3BI1A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of methotrexate-glu
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bi1A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bi1A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bi1A02
3IEHA 5LRGA 3KR4A 3D7DA 1OBRA 3B3TA 4MHYA 2NYQA 3SJGA 5K8MA 3WC6A 4AXVA 4TNUA 1XBUA 1VIXA 1BPMA 1TF8A 4C9VA 3SJEA 2PJ2A 1BPNA 2PJ7A 1YSJA 2C6PA 4P4FA 4C8FA 2CF4A 5IB9A 3B35A 2Q51A 2RB7A 1YW4A 4DJLA 2ZEEA 2IQ6A 4NJQA 3GUXA 4ZY1A 5HXDA 1LCPA 4C84A 3B3VA 2XEGA 4TJVA 3FEDA 1HDQA 1JQGA 4A94A 1AYEA 1Z2LA 5K8PA 4ZYQA 4K3NA 4A38A 2WYRA 2V8HA 3CDXA 2AFZA 3VH9A 4C9EA 5JM6A 1CP6A 2PJ1A 3FF3A 4CDJA 4EWTA 2O4HA 4MXUA 1ZLIA 3LWUA 1Y9ZA 2PVWA 2EK9A 4OC3A 2RFHA 4PQAA 2C1CA 4PXCA 2BCOA 2XEFA 2XEJA 3D7GA 2POKA 4DYOA 3ICUA 1Z5RA 2AFMA 3VTAA 4H2KA 2JBJA 4MCSA 4P4IA 1YMEA 3RAMA 3PB7X 4C9UA 1TKFA 1Y0YA 3KHZA 4NGMA 4PXDA 2PJ9A 3KQXA 3S9NA 4MCRA 4UEZA 3B2YA 3SI2A 2AFUA 2PJCA 3RBUA 4EFDA 4NGQA 5D29A 4KNGE 1GYTA 3KHXA 4OC2A 4IAVA 5ELYA 4C8CA 3IO1A 2PE3A 2ZEPA 3PBBA 1CX8A 4R6TA 4NGNA 1ELLP 2PJ4A 3JRUA 2ZOGA 4ZY0A 1QMUA 4FAIA 2ZEOA 3IWWA 1YLOA 1VHOA 3EIFA 3IC1A 4YU9A 4IK2A 3FEEA 1VGYA 2Q43A 4ZY2A 4ONWA 4UIAA 2XEIA 4P4JA 3BHXA 4MMOA 3CT9A 3PB4X 4C8PA 7CPAA 1CPSA 2WZNA 2AFSA 4FBEA 3V7ZA 1IGBA 1YW6A 3IIBA 4FWUA 1BLLE 3T8WA 3IFEA 3GB0A 4C86A 5THWA 2EWBA 1PYTB 2V8GA 1NSAA 2O53A 2AFOA 3D7HA 4NGRA 1CP7A 1TF9A 3NH8A 2PJBA 1LANA 2C6GA 3MRUA 3S9MA 3PB8X 1UWYA 2V77A 4OKOA 2GREA 5JH9A 4PXEA 1LAMA 3FH4A 4TJXA 4C99A 3FECA 1ELMP 2GLFA 4MRIA 3TX8A 5D8NA 2JEWA 5HVFA 2JBKA 1V6CA 3KQZA 2V8DA 3FVLA 4ZX8A 4R8FA 1HEEA 2QVPA 2PIYA 2F8HA 4RUHA 3IJ3A 2V8VA 1AMPA 2EK8A 5LYIA 4NJRA 4IHMA 2F7VA 1CPXA 3SI1A 3D4UA 5HVHA 2ZOFA 4EMEA 4O23A 3PRTA 3BI1A 2ZENA 3ISZA 3D68A 4MCPA 1QQ9A 3KZWA 5LRJA 2ANPA 1R3NA 2PJ8A 1XRYA 4P44A 3LMSA 4OP4A 1WVMA 4JZ0A 3PFEA 3I74A 4P6YA 6CPAA 2QJ8A 4UEEA 3H8FA 4P10A 2DEAA 4KSIA 4OIDA 4CPAA 4C85A 2VL1A 3NH4A 4P4BA 4W9YA 3CPXA 4UEFA 3KGQA 4G1PA 1TXRA 2HB6A 1ZLHA 4MHNA 1M4LA 4F8ZA 4OC5A 3DLJA 3SI0A 2J9AA 2QYVA 3D66A 4YWYA 1PCAA 2PJAA 1F2PA 3I6SA 1ZG7A 4WWVA 3WT4A 5LYFA 1DTDA 4P4DA 1KWMA 4B6ZA 4BD9A 3DGVA 2PVVA 1DE4C 4P4EA 3WC5A 3SJFA 2IMOA 2HC9A 3I1UA 4NGTA 3L2NA 4FUUA 1TKHA 2PJ5A 3GLJA 3NA6A 3B7IA 1IY7A 8CPAA 4R76A 3RZAA 1H8LA 4OMEA 3ISXA 1LOKA 3HUVA 4NFRA 4DUKA 1Y0RA 1VHEA 3BI0A 5CPAA 2ZEFA 2AFXA 4MCQA 3H8EA 3TC8A 4GM5A 1F2OA 4OIWA 3PEIA 4R7MA 2AFWA 4P45A 1TKJA 4F9VA 5CBMA 2ZEMA 5I4MA 1EE3P 4MHPA 3FMCA 3H8GA 3K2KA 3KASA 3B3CA 3D67A 4ZX9A 1CG2A 2PRQA 4X8IA 4OC0A 4JYWA 3FJUA 1R43A 2FVGA 4NGPA 3HLPA 3KI9A 5LYDA 1HDUA 3SJXA 2PIZA 1FT7A 4C9RA 2BO9A 2CTCA 1ARMA 3KR5A 2ABZA 3B3WA 5K8OA 4NGSA 3K9TA 4CDKA 4X3RA 1LAPA 2GU2A 2ZEHA 3B3SA 2PJ3A 3MN8A 2PJ0A 3WC7A 4LQGA 2ZEDA 4C8TA 1Q7LA 2CTBA 3PB6X 2ZELA 4TWEA 5K8NA 4F9UA 3NH5A 4C9AA 4A37A 1CBXA 3PB9X 4C8AA 4WJBA 2I3CA 2C6CA 1XFOA 3NFZA 1Z8LA 3PBEA 4C8UA 5DS0A 2GLJA 2BOAA 2IJZA 4OC4A 4MHZA 5HVGA 1FNOA 2PCUA 4A39A 2PJ6A 2Q4ZA 4ZI6A 3VARA 4UIBA 2NSMA 2OR4A 2ZEGA 1ARLA 3WABA 2CIJA 4UF4A 2OOTA 1LFWA 2G9DA 3N5FA 5JGFA 3D7FA 3VATA 4Z65A 4PPZA 3S9LA 3BXMA 1XMBA 3QNVA 3FX6A 1ZG9A 3CPAA 5J1QA 1XF1A 4YN3A 5F09A 1Y7EA 3KL9A 1ZG8A 1XJOA 4OC1A 5LRKA 4PXBA 3V38A 4Q7AA 1F57A 4X2TA 1BAVA 1RTQA 3PFOA 5LYLA
chains in the Genus database with same CATH superfamily
5F9MA 2Q4VA 4CAEA 3IEHA 5LRGA 3BUOB 4GXHA 1CJWA 2EVNA 2FIAA 3KR4A 4L89A 2BL1A 3I3GA 3D7DA 2VQYA 2NMTA 1OBRA 1S7KA 3B3TA 1YVOA 4HKFA 4MHYA 4FD6A 4QBJA 3T0TA 2NYQA 3SJGA 2WUUA 5K8MA 3WC6A 4ORFA 1J4JA 1NE9A 4AXVA 4TNUA 2Q44A 1XBUA 1YREA 1NSLA 4U9YA 1VIXA 2A4NA 1I21A 2GIVA 1S7LA 4H89A 1BPMA 1WK4A 3A9LA 3EO4A 1TF8A 3FYNA 2Z11A 4C9VA 5G1ZA 4Y49C 4UA3A 4MJ8A 4KVXA 1YLEA 3SJEA 3VRQA 2PJ2A 4QUSA 4PK2A 5A28A 5IB0A 2VZZA 4NCZA 1BPNA 2PJ7A 3GYAA 5AG6A 4AG7A 1YSJA 2C6PA 4P4FA 2R82A 2OLSA 4C8FA 3PFVA 2F5IA 2WPWA 4PK3A 3HPHE 2CF4A 5IB9A 3RNZA 4UFWA 3B35A 2Q51A 2HQYA 2RB7A 1JDBC 1IYLA 5KTCA 1YW4A 4DJLA 2JDDA 4CGOA 2ZEEA 2IQ6A 4NJQA 3NFQA 3CXPA 3GUXA 4ZY1A 4JLYA 4OLLA 3S6KA 1AUGA 3R9GA 3SXNA 2VEZA 4AVBA 5HXDA 2XPPA 4EYSA 1Y9WA 4JD6A 1LCPA 4C84A 3B3VA 2XEGA 2VZYA 5FVJA 4M6IA 4I49A 4TJVA 3FEDA 1CM0A 1S7NA 3IWEA 1X12A 2ZXVA 1HDQA 3W6SA 1JQGA 3S6GA 4A94A 1AYEA 2R98A 1QSMA 1QSRA 2ZPAA 1Z2LA 2D0OA 1I12A 5K8PA 4ZYQA 2DPSA 4K3NA 5IV0A 4A38A 2WYRA 3JTKA 2V8HA 3CDXA 2AFZA 5G22A 2I79A 1IOIA 2HWGA 2G3TA 3VH9A 5AG4A 4C9EA 5JM6A 4HPSA 4C68A 1CP6A 2PJ1A 3FF3A 2YNCC 3F8KA 4EWTA 4CDJA 4PSWA 2OZGA 2P6FA 1KC7A 3HPGG 2O4HA 2REFA 4MXUA 1ZLIA 2K5TA 5IR2A 3LWUA 2VXKA 1Y9ZA 4H6ZA 2PVWA 2EK9A 2D4OA 4KS9A 4IF5A 3NOJA 3F0AA 4OC3A 2RFHA 2EUIA 4JXQA 2EO8A 4ONUA 4PQAA 2C1CA 2FE7A 2GP4A 5F49A 3BJ8A 3PZJA 1A2ZA 4C2XA 4BINA 5EC4A 1Q2DA 2AJ6A 1Z4RA 2G0BA 4JVOA 4QVTA 2EBJA 4PXCA 2BCOA 2XEFA 2XEJA 3D7GA 4B5PA 2POKA 4KOWA 3B8GA 4JWPA 4NSQA 4DYOA 1Z5RA 2AFMA 4KOUA 2ZW6A 4KUAA 2PDOA 3ICUA 2VI7A 1Z8XA 4H2KA 2JBJA 4MCSA 4P4IA 1IYKA 1YMEA 3PB7X 4H6UA 4M6HA 3RAMA 1TKFA 4U5YA 4IIYA 1Y0YA 2HV2A 3KHZA 4B5OA 2PR1A 4NGMA 1R57A 4PXDA 4MY0A 4B13A 2DXQA 2PJ9A 2BSWA 2Z3KA 1NMTA 3EY5A 3R95A 3KQXA 4OADA 1MK4A 4CAFA 5KTAA 3S9NA 2B5GA 2I00A 4MCRA 1L0CA 5EMIA 3OP0A 3B2YA 4KOXA 4KOTA 4UEZA 3SI2A 2AFUA 2PJCA 4MJXA 3ZZIA 4E8OA 4ZBGA 4AB7A 2FIWA 2ARHA 4MFQA 3TLZA 3RBUA 2KCWA 4EFDA 4Q36A 4CGNA 4NGQA 5D29A 2ZW5A 3OAKA 4KNGE 3EXNA 3W6XA 1GYTA 1M6VB 1Z9EA 2CNSA 4CGMA 3KHXA 3KKWA 3BUXB 4OC2A 4IAVA 5ELYA 3TO7A 3P2FA 4F6AA 2HUZA 3IO1A 4C8CA 2PE3A 2P6EA 2ZEPA 3PBBA 3TO9A 1CX8A 4R6TA 4F0XA 4NGNA 1ELLP 1M4GA 5F13A 2PJ4A 3C8OA 1VI4A 1FY7A 3JRUA 1EO0A 3IWGA 1J3LA 2ZOGA 4ZY0A 1TIQA 2FM4A 2B5GB 1QMUA 4BBHA 4BTFA 4FAIA 4R57A 2ZEOA 3RO0A 2YNCA 4R87A 3IWWA 1YLOA 1VHOA 1B6BA 4E5SA 3N7ZA 3EIFA 3IC1A 1X10A 4YU9A 4IK2A 5EBVA 3FEEA 1VGYA 1OZPA 1Z8TA 2Q4YA 2Q43A 4ZY2A 4ONWA 4UIAA 3PLFB 2J8MA 5HH1A 2XEIA 4P4JA 4PV6A 5HMNA 3BHXA 4MMOA 3VWEA 3GIUA 3CT9A 3PB4X 1T36B 4KVOE 4A33A 4C8PA 7CPAA 1CPSA 3RYOA 2WZNA 2AFSA 4FBEA 3K4IA 4FD7A 3OB1B 4OAEA 3V7ZA 1IGBA 1YW6A 3IIBA 4FWUA 3VRPA 1BLLE 1YX0A 4MFZA 1PUAA 3T8WA 3D2PA 1QSOA 3GB0A 3IFEA 5THWA 2B4DA 4C86A 2EWBA 1PYTB 2V8GA 1NSAA 2O53A 3FB3A 3H4QA 4FD5A 4KZTA 4C7IA 4XPKA 1QSNA 3MGDA 1Y9KA 2AFOA 3DDDA 3SXOA 3D7HA 4NGRA 3F5BA 1CP7A 4NEXA 4UCMA 1TF9A 1BOBA 1C3OB 3NH8A 3TLEA 2PJBA 2FL4A 1LANA 4X5KA 1CS0B 2C6GA 3MRUA 4HNWB 2YJTA 3BJ7A 4II9A 3S9MA 3PB8X 4C7HA 1UWYA 2V77A 4OKOA 4JJXA 3KRVA 2GREA 5JH9A 4PXEA 2ZW4A 2DPTA 4MHDA 1LAMA 2YNDA 3FH4A 1KEEB 2YJVA 4TJXA 4C99A 3FECA 2UV8G 1ELMP 2D4PA 2GLFA 3LODA 1KBLA 4R9MA 2DIKA 4MRIA 5H84A 3TX8A 1IICA 2R8VA 5D8NA 1NBWA 2JEWA 5HVFA 2JBKA 1MJBA 3KQZA 1XF8A 2V8DA 1Z9UA 5JQ4A 3CZXA 3OB2B 2B4BA 4RS2A 1JDEA 3FVLA 1VBGA 2QECA 4Y49B 4ZX8A 3LD2A 3E0KA 3ZNIA 4K30A 4R8FA 5KTDA 1HEEA 4M8DA 3S6HA 3SR3A 2BEIA 2QVPA 3FRMA 1Q2YA 2PIYA 2CNTA 2F8HA 1MJ9A 4RUHA 3BUMB 3IJ3A 2ATRA 2V8VA 1R61A 1AMPA 2EK8A 4A32A 3R1KA 4CAXA 4UFXA 4CZ1A 3EZEA 2FT0A 5LYIA 2B58A 4XPLA 1V0CA 4NJRA 2X7BA 4IHMA 4KORA 1Y7RA 2Q7SA 4M85A 5AG5A 3TTHA 3G23A 4C2YA 3TO6A 2Y1NA 2F7VA 1CPXA 4MFKA 2JEVA 2GE3A 3TOAA 4BMHA 4LQ6A 3G3SA 3FIXA 3SI1A 5IX3A 1S5KA 2FS5A 3D4UA 3DSBA 3SHPA 5J8CA 5HVHA 2ZOFA 3FBUA 4CYNA 3EZBA 4EMEA 4O23A 3GY9A 3PRTA 3LACA 1ZYMA 3P2HA 4HNYB 4EVYA 1M1DA 5BWAB 3BI1A 2DLAA 4B12A 3D3SA 2ZENA 3ISZA 4UCPA 5K99A 4LUAA 5BY0A 1YR0A 3D68A 4XNHB 1VBHA 4MCPA 1QQ9A 3KZWA 4UWJA 5LRJA 2ANPA 2Y0MA 3FXTA 1R3NA 2AE6A 2XPOA 2PJ8A 4JXRA 4AG9A 5JPHA 3D8PA 1LRZA 1XRYA 3NE8A 4RN7A 4P44A 3LMSA 3EC4A 4OP4A 5G20A 1WVMA 2D0PA 4B14A 3WR7A 4JZ0A 2C5QA 3PFEA 3OWCA 3QB8A 1KUXA 4P6YA 3I74A 6CPAA 4C9UA 5HKWA 1M4DA 2HI6A 1RXTA 2QJ8A 2CXAA 3D2MA 2YNEA 4UEEA 3H8FA 4P10A 5HKYA 2DEAA 4KSIA 4KVME 4OIDA 2VL1A 4CPAA 4KLWA 3NH4A 4C85A 2G3AA 4P4BA 4W9YA 3CPXA 5AGEA 2AUNA 2FSRA 4KLVA 1UFHA 4UEFA 3KGQA 4G1PA 4KUBA 1TXRA 5E96A 1GGOA 1S7FA 1XEBA 2HB6A 3JUWA 1ZLHA 2PSWA 4MHNA 4CS0B 2Z3NA 1ZL0A 1M4LA 4F8ZA 4OC5A 4INJA 3TLAA 2CBLA 2B4JC 3DLJA 3DNSA 2J9AA 3SI0A 2QYVA 3D66A 4YWYA 4E2AA 5AXIA 1PCAA 2RC4A 3R96A 1YQEA 3DR8A 5F1YA 1KZFA 2QIRA 2PJAA 1F2PA 1KUVA 2PR8A 2Z3PA 2X0SA 2Q04A 2OB0A 3I6SA 1ZG7A 3K9UA 4WWVA 5F47A 2Z0ZA 3WT4A 5LYFA 1DTDA 4BPWB 2P0WA 3W91A 4AVCA 2E28A 1M44A 2EZCA 3GKRA 4P4DA 1KWMA 4B6ZA 4COBA 4CRYB 3FNCA 4BD9A 2QMLA 3DGVA 2PVVA 1DE4C 3VRRA 4A31A 4MY3A 4HNXB 1YK3A 2EZAA 2FXFA 2VBQA 4KSAA 1CE8B 4AVAA 5JVLA 4P4EA 3WC5A 3SJFA 2Y1MA 2HC9A 2IMOA 4NGTA 3I1UA 3L2NA 4FUUA 1B87A 1TKHA 2PJ5A 3GLJA 3I9SA 3NA6A 4KSFA 4MFJA 3B7IA 3BLNA 4NF1A 1IY7A 2PQ8A 4RI1A 2VKZG 8CPAA 4KOSA 5G21A 3HMJG 3TLGA 4R76A 4QB9A 4L8AA 3RZAA 1H8LA 4OMEA 1I1DA 1LOKA 3ISXA 3TFYA 2OH1A 3HUVA 4NFRA 4DUKA 1BXRB 1Y0RA 1EZAA 5FD8A 2EZBA 1VHEA 3BI0A 5CPAA 1MJAA 2WPXA 2ZEFA 2CNMA 2AFXA 5HKZA 4MCQA 3VROA 2Z10A 1YVKA 3H8EA 1F2OA 3IGRA 4GM5A 4KOVA 3TC8A 4OIWA 1A9XB 3PEIA 1U6MA 4R7MA 4J3GA 2AFWA 1P0HA 4P45A 3TLCA 1IB1E 4B11A 3EZAA 1TKJA 4F9VA 5C88A 2ZW7A 4CYQA 5CBMA 2YGWA 3H5ZA 2ZEMA 4KOYA 4UBRA 5I4MA 4BPXB 1EE3P 2PC1A 4MHPA 4U9ZA 3CXQA 4F0YA 4H1HA 3FMCA 4YRHA 3H8GA 2WSAA 1S3ZA 1GHEA 4C2ZA 3K2KA 5F46A 4Q38A 4CAWA 3KASA 3ZJ0A 4R3LA 3B3CA 1IIDA 3VTAA 3D67A 3V8IA 4UWIA 4GPLB 1PU9A 3EFAA 4QC6A 1ZRSA 2P6GA 4ZX9A 4XPDC 4CGLA 1CG2A 3BUWB 4M6GA 2PRQA 1VKCA 2XPNA 3VRNA 2H5MA 4X8IA 2OZUA 3T90A 2REEA 4A30A 3PGPA 1N71A 4OC0A 4JYWA 1XIXA 1R43A 2FVGA 4NGPA 2J8RA 3FJUA 3HLPA 1HDUA 1VHSA 5LYDA 3U1BA 3SJXA 2PIZA 1IU8A 1FT7A 3G8WA 3VWDA 2BO9A 4MBUA 2MP0A 4C9RA 2N3AB 2HROA 2CTCA 4CRZB 3IU1A 4PSXA 1C30B 1ARMA 4XNHC 3DR6A 1ZO0A 1V6CA 3KR5A 1Z8WA 2ABZA 3B3WA 4UFVA 4CYPA 5K8OA 4NGSA 1XMTA 1NXJA 4CO9A 4GS4A 2B3UA 4CAVA 3BUNB 1FBVA 1JWQA 3K9TA 3S6FA 4A2ZA 4CDKA 4X3RA 1LAPA 2GU2A 2ZEHA 3B3SA 4YGOA 3R9EA 4CGPA 2PJ3A 3MN8A 1SQHA 2PJ0A 2B4DB 3WC7A 1Q5XA 4LQGA 1B47A 2Z3MA 3TLYA 2ZEDA 2CY2A 4C8TA 3VGOA 1Q7LA 4J0NA 2CTBA 3PB6X 2ZELA 4TWEA 5K8NA 4F9UA 3KI9A 4R3KA 3TT2A 3U88C 4UCNA 4IIXA 3NH5A 4E0AA 3T05A 4B10A 2PCNA 4C9AA 2XPLA 4A37A 3T5MA 2B3VA 1CBXA 2GANA 3PB9X 1WJTA 3GJZA 3IU2A 4C8AA 4WJBA 4BPUB 2I3CA 2C6CA 4NXYA 3R9FA 3O8ZA 1XFOA 2BUEA 3NFZA 1Z8LA 1IOFA 4RR2B 1YGHA 3PBEA 1XOVA 3QAYA 5H86A 2DF5A 1EZBA 1XE4A 1K4JA 1Q2CA 3JVNA 1YVHA 3F9KC 1M4IA 2GLJA 2O28A 5DS0A 5GCNA 4C8UA 4M3SA 2BOAA 2IJZA 4OC4A 4MHZA 4CYOA 5HVGA 1FNOA 4E94A 2GFQA 5AG7A 2PCUA 4ZGYB 4A39A 2PJ6A 4MI1A 2J8NA 5DWNA 5C82A 2Q4ZA 4COGA 2Q0YA 2IL4A 1ON0A 3T9YA 3PP9A 4ZI6A 3VARA 4UIBA 5F48A 2NSMA 2OR4A 2R1IA 2ZEGA 1ARLA 2R7HA 3WABA 2CIJA 4MFLA 1RO5A 4MI4A 2OOTA 1S60A 4UF4A 4A95A 1LFWA 5J8FA 2G9DA 3TE4A 4XPDB 4DNCA 4A4CA 3N5FA 3TOBA 3D7FA 3PT1A 5JGFA 2AUMA 5JYBA 3T07A 5J3XA 3NE7A 5DWMA 1WWZA 2JLMA 2PRBA 4PPZA 2OU2A 3VATA 4Z65A 5ISVA 4B5PB 3C26A 3S9LA 3BXMA 5A27A 1XMBA 3QNVA 5I0CA 3FX6A 1DIKA 1Z4EA 2Q7BA 1ZG9A 2Z3LA 3UY5A 3CPAA 5J1QA 3CXSA 2OZHA 1XF1A 4YN3A 5F09A 3TLBA 3TLGB 1Y7EA 2C27A 1BO4A 4FD4A 3KL9A 2B0AA 4IUSA 3TCVA 4MFPA 2ODFA 3TYXA 1ZG8A 2FCKA 1XJOA 4OC1A 1KUYA 5CNPA 4LX9A 5LRKA 5F5XA 4PXBA 3V38A 4A4BA 3QAHA 4Q7AA 1F57A 4X2TA 1BAVA 2JDCA 1QSTA 1RTQA 2Z3OA 4YFJA 3PFOA 1P4NA 5LYLA
chains in the Genus database with same CATH topology
3IEHA 5LRGA 3KR4A 3D7DA 1OBRA 3B3TA 4MHYA 2NYQA 3SJGA 5K8MA 3WC6A 4AXVA 4TNUA 1XBUA 1VIXA 1BPMA 1TF8A 4C9VA 3SJEA 2PJ2A 1BPNA 2PJ7A 1YSJA 2C6PA 4P4FA 4C8FA 2CF4A 5IB9A 3B35A 2Q51A 2RB7A 1YW4A 4DJLA 2ZEEA 2IQ6A 4NJQA 3GUXA 4ZY1A 5HXDA 1LCPA 4C84A 3B3VA 2XEGA 4TJVA 3FEDA 1HDQA 1JQGA 4A94A 1AYEA 1Z2LA 5K8PA 4ZYQA 4K3NA 4A38A 2WYRA 2V8HA 3CDXA 2AFZA 3VH9A 4C9EA 5JM6A 1CP6A 2PJ1A 3FF3A 4CDJA 4EWTA 2O4HA 4MXUA 5IR2A 1ZLIA 3LWUA 1Y9ZA 2PVWA 2EK9A 4OC3A 2RFHA 4PQAA 2C1CA 2GP4A 4PXCA 2BCOA 2XEFA 2XEJA 3D7GA 2POKA 4DYOA 3ICUA 1Z5RA 2AFMA 3VTAA 4H2KA 2JBJA 4MCSA 4P4IA 1YMEA 3RAMA 3PB7X 4C9UA 1TKFA 1Y0YA 3KHZA 4NGMA 4PXDA 2PJ9A 3KQXA 3S9NA 4MCRA 4UEZA 3B2YA 3SI2A 2AFUA 2PJCA 3RBUA 4EFDA 4NGQA 5D29A 4KNGE 1GYTA 3KHXA 4OC2A 4IAVA 5ELYA 4C8CA 3IO1A 2PE3A 2ZEPA 3PBBA 1CX8A 4R6TA 4NGNA 1ELLP 2PJ4A 3JRUA 2ZOGA 4ZY0A 1QMUA 4FAIA 2ZEOA 3IWWA 1YLOA 1VHOA 3EIFA 3IC1A 4YU9A 4IK2A 3FEEA 1VGYA 2Q43A 4ZY2A 4ONWA 4UIAA 2XEIA 4P4JA 3BHXA 4MMOA 3CT9A 3PB4X 4C8PA 7CPAA 1CPSA 2WZNA 2AFSA 4FBEA 3V7ZA 1IGBA 1YW6A 3IIBA 4FWUA 1BLLE 3T8WA 3IFEA 3GB0A 4C86A 5THWA 2EWBA 1PYTB 2V8GA 1NSAA 2O53A 2AFOA 3D7HA 4NGRA 1CP7A 1TF9A 3NH8A 2PJBA 1LANA 2C6GA 3MRUA 3S9MA 3PB8X 1UWYA 2V77A 4OKOA 2GREA 5JH9A 4PXEA 1LAMA 3FH4A 4TJXA 4C99A 3FECA 1ELMP 2GLFA 4MRIA 3TX8A 5D8NA 2JEWA 5HVFA 2JBKA 1V6CA 3KQZA 2V8DA 3FVLA 4ZX8A 4R8FA 1HEEA 2QVPA 2PIYA 2F8HA 4RUHA 3IJ3A 2V8VA 1AMPA 2EK8A 5LYIA 4NJRA 4IHMA 2F7VA 1CPXA 3SI1A 3D4UA 5HVHA 2ZOFA 4EMEA 4O23A 3PRTA 3BI1A 2ZENA 3ISZA 3D68A 4MCPA 1QQ9A 3KZWA 5LRJA 2ANPA 1R3NA 2PJ8A 1XRYA 4P44A 3LMSA 4OP4A 1WVMA 4JZ0A 2C5QA 3PFEA 3I74A 4P6YA 6CPAA 2QJ8A 4UEEA 3H8FA 4P10A 2DEAA 4KSIA 4OIDA 4CPAA 4C85A 2VL1A 3NH4A 4P4BA 4W9YA 3CPXA 4UEFA 3KGQA 4G1PA 1TXRA 2HB6A 1ZLHA 4MHNA 1M4LA 4F8ZA 4OC5A 3DLJA 3SI0A 2J9AA 2QYVA 3D66A 4YWYA 1PCAA 2PJAA 1F2PA 3I6SA 1ZG7A 4WWVA 3WT4A 5LYFA 1DTDA 4P4DA 1KWMA 4B6ZA 4BD9A 3DGVA 2PVVA 1DE4C 4P4EA 3WC5A 3SJFA 2IMOA 2HC9A 3I1UA 4NGTA 3L2NA 4FUUA 1TKHA 2PJ5A 3GLJA 3NA6A 3B7IA 1IY7A 8CPAA 4R76A 3RZAA 1H8LA 4OMEA 3ISXA 1LOKA 3HUVA 4NFRA 4DUKA 1Y0RA 1VHEA 3BI0A 5CPAA 2ZEFA 2AFXA 4MCQA 3H8EA 3TC8A 4GM5A 1F2OA 4OIWA 3PEIA 4R7MA 2AFWA 4P45A 1TKJA 4F9VA 5CBMA 2ZEMA 5I4MA 1EE3P 4MHPA 3FMCA 3H8GA 3K2KA 3KASA 3B3CA 3D67A 4ZX9A 1CG2A 2PRQA 4X8IA 4OC0A 4JYWA 3FJUA 1R43A 2FVGA 4NGPA 3HLPA 3KI9A 5LYDA 1HDUA 3SJXA 2PIZA 1FT7A 4C9RA 2BO9A 2CTCA 1ARMA 3KR5A 2ABZA 3B3WA 5K8OA 4NGSA 3K9TA 4CDKA 4X3RA 1LAPA 2GU2A 2ZEHA 3B3SA 2PJ3A 3MN8A 2PJ0A 3WC7A 4LQGA 2ZEDA 4C8TA 1Q7LA 2CTBA 3PB6X 2ZELA 4TWEA 5K8NA 4F9UA 3NH5A 4C9AA 4A37A 1CBXA 3PB9X 4C8AA 4WJBA 2I3CA 2C6CA 1XFOA 3NFZA 1Z8LA 3PBEA 4C8UA 5DS0A 2GLJA 2BOAA 2IJZA 4OC4A 4MHZA 5HVGA 1FNOA 2PCUA 4A39A 2PJ6A 2Q4ZA 4ZI6A 3VARA 4UIBA 2NSMA 2OR4A 2ZEGA 1ARLA 3WABA 2CIJA 4UF4A 2OOTA 1LFWA 2G9DA 3N5FA 5JGFA 3D7FA 3VATA 4Z65A 4PPZA 3S9LA 3BXMA 1XMBA 3QNVA 3FX6A 1ZG9A 3CPAA 5J1QA 1XF1A 4YN3A 5F09A 1Y7EA 3KL9A 1ZG8A 1XJOA 4OC1A 5LRKA 4PXBA 3V38A 4Q7AA 1F57A 4X2TA 1BAVA 1RTQA 3PFOA 5LYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEH A;  5LRG A;  3KR4 A;  3D7D A;  1OBR A;  3B3T A;  4MHY A;  2NYQ A;  3SJG A;  5K8M A;  3WC6 A;  4AXV A;  4TNU A;  1XBU A;  1VIX A;  1BPM A;  1TF8 A;  4C9V A;  3SJE A;  2PJ2 A;  1BPN A;  2PJ7 A;  1YSJ A;  2C6P A;  4P4F A;  4C8F A;  2CF4 A;  5IB9 A;  3B35 A;  2Q51 A;  2RB7 A;  1YW4 A;  4DJL A;  2ZEE A;  2IQ6 A;  4NJQ A;  3GUX A;  4ZY1 A;  5HXD A;  1LCP A;  4C84 A;  3B3V A;  2XEG A;  4TJV A;  3FED A;  1HDQ A;  1JQG A;  4A94 A;  1AYE A;  1Z2L A;  5K8P A;  4ZYQ A;  4K3N A;  4A38 A;  2WYR A;  2V8H A;  3CDX A;  2AFZ A;  3VH9 A;  4C9E A;  5JM6 A;  1CP6 A;  2PJ1 A;  3FF3 A;  4CDJ A;  4EWT A;  2O4H A;  4MXU A;  1ZLI A;  3LWU A;  1Y9Z A;  2PVW A;  2EK9 A;  4OC3 A;  2RFH A;  4PQA A;  2C1C A;  4PXC A;  2BCO A;  2XEF A;  2XEJ A;  3D7G A;  2POK A;  4DYO A;  3ICU A;  1Z5R A;  2AFM A;  3VTA A;  4H2K A;  2JBJ A;  4MCS A;  4P4I A;  1YME A;  3RAM A;  3PB7 X;  4C9U A;  1TKF A;  1Y0Y A;  3KHZ A;  4NGM A;  4PXD A;  2PJ9 A;  3KQX A;  3S9N A;  4MCR A;  4UEZ A;  3B2Y A;  3SI2 A;  2AFU A;  2PJC A;  3RBU A;  4EFD A;  4NGQ A;  5D29 A;  4KNG E;  1GYT A;  3KHX A;  4OC2 A;  4IAV A;  5ELY A;  4C8C A;  3IO1 A;  2PE3 A;  2ZEP A;  3PBB A;  1CX8 A;  4R6T A;  4NGN A;  1ELL P;  2PJ4 A;  3JRU A;  2ZOG A;  4ZY0 A;  1QMU A;  4FAI A;  2ZEO A;  3IWW A;  1YLO A;  1VHO A;  3EIF A;  3IC1 A;  4YU9 A;  4IK2 A;  3FEE A;  1VGY A;  2Q43 A;  4ZY2 A;  4ONW A;  4UIA A;  2XEI A;  4P4J A;  3BHX A;  4MMO A;  3CT9 A;  3PB4 X;  4C8P A;  7CPA A;  1CPS A;  2WZN A;  2AFS A;  4FBE A;  3V7Z A;  1IGB A;  1YW6 A;  3IIB A;  4FWU A;  1BLL E;  3T8W A;  3IFE A;  3GB0 A;  4C86 A;  5THW A;  2EWB A;  1PYT B;  2V8G A;  1NSA A;  2O53 A;  2AFO A;  3D7H A;  4NGR A;  1CP7 A;  1TF9 A;  3NH8 A;  2PJB A;  1LAN A;  2C6G A;  3MRU A;  3S9M A;  3PB8 X;  1UWY A;  2V77 A;  4OKO A;  2GRE A;  5JH9 A;  4PXE A;  1LAM A;  3FH4 A;  4TJX A;  4C99 A;  3FEC A;  1ELM P;  2GLF A;  4MRI A;  3TX8 A;  5D8N A;  2JEW A;  5HVF A;  2JBK A;  1V6C A;  3KQZ A;  2V8D A;  3FVL A;  4ZX8 A;  4R8F A;  1HEE A;  2QVP A;  2PIY A;  2F8H A;  4RUH A;  3IJ3 A;  2V8V A;  1AMP A;  2EK8 A;  5LYI A;  4NJR A;  4IHM A;  2F7V A;  1CPX A;  3SI1 A;  3D4U A;  5HVH A;  2ZOF A;  4EME A;  4O23 A;  3PRT A;  3BI1 A;  2ZEN A;  3ISZ A;  3D68 A;  4MCP A;  1QQ9 A;  3KZW A;  5LRJ A;  2ANP A;  1R3N A;  2PJ8 A;  1XRY A;  4P44 A;  3LMS A;  4OP4 A;  1WVM A;  4JZ0 A;  3PFE A;  3I74 A;  4P6Y A;  6CPA A;  2QJ8 A;  4UEE A;  3H8F A;  4P10 A;  2DEA A;  4KSI A;  4OID A;  4CPA A;  4C85 A;  2VL1 A;  3NH4 A;  4P4B A;  4W9Y A;  3CPX A;  4UEF A;  3KGQ A;  4G1P A;  1TXR A;  2HB6 A;  1ZLH A;  4MHN A;  1M4L A;  4F8Z A;  4OC5 A;  3DLJ A;  3SI0 A;  2J9A A;  2QYV A;  3D66 A;  4YWY A;  1PCA A;  2PJA A;  1F2P A;  3I6S A;  1ZG7 A;  4WWV A;  3WT4 A;  5LYF A;  1DTD A;  4P4D A;  1KWM A;  4B6Z A;  4BD9 A;  3DGV A;  2PVV A;  1DE4 C;  4P4E A;  3WC5 A;  3SJF A;  2IMO A;  2HC9 A;  3I1U A;  4NGT A;  3L2N A;  4FUU A;  1TKH A;  2PJ5 A;  3GLJ A;  3NA6 A;  3B7I A;  1IY7 A;  8CPA A;  4R76 A;  3RZA A;  1H8L A;  4OME A;  3ISX A;  1LOK A;  3HUV A;  4NFR A;  4DUK A;  1Y0R A;  1VHE A;  3BI0 A;  5CPA A;  2ZEF A;  2AFX A;  4MCQ A;  3H8E A;  3TC8 A;  4GM5 A;  1F2O A;  4OIW A;  3PEI A;  4R7M A;  2AFW A;  4P45 A;  1TKJ A;  4F9V A;  5CBM A;  2ZEM A;  5I4M A;  1EE3 P;  4MHP A;  3FMC A;  3H8G A;  3K2K A;  3KAS A;  3B3C A;  3D67 A;  4ZX9 A;  1CG2 A;  2PRQ A;  4X8I A;  4OC0 A;  4JYW A;  3FJU A;  1R43 A;  2FVG A;  4NGP A;  3HLP A;  3KI9 A;  5LYD A;  1HDU A;  3SJX A;  2PIZ A;  1FT7 A;  4C9R A;  2BO9 A;  2CTC A;  1ARM A;  3KR5 A;  2ABZ A;  3B3W A;  5K8O A;  4NGS A;  3K9T A;  4CDK A;  4X3R A;  1LAP A;  2GU2 A;  2ZEH A;  3B3S A;  2PJ3 A;  3MN8 A;  2PJ0 A;  3WC7 A;  4LQG A;  2ZED A;  4C8T A;  1Q7L A;  2CTB A;  3PB6 X;  2ZEL A;  4TWE A;  5K8N A;  4F9U A;  3NH5 A;  4C9A A;  4A37 A;  1CBX A;  3PB9 X;  4C8A A;  4WJB A;  2I3C A;  2C6C A;  1XFO A;  3NFZ A;  1Z8L A;  3PBE A;  4C8U A;  5DS0 A;  2GLJ A;  2BOA A;  2IJZ A;  4OC4 A;  4MHZ A;  5HVG A;  1FNO A;  2PCU A;  4A39 A;  2PJ6 A;  2Q4Z A;  4ZI6 A;  3VAR A;  4UIB A;  2NSM A;  2OR4 A;  2ZEG A;  1ARL A;  3WAB A;  2CIJ A;  4UF4 A;  2OOT A;  1LFW A;  2G9D A;  3N5F A;  5JGF A;  3D7F A;  3VAT A;  4Z65 A;  4PPZ A;  3S9L A;  3BXM A;  1XMB A;  3QNV A;  3FX6 A;  1ZG9 A;  3CPA A;  5J1Q A;  1XF1 A;  4YN3 A;  5F09 A;  1Y7E A;  3KL9 A;  1ZG8 A;  1XJO A;  4OC1 A;  5LRK A;  4PXB A;  3V38 A;  4Q7A A;  1F57 A;  4X2T A;  1BAV A;  1RTQ A;  3PFO A;  5LYL A; 
#chains in the Genus database with same CATH topology
 5F9M A;  2Q4V A;  4CAE A;  3IEH A;  5LRG A;  3BUO B;  4GXH A;  1CJW A;  2EVN A;  2FIA A;  3KR4 A;  4L89 A;  2BL1 A;  3I3G A;  3D7D A;  2VQY A;  2NMT A;  1OBR A;  1S7K A;  3B3T A;  1YVO A;  4HKF A;  4MHY A;  4FD6 A;  4QBJ A;  3T0T A;  2NYQ A;  3SJG A;  2WUU A;  5K8M A;  3WC6 A;  4ORF A;  1J4J A;  1NE9 A;  4AXV A;  4TNU A;  2Q44 A;  1XBU A;  1YRE A;  1NSL A;  4U9Y A;  1VIX A;  2A4N A;  1I21 A;  2GIV A;  1S7L A;  4H89 A;  1BPM A;  1WK4 A;  3A9L A;  3EO4 A;  1TF8 A;  3FYN A;  2Z11 A;  4C9V A;  5G1Z A;  4Y49 C;  4UA3 A;  4MJ8 A;  4KVX A;  1YLE A;  3SJE A;  3VRQ A;  2PJ2 A;  4QUS A;  4PK2 A;  5A28 A;  5IB0 A;  2VZZ A;  4NCZ A;  1BPN A;  2PJ7 A;  3GYA A;  5AG6 A;  4AG7 A;  1YSJ A;  2C6P A;  4P4F A;  2R82 A;  2OLS A;  4C8F A;  3PFV A;  2F5I A;  2WPW A;  4PK3 A;  3HPH E;  2CF4 A;  5IB9 A;  3RNZ A;  4UFW A;  3B35 A;  2Q51 A;  2HQY A;  2RB7 A;  1JDB C;  1IYL A;  5KTC A;  1YW4 A;  4DJL A;  2JDD A;  4CGO A;  2ZEE A;  2IQ6 A;  4NJQ A;  3NFQ A;  3CXP A;  3GUX A;  4ZY1 A;  4JLY A;  4OLL A;  3S6K A;  1AUG A;  3R9G A;  3SXN A;  2VEZ A;  4AVB A;  5HXD A;  2XPP A;  4EYS A;  1Y9W A;  4JD6 A;  1LCP A;  4C84 A;  3B3V A;  2XEG A;  2VZY A;  5FVJ A;  4M6I A;  4I49 A;  4TJV A;  3FED A;  1CM0 A;  1S7N A;  3IWE A;  1X12 A;  2ZXV A;  1HDQ A;  3W6S A;  1JQG A;  3S6G A;  4A94 A;  1AYE A;  2R98 A;  1QSM A;  1QSR A;  2ZPA A;  1Z2L A;  2D0O A;  1I12 A;  5K8P A;  4ZYQ A;  2DPS A;  4K3N A;  5IV0 A;  4A38 A;  2WYR A;  3JTK A;  2V8H A;  3CDX A;  2AFZ A;  5G22 A;  2I79 A;  1IOI A;  2HWG A;  2G3T A;  3VH9 A;  5AG4 A;  4C9E A;  5JM6 A;  4HPS A;  4C68 A;  1CP6 A;  2PJ1 A;  3FF3 A;  2YNC C;  3F8K A;  4EWT A;  4CDJ A;  4PSW A;  2OZG A;  2P6F A;  1KC7 A;  3HPG G;  2O4H A;  2REF A;  4MXU A;  1ZLI A;  2K5T A;  5IR2 A;  3LWU A;  2VXK A;  1Y9Z A;  4H6Z A;  2PVW A;  2EK9 A;  2D4O A;  4KS9 A;  4IF5 A;  3NOJ A;  3F0A A;  4OC3 A;  2RFH A;  2EUI A;  4JXQ A;  2EO8 A;  4ONU A;  4PQA A;  2C1C A;  2FE7 A;  2GP4 A;  5F49 A;  3BJ8 A;  3PZJ A;  1A2Z A;  4C2X A;  4BIN A;  5EC4 A;  1Q2D A;  2AJ6 A;  1Z4R A;  2G0B A;  4JVO A;  4QVT A;  2EBJ A;  4PXC A;  2BCO A;  2XEF A;  2XEJ A;  3D7G A;  4B5P A;  2POK A;  4KOW A;  3B8G A;  4JWP A;  4NSQ A;  4DYO A;  1Z5R A;  2AFM A;  4KOU A;  2ZW6 A;  4KUA A;  2PDO A;  3ICU A;  2VI7 A;  1Z8X A;  4H2K A;  2JBJ A;  4MCS A;  4P4I A;  1IYK A;  1YME A;  3PB7 X;  4H6U A;  4M6H A;  3RAM A;  1TKF A;  4U5Y A;  4IIY A;  1Y0Y A;  2HV2 A;  3KHZ A;  4B5O A;  2PR1 A;  4NGM A;  1R57 A;  4PXD A;  4MY0 A;  4B13 A;  2DXQ A;  2PJ9 A;  2BSW A;  2Z3K A;  1NMT A;  3EY5 A;  3R95 A;  3KQX A;  4OAD A;  1MK4 A;  4CAF A;  5KTA A;  3S9N A;  2B5G A;  2I00 A;  4MCR A;  1L0C A;  5EMI A;  3OP0 A;  3B2Y A;  4KOX A;  4KOT A;  4UEZ A;  3SI2 A;  2AFU A;  2PJC A;  4MJX A;  3ZZI A;  4E8O A;  4ZBG A;  4AB7 A;  2FIW A;  2ARH A;  4MFQ A;  3TLZ A;  3RBU A;  2KCW A;  4EFD A;  4Q36 A;  4CGN A;  4NGQ A;  5D29 A;  2ZW5 A;  3OAK A;  4KNG E;  3EXN A;  3W6X A;  1GYT A;  1M6V B;  1Z9E A;  2CNS A;  4CGM A;  3KHX A;  3KKW A;  3BUX B;  4OC2 A;  4IAV A;  5ELY A;  3TO7 A;  3P2F A;  4F6A A;  2HUZ A;  3IO1 A;  4C8C A;  2PE3 A;  2P6E A;  2ZEP A;  3PBB A;  3TO9 A;  1CX8 A;  4R6T A;  4F0X A;  4NGN A;  1ELL P;  1M4G A;  5F13 A;  2PJ4 A;  3C8O A;  1VI4 A;  1FY7 A;  3JRU A;  1EO0 A;  3IWG A;  1J3L A;  2ZOG A;  4ZY0 A;  1TIQ A;  2FM4 A;  2B5G B;  1QMU A;  4BBH A;  4BTF A;  4FAI A;  4R57 A;  2ZEO A;  3RO0 A;  2YNC A;  4R87 A;  3IWW A;  1YLO A;  1VHO A;  1B6B A;  4E5S A;  3N7Z A;  3EIF A;  3IC1 A;  1X10 A;  4YU9 A;  4IK2 A;  5EBV A;  3FEE A;  1VGY A;  1OZP A;  1Z8T A;  2Q4Y A;  2Q43 A;  4ZY2 A;  4ONW A;  4UIA A;  3PLF B;  2J8M A;  5HH1 A;  2XEI A;  4P4J A;  4PV6 A;  5HMN A;  3BHX A;  4MMO A;  3VWE A;  3GIU A;  3CT9 A;  3PB4 X;  1T36 B;  4KVO E;  4A33 A;  4C8P A;  7CPA A;  1CPS A;  3RYO A;  2WZN A;  2AFS A;  4FBE A;  3K4I A;  4FD7 A;  3OB1 B;  4OAE A;  3V7Z A;  1IGB A;  1YW6 A;  3IIB A;  4FWU A;  3VRP A;  1BLL E;  1YX0 A;  4MFZ A;  1PUA A;  3T8W A;  3D2P A;  1QSO A;  3GB0 A;  3IFE A;  5THW A;  2B4D A;  4C86 A;  2EWB A;  1PYT B;  2V8G A;  1NSA A;  2O53 A;  3FB3 A;  3H4Q A;  4FD5 A;  4KZT A;  4C7I A;  4XPK A;  1QSN A;  3MGD A;  1Y9K A;  2AFO A;  3DDD A;  3SXO A;  3D7H A;  4NGR A;  3F5B A;  1CP7 A;  4NEX A;  4UCM A;  1TF9 A;  1BOB A;  1C3O B;  3NH8 A;  3TLE A;  2PJB A;  2FL4 A;  1LAN A;  4X5K A;  1CS0 B;  2C6G A;  3MRU A;  4HNW B;  2YJT A;  3BJ7 A;  4II9 A;  3S9M A;  3PB8 X;  4C7H A;  1UWY A;  2V77 A;  4OKO A;  4JJX A;  3KRV A;  2GRE A;  5JH9 A;  4PXE A;  2ZW4 A;  2DPT A;  4MHD A;  1LAM A;  2YND A;  3FH4 A;  1KEE B;  2YJV A;  4TJX A;  4C99 A;  3FEC A;  2UV8 G;  1ELM P;  2D4P A;  2GLF A;  3LOD A;  1KBL A;  4R9M A;  2DIK A;  4MRI A;  5H84 A;  3TX8 A;  1IIC A;  2R8V A;  5D8N A;  1NBW A;  2JEW A;  5HVF A;  2JBK A;  1MJB A;  3KQZ A;  1XF8 A;  2V8D A;  1Z9U A;  5JQ4 A;  3CZX A;  3OB2 B;  2B4B A;  4RS2 A;  1JDE A;  3FVL A;  1VBG A;  2QEC A;  4Y49 B;  4ZX8 A;  3LD2 A;  3E0K A;  3ZNI A;  4K30 A;  4R8F A;  5KTD A;  1HEE A;  4M8D A;  3S6H A;  3SR3 A;  2BEI A;  2QVP A;  3FRM A;  1Q2Y A;  2PIY A;  2CNT A;  2F8H A;  1MJ9 A;  4RUH A;  3BUM B;  3IJ3 A;  2ATR A;  2V8V A;  1R61 A;  1AMP A;  2EK8 A;  4A32 A;  3R1K A;  4CAX A;  4UFX A;  4CZ1 A;  3EZE A;  2FT0 A;  5LYI A;  2B58 A;  4XPL A;  1V0C A;  4NJR A;  2X7B A;  4IHM A;  4KOR A;  1Y7R A;  2Q7S A;  4M85 A;  5AG5 A;  3TTH A;  3G23 A;  4C2Y A;  3TO6 A;  2Y1N A;  2F7V A;  1CPX A;  4MFK A;  2JEV A;  2GE3 A;  3TOA A;  4BMH A;  4LQ6 A;  3G3S A;  3FIX A;  3SI1 A;  5IX3 A;  1S5K A;  2FS5 A;  3D4U A;  3DSB A;  3SHP A;  5J8C A;  5HVH A;  2ZOF A;  3FBU A;  4CYN A;  3EZB A;  4EME A;  4O23 A;  3GY9 A;  3PRT A;  3LAC A;  1ZYM A;  3P2H A;  4HNY B;  4EVY A;  1M1D A;  5BWA B;  3BI1 A;  2DLA A;  4B12 A;  3D3S A;  2ZEN A;  3ISZ A;  4UCP A;  5K99 A;  4LUA A;  5BY0 A;  1YR0 A;  3D68 A;  4XNH B;  1VBH A;  4MCP A;  1QQ9 A;  3KZW A;  4UWJ A;  5LRJ A;  2ANP A;  2Y0M A;  3FXT A;  1R3N A;  2AE6 A;  2XPO A;  2PJ8 A;  4JXR A;  4AG9 A;  5JPH A;  3D8P A;  1LRZ A;  1XRY A;  3NE8 A;  4RN7 A;  4P44 A;  3LMS A;  3EC4 A;  4OP4 A;  5G20 A;  1WVM A;  2D0P A;  4B14 A;  3WR7 A;  4JZ0 A;  2C5Q A;  3PFE A;  3OWC A;  3QB8 A;  1KUX A;  4P6Y A;  3I74 A;  6CPA A;  4C9U A;  5HKW A;  1M4D A;  2HI6 A;  1RXT A;  2QJ8 A;  2CXA A;  3D2M A;  2YNE A;  4UEE A;  3H8F A;  4P10 A;  5HKY A;  2DEA A;  4KSI A;  4KVM E;  4OID A;  2VL1 A;  4CPA A;  4KLW A;  3NH4 A;  4C85 A;  2G3A A;  4P4B A;  4W9Y A;  3CPX A;  5AGE A;  2AUN A;  2FSR A;  4KLV A;  1UFH A;  4UEF A;  3KGQ A;  4G1P A;  4KUB A;  1TXR A;  5E96 A;  1GGO A;  1S7F A;  1XEB A;  2HB6 A;  3JUW A;  1ZLH A;  2PSW A;  4MHN A;  4CS0 B;  2Z3N A;  1ZL0 A;  1M4L A;  4F8Z A;  4OC5 A;  4INJ A;  3TLA A;  2CBL A;  2B4J C;  3DLJ A;  3DNS A;  2J9A A;  3SI0 A;  2QYV A;  3D66 A;  4YWY A;  4E2A A;  5AXI A;  1PCA A;  2RC4 A;  3R96 A;  1YQE A;  3DR8 A;  5F1Y A;  1KZF A;  2QIR A;  2PJA A;  1F2P A;  1KUV A;  2PR8 A;  2Z3P A;  2X0S A;  2Q04 A;  2OB0 A;  3I6S A;  1ZG7 A;  3K9U A;  4WWV A;  5F47 A;  2Z0Z A;  3WT4 A;  5LYF A;  1DTD A;  4BPW B;  2P0W A;  3W91 A;  4AVC A;  2E28 A;  1M44 A;  2EZC A;  3GKR A;  4P4D A;  1KWM A;  4B6Z A;  4COB A;  4CRY B;  3FNC A;  4BD9 A;  2QML A;  3DGV A;  2PVV A;  1DE4 C;  3VRR A;  4A31 A;  4MY3 A;  4HNX B;  1YK3 A;  2EZA A;  2FXF A;  2VBQ A;  4KSA A;  1CE8 B;  4AVA A;  5JVL A;  4P4E A;  3WC5 A;  3SJF A;  2Y1M A;  2HC9 A;  2IMO A;  4NGT A;  3I1U A;  3L2N A;  4FUU A;  1B87 A;  1TKH A;  2PJ5 A;  3GLJ A;  3I9S A;  3NA6 A;  4KSF A;  4MFJ A;  3B7I A;  3BLN A;  4NF1 A;  1IY7 A;  2PQ8 A;  4RI1 A;  2VKZ G;  8CPA A;  4KOS A;  5G21 A;  3HMJ G;  3TLG A;  4R76 A;  4QB9 A;  4L8A A;  3RZA A;  1H8L A;  4OME A;  1I1D A;  1LOK A;  3ISX A;  3TFY A;  2OH1 A;  3HUV A;  4NFR A;  4DUK A;  1BXR B;  1Y0R A;  1EZA A;  5FD8 A;  2EZB A;  1VHE A;  3BI0 A;  5CPA A;  1MJA A;  2WPX A;  2ZEF A;  2CNM A;  2AFX A;  5HKZ A;  4MCQ A;  3VRO A;  2Z10 A;  1YVK A;  3H8E A;  1F2O A;  3IGR A;  4GM5 A;  4KOV A;  3TC8 A;  4OIW A;  1A9X B;  3PEI A;  1U6M A;  4R7M A;  4J3G A;  2AFW A;  1P0H A;  4P45 A;  3TLC A;  1IB1 E;  4B11 A;  3EZA A;  1TKJ A;  4F9V A;  5C88 A;  2ZW7 A;  4CYQ A;  5CBM A;  2YGW A;  3H5Z A;  2ZEM A;  4KOY A;  4UBR A;  5I4M A;  4BPX B;  1EE3 P;  2PC1 A;  4MHP A;  4U9Z A;  3CXQ A;  4F0Y A;  4H1H A;  3FMC A;  4YRH A;  3H8G A;  2WSA A;  1S3Z A;  1GHE A;  4C2Z A;  3K2K A;  5F46 A;  4Q38 A;  4CAW A;  3KAS A;  3ZJ0 A;  4R3L A;  3B3C A;  1IID A;  3VTA A;  3D67 A;  3V8I A;  4UWI A;  4GPL B;  1PU9 A;  3EFA A;  4QC6 A;  1ZRS A;  2P6G A;  4ZX9 A;  4XPD C;  4CGL A;  1CG2 A;  3BUW B;  4M6G A;  2PRQ A;  1VKC A;  2XPN A;  3VRN A;  2H5M A;  4X8I A;  2OZU A;  3T90 A;  2REE A;  4A30 A;  3PGP A;  1N71 A;  4OC0 A;  4JYW A;  1XIX A;  1R43 A;  2FVG A;  4NGP A;  2J8R A;  3FJU A;  3HLP A;  1HDU A;  1VHS A;  5LYD A;  3U1B A;  3SJX A;  2PIZ A;  1IU8 A;  1FT7 A;  3G8W A;  3VWD A;  2BO9 A;  4MBU A;  2MP0 A;  4C9R A;  2N3A B;  2HRO A;  2CTC A;  4CRZ B;  3IU1 A;  4PSX A;  1C30 B;  1ARM A;  4XNH C;  3DR6 A;  1ZO0 A;  1V6C A;  3KR5 A;  1Z8W A;  2ABZ A;  3B3W A;  4UFV A;  4CYP A;  5K8O A;  4NGS A;  1XMT A;  1NXJ A;  4CO9 A;  4GS4 A;  2B3U A;  4CAV A;  3BUN B;  1FBV A;  1JWQ A;  3K9T A;  3S6F A;  4A2Z A;  4CDK A;  4X3R A;  1LAP A;  2GU2 A;  2ZEH A;  3B3S A;  4YGO A;  3R9E A;  4CGP A;  2PJ3 A;  3MN8 A;  1SQH A;  2PJ0 A;  2B4D B;  3WC7 A;  1Q5X A;  4LQG A;  1B47 A;  2Z3M A;  3TLY A;  2ZED A;  2CY2 A;  4C8T A;  3VGO A;  1Q7L A;  4J0N A;  2CTB A;  3PB6 X;  2ZEL A;  4TWE A;  5K8N A;  4F9U A;  3KI9 A;  4R3K A;  3TT2 A;  3U88 C;  4UCN A;  4IIX A;  3NH5 A;  4E0A A;  3T05 A;  4B10 A;  2PCN A;  4C9A A;  2XPL A;  4A37 A;  3T5M A;  2B3V A;  1CBX A;  2GAN A;  3PB9 X;  1WJT A;  3GJZ A;  3IU2 A;  4C8A A;  4WJB A;  4BPU B;  2I3C A;  2C6C A;  4NXY A;  3R9F A;  3O8Z A;  1XFO A;  2BUE A;  3NFZ A;  1Z8L A;  1IOF A;  4RR2 B;  1YGH A;  3PBE A;  1XOV A;  3QAY A;  5H86 A;  2DF5 A;  1EZB A;  1XE4 A;  1K4J A;  1Q2C A;  3JVN A;  1YVH A;  3F9K C;  1M4I A;  2GLJ A;  2O28 A;  5DS0 A;  5GCN A;  4C8U A;  4M3S A;  2BOA A;  2IJZ A;  4OC4 A;  4MHZ A;  4CYO A;  5HVG A;  1FNO A;  4E94 A;  2GFQ A;  5AG7 A;  2PCU A;  4ZGY B;  4A39 A;  2PJ6 A;  4MI1 A;  2J8N A;  5DWN A;  5C82 A;  2Q4Z A;  4COG A;  2Q0Y A;  2IL4 A;  1ON0 A;  3T9Y A;  3PP9 A;  4ZI6 A;  3VAR A;  4UIB A;  5F48 A;  2NSM A;  2OR4 A;  2R1I A;  2ZEG A;  1ARL A;  2R7H A;  3WAB A;  2CIJ A;  4MFL A;  1RO5 A;  4MI4 A;  2OOT A;  1S60 A;  4UF4 A;  4A95 A;  1LFW A;  5J8F A;  2G9D A;  3TE4 A;  4XPD B;  4DNC A;  4A4C A;  3N5F A;  3TOB A;  3D7F A;  3PT1 A;  5JGF A;  2AUM A;  5JYB A;  3T07 A;  5J3X A;  3NE7 A;  5DWM A;  1WWZ A;  2JLM A;  2PRB A;  4PPZ A;  2OU2 A;  3VAT A;  4Z65 A;  5ISV A;  4B5P B;  3C26 A;  3S9L A;  3BXM A;  5A27 A;  1XMB A;  3QNV A;  5I0C A;  3FX6 A;  1DIK A;  1Z4E A;  2Q7B A;  1ZG9 A;  2Z3L A;  3UY5 A;  3CPA A;  5J1Q A;  3CXS A;  2OZH A;  1XF1 A;  4YN3 A;  5F09 A;  3TLB A;  3TLG B;  1Y7E A;  2C27 A;  1BO4 A;  4FD4 A;  3KL9 A;  2B0A A;  4IUS A;  3TCV A;  4MFP A;  2ODF A;  3TYX A;  1ZG8 A;  2FCK A;  1XJO A;  4OC1 A;  1KUY A;  5CNP A;  4LX9 A;  5LRK A;  5F5X A;  4PXB A;  3V38 A;  4A4B A;  3QAH A;  4Q7A A;  1F57 A;  4X2T A;  1BAV A;  2JDC A;  1QST A;  1RTQ A;  2Z3O A;  4YFJ A;  3PFO A;  1P4N A;  5LYL A; 
#chains in the Genus database with same CATH homology
 3IEH A;  5LRG A;  3KR4 A;  3D7D A;  1OBR A;  3B3T A;  4MHY A;  2NYQ A;  3SJG A;  5K8M A;  3WC6 A;  4AXV A;  4TNU A;  1XBU A;  1VIX A;  1BPM A;  1TF8 A;  4C9V A;  3SJE A;  2PJ2 A;  1BPN A;  2PJ7 A;  1YSJ A;  2C6P A;  4P4F A;  4C8F A;  2CF4 A;  5IB9 A;  3B35 A;  2Q51 A;  2RB7 A;  1YW4 A;  4DJL A;  2ZEE A;  2IQ6 A;  4NJQ A;  3GUX A;  4ZY1 A;  5HXD A;  1LCP A;  4C84 A;  3B3V A;  2XEG A;  4TJV A;  3FED A;  1HDQ A;  1JQG A;  4A94 A;  1AYE A;  1Z2L A;  5K8P A;  4ZYQ A;  4K3N A;  4A38 A;  2WYR A;  2V8H A;  3CDX A;  2AFZ A;  3VH9 A;  4C9E A;  5JM6 A;  1CP6 A;  2PJ1 A;  3FF3 A;  4CDJ A;  4EWT A;  2O4H A;  4MXU A;  5IR2 A;  1ZLI A;  3LWU A;  1Y9Z A;  2PVW A;  2EK9 A;  4OC3 A;  2RFH A;  4PQA A;  2C1C A;  2GP4 A;  4PXC A;  2BCO A;  2XEF A;  2XEJ A;  3D7G A;  2POK A;  4DYO A;  3ICU A;  1Z5R A;  2AFM A;  3VTA A;  4H2K A;  2JBJ A;  4MCS A;  4P4I A;  1YME A;  3RAM A;  3PB7 X;  4C9U A;  1TKF A;  1Y0Y A;  3KHZ A;  4NGM A;  4PXD A;  2PJ9 A;  3KQX A;  3S9N A;  4MCR A;  4UEZ A;  3B2Y A;  3SI2 A;  2AFU A;  2PJC A;  3RBU A;  4EFD A;  4NGQ A;  5D29 A;  4KNG E;  1GYT A;  3KHX A;  4OC2 A;  4IAV A;  5ELY A;  4C8C A;  3IO1 A;  2PE3 A;  2ZEP A;  3PBB A;  1CX8 A;  4R6T A;  4NGN A;  1ELL P;  2PJ4 A;  3JRU A;  2ZOG A;  4ZY0 A;  1QMU A;  4FAI A;  2ZEO A;  3IWW A;  1YLO A;  1VHO A;  3EIF A;  3IC1 A;  4YU9 A;  4IK2 A;  3FEE A;  1VGY A;  2Q43 A;  4ZY2 A;  4ONW A;  4UIA A;  2XEI A;  4P4J A;  3BHX A;  4MMO A;  3CT9 A;  3PB4 X;  4C8P A;  7CPA A;  1CPS A;  2WZN A;  2AFS A;  4FBE A;  3V7Z A;  1IGB A;  1YW6 A;  3IIB A;  4FWU A;  1BLL E;  3T8W A;  3IFE A;  3GB0 A;  4C86 A;  5THW A;  2EWB A;  1PYT B;  2V8G A;  1NSA A;  2O53 A;  2AFO A;  3D7H A;  4NGR A;  1CP7 A;  1TF9 A;  3NH8 A;  2PJB A;  1LAN A;  2C6G A;  3MRU A;  3S9M A;  3PB8 X;  1UWY A;  2V77 A;  4OKO A;  2GRE A;  5JH9 A;  4PXE A;  1LAM A;  3FH4 A;  4TJX A;  4C99 A;  3FEC A;  1ELM P;  2GLF A;  4MRI A;  3TX8 A;  5D8N A;  2JEW A;  5HVF A;  2JBK A;  1V6C A;  3KQZ A;  2V8D A;  3FVL A;  4ZX8 A;  4R8F A;  1HEE A;  2QVP A;  2PIY A;  2F8H A;  4RUH A;  3IJ3 A;  2V8V A;  1AMP A;  2EK8 A;  5LYI A;  4NJR A;  4IHM A;  2F7V A;  1CPX A;  3SI1 A;  3D4U A;  5HVH A;  2ZOF A;  4EME A;  4O23 A;  3PRT A;  3BI1 A;  2ZEN A;  3ISZ A;  3D68 A;  4MCP A;  1QQ9 A;  3KZW A;  5LRJ A;  2ANP A;  1R3N A;  2PJ8 A;  1XRY A;  4P44 A;  3LMS A;  4OP4 A;  1WVM A;  4JZ0 A;  2C5Q A;  3PFE A;  3I74 A;  4P6Y A;  6CPA A;  2QJ8 A;  4UEE A;  3H8F A;  4P10 A;  2DEA A;  4KSI A;  4OID A;  4CPA A;  4C85 A;  2VL1 A;  3NH4 A;  4P4B A;  4W9Y A;  3CPX A;  4UEF A;  3KGQ A;  4G1P A;  1TXR A;  2HB6 A;  1ZLH A;  4MHN A;  1M4L A;  4F8Z A;  4OC5 A;  3DLJ A;  3SI0 A;  2J9A A;  2QYV A;  3D66 A;  4YWY A;  1PCA A;  2PJA A;  1F2P A;  3I6S A;  1ZG7 A;  4WWV A;  3WT4 A;  5LYF A;  1DTD A;  4P4D A;  1KWM A;  4B6Z A;  4BD9 A;  3DGV A;  2PVV A;  1DE4 C;  4P4E A;  3WC5 A;  3SJF A;  2IMO A;  2HC9 A;  3I1U A;  4NGT A;  3L2N A;  4FUU A;  1TKH A;  2PJ5 A;  3GLJ A;  3NA6 A;  3B7I A;  1IY7 A;  8CPA A;  4R76 A;  3RZA A;  1H8L A;  4OME A;  3ISX A;  1LOK A;  3HUV A;  4NFR A;  4DUK A;  1Y0R A;  1VHE A;  3BI0 A;  5CPA A;  2ZEF A;  2AFX A;  4MCQ A;  3H8E A;  3TC8 A;  4GM5 A;  1F2O A;  4OIW A;  3PEI A;  4R7M A;  2AFW A;  4P45 A;  1TKJ A;  4F9V A;  5CBM A;  2ZEM A;  5I4M A;  1EE3 P;  4MHP A;  3FMC A;  3H8G A;  3K2K A;  3KAS A;  3B3C A;  3D67 A;  4ZX9 A;  1CG2 A;  2PRQ A;  4X8I A;  4OC0 A;  4JYW A;  3FJU A;  1R43 A;  2FVG A;  4NGP A;  3HLP A;  3KI9 A;  5LYD A;  1HDU A;  3SJX A;  2PIZ A;  1FT7 A;  4C9R A;  2BO9 A;  2CTC A;  1ARM A;  3KR5 A;  2ABZ A;  3B3W A;  5K8O A;  4NGS A;  3K9T A;  4CDK A;  4X3R A;  1LAP A;  2GU2 A;  2ZEH A;  3B3S A;  2PJ3 A;  3MN8 A;  2PJ0 A;  3WC7 A;  4LQG A;  2ZED A;  4C8T A;  1Q7L A;  2CTB A;  3PB6 X;  2ZEL A;  4TWE A;  5K8N A;  4F9U A;  3NH5 A;  4C9A A;  4A37 A;  1CBX A;  3PB9 X;  4C8A A;  4WJB A;  2I3C A;  2C6C A;  1XFO A;  3NFZ A;  1Z8L A;  3PBE A;  4C8U A;  5DS0 A;  2GLJ A;  2BOA A;  2IJZ A;  4OC4 A;  4MHZ A;  5HVG A;  1FNO A;  2PCU A;  4A39 A;  2PJ6 A;  2Q4Z A;  4ZI6 A;  3VAR A;  4UIB A;  2NSM A;  2OR4 A;  2ZEG A;  1ARL A;  3WAB A;  2CIJ A;  4UF4 A;  2OOT A;  1LFW A;  2G9D A;  3N5F A;  5JGF A;  3D7F A;  3VAT A;  4Z65 A;  4PPZ A;  3S9L A;  3BXM A;  1XMB A;  3QNV A;  3FX6 A;  1ZG9 A;  3CPA A;  5J1Q A;  1XF1 A;  4YN3 A;  5F09 A;  1Y7E A;  3KL9 A;  1ZG8 A;  1XJO A;  4OC1 A;  5LRK A;  4PXB A;  3V38 A;  4Q7A A;  1F57 A;  4X2T A;  1BAV A;  1RTQ A;  3PFO A;  5LYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...