4OC0A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with ccibzl, a urea-based inhibitor n~2~-[(1-carboxycyclopropyl)carbamoyl]-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc0A02
1R3NA 4A39A 1CP6A 5JM6A 3IO1A 2Q43A 1ZLIA 5THWA 2CTCA 3KL9A 2FVGA 4DUKA 3I6SA 4C8CA 1CPXA 3IEHA 1ARMA 2GU2A 1UWYA 2NSMA 2RB7A 2EK8A 1Y9ZA 1DTDA 4C8UA 3FEEA 1VGYA 3D4UA 2F7VA 3DLJA 3FECA 4EMEA 4X3RA 1HEEA 4P44A 1XMBA 3ICUA 4MXUA 2XEJA 5LRJA 1PYTB 3FEDA 2XEGA 2JBKA 2ZOFA 4EFDA 4NJQA 2O4HA 4UEFA 4F9VA 4YN3A 3KZWA 1LAPA 3PB4X 2JEWA 1OBRA 2PVWA 2I3CA 2ZEPA 2ZEOA 3SJFA 4ZI6A 4PXCA 4C9EA 5HVHA 3B2YA 2PJCA 5HVFA 3RAMA 2ZEGA 1EE3P 1R43A 4P45A 2QJ8A 4W9YA 2PE3A 1YW6A 2ZEFA 1BAVA 3CPXA 2ZELA 4PXDA 4FUUA 4C8TA 3PB6X 4ZX8A 1XFOA 1CP7A 4G1PA 1JQGA 3NH8A 3D7HA 2RFHA 3VARA 3SJEA 2Q51A 1TF8A 3FMCA 3KHZA 3PEIA 3PB7X 2ZOGA 5D8NA 2PVVA 2EK9A 1VIXA 2HC9A 4K3NA 2WYRA 5HXDA 7CPAA 3BI1A 1TF9A 2IJZA 2AFZA 2G9DA 3HUVA 4R8FA 2F8HA 8CPAA 5J1QA 1ELMP 2PJAA 4OKOA 4ONWA 3CPAA 2BOAA 2JBJA 3S9LA 3HLPA 4A37A 1LAMA 4CDKA 1YLOA 2AFWA 2ZEHA 3FX6A 4YWYA 4MHPA 4B6ZA 3D7FA 3H8FA 4P4DA 1Y7EA 4ZY1A 3FVLA 5D29A 3TX8A 1CPSA 2NYQA 2PRQA 4OMEA 3LMSA 1V6CA 1XJOA 4CPAA 4OC1A 4OC5A 4X2TA 4C99A 1YW4A 4WWVA 1TXRA 3WABA 4A38A 1BPMA 4F8ZA 4PQAA 4EWTA 2CF4A 4ZYQA 5ELYA 1XRYA 4X8IA 2ANPA 3PB9X 2VL1A 5CBMA 3BHXA 3GLJA 3KI9A 4OC3A 4C8PA 3N5FA 2CIJA 4IAVA 1F57A 3EIFA 4TJVA 4ZY2A 2BCOA 5LYDA 3WC5A 3K9TA 1ZG7A 4H2KA 3NFZA 3GB0A 2V8VA 2PJ1A 3B3VA 3PRTA 4NGQA 4R76A 3D7DA 5LYFA 1Z8LA 1ARLA 1M4LA 4JYWA 4NGRA 1YSJA 1HDQA 4MHYA 1VHEA 4NGMA 4IHMA 2PJ6A 4CDJA 4MCPA 4UF4A 2AFXA 1IY7A 3B3WA 1WVMA 2PIYA 1VHOA 3SJXA 3I74A 4MHZA 1PCAA 4DYOA 3KQZA 2XEFA 1TKJA 1Q7LA 4NGTA 3IIBA 3MN8A 4PXEA 1AYEA 1QMUA 4WJBA 1BPNA 3KQXA 3RBUA 2DEAA 3D66A 2GLJA 1FT7A 3WC7A 1CBXA 5LYLA 3KASA 4TJXA 1F2PA 2PJ8A 3WT4A 2PJBA 4C9VA 3PBEA 2ZENA 4FAIA 4C9AA 3FJUA 2AFUA 3ISZA 4OC2A 3B3TA 1KWMA 2AFSA 5DS0A 1NSAA 2O53A 3B7IA 4R7MA 2WZNA 1GYTA 3IJ3A 3WC6A 2PJ7A 3LWUA 3SJGA 1XBUA 1LANA 1DE4C 1LOKA 4TWEA 3D7GA 3ISXA 3V7ZA 4GM5A 4A94A 4OC4A 4OC0A 1FNOA 2ABZA 2QVPA 3IFEA 4UIBA 4C9RA 2BO9A 1YMEA 1TKHA 2GLFA 4FWUA 2PJ2A 1AMPA 4KNGE 5K8OA 1ELLP 5I4MA 4Z65A 4JZ0A 3PB8X 3VH9A 4P4IA 4NFRA 4P4EA 1QQ9A 3D67A 3S9MA 6CPAA 5CPAA 4C8FA 1LCPA 4R6TA 2V8DA 4OIDA 4NGNA 1CG2A 3H8EA 2GREA 2Q4ZA 1IGBA 2V8GA 3PFOA 4AXVA 5LRGA 4C86A 4P10A 5K8PA 3KR5A 5K8NA 1F2OA 3I1UA 1ZG9A 2OR4A 4MMOA 3SI0A 1Z2LA 2ZEEA 1RTQA 3QNVA 3IC1A 4UEZA 4ZY0A 2V8HA 3B3SA 3SI2A 3FH4A 2PJ3A 1H8LA 5IB9A 2PJ0A 4DJLA 1ZG8A 2QYVA 1LFWA 4NGPA 2AFMA 2ZEMA 3KGQA 3K2KA 1Y0RA 4P6YA 4C9UA 4PXBA 3DGVA 4TNUA 1CX8A 3BXMA 2PJ9A 3NA6A 4MCRA 4YU9A 4UEEA 5K8MA 2EWBA 4NGSA 3MRUA 2C6GA 4O23A 2AFOA 4OIWA 4C8AA 4P4JA 3B3CA 3SI1A 4ZX9A 3PBBA 3L2NA 1HDUA 4C84A 3CT9A 3H8GA 4RUHA 2HB6A 3JRUA 4IK2A 4MHNA 2OOTA 5LYIA 2ZEDA 3B35A 1BLLE 1TKFA 2PJ4A 4MRIA 4NJRA 5JH9A 2V77A 3NH4A 3KR4A 4Q7AA 2XEIA 3V38A 2J9AA 3T8WA 3RZAA 1ZLHA 5HVGA 1XF1A 4F9UA 2C6PA 2IQ6A 5JGFA 4UIAA 3VTAA 4LQGA 2IMOA 3BI0A 3TC8A 4P4FA 3NH5A 2POKA 4BD9A 4P4BA 3S9NA 2C1CA 4MCQA 3VATA 3PFEA 4MCSA 4OP4A 2PJ5A 5F09A 4KSIA 1Z5RA 3FF3A 2PCUA 3KHXA 3CDXA 4PPZA 3GUXA 4C85A 2C6CA 3D68A 1Y0YA 2CTBA 3IWWA 4FBEA 5LRKA 2PIZA
chains in the Genus database with same CATH superfamily
1R3NA 4A39A 1CP6A 5JM6A 3IO1A 3EO4A 2Q43A 2B58A 1ZLIA 5THWA 2D0OA 2CTCA 3NE7A 1M4GA 2FVGA 3KL9A 4JWPA 4M6HA 4DUKA 3I6SA 4C8CA 3N7ZA 2ZXVA 4KORA 1Y9KA 1CPXA 3RYOA 1NMTA 3IEHA 5JVLA 3DSBA 4QBJA 1ARMA 2GU2A 1UWYA 4KZTA 2NSMA 2RB7A 2EK8A 3VRRA 3ZZIA 4CRYB 2B5GA 1JDBC 1Y9ZA 4CO9A 1DTDA 4C7IA 1WK4A 1AUGA 4AG7A 4C8UA 3FEEA 1VGYA 3QAHA 4A95A 2N3AB 1YQEA 3D4UA 2ARHA 3TOBA 2F7VA 3DLJA 3HPHE 4FD4A 3FECA 4KUBA 4KNGE 4EMEA 4X3RA 1HEEA 2B0AA 2CBLA 3IWEA 1YLEA 4P44A 4IF5A 3F9KC 3I9SA 4A33A 1XMTA 1XMBA 3ICUA 2C27A 4MXUA 2XEJA 5LRJA 5J8CA 2HI6A 2XPPA 4CGLA 1NBWA 1PYTB 1BXRB 3FEDA 2XEGA 3TLYA 1X12A 2JBKA 1S7KA 2ZOFA 4EFDA 4LUAA 3NE8A 4MJ8A 4I49A 4NJQA 2O4HA 4UEFA 4F9VA 4CGPA 3FNCA 4YN3A 3KZWA 4FD5A 3RO0A 1LAPA 3PB4X 5IR2A 4YRHA 2JEWA 3OWCA 4B14A 4OAEA 2JDDA 3EY5A 4C2ZA 1OBRA 3EZAA 1P0HA 1S7FA 2PVWA 2I3CA 2ZEPA 2ZEOA 4CAFA 5EMIA 3SJFA 4RI1A 4ZI6A 4PXCA 4C9EA 3IGRA 4UA3A 5HVHA 4B5PB 3B2YA 4AVAA 3SR3A 2PJCA 1XIXA 3K9UA 4JXQA 2ZEGA 5G22A 5HVFA 3RAMA 1EE3P 4YFJA 2R82A 1R43A 5AG7A 4P45A 4MFJA 2P6EA 2F5IA 2QJ8A 4W9YA 2PE3A 4E2AA 3O8ZA 1YW6A 2ZEFA 4II9A 4CAEA 2OU2A 3OP0A 1BAVA 3FYNA 3CPXA 3D2PA 2ZELA 4PXDA 2B4DB 2EUIA 3TT2A 4AG9A 4B11A 4B13A 4FUUA 1ZYMA 4C8TA 3PB6X 4ZX8A 3U88C 1XFOA 1CP7A 2CNTA 4G1PA 1JQGA 2AUNA 5J3XA 3D7HA 2RFHA 3NH8A 3VARA 1FBVA 3TCVA 3GJZA 2I79A 3SJEA 1IYKA 4KOVA 4EVYA 2Q51A 1TF8A 2OZHA 3FMCA 3KHZA 3PEIA 5F5XA 3PB7X 2ZOGA 5D8NA 2X0SA 2PVVA 2EK9A 1VIXA 4J3GA 2HC9A 4K3NA 2WYRA 3E0KA 3KKWA 1B6BA 4CAVA 3BUOB 3TLGB 5HXDA 7CPAA 3EXNA 2Z3LA 3BI1A 1TF9A 3JVNA 1EZAA 2IJZA 3U1BA 4KVXA 3CXPA 2AFZA 2G9DA 4ZBGA 4UCPA 3OB2B 4MJXA 3HUVA 4R8FA 2F8HA 4Y49C 4IIYA 1VHSA 3R9GA 3T5MA 2R8VA 1IU8A 2EO8A 1Y7RA 3P2HA 8CPAA 5J1QA 1ELMP 3VRQA 2PJAA 4OKOA 4B5PA 5CNPA 4ONWA 1I12A 4A4CA 2BOAA 3CPAA 3H5ZA 2JBJA 3S9LA 4C2XA 1VI4A 5FD8A 3HLPA 4A37A 1LAMA 2ZW6A 4CDKA 1Z8WA 1YLOA 2AFWA 2ZEHA 3A9LA 3FX6A 4UFXA 4YWYA 1S5KA 5IB0A 1A9XB 4MHPA 1MJBA 1S7LA 1KZFA 2WPXA 4B6ZA 4BINA 2B3VA 3D7FA 3H8FA 4P4DA 1PUAA 1NE9A 4L8AA 1OZPA 3TLCA 2B4DA 1Y7EA 2P6GA 4ZY1A 4QB9A 3FVLA 2PR8A 2BL1A 5D29A 3TX8A 4M3SA 5LYFA 1CPSA 3TFYA 4EYSA 2NYQA 2PRQA 4OMEA 1BO4A 4MFLA 3LMSA 4E8OA 1V6CA 1QSRA 4HNYB 1XJOA 2KCWA 4CPAA 4ORFA 1KUVA 4XPKA 4OC1A 3W6SA 4OC5A 4X2TA 3FXTA 3T05A 4C99A 1YW4A 5G1ZA 4F0XA 4WWVA 3H4QA 2PQ8A 1TXRA 3TLGA 1M1DA 3WABA 4H6ZA 2YNDA 4A38A 4INJA 1BPMA 1VKCA 3EZEA 4R3LA 4H6UA 4F8ZA 4M6GA 2Y0MA 2UV8G 3LD2A 4PQAA 2ZW7A 4EWTA 2JDCA 2CF4A 4ZYQA 2OLSA 5ELYA 1XRYA 4RR2B 4X8IA 3S6HA 4UFWA 4MFQA 2ANPA 2O28A 2FCKA 2VL1A 3PB9X 5CBMA 2VQYA 2VZYA 3BHXA 3PP9A 3GLJA 3KI9A 4OC3A 5G20A 3S6KA 3EFAA 5F49A 4C8PA 5HKZA 1X10A 3HMJG 2P6FA 4H89A 4KOTA 3N5FA 3T90A 2CIJA 4IAVA 4UWIA 2FIWA 1YVOA 3SXNA 2DPSA 1XOVA 1F57A 3EIFA 5EBVA 3TLAA 2AE6A 5DWNA 2BEIA 4LQ6A 4A2ZA 4TJVA 2JLMA 2BCOA 4ZY2A 5LYDA 3WC5A 1KBLA 4COBA 3K9TA 1ZG7A 3TO7A 1J4JA 3OAKA 4H2KA 3NFZA 2GE3A 3GB0A 4RN7A 4Y49B 2V8VA 2PJ1A 3BUXB 3B3VA 4MFZA 5I0CA 3PRTA 4NGQA 2PC1A 3D7DA 3VGOA 2WPWA 4NXYA 4R76A 3ZJ0A 4KOUA 1Z8LA 1ARLA 1EO0A 3QAYA 2REEA 1M4LA 4JYWA 4NGRA 1YSJA 4FD6A 3VROA 1Z9EA 2GIVA 4AB7A 1HDQA 2A4NA 4MHYA 4KOYA 2D4OA 2ZPAA 4E0AA 5KTCA 1VHEA 4NGMA 4IHMA 4CAWA 2PJ6A 4CDJA 2DF5A 3DR8A 4MCPA 4YGOA 1QSOA 4DNCA 4ZGYB 3G8WA 4UF4A 2AFXA 1IY7A 3FB3A 4PSWA 3B3WA 1WVMA 1KC7A 5JPHA 2FL4A 3R9FA 4CYQA 2PIYA 5AG4A 4J0NA 1VHOA 3SJXA 4A30A 3I74A 1TIQA 4MHZA 1PCAA 3PFVA 4DYOA 2EVNA 3KQZA 3F8KA 2XEFA 3GY9A 4MY3A 5IX3A 1TKJA 1Q7LA 4NGTA 1Z9UA 3IIBA 3MN8A 4PXEA 1AYEA 1QMUA 4WJBA 4CGNA 4F6AA 2HV2A 1BPNA 3KQXA 3RBUA 3JUWA 2FS5A 2DEAA 3D2MA 3D66A 2B4JC 1PU9A 1VBHA 2GLJA 3GYAA 4KSAA 3VRNA 2VI7A 1FT7A 3RNZA 1CBXA 3WC7A 5LYLA 3KASA 1XF8A 1F2PA 2PJ8A 4GS4A 4PK3A 4TJXA 2Q0YA 4R3KA 2OZGA 4JLYA 4ONUA 3WT4A 2PJBA 2Y1MA 1MJ9A 2Q44A 2Z3NA 2H5MA 4C7HA 4GPLB 4C9VA 4E94A 3PZJA 2MP0A 3PBEA 1XEBA 1V0CA 2YNCC 2ZENA 4CRZB 1SQHA 1WWZA 4FAIA 3EC4A 1ON0A 2GP4A 4C9AA 3GIUA 2Q04A 2VZZA 3FJUA 2AFUA 2J8RA 4CGMA 1JDEA 2DLAA 1IB1E 3DNSA 3ISZA 4OC2A 2EBJA 2OZUA 3TO9A 3B3TA 4IUSA 2BUEA 3IU2A 4NEXA 1KWMA 4R87A 2AFSA 5DS0A 5GCNA 1M4IA 2RC4A 4PSXA 5K99A 4Q36A 1I1DA 2JEVA 1NSAA 2O53A 3B7IA 4C2YA 4R7MA 2XPNA 2WZNA 2ATRA 1GYTA 3IJ3A 1Z4RA 2CNSA 3WC6A 4CGOA 2PJ7A 3LWUA 3SJGA 2XPOA 1WJTA 3D3SA 4XPDC 3PLFB 3D8PA 1XBUA 1YK3A 1LANA 1IOFA 3F0AA 1DE4C 3VRPA 1LOKA 1Z8XA 3D7GA 2PRBA 3ISXA 2Z3KA 4TWEA 3WR7A 5C88A 4KOXA 5F46A 3TE4A 2AUMA 3V7ZA 4GM5A 4A94A 4CZ1A 4AVBA 4OC4A 1M6VB 1N71A 3TLEA 4E5SA 3BUMB 4OC0A 3SHPA 1FNOA 2ABZA 2J8MA 4K30A 2QVPA 3IFEA 4UIBA 4C9RA 3NFQA 2B4BA 2FE7A 4F0YA 2GANA 1UFHA 2BO9A 1YMEA 2D4PA 1TKHA 2GLFA 4FWUA 4C68A 2PJ2A 2ZW5A 1AMPA 2HWGA 1M44A 3FBUA 3BUNB 3IWGA 1YVHA 2G3TA 2Q4VA 3CXQA 5JQ4A 1ELLP 5I4MA 4Z65A 5K8OA 2EZBA 4JZ0A 2FIAA 3PB8X 3VH9A 2WSAA 2Q7BA 5FVJA 3SXOA 4P4IA 4BBHA 4BMHA 4NFRA 4P4EA 2DPTA 3T07A 1QQ9A 1YGHA 2NMTA 3D67A 1XF1A 1CJWA 1MJAA 1Q2CA 3R1KA 3R95A 5AXIA 3NOJA 3S9MA 6CPAA 2I00A 5CPAA 4BPWB 2VKZG 1LCPA 4R6TA 1C3OB 1IOIA 1IYLA 2K5TA 2V8DA 4OIDA 4R9MA 1T36B 4NGNA 2VBQA 2ZW4A 1CG2A 1BOBA 3H8EA 3R96A 1DIKA 5HKWA 1Z8TA 3R9EA 2GREA 2Q4ZA 2VEZA 4KVOE 1IGBA 2V8GA 3PFOA 4KS9A 4C9UA 4AXVA 5LRGA 4C86A 3IU1A 4P10A 3KR5A 5K8NA 5K8PA 4KVME 1ZRSA 4OADA 1F2OA 1KUYA 2PSWA 3CZXA 2QMLA 3I3GA 3LACA 3G3SA 4UFVA 3I1UA 5BWAB 1ZG9A 1CE8B 2OR4A 1Z4EA 3BLNA 4H1HA 3OB1B 1RO5A 3DR6A 3G23A 4MMOA 1I21A 2J8NA 5HH1A 3SI0A 4CYPA 3T9YA 3B8GA 5F48A 4M8DA 2YNEA 1Z2LA 2ZEEA 1IIDA 4CYNA 1RTQA 1XE4A 2DIKA 3JTKA 1B47A 1A2ZA 3QNVA 3IC1A 4UEZA 4ZY0A 4NF1A 1GHEA 2V8HA 3B3SA 3SI2A 4MBUA 1KEEB 1J3LA 1EZBA 4NCZA 3FH4A 4XPDB 2PJ3A 4FD7A 4KOSA 1H8LA 4QUSA 5IB9A 5F13A 4C8FA 4A4BA 4M85A 3C8OA 2PJ0A 4HPSA 3P2FA 1S7NA 4DJLA 2Z3PA 1ZG8A 4HNXB 4COGA 1NSLA 3TLZA 4BPXB 3LODA 3S6FA 1YREA 2CXAA 2QYVA 2QECA 1L0CA 5DWMA 5A28A 1LFWA 4JVOA 3EZBA 2CNMA 3W91A 2YJTA 4KOWA 4JXRA 4OLLA 5KTAA 4NGPA 2AFMA 2WUUA 2ZEMA 4U9ZA 3TTHA 3TLBA 4UCMA 4XNHC 3KGQA 1ZL0A 3TO6A 2EZCA 3K2KA 1Y0RA 3ZNIA 1QSMA 4X5KA 3UY5A 2G3AA 3MGDA 4GXHA 2R7HA 4P6YA 2Q7SA 2YNCA 3C26A 3DGVA 4PXBA 3W6XA 4A32A 3GKRA 4TNUA 1CX8A 4NSQA 3BXMA 2PJ9A 3NA6A 4MCRA 1S60A 2FSRA 1B87A 4YU9A 2Z3MA 1YVKA 2REFA 4KLWA 2GFQA 2IL4A 4UEEA 2Y1NA 3TYXA 5G21A 5K8MA 1RXTA 2EWBA 2Z11A 4NGSA 5F9MA 3MRUA 5HKYA 2C6GA 4O23A 1FY7A 3HPGG 2AFOA 2YGWA 1K4JA 4HNWB 4KUAA 4OIWA 1KUXA 3VWDA 1VBGA 3TOAA 4MI1A 4P4JA 1R61A 2HROA 3BJ7A 4C8AA 3B3CA 3SI1A 4ZX9A 4BTFA 4XPLA 2EZAA 3PBBA 3F5BA 4L89A 3L2NA 1Q2DA 1HDUA 4C84A 3CT9A 4MY0A 4CYOA 3H8GA 4JD6A 2OB0A 3BJ8A 1Q5XA 5JYBA 1QSTA 4RUHA 2HB6A 3JRUA 2P0WA 4IK2A 4MFKA 2BSWA 2VXKA 4MI4A 4QVTA 4MHNA 2OOTA 3VWEA 3V8IA 5LYIA 4CS0B 1GGOA 1S3ZA 4MHDA 4RS2A 2ZEDA 2HUZA 5J8FA 3QB8A 3PGPA 5KTDA 3B35A 1BLLE 1TKFA 2PJ4A 3FIXA 4MRIA 4NJRA 2XPLA 2V77A 3KR4A 1IICA 2G0BA 3NH4A 4LX9A 5JH9A 4Q7AA 4R57A 1LRZA 2XEIA 2R98A 2OH1A 4U9YA 3V38A 4KLVA 3T0TA 4JJXA 3PT1A 2J9AA 5AG5A 1Q2YA 3RZAA 1ZLHA 3T8WA 5HVGA 5E96A 4CAXA 4M6IA 2ODFA 1ZO0A 4AVCA 2C6PA 2AJ6A 2IQ6A 3CXSA 4F9UA 2D0PA 5JGFA 3FRMA 2Q4YA 3BUWB 5EC4A 5HMNA 4UIAA 5ISVA 2PDOA 4U5YA 5IV0A 4IIXA 1YX0A 1MK4A 3VTAA 4LQGA 2B5GB 2IMOA 2HQYA 3BI0A 3TC8A 4P4FA 3NH5A 4PK2A 1R57A 2POKA 2X7BA 4P4BA 4BD9A 3K4IA 2Z3OA 4B5OA 2QIRA 3S9NA 2C1CA 2FT0A 4KSFA 4XNHB 4BPUB 2FXFA 4MCQA 3VATA 1JWQA 4B12A 3PFEA 2YJVA 5AGEA 1P4NA 4MFPA 2PR1A 4UWJA 2PCNA 4PV6A 1CS0B 1QSNA 5A27A 4MCSA 4OP4A 1U6MA 2PJ5A 5F09A 4KSIA 1Z5RA 3FF3A 5F47A 1Y9WA 2B3UA 5F1YA 2PCUA 3KRVA 3KHXA 1C30B 4B10A 2DXQA 3CDXA 4PPZA 4Q38A 4UBRA 3GUXA 1CM0A 4QC6A 2Z10A 4C85A 2C6CA 2Z0ZA 1M4DA 3D68A 2E28A 1Y0YA 2R1IA 4HKFA 4A31A 3DDDA 2CTBA 3IWWA 5C82A 5H84A 2FM4A 3S6GA 4FBEA 5LRKA 5H86A 2C5QA 1YR0A 4UCNA 1NXJA 5BY0A 5AG6A 2CY2A 2PIZA
chains in the Genus database with same CATH topology
1R3NA 4A39A 1CP6A 5JM6A 3IO1A 2Q43A 1ZLIA 5THWA 2CTCA 3KL9A 2FVGA 4DUKA 3I6SA 4C8CA 1CPXA 3IEHA 1ARMA 2GU2A 1UWYA 2NSMA 2RB7A 2EK8A 1Y9ZA 1DTDA 4C8UA 3FEEA 1VGYA 3D4UA 2F7VA 3DLJA 3FECA 4EMEA 4X3RA 1HEEA 4P44A 1XMBA 3ICUA 4MXUA 2XEJA 5LRJA 1PYTB 3FEDA 2XEGA 2JBKA 2ZOFA 4EFDA 4NJQA 2O4HA 4UEFA 4F9VA 4YN3A 3KZWA 1LAPA 3PB4X 5IR2A 2JEWA 1OBRA 2PVWA 2I3CA 2ZEPA 2ZEOA 3SJFA 4ZI6A 4PXCA 4C9EA 5HVHA 3B2YA 2PJCA 5HVFA 3RAMA 2ZEGA 1EE3P 1R43A 4P45A 2QJ8A 4W9YA 2PE3A 1YW6A 2ZEFA 1BAVA 3CPXA 2ZELA 4PXDA 4FUUA 4C8TA 3PB6X 4ZX8A 1XFOA 1CP7A 4G1PA 1JQGA 3NH8A 3D7HA 2RFHA 3VARA 3SJEA 2Q51A 1TF8A 3FMCA 3KHZA 3PEIA 3PB7X 2ZOGA 5D8NA 2PVVA 2EK9A 1VIXA 2HC9A 4K3NA 2WYRA 5HXDA 7CPAA 3BI1A 1TF9A 2IJZA 2AFZA 2G9DA 3HUVA 4R8FA 2F8HA 8CPAA 5J1QA 1ELMP 2PJAA 4OKOA 4ONWA 3CPAA 2BOAA 2JBJA 3S9LA 3HLPA 4A37A 1LAMA 4CDKA 1YLOA 2AFWA 2ZEHA 3FX6A 4YWYA 4MHPA 4B6ZA 3D7FA 3H8FA 4P4DA 1Y7EA 4ZY1A 3FVLA 5D29A 3TX8A 1CPSA 2NYQA 2PRQA 4OMEA 3LMSA 1V6CA 1XJOA 4CPAA 4OC1A 4OC5A 4X2TA 4C99A 1YW4A 4WWVA 1TXRA 3WABA 4A38A 1BPMA 4F8ZA 4PQAA 4EWTA 2CF4A 4ZYQA 5ELYA 1XRYA 4X8IA 2ANPA 3PB9X 2VL1A 5CBMA 3BHXA 3GLJA 3KI9A 4OC3A 4C8PA 3N5FA 2CIJA 4IAVA 1F57A 3EIFA 4TJVA 4ZY2A 2BCOA 5LYDA 3WC5A 3K9TA 1ZG7A 4H2KA 3NFZA 3GB0A 2V8VA 2PJ1A 3B3VA 3PRTA 4NGQA 4R76A 3D7DA 5LYFA 1Z8LA 1ARLA 1M4LA 4JYWA 4NGRA 1YSJA 1HDQA 4MHYA 1VHEA 4NGMA 4IHMA 2PJ6A 4CDJA 4MCPA 4UF4A 2AFXA 1IY7A 3B3WA 1WVMA 2PIYA 1VHOA 3SJXA 3I74A 4MHZA 1PCAA 4DYOA 3KQZA 2XEFA 1TKJA 1Q7LA 4NGTA 3IIBA 3MN8A 4PXEA 1AYEA 1QMUA 4WJBA 1BPNA 3KQXA 3RBUA 2DEAA 3D66A 2GLJA 1FT7A 3WC7A 1CBXA 5LYLA 3KASA 4TJXA 1F2PA 2PJ8A 3WT4A 2PJBA 4C9VA 3PBEA 2ZENA 4FAIA 2GP4A 4C9AA 3FJUA 2AFUA 3ISZA 4OC2A 3B3TA 1KWMA 2AFSA 5DS0A 1NSAA 2O53A 3B7IA 4R7MA 2WZNA 1GYTA 3IJ3A 3WC6A 2PJ7A 3LWUA 3SJGA 1XBUA 1LANA 1DE4C 1LOKA 4TWEA 3D7GA 3ISXA 3V7ZA 4GM5A 4A94A 4OC4A 4OC0A 1FNOA 2ABZA 2QVPA 3IFEA 4UIBA 4C9RA 2BO9A 1YMEA 1TKHA 2GLFA 4FWUA 2PJ2A 1AMPA 4KNGE 5K8OA 1ELLP 5I4MA 4Z65A 4JZ0A 3PB8X 3VH9A 4P4IA 4NFRA 4P4EA 1QQ9A 3D67A 3S9MA 6CPAA 5CPAA 4C8FA 1LCPA 4R6TA 2V8DA 4OIDA 4NGNA 1CG2A 3H8EA 2GREA 2Q4ZA 1IGBA 2V8GA 3PFOA 4AXVA 5LRGA 4C86A 4P10A 5K8PA 3KR5A 5K8NA 1F2OA 3I1UA 1ZG9A 2OR4A 4MMOA 3SI0A 1Z2LA 2ZEEA 1RTQA 3QNVA 3IC1A 4UEZA 4ZY0A 2V8HA 3B3SA 3SI2A 3FH4A 2PJ3A 1H8LA 5IB9A 2PJ0A 4DJLA 1ZG8A 2QYVA 1LFWA 4NGPA 2AFMA 2ZEMA 3KGQA 3K2KA 1Y0RA 4P6YA 4C9UA 4PXBA 3DGVA 4TNUA 1CX8A 3BXMA 2PJ9A 3NA6A 4MCRA 4YU9A 4UEEA 5K8MA 2EWBA 4NGSA 3MRUA 2C6GA 4O23A 2AFOA 4OIWA 4C8AA 4P4JA 3B3CA 3SI1A 4ZX9A 3PBBA 3L2NA 1HDUA 4C84A 3CT9A 3H8GA 4RUHA 2HB6A 3JRUA 4IK2A 4MHNA 2OOTA 5LYIA 2ZEDA 3B35A 1BLLE 1TKFA 2PJ4A 4MRIA 4NJRA 5JH9A 2V77A 3NH4A 3KR4A 4Q7AA 2XEIA 3V38A 2J9AA 3T8WA 3RZAA 1ZLHA 5HVGA 1XF1A 4F9UA 2C6PA 2IQ6A 5JGFA 4UIAA 3VTAA 4LQGA 2IMOA 3BI0A 3TC8A 4P4FA 3NH5A 2POKA 4BD9A 4P4BA 3S9NA 2C1CA 4MCQA 3VATA 3PFEA 4MCSA 4OP4A 2PJ5A 5F09A 4KSIA 1Z5RA 3FF3A 2PCUA 3KHXA 3CDXA 4PPZA 3GUXA 4C85A 2C6CA 3D68A 1Y0YA 2CTBA 3IWWA 4FBEA 5LRKA 2C5QA 2PIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3N A;  4A39 A;  1CP6 A;  5JM6 A;  3IO1 A;  2Q43 A;  1ZLI A;  5THW A;  2CTC A;  3KL9 A;  2FVG A;  4DUK A;  3I6S A;  4C8C A;  1CPX A;  3IEH A;  1ARM A;  2GU2 A;  1UWY A;  2NSM A;  2RB7 A;  2EK8 A;  1Y9Z A;  1DTD A;  4C8U A;  3FEE A;  1VGY A;  3D4U A;  2F7V A;  3DLJ A;  3FEC A;  4EME A;  4X3R A;  1HEE A;  4P44 A;  1XMB A;  3ICU A;  4MXU A;  2XEJ A;  5LRJ A;  1PYT B;  3FED A;  2XEG A;  2JBK A;  2ZOF A;  4EFD A;  4NJQ A;  2O4H A;  4UEF A;  4F9V A;  4YN3 A;  3KZW A;  1LAP A;  3PB4 X;  2JEW A;  1OBR A;  2PVW A;  2I3C A;  2ZEP A;  2ZEO A;  3SJF A;  4ZI6 A;  4PXC A;  4C9E A;  5HVH A;  3B2Y A;  2PJC A;  5HVF A;  3RAM A;  2ZEG A;  1EE3 P;  1R43 A;  4P45 A;  2QJ8 A;  4W9Y A;  2PE3 A;  1YW6 A;  2ZEF A;  1BAV A;  3CPX A;  2ZEL A;  4PXD A;  4FUU A;  4C8T A;  3PB6 X;  4ZX8 A;  1XFO A;  1CP7 A;  4G1P A;  1JQG A;  3NH8 A;  3D7H A;  2RFH A;  3VAR A;  3SJE A;  2Q51 A;  1TF8 A;  3FMC A;  3KHZ A;  3PEI A;  3PB7 X;  2ZOG A;  5D8N A;  2PVV A;  2EK9 A;  1VIX A;  2HC9 A;  4K3N A;  2WYR A;  5HXD A;  7CPA A;  3BI1 A;  1TF9 A;  2IJZ A;  2AFZ A;  2G9D A;  3HUV A;  4R8F A;  2F8H A;  8CPA A;  5J1Q A;  1ELM P;  2PJA A;  4OKO A;  4ONW A;  3CPA A;  2BOA A;  2JBJ A;  3S9L A;  3HLP A;  4A37 A;  1LAM A;  4CDK A;  1YLO A;  2AFW A;  2ZEH A;  3FX6 A;  4YWY A;  4MHP A;  4B6Z A;  3D7F A;  3H8F A;  4P4D A;  1Y7E A;  4ZY1 A;  3FVL A;  5D29 A;  3TX8 A;  1CPS A;  2NYQ A;  2PRQ A;  4OME A;  3LMS A;  1V6C A;  1XJO A;  4CPA A;  4OC1 A;  4OC5 A;  4X2T A;  4C99 A;  1YW4 A;  4WWV A;  1TXR A;  3WAB A;  4A38 A;  1BPM A;  4F8Z A;  4PQA A;  4EWT A;  2CF4 A;  4ZYQ A;  5ELY A;  1XRY A;  4X8I A;  2ANP A;  3PB9 X;  2VL1 A;  5CBM A;  3BHX A;  3GLJ A;  3KI9 A;  4OC3 A;  4C8P A;  3N5F A;  2CIJ A;  4IAV A;  1F57 A;  3EIF A;  4TJV A;  4ZY2 A;  2BCO A;  5LYD A;  3WC5 A;  3K9T A;  1ZG7 A;  4H2K A;  3NFZ A;  3GB0 A;  2V8V A;  2PJ1 A;  3B3V A;  3PRT A;  4NGQ A;  4R76 A;  3D7D A;  5LYF A;  1Z8L A;  1ARL A;  1M4L A;  4JYW A;  4NGR A;  1YSJ A;  1HDQ A;  4MHY A;  1VHE A;  4NGM A;  4IHM A;  2PJ6 A;  4CDJ A;  4MCP A;  4UF4 A;  2AFX A;  1IY7 A;  3B3W A;  1WVM A;  2PIY A;  1VHO A;  3SJX A;  3I74 A;  4MHZ A;  1PCA A;  4DYO A;  3KQZ A;  2XEF A;  1TKJ A;  1Q7L A;  4NGT A;  3IIB A;  3MN8 A;  4PXE A;  1AYE A;  1QMU A;  4WJB A;  1BPN A;  3KQX A;  3RBU A;  2DEA A;  3D66 A;  2GLJ A;  1FT7 A;  3WC7 A;  1CBX A;  5LYL A;  3KAS A;  4TJX A;  1F2P A;  2PJ8 A;  3WT4 A;  2PJB A;  4C9V A;  3PBE A;  2ZEN A;  4FAI A;  4C9A A;  3FJU A;  2AFU A;  3ISZ A;  4OC2 A;  3B3T A;  1KWM A;  2AFS A;  5DS0 A;  1NSA A;  2O53 A;  3B7I A;  4R7M A;  2WZN A;  1GYT A;  3IJ3 A;  3WC6 A;  2PJ7 A;  3LWU A;  3SJG A;  1XBU A;  1LAN A;  1DE4 C;  1LOK A;  4TWE A;  3D7G A;  3ISX A;  3V7Z A;  4GM5 A;  4A94 A;  4OC4 A;  4OC0 A;  1FNO A;  2ABZ A;  2QVP A;  3IFE A;  4UIB A;  4C9R A;  2BO9 A;  1YME A;  1TKH A;  2GLF A;  4FWU A;  2PJ2 A;  1AMP A;  4KNG E;  5K8O A;  1ELL P;  5I4M A;  4Z65 A;  4JZ0 A;  3PB8 X;  3VH9 A;  4P4I A;  4NFR A;  4P4E A;  1QQ9 A;  3D67 A;  3S9M A;  6CPA A;  5CPA A;  4C8F A;  1LCP A;  4R6T A;  2V8D A;  4OID A;  4NGN A;  1CG2 A;  3H8E A;  2GRE A;  2Q4Z A;  1IGB A;  2V8G A;  3PFO A;  4AXV A;  5LRG A;  4C86 A;  4P10 A;  5K8P A;  3KR5 A;  5K8N A;  1F2O A;  3I1U A;  1ZG9 A;  2OR4 A;  4MMO A;  3SI0 A;  1Z2L A;  2ZEE A;  1RTQ A;  3QNV A;  3IC1 A;  4UEZ A;  4ZY0 A;  2V8H A;  3B3S A;  3SI2 A;  3FH4 A;  2PJ3 A;  1H8L A;  5IB9 A;  2PJ0 A;  4DJL A;  1ZG8 A;  2QYV A;  1LFW A;  4NGP A;  2AFM A;  2ZEM A;  3KGQ A;  3K2K A;  1Y0R A;  4P6Y A;  4C9U A;  4PXB A;  3DGV A;  4TNU A;  1CX8 A;  3BXM A;  2PJ9 A;  3NA6 A;  4MCR A;  4YU9 A;  4UEE A;  5K8M A;  2EWB A;  4NGS A;  3MRU A;  2C6G A;  4O23 A;  2AFO A;  4OIW A;  4C8A A;  4P4J A;  3B3C A;  3SI1 A;  4ZX9 A;  3PBB A;  3L2N A;  1HDU A;  4C84 A;  3CT9 A;  3H8G A;  4RUH A;  2HB6 A;  3JRU A;  4IK2 A;  4MHN A;  2OOT A;  5LYI A;  2ZED A;  3B35 A;  1BLL E;  1TKF A;  2PJ4 A;  4MRI A;  4NJR A;  5JH9 A;  2V77 A;  3NH4 A;  3KR4 A;  4Q7A A;  2XEI A;  3V38 A;  2J9A A;  3T8W A;  3RZA A;  1ZLH A;  5HVG A;  1XF1 A;  4F9U A;  2C6P A;  2IQ6 A;  5JGF A;  4UIA A;  3VTA A;  4LQG A;  2IMO A;  3BI0 A;  3TC8 A;  4P4F A;  3NH5 A;  2POK A;  4BD9 A;  4P4B A;  3S9N A;  2C1C A;  4MCQ A;  3VAT A;  3PFE A;  4MCS A;  4OP4 A;  2PJ5 A;  5F09 A;  4KSI A;  1Z5R A;  3FF3 A;  2PCU A;  3KHX A;  3CDX A;  4PPZ A;  3GUX A;  4C85 A;  2C6C A;  3D68 A;  1Y0Y A;  2CTB A;  3IWW A;  4FBE A;  5LRK A;  2PIZ A; 
#chains in the Genus database with same CATH topology
 1R3N A;  4A39 A;  1CP6 A;  5JM6 A;  3IO1 A;  3EO4 A;  2Q43 A;  2B58 A;  1ZLI A;  5THW A;  2D0O A;  2CTC A;  3NE7 A;  1M4G A;  2FVG A;  3KL9 A;  4JWP A;  4M6H A;  4DUK A;  3I6S A;  4C8C A;  3N7Z A;  2ZXV A;  4KOR A;  1Y9K A;  1CPX A;  3RYO A;  1NMT A;  3IEH A;  5JVL A;  3DSB A;  4QBJ A;  1ARM A;  2GU2 A;  1UWY A;  4KZT A;  2NSM A;  2RB7 A;  2EK8 A;  3VRR A;  3ZZI A;  4CRY B;  2B5G A;  1JDB C;  1Y9Z A;  4CO9 A;  1DTD A;  4C7I A;  1WK4 A;  1AUG A;  4AG7 A;  4C8U A;  3FEE A;  1VGY A;  3QAH A;  4A95 A;  2N3A B;  1YQE A;  3D4U A;  2ARH A;  3TOB A;  2F7V A;  3DLJ A;  3HPH E;  4FD4 A;  3FEC A;  4KUB A;  4KNG E;  4EME A;  4X3R A;  1HEE A;  2B0A A;  2CBL A;  3IWE A;  1YLE A;  4P44 A;  4IF5 A;  3F9K C;  3I9S A;  4A33 A;  1XMT A;  1XMB A;  3ICU A;  2C27 A;  4MXU A;  2XEJ A;  5LRJ A;  5J8C A;  2HI6 A;  2XPP A;  4CGL A;  1NBW A;  1PYT B;  1BXR B;  3FED A;  2XEG A;  3TLY A;  1X12 A;  2JBK A;  1S7K A;  2ZOF A;  4EFD A;  4LUA A;  3NE8 A;  4MJ8 A;  4I49 A;  4NJQ A;  2O4H A;  4UEF A;  4F9V A;  4CGP A;  3FNC A;  4YN3 A;  3KZW A;  4FD5 A;  3RO0 A;  1LAP A;  3PB4 X;  5IR2 A;  4YRH A;  2JEW A;  3OWC A;  4B14 A;  4OAE A;  2JDD A;  3EY5 A;  4C2Z A;  1OBR A;  3EZA A;  1P0H A;  1S7F A;  2PVW A;  2I3C A;  2ZEP A;  2ZEO A;  4CAF A;  5EMI A;  3SJF A;  4RI1 A;  4ZI6 A;  4PXC A;  4C9E A;  3IGR A;  4UA3 A;  5HVH A;  4B5P B;  3B2Y A;  4AVA A;  3SR3 A;  2PJC A;  1XIX A;  3K9U A;  4JXQ A;  2ZEG A;  5G22 A;  5HVF A;  3RAM A;  1EE3 P;  4YFJ A;  2R82 A;  1R43 A;  5AG7 A;  4P45 A;  4MFJ A;  2P6E A;  2F5I A;  2QJ8 A;  4W9Y A;  2PE3 A;  4E2A A;  3O8Z A;  1YW6 A;  2ZEF A;  4II9 A;  4CAE A;  2OU2 A;  3OP0 A;  1BAV A;  3FYN A;  3CPX A;  3D2P A;  2ZEL A;  4PXD A;  2B4D B;  2EUI A;  3TT2 A;  4AG9 A;  4B11 A;  4B13 A;  4FUU A;  1ZYM A;  4C8T A;  3PB6 X;  4ZX8 A;  3U88 C;  1XFO A;  1CP7 A;  2CNT A;  4G1P A;  1JQG A;  2AUN A;  5J3X A;  3D7H A;  2RFH A;  3NH8 A;  3VAR A;  1FBV A;  3TCV A;  3GJZ A;  2I79 A;  3SJE A;  1IYK A;  4KOV A;  4EVY A;  2Q51 A;  1TF8 A;  2OZH A;  3FMC A;  3KHZ A;  3PEI A;  5F5X A;  3PB7 X;  2ZOG A;  5D8N A;  2X0S A;  2PVV A;  2EK9 A;  1VIX A;  4J3G A;  2HC9 A;  4K3N A;  2WYR A;  3E0K A;  3KKW A;  1B6B A;  4CAV A;  3BUO B;  3TLG B;  5HXD A;  7CPA A;  3EXN A;  2Z3L A;  3BI1 A;  1TF9 A;  3JVN A;  1EZA A;  2IJZ A;  3U1B A;  4KVX A;  3CXP A;  2AFZ A;  2G9D A;  4ZBG A;  4UCP A;  3OB2 B;  4MJX A;  3HUV A;  4R8F A;  2F8H A;  4Y49 C;  4IIY A;  1VHS A;  3R9G A;  3T5M A;  2R8V A;  1IU8 A;  2EO8 A;  1Y7R A;  3P2H A;  8CPA A;  5J1Q A;  1ELM P;  3VRQ A;  2PJA A;  4OKO A;  4B5P A;  5CNP A;  4ONW A;  1I12 A;  4A4C A;  2BOA A;  3CPA A;  3H5Z A;  2JBJ A;  3S9L A;  4C2X A;  1VI4 A;  5FD8 A;  3HLP A;  4A37 A;  1LAM A;  2ZW6 A;  4CDK A;  1Z8W A;  1YLO A;  2AFW A;  2ZEH A;  3A9L A;  3FX6 A;  4UFX A;  4YWY A;  1S5K A;  5IB0 A;  1A9X B;  4MHP A;  1MJB A;  1S7L A;  1KZF A;  2WPX A;  4B6Z A;  4BIN A;  2B3V A;  3D7F A;  3H8F A;  4P4D A;  1PUA A;  1NE9 A;  4L8A A;  1OZP A;  3TLC A;  2B4D A;  1Y7E A;  2P6G A;  4ZY1 A;  4QB9 A;  3FVL A;  2PR8 A;  2BL1 A;  5D29 A;  3TX8 A;  4M3S A;  5LYF A;  1CPS A;  3TFY A;  4EYS A;  2NYQ A;  2PRQ A;  4OME A;  1BO4 A;  4MFL A;  3LMS A;  4E8O A;  1V6C A;  1QSR A;  4HNY B;  1XJO A;  2KCW A;  4CPA A;  4ORF A;  1KUV A;  4XPK A;  4OC1 A;  3W6S A;  4OC5 A;  4X2T A;  3FXT A;  3T05 A;  4C99 A;  1YW4 A;  5G1Z A;  4F0X A;  4WWV A;  3H4Q A;  2PQ8 A;  1TXR A;  3TLG A;  1M1D A;  3WAB A;  4H6Z A;  2YND A;  4A38 A;  4INJ A;  1BPM A;  1VKC A;  3EZE A;  4R3L A;  4H6U A;  4F8Z A;  4M6G A;  2Y0M A;  2UV8 G;  3LD2 A;  4PQA A;  2ZW7 A;  4EWT A;  2JDC A;  2CF4 A;  4ZYQ A;  2OLS A;  5ELY A;  1XRY A;  4RR2 B;  4X8I A;  3S6H A;  4UFW A;  4MFQ A;  2ANP A;  2O28 A;  2FCK A;  2VL1 A;  3PB9 X;  5CBM A;  2VQY A;  2VZY A;  3BHX A;  3PP9 A;  3GLJ A;  3KI9 A;  4OC3 A;  5G20 A;  3S6K A;  3EFA A;  5F49 A;  4C8P A;  5HKZ A;  1X10 A;  3HMJ G;  2P6F A;  4H89 A;  4KOT A;  3N5F A;  3T90 A;  2CIJ A;  4IAV A;  4UWI A;  2FIW A;  1YVO A;  3SXN A;  2DPS A;  1XOV A;  1F57 A;  3EIF A;  5EBV A;  3TLA A;  2AE6 A;  5DWN A;  2BEI A;  4LQ6 A;  4A2Z A;  4TJV A;  2JLM A;  2BCO A;  4ZY2 A;  5LYD A;  3WC5 A;  1KBL A;  4COB A;  3K9T A;  1ZG7 A;  3TO7 A;  1J4J A;  3OAK A;  4H2K A;  3NFZ A;  2GE3 A;  3GB0 A;  4RN7 A;  4Y49 B;  2V8V A;  2PJ1 A;  3BUX B;  3B3V A;  4MFZ A;  5I0C A;  3PRT A;  4NGQ A;  2PC1 A;  3D7D A;  3VGO A;  2WPW A;  4NXY A;  4R76 A;  3ZJ0 A;  4KOU A;  1Z8L A;  1ARL A;  1EO0 A;  3QAY A;  2REE A;  1M4L A;  4JYW A;  4NGR A;  1YSJ A;  4FD6 A;  3VRO A;  1Z9E A;  2GIV A;  4AB7 A;  1HDQ A;  2A4N A;  4MHY A;  4KOY A;  2D4O A;  2ZPA A;  4E0A A;  5KTC A;  1VHE A;  4NGM A;  4IHM A;  4CAW A;  2PJ6 A;  4CDJ A;  2DF5 A;  3DR8 A;  4MCP A;  4YGO A;  1QSO A;  4DNC A;  4ZGY B;  3G8W A;  4UF4 A;  2AFX A;  1IY7 A;  3FB3 A;  4PSW A;  3B3W A;  1WVM A;  1KC7 A;  5JPH A;  2FL4 A;  3R9F A;  4CYQ A;  2PIY A;  5AG4 A;  4J0N A;  1VHO A;  3SJX A;  4A30 A;  3I74 A;  1TIQ A;  4MHZ A;  1PCA A;  3PFV A;  4DYO A;  2EVN A;  3KQZ A;  3F8K A;  2XEF A;  3GY9 A;  4MY3 A;  5IX3 A;  1TKJ A;  1Q7L A;  4NGT A;  1Z9U A;  3IIB A;  3MN8 A;  4PXE A;  1AYE A;  1QMU A;  4WJB A;  4CGN A;  4F6A A;  2HV2 A;  1BPN A;  3KQX A;  3RBU A;  3JUW A;  2FS5 A;  2DEA A;  3D2M A;  3D66 A;  2B4J C;  1PU9 A;  1VBH A;  2GLJ A;  3GYA A;  4KSA A;  3VRN A;  2VI7 A;  1FT7 A;  3RNZ A;  1CBX A;  3WC7 A;  5LYL A;  3KAS A;  1XF8 A;  1F2P A;  2PJ8 A;  4GS4 A;  4PK3 A;  4TJX A;  2Q0Y A;  4R3K A;  2OZG A;  4JLY A;  4ONU A;  3WT4 A;  2PJB A;  2Y1M A;  1MJ9 A;  2Q44 A;  2Z3N A;  2H5M A;  4C7H A;  4GPL B;  4C9V A;  4E94 A;  3PZJ A;  2MP0 A;  3PBE A;  1XEB A;  1V0C A;  2YNC C;  2ZEN A;  4CRZ B;  1SQH A;  1WWZ A;  4FAI A;  3EC4 A;  1ON0 A;  2GP4 A;  4C9A A;  3GIU A;  2Q04 A;  2VZZ A;  3FJU A;  2AFU A;  2J8R A;  4CGM A;  1JDE A;  2DLA A;  1IB1 E;  3DNS A;  3ISZ A;  4OC2 A;  2EBJ A;  2OZU A;  3TO9 A;  3B3T A;  4IUS A;  2BUE A;  3IU2 A;  4NEX A;  1KWM A;  4R87 A;  2AFS A;  5DS0 A;  5GCN A;  1M4I A;  2RC4 A;  4PSX A;  5K99 A;  4Q36 A;  1I1D A;  2JEV A;  1NSA A;  2O53 A;  3B7I A;  4C2Y A;  4R7M A;  2XPN A;  2WZN A;  2ATR A;  1GYT A;  3IJ3 A;  1Z4R A;  2CNS A;  3WC6 A;  4CGO A;  2PJ7 A;  3LWU A;  3SJG A;  2XPO A;  1WJT A;  3D3S A;  4XPD C;  3PLF B;  3D8P A;  1XBU A;  1YK3 A;  1LAN A;  1IOF A;  3F0A A;  1DE4 C;  3VRP A;  1LOK A;  1Z8X A;  3D7G A;  2PRB A;  3ISX A;  2Z3K A;  4TWE A;  3WR7 A;  5C88 A;  4KOX A;  5F46 A;  3TE4 A;  2AUM A;  3V7Z A;  4GM5 A;  4A94 A;  4CZ1 A;  4AVB A;  4OC4 A;  1M6V B;  1N71 A;  3TLE A;  4E5S A;  3BUM B;  4OC0 A;  3SHP A;  1FNO A;  2ABZ A;  2J8M A;  4K30 A;  2QVP A;  3IFE A;  4UIB A;  4C9R A;  3NFQ A;  2B4B A;  2FE7 A;  4F0Y A;  2GAN A;  1UFH A;  2BO9 A;  1YME A;  2D4P A;  1TKH A;  2GLF A;  4FWU A;  4C68 A;  2PJ2 A;  2ZW5 A;  1AMP A;  2HWG A;  1M44 A;  3FBU A;  3BUN B;  3IWG A;  1YVH A;  2G3T A;  2Q4V A;  3CXQ A;  5JQ4 A;  1ELL P;  5I4M A;  4Z65 A;  5K8O A;  2EZB A;  4JZ0 A;  2FIA A;  3PB8 X;  3VH9 A;  2WSA A;  2Q7B A;  5FVJ A;  3SXO A;  4P4I A;  4BBH A;  4BMH A;  4NFR A;  4P4E A;  2DPT A;  3T07 A;  1QQ9 A;  1YGH A;  2NMT A;  3D67 A;  1XF1 A;  1CJW A;  1MJA A;  1Q2C A;  3R1K A;  3R95 A;  5AXI A;  3NOJ A;  3S9M A;  6CPA A;  2I00 A;  5CPA A;  4BPW B;  2VKZ G;  1LCP A;  4R6T A;  1C3O B;  1IOI A;  1IYL A;  2K5T A;  2V8D A;  4OID A;  4R9M A;  1T36 B;  4NGN A;  2VBQ A;  2ZW4 A;  1CG2 A;  1BOB A;  3H8E A;  3R96 A;  1DIK A;  5HKW A;  1Z8T A;  3R9E A;  2GRE A;  2Q4Z A;  2VEZ A;  4KVO E;  1IGB A;  2V8G A;  3PFO A;  4KS9 A;  4C9U A;  4AXV A;  5LRG A;  4C86 A;  3IU1 A;  4P10 A;  3KR5 A;  5K8N A;  5K8P A;  4KVM E;  1ZRS A;  4OAD A;  1F2O A;  1KUY A;  2PSW A;  3CZX A;  2QML A;  3I3G A;  3LAC A;  3G3S A;  4UFV A;  3I1U A;  5BWA B;  1ZG9 A;  1CE8 B;  2OR4 A;  1Z4E A;  3BLN A;  4H1H A;  3OB1 B;  1RO5 A;  3DR6 A;  3G23 A;  4MMO A;  1I21 A;  2J8N A;  5HH1 A;  3SI0 A;  4CYP A;  3T9Y A;  3B8G A;  5F48 A;  4M8D A;  2YNE A;  1Z2L A;  2ZEE A;  1IID A;  4CYN A;  1RTQ A;  1XE4 A;  2DIK A;  3JTK A;  1B47 A;  1A2Z A;  3QNV A;  3IC1 A;  4UEZ A;  4ZY0 A;  4NF1 A;  1GHE A;  2V8H A;  3B3S A;  3SI2 A;  4MBU A;  1KEE B;  1J3L A;  1EZB A;  4NCZ A;  3FH4 A;  4XPD B;  2PJ3 A;  4FD7 A;  4KOS A;  1H8L A;  4QUS A;  5IB9 A;  5F13 A;  4C8F A;  4A4B A;  4M85 A;  3C8O A;  2PJ0 A;  4HPS A;  3P2F A;  1S7N A;  4DJL A;  2Z3P A;  1ZG8 A;  4HNX B;  4COG A;  1NSL A;  3TLZ A;  4BPX B;  3LOD A;  3S6F A;  1YRE A;  2CXA A;  2QYV A;  2QEC A;  1L0C A;  5DWM A;  5A28 A;  1LFW A;  4JVO A;  3EZB A;  2CNM A;  3W91 A;  2YJT A;  4KOW A;  4JXR A;  4OLL A;  5KTA A;  4NGP A;  2AFM A;  2WUU A;  2ZEM A;  4U9Z A;  3TTH A;  3TLB A;  4UCM A;  4XNH C;  3KGQ A;  1ZL0 A;  3TO6 A;  2EZC A;  3K2K A;  1Y0R A;  3ZNI A;  1QSM A;  4X5K A;  3UY5 A;  2G3A A;  3MGD A;  4GXH A;  2R7H A;  4P6Y A;  2Q7S A;  2YNC A;  3C26 A;  3DGV A;  4PXB A;  3W6X A;  4A32 A;  3GKR A;  4TNU A;  1CX8 A;  4NSQ A;  3BXM A;  2PJ9 A;  3NA6 A;  4MCR A;  1S60 A;  2FSR A;  1B87 A;  4YU9 A;  2Z3M A;  1YVK A;  2REF A;  4KLW A;  2GFQ A;  2IL4 A;  4UEE A;  2Y1N A;  3TYX A;  5G21 A;  5K8M A;  1RXT A;  2EWB A;  2Z11 A;  4NGS A;  5F9M A;  3MRU A;  5HKY A;  2C6G A;  4O23 A;  1FY7 A;  3HPG G;  2AFO A;  2YGW A;  1K4J A;  4HNW B;  4KUA A;  4OIW A;  1KUX A;  3VWD A;  1VBG A;  3TOA A;  4MI1 A;  4P4J A;  1R61 A;  2HRO A;  3BJ7 A;  4C8A A;  3B3C A;  3SI1 A;  4ZX9 A;  4BTF A;  4XPL A;  2EZA A;  3PBB A;  3F5B A;  4L89 A;  3L2N A;  1Q2D A;  1HDU A;  4C84 A;  3CT9 A;  4MY0 A;  4CYO A;  3H8G A;  4JD6 A;  2OB0 A;  3BJ8 A;  1Q5X A;  5JYB A;  1QST A;  4RUH A;  2HB6 A;  3JRU A;  2P0W A;  4IK2 A;  4MFK A;  2BSW A;  2VXK A;  4MI4 A;  4QVT A;  4MHN A;  2OOT A;  3VWE A;  3V8I A;  5LYI A;  4CS0 B;  1GGO A;  1S3Z A;  4MHD A;  4RS2 A;  2ZED A;  2HUZ A;  5J8F A;  3QB8 A;  3PGP A;  5KTD A;  3B35 A;  1BLL E;  1TKF A;  2PJ4 A;  3FIX A;  4MRI A;  4NJR A;  2XPL A;  2V77 A;  3KR4 A;  1IIC A;  2G0B A;  3NH4 A;  4LX9 A;  5JH9 A;  4Q7A A;  4R57 A;  1LRZ A;  2XEI A;  2R98 A;  2OH1 A;  4U9Y A;  3V38 A;  4KLV A;  3T0T A;  4JJX A;  3PT1 A;  2J9A A;  5AG5 A;  1Q2Y A;  3RZA A;  1ZLH A;  3T8W A;  5HVG A;  5E96 A;  4CAX A;  4M6I A;  2ODF A;  1ZO0 A;  4AVC A;  2C6P A;  2AJ6 A;  2IQ6 A;  3CXS A;  4F9U A;  2D0P A;  5JGF A;  3FRM A;  2Q4Y A;  3BUW B;  5EC4 A;  5HMN A;  4UIA A;  5ISV A;  2PDO A;  4U5Y A;  5IV0 A;  4IIX A;  1YX0 A;  1MK4 A;  3VTA A;  4LQG A;  2B5G B;  2IMO A;  2HQY A;  3BI0 A;  3TC8 A;  4P4F A;  3NH5 A;  4PK2 A;  1R57 A;  2POK A;  2X7B A;  4P4B A;  4BD9 A;  3K4I A;  2Z3O A;  4B5O A;  2QIR A;  3S9N A;  2C1C A;  2FT0 A;  4KSF A;  4XNH B;  4BPU B;  2FXF A;  4MCQ A;  3VAT A;  1JWQ A;  4B12 A;  3PFE A;  2YJV A;  5AGE A;  1P4N A;  4MFP A;  2PR1 A;  4UWJ A;  2PCN A;  4PV6 A;  1CS0 B;  1QSN A;  5A27 A;  4MCS A;  4OP4 A;  1U6M A;  2PJ5 A;  5F09 A;  4KSI A;  1Z5R A;  3FF3 A;  5F47 A;  1Y9W A;  2B3U A;  5F1Y A;  2PCU A;  3KRV A;  3KHX A;  1C30 B;  4B10 A;  2DXQ A;  3CDX A;  4PPZ A;  4Q38 A;  4UBR A;  3GUX A;  1CM0 A;  4QC6 A;  2Z10 A;  4C85 A;  2C6C A;  2Z0Z A;  1M4D A;  3D68 A;  2E28 A;  1Y0Y A;  2R1I A;  4HKF A;  4A31 A;  3DDD A;  2CTB A;  3IWW A;  5C82 A;  5H84 A;  2FM4 A;  3S6G A;  4FBE A;  5LRK A;  5H86 A;  2C5Q A;  1YR0 A;  4UCN A;  1NXJ A;  5BY0 A;  5AG6 A;  2CY2 A;  2PIZ A; 
#chains in the Genus database with same CATH homology
 1R3N A;  4A39 A;  1CP6 A;  5JM6 A;  3IO1 A;  2Q43 A;  1ZLI A;  5THW A;  2CTC A;  3KL9 A;  2FVG A;  4DUK A;  3I6S A;  4C8C A;  1CPX A;  3IEH A;  1ARM A;  2GU2 A;  1UWY A;  2NSM A;  2RB7 A;  2EK8 A;  1Y9Z A;  1DTD A;  4C8U A;  3FEE A;  1VGY A;  3D4U A;  2F7V A;  3DLJ A;  3FEC A;  4EME A;  4X3R A;  1HEE A;  4P44 A;  1XMB A;  3ICU A;  4MXU A;  2XEJ A;  5LRJ A;  1PYT B;  3FED A;  2XEG A;  2JBK A;  2ZOF A;  4EFD A;  4NJQ A;  2O4H A;  4UEF A;  4F9V A;  4YN3 A;  3KZW A;  1LAP A;  3PB4 X;  5IR2 A;  2JEW A;  1OBR A;  2PVW A;  2I3C A;  2ZEP A;  2ZEO A;  3SJF A;  4ZI6 A;  4PXC A;  4C9E A;  5HVH A;  3B2Y A;  2PJC A;  5HVF A;  3RAM A;  2ZEG A;  1EE3 P;  1R43 A;  4P45 A;  2QJ8 A;  4W9Y A;  2PE3 A;  1YW6 A;  2ZEF A;  1BAV A;  3CPX A;  2ZEL A;  4PXD A;  4FUU A;  4C8T A;  3PB6 X;  4ZX8 A;  1XFO A;  1CP7 A;  4G1P A;  1JQG A;  3NH8 A;  3D7H A;  2RFH A;  3VAR A;  3SJE A;  2Q51 A;  1TF8 A;  3FMC A;  3KHZ A;  3PEI A;  3PB7 X;  2ZOG A;  5D8N A;  2PVV A;  2EK9 A;  1VIX A;  2HC9 A;  4K3N A;  2WYR A;  5HXD A;  7CPA A;  3BI1 A;  1TF9 A;  2IJZ A;  2AFZ A;  2G9D A;  3HUV A;  4R8F A;  2F8H A;  8CPA A;  5J1Q A;  1ELM P;  2PJA A;  4OKO A;  4ONW A;  3CPA A;  2BOA A;  2JBJ A;  3S9L A;  3HLP A;  4A37 A;  1LAM A;  4CDK A;  1YLO A;  2AFW A;  2ZEH A;  3FX6 A;  4YWY A;  4MHP A;  4B6Z A;  3D7F A;  3H8F A;  4P4D A;  1Y7E A;  4ZY1 A;  3FVL A;  5D29 A;  3TX8 A;  1CPS A;  2NYQ A;  2PRQ A;  4OME A;  3LMS A;  1V6C A;  1XJO A;  4CPA A;  4OC1 A;  4OC5 A;  4X2T A;  4C99 A;  1YW4 A;  4WWV A;  1TXR A;  3WAB A;  4A38 A;  1BPM A;  4F8Z A;  4PQA A;  4EWT A;  2CF4 A;  4ZYQ A;  5ELY A;  1XRY A;  4X8I A;  2ANP A;  3PB9 X;  2VL1 A;  5CBM A;  3BHX A;  3GLJ A;  3KI9 A;  4OC3 A;  4C8P A;  3N5F A;  2CIJ A;  4IAV A;  1F57 A;  3EIF A;  4TJV A;  4ZY2 A;  2BCO A;  5LYD A;  3WC5 A;  3K9T A;  1ZG7 A;  4H2K A;  3NFZ A;  3GB0 A;  2V8V A;  2PJ1 A;  3B3V A;  3PRT A;  4NGQ A;  4R76 A;  3D7D A;  5LYF A;  1Z8L A;  1ARL A;  1M4L A;  4JYW A;  4NGR A;  1YSJ A;  1HDQ A;  4MHY A;  1VHE A;  4NGM A;  4IHM A;  2PJ6 A;  4CDJ A;  4MCP A;  4UF4 A;  2AFX A;  1IY7 A;  3B3W A;  1WVM A;  2PIY A;  1VHO A;  3SJX A;  3I74 A;  4MHZ A;  1PCA A;  4DYO A;  3KQZ A;  2XEF A;  1TKJ A;  1Q7L A;  4NGT A;  3IIB A;  3MN8 A;  4PXE A;  1AYE A;  1QMU A;  4WJB A;  1BPN A;  3KQX A;  3RBU A;  2DEA A;  3D66 A;  2GLJ A;  1FT7 A;  3WC7 A;  1CBX A;  5LYL A;  3KAS A;  4TJX A;  1F2P A;  2PJ8 A;  3WT4 A;  2PJB A;  4C9V A;  3PBE A;  2ZEN A;  4FAI A;  2GP4 A;  4C9A A;  3FJU A;  2AFU A;  3ISZ A;  4OC2 A;  3B3T A;  1KWM A;  2AFS A;  5DS0 A;  1NSA A;  2O53 A;  3B7I A;  4R7M A;  2WZN A;  1GYT A;  3IJ3 A;  3WC6 A;  2PJ7 A;  3LWU A;  3SJG A;  1XBU A;  1LAN A;  1DE4 C;  1LOK A;  4TWE A;  3D7G A;  3ISX A;  3V7Z A;  4GM5 A;  4A94 A;  4OC4 A;  4OC0 A;  1FNO A;  2ABZ A;  2QVP A;  3IFE A;  4UIB A;  4C9R A;  2BO9 A;  1YME A;  1TKH A;  2GLF A;  4FWU A;  2PJ2 A;  1AMP A;  4KNG E;  5K8O A;  1ELL P;  5I4M A;  4Z65 A;  4JZ0 A;  3PB8 X;  3VH9 A;  4P4I A;  4NFR A;  4P4E A;  1QQ9 A;  3D67 A;  3S9M A;  6CPA A;  5CPA A;  4C8F A;  1LCP A;  4R6T A;  2V8D A;  4OID A;  4NGN A;  1CG2 A;  3H8E A;  2GRE A;  2Q4Z A;  1IGB A;  2V8G A;  3PFO A;  4AXV A;  5LRG A;  4C86 A;  4P10 A;  5K8P A;  3KR5 A;  5K8N A;  1F2O A;  3I1U A;  1ZG9 A;  2OR4 A;  4MMO A;  3SI0 A;  1Z2L A;  2ZEE A;  1RTQ A;  3QNV A;  3IC1 A;  4UEZ A;  4ZY0 A;  2V8H A;  3B3S A;  3SI2 A;  3FH4 A;  2PJ3 A;  1H8L A;  5IB9 A;  2PJ0 A;  4DJL A;  1ZG8 A;  2QYV A;  1LFW A;  4NGP A;  2AFM A;  2ZEM A;  3KGQ A;  3K2K A;  1Y0R A;  4P6Y A;  4C9U A;  4PXB A;  3DGV A;  4TNU A;  1CX8 A;  3BXM A;  2PJ9 A;  3NA6 A;  4MCR A;  4YU9 A;  4UEE A;  5K8M A;  2EWB A;  4NGS A;  3MRU A;  2C6G A;  4O23 A;  2AFO A;  4OIW A;  4C8A A;  4P4J A;  3B3C A;  3SI1 A;  4ZX9 A;  3PBB A;  3L2N A;  1HDU A;  4C84 A;  3CT9 A;  3H8G A;  4RUH A;  2HB6 A;  3JRU A;  4IK2 A;  4MHN A;  2OOT A;  5LYI A;  2ZED A;  3B35 A;  1BLL E;  1TKF A;  2PJ4 A;  4MRI A;  4NJR A;  5JH9 A;  2V77 A;  3NH4 A;  3KR4 A;  4Q7A A;  2XEI A;  3V38 A;  2J9A A;  3T8W A;  3RZA A;  1ZLH A;  5HVG A;  1XF1 A;  4F9U A;  2C6P A;  2IQ6 A;  5JGF A;  4UIA A;  3VTA A;  4LQG A;  2IMO A;  3BI0 A;  3TC8 A;  4P4F A;  3NH5 A;  2POK A;  4BD9 A;  4P4B A;  3S9N A;  2C1C A;  4MCQ A;  3VAT A;  3PFE A;  4MCS A;  4OP4 A;  2PJ5 A;  5F09 A;  4KSI A;  1Z5R A;  3FF3 A;  2PCU A;  3KHX A;  3CDX A;  4PPZ A;  3GUX A;  4C85 A;  2C6C A;  3D68 A;  1Y0Y A;  2CTB A;  3IWW A;  4FBE A;  5LRK A;  2C5Q A;  2PIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...