3BI1A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of methotrexate-glu
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bi1A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bi1A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bi1A02
3NH5A 3DLJA 4JZ0A 2VL1A 4ZY1A 1EE3P 3I74A 4FBEA 2GREA 2PIZA 1Y7EA 3H8GA 3H8FA 1TXRA 4W9YA 4CDKA 4A37A 1F2OA 4K3NA 1AYEA 4CPAA 4OIDA 2AFMA 4NJRA 3PB7X 4Z65A 5J1QA 2JEWA 2ZEEA 1YSJA 3CPXA 4C8PA 2CIJA 3D7GA 1F2PA 4P4FA 2JBJA 1TKJA 1ZLHA 2ZEDA 1XFOA 2QYVA 4MHYA 1ARLA 3D7FA 4F9VA 4OC1A 4A94A 3GB0A 1HDUA 1YLOA 3S9LA 3KHZA 3PB8X 3KQXA 2Q43A 4H2KA 2O53A 3PRTA 3BHXA 3GLJA 5D29A 3FVLA 3FMCA 3FX6A 2ANPA 3LWUA 1CPXA 5LRKA 3D4UA 2ABZA 1F57A 3GUXA 1VGYA 2GLJA 1PYTB 4MCQA 1XBUA 1IGBA 8CPAA 4GM5A 1HEEA 4MHPA 4WJBA 4C99A 3ICUA 1IY7A 2ZEHA 4C9RA 4C8TA 2WZNA 2QJ8A 4OC4A 1Y9ZA 3TX8A 2PCUA 1PCAA 4MHNA 4F8ZA 2RB7A 5K8PA 5THWA 3K2KA 2OR4A 3SJFA 6CPAA 1ELLP 3PB9X 2F8HA 4OIWA 4A38A 4NJQA 4PXCA 3D68A 4R8FA 4P4JA 2AFWA 4RUHA 4P4BA 1BAVA 4C9EA 2PJBA 2C6GA 3B7IA 3BI1A 1BPMA 4BD9A 4ZY0A 4KSIA 5JM6A 4R6TA 3ISZA 4C9AA 1H8LA 3SI1A 2QVPA 3BXMA 4DJLA 4FWUA 2GU2A 4X3RA 4C84A 2PJ0A 4OP4A 1ELMP 2HB6A 2PJ8A 3KR4A 3D7DA 4MCPA 3IO1A 3PFOA 2J9AA 4TJXA 2I3CA 3B2YA 3D67A 3NFZA 2XEGA 2DEAA 4C9VA 1TKHA 4KNGE 2ZEMA 3B35A 5LYDA 2XEFA 2PJ6A 4DYOA 3SJGA 3FEDA 2OOTA 5K8MA 1VIXA 1BLLE 1DE4C 4NGQA 1XRYA 4UEEA 1CP7A 3K9TA 4Q7AA 1ZLIA 3IJ3A 1ZG8A 3SJXA 4OKOA 3SJEA 2PJ3A 3VARA 4NFRA 2PVVA 2BO9A 3B3SA 3RBUA 4P44A 1CBXA 3L2NA 4FUUA 3FEEA 2JBKA 1QMUA 3FECA 4OC5A 5LYFA 3V7ZA 5ELYA 5LYLA 1R43A 3PFEA 4PQAA 1Z5RA 3IFEA 1FNOA 4LQGA 1TKFA 2PJCA 4UEZA 4JYWA 2POKA 4ZI6A 2Q4ZA 3LMSA 1VHOA 4UF4A 2IMOA 3JRUA 4C85A 1M4LA 5CBMA 1DTDA 4IHMA 3NH8A 3RAMA 3IEHA 2PIYA 4P45A 5HVHA 1GYTA 3VH9A 5HVFA 2O4HA 1QQ9A 5JGFA 2WYRA 4WWVA 4ZX9A 3MRUA 2PJ7A 2PJ1A 2V8GA 3SI2A 4PPZA 4MHZA 4MCSA 4P4IA 1LANA 2AFZA 1ZG7A 4X8IA 4MRIA 2NYQA 1BPNA 4CDJA 1LCPA 4P4DA 3D66A 5LRJA 3PB4X 1FT7A 1Z2LA 1Q7LA 4NGTA 2PJAA 4MCRA 1VHEA 2PJ2A 5K8NA 4C8AA 4NGPA 1XJOA 2PJ5A 3PBEA 7CPAA 2AFSA 3NA6A 3I1UA 3B3VA 4MXUA 5HXDA 3IWWA 2CTCA 2F7VA 1WVMA 3S9MA 4EWTA 2ZEPA 4EMEA 4O23A 3VTAA 4ONWA 5LRGA 1R3NA 2ZELA 4TWEA 4R76A 3DGVA 3D7HA 4C86A 4UIAA 2NSMA 2PRQA 4TJVA 2FVGA 2V8VA 5D8NA 1OBRA 4C8FA 2PJ9A 3B3CA 3KASA 2V8HA 4PXEA 2AFUA 4ZX8A 4NGRA 4C9UA 4C8CA 4ZYQA 3KI9A 3CPAA 4F9UA 3QNVA 2XEIA 3KGQA 3PEIA 4C8UA 3KQZA 2Q51A 2EK9A 3IC1A 3WC7A 2PVWA 2IJZA 3B3WA 3WT4A 1CP6A 4MMOA 4B6ZA 3VATA 1CX8A 3BI0A 2BCOA 1XF1A 4UIBA 4EFDA 4FAIA 4NGMA 1YMEA 4PXDA 1ZG9A 1LOKA 5F09A 4PXBA 4OC3A 2GLFA 4OMEA 5HVGA 2HC9A 3MN8A 3PB6X 4OC0A 3SI0A 3N5FA 4YU9A 2CF4A 2ZOFA 1Y0YA 1UWYA 2EWBA 2RFHA 3CDXA 3IIBA 4AXVA 4YN3A 3HUVA 4ZY2A 3PBBA 1RTQA 2C6PA 4YWYA 2PE3A 2C1CA 5DS0A 3FF3A 2AFXA 4UEFA 3NH4A 1HDQA 4DUKA 1AMPA 1NSAA 3HLPA 5IB9A 3TC8A 1XMBA 2XEJA 2BOAA 3KR5A 1TF8A 2V8DA 4OC2A 2EK8A 1JQGA 1LAPA 4NGSA 2C6CA 4TNUA 4IK2A 4P6YA 3CT9A 4P10A 3WC5A 3ISXA 2ZEGA 2PJ4A 5I4MA 3WC6A 3KHXA 1CPSA 5JH9A 3I6SA 4NGNA 1YW4A 3KZWA 5K8OA 1LAMA 2AFOA 2ZENA 2IQ6A 1KWMA 3KL9A 3B3TA 5LYIA 3EIFA 4IAVA 2ZOGA 3S9NA 3FJUA 1Z8LA 1TF9A 1YW6A 4X2TA 2ZEOA 2V77A 3T8WA 1LFWA 1ARMA 4A39A 3RZAA 3WABA 1V6CA 4R7MA 3V38A 3FH4A 4G1PA 1CG2A 2G9DA 1Y0RA 2ZEFA 5CPAA 2CTBA 3H8EA 4P4EA
chains in the Genus database with same CATH superfamily
2VBQA 3NH5A 2B0AA 3HPGG 3DLJA 2J8NA 1A2ZA 5AGEA 4JZ0A 2WUUA 2VL1A 4ZBGA 4ZY1A 2ZW6A 1EE3P 5J8FA 3I74A 4FBEA 2XPOA 4AVBA 2GREA 2PIZA 1YREA 5G22A 1Y7EA 3H8GA 1YK3A 3IWEA 3PGPA 3H8FA 3R9FA 4CYNA 1TXRA 4W9YA 4JXQA 3R9EA 4A37A 4CDKA 4ORFA 3R95A 1YVKA 4H6UA 4M6GA 1F2OA 4K3NA 1AYEA 4A33A 4CPAA 4OIDA 5AG6A 2AFMA 1R57A 4AB7A 1VBGA 2Z11A 4NJRA 3PB7X 4A2ZA 4Z65A 5BWAB 2XPNA 3O8ZA 4B10A 4E8OA 5J1QA 2JEWA 3RYOA 2ZEEA 1YSJA 2H5MA 2G0BA 2FT0A 3CPXA 4C68A 2AUNA 4C8PA 2CIJA 3D7GA 1F2PA 3T90A 2OZUA 4KOUA 4P4FA 1CM0A 1FY7A 2Q7SA 1KC7A 2JBJA 1TKJA 1ZLHA 3D2MA 2ZEDA 1XFOA 2QYVA 3A9LA 1B47A 3D7FA 1ARLA 2GE3A 2OU2A 4MHYA 4OC1A 1Y9KA 4A94A 4CAWA 4F9VA 3GB0A 3VWEA 1HDUA 1YLOA 2WPXA 3S9LA 5J3XA 3E0KA 3KHZA 3PB8X 1YX0A 2X7BA 4KOSA 4XNHC 5AG7A 4CAVA 3KQXA 4R9MA 3T9YA 5JVLA 2HROA 2Q43A 4H2KA 4H89A 2O53A 3PRTA 4QC6A 3SHPA 3BHXA 1XIXA 3GLJA 5F5XA 2Q4YA 3VRRA 5D29A 1YGHA 3FVLA 3VRNA 1J4JA 3FMCA 3FX6A 4KSFA 2ANPA 3LWUA 2P0WA 3S6KA 4IIXA 2FSRA 1CPXA 5LRKA 3IGRA 3OWCA 1P4NA 3D4UA 2ABZA 4M3SA 2KCWA 4LX9A 1F57A 4UFWA 3HPHE 4UCNA 3SXNA 5JPHA 3GUXA 1C3OB 1VGYA 3G8WA 2Q0YA 3U1BA 2GLJA 1PYTB 4MCQA 1XBUA 1IGBA 3VROA 2YNCC 3PP9A 8CPAA 3DNSA 4Y49C 3BJ7A 4GM5A 1HEEA 3VGOA 3OAKA 5KTAA 5HKWA 4MHPA 5HKYA 4WJBA 4CYQA 4C99A 1NBWA 2P6EA 4A4CA 3ICUA 1IY7A 2ZEHA 4C9RA 4HPSA 4C8TA 2EO8A 5EC4A 1TIQA 1CS0B 3F0AA 2WZNA 2QJ8A 1S7FA 4C2XA 4OC4A 1M4IA 2PSWA 3TX8A 1Y9ZA 2PCUA 1PCAA 4MHNA 4F8ZA 2F5IA 3W6XA 3EXNA 2ODFA 4FD5A 2C5QA 4KUAA 3BUXB 2RB7A 2YNCA 4GS4A 4B13A 1LRZA 4H6ZA 1EZBA 2R7HA 5THWA 5K8PA 2YJVA 1GHEA 3K2KA 4CO9A 5F13A 2OR4A 3CXPA 3SJFA 6CPAA 1WWZA 1ELLP 3PB9X 2F8HA 3FNCA 4KSAA 2Q4VA 4OIWA 1Z8XA 4JXRA 4A38A 4NJQA 3V8IA 3IWGA 4J3GA 3D68A 4PXCA 2BL1A 4R8FA 1XF8A 4P4JA 2AFWA 3W91A 4M6HA 2GFQA 4RUHA 4ONUA 4P4BA 1BAVA 1VI4A 2PJBA 4C9EA 2C6GA 3B7IA 5G21A 2ARHA 3BI1A 1BPMA 4BD9A 3BJ8A 1Z9UA 2PRBA 4JLYA 3CXSA 4ZY0A 1NSLA 4KSIA 4HNYB 5JM6A 4R6TA 1Y9WA 3ISZA 4UWIA 2B5GB 4BINA 4C9AA 1H8LA 3LACA 4XPDC 3SI1A 4CS0B 5FVJA 1JDEA 2QVPA 4KOVA 3OP0A 4MI4A 3K9UA 3UY5A 5A28A 2B3UA 4RR2B 4MFLA 2FIAA 3BUWB 3TO6A 2HI6A 4II9A 3BXMA 4KOWA 4DJLA 4J0NA 4FWUA 2GU2A 4X3RA 1XE4A 1KEEB 4C84A 1JWQA 2NMTA 2PJ0A 4OP4A 2D4OA 1ELMP 2HB6A 5G20A 1IU8A 2PJ8A 3KR4A 3KRVA 3G3SA 1VBHA 2AJ6A 5FD8A 1B87A 4XNHB 3D7DA 4MCPA 2B58A 3IO1A 3PFOA 2J9AA 1YQEA 4E0AA 4MJ8A 2VQYA 4TJXA 2CY2A 2I3CA 3B2YA 3D67A 3LD2A 3G23A 1IYKA 2AUMA 3TLBA 1IYLA 2Q44A 3NFZA 2XEGA 2DEAA 4C9VA 1TKHA 4B14A 4BTFA 2JDDA 1BO4A 4AG9A 1M44A 2B4DA 4KNGE 1BXRB 2ZEMA 1KUVA 1AUGA 3B35A 5LYDA 5C88A 4JJXA 2XEFA 2PJ6A 4NEXA 3SJGA 4DYOA 3FEDA 4F0XA 2OOTA 5K8MA 3TLGB 1Q2DA 1VIXA 1BLLE 1DE4C 4NGQA 1XRYA 4UEEA 3TYXA 1EO0A 4A30A 1CP7A 4PSXA 1X12A 3K9TA 4Q7AA 2GP4A 1ZLIA 4B5PB 1Z9EA 3VRQA 5HKZA 3QB8A 3IJ3A 1ZG8A 3SJXA 4MY3A 3SJEA 2BSWA 4OKOA 5F48A 2PJ3A 5JYBA 3FB3A 3VARA 4NFRA 4RI1A 2PVVA 1P0HA 4C2YA 2CBLA 2BO9A 3B3SA 2WPWA 3RBUA 2BEIA 4DNCA 4P44A 4BBHA 1CBXA 3CXQA 3L2NA 4FUUA 4KZTA 3FEEA 1S7LA 4MI1A 3GJZA 2JBKA 4JVOA 1L0CA 1IIDA 1QMUA 3FECA 4OC5A 2VKZG 3FYNA 2Z3MA 4CAXA 3S6FA 5DWMA 3V7ZA 4M6IA 5LYFA 5ELYA 3D8PA 5LYLA 1R43A 3PFEA 2Y0MA 4PQAA 1Z5RA 4M85A 3IU2A 4CYOA 2D0PA 3IFEA 3PFVA 1FNOA 1KUYA 2K5TA 4LQGA 4LQ6A 3F5BA 1ZRSA 3H5ZA 3QAHA 1QSTA 2REEA 1TKFA 2PJCA 4UEZA 4JYWA 2POKA 4ZI6A 5HH1A 4MFQA 1IOIA 2Q4ZA 3LMSA 3BUOB 3OB1B 2GANA 1VHOA 4BPWB 4UF4A 3EY5A 2IMOA 4NXYA 3JRUA 4C85A 1M4LA 5F46A 4EVYA 5CBMA 1DTDA 1IICA 3R96A 3OB2B 4IHMA 4KORA 2J8MA 3NH8A 3RAMA 1C30B 4XPLA 3IEHA 2A4NA 4P45A 2PIYA 5HVHA 1GYTA 3VH9A 5HVFA 4XPDB 4A95A 4MJXA 4GXHA 2ZXVA 4QBJA 2O4HA 1QQ9A 1Y7RA 4CAEA 2JEVA 2WYRA 5JGFA 3EZEA 1RXTA 3FBUA 4WWVA 3SXOA 4OLLA 4ZX9A 3ZNIA 3MRUA 1XOVA 2PJ7A 2PJ1A 2V8GA 4E94A 2B4JC 1KUXA 4CGNA 2QMLA 3SI2A 2YNDA 4CAFA 2FL4A 4PPZA 3NE8A 2B4DB 4MHZA 5ISVA 1KBLA 2D4PA 4QVTA 5CNPA 4RN7A 5F47A 5C82A 3ZZIA 1IB1E 4MCSA 3DDDA 2PR1A 4IF5A 4P4IA 4JD6A 2OLSA 1LANA 4E2AA 2AFZA 1MJ9A 3I3GA 1ZG7A 4KS9A 3TTHA 5IB0A 1X10A 4X8IA 1MJAA 4MRIA 3U88C 2CNTA 2NYQA 1BPNA 4CDJA 2OH1A 1UFHA 3EZBA 1LCPA 4P4DA 1ZO0A 3D66A 3QAYA 2DPTA 5H84A 5LRJA 4CYPA 4M8DA 3PB4X 1FT7A 1M4DA 1S5KA 1Z2LA 3TFYA 2PC1A 2HUZA 4R87A 3TCVA 2PQ8A 1Q7LA 4NGTA 5DWNA 4COGA 1VKCA 2PJAA 4MCRA 1VHEA 2PJ2A 5IV0A 5K8NA 1T36B 4HNWB 4Q38A 4C8AA 3TT2A 4NGPA 1XJOA 4KVOE 2CXAA 2G3TA 4XPKA 5AXIA 2PJ5A 3PBEA 1Q5XA 7CPAA 1VHSA 2AFSA 2ZW7A 3NA6A 2B3VA 2R98A 3TOBA 3I1UA 1XEBA 1PUAA 3B3VA 3GIUA 4UCPA 5H86A 2ZW4A 2OZHA 2VI7A 5AG5A 1I12A 1U6MA 2REFA 3H4QA 3TOAA 2Y1MA 2HWGA 4MXUA 5HXDA 1KZFA 1S60A 3LODA 3D3SA 3IWWA 1S7KA 1XMTA 2CTCA 2DXQA 2DPSA 2F7VA 5HMNA 3D2PA 3MGDA 4INJA 1WVMA 2VZYA 3S9MA 3TO7A 4NF1A 4AVAA 5EMIA 4EWTA 5K99A 2VEZA 4UBRA 2ZEPA 4EMEA 1R61A 4O23A 3VTAA 4Q36A 2Y1NA 5F1YA 1IOFA 4BMHA 4ONWA 3K4IA 5LRGA 3ZJ0A 4QUSA 1NE9A 4MBUA 1R3NA 4B5OA 2ZELA 2JLMA 4CZ1A 4TWEA 4OADA 4R76A 1S7NA 3DGVA 1GGOA 2CNSA 4UFXA 5F49A 3D7HA 1A9XB 4C86A 4UIAA 1ZL0A 3DSBA 2MP0A 5I0CA 2NSMA 2PRQA 1RO5A 4MFZA 4RS2A 4KOXA 4TJVA 3TLYA 2FVGA 2V8VA 3R9GA 4PV6A 5D8NA 1OBRA 4KUBA 4C8FA 2PJ9A 5AG4A 3TLCA 3B3CA 3KASA 2FE7A 3EFAA 4PK3A 5GCNA 2V8HA 4PXEA 2R82A 2AFUA 1JDBC 1Q2YA 4ZX8A 4NGRA 5BY0A 2X0SA 4C8CA 4C9UA 2AE6A 4Y49B 4ZYQA 1B6BA 3B8GA 3KI9A 1Z4EA 4YRHA 3CPAA 4F9UA 2HV2A 1J3LA 1ZYMA 1V0CA 3QNVA 2XEIA 3KGQA 1YLEA 4MHDA 4UWJA 2R8VA 3PEIA 4C8UA 4MFKA 2B4BA 4A32A 3KQZA 2Q51A 2EK9A 3IC1A 3WC7A 2EBJA 3C26A 3EO4A 3FXTA 2PVWA 1Z8WA 2D0OA 2IJZA 3B3WA 4KVME 1M1DA 2OZGA 3WT4A 3T05A 1CP6A 2YGWA 2J8RA 4MMOA 2DF5A 2R1IA 3NE7A 3VATA 4B6ZA 1CX8A 3BI0A 4PSWA 2N3AB 4NSQA 2FS5A 2BCOA 4KOTA 1XF1A 5EBVA 2PCNA 2P6FA 3JTKA 3KKWA 4UIBA 4EFDA 3IU1A 1NXJA 3TLEA 5JQ4A 4FAIA 4GPLB 4A4BA 4NGMA 1YMEA 2I00A 5F9MA 4PXDA 3EC4A 4C7HA 5IR2A 1YR0A 4I49A 1ZG9A 3BUNB 1LOKA 4KOYA 2YJTA 3HMJG 2VZZA 3F8KA 5F09A 4MFPA 4PXBA 4FD4A 5A27A 2FM4A 4OC3A 5KTDA 2EZBA 2GLFA 4OMEA 4KLWA 4A31A 3RO0A 3N7ZA 3NFQA 5HVGA 4L8AA 2HC9A 2B5GA 3MN8A 4LUAA 4UFVA 3PB6X 4OC0A 4KLVA 3WR7A 3T5MA 3SI0A 2Z3NA 4FD7A 2FXFA 3N5FA 2XPPA 4YU9A 4C2ZA 3GY9A 2DIKA 3F9KC 2CF4A 3DR6A 2ZOFA 1QSNA 1Y0YA 4U9YA 1NMTA 1UWYA 4R3LA 2EWBA 2EZCA 4BPXB 2RFHA 2WSAA 3CDXA 3IIBA 4NCZA 4U5YA 4AXVA 5J8CA 1EZAA 4YN3A 3HUVA 4ZY2A 3PBBA 1RTQA 2GIVA 2RC4A 1Z8TA 2C6PA 4YWYA 2PE3A 1I21A 5KTCA 3P2FA 3C8OA 2ZW5A 4COBA 2QIRA 3CZXA 2C1CA 4AG7A 4PK2A 1OZPA 5DS0A 3FF3A 2EZAA 2AFXA 4BPUB 4UEFA 3NOJA 1BOBA 2DLAA 3NH4A 4H1HA 4X5KA 1HDQA 2FIWA 4DUKA 2XPLA 1AMPA 2Q7BA 2P6GA 1NSAA 5G1ZA 4CRYB 3HLPA 4JWPA 4CGPA 4CRZB 3TC8A 1XMBA 2HQYA 5IB9A 2XEJA 3S6GA 2O28A 3DR8A 4EYSA 4R3KA 2Z3KA 2EUIA 3TLAA 2BOAA 3TLZA 1QSRA 2G3AA 3JUWA 3KR5A 2YNEA 3PZJA 3JVNA 1TF8A 2V8DA 1QSMA 4CGMA 3TLGA 3R1KA 4OC2A 2EK8A 1JQGA 1LAPA 4NGSA 2C6CA 4TNUA 3BUMB 4IK2A 4P6YA 4B5PA 3CT9A 1PU9A 4HNXB 4P10A 2C27A 4R57A 3WC5A 3ISXA 2BUEA 1WJTA 1MK4A 2ZEGA 1CE8B 1M6VB 2PJ4A 1SQHA 4L89A 3WC6A 3KHXA 5I4MA 1CPSA 3I9SA 4MY0A 5JH9A 3T07A 5IX3A 3EZAA 5E96A 3TE4A 2Z0ZA 3W6SA 1Q2CA 3I6SA 4NGNA 2I79A 4CGOA 2FCKA 3VWDA 2Z3OA 4F6AA 2Z10A 2ZPAA 1S3ZA 1YW4A 3KZWA 4QB9A 1LAMA 2AFOA 2ZENA 2IQ6A 5K8OA 4IIYA 4YFJA 2QECA 1KWMA 1FBVA 3FIXA 3KL9A 3TO9A 3FRMA 3RNZA 1QSOA 2PR8A 2Z3PA 3B3TA 5LYIA 3EIFA 4FD6A 4IAVA 2ZOGA 3S9NA 3GYAA 3SR3A 4OAEA 1ON0A 3FJUA 2PDOA 3PT1A 1YVOA 1Z8LA 1TF9A 2UV8G 1YW6A 4X2TA 4MFJA 1WK4A 4IUSA 4UA3A 2ZEOA 2IL4A 4AVCA 4ZGYB 4E5SA 2CNMA 3S6HA 1I1DA 2EVNA 2V77A 3T8WA 4C7IA 3BLNA 1LFWA 1N71A 1ARMA 2OB0A 3P2HA 4CGLA 3T0TA 4A39A 1MJBA 3GKRA 1Z4RA 2JDCA 3RZAA 3WABA 1V6CA 1M4GA 4UCMA 4B12A 2Q04A 1CJWA 4F0YA 4R7MA 4U9ZA 3V38A 4YGOA 2Z3LA 3FH4A 4B11A 4G1PA 4K30A 4HKFA 3PLFB 1CG2A 4KVXA 2G9DA 1Y0RA 2VXKA 2ZEFA 5CPAA 1DIKA 2E28A 2CTBA 3VRPA 3H8EA 1K4JA 2ATRA 4P4EA 1YVHA
chains in the Genus database with same CATH topology
3NH5A 3DLJA 4JZ0A 2VL1A 4ZY1A 1EE3P 3I74A 4FBEA 2GREA 2PIZA 1Y7EA 3H8GA 3H8FA 1TXRA 4W9YA 4CDKA 4A37A 1F2OA 4K3NA 1AYEA 4CPAA 4OIDA 2AFMA 4NJRA 3PB7X 4Z65A 5J1QA 2JEWA 2ZEEA 1YSJA 3CPXA 4C8PA 2CIJA 3D7GA 1F2PA 4P4FA 2JBJA 1TKJA 1ZLHA 2ZEDA 1XFOA 2QYVA 4MHYA 1ARLA 3D7FA 4F9VA 4OC1A 4A94A 3GB0A 1HDUA 1YLOA 3S9LA 3KHZA 3PB8X 3KQXA 2Q43A 4H2KA 2O53A 3PRTA 3BHXA 3GLJA 5D29A 3FVLA 3FMCA 3FX6A 2ANPA 3LWUA 1CPXA 5LRKA 3D4UA 2ABZA 1F57A 3GUXA 1VGYA 2GLJA 1PYTB 4MCQA 1XBUA 1IGBA 8CPAA 4GM5A 1HEEA 4MHPA 4WJBA 4C99A 3ICUA 1IY7A 2ZEHA 4C9RA 4C8TA 2WZNA 2QJ8A 4OC4A 1Y9ZA 3TX8A 2PCUA 1PCAA 4MHNA 4F8ZA 2C5QA 2RB7A 5K8PA 5THWA 3K2KA 2OR4A 3SJFA 6CPAA 1ELLP 3PB9X 2F8HA 4OIWA 4A38A 4NJQA 4PXCA 3D68A 4R8FA 4P4JA 2AFWA 4RUHA 4P4BA 1BAVA 4C9EA 2PJBA 2C6GA 3B7IA 3BI1A 1BPMA 4BD9A 4ZY0A 4KSIA 5JM6A 4R6TA 3ISZA 4C9AA 1H8LA 3SI1A 2QVPA 3BXMA 4DJLA 4FWUA 2GU2A 4X3RA 4C84A 2PJ0A 4OP4A 1ELMP 2HB6A 2PJ8A 3KR4A 3D7DA 4MCPA 3IO1A 3PFOA 2J9AA 4TJXA 2I3CA 3B2YA 3D67A 3NFZA 2XEGA 2DEAA 4C9VA 1TKHA 4KNGE 2ZEMA 3B35A 5LYDA 2XEFA 2PJ6A 4DYOA 3SJGA 3FEDA 2OOTA 5K8MA 1VIXA 1BLLE 1DE4C 4NGQA 1XRYA 4UEEA 1CP7A 3K9TA 4Q7AA 2GP4A 1ZLIA 3IJ3A 1ZG8A 3SJXA 4OKOA 3SJEA 2PJ3A 3VARA 4NFRA 2PVVA 2BO9A 3B3SA 3RBUA 4P44A 1CBXA 3L2NA 4FUUA 3FEEA 2JBKA 1QMUA 3FECA 4OC5A 5LYFA 3V7ZA 5ELYA 5LYLA 1R43A 3PFEA 4PQAA 1Z5RA 3IFEA 1FNOA 4LQGA 1TKFA 2PJCA 4UEZA 4JYWA 2POKA 4ZI6A 2Q4ZA 3LMSA 1VHOA 4UF4A 2IMOA 3JRUA 4C85A 1M4LA 5CBMA 1DTDA 4IHMA 3NH8A 3RAMA 3IEHA 2PIYA 4P45A 5HVHA 1GYTA 3VH9A 5HVFA 2O4HA 1QQ9A 5JGFA 2WYRA 4WWVA 4ZX9A 3MRUA 2PJ7A 2PJ1A 2V8GA 3SI2A 4PPZA 4MHZA 4MCSA 4P4IA 1LANA 2AFZA 1ZG7A 4X8IA 4MRIA 2NYQA 1BPNA 4CDJA 1LCPA 4P4DA 3D66A 5LRJA 3PB4X 1FT7A 1Z2LA 1Q7LA 4NGTA 2PJAA 4MCRA 1VHEA 2PJ2A 5K8NA 4C8AA 4NGPA 1XJOA 2PJ5A 3PBEA 7CPAA 2AFSA 3NA6A 3I1UA 3B3VA 4MXUA 5HXDA 3IWWA 2CTCA 2F7VA 1WVMA 3S9MA 4EWTA 2ZEPA 4EMEA 4O23A 3VTAA 4ONWA 5LRGA 1R3NA 2ZELA 4TWEA 4R76A 3DGVA 3D7HA 4C86A 4UIAA 2NSMA 2PRQA 4TJVA 2FVGA 2V8VA 5D8NA 1OBRA 4C8FA 2PJ9A 3B3CA 3KASA 2V8HA 4PXEA 2AFUA 4ZX8A 4NGRA 4C9UA 4C8CA 4ZYQA 3KI9A 3CPAA 4F9UA 3QNVA 2XEIA 3KGQA 3PEIA 4C8UA 3KQZA 2Q51A 2EK9A 3IC1A 3WC7A 2PVWA 2IJZA 3B3WA 3WT4A 1CP6A 4MMOA 4B6ZA 3VATA 1CX8A 3BI0A 2BCOA 1XF1A 4UIBA 4EFDA 4FAIA 4NGMA 1YMEA 4PXDA 5IR2A 1ZG9A 1LOKA 5F09A 4PXBA 4OC3A 2GLFA 4OMEA 5HVGA 2HC9A 3MN8A 3PB6X 4OC0A 3SI0A 3N5FA 4YU9A 2CF4A 2ZOFA 1Y0YA 1UWYA 2EWBA 2RFHA 3CDXA 3IIBA 4AXVA 4YN3A 3HUVA 4ZY2A 3PBBA 1RTQA 2C6PA 4YWYA 2PE3A 2C1CA 5DS0A 3FF3A 2AFXA 4UEFA 3NH4A 1HDQA 4DUKA 1AMPA 1NSAA 3HLPA 5IB9A 3TC8A 1XMBA 2XEJA 2BOAA 3KR5A 1TF8A 2V8DA 4OC2A 2EK8A 1JQGA 1LAPA 4NGSA 2C6CA 4TNUA 4IK2A 4P6YA 3CT9A 4P10A 3WC5A 3ISXA 2ZEGA 2PJ4A 5I4MA 3WC6A 3KHXA 1CPSA 5JH9A 3I6SA 4NGNA 1YW4A 3KZWA 5K8OA 1LAMA 2AFOA 2ZENA 2IQ6A 1KWMA 3KL9A 3B3TA 5LYIA 3EIFA 4IAVA 2ZOGA 3S9NA 3FJUA 1Z8LA 1TF9A 1YW6A 4X2TA 2ZEOA 2V77A 3T8WA 1LFWA 1ARMA 4A39A 3RZAA 3WABA 1V6CA 4R7MA 3V38A 3FH4A 4G1PA 1CG2A 2G9DA 1Y0RA 2ZEFA 5CPAA 2CTBA 3H8EA 4P4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NH5 A;  3DLJ A;  4JZ0 A;  2VL1 A;  4ZY1 A;  1EE3 P;  3I74 A;  4FBE A;  2GRE A;  2PIZ A;  1Y7E A;  3H8G A;  3H8F A;  1TXR A;  4W9Y A;  4CDK A;  4A37 A;  1F2O A;  4K3N A;  1AYE A;  4CPA A;  4OID A;  2AFM A;  4NJR A;  3PB7 X;  4Z65 A;  5J1Q A;  2JEW A;  2ZEE A;  1YSJ A;  3CPX A;  4C8P A;  2CIJ A;  3D7G A;  1F2P A;  4P4F A;  2JBJ A;  1TKJ A;  1ZLH A;  2ZED A;  1XFO A;  2QYV A;  4MHY A;  1ARL A;  3D7F A;  4F9V A;  4OC1 A;  4A94 A;  3GB0 A;  1HDU A;  1YLO A;  3S9L A;  3KHZ A;  3PB8 X;  3KQX A;  2Q43 A;  4H2K A;  2O53 A;  3PRT A;  3BHX A;  3GLJ A;  5D29 A;  3FVL A;  3FMC A;  3FX6 A;  2ANP A;  3LWU A;  1CPX A;  5LRK A;  3D4U A;  2ABZ A;  1F57 A;  3GUX A;  1VGY A;  2GLJ A;  1PYT B;  4MCQ A;  1XBU A;  1IGB A;  8CPA A;  4GM5 A;  1HEE A;  4MHP A;  4WJB A;  4C99 A;  3ICU A;  1IY7 A;  2ZEH A;  4C9R A;  4C8T A;  2WZN A;  2QJ8 A;  4OC4 A;  1Y9Z A;  3TX8 A;  2PCU A;  1PCA A;  4MHN A;  4F8Z A;  2RB7 A;  5K8P A;  5THW A;  3K2K A;  2OR4 A;  3SJF A;  6CPA A;  1ELL P;  3PB9 X;  2F8H A;  4OIW A;  4A38 A;  4NJQ A;  4PXC A;  3D68 A;  4R8F A;  4P4J A;  2AFW A;  4RUH A;  4P4B A;  1BAV A;  4C9E A;  2PJB A;  2C6G A;  3B7I A;  3BI1 A;  1BPM A;  4BD9 A;  4ZY0 A;  4KSI A;  5JM6 A;  4R6T A;  3ISZ A;  4C9A A;  1H8L A;  3SI1 A;  2QVP A;  3BXM A;  4DJL A;  4FWU A;  2GU2 A;  4X3R A;  4C84 A;  2PJ0 A;  4OP4 A;  1ELM P;  2HB6 A;  2PJ8 A;  3KR4 A;  3D7D A;  4MCP A;  3IO1 A;  3PFO A;  2J9A A;  4TJX A;  2I3C A;  3B2Y A;  3D67 A;  3NFZ A;  2XEG A;  2DEA A;  4C9V A;  1TKH A;  4KNG E;  2ZEM A;  3B35 A;  5LYD A;  2XEF A;  2PJ6 A;  4DYO A;  3SJG A;  3FED A;  2OOT A;  5K8M A;  1VIX A;  1BLL E;  1DE4 C;  4NGQ A;  1XRY A;  4UEE A;  1CP7 A;  3K9T A;  4Q7A A;  1ZLI A;  3IJ3 A;  1ZG8 A;  3SJX A;  4OKO A;  3SJE A;  2PJ3 A;  3VAR A;  4NFR A;  2PVV A;  2BO9 A;  3B3S A;  3RBU A;  4P44 A;  1CBX A;  3L2N A;  4FUU A;  3FEE A;  2JBK A;  1QMU A;  3FEC A;  4OC5 A;  5LYF A;  3V7Z A;  5ELY A;  5LYL A;  1R43 A;  3PFE A;  4PQA A;  1Z5R A;  3IFE A;  1FNO A;  4LQG A;  1TKF A;  2PJC A;  4UEZ A;  4JYW A;  2POK A;  4ZI6 A;  2Q4Z A;  3LMS A;  1VHO A;  4UF4 A;  2IMO A;  3JRU A;  4C85 A;  1M4L A;  5CBM A;  1DTD A;  4IHM A;  3NH8 A;  3RAM A;  3IEH A;  2PIY A;  4P45 A;  5HVH A;  1GYT A;  3VH9 A;  5HVF A;  2O4H A;  1QQ9 A;  5JGF A;  2WYR A;  4WWV A;  4ZX9 A;  3MRU A;  2PJ7 A;  2PJ1 A;  2V8G A;  3SI2 A;  4PPZ A;  4MHZ A;  4MCS A;  4P4I A;  1LAN A;  2AFZ A;  1ZG7 A;  4X8I A;  4MRI A;  2NYQ A;  1BPN A;  4CDJ A;  1LCP A;  4P4D A;  3D66 A;  5LRJ A;  3PB4 X;  1FT7 A;  1Z2L A;  1Q7L A;  4NGT A;  2PJA A;  4MCR A;  1VHE A;  2PJ2 A;  5K8N A;  4C8A A;  4NGP A;  1XJO A;  2PJ5 A;  3PBE A;  7CPA A;  2AFS A;  3NA6 A;  3I1U A;  3B3V A;  4MXU A;  5HXD A;  3IWW A;  2CTC A;  2F7V A;  1WVM A;  3S9M A;  4EWT A;  2ZEP A;  4EME A;  4O23 A;  3VTA A;  4ONW A;  5LRG A;  1R3N A;  2ZEL A;  4TWE A;  4R76 A;  3DGV A;  3D7H A;  4C86 A;  4UIA A;  2NSM A;  2PRQ A;  4TJV A;  2FVG A;  2V8V A;  5D8N A;  1OBR A;  4C8F A;  2PJ9 A;  3B3C A;  3KAS A;  2V8H A;  4PXE A;  2AFU A;  4ZX8 A;  4NGR A;  4C9U A;  4C8C A;  4ZYQ A;  3KI9 A;  3CPA A;  4F9U A;  3QNV A;  2XEI A;  3KGQ A;  3PEI A;  4C8U A;  3KQZ A;  2Q51 A;  2EK9 A;  3IC1 A;  3WC7 A;  2PVW A;  2IJZ A;  3B3W A;  3WT4 A;  1CP6 A;  4MMO A;  4B6Z A;  3VAT A;  1CX8 A;  3BI0 A;  2BCO A;  1XF1 A;  4UIB A;  4EFD A;  4FAI A;  4NGM A;  1YME A;  4PXD A;  1ZG9 A;  1LOK A;  5F09 A;  4PXB A;  4OC3 A;  2GLF A;  4OME A;  5HVG A;  2HC9 A;  3MN8 A;  3PB6 X;  4OC0 A;  3SI0 A;  3N5F A;  4YU9 A;  2CF4 A;  2ZOF A;  1Y0Y A;  1UWY A;  2EWB A;  2RFH A;  3CDX A;  3IIB A;  4AXV A;  4YN3 A;  3HUV A;  4ZY2 A;  3PBB A;  1RTQ A;  2C6P A;  4YWY A;  2PE3 A;  2C1C A;  5DS0 A;  3FF3 A;  2AFX A;  4UEF A;  3NH4 A;  1HDQ A;  4DUK A;  1AMP A;  1NSA A;  3HLP A;  5IB9 A;  3TC8 A;  1XMB A;  2XEJ A;  2BOA A;  3KR5 A;  1TF8 A;  2V8D A;  4OC2 A;  2EK8 A;  1JQG A;  1LAP A;  4NGS A;  2C6C A;  4TNU A;  4IK2 A;  4P6Y A;  3CT9 A;  4P10 A;  3WC5 A;  3ISX A;  2ZEG A;  2PJ4 A;  5I4M A;  3WC6 A;  3KHX A;  1CPS A;  5JH9 A;  3I6S A;  4NGN A;  1YW4 A;  3KZW A;  5K8O A;  1LAM A;  2AFO A;  2ZEN A;  2IQ6 A;  1KWM A;  3KL9 A;  3B3T A;  5LYI A;  3EIF A;  4IAV A;  2ZOG A;  3S9N A;  3FJU A;  1Z8L A;  1TF9 A;  1YW6 A;  4X2T A;  2ZEO A;  2V77 A;  3T8W A;  1LFW A;  1ARM A;  4A39 A;  3RZA A;  3WAB A;  1V6C A;  4R7M A;  3V38 A;  3FH4 A;  4G1P A;  1CG2 A;  2G9D A;  1Y0R A;  2ZEF A;  5CPA A;  2CTB A;  3H8E A;  4P4E A; 
#chains in the Genus database with same CATH topology
 2VBQ A;  3NH5 A;  2B0A A;  3HPG G;  3DLJ A;  2J8N A;  1A2Z A;  5AGE A;  4JZ0 A;  2WUU A;  2VL1 A;  4ZBG A;  4ZY1 A;  2ZW6 A;  1EE3 P;  5J8F A;  3I74 A;  4FBE A;  2XPO A;  4AVB A;  2GRE A;  2PIZ A;  1YRE A;  5G22 A;  1Y7E A;  3H8G A;  1YK3 A;  3IWE A;  3PGP A;  3H8F A;  3R9F A;  4CYN A;  1TXR A;  4W9Y A;  4JXQ A;  3R9E A;  4A37 A;  4CDK A;  4ORF A;  3R95 A;  1YVK A;  4H6U A;  4M6G A;  1F2O A;  4K3N A;  1AYE A;  4A33 A;  4CPA A;  4OID A;  5AG6 A;  2AFM A;  1R57 A;  4AB7 A;  1VBG A;  2Z11 A;  4NJR A;  3PB7 X;  4A2Z A;  4Z65 A;  5BWA B;  2XPN A;  3O8Z A;  4B10 A;  4E8O A;  5J1Q A;  2JEW A;  3RYO A;  2ZEE A;  1YSJ A;  2H5M A;  2G0B A;  2FT0 A;  3CPX A;  4C68 A;  2AUN A;  4C8P A;  2CIJ A;  3D7G A;  1F2P A;  3T90 A;  2OZU A;  4KOU A;  4P4F A;  1CM0 A;  1FY7 A;  2Q7S A;  1KC7 A;  2JBJ A;  1TKJ A;  1ZLH A;  3D2M A;  2ZED A;  1XFO A;  2QYV A;  3A9L A;  1B47 A;  3D7F A;  1ARL A;  2GE3 A;  2OU2 A;  4MHY A;  4OC1 A;  1Y9K A;  4A94 A;  4CAW A;  4F9V A;  3GB0 A;  3VWE A;  1HDU A;  1YLO A;  2WPX A;  3S9L A;  5J3X A;  3E0K A;  3KHZ A;  3PB8 X;  1YX0 A;  2X7B A;  4KOS A;  4XNH C;  5AG7 A;  4CAV A;  3KQX A;  4R9M A;  3T9Y A;  5JVL A;  2HRO A;  2Q43 A;  4H2K A;  4H89 A;  2O53 A;  3PRT A;  4QC6 A;  3SHP A;  3BHX A;  1XIX A;  3GLJ A;  5F5X A;  2Q4Y A;  3VRR A;  5D29 A;  1YGH A;  3FVL A;  3VRN A;  1J4J A;  3FMC A;  3FX6 A;  4KSF A;  2ANP A;  3LWU A;  2P0W A;  3S6K A;  4IIX A;  2FSR A;  1CPX A;  5LRK A;  3IGR A;  3OWC A;  1P4N A;  3D4U A;  2ABZ A;  4M3S A;  2KCW A;  4LX9 A;  1F57 A;  4UFW A;  3HPH E;  4UCN A;  3SXN A;  5JPH A;  3GUX A;  1C3O B;  1VGY A;  3G8W A;  2Q0Y A;  3U1B A;  2GLJ A;  1PYT B;  4MCQ A;  1XBU A;  1IGB A;  3VRO A;  2YNC C;  3PP9 A;  8CPA A;  3DNS A;  4Y49 C;  3BJ7 A;  4GM5 A;  1HEE A;  3VGO A;  3OAK A;  5KTA A;  5HKW A;  4MHP A;  5HKY A;  4WJB A;  4CYQ A;  4C99 A;  1NBW A;  2P6E A;  4A4C A;  3ICU A;  1IY7 A;  2ZEH A;  4C9R A;  4HPS A;  4C8T A;  2EO8 A;  5EC4 A;  1TIQ A;  1CS0 B;  3F0A A;  2WZN A;  2QJ8 A;  1S7F A;  4C2X A;  4OC4 A;  1M4I A;  2PSW A;  3TX8 A;  1Y9Z A;  2PCU A;  1PCA A;  4MHN A;  4F8Z A;  2F5I A;  3W6X A;  3EXN A;  2ODF A;  4FD5 A;  2C5Q A;  4KUA A;  3BUX B;  2RB7 A;  2YNC A;  4GS4 A;  4B13 A;  1LRZ A;  4H6Z A;  1EZB A;  2R7H A;  5THW A;  5K8P A;  2YJV A;  1GHE A;  3K2K A;  4CO9 A;  5F13 A;  2OR4 A;  3CXP A;  3SJF A;  6CPA A;  1WWZ A;  1ELL P;  3PB9 X;  2F8H A;  3FNC A;  4KSA A;  2Q4V A;  4OIW A;  1Z8X A;  4JXR A;  4A38 A;  4NJQ A;  3V8I A;  3IWG A;  4J3G A;  3D68 A;  4PXC A;  2BL1 A;  4R8F A;  1XF8 A;  4P4J A;  2AFW A;  3W91 A;  4M6H A;  2GFQ A;  4RUH A;  4ONU A;  4P4B A;  1BAV A;  1VI4 A;  2PJB A;  4C9E A;  2C6G A;  3B7I A;  5G21 A;  2ARH A;  3BI1 A;  1BPM A;  4BD9 A;  3BJ8 A;  1Z9U A;  2PRB A;  4JLY A;  3CXS A;  4ZY0 A;  1NSL A;  4KSI A;  4HNY B;  5JM6 A;  4R6T A;  1Y9W A;  3ISZ A;  4UWI A;  2B5G B;  4BIN A;  4C9A A;  1H8L A;  3LAC A;  4XPD C;  3SI1 A;  4CS0 B;  5FVJ A;  1JDE A;  2QVP A;  4KOV A;  3OP0 A;  4MI4 A;  3K9U A;  3UY5 A;  5A28 A;  2B3U A;  4RR2 B;  4MFL A;  2FIA A;  3BUW B;  3TO6 A;  2HI6 A;  4II9 A;  3BXM A;  4KOW A;  4DJL A;  4J0N A;  4FWU A;  2GU2 A;  4X3R A;  1XE4 A;  1KEE B;  4C84 A;  1JWQ A;  2NMT A;  2PJ0 A;  4OP4 A;  2D4O A;  1ELM P;  2HB6 A;  5G20 A;  1IU8 A;  2PJ8 A;  3KR4 A;  3KRV A;  3G3S A;  1VBH A;  2AJ6 A;  5FD8 A;  1B87 A;  4XNH B;  3D7D A;  4MCP A;  2B58 A;  3IO1 A;  3PFO A;  2J9A A;  1YQE A;  4E0A A;  4MJ8 A;  2VQY A;  4TJX A;  2CY2 A;  2I3C A;  3B2Y A;  3D67 A;  3LD2 A;  3G23 A;  1IYK A;  2AUM A;  3TLB A;  1IYL A;  2Q44 A;  3NFZ A;  2XEG A;  2DEA A;  4C9V A;  1TKH A;  4B14 A;  4BTF A;  2JDD A;  1BO4 A;  4AG9 A;  1M44 A;  2B4D A;  4KNG E;  1BXR B;  2ZEM A;  1KUV A;  1AUG A;  3B35 A;  5LYD A;  5C88 A;  4JJX A;  2XEF A;  2PJ6 A;  4NEX A;  3SJG A;  4DYO A;  3FED A;  4F0X A;  2OOT A;  5K8M A;  3TLG B;  1Q2D A;  1VIX A;  1BLL E;  1DE4 C;  4NGQ A;  1XRY A;  4UEE A;  3TYX A;  1EO0 A;  4A30 A;  1CP7 A;  4PSX A;  1X12 A;  3K9T A;  4Q7A A;  2GP4 A;  1ZLI A;  4B5P B;  1Z9E A;  3VRQ A;  5HKZ A;  3QB8 A;  3IJ3 A;  1ZG8 A;  3SJX A;  4MY3 A;  3SJE A;  2BSW A;  4OKO A;  5F48 A;  2PJ3 A;  5JYB A;  3FB3 A;  3VAR A;  4NFR A;  4RI1 A;  2PVV A;  1P0H A;  4C2Y A;  2CBL A;  2BO9 A;  3B3S A;  2WPW A;  3RBU A;  2BEI A;  4DNC A;  4P44 A;  4BBH A;  1CBX A;  3CXQ A;  3L2N A;  4FUU A;  4KZT A;  3FEE A;  1S7L A;  4MI1 A;  3GJZ A;  2JBK A;  4JVO A;  1L0C A;  1IID A;  1QMU A;  3FEC A;  4OC5 A;  2VKZ G;  3FYN A;  2Z3M A;  4CAX A;  3S6F A;  5DWM A;  3V7Z A;  4M6I A;  5LYF A;  5ELY A;  3D8P A;  5LYL A;  1R43 A;  3PFE A;  2Y0M A;  4PQA A;  1Z5R A;  4M85 A;  3IU2 A;  4CYO A;  2D0P A;  3IFE A;  3PFV A;  1FNO A;  1KUY A;  2K5T A;  4LQG A;  4LQ6 A;  3F5B A;  1ZRS A;  3H5Z A;  3QAH A;  1QST A;  2REE A;  1TKF A;  2PJC A;  4UEZ A;  4JYW A;  2POK A;  4ZI6 A;  5HH1 A;  4MFQ A;  1IOI A;  2Q4Z A;  3LMS A;  3BUO B;  3OB1 B;  2GAN A;  1VHO A;  4BPW B;  4UF4 A;  3EY5 A;  2IMO A;  4NXY A;  3JRU A;  4C85 A;  1M4L A;  5F46 A;  4EVY A;  5CBM A;  1DTD A;  1IIC A;  3R96 A;  3OB2 B;  4IHM A;  4KOR A;  2J8M A;  3NH8 A;  3RAM A;  1C30 B;  4XPL A;  3IEH A;  2A4N A;  4P45 A;  2PIY A;  5HVH A;  1GYT A;  3VH9 A;  5HVF A;  4XPD B;  4A95 A;  4MJX A;  4GXH A;  2ZXV A;  4QBJ A;  2O4H A;  1QQ9 A;  1Y7R A;  4CAE A;  2JEV A;  2WYR A;  5JGF A;  3EZE A;  1RXT A;  3FBU A;  4WWV A;  3SXO A;  4OLL A;  4ZX9 A;  3ZNI A;  3MRU A;  1XOV A;  2PJ7 A;  2PJ1 A;  2V8G A;  4E94 A;  2B4J C;  1KUX A;  4CGN A;  2QML A;  3SI2 A;  2YND A;  4CAF A;  2FL4 A;  4PPZ A;  3NE8 A;  2B4D B;  4MHZ A;  5ISV A;  1KBL A;  2D4P A;  4QVT A;  5CNP A;  4RN7 A;  5F47 A;  5C82 A;  3ZZI A;  1IB1 E;  4MCS A;  3DDD A;  2PR1 A;  4IF5 A;  4P4I A;  4JD6 A;  2OLS A;  1LAN A;  4E2A A;  2AFZ A;  1MJ9 A;  3I3G A;  1ZG7 A;  4KS9 A;  3TTH A;  5IB0 A;  1X10 A;  4X8I A;  1MJA A;  4MRI A;  3U88 C;  2CNT A;  2NYQ A;  1BPN A;  4CDJ A;  2OH1 A;  1UFH A;  3EZB A;  1LCP A;  4P4D A;  1ZO0 A;  3D66 A;  3QAY A;  2DPT A;  5H84 A;  5LRJ A;  4CYP A;  4M8D A;  3PB4 X;  1FT7 A;  1M4D A;  1S5K A;  1Z2L A;  3TFY A;  2PC1 A;  2HUZ A;  4R87 A;  3TCV A;  2PQ8 A;  1Q7L A;  4NGT A;  5DWN A;  4COG A;  1VKC A;  2PJA A;  4MCR A;  1VHE A;  2PJ2 A;  5IV0 A;  5K8N A;  1T36 B;  4HNW B;  4Q38 A;  4C8A A;  3TT2 A;  4NGP A;  1XJO A;  4KVO E;  2CXA A;  2G3T A;  4XPK A;  5AXI A;  2PJ5 A;  3PBE A;  1Q5X A;  7CPA A;  1VHS A;  2AFS A;  2ZW7 A;  3NA6 A;  2B3V A;  2R98 A;  3TOB A;  3I1U A;  1XEB A;  1PUA A;  3B3V A;  3GIU A;  4UCP A;  5H86 A;  2ZW4 A;  2OZH A;  2VI7 A;  5AG5 A;  1I12 A;  1U6M A;  2REF A;  3H4Q A;  3TOA A;  2Y1M A;  2HWG A;  4MXU A;  5HXD A;  1KZF A;  1S60 A;  3LOD A;  3D3S A;  3IWW A;  1S7K A;  1XMT A;  2CTC A;  2DXQ A;  2DPS A;  2F7V A;  5HMN A;  3D2P A;  3MGD A;  4INJ A;  1WVM A;  2VZY A;  3S9M A;  3TO7 A;  4NF1 A;  4AVA A;  5EMI A;  4EWT A;  5K99 A;  2VEZ A;  4UBR A;  2ZEP A;  4EME A;  1R61 A;  4O23 A;  3VTA A;  4Q36 A;  2Y1N A;  5F1Y A;  1IOF A;  4BMH A;  4ONW A;  3K4I A;  5LRG A;  3ZJ0 A;  4QUS A;  1NE9 A;  4MBU A;  1R3N A;  4B5O A;  2ZEL A;  2JLM A;  4CZ1 A;  4TWE A;  4OAD A;  4R76 A;  1S7N A;  3DGV A;  1GGO A;  2CNS A;  4UFX A;  5F49 A;  3D7H A;  1A9X B;  4C86 A;  4UIA A;  1ZL0 A;  3DSB A;  2MP0 A;  5I0C A;  2NSM A;  2PRQ A;  1RO5 A;  4MFZ A;  4RS2 A;  4KOX A;  4TJV A;  3TLY A;  2FVG A;  2V8V A;  3R9G A;  4PV6 A;  5D8N A;  1OBR A;  4KUB A;  4C8F A;  2PJ9 A;  5AG4 A;  3TLC A;  3B3C A;  3KAS A;  2FE7 A;  3EFA A;  4PK3 A;  5GCN A;  2V8H A;  4PXE A;  2R82 A;  2AFU A;  1JDB C;  1Q2Y A;  4ZX8 A;  4NGR A;  5BY0 A;  2X0S A;  4C8C A;  4C9U A;  2AE6 A;  4Y49 B;  4ZYQ A;  1B6B A;  3B8G A;  3KI9 A;  1Z4E A;  4YRH A;  3CPA A;  4F9U A;  2HV2 A;  1J3L A;  1ZYM A;  1V0C A;  3QNV A;  2XEI A;  3KGQ A;  1YLE A;  4MHD A;  4UWJ A;  2R8V A;  3PEI A;  4C8U A;  4MFK A;  2B4B A;  4A32 A;  3KQZ A;  2Q51 A;  2EK9 A;  3IC1 A;  3WC7 A;  2EBJ A;  3C26 A;  3EO4 A;  3FXT A;  2PVW A;  1Z8W A;  2D0O A;  2IJZ A;  3B3W A;  4KVM E;  1M1D A;  2OZG A;  3WT4 A;  3T05 A;  1CP6 A;  2YGW A;  2J8R A;  4MMO A;  2DF5 A;  2R1I A;  3NE7 A;  3VAT A;  4B6Z A;  1CX8 A;  3BI0 A;  4PSW A;  2N3A B;  4NSQ A;  2FS5 A;  2BCO A;  4KOT A;  1XF1 A;  5EBV A;  2PCN A;  2P6F A;  3JTK A;  3KKW A;  4UIB A;  4EFD A;  3IU1 A;  1NXJ A;  3TLE A;  5JQ4 A;  4FAI A;  4GPL B;  4A4B A;  4NGM A;  1YME A;  2I00 A;  5F9M A;  4PXD A;  3EC4 A;  4C7H A;  5IR2 A;  1YR0 A;  4I49 A;  1ZG9 A;  3BUN B;  1LOK A;  4KOY A;  2YJT A;  3HMJ G;  2VZZ A;  3F8K A;  5F09 A;  4MFP A;  4PXB A;  4FD4 A;  5A27 A;  2FM4 A;  4OC3 A;  5KTD A;  2EZB A;  2GLF A;  4OME A;  4KLW A;  4A31 A;  3RO0 A;  3N7Z A;  3NFQ A;  5HVG A;  4L8A A;  2HC9 A;  2B5G A;  3MN8 A;  4LUA A;  4UFV A;  3PB6 X;  4OC0 A;  4KLV A;  3WR7 A;  3T5M A;  3SI0 A;  2Z3N A;  4FD7 A;  2FXF A;  3N5F A;  2XPP A;  4YU9 A;  4C2Z A;  3GY9 A;  2DIK A;  3F9K C;  2CF4 A;  3DR6 A;  2ZOF A;  1QSN A;  1Y0Y A;  4U9Y A;  1NMT A;  1UWY A;  4R3L A;  2EWB A;  2EZC A;  4BPX B;  2RFH A;  2WSA A;  3CDX A;  3IIB A;  4NCZ A;  4U5Y A;  4AXV A;  5J8C A;  1EZA A;  4YN3 A;  3HUV A;  4ZY2 A;  3PBB A;  1RTQ A;  2GIV A;  2RC4 A;  1Z8T A;  2C6P A;  4YWY A;  2PE3 A;  1I21 A;  5KTC A;  3P2F A;  3C8O A;  2ZW5 A;  4COB A;  2QIR A;  3CZX A;  2C1C A;  4AG7 A;  4PK2 A;  1OZP A;  5DS0 A;  3FF3 A;  2EZA A;  2AFX A;  4BPU B;  4UEF A;  3NOJ A;  1BOB A;  2DLA A;  3NH4 A;  4H1H A;  4X5K A;  1HDQ A;  2FIW A;  4DUK A;  2XPL A;  1AMP A;  2Q7B A;  2P6G A;  1NSA A;  5G1Z A;  4CRY B;  3HLP A;  4JWP A;  4CGP A;  4CRZ B;  3TC8 A;  1XMB A;  2HQY A;  5IB9 A;  2XEJ A;  3S6G A;  2O28 A;  3DR8 A;  4EYS A;  4R3K A;  2Z3K A;  2EUI A;  3TLA A;  2BOA A;  3TLZ A;  1QSR A;  2G3A A;  3JUW A;  3KR5 A;  2YNE A;  3PZJ A;  3JVN A;  1TF8 A;  2V8D A;  1QSM A;  4CGM A;  3TLG A;  3R1K A;  4OC2 A;  2EK8 A;  1JQG A;  1LAP A;  4NGS A;  2C6C A;  4TNU A;  3BUM B;  4IK2 A;  4P6Y A;  4B5P A;  3CT9 A;  1PU9 A;  4HNX B;  4P10 A;  2C27 A;  4R57 A;  3WC5 A;  3ISX A;  2BUE A;  1WJT A;  1MK4 A;  2ZEG A;  1CE8 B;  1M6V B;  2PJ4 A;  1SQH A;  4L89 A;  3WC6 A;  3KHX A;  5I4M A;  1CPS A;  3I9S A;  4MY0 A;  5JH9 A;  3T07 A;  5IX3 A;  3EZA A;  5E96 A;  3TE4 A;  2Z0Z A;  3W6S A;  1Q2C A;  3I6S A;  4NGN A;  2I79 A;  4CGO A;  2FCK A;  3VWD A;  2Z3O A;  4F6A A;  2Z10 A;  2ZPA A;  1S3Z A;  1YW4 A;  3KZW A;  4QB9 A;  1LAM A;  2AFO A;  2ZEN A;  2IQ6 A;  5K8O A;  4IIY A;  4YFJ A;  2QEC A;  1KWM A;  1FBV A;  3FIX A;  3KL9 A;  3TO9 A;  3FRM A;  3RNZ A;  1QSO A;  2PR8 A;  2Z3P A;  3B3T A;  5LYI A;  3EIF A;  4FD6 A;  4IAV A;  2ZOG A;  3S9N A;  3GYA A;  3SR3 A;  4OAE A;  1ON0 A;  3FJU A;  2PDO A;  3PT1 A;  1YVO A;  1Z8L A;  1TF9 A;  2UV8 G;  1YW6 A;  4X2T A;  4MFJ A;  1WK4 A;  4IUS A;  4UA3 A;  2ZEO A;  2IL4 A;  4AVC A;  4ZGY B;  4E5S A;  2CNM A;  3S6H A;  1I1D A;  2EVN A;  2V77 A;  3T8W A;  4C7I A;  3BLN A;  1LFW A;  1N71 A;  1ARM A;  2OB0 A;  3P2H A;  4CGL A;  3T0T A;  4A39 A;  1MJB A;  3GKR A;  1Z4R A;  2JDC A;  3RZA A;  3WAB A;  1V6C A;  1M4G A;  4UCM A;  4B12 A;  2Q04 A;  1CJW A;  4F0Y A;  4R7M A;  4U9Z A;  3V38 A;  4YGO A;  2Z3L A;  3FH4 A;  4B11 A;  4G1P A;  4K30 A;  4HKF A;  3PLF B;  1CG2 A;  4KVX A;  2G9D A;  1Y0R A;  2VXK A;  2ZEF A;  5CPA A;  1DIK A;  2E28 A;  2CTB A;  3VRP A;  3H8E A;  1K4J A;  2ATR A;  4P4E A;  1YVH A; 
#chains in the Genus database with same CATH homology
 3NH5 A;  3DLJ A;  4JZ0 A;  2VL1 A;  4ZY1 A;  1EE3 P;  3I74 A;  4FBE A;  2GRE A;  2PIZ A;  1Y7E A;  3H8G A;  3H8F A;  1TXR A;  4W9Y A;  4CDK A;  4A37 A;  1F2O A;  4K3N A;  1AYE A;  4CPA A;  4OID A;  2AFM A;  4NJR A;  3PB7 X;  4Z65 A;  5J1Q A;  2JEW A;  2ZEE A;  1YSJ A;  3CPX A;  4C8P A;  2CIJ A;  3D7G A;  1F2P A;  4P4F A;  2JBJ A;  1TKJ A;  1ZLH A;  2ZED A;  1XFO A;  2QYV A;  4MHY A;  1ARL A;  3D7F A;  4F9V A;  4OC1 A;  4A94 A;  3GB0 A;  1HDU A;  1YLO A;  3S9L A;  3KHZ A;  3PB8 X;  3KQX A;  2Q43 A;  4H2K A;  2O53 A;  3PRT A;  3BHX A;  3GLJ A;  5D29 A;  3FVL A;  3FMC A;  3FX6 A;  2ANP A;  3LWU A;  1CPX A;  5LRK A;  3D4U A;  2ABZ A;  1F57 A;  3GUX A;  1VGY A;  2GLJ A;  1PYT B;  4MCQ A;  1XBU A;  1IGB A;  8CPA A;  4GM5 A;  1HEE A;  4MHP A;  4WJB A;  4C99 A;  3ICU A;  1IY7 A;  2ZEH A;  4C9R A;  4C8T A;  2WZN A;  2QJ8 A;  4OC4 A;  1Y9Z A;  3TX8 A;  2PCU A;  1PCA A;  4MHN A;  4F8Z A;  2C5Q A;  2RB7 A;  5K8P A;  5THW A;  3K2K A;  2OR4 A;  3SJF A;  6CPA A;  1ELL P;  3PB9 X;  2F8H A;  4OIW A;  4A38 A;  4NJQ A;  4PXC A;  3D68 A;  4R8F A;  4P4J A;  2AFW A;  4RUH A;  4P4B A;  1BAV A;  4C9E A;  2PJB A;  2C6G A;  3B7I A;  3BI1 A;  1BPM A;  4BD9 A;  4ZY0 A;  4KSI A;  5JM6 A;  4R6T A;  3ISZ A;  4C9A A;  1H8L A;  3SI1 A;  2QVP A;  3BXM A;  4DJL A;  4FWU A;  2GU2 A;  4X3R A;  4C84 A;  2PJ0 A;  4OP4 A;  1ELM P;  2HB6 A;  2PJ8 A;  3KR4 A;  3D7D A;  4MCP A;  3IO1 A;  3PFO A;  2J9A A;  4TJX A;  2I3C A;  3B2Y A;  3D67 A;  3NFZ A;  2XEG A;  2DEA A;  4C9V A;  1TKH A;  4KNG E;  2ZEM A;  3B35 A;  5LYD A;  2XEF A;  2PJ6 A;  4DYO A;  3SJG A;  3FED A;  2OOT A;  5K8M A;  1VIX A;  1BLL E;  1DE4 C;  4NGQ A;  1XRY A;  4UEE A;  1CP7 A;  3K9T A;  4Q7A A;  2GP4 A;  1ZLI A;  3IJ3 A;  1ZG8 A;  3SJX A;  4OKO A;  3SJE A;  2PJ3 A;  3VAR A;  4NFR A;  2PVV A;  2BO9 A;  3B3S A;  3RBU A;  4P44 A;  1CBX A;  3L2N A;  4FUU A;  3FEE A;  2JBK A;  1QMU A;  3FEC A;  4OC5 A;  5LYF A;  3V7Z A;  5ELY A;  5LYL A;  1R43 A;  3PFE A;  4PQA A;  1Z5R A;  3IFE A;  1FNO A;  4LQG A;  1TKF A;  2PJC A;  4UEZ A;  4JYW A;  2POK A;  4ZI6 A;  2Q4Z A;  3LMS A;  1VHO A;  4UF4 A;  2IMO A;  3JRU A;  4C85 A;  1M4L A;  5CBM A;  1DTD A;  4IHM A;  3NH8 A;  3RAM A;  3IEH A;  2PIY A;  4P45 A;  5HVH A;  1GYT A;  3VH9 A;  5HVF A;  2O4H A;  1QQ9 A;  5JGF A;  2WYR A;  4WWV A;  4ZX9 A;  3MRU A;  2PJ7 A;  2PJ1 A;  2V8G A;  3SI2 A;  4PPZ A;  4MHZ A;  4MCS A;  4P4I A;  1LAN A;  2AFZ A;  1ZG7 A;  4X8I A;  4MRI A;  2NYQ A;  1BPN A;  4CDJ A;  1LCP A;  4P4D A;  3D66 A;  5LRJ A;  3PB4 X;  1FT7 A;  1Z2L A;  1Q7L A;  4NGT A;  2PJA A;  4MCR A;  1VHE A;  2PJ2 A;  5K8N A;  4C8A A;  4NGP A;  1XJO A;  2PJ5 A;  3PBE A;  7CPA A;  2AFS A;  3NA6 A;  3I1U A;  3B3V A;  4MXU A;  5HXD A;  3IWW A;  2CTC A;  2F7V A;  1WVM A;  3S9M A;  4EWT A;  2ZEP A;  4EME A;  4O23 A;  3VTA A;  4ONW A;  5LRG A;  1R3N A;  2ZEL A;  4TWE A;  4R76 A;  3DGV A;  3D7H A;  4C86 A;  4UIA A;  2NSM A;  2PRQ A;  4TJV A;  2FVG A;  2V8V A;  5D8N A;  1OBR A;  4C8F A;  2PJ9 A;  3B3C A;  3KAS A;  2V8H A;  4PXE A;  2AFU A;  4ZX8 A;  4NGR A;  4C9U A;  4C8C A;  4ZYQ A;  3KI9 A;  3CPA A;  4F9U A;  3QNV A;  2XEI A;  3KGQ A;  3PEI A;  4C8U A;  3KQZ A;  2Q51 A;  2EK9 A;  3IC1 A;  3WC7 A;  2PVW A;  2IJZ A;  3B3W A;  3WT4 A;  1CP6 A;  4MMO A;  4B6Z A;  3VAT A;  1CX8 A;  3BI0 A;  2BCO A;  1XF1 A;  4UIB A;  4EFD A;  4FAI A;  4NGM A;  1YME A;  4PXD A;  5IR2 A;  1ZG9 A;  1LOK A;  5F09 A;  4PXB A;  4OC3 A;  2GLF A;  4OME A;  5HVG A;  2HC9 A;  3MN8 A;  3PB6 X;  4OC0 A;  3SI0 A;  3N5F A;  4YU9 A;  2CF4 A;  2ZOF A;  1Y0Y A;  1UWY A;  2EWB A;  2RFH A;  3CDX A;  3IIB A;  4AXV A;  4YN3 A;  3HUV A;  4ZY2 A;  3PBB A;  1RTQ A;  2C6P A;  4YWY A;  2PE3 A;  2C1C A;  5DS0 A;  3FF3 A;  2AFX A;  4UEF A;  3NH4 A;  1HDQ A;  4DUK A;  1AMP A;  1NSA A;  3HLP A;  5IB9 A;  3TC8 A;  1XMB A;  2XEJ A;  2BOA A;  3KR5 A;  1TF8 A;  2V8D A;  4OC2 A;  2EK8 A;  1JQG A;  1LAP A;  4NGS A;  2C6C A;  4TNU A;  4IK2 A;  4P6Y A;  3CT9 A;  4P10 A;  3WC5 A;  3ISX A;  2ZEG A;  2PJ4 A;  5I4M A;  3WC6 A;  3KHX A;  1CPS A;  5JH9 A;  3I6S A;  4NGN A;  1YW4 A;  3KZW A;  5K8O A;  1LAM A;  2AFO A;  2ZEN A;  2IQ6 A;  1KWM A;  3KL9 A;  3B3T A;  5LYI A;  3EIF A;  4IAV A;  2ZOG A;  3S9N A;  3FJU A;  1Z8L A;  1TF9 A;  1YW6 A;  4X2T A;  2ZEO A;  2V77 A;  3T8W A;  1LFW A;  1ARM A;  4A39 A;  3RZA A;  3WAB A;  1V6C A;  4R7M A;  3V38 A;  3FH4 A;  4G1P A;  1CG2 A;  2G9D A;  1Y0R A;  2ZEF A;  5CPA A;  2CTB A;  3H8E A;  4P4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...