3BI1A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of methotrexate-glu
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bi1A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bi1A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bi1A02
4R8FA 5CPAA 2QVPA 4CPAA 1CX8A 2Q51A 3PB8X 3D7HA 4EWTA 2GU2A 1F2OA 3KGQA 2JBJA 2AFUA 3CT9A 3D7DA 2AFWA 5I4MA 4F8ZA 5JH9A 4PPZA 3PB4X 2PIYA 2NSMA 3WC7A 4B6ZA 2GLFA 2ZOGA 4UEEA 2G9DA 1ARLA 4DYOA 4G1PA 4MHPA 2PJ2A 4PQAA 2EK9A 4YWYA 5THWA 1ELLP 4NFRA 4OC4A 1LOKA 4OC0A 1YW4A 2C6CA 1ZG7A 2EWBA 2J9AA 5HVGA 3K2KA 1YMEA 4MCSA 2PJ5A 2ZEEA 1KWMA 3FEEA 2XEGA 2C6PA 2JBKA 1Z8LA 1Q7LA 1XF1A 1FNOA 2ANPA 4ZI6A 3H8GA 3S9MA 1HDUA 2ZENA 3PEIA 3KL9A 3GB0A 1M4LA 1TF9A 4TJXA 3B3TA 4C9RA 2BCOA 3KI9A 3IJ3A 4GM5A 2ABZA 5D29A 4MHYA 3B3SA 4OIDA 4C9AA 2BOAA 3IO1A 4MCPA 4P4DA 2CF4A 1ZG9A 2GREA 3B3CA 4OC5A 3KR4A 4ZY1A 3VTAA 3WC6A 3ICUA 3NH5A 3VATA 3N5FA 5HXDA 1DE4C 2ZEMA 2PCUA 3T8WA 4ZY0A 1V6CA 2PJ3A 4UIAA 2AFXA 3KQXA 4AXVA 3FX6A 1WVMA 2OR4A 4A38A 4FUUA 3HLPA 2FVGA 1NSAA 3RBUA 5K8OA 3SJGA 3LWUA 2HC9A 4F9VA 4K3NA 3WC5A 5LYLA 4NGRA 3KZWA 2IMOA 5HVHA 3HUVA 1YW6A 5K8NA 4P45A 4C9UA 3CDXA 2POKA 2ZEFA 1XFOA 3KR5A 3IC1A 5IB9A 1TXRA 2GLJA 3NFZA 2HB6A 3FMCA 4FBEA 4X8IA 3I1UA 3IWWA 3FVLA 1BAVA 5DS0A 4TJVA 2ZELA 1QQ9A 3TC8A 3D4UA 2XEFA 3ISZA 4IHMA 3SJXA 2V8DA 1XJOA 1H8LA 3VH9A 4YU9A 4MCRA 1TKHA 3NH8A 4IAVA 3JRUA 4NGSA 4OC2A 3B3WA 1CPSA 4P10A 2V77A 4PXBA 3I74A 4C8TA 4OIWA 1LAMA 4C85A 2JEWA 2Q4ZA 2ZOFA 4MXUA 2AFSA 2RB7A 4JYWA 1ZLHA 3PRTA 3FJUA 3RAMA 2DEAA 3B35A 3LMSA 4ONWA 4R6TA 3B7IA 2I3CA 2CIJA 2C6GA 3FH4A 2PVWA 3FECA 5J1QA 4C99A 4ZX8A 2QJ8A 3TX8A 4EFDA 2O4HA 1TKFA 4TWEA 4ZX9A 4O23A 5F09A 3FF3A 4BD9A 4P4EA 4OMEA 3DLJA 4EMEA 4C8UA 3WABA 3KHXA 3K9TA 4NGMA 3L2NA 4NGPA 1CPXA 3GLJA 4WWVA 1VHEA 2EK8A 1PYTB 5D8NA 3SI2A 4C8CA 1XMBA 3RZAA 6CPAA 1Y0RA 2WZNA 4NJQA 4C86A 3IEHA 4KSIA 3PB7X 1Z2LA 3V7ZA 3B2YA 1DTDA 3B3VA 1CBXA 3D67A 3CPAA 4JZ0A 4ZYQA 3GUXA 3QNVA 4F9UA 3MN8A 3PFOA 1QMUA 2QYVA 5ELYA 2V8VA 4Z65A 1VHOA 5LYFA 4NGNA 3BI1A 4CDJA 3H8FA 2CTBA 3MRUA 4KNGE 2RFHA 4IK2A 2O53A 1BPNA 2PJAA 1BLLE 4UF4A 2ZEOA 3IIBA 4UIBA 4OC1A 1HDQA 2VL1A 5LRGA 3PBBA 3SI0A 1OBRA 5K8MA 4NGTA 3BI0A 4R76A 2PJ6A 4WJBA 4FWUA 1PCAA 4MHNA 4W9YA 2ZEHA 2XEIA 1UWYA 1CP7A 4Q7AA 2PJ0A 3CPXA 3DGVA 2PIZA 1BPMA 3D7GA 3SI1A 2PJ7A 5CBMA 2F7VA 1YSJA 3D68A 3D66A 4DJLA 3VARA 7CPAA 1YLOA 3BXMA 1RTQA 5LYIA 3IFEA 1XBUA 2V8HA 3FEDA 8CPAA 5K8PA 2ZEPA 4X3RA 5LRJA 4MCQA 4OC3A 2AFOA 2Q43A 3KHZA 3NH4A 1TKJA 2AFMA 1IY7A 4YN3A 2PJ1A 3BHXA 1IGBA 1Y0YA 3PFEA 4P4FA 3PB9X 3SJFA 2NYQA 2OOTA 4P4IA 3PBEA 4PXEA 1Z5RA 4C9EA 1CP6A 4C9VA 2AFZA 2PJ9A 4RUHA 4ZY2A 5JGFA 4NGQA 2XEJA 1LCPA 1ELMP 4P6YA 1TF8A 2ZEDA 4P4JA 1FT7A 1CG2A 4LQGA 4UEZA 3PB6X 4DUKA 3WT4A 2V8GA 4A94A 2PRQA 5LYDA 4A39A 4R7MA 3KQZA 4NJRA 4MMOA 1LANA 1F2PA 4P4BA 1VGYA 2IQ6A 2ZEGA 4C8PA 3H8EA 4TNUA 2PJBA 2F8HA 3S9LA 5LRKA 1JQGA 3I6SA 5JM6A 4OP4A 2CTCA 1GYTA 1ZLIA 3SJEA 4PXDA 1R3NA 4H2KA 2WYRA 1EE3P 1ARMA 4MRIA 4CDKA 1R43A 1AYEA 2C1CA 1HEEA 3KASA 4P44A 4MHZA 4C8AA 2PVVA 4A37A 4FAIA 2IJZA 2BO9A 5HVFA 1LFWA 3S9NA 1ZG8A 4PXCA 2PE3A 2PJ4A 2PJ8A 1LAPA 4X2TA 3EIFA 2PJCA 1F57A 4OKOA 4UEFA 1Y9ZA 3NA6A 4C8FA 3D7FA 1XRYA 4C84A 3V38A 3ISXA 1VIXA 1AMPA 1Y7EA
chains in the Genus database with same CATH superfamily
1P4NA 1R57A 4XPDB 3EC4A 4R8FA 5CPAA 2J8MA 1QSNA 3N7ZA 2YNCC 2QVPA 3IU2A 3QB8A 4YGOA 3TE4A 4CPAA 1CX8A 3TO7A 3IU1A 1Z8WA 2K5TA 3TLCA 2Q51A 3PP9A 2VI7A 4M6IA 4H1HA 3PB8X 5F13A 3D7HA 2FXFA 4KOWA 5KTAA 4EWTA 2B58A 2GU2A 1I21A 1F2OA 4QUSA 3KGQA 1NXJA 4F0XA 2JBJA 2AFUA 3CT9A 4CYPA 3D7DA 5AXIA 2AFWA 3OP0A 4A33A 2AUNA 5I4MA 4F8ZA 1B47A 3R9EA 5IB0A 4PPZA 3PB4X 4FD6A 2PIYA 2NSMA 3EFAA 3WC7A 4B6ZA 5JH9A 1Q5XA 4E5SA 1KBLA 2C5QA 2GLFA 1VBGA 4C2ZA 3RNZA 2ZOGA 2HQYA 4PK2A 3EO4A 4UEEA 2G9DA 3OWCA 3RYOA 1ARLA 3NOJA 3NE7A 4DYOA 4G1PA 4MHPA 2PJ2A 4PQAA 2EK9A 3S6FA 3CXSA 4YWYA 5THWA 1ELLP 2PDOA 2Y1MA 4OC4A 4NFRA 2ARHA 1LOKA 3T90A 2G3TA 4OC0A 3BUMB 1YW4A 2C6CA 1ZG7A 2EWBA 2J9AA 2ZW4A 4XPDC 5HVGA 3K2KA 1YR0A 1YMEA 3KKWA 3R9GA 4MCSA 2PJ5A 2OZHA 5GCNA 2ZEEA 3D8PA 4L89A 1KWMA 4JLYA 4XNHB 4F0YA 4H6UA 3FEEA 4M3SA 3TFYA 2C6PA 2XEGA 4Y49B 2JBKA 1Z8LA 2B5GB 1Q7LA 4KOUA 1XF1A 1SQHA 3F8KA 2CBLA 1FNOA 2ANPA 4ZI6A 1ON0A 3H8GA 3S9MA 2FCKA 4MY0A 1HDUA 3CXPA 2ZENA 3PEIA 1V0CA 1XF8A 4AG9A 3KL9A 1P0HA 5AG7A 4F6AA 3GB0A 1M4LA 1TF9A 2ZW7A 4MFZA 4XPKA 4TJXA 4KLWA 2FIWA 1NMTA 3B3TA 2EVNA 2BCOA 4C9RA 1ZO0A 4QB9A 4AVAA 2CNMA 3KI9A 3IJ3A 4KUAA 4GM5A 2ABZA 3VRQA 5D29A 4LQ6A 1Z9EA 4MHYA 4UCNA 5C88A 3B3SA 4OIDA 4PSXA 4C9AA 2EBJA 4AG7A 2BOAA 2PRBA 3IO1A 4MCPA 2VXKA 4UFWA 4KOXA 4P4DA 3TLGA 1M1DA 2HV2A 3RO0A 2PR1A 2CF4A 4QBJA 1ZG9A 2GREA 3B3CA 2B4BA 2OU2A 4OC5A 2PQ8A 4XNHC 2E28A 3KR4A 4CAFA 4ZY1A 3VTAA 2HROA 4Y49C 1IICA 2VBQA 3WC6A 3TOBA 3ICUA 3NH5A 1QSTA 4KOYA 3N5FA 1S7NA 3VATA 3BUXB 2ATRA 1DE4C 4BBHA 5HXDA 4JVOA 2Q44A 2ZEMA 2VKZG 1S7LA 1TIQA 2EUIA 2PCUA 4HNYB 3E0KA 3HMJG 1PU9A 2WSAA 3T8WA 4L8AA 4ZY0A 1V6CA 4Q36A 3IWEA 3ZZIA 2PJ3A 4UIAA 4A31A 2PSWA 2AFXA 2MP0A 1B87A 3KQXA 1S5KA 4AXVA 5DWNA 4B11A 2I79A 2QIRA 3FX6A 1WVMA 2O28A 2OR4A 2FIAA 3TYXA 4A38A 1MJAA 3BUOB 4HKFA 4MI4A 4FUUA 1R61A 2R7HA 1VBHA 3HLPA 2FVGA 3W6XA 1IOIA 1NSAA 2Z3MA 2XPLA 4RR2B 4CGOA 3RBUA 5HMNA 5K8OA 1XOVA 3K9UA 3SJGA 1WK4A 3LWUA 5F9MA 3QAYA 2HC9A 4F9VA 4NXYA 4K3NA 3WC5A 2B3VA 5LYLA 1K4JA 4NGRA 4UFVA 2Q7BA 3T0TA 3KZWA 1MJBA 4KLVA 4CGNA 4E8OA 2FM4A 2IMOA 5HVHA 2GE3A 3FB3A 3HUVA 1YW6A 3TOAA 5K8NA 2JEVA 2G3AA 4P45A 4C9UA 3CDXA 2R1IA 4UWIA 3SXNA 2POKA 4PV6A 1M4IA 2ZEFA 1XFOA 3KR5A 1IU8A 3IC1A 3TCVA 4E2AA 5J8CA 1S60A 3BLNA 5F47A 5IB9A 4BPUB 1TXRA 2GLJA 1DIKA 3GY9A 3NFZA 2HB6A 3FMCA 4FBEA 4X8IA 4H6ZA 3I1UA 3IWWA 1T36B 3PLFB 5HKZA 2Z3LA 4JXQA 3TTHA 2A4NA 4U9ZA 1KUYA 3FVLA 2B4DA 4YRHA 2CNSA 5C82A 4KVME 3SR3A 4EYSA 2P6EA 1BAVA 3FNCA 3TLGB 5DS0A 3TT2A 4FD4A 4TJVA 2Q04A 4QC6A 4C2YA 2ZELA 1QQ9A 2JLMA 4KZTA 5FVJA 3TC8A 5H84A 2B3UA 2H5MA 2DIKA 3D4UA 3DDDA 2XEFA 3D2MA 2Z3OA 2Z3NA 3ISZA 4IHMA 3ZNIA 2EZBA 3JUWA 3SJXA 5E96A 2V8DA 3P2FA 4C8UA 2OLSA 1XJOA 4PK3A 1XEBA 1H8LA 1WWZA 3VH9A 1BOBA 3F9KC 2ZPAA 4YU9A 5G21A 1IOFA 2YJTA 4MCRA 1TKHA 4QVTA 1LRZA 3NH8A 1YVOA 4M8DA 4KUBA 4IAVA 3JRUA 3G23A 4NGSA 4OC2A 3GKRA 2HWGA 3B3WA 1CPSA 1Y9KA 4P10A 2V77A 4PXBA 2AE6A 2DPTA 4OIWA 3I74A 2RC4A 5IR2A 4C8TA 1LAMA 3D3SA 4I49A 4C85A 2JEWA 4CRZB 2Q4ZA 1B6BA 2ZOFA 1VKCA 4MXUA 5F1YA 1KUXA 2AFSA 2RB7A 1NE9A 4JJXA 3PT1A 4MJXA 3F5BA 2HI6A 5I0CA 2GFQA 3PZJA 2JDDA 4JYWA 1ZLHA 2D4OA 3PRTA 3A9LA 4M6GA 3FJUA 3CZXA 3RAMA 4CAVA 1QSOA 2DEAA 3B35A 3LMSA 4B5PA 4ONWA 4UCMA 4R6TA 4R3KA 1CM0A 3B7IA 4CAEA 2I3CA 4BINA 2CIJA 2C6GA 3H4QA 4CGMA 3FH4A 1Y7RA 2PVWA 3FECA 2Q4YA 5J1QA 4C99A 1C3OB 2XPNA 4BPXB 4NCZA 4ZX8A 2QJ8A 2VZZA 3TX8A 4EFDA 1Z4RA 2O4HA 4A4CA 3BJ7A 1TKFA 4BPWB 2XPOA 4TWEA 4ZX9A 2B0AA 4O23A 1JDEA 4II9A 1KZFA 5F09A 4EVYA 3FF3A 4MFJA 4BD9A 3JTKA 4DNCA 1MJ9A 5HKYA 4P4EA 3W91A 4MFLA 1M4DA 4OMEA 3DLJA 4EMEA 2OZUA 1GHEA 3NE8A 4H89A 5AG5A 3EZBA 3BUWB 3TLYA 1YGHA 2OZGA 4KSAA 2YJVA 3WABA 4NGMA 3K9TA 3KHXA 2PC1A 3L2NA 4KVOE 4NGPA 1CPXA 2VQYA 3GLJA 1UFHA 4WWVA 1VHEA 2YGWA 4C2XA 4U9YA 2EK8A 2Z0ZA 1PYTB 5D8NA 3BUNB 2G0BA 3JVNA 4IIXA 3SI2A 4C8CA 1XMBA 5F46A 1BXRB 4OLLA 4UCPA 3C26A 3RZAA 1Y0RA 3VRNA 2WZNA 4NJQA 2HUZA 3SHPA 1YQEA 3FXTA 3WR7A 5AG4A 4C86A 4MFQA 2XPPA 4KOVA 3IEHA 4KSIA 3PB7X 1Z2LA 3V8IA 1BO4A 3V7ZA 3B2YA 1DTDA 4KOSA 3B3VA 4CAWA 3GJZA 1X12A 1CBXA 3D67A 4CRYB 3VGOA 3CPAA 4YFJA 4JZ0A 1J4JA 4JD6A 4ZGYB 2Q7SA 4ZYQA 3GUXA 5ISVA 3O8ZA 2Y1NA 3QNVA 3T05A 3T9YA 4F9UA 3OAKA 4UA3A 1IYKA 3MN8A 2FSRA 4OADA 2ZXVA 3PFOA 1QMUA 3P2HA 2QYVA 5ELYA 1CE8B 4CZ1A 3G3SA 4R57A 5EC4A 2V8VA 3PGPA 1PUAA 1ZL0A 5EBVA 2JDCA 2WPXA 3G8WA 3VRPA 1Z8XA 2DF5A 4A30A 4Z65A 4MJ8A 1VHOA 1JWQA 1NBWA 5LYFA 5CNPA 4NGNA 3FRMA 5F48A 3BI1A 2WPWA 4B5PB 4CYOA 4CDJA 3H8FA 4NEXA 2Y0MA 2CTBA 4A4BA 3MRUA 4IF5A 3W6SA 4KNGE 1Q2DA 2C27A 2RFHA 3DR6A 3HPGG 4IK2A 2O53A 3DR8A 5AGEA 3QAHA 4J0NA 2X7BA 1BPNA 4A95A 2B5GA 2PJAA 4MHDA 1J3LA 1BLLE 5DWMA 2R82A 2P6GA 4UF4A 2ZEOA 3IIBA 4UIBA 1FBVA 3NFQA 2EZCA 4OC1A 4CS0B 1HDQA 2VL1A 3VWDA 5LRGA 2DLAA 2N3AB 1RO5A 2EO8A 2BEIA 3F0AA 4MFPA 2VEZA 1N71A 1NSLA 5JPHA 4C7IA 3PBBA 5A28A 1A9XB 4AVBA 4E94A 2Z11A 3SI0A 5JYBA 1OBRA 5K8MA 4NGTA 3GYAA 3BI0A 5HKWA 1CJWA 3FYNA 4R76A 4CYNA 2PJ6A 4WJBA 4FWUA 2F5IA 2YNDA 3FBUA 4RN7A 5G1ZA 4J3GA 1PCAA 3DNSA 4MHNA 4W9YA 4UWJA 3OB2B 2ZEHA 4NSQA 4MI1A 2XEIA 1YVHA 1UWYA 1CP7A 2FE7A 3R1KA 2CXAA 1S7FA 4Q7AA 2BL1A 3TO6A 1RXTA 2PJ0A 3PFVA 4X5KA 2D0PA 3CPXA 1I1DA 3DGVA 5IV0A 2DXQA 2GIVA 2PIZA 1BPMA 1OZPA 3R95A 4B5OA 3BJ8A 3HPHE 3D7GA 4IIYA 3SI1A 4CAXA 4IUSA 1VHSA 2PJ7A 5CBMA 2F7VA 1YSJA 3D68A 3D66A 5K99A 4DJLA 4HNWB 2PCNA 2CNTA 3VARA 4CGPA 3GIUA 7CPAA 1XIXA 5A27A 1YLOA 3BXMA 3TLBA 1RTQA 3DSBA 5LYIA 4K30A 2REFA 1XBUA 2V8HA 3IFEA 3U88C 3FEDA 4RS2A 8CPAA 1KC7A 2Q0YA 3ZJ0A 5K8PA 4Q38A 3R96A 1X10A 3OB1B 2YNCA 2ZEPA 4X3RA 2QMLA 4GXHA 4MFKA 5F5XA 4CYQA 5LRJA 4MCQA 4OC3A 2Z10A 4LUAA 2AFOA 4CGLA 2Q43A 4KSFA 3MGDA 1AUGA 2IL4A 3KHZA 3NH4A 3S6GA 3S6HA 1TKJA 2AFMA 1IY7A 1FY7A 2YNEA 4JXRA 4M6HA 3EZEA 4YN3A 1M44A 2PJ1A 3BHXA 1IGBA 4BTFA 1Y0YA 3PFEA 4P4FA 4MY3A 1Q2YA 1CS0B 4R3LA 3KRVA 3PB9X 3TLEA 1XE4A 3TLZA 4ONUA 4AVCA 5FD8A 3SJFA 2FT0A 2NYQA 2OOTA 4P4IA 1IIDA 3PBEA 4C68A 1EZAA 3LODA 2P0WA 2AJ6A 2J8RA 4A32A 4PXEA 1Z5RA 4C9EA 1CP6A 4C9VA 2Z3KA 2WUUA 2UV8G 4B13A 1ZRSA 1Z4EA 1I12A 2AFZA 2PJ9A 4R87A 4RUHA 4ZY2A 5JGFA 4NGQA 4B10A 2XEJA 1LCPA 1U6MA 4M85A 3CXQA 2B4DB 1EZBA 5BY0A 2EZAA 2OB0A 3TO9A 1ELMP 4P6YA 5IX3A 4E0AA 1TF8A 2ZEDA 4P4JA 5G20A 2CY2A 3H5ZA 1FT7A 5H86A 3R9FA 1CG2A 4LQGA 4UEZA 1EO0A 3PB6X 4DUKA 4HPSA 3WT4A 2V8GA 1YX0A 4GS4A 3LACA 3I3GA 4NF1A 2PRQA 5LYDA 4A39A 4A94A 4AB7A 4INJA 4R7MA 1Z8TA 3KQZA 4NJRA 4MMOA 1LANA 1F2PA 4P4BA 1QSRA 1VGYA 4KVXA 1GGOA 1VI4A 2OH1A 2PR8A 4UFXA 2GP4A 2IQ6A 3K4IA 2ZEGA 1Z9UA 4OAEA 1YK3A 1WJTA 2KCWA 3EZAA 5JVLA 4RI1A 3H8EA 4C8PA 4TNUA 2AUMA 2REEA 4FD7A 4A2ZA 2P6FA 2PJBA 2QECA 2R8VA 3B8GA 2F8HA 4ORFA 4CO9A 3S9LA 2ODFA 3UY5A 1JQGA 4LX9A 4U5YA 5LRKA 2NMTA 3EY5A 3I6SA 5JM6A 4KS9A 4OP4A 2CTCA 1M6VB 4BMHA 1GYTA 4COBA 2B4JC 1ZLIA 3SJEA 1JDBC 4PXDA 1S7KA 3D2PA 1QSMA 2Q4VA 3IWGA 2FL4A 3I9SA 1A2ZA 1YREA 1R3NA 1YVKA 4H2KA 1Q2CA 2WYRA 1EE3P 2Z3PA 3FIXA 1KEEB 4GPLB 1ARMA 4KOTA 4MRIA 4UBRA 5AG6A 4CDKA 4C7HA 4B12A 4B14A 1R43A 1AYEA 5HH1A 1ZYMA 4PSWA 3S6KA 2C1CA 1HEEA 5J3XA 2FS5A 1MK4A 3KASA 3T07A 5KTCA 4P44A 4MHZA 4C8AA 1L0CA 2PVVA 4A37A 3VROA 3U1BA 2J8NA 1IB1E 4FAIA 2VZYA 6CPAA 3IGRA 2IJZA 2ZW5A 2BO9A 5HVFA 3TLAA 3VWEA 3SXOA 1LFWA 3S9NA 1ZG8A 2D0OA 4FD5A 1KUVA 4ZBGA 4PXCA 5JQ4A 2PE3A 3VRRA 2PJ4A 2PJ8A 2R98A 1LAPA 4KORA 4COGA 4R9MA 2BUEA 5EMIA 4X2TA 1YLEA 5G22A 3EIFA 5BWAB 2PJCA 3EXNA 1F57A 2ZW6A 4OKOA 3T5MA 2GANA 1C30B 1S3ZA 2X0SA 4UEFA 2BSWA 5J8FA 5KTDA 1Y9ZA 4HNXB 4XPLA 1Y9WA 5F49A 3NA6A 1XMTA 3LD2A 4C8FA 3D7FA 1XRYA 2I00A 4C84A 2D4PA 2DPSA 4JWPA 1IYLA 3ISXA 3V38A 1VIXA 1AMPA 4MBUA 1Y7EA 3C8OA 1M4GA
chains in the Genus database with same CATH topology
4R8FA 5CPAA 2QVPA 4CPAA 1CX8A 2Q51A 3PB8X 3D7HA 4EWTA 2GU2A 1F2OA 3KGQA 2JBJA 2AFUA 3CT9A 3D7DA 2AFWA 5I4MA 4F8ZA 5JH9A 4PPZA 3PB4X 2PIYA 2NSMA 3WC7A 4B6ZA 2C5QA 2GLFA 2ZOGA 4UEEA 2G9DA 1ARLA 4DYOA 4G1PA 4MHPA 2PJ2A 4PQAA 2EK9A 4YWYA 5THWA 1ELLP 4NFRA 4OC4A 1LOKA 4OC0A 1YW4A 2C6CA 1ZG7A 2EWBA 2J9AA 5HVGA 3K2KA 1YMEA 4MCSA 2PJ5A 2ZEEA 1KWMA 3FEEA 2XEGA 2C6PA 2JBKA 1Z8LA 1Q7LA 1XF1A 1FNOA 2ANPA 4ZI6A 3H8GA 3S9MA 1HDUA 2ZENA 3PEIA 3KL9A 3GB0A 1M4LA 1TF9A 4TJXA 3B3TA 4C9RA 2BCOA 3KI9A 3IJ3A 4GM5A 2ABZA 5D29A 4MHYA 3B3SA 4OIDA 4C9AA 2BOAA 3IO1A 4MCPA 4P4DA 2CF4A 1ZG9A 2GREA 3B3CA 4OC5A 3KR4A 4ZY1A 3VTAA 3WC6A 3ICUA 3NH5A 3VATA 3N5FA 5HXDA 1DE4C 2ZEMA 2PCUA 3T8WA 4ZY0A 1V6CA 2PJ3A 4UIAA 2AFXA 3KQXA 4AXVA 3FX6A 1WVMA 2OR4A 4A38A 4FUUA 3HLPA 2FVGA 1NSAA 3RBUA 5K8OA 3SJGA 3LWUA 2HC9A 4F9VA 4K3NA 3WC5A 5LYLA 4NGRA 3KZWA 2IMOA 5HVHA 3HUVA 1YW6A 5K8NA 4P45A 4C9UA 3CDXA 2POKA 2ZEFA 1XFOA 3KR5A 3IC1A 5IB9A 1TXRA 2GLJA 3NFZA 2HB6A 3FMCA 4FBEA 4X8IA 3I1UA 3IWWA 3FVLA 1BAVA 5DS0A 4TJVA 2ZELA 1QQ9A 3TC8A 3D4UA 2XEFA 3ISZA 4IHMA 3SJXA 2V8DA 1XJOA 1H8LA 3VH9A 4YU9A 4MCRA 1TKHA 3NH8A 4IAVA 3JRUA 4NGSA 4OC2A 3B3WA 1CPSA 4P10A 2V77A 4PXBA 3I74A 5IR2A 4OIWA 4C8TA 1LAMA 4C85A 2JEWA 2Q4ZA 2ZOFA 4MXUA 2AFSA 2RB7A 4JYWA 1ZLHA 3PRTA 3FJUA 3RAMA 2DEAA 3B35A 3LMSA 4ONWA 4R6TA 3B7IA 2I3CA 2CIJA 2C6GA 3FH4A 2PVWA 3FECA 5J1QA 4C99A 4ZX8A 2QJ8A 3TX8A 4EFDA 2O4HA 1TKFA 4TWEA 4ZX9A 4O23A 5F09A 3FF3A 4BD9A 4P4EA 4OMEA 3DLJA 4EMEA 4C8UA 3WABA 3KHXA 3K9TA 4NGMA 3L2NA 4NGPA 1CPXA 3GLJA 4WWVA 1VHEA 2EK8A 1PYTB 5D8NA 3SI2A 4C8CA 1XMBA 3RZAA 6CPAA 1Y0RA 2WZNA 4NJQA 4C86A 3IEHA 4KSIA 3PB7X 1Z2LA 3V7ZA 3B2YA 1DTDA 3B3VA 1CBXA 3D67A 3CPAA 4JZ0A 4ZYQA 3GUXA 3QNVA 4F9UA 3MN8A 3PFOA 1QMUA 2QYVA 5ELYA 2V8VA 4Z65A 1VHOA 5LYFA 4NGNA 3BI1A 4CDJA 3H8FA 2CTBA 3MRUA 4KNGE 2RFHA 4IK2A 2O53A 1BPNA 2PJAA 1BLLE 4UF4A 2ZEOA 3IIBA 4UIBA 4OC1A 1HDQA 2VL1A 5LRGA 3PBBA 3SI0A 1OBRA 5K8MA 4NGTA 3BI0A 4R76A 2PJ6A 4WJBA 4FWUA 1PCAA 4MHNA 4W9YA 2ZEHA 2XEIA 1UWYA 1CP7A 4Q7AA 2PJ0A 3CPXA 3DGVA 2PIZA 1BPMA 3D7GA 3SI1A 2PJ7A 5CBMA 2F7VA 1YSJA 3D68A 3D66A 4DJLA 3VARA 7CPAA 1YLOA 3BXMA 1RTQA 5LYIA 3IFEA 1XBUA 2V8HA 3FEDA 8CPAA 5K8PA 2ZEPA 4X3RA 5LRJA 4MCQA 4OC3A 2AFOA 2Q43A 3KHZA 3NH4A 1TKJA 2AFMA 1IY7A 4YN3A 2PJ1A 3BHXA 1IGBA 1Y0YA 3PFEA 4P4FA 3PB9X 3SJFA 2NYQA 2OOTA 4P4IA 3PBEA 4PXEA 1Z5RA 4C9EA 1CP6A 4C9VA 2AFZA 2PJ9A 4RUHA 4ZY2A 5JGFA 4NGQA 2XEJA 1LCPA 1ELMP 4P6YA 1TF8A 2ZEDA 4P4JA 1FT7A 1CG2A 4LQGA 4UEZA 3PB6X 4DUKA 3WT4A 2V8GA 4A94A 2PRQA 5LYDA 4A39A 4R7MA 3KQZA 4NJRA 4MMOA 1LANA 1F2PA 4P4BA 1VGYA 2GP4A 2IQ6A 2ZEGA 4C8PA 3H8EA 4TNUA 2PJBA 2F8HA 3S9LA 5LRKA 1JQGA 3I6SA 5JM6A 4OP4A 2CTCA 1GYTA 1ZLIA 3SJEA 4PXDA 1R3NA 4H2KA 2WYRA 1EE3P 1ARMA 4MRIA 4CDKA 1R43A 1AYEA 2C1CA 1HEEA 3KASA 4P44A 4MHZA 4C8AA 2PVVA 4A37A 4FAIA 2IJZA 2BO9A 5HVFA 1LFWA 3S9NA 1ZG8A 4PXCA 2PE3A 2PJ4A 2PJ8A 1LAPA 4X2TA 3EIFA 2PJCA 1F57A 4OKOA 4UEFA 1Y9ZA 3NA6A 4C8FA 3D7FA 1XRYA 4C84A 3V38A 3ISXA 1VIXA 1AMPA 1Y7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8F A;  5CPA A;  2QVP A;  4CPA A;  1CX8 A;  2Q51 A;  3PB8 X;  3D7H A;  4EWT A;  2GU2 A;  1F2O A;  3KGQ A;  2JBJ A;  2AFU A;  3CT9 A;  3D7D A;  2AFW A;  5I4M A;  4F8Z A;  5JH9 A;  4PPZ A;  3PB4 X;  2PIY A;  2NSM A;  3WC7 A;  4B6Z A;  2GLF A;  2ZOG A;  4UEE A;  2G9D A;  1ARL A;  4DYO A;  4G1P A;  4MHP A;  2PJ2 A;  4PQA A;  2EK9 A;  4YWY A;  5THW A;  1ELL P;  4NFR A;  4OC4 A;  1LOK A;  4OC0 A;  1YW4 A;  2C6C A;  1ZG7 A;  2EWB A;  2J9A A;  5HVG A;  3K2K A;  1YME A;  4MCS A;  2PJ5 A;  2ZEE A;  1KWM A;  3FEE A;  2XEG A;  2C6P A;  2JBK A;  1Z8L A;  1Q7L A;  1XF1 A;  1FNO A;  2ANP A;  4ZI6 A;  3H8G A;  3S9M A;  1HDU A;  2ZEN A;  3PEI A;  3KL9 A;  3GB0 A;  1M4L A;  1TF9 A;  4TJX A;  3B3T A;  4C9R A;  2BCO A;  3KI9 A;  3IJ3 A;  4GM5 A;  2ABZ A;  5D29 A;  4MHY A;  3B3S A;  4OID A;  4C9A A;  2BOA A;  3IO1 A;  4MCP A;  4P4D A;  2CF4 A;  1ZG9 A;  2GRE A;  3B3C A;  4OC5 A;  3KR4 A;  4ZY1 A;  3VTA A;  3WC6 A;  3ICU A;  3NH5 A;  3VAT A;  3N5F A;  5HXD A;  1DE4 C;  2ZEM A;  2PCU A;  3T8W A;  4ZY0 A;  1V6C A;  2PJ3 A;  4UIA A;  2AFX A;  3KQX A;  4AXV A;  3FX6 A;  1WVM A;  2OR4 A;  4A38 A;  4FUU A;  3HLP A;  2FVG A;  1NSA A;  3RBU A;  5K8O A;  3SJG A;  3LWU A;  2HC9 A;  4F9V A;  4K3N A;  3WC5 A;  5LYL A;  4NGR A;  3KZW A;  2IMO A;  5HVH A;  3HUV A;  1YW6 A;  5K8N A;  4P45 A;  4C9U A;  3CDX A;  2POK A;  2ZEF A;  1XFO A;  3KR5 A;  3IC1 A;  5IB9 A;  1TXR A;  2GLJ A;  3NFZ A;  2HB6 A;  3FMC A;  4FBE A;  4X8I A;  3I1U A;  3IWW A;  3FVL A;  1BAV A;  5DS0 A;  4TJV A;  2ZEL A;  1QQ9 A;  3TC8 A;  3D4U A;  2XEF A;  3ISZ A;  4IHM A;  3SJX A;  2V8D A;  1XJO A;  1H8L A;  3VH9 A;  4YU9 A;  4MCR A;  1TKH A;  3NH8 A;  4IAV A;  3JRU A;  4NGS A;  4OC2 A;  3B3W A;  1CPS A;  4P10 A;  2V77 A;  4PXB A;  3I74 A;  4C8T A;  4OIW A;  1LAM A;  4C85 A;  2JEW A;  2Q4Z A;  2ZOF A;  4MXU A;  2AFS A;  2RB7 A;  4JYW A;  1ZLH A;  3PRT A;  3FJU A;  3RAM A;  2DEA A;  3B35 A;  3LMS A;  4ONW A;  4R6T A;  3B7I A;  2I3C A;  2CIJ A;  2C6G A;  3FH4 A;  2PVW A;  3FEC A;  5J1Q A;  4C99 A;  4ZX8 A;  2QJ8 A;  3TX8 A;  4EFD A;  2O4H A;  1TKF A;  4TWE A;  4ZX9 A;  4O23 A;  5F09 A;  3FF3 A;  4BD9 A;  4P4E A;  4OME A;  3DLJ A;  4EME A;  4C8U A;  3WAB A;  3KHX A;  3K9T A;  4NGM A;  3L2N A;  4NGP A;  1CPX A;  3GLJ A;  4WWV A;  1VHE A;  2EK8 A;  1PYT B;  5D8N A;  3SI2 A;  4C8C A;  1XMB A;  3RZA A;  6CPA A;  1Y0R A;  2WZN A;  4NJQ A;  4C86 A;  3IEH A;  4KSI A;  3PB7 X;  1Z2L A;  3V7Z A;  3B2Y A;  1DTD A;  3B3V A;  1CBX A;  3D67 A;  3CPA A;  4JZ0 A;  4ZYQ A;  3GUX A;  3QNV A;  4F9U A;  3MN8 A;  3PFO A;  1QMU A;  2QYV A;  5ELY A;  2V8V A;  4Z65 A;  1VHO A;  5LYF A;  4NGN A;  3BI1 A;  4CDJ A;  3H8F A;  2CTB A;  3MRU A;  4KNG E;  2RFH A;  4IK2 A;  2O53 A;  1BPN A;  2PJA A;  1BLL E;  4UF4 A;  2ZEO A;  3IIB A;  4UIB A;  4OC1 A;  1HDQ A;  2VL1 A;  5LRG A;  3PBB A;  3SI0 A;  1OBR A;  5K8M A;  4NGT A;  3BI0 A;  4R76 A;  2PJ6 A;  4WJB A;  4FWU A;  1PCA A;  4MHN A;  4W9Y A;  2ZEH A;  2XEI A;  1UWY A;  1CP7 A;  4Q7A A;  2PJ0 A;  3CPX A;  3DGV A;  2PIZ A;  1BPM A;  3D7G A;  3SI1 A;  2PJ7 A;  5CBM A;  2F7V A;  1YSJ A;  3D68 A;  3D66 A;  4DJL A;  3VAR A;  7CPA A;  1YLO A;  3BXM A;  1RTQ A;  5LYI A;  3IFE A;  1XBU A;  2V8H A;  3FED A;  8CPA A;  5K8P A;  2ZEP A;  4X3R A;  5LRJ A;  4MCQ A;  4OC3 A;  2AFO A;  2Q43 A;  3KHZ A;  3NH4 A;  1TKJ A;  2AFM A;  1IY7 A;  4YN3 A;  2PJ1 A;  3BHX A;  1IGB A;  1Y0Y A;  3PFE A;  4P4F A;  3PB9 X;  3SJF A;  2NYQ A;  2OOT A;  4P4I A;  3PBE A;  4PXE A;  1Z5R A;  4C9E A;  1CP6 A;  4C9V A;  2AFZ A;  2PJ9 A;  4RUH A;  4ZY2 A;  5JGF A;  4NGQ A;  2XEJ A;  1LCP A;  1ELM P;  4P6Y A;  1TF8 A;  2ZED A;  4P4J A;  1FT7 A;  1CG2 A;  4LQG A;  4UEZ A;  3PB6 X;  4DUK A;  3WT4 A;  2V8G A;  4A94 A;  2PRQ A;  5LYD A;  4A39 A;  4R7M A;  3KQZ A;  4NJR A;  4MMO A;  1LAN A;  1F2P A;  4P4B A;  1VGY A;  2IQ6 A;  2ZEG A;  4C8P A;  3H8E A;  4TNU A;  2PJB A;  2F8H A;  3S9L A;  5LRK A;  1JQG A;  3I6S A;  5JM6 A;  4OP4 A;  2CTC A;  1GYT A;  1ZLI A;  3SJE A;  4PXD A;  1R3N A;  4H2K A;  2WYR A;  1EE3 P;  1ARM A;  4MRI A;  4CDK A;  1R43 A;  1AYE A;  2C1C A;  1HEE A;  3KAS A;  4P44 A;  4MHZ A;  4C8A A;  2PVV A;  4A37 A;  4FAI A;  2IJZ A;  2BO9 A;  5HVF A;  1LFW A;  3S9N A;  1ZG8 A;  4PXC A;  2PE3 A;  2PJ4 A;  2PJ8 A;  1LAP A;  4X2T A;  3EIF A;  2PJC A;  1F57 A;  4OKO A;  4UEF A;  1Y9Z A;  3NA6 A;  4C8F A;  3D7F A;  1XRY A;  4C84 A;  3V38 A;  3ISX A;  1VIX A;  1AMP A;  1Y7E A; 
#chains in the Genus database with same CATH topology
 1P4N A;  1R57 A;  4XPD B;  3EC4 A;  4R8F A;  5CPA A;  2J8M A;  1QSN A;  3N7Z A;  2YNC C;  2QVP A;  3IU2 A;  3QB8 A;  4YGO A;  3TE4 A;  4CPA A;  1CX8 A;  3TO7 A;  3IU1 A;  1Z8W A;  2K5T A;  3TLC A;  2Q51 A;  3PP9 A;  2VI7 A;  4M6I A;  4H1H A;  3PB8 X;  5F13 A;  3D7H A;  2FXF A;  4KOW A;  5KTA A;  4EWT A;  2B58 A;  2GU2 A;  1I21 A;  1F2O A;  4QUS A;  3KGQ A;  1NXJ A;  4F0X A;  2JBJ A;  2AFU A;  3CT9 A;  4CYP A;  3D7D A;  5AXI A;  2AFW A;  3OP0 A;  4A33 A;  2AUN A;  5I4M A;  4F8Z A;  1B47 A;  3R9E A;  5IB0 A;  4PPZ A;  3PB4 X;  4FD6 A;  2PIY A;  2NSM A;  3EFA A;  3WC7 A;  4B6Z A;  5JH9 A;  1Q5X A;  4E5S A;  1KBL A;  2C5Q A;  2GLF A;  1VBG A;  4C2Z A;  3RNZ A;  2ZOG A;  2HQY A;  4PK2 A;  3EO4 A;  4UEE A;  2G9D A;  3OWC A;  3RYO A;  1ARL A;  3NOJ A;  3NE7 A;  4DYO A;  4G1P A;  4MHP A;  2PJ2 A;  4PQA A;  2EK9 A;  3S6F A;  3CXS A;  4YWY A;  5THW A;  1ELL P;  2PDO A;  2Y1M A;  4OC4 A;  4NFR A;  2ARH A;  1LOK A;  3T90 A;  2G3T A;  4OC0 A;  3BUM B;  1YW4 A;  2C6C A;  1ZG7 A;  2EWB A;  2J9A A;  2ZW4 A;  4XPD C;  5HVG A;  3K2K A;  1YR0 A;  1YME A;  3KKW A;  3R9G A;  4MCS A;  2PJ5 A;  2OZH A;  5GCN A;  2ZEE A;  3D8P A;  4L89 A;  1KWM A;  4JLY A;  4XNH B;  4F0Y A;  4H6U A;  3FEE A;  4M3S A;  3TFY A;  2C6P A;  2XEG A;  4Y49 B;  2JBK A;  1Z8L A;  2B5G B;  1Q7L A;  4KOU A;  1XF1 A;  1SQH A;  3F8K A;  2CBL A;  1FNO A;  2ANP A;  4ZI6 A;  1ON0 A;  3H8G A;  3S9M A;  2FCK A;  4MY0 A;  1HDU A;  3CXP A;  2ZEN A;  3PEI A;  1V0C A;  1XF8 A;  4AG9 A;  3KL9 A;  1P0H A;  5AG7 A;  4F6A A;  3GB0 A;  1M4L A;  1TF9 A;  2ZW7 A;  4MFZ A;  4XPK A;  4TJX A;  4KLW A;  2FIW A;  1NMT A;  3B3T A;  2EVN A;  2BCO A;  4C9R A;  1ZO0 A;  4QB9 A;  4AVA A;  2CNM A;  3KI9 A;  3IJ3 A;  4KUA A;  4GM5 A;  2ABZ A;  3VRQ A;  5D29 A;  4LQ6 A;  1Z9E A;  4MHY A;  4UCN A;  5C88 A;  3B3S A;  4OID A;  4PSX A;  4C9A A;  2EBJ A;  4AG7 A;  2BOA A;  2PRB A;  3IO1 A;  4MCP A;  2VXK A;  4UFW A;  4KOX A;  4P4D A;  3TLG A;  1M1D A;  2HV2 A;  3RO0 A;  2PR1 A;  2CF4 A;  4QBJ A;  1ZG9 A;  2GRE A;  3B3C A;  2B4B A;  2OU2 A;  4OC5 A;  2PQ8 A;  4XNH C;  2E28 A;  3KR4 A;  4CAF A;  4ZY1 A;  3VTA A;  2HRO A;  4Y49 C;  1IIC A;  2VBQ A;  3WC6 A;  3TOB A;  3ICU A;  3NH5 A;  1QST A;  4KOY A;  3N5F A;  1S7N A;  3VAT A;  3BUX B;  2ATR A;  1DE4 C;  4BBH A;  5HXD A;  4JVO A;  2Q44 A;  2ZEM A;  2VKZ G;  1S7L A;  1TIQ A;  2EUI A;  2PCU A;  4HNY B;  3E0K A;  3HMJ G;  1PU9 A;  2WSA A;  3T8W A;  4L8A A;  4ZY0 A;  1V6C A;  4Q36 A;  3IWE A;  3ZZI A;  2PJ3 A;  4UIA A;  4A31 A;  2PSW A;  2AFX A;  2MP0 A;  1B87 A;  3KQX A;  1S5K A;  4AXV A;  5DWN A;  4B11 A;  2I79 A;  2QIR A;  3FX6 A;  1WVM A;  2O28 A;  2OR4 A;  2FIA A;  3TYX A;  4A38 A;  1MJA A;  3BUO B;  4HKF A;  4MI4 A;  4FUU A;  1R61 A;  2R7H A;  1VBH A;  3HLP A;  2FVG A;  3W6X A;  1IOI A;  1NSA A;  2Z3M A;  2XPL A;  4RR2 B;  4CGO A;  3RBU A;  5HMN A;  5K8O A;  1XOV A;  3K9U A;  3SJG A;  1WK4 A;  3LWU A;  5F9M A;  3QAY A;  2HC9 A;  4F9V A;  4NXY A;  4K3N A;  3WC5 A;  2B3V A;  5LYL A;  1K4J A;  4NGR A;  4UFV A;  2Q7B A;  3T0T A;  3KZW A;  1MJB A;  4KLV A;  4CGN A;  4E8O A;  2FM4 A;  2IMO A;  5HVH A;  2GE3 A;  3FB3 A;  3HUV A;  1YW6 A;  3TOA A;  5K8N A;  2JEV A;  2G3A A;  4P45 A;  4C9U A;  3CDX A;  2R1I A;  4UWI A;  3SXN A;  2POK A;  4PV6 A;  1M4I A;  2ZEF A;  1XFO A;  3KR5 A;  1IU8 A;  3IC1 A;  3TCV A;  4E2A A;  5J8C A;  1S60 A;  3BLN A;  5F47 A;  5IB9 A;  4BPU B;  1TXR A;  2GLJ A;  1DIK A;  3GY9 A;  3NFZ A;  2HB6 A;  3FMC A;  4FBE A;  4X8I A;  4H6Z A;  3I1U A;  3IWW A;  1T36 B;  3PLF B;  5HKZ A;  2Z3L A;  4JXQ A;  3TTH A;  2A4N A;  4U9Z A;  1KUY A;  3FVL A;  2B4D A;  4YRH A;  2CNS A;  5C82 A;  4KVM E;  3SR3 A;  4EYS A;  2P6E A;  1BAV A;  3FNC A;  3TLG B;  5DS0 A;  3TT2 A;  4FD4 A;  4TJV A;  2Q04 A;  4QC6 A;  4C2Y A;  2ZEL A;  1QQ9 A;  2JLM A;  4KZT A;  5FVJ A;  3TC8 A;  5H84 A;  2B3U A;  2H5M A;  2DIK A;  3D4U A;  3DDD A;  2XEF A;  3D2M A;  2Z3O A;  2Z3N A;  3ISZ A;  4IHM A;  3ZNI A;  2EZB A;  3JUW A;  3SJX A;  5E96 A;  2V8D A;  3P2F A;  4C8U A;  2OLS A;  1XJO A;  4PK3 A;  1XEB A;  1H8L A;  1WWZ A;  3VH9 A;  1BOB A;  3F9K C;  2ZPA A;  4YU9 A;  5G21 A;  1IOF A;  2YJT A;  4MCR A;  1TKH A;  4QVT A;  1LRZ A;  3NH8 A;  1YVO A;  4M8D A;  4KUB A;  4IAV A;  3JRU A;  3G23 A;  4NGS A;  4OC2 A;  3GKR A;  2HWG A;  3B3W A;  1CPS A;  1Y9K A;  4P10 A;  2V77 A;  4PXB A;  2AE6 A;  2DPT A;  4OIW A;  3I74 A;  2RC4 A;  5IR2 A;  4C8T A;  1LAM A;  3D3S A;  4I49 A;  4C85 A;  2JEW A;  4CRZ B;  2Q4Z A;  1B6B A;  2ZOF A;  1VKC A;  4MXU A;  5F1Y A;  1KUX A;  2AFS A;  2RB7 A;  1NE9 A;  4JJX A;  3PT1 A;  4MJX A;  3F5B A;  2HI6 A;  5I0C A;  2GFQ A;  3PZJ A;  2JDD A;  4JYW A;  1ZLH A;  2D4O A;  3PRT A;  3A9L A;  4M6G A;  3FJU A;  3CZX A;  3RAM A;  4CAV A;  1QSO A;  2DEA A;  3B35 A;  3LMS A;  4B5P A;  4ONW A;  4UCM A;  4R6T A;  4R3K A;  1CM0 A;  3B7I A;  4CAE A;  2I3C A;  4BIN A;  2CIJ A;  2C6G A;  3H4Q A;  4CGM A;  3FH4 A;  1Y7R A;  2PVW A;  3FEC A;  2Q4Y A;  5J1Q A;  4C99 A;  1C3O B;  2XPN A;  4BPX B;  4NCZ A;  4ZX8 A;  2QJ8 A;  2VZZ A;  3TX8 A;  4EFD A;  1Z4R A;  2O4H A;  4A4C A;  3BJ7 A;  1TKF A;  4BPW B;  2XPO A;  4TWE A;  4ZX9 A;  2B0A A;  4O23 A;  1JDE A;  4II9 A;  1KZF A;  5F09 A;  4EVY A;  3FF3 A;  4MFJ A;  4BD9 A;  3JTK A;  4DNC A;  1MJ9 A;  5HKY A;  4P4E A;  3W91 A;  4MFL A;  1M4D A;  4OME A;  3DLJ A;  4EME A;  2OZU A;  1GHE A;  3NE8 A;  4H89 A;  5AG5 A;  3EZB A;  3BUW B;  3TLY A;  1YGH A;  2OZG A;  4KSA A;  2YJV A;  3WAB A;  4NGM A;  3K9T A;  3KHX A;  2PC1 A;  3L2N A;  4KVO E;  4NGP A;  1CPX A;  2VQY A;  3GLJ A;  1UFH A;  4WWV A;  1VHE A;  2YGW A;  4C2X A;  4U9Y A;  2EK8 A;  2Z0Z A;  1PYT B;  5D8N A;  3BUN B;  2G0B A;  3JVN A;  4IIX A;  3SI2 A;  4C8C A;  1XMB A;  5F46 A;  1BXR B;  4OLL A;  4UCP A;  3C26 A;  3RZA A;  1Y0R A;  3VRN A;  2WZN A;  4NJQ A;  2HUZ A;  3SHP A;  1YQE A;  3FXT A;  3WR7 A;  5AG4 A;  4C86 A;  4MFQ A;  2XPP A;  4KOV A;  3IEH A;  4KSI A;  3PB7 X;  1Z2L A;  3V8I A;  1BO4 A;  3V7Z A;  3B2Y A;  1DTD A;  4KOS A;  3B3V A;  4CAW A;  3GJZ A;  1X12 A;  1CBX A;  3D67 A;  4CRY B;  3VGO A;  3CPA A;  4YFJ A;  4JZ0 A;  1J4J A;  4JD6 A;  4ZGY B;  2Q7S A;  4ZYQ A;  3GUX A;  5ISV A;  3O8Z A;  2Y1N A;  3QNV A;  3T05 A;  3T9Y A;  4F9U A;  3OAK A;  4UA3 A;  1IYK A;  3MN8 A;  2FSR A;  4OAD A;  2ZXV A;  3PFO A;  1QMU A;  3P2H A;  2QYV A;  5ELY A;  1CE8 B;  4CZ1 A;  3G3S A;  4R57 A;  5EC4 A;  2V8V A;  3PGP A;  1PUA A;  1ZL0 A;  5EBV A;  2JDC A;  2WPX A;  3G8W A;  3VRP A;  1Z8X A;  2DF5 A;  4A30 A;  4Z65 A;  4MJ8 A;  1VHO A;  1JWQ A;  1NBW A;  5LYF A;  5CNP A;  4NGN A;  3FRM A;  5F48 A;  3BI1 A;  2WPW A;  4B5P B;  4CYO A;  4CDJ A;  3H8F A;  4NEX A;  2Y0M A;  2CTB A;  4A4B A;  3MRU A;  4IF5 A;  3W6S A;  4KNG E;  1Q2D A;  2C27 A;  2RFH A;  3DR6 A;  3HPG G;  4IK2 A;  2O53 A;  3DR8 A;  5AGE A;  3QAH A;  4J0N A;  2X7B A;  1BPN A;  4A95 A;  2B5G A;  2PJA A;  4MHD A;  1J3L A;  1BLL E;  5DWM A;  2R82 A;  2P6G A;  4UF4 A;  2ZEO A;  3IIB A;  4UIB A;  1FBV A;  3NFQ A;  2EZC A;  4OC1 A;  4CS0 B;  1HDQ A;  2VL1 A;  3VWD A;  5LRG A;  2DLA A;  2N3A B;  1RO5 A;  2EO8 A;  2BEI A;  3F0A A;  4MFP A;  2VEZ A;  1N71 A;  1NSL A;  5JPH A;  4C7I A;  3PBB A;  5A28 A;  1A9X B;  4AVB A;  4E94 A;  2Z11 A;  3SI0 A;  5JYB A;  1OBR A;  5K8M A;  4NGT A;  3GYA A;  3BI0 A;  5HKW A;  1CJW A;  3FYN A;  4R76 A;  4CYN A;  2PJ6 A;  4WJB A;  4FWU A;  2F5I A;  2YND A;  3FBU A;  4RN7 A;  5G1Z A;  4J3G A;  1PCA A;  3DNS A;  4MHN A;  4W9Y A;  4UWJ A;  3OB2 B;  2ZEH A;  4NSQ A;  4MI1 A;  2XEI A;  1YVH A;  1UWY A;  1CP7 A;  2FE7 A;  3R1K A;  2CXA A;  1S7F A;  4Q7A A;  2BL1 A;  3TO6 A;  1RXT A;  2PJ0 A;  3PFV A;  4X5K A;  2D0P A;  3CPX A;  1I1D A;  3DGV A;  5IV0 A;  2DXQ A;  2GIV A;  2PIZ A;  1BPM A;  1OZP A;  3R95 A;  4B5O A;  3BJ8 A;  3HPH E;  3D7G A;  4IIY A;  3SI1 A;  4CAX A;  4IUS A;  1VHS A;  2PJ7 A;  5CBM A;  2F7V A;  1YSJ A;  3D68 A;  3D66 A;  5K99 A;  4DJL A;  4HNW B;  2PCN A;  2CNT A;  3VAR A;  4CGP A;  3GIU A;  7CPA A;  1XIX A;  5A27 A;  1YLO A;  3BXM A;  3TLB A;  1RTQ A;  3DSB A;  5LYI A;  4K30 A;  2REF A;  1XBU A;  2V8H A;  3IFE A;  3U88 C;  3FED A;  4RS2 A;  8CPA A;  1KC7 A;  2Q0Y A;  3ZJ0 A;  5K8P A;  4Q38 A;  3R96 A;  1X10 A;  3OB1 B;  2YNC A;  2ZEP A;  4X3R A;  2QML A;  4GXH A;  4MFK A;  5F5X A;  4CYQ A;  5LRJ A;  4MCQ A;  4OC3 A;  2Z10 A;  4LUA A;  2AFO A;  4CGL A;  2Q43 A;  4KSF A;  3MGD A;  1AUG A;  2IL4 A;  3KHZ A;  3NH4 A;  3S6G A;  3S6H A;  1TKJ A;  2AFM A;  1IY7 A;  1FY7 A;  2YNE A;  4JXR A;  4M6H A;  3EZE A;  4YN3 A;  1M44 A;  2PJ1 A;  3BHX A;  1IGB A;  4BTF A;  1Y0Y A;  3PFE A;  4P4F A;  4MY3 A;  1Q2Y A;  1CS0 B;  4R3L A;  3KRV A;  3PB9 X;  3TLE A;  1XE4 A;  3TLZ A;  4ONU A;  4AVC A;  5FD8 A;  3SJF A;  2FT0 A;  2NYQ A;  2OOT A;  4P4I A;  1IID A;  3PBE A;  4C68 A;  1EZA A;  3LOD A;  2P0W A;  2AJ6 A;  2J8R A;  4A32 A;  4PXE A;  1Z5R A;  4C9E A;  1CP6 A;  4C9V A;  2Z3K A;  2WUU A;  2UV8 G;  4B13 A;  1ZRS A;  1Z4E A;  1I12 A;  2AFZ A;  2PJ9 A;  4R87 A;  4RUH A;  4ZY2 A;  5JGF A;  4NGQ A;  4B10 A;  2XEJ A;  1LCP A;  1U6M A;  4M85 A;  3CXQ A;  2B4D B;  1EZB A;  5BY0 A;  2EZA A;  2OB0 A;  3TO9 A;  1ELM P;  4P6Y A;  5IX3 A;  4E0A A;  1TF8 A;  2ZED A;  4P4J A;  5G20 A;  2CY2 A;  3H5Z A;  1FT7 A;  5H86 A;  3R9F A;  1CG2 A;  4LQG A;  4UEZ A;  1EO0 A;  3PB6 X;  4DUK A;  4HPS A;  3WT4 A;  2V8G A;  1YX0 A;  4GS4 A;  3LAC A;  3I3G A;  4NF1 A;  2PRQ A;  5LYD A;  4A39 A;  4A94 A;  4AB7 A;  4INJ A;  4R7M A;  1Z8T A;  3KQZ A;  4NJR A;  4MMO A;  1LAN A;  1F2P A;  4P4B A;  1QSR A;  1VGY A;  4KVX A;  1GGO A;  1VI4 A;  2OH1 A;  2PR8 A;  4UFX A;  2GP4 A;  2IQ6 A;  3K4I A;  2ZEG A;  1Z9U A;  4OAE A;  1YK3 A;  1WJT A;  2KCW A;  3EZA A;  5JVL A;  4RI1 A;  3H8E A;  4C8P A;  4TNU A;  2AUM A;  2REE A;  4FD7 A;  4A2Z A;  2P6F A;  2PJB A;  2QEC A;  2R8V A;  3B8G A;  2F8H A;  4ORF A;  4CO9 A;  3S9L A;  2ODF A;  3UY5 A;  1JQG A;  4LX9 A;  4U5Y A;  5LRK A;  2NMT A;  3EY5 A;  3I6S A;  5JM6 A;  4KS9 A;  4OP4 A;  2CTC A;  1M6V B;  4BMH A;  1GYT A;  4COB A;  2B4J C;  1ZLI A;  3SJE A;  1JDB C;  4PXD A;  1S7K A;  3D2P A;  1QSM A;  2Q4V A;  3IWG A;  2FL4 A;  3I9S A;  1A2Z A;  1YRE A;  1R3N A;  1YVK A;  4H2K A;  1Q2C A;  2WYR A;  1EE3 P;  2Z3P A;  3FIX A;  1KEE B;  4GPL B;  1ARM A;  4KOT A;  4MRI A;  4UBR A;  5AG6 A;  4CDK A;  4C7H A;  4B12 A;  4B14 A;  1R43 A;  1AYE A;  5HH1 A;  1ZYM A;  4PSW A;  3S6K A;  2C1C A;  1HEE A;  5J3X A;  2FS5 A;  1MK4 A;  3KAS A;  3T07 A;  5KTC A;  4P44 A;  4MHZ A;  4C8A A;  1L0C A;  2PVV A;  4A37 A;  3VRO A;  3U1B A;  2J8N A;  1IB1 E;  4FAI A;  2VZY A;  6CPA A;  3IGR A;  2IJZ A;  2ZW5 A;  2BO9 A;  5HVF A;  3TLA A;  3VWE A;  3SXO A;  1LFW A;  3S9N A;  1ZG8 A;  2D0O A;  4FD5 A;  1KUV A;  4ZBG A;  4PXC A;  5JQ4 A;  2PE3 A;  3VRR A;  2PJ4 A;  2PJ8 A;  2R98 A;  1LAP A;  4KOR A;  4COG A;  4R9M A;  2BUE A;  5EMI A;  4X2T A;  1YLE A;  5G22 A;  3EIF A;  5BWA B;  2PJC A;  3EXN A;  1F57 A;  2ZW6 A;  4OKO A;  3T5M A;  2GAN A;  1C30 B;  1S3Z A;  2X0S A;  4UEF A;  2BSW A;  5J8F A;  5KTD A;  1Y9Z A;  4HNX B;  4XPL A;  1Y9W A;  5F49 A;  3NA6 A;  1XMT A;  3LD2 A;  4C8F A;  3D7F A;  1XRY A;  2I00 A;  4C84 A;  2D4P A;  2DPS A;  4JWP A;  1IYL A;  3ISX A;  3V38 A;  1VIX A;  1AMP A;  4MBU A;  1Y7E A;  3C8O A;  1M4G A; 
#chains in the Genus database with same CATH homology
 4R8F A;  5CPA A;  2QVP A;  4CPA A;  1CX8 A;  2Q51 A;  3PB8 X;  3D7H A;  4EWT A;  2GU2 A;  1F2O A;  3KGQ A;  2JBJ A;  2AFU A;  3CT9 A;  3D7D A;  2AFW A;  5I4M A;  4F8Z A;  5JH9 A;  4PPZ A;  3PB4 X;  2PIY A;  2NSM A;  3WC7 A;  4B6Z A;  2C5Q A;  2GLF A;  2ZOG A;  4UEE A;  2G9D A;  1ARL A;  4DYO A;  4G1P A;  4MHP A;  2PJ2 A;  4PQA A;  2EK9 A;  4YWY A;  5THW A;  1ELL P;  4NFR A;  4OC4 A;  1LOK A;  4OC0 A;  1YW4 A;  2C6C A;  1ZG7 A;  2EWB A;  2J9A A;  5HVG A;  3K2K A;  1YME A;  4MCS A;  2PJ5 A;  2ZEE A;  1KWM A;  3FEE A;  2XEG A;  2C6P A;  2JBK A;  1Z8L A;  1Q7L A;  1XF1 A;  1FNO A;  2ANP A;  4ZI6 A;  3H8G A;  3S9M A;  1HDU A;  2ZEN A;  3PEI A;  3KL9 A;  3GB0 A;  1M4L A;  1TF9 A;  4TJX A;  3B3T A;  4C9R A;  2BCO A;  3KI9 A;  3IJ3 A;  4GM5 A;  2ABZ A;  5D29 A;  4MHY A;  3B3S A;  4OID A;  4C9A A;  2BOA A;  3IO1 A;  4MCP A;  4P4D A;  2CF4 A;  1ZG9 A;  2GRE A;  3B3C A;  4OC5 A;  3KR4 A;  4ZY1 A;  3VTA A;  3WC6 A;  3ICU A;  3NH5 A;  3VAT A;  3N5F A;  5HXD A;  1DE4 C;  2ZEM A;  2PCU A;  3T8W A;  4ZY0 A;  1V6C A;  2PJ3 A;  4UIA A;  2AFX A;  3KQX A;  4AXV A;  3FX6 A;  1WVM A;  2OR4 A;  4A38 A;  4FUU A;  3HLP A;  2FVG A;  1NSA A;  3RBU A;  5K8O A;  3SJG A;  3LWU A;  2HC9 A;  4F9V A;  4K3N A;  3WC5 A;  5LYL A;  4NGR A;  3KZW A;  2IMO A;  5HVH A;  3HUV A;  1YW6 A;  5K8N A;  4P45 A;  4C9U A;  3CDX A;  2POK A;  2ZEF A;  1XFO A;  3KR5 A;  3IC1 A;  5IB9 A;  1TXR A;  2GLJ A;  3NFZ A;  2HB6 A;  3FMC A;  4FBE A;  4X8I A;  3I1U A;  3IWW A;  3FVL A;  1BAV A;  5DS0 A;  4TJV A;  2ZEL A;  1QQ9 A;  3TC8 A;  3D4U A;  2XEF A;  3ISZ A;  4IHM A;  3SJX A;  2V8D A;  1XJO A;  1H8L A;  3VH9 A;  4YU9 A;  4MCR A;  1TKH A;  3NH8 A;  4IAV A;  3JRU A;  4NGS A;  4OC2 A;  3B3W A;  1CPS A;  4P10 A;  2V77 A;  4PXB A;  3I74 A;  5IR2 A;  4OIW A;  4C8T A;  1LAM A;  4C85 A;  2JEW A;  2Q4Z A;  2ZOF A;  4MXU A;  2AFS A;  2RB7 A;  4JYW A;  1ZLH A;  3PRT A;  3FJU A;  3RAM A;  2DEA A;  3B35 A;  3LMS A;  4ONW A;  4R6T A;  3B7I A;  2I3C A;  2CIJ A;  2C6G A;  3FH4 A;  2PVW A;  3FEC A;  5J1Q A;  4C99 A;  4ZX8 A;  2QJ8 A;  3TX8 A;  4EFD A;  2O4H A;  1TKF A;  4TWE A;  4ZX9 A;  4O23 A;  5F09 A;  3FF3 A;  4BD9 A;  4P4E A;  4OME A;  3DLJ A;  4EME A;  4C8U A;  3WAB A;  3KHX A;  3K9T A;  4NGM A;  3L2N A;  4NGP A;  1CPX A;  3GLJ A;  4WWV A;  1VHE A;  2EK8 A;  1PYT B;  5D8N A;  3SI2 A;  4C8C A;  1XMB A;  3RZA A;  6CPA A;  1Y0R A;  2WZN A;  4NJQ A;  4C86 A;  3IEH A;  4KSI A;  3PB7 X;  1Z2L A;  3V7Z A;  3B2Y A;  1DTD A;  3B3V A;  1CBX A;  3D67 A;  3CPA A;  4JZ0 A;  4ZYQ A;  3GUX A;  3QNV A;  4F9U A;  3MN8 A;  3PFO A;  1QMU A;  2QYV A;  5ELY A;  2V8V A;  4Z65 A;  1VHO A;  5LYF A;  4NGN A;  3BI1 A;  4CDJ A;  3H8F A;  2CTB A;  3MRU A;  4KNG E;  2RFH A;  4IK2 A;  2O53 A;  1BPN A;  2PJA A;  1BLL E;  4UF4 A;  2ZEO A;  3IIB A;  4UIB A;  4OC1 A;  1HDQ A;  2VL1 A;  5LRG A;  3PBB A;  3SI0 A;  1OBR A;  5K8M A;  4NGT A;  3BI0 A;  4R76 A;  2PJ6 A;  4WJB A;  4FWU A;  1PCA A;  4MHN A;  4W9Y A;  2ZEH A;  2XEI A;  1UWY A;  1CP7 A;  4Q7A A;  2PJ0 A;  3CPX A;  3DGV A;  2PIZ A;  1BPM A;  3D7G A;  3SI1 A;  2PJ7 A;  5CBM A;  2F7V A;  1YSJ A;  3D68 A;  3D66 A;  4DJL A;  3VAR A;  7CPA A;  1YLO A;  3BXM A;  1RTQ A;  5LYI A;  3IFE A;  1XBU A;  2V8H A;  3FED A;  8CPA A;  5K8P A;  2ZEP A;  4X3R A;  5LRJ A;  4MCQ A;  4OC3 A;  2AFO A;  2Q43 A;  3KHZ A;  3NH4 A;  1TKJ A;  2AFM A;  1IY7 A;  4YN3 A;  2PJ1 A;  3BHX A;  1IGB A;  1Y0Y A;  3PFE A;  4P4F A;  3PB9 X;  3SJF A;  2NYQ A;  2OOT A;  4P4I A;  3PBE A;  4PXE A;  1Z5R A;  4C9E A;  1CP6 A;  4C9V A;  2AFZ A;  2PJ9 A;  4RUH A;  4ZY2 A;  5JGF A;  4NGQ A;  2XEJ A;  1LCP A;  1ELM P;  4P6Y A;  1TF8 A;  2ZED A;  4P4J A;  1FT7 A;  1CG2 A;  4LQG A;  4UEZ A;  3PB6 X;  4DUK A;  3WT4 A;  2V8G A;  4A94 A;  2PRQ A;  5LYD A;  4A39 A;  4R7M A;  3KQZ A;  4NJR A;  4MMO A;  1LAN A;  1F2P A;  4P4B A;  1VGY A;  2GP4 A;  2IQ6 A;  2ZEG A;  4C8P A;  3H8E A;  4TNU A;  2PJB A;  2F8H A;  3S9L A;  5LRK A;  1JQG A;  3I6S A;  5JM6 A;  4OP4 A;  2CTC A;  1GYT A;  1ZLI A;  3SJE A;  4PXD A;  1R3N A;  4H2K A;  2WYR A;  1EE3 P;  1ARM A;  4MRI A;  4CDK A;  1R43 A;  1AYE A;  2C1C A;  1HEE A;  3KAS A;  4P44 A;  4MHZ A;  4C8A A;  2PVV A;  4A37 A;  4FAI A;  2IJZ A;  2BO9 A;  5HVF A;  1LFW A;  3S9N A;  1ZG8 A;  4PXC A;  2PE3 A;  2PJ4 A;  2PJ8 A;  1LAP A;  4X2T A;  3EIF A;  2PJC A;  1F57 A;  4OKO A;  4UEF A;  1Y9Z A;  3NA6 A;  4C8F A;  3D7F A;  1XRY A;  4C84 A;  3V38 A;  3ISX A;  1VIX A;  1AMP A;  1Y7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...