MXU A;  3IEH A;  1LCP A;  5HVG A;  2AFU A;  1DE4 C;  3IIB A;  4MCR A;  2Q4Z A;  5F09 A;  3FEE A;  4C9U A;  2C5Q A;  3PRT A;  2PJ6 A;  4O23 A;  3IFE A;  3PB7 X;  5LYI A;  1PCA A;  3RBU A;  2PJ9 A;  3GLJ A;  3KZW A;  1Z8L A;  2VL1 A;  4OKO A;  3N5F A;  2CIJ A;  3DLJ A;  4P4J A;  2ZEH A;  2RFH A;  4C8F A;  5ELY A;  4OME A;  4GM5 A;  5K8N A;  3FJU A;  1CPS A;  3NA6 A;  4P10 A;  2XEJ A;  1F57 A;  3PFO A;  1VHO A;  5LYF A;  4KSI A;  3CDX A;  2RB7 A;  4C86 A;  2PJ4 A;  1HDQ A;  2QYV A;  1QQ9 A;  1CP6 A;  4ZI6 A;  1YLO A;  2O4H A;  4LQG A;  4PQA A;  3QNV A;  1ZLH A;  4NFR A;  4EFD A;  1VIX A;  3B3T A;  3PB6 X;  1WVM A;  2C6P A;  2EK8 A;  3H8F A;  4PXD A;  1HEE A;  5D29 A;  3LWU A;  4MCP A;  1LAM A;  2WYR A;  4R6T A;  4P4F A;  2IJZ A;  2OOT A;  1YME A;  1XF1 A;  3IO1 A;  4ZY0 A;  4C9A A;  3MRU A;  1KWM A;  2GP4 A;  1TF9 A;  4P4E A;  2PJ3 A;  4NGM A;  4P4B A;  1FT7 A;  3KQX A;  3I6S A;  4CPA A;  4IK2 A;  3VAT A;  4MHN A;  3SJF A;  2ZEN A;  2ZED A;  4OIW A;  3B2Y A;  1HDU A;  3S9N A;  3ISZ A;  4MHP A;  3KI9 A;  2ZEL A;  5I4M A;  4C8U A;  2G9D A;  4NGQ A;  1IY7 A;  2XEF A;  3H8G A;  1LFW A;  1OBR A;  3SJG A;  3KQZ A;  4FAI A;  4C8P A;  2ZEE A;  1ELM P;  4A39 A;  2AFX A;  6CPA A;  4R7M A;  4X8I A;  3SJX A;  7CPA A;  4NGP A;  2IQ6 A;  3B35 A;  1BLL E;  2C6G A;  3CT9 A;  4F9V A;  3MN8 A;  2C1C A;  3NFZ A;  1VHE A;  3BI1 A;  1LAP A;  4C8A A;  4PPZ A;  5K8P A;  5K8M A;  3KHX A;  4C9R A;  4WJB A;  1QMU A;  4WWV A;  3SI0 A;  2PCU A;  2J9A A;  4ZYQ A;  3VH9 A;  2F8H A;  3WC7 A;  1AYE A;  3B3C A;  1UWY A;  3I1U A;  4Q7A A;  4OC3 A;  3KR4 A;  3PB8 X;  4FWU A;  4RUH A;  4FUU A;  4FBE A;  3NH4 A;  4A94 A;  3PFE A;  3BXM A;  1M4L A;  4IHM A;  1R3N A;  4H2K A;  3PB4 X;  3FH4 A;  2ANP A;  2PRQ A;  4UEE A;  3TX8 A;  4YU9 A;  5HVF A;  3GUX A;  2V77 A;  2AFO A;  5LRG A;  3IC1 A;  3H8E A;  3VTA A;  1YSJ A;  4TNU A;  1DTD A;  2QVP A;  3FF3 A;  2PIY A;  1YW4 A;  3WC5 A;  3V7Z A;  8CPA A;  3S9M A;  4OC2 A;  5LYD A;  1TXR A;  2PJ0 A;  2BCO A;  1Y0R A;  4G1P A;  3PBE A;  2PJC A;  4C9V A;  1ZG9 A;  1RTQ A;  2GU2 A;  3D66 A;  4TWE A;  4MCQ A;  4C84 A;  2GRE A;  4EWT A;  3WT4 A;  4B6Z A;  1V6C A;  5LYL A;  2V8D A;  2Q43 A;  3DGV A;  4ZX8 A;  1NSA A;  4OC0 A;  3V38 A;  2GLJ A;  4PXC A;  5JGF A;  2AFW A;  3KGQ A;  3D4U A;  1Z2L A;  4UIB A;  5JM6 A;  4R8F A;  5IR2 A;  4NJR A;  4NGN A;  1ELL P;  2ZOF A;  4MRI A;  4ZX9 A;  2PE3 A;  2V8H A;  2CTB A;  4C9E A;  4TJX A;  4A38 A;  4P4I A;  4UIA A;  1ZG8 A;  4X2T A;  2V8G A;  3KL9 A;  1R43 A;  5THW A;  1TF8 A;  5D8N A;  3SJE A;  3FMC A;  3KAS A;  3D7F A;  2PJ8 A;  5DS0 A;  3RAM A;  4KNG E;  3B3V A;  3S9L A;  4YN3 A;  4OC5 A;  4OID A;  2PJ5 A;  3CPA A;  2NSM A;  2PJ7 A;  2FVG A;  4UEZ A;  3GB0 A;  4OC1 A;  4X3R A;  3EIF A;  3L2N A;  5HVH A;  5J1Q A;  2HB6 A;  1ZLI A;  1F2O A;  2C6C A;  2QJ8 A;  4UEF A;  1BPM A;  1TKH A;  3FVL A;  4DYO A;  1IGB A;  1XBU A;  4Z65 A;  1XMB A;  4AXV A;  3PBB A;  1CX8 A;  5LRK A;  3SI2 A;  4EME A;  1ZG7 A;  3WC6 A;  5JH9 A;  2DEA A;  5HXD A;  2ZEP A;  4C85 A;  3HLP A;  4F9U A;  1GYT A;  3IJ3 A;  2PJB A;  3D7D A;  1TKJ A;  4ONW A;  4YWY A;  4W9Y A;  2PVV A;  2ZEO A;  2JBJ A;  1EE3 P;  2ZEF A;  3KHZ A;  5CBM A;  3BI0 A;  3LMS A;  4P4D A;  2Q51 A;  1CBX A;  2ABZ A;  3D7G A;  3KR5 A;  4NGT A;  4A37 A;  4JYW A;  5LRJ A;  4P45 A;  4MCS A;  4K3N A;  1YW6 A;  4PXE A;  2JBK A;  3B3S A;  3ICU A;  1CP7 A;  2AFZ A;  4PXB A;  2OR4 A;  5IB9 A;  1XFO A;  1CG2 A;  4C99 A;  1VGY A;  2BO9 A;  4JZ0 A;  1XJO A;  2PIZ A;  4R76 A;  1AMP A;  1ARM A;  1Y0Y A;  3JRU A;  2ZOG A;  3IWW A;  2V8V A;  4C8C A;  3D7H A;  1LOK A;  1F2P A;  3K2K A;  3RZA A;  4NGR A;  1BAV A;  2AFM A;  3ISX A;  4TJV A;  3D67 A;  2F7V A;  2GLF A;  2PJA A;  3BHX A;  1Y7E A;  2NYQ A;  3FEC A;  1XRY A;  2EK9 A;  4MHY A;  2XEG A;  3T8W A;  1Y9Z A;  4ZY2 A;  1BPN A;  2PJ2 A;  4P44 A;  2O53 A;  3B3W A;  4UF4 A;  3HUV A;  1Q7L A;  4ZY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...