4OC0A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with ccibzl, a urea-based inhibitor n~2~-[(1-carboxycyclopropyl)carbamoyl]-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc0A02
3KR5A 3WABA 3I6SA 3LWUA 3I1UA 2V8DA 4UIBA 2PJCA 4K3NA 2AFWA 4C8AA 3SI0A 1BAVA 2PIZA 3KHZA 2JBJA 4P4IA 1NSAA 1OBRA 3WT4A 4O23A 2PE3A 4MCQA 3CPXA 2PJAA 5LYIA 2PJ0A 2O53A 3DGVA 1Z8LA 1XF1A 2AFUA 3KL9A 3D67A 4A94A 4F9VA 2WZNA 1CPXA 3D4UA 1Z2LA 5LRKA 4P4EA 1IY7A 1AMPA 3ISZA 4OIWA 4IAVA 1CP7A 5J1QA 4NGSA 1CX8A 2V8VA 1TXRA 3FEEA 1VIXA 3KZWA 4IK2A 4NJQA 3TC8A 4A38A 1XJOA 4OC0A 3ICUA 1ELMP 3BI1A 3PB6X 4C99A 3KQXA 2PJ3A 3SJEA 1ZLHA 1V6CA 4MMOA 3VH9A 2PJ8A 3KGQA 2JBKA 4FWUA 3B35A 2FVGA 4MHNA 1Y0YA 1BLLE 4P10A 2PCUA 3PB8X 3K9TA 2C6PA 3VTAA 2HC9A 2AFZA 1CP6A 4FUUA 1HEEA 4X3RA 2XEGA 2F7VA 4OC2A 2PIYA 5DS0A 3PEIA 2O4HA 2HB6A 3B2YA 1ZG7A 3HLPA 1TKHA 2I3CA 4OKOA 3V38A 4RUHA 1HDQA 1ARMA 1TKJA 2EK9A 4F8ZA 2BCOA 2Q4ZA 3IJ3A 4G1PA 5ELYA 3I74A 1BPNA 3SI1A 2CF4A 3GUXA 5THWA 3RZAA 1Y9ZA 4ZX9A 4R76A 1PCAA 3BI0A 3RAMA 3NH4A 4C8CA 4OC1A 1TF9A 2POKA 2GLJA 1KWMA 3KQZA 3D7GA 3PB7X 4TJXA 5K8NA 4MXUA 1QQ9A 3D7HA 4OC3A 2V8GA 4EFDA 4OC4A 3D66A 3H8FA 4TWEA 2AFSA 4JYWA 3MN8A 3IFEA 5HXDA 4H2KA 3FJUA 2JEWA 2ABZA 3VARA 1H8LA 4UF4A 3N5FA 1YLOA 4W9YA 3B3SA 6CPAA 4UEEA 4P4JA 1M4LA 3EIFA 1FT7A 2V77A 2RB7A 3CDXA 4ONWA 2OR4A 3DLJA 3FX6A 5LRJA 4DUKA 3FH4A 4NGPA 5HVFA 5K8OA 2ZEPA 4UIAA 2G9DA 1LOKA 4TNUA 4P44A 2ZOFA 3TX8A 1F2OA 2XEFA 4Z65A 2CIJA 4P4BA 2AFMA 3QNVA 1Y0RA 2IQ6A 3IO1A 2PVVA 3T8WA 2C6CA 3B3CA 1Y7EA 3PFOA 1RTQA 3KR4A 3PBBA 4NGNA 7CPAA 1ELLP 2IMOA 3GLJA 2XEIA 2J9AA 3PBEA 4NJRA 2VL1A 1TF8A 1LFWA 4NGQA 4UEFA 3MRUA 3SJFA 4MCPA 1VHOA 4FAIA 5F09A 2GU2A 8CPAA 4KSIA 4CPAA 2ZENA 4LQGA 4MRIA 4UEZA 2C6GA 3KHXA 2PVWA 4NGMA 4P6YA 5LYLA 3B3VA 2Q51A 3BHXA 1DTDA 1LAPA 2PJ5A 3SJXA 4OMEA 1YW6A 4DYOA 5JH9A 1EE3P 1Q7LA 3WC5A 4C8TA 1VGYA 5D29A 2NYQA 3FVLA 4OP4A 1LCPA 4A37A 1ARLA 2ZEDA 1TKFA 1ZG8A 1R43A 4EWTA 4EMEA 3PRTA 3WC7A 4MHZA 3IIBA 4WWVA 1QMUA 1IGBA 3JRUA 4ZY0A 1JQGA 4ZX8A 4PXDA 3BXMA 2QYVA 1F57A 2ZEOA 3GB0A 4MCRA 1CBXA 2PJ1A 3PB9X 1BPMA 5HVGA 4R7MA 2RFHA 3SI2A 4B6ZA 4C9EA 5D8NA 4X8IA 2XEJA 3NH5A 4CDKA 1R3NA 4R8FA 4TJVA 3IEHA 2AFOA 2ANPA 3V7ZA 1CG2A 2PRQA 3D68A 2PJ6A 2NSMA 3B3WA 2ZEHA 4IHMA 3SJGA 4PPZA 3HUVA 3S9LA 5LYFA 4NFRA 2CTCA 4P4FA 4YU9A 4PXCA 1VHEA 2ZOGA 3FEDA 3FF3A 4NGRA 3NA6A 4ZY1A 4PQAA 3L2NA 1XMBA 4P45A 2QJ8A 1GYTA 1HDUA 2ZEGA 5I4MA 5IB9A 4ZYQA 1Z5RA 3CT9A 1FNOA 1LAMA 1XRYA 5JGFA 1WVMA 2ZEEA 3H8GA 5LYDA 2PJ2A 2PJ4A 2EWBA 2ZEMA 3S9NA 2OOTA 2ZEFA 4OC5A 2PJ9A 3KI9A 4C9UA 4C8UA 2AFXA 5CBMA 1CPSA 1ZLIA 3LMSA 4C9AA 2IJZA 1LANA 4C85A 3NFZA 3FMCA 2EK8A 4A39A 1DE4C 4YWYA 3CPAA 4DJLA 4AXVA 3PFEA 1YW4A 4MHPA 4C8PA 4GM5A 4KNGE 5CPAA 1F2PA 3H8EA 4C8FA 2F8HA 1UWYA 3D7FA 2QVPA 4YN3A 4ZY2A 4WJBA 4JZ0A 4X2TA 3FECA 5LRGA 4CDJA 1YMEA 3PB4X 4P4DA 3VATA 1XBUA 3B7IA 3IC1A 1ZG9A 2BO9A 2DEAA 4ZI6A 2WYRA 3B3TA 4OIDA 2CTBA 3S9MA 4FBEA 5K8PA 4C9VA 3IWWA 4PXEA 4MCSA 5JM6A 3KASA 3WC6A 4F9UA 5HVHA 4PXBA 4C84A 1YSJA 1XFOA 4Q7AA 1AYEA 2Q43A 3ISXA 3NH8A 2GLFA 4R6TA 4NGTA 3RBUA 2C1CA 2V8HA 4C9RA 3D7DA 5K8MA 4C86A 4BD9A 4MHYA 2GREA 2ZELA 3K2KA 2PJ7A 1PYTB 2BOAA 2PJBA
chains in the Genus database with same CATH superfamily
4CAWA 3VGOA 3TOBA 3KR5A 3WABA 5KTCA 3I6SA 3LWUA 3I1UA 1YGHA 1J3LA 1YREA 2V8DA 4UFWA 4UIBA 2G0BA 2HQYA 2BL1A 3TYXA 1X10A 3VRPA 2PJCA 5FVJA 4K3NA 5G1ZA 3PGPA 2AFWA 4HNXB 4C8AA 5G21A 3S6FA 2K5TA 2OZGA 3QAHA 3SI0A 4FD6A 4QB9A 3SHPA 1BAVA 1M44A 2PIZA 3KHZA 2JBJA 2B0AA 4P4IA 4IIXA 1NSAA 1OBRA 1IU8A 1VBHA 4B14A 3WT4A 1Z9UA 4O23A 3C8OA 1UFHA 2PE3A 4MCQA 4A95A 4KVXA 1VKCA 1YLEA 2YJTA 3SR3A 2P6EA 3CPXA 3RO0A 1XMTA 2PJAA 1P4NA 1ZYMA 5LYIA 4RN7A 4UFXA 2PJ0A 3R9EA 2O53A 3TTHA 3DDDA 1Z8LA 3DGVA 4R57A 5KTAA 1XF1A 3ZNIA 4MY0A 3BUOB 4E0AA 1Z8XA 2AFUA 4XNHB 4R9MA 1XIXA 3P2FA 3KL9A 3D67A 4L8AA 4A94A 4F9VA 2WZNA 4EYSA 2XPLA 2FCKA 2Z10A 3EO4A 1CPXA 4E8OA 3K4IA 4I49A 3D4UA 5HKYA 1Z2LA 4CAFA 5LRKA 4P4EA 1IY7A 5IX3A 1AMPA 3ISZA 2Z3OA 4OIWA 3TLGA 4IAVA 1BOBA 2JDCA 1CP7A 3D2MA 5J1QA 4NGSA 1BO4A 1CX8A 4CYPA 2NMTA 2V8VA 2ZW4A 3BUWB 4YRHA 3VRNA 4IF5A 1TXRA 3FEEA 1VIXA 3KZWA 4IK2A 4NJQA 3TC8A 3V8IA 1S5KA 1XJOA 4UWIA 4A38A 5K99A 1BXRB 4OC0A 2YNCC 4CGLA 3TLYA 5C88A 3ICUA 1ELMP 3BI1A 3DR8A 3TT2A 1Q2CA 3PB6X 4C2YA 4C99A 4GXHA 3KRVA 3KQXA 2PJ3A 3SJEA 1ZLHA 1V6CA 4MMOA 2Q4YA 3LODA 2CXAA 2P0WA 3VH9A 2Z3MA 2PJ8A 4UCPA 3EZAA 2R1IA 3KGQA 2JBKA 3IGRA 4L89A 4FWUA 3ZJ0A 1FY7A 3EZEA 1PUAA 2EO8A 3B35A 2FVGA 4MHNA 1M4GA 1Y0YA 2FIAA 1ZRSA 1NXJA 5GCNA 1BLLE 2HWGA 4P10A 2PCUA 3PB8X 1S3ZA 5I0CA 4CO9A 3K9TA 2C6PA 3VTAA 2HC9A 2AFZA 1CP6A 4JD6A 4FUUA 4MFKA 4CS0B 1HEEA 1Y9ZA 4X3RA 4Q36A 2ZXVA 2XEGA 2F7VA 4PK2A 3TO6A 4COGA 1Z4RA 4OC2A 4EVYA 2ZPAA 2VQYA 2CY2A 2P6FA 4KLWA 3CXSA 4C2ZA 3G23A 1KEEB 2GIVA 2PIYA 1KUYA 2EZBA 1R57A 3T9YA 5J3XA 2AUMA 2Q0YA 4A4BA 1QSMA 3I3GA 5DS0A 3PEIA 4CGPA 2O4HA 1I1DA 1YK3A 4GPLB 2HB6A 3B2YA 2OU2A 3CXPA 3S6HA 1ZG7A 1TKHA 2I3CA 3HLPA 4OKOA 2PC1A 3V38A 4RUHA 1HDQA 2EUIA 1ARMA 1TKJA 2B3UA 2EK9A 4F8ZA 4A32A 4CZ1A 1XE4A 5HKWA 2BCOA 2Q4ZA 3IJ3A 4G1PA 5ELYA 4NSQA 3I74A 1BPNA 4UWJA 2VXKA 3SI1A 2CF4A 3GUXA 5THWA 1KUXA 3LACA 4ZX9A 3RZAA 4R76A 2KCWA 4AG9A 1PCAA 3BI0A 3VWEA 3RAMA 3NH4A 1A2ZA 4C7IA 4C8CA 4OC1A 1TF9A 2Y0MA 3FNCA 2POKA 3UY5A 2GLJA 4AVBA 2ODFA 1GGOA 2XPOA 1YQEA 2VI7A 1KWMA 4OAEA 3KQZA 3R1KA 3D7GA 3PB7X 4TJXA 5K8NA 5KTDA 4LQ6A 4MXUA 3HMJG 2D4PA 3FXTA 1KUVA 1QQ9A 4JWPA 3D7HA 4MFQA 5HH1A 2MP0A 2CNTA 5J8CA 3W91A 4KLVA 2ZW7A 4CYOA 4OC3A 2Z3NA 3QAYA 2WUUA 5IB0A 3EFAA 2V8GA 3TCVA 4EFDA 4OC4A 5C82A 2FXFA 5IR2A 3TLEA 3D66A 3G3SA 3T07A 2FS5A 3H8FA 4MFPA 2N3AB 2AFSA 4TWEA 2QIRA 3JUWA 4JYWA 4BTFA 4UBRA 4J0NA 3MN8A 4HPSA 4AVAA 3IFEA 2YJVA 3NOJA 2DLAA 1IOFA 5HXDA 2B4BA 1IYKA 2ATRA 4H2KA 4HNYB 3FB3A 3FJUA 2JEWA 2ABZA 1EZAA 3VARA 1MJBA 2REEA 1H8LA 1IIDA 4UF4A 2Q4VA 3N5FA 3OP0A 1YLOA 4W9YA 3B3SA 6CPAA 1FBVA 2X7BA 4UEEA 4P4JA 2QMLA 1WJTA 1M4LA 3F8KA 1FT7A 3EIFA 5JPHA 4MJXA 2V77A 2RB7A 1S7LA 3SXNA 1C3OB 4M6GA 2HI6A 5J8FA 4B10A 1GHEA 3D3SA 3CDXA 4ONWA 2Y1MA 2Q44A 2OR4A 3DLJA 3FX6A 5LRJA 4DUKA 3FH4A 4NGPA 5HVFA 1IICA 5K8OA 3U1BA 2ZEPA 4JXQA 1JWQA 5F9MA 4UIAA 2G9DA 1LOKA 2P6GA 4PSXA 4TNUA 1EO0A 3R9GA 4JLYA 4P44A 2ZOFA 3B8GA 3TX8A 1F2OA 4H6UA 4Q38A 1IOIA 5AG6A 2XEFA 4KVOE 2DF5A 2FSRA 1KZFA 4JJXA 1Z9EA 1KBLA 4Z65A 2J8NA 4KORA 2CIJA 4P4BA 2AFMA 3QNVA 3A9LA 1U6MA 1Y0RA 2IQ6A 3GIUA 3IO1A 3G8WA 2PVVA 1AUGA 3T8WA 1M6VB 2C6CA 2R98A 1P0HA 3B3CA 1Y7EA 3I9SA 4NEXA 3PFOA 1I12A 1WWZA 1RTQA 4XPKA 3KR4A 3PBBA 4NGNA 4NF1A 3U88C 4CRYB 7CPAA 1ELLP 2IMOA 3IWEA 4LX9A 5G20A 4QBJA 3EXNA 3GLJA 2XEIA 4KOXA 2J9AA 3PBEA 1SQHA 4E5SA 4NJRA 2VL1A 3IU2A 2EZCA 1TF8A 1LFWA 4NGQA 4UEFA 5E96A 2JDDA 3MRUA 3SJFA 1Y7RA 4A30A 4A2ZA 4CAVA 3TE4A 4MCPA 2FM4A 1VHOA 4C2XA 4FAIA 1NMTA 5H86A 5F09A 3KKWA 2YNEA 1NE9A 3P2HA 2GU2A 8CPAA 4HNWB 4KSIA 4CPAA 4M6IA 1XF8A 4KS9A 3GY9A 2ZENA 2R82A 4KOVA 4LQGA 5FD8A 3PT1A 4MRIA 2R7HA 2GE3A 4UEZA 3R9FA 1JDEA 3DSBA 4B5PB 3HPGG 1YVKA 2C6GA 2Z11A 3S6KA 4H1HA 3KHXA 3MGDA 2PVWA 4NGMA 4P6YA 4QUSA 2VKZG 2PDOA 5EBVA 4F0YA 5LYLA 2XPNA 3OWCA 3R95A 3B3VA 2E28A 3IWGA 4RI1A 2Q51A 2YGWA 3BHXA 1DTDA 1LAPA 2PJ5A 3SJXA 4OMEA 1M1DA 1YW6A 5DWMA 4U5YA 3FBUA 1EE3P 4DYOA 1Q7LA 5JH9A 3WC5A 4C8TA 1VGYA 2ZW5A 5D29A 1XOVA 1S7KA 2NYQA 3RYOA 4II9A 2CNSA 3PFVA 3FVLA 4OP4A 4QVTA 1LCPA 2J8RA 4MFLA 4A33A 4A37A 4FD4A 2Z3PA 1ARLA 1L0CA 1YR0A 1QSOA 2AE6A 2F5IA 2Q04A 2ZEDA 3F0AA 4OLLA 4KUAA 1TKFA 1ZG8A 3TFYA 2CBLA 1R43A 4EWTA 5BY0A 1Y9KA 4ONUA 4EMEA 2O28A 2PR8A 5F47A 2G3AA 4KOUA 3PRTA 3WC7A 4MHZA 3IIBA 2AUNA 4WWVA 1QMUA 1IGBA 5F1YA 2H5MA 5CNPA 3JRUA 4AG7A 1OZPA 4ZY0A 4MY3A 4R3LA 1JQGA 5ISVA 4ZX8A 3CZXA 5F13A 4PXDA 3BXMA 3LD2A 2QYVA 4ZGYB 3EY5A 2DXQA 1F57A 2A4NA 1B47A 2ZEOA 4ZBGA 2OH1A 3FIXA 3GJZA 3GB0A 1N71A 4MCRA 4XNHC 4AVCA 1CBXA 3OAKA 4COBA 4JVOA 2REFA 2PJ1A 5BWAB 4UCMA 5DWNA 4CYNA 3PB9X 1BPMA 5HVGA 3T0TA 4E94A 4R7MA 2RFHA 4LUAA 3W6SA 3SI2A 3BJ8A 3TLZA 4H6ZA 3BUNB 4B6ZA 4C9EA 2UV8G 2B4JC 5D8NA 2JEVA 4MFJA 4XPDC 4BPXB 3GKRA 4X8IA 2XEJA 2C27A 3NH5A 3VRQA 4CDKA 1R3NA 4R8FA 4CGMA 1Q5XA 3IEHA 4TJVA 2AFOA 2ANPA 3V7ZA 4U9ZA 1T36B 3R96A 1CG2A 3BUXB 2PRQA 3EC4A 3D68A 4B13A 3DR6A 5AG7A 1ON0A 2PJ6A 4K30A 4KUBA 4Y49C 4E2AA 1M4DA 4MJ8A 4QC6A 4B5OA 2B5GA 5HKZA 4YFJA 3OB2B 3HPHE 2NSMA 4NCZA 3B3WA 4MBUA 2ZEHA 2BEIA 4IHMA 2EBJA 3SJGA 4PPZA 1IYLA 2Z3KA 3VROA 3S9LA 2WSAA 3FRMA 3FYNA 3HUVA 4NFRA 5LYFA 4PSWA 2BSWA 4P4FA 2CTCA 4YU9A 4C7HA 4PXCA 1VHEA 2ZOGA 1YVHA 4M8DA 1M4IA 3FEDA 1QSRA 5AG5A 2D0PA 3FF3A 2FE7A 4MI1A 4NGRA 3NA6A 2OLSA 4FD5A 4ZY1A 4PQAA 5JVLA 3L2NA 4PK3A 1XMBA 4P45A 3TLBA 2R8VA 2QJ8A 1GYTA 1HDUA 2ZEGA 4NXYA 3T5MA 3H5ZA 5I4MA 1QSTA 5IB9A 3RNZA 3NE7A 4ZYQA 1TIQA 4B11A 1Q2DA 2FL4A 4BINA 3NFQA 4YGOA 2D0OA 1Z5RA 3CT9A 3O8ZA 1FNOA 2Q7SA 2PCNA 4OADA 4A4CA 1LAMA 2C5QA 2VZYA 1XRYA 2RC4A 3D8PA 2OZUA 5JGFA 2ZEEA 3H8GA 5LYDA 1WVMA 2PJ2A 2YNDA 3JVNA 4MFZA 2Q7BA 3SXOA 1Z8TA 2EWBA 2PJ4A 2ZEMA 4INJA 3S9NA 4CYQA 1CJWA 2OOTA 2ZEFA 4B5PA 1JDBC 2D4OA 2I00A 3ZZIA 4OC5A 1CM0A 2PJ9A 3KI9A 4R3KA 4X5KA 4XPLA 4C8UA 1Z8WA 4RS2A 5F46A 1KC7A 2X0SA 5A28A 2PSWA 3BJ7A 2B4DB 5AG4A 2GP4A 1I21A 2HV2A 2XPPA 1S60A 2B4DA 4KZTA 4H89A 2AFXA 5CBMA 1YVOA 4C9UA 1MK4A 3S6GA 1K4JA 3N7ZA 4J3GA 3W6XA 1CPSA 1ZLIA 3LMSA 4UCNA 3T05A 1ZO0A 4FD7A 4RR2B 1NBWA 2IJZA 4C9AA 1Y9WA 3OB1B 2B3VA 2Z0ZA 3BUMB 4CGOA 1A9XB 2B5GB 2DIKA 3TLAA 2VBQA 1LANA 3GYAA 4C85A 3NFZA 3FMCA 4MHDA 2EK8A 5F49A 4BBHA 4A39A 1DE4C 3DNSA 3CPAA 4YWYA 4AXVA 3PFEA 1YW4A 4DJLA 1CS0B 1R61A 2DPTA 2FIWA 4JXRA 4MHPA 4C8PA 3VRRA 2ARHA 3C26A 3JTKA 4GM5A 2J8MA 4A31A 2Y1NA 5F48A 5IV0A 4KNGE 5CPAA 4CRZB 1IB1E 2Z3LA 3E0KA 1QSNA 1F2PA 1J4JA 3EZBA 2EVNA 3H8EA 4M3SA 4R87A 3TOAA 1WK4A 3H4QA 3PP9A 2OB0A 4C8FA 3VWDA 5JYBA 2F8HA 1UWYA 3D7FA 2I79A 1VHSA 2QVPA 1DIKA 4YN3A 5JQ4A 4ZY2A 4ORFA 4WJBA 3TO7A 1CE8B 3F5BA 5AGEA 4JZ0A 2YNCA 4X2TA 3FECA 3PLFB 5LRGA 4DNCA 5F5XA 3TLCA 4Y49B 3WR7A 4CDJA 1YMEA 3PB4X 2GFQA 2QECA 4P4DA 2IL4A 3VATA 4KSFA 1NSLA 1B87A 1XBUA 2CNMA 4PV6A 1VI4A 3B7IA 4KSAA 3IC1A 4F6AA 5G22A 1ZG9A 2BO9A 2DEAA 4ZI6A 3K9UA 2DPSA 2WYRA 2VZZA 3CXQA 3D2PA 4KOYA 4XPDB 5H84A 3QB8A 3B3TA 4OIDA 3F9KC 4C68A 2JLMA 4UFVA 2AJ6A 1ZL0A 2CTBA 3S9MA 4FBEA 5K8PA 1X12A 4C9VA 1MJ9A 4GS4A 3IWWA 2G3TA 2ZW6A 1B6BA 5A27A 4PXEA 1V0CA 4M6HA 4BPWB 1VBGA 5EMIA 5HMNA 2HROA 4KOTA 4MCSA 1MJAA 4KOWA 2PRBA 5JM6A 3KASA 4KOSA 3PZJA 2WPXA 4MI4A 3NE8A 3WC6A 4B12A 3IU1A 4F9UA 4IIYA 5HVHA 1XEBA 4PXBA 4C84A 1YSJA 3TO9A 1XFOA 4Q7AA 1AYEA 2GANA 2OZHA 2Q43A 3ISXA 4F0XA 2VEZA 3NH8A 2GLFA 4KVME 1Q2YA 2HUZA 4AB7A 4R6TA 1S7NA 4NGTA 3RBUA 4BPUB 1YX0A 1Z4EA 2PR1A 4BMHA 4CAXA 2C1CA 4CAEA 4HKFA 1RXTA 1C30B 2B58A 2V8HA 1EZBA 3T90A 3BLNA 3D7DA 4CGNA 4C9RA 1RO5A 1LRZA 2PQ8A 5K8MA 4BD9A 5AXIA 4C86A 4IUSA 2EZAA 4MHYA 2BUEA 2GREA 2ZELA 3K2KA 1PU9A 3TLGB 2WPWA 5EC4A 2PJ7A 1S7FA 4U9YA 4M85A 1PYTB 2BOAA 2PJBA 2FT0A 4UA3A
chains in the Genus database with same CATH topology
3KR5A 3WABA 3I6SA 3LWUA 3I1UA 2V8DA 4UIBA 2PJCA 4K3NA 2AFWA 4C8AA 3SI0A 1BAVA 2PIZA 3KHZA 2JBJA 4P4IA 1NSAA 1OBRA 3WT4A 4O23A 2PE3A 4MCQA 3CPXA 2PJAA 5LYIA 2PJ0A 2O53A 3DGVA 1Z8LA 1XF1A 2AFUA 3KL9A 3D67A 4A94A 4F9VA 2WZNA 1CPXA 3D4UA 1Z2LA 5LRKA 4P4EA 1IY7A 1AMPA 3ISZA 4OIWA 4IAVA 1CP7A 5J1QA 4NGSA 1CX8A 2V8VA 1TXRA 3FEEA 1VIXA 3KZWA 4IK2A 4NJQA 3TC8A 4A38A 1XJOA 4OC0A 3ICUA 1ELMP 3BI1A 3PB6X 4C99A 3KQXA 2PJ3A 3SJEA 1ZLHA 1V6CA 4MMOA 3VH9A 2PJ8A 3KGQA 2JBKA 4FWUA 3B35A 2FVGA 4MHNA 1Y0YA 1BLLE 4P10A 2PCUA 3PB8X 3K9TA 2C6PA 3VTAA 2HC9A 2AFZA 1CP6A 4FUUA 1HEEA 4X3RA 2XEGA 2F7VA 4OC2A 2PIYA 5DS0A 3PEIA 2O4HA 2HB6A 3B2YA 1ZG7A 3HLPA 1TKHA 2I3CA 4OKOA 3V38A 4RUHA 1HDQA 1ARMA 1TKJA 2EK9A 4F8ZA 2BCOA 2Q4ZA 3IJ3A 4G1PA 5ELYA 3I74A 1BPNA 3SI1A 2CF4A 3GUXA 5THWA 3RZAA 1Y9ZA 4ZX9A 4R76A 1PCAA 3BI0A 3RAMA 3NH4A 4C8CA 4OC1A 1TF9A 2POKA 2GLJA 1KWMA 3KQZA 3D7GA 3PB7X 4TJXA 5K8NA 4MXUA 1QQ9A 3D7HA 4OC3A 2V8GA 4EFDA 5IR2A 4OC4A 3D66A 3H8FA 4TWEA 2AFSA 4JYWA 3MN8A 3IFEA 5HXDA 4H2KA 3FJUA 2JEWA 2ABZA 3VARA 1H8LA 4UF4A 3N5FA 1YLOA 4W9YA 3B3SA 6CPAA 4UEEA 4P4JA 1M4LA 3EIFA 1FT7A 2V77A 2RB7A 3CDXA 4ONWA 2OR4A 3DLJA 3FX6A 5LRJA 4DUKA 3FH4A 4NGPA 5HVFA 5K8OA 2ZEPA 4UIAA 2G9DA 1LOKA 4TNUA 4P44A 2ZOFA 3TX8A 1F2OA 2XEFA 4Z65A 2CIJA 4P4BA 2AFMA 3QNVA 1Y0RA 2IQ6A 3IO1A 2PVVA 3T8WA 2C6CA 3B3CA 1Y7EA 3PFOA 1RTQA 3KR4A 3PBBA 4NGNA 7CPAA 1ELLP 2IMOA 3GLJA 2XEIA 2J9AA 3PBEA 4NJRA 2VL1A 1TF8A 1LFWA 4NGQA 4UEFA 3MRUA 3SJFA 4MCPA 1VHOA 4FAIA 5F09A 2GU2A 8CPAA 4KSIA 4CPAA 2ZENA 4LQGA 4MRIA 4UEZA 2C6GA 3KHXA 2PVWA 4NGMA 4P6YA 5LYLA 3B3VA 2Q51A 3BHXA 1DTDA 1LAPA 2PJ5A 3SJXA 4OMEA 1YW6A 4DYOA 5JH9A 1EE3P 1Q7LA 3WC5A 4C8TA 1VGYA 5D29A 2NYQA 3FVLA 4OP4A 1LCPA 4A37A 1ARLA 2ZEDA 1TKFA 1ZG8A 1R43A 4EWTA 4EMEA 3PRTA 3WC7A 4MHZA 3IIBA 4WWVA 1QMUA 1IGBA 3JRUA 4ZY0A 1JQGA 4ZX8A 4PXDA 3BXMA 2QYVA 1F57A 2ZEOA 3GB0A 4MCRA 1CBXA 2PJ1A 3PB9X 1BPMA 5HVGA 4R7MA 2RFHA 3SI2A 4B6ZA 4C9EA 5D8NA 4X8IA 2XEJA 3NH5A 4CDKA 1R3NA 4R8FA 4TJVA 3IEHA 2AFOA 2ANPA 3V7ZA 1CG2A 2PRQA 3D68A 2PJ6A 2NSMA 3B3WA 2ZEHA 4IHMA 3SJGA 4PPZA 3HUVA 3S9LA 5LYFA 4NFRA 2CTCA 4P4FA 4YU9A 4PXCA 1VHEA 2ZOGA 3FEDA 3FF3A 4NGRA 3NA6A 4ZY1A 4PQAA 3L2NA 1XMBA 4P45A 2QJ8A 1GYTA 1HDUA 2ZEGA 5I4MA 5IB9A 4ZYQA 1Z5RA 3CT9A 1FNOA 2C5QA 1LAMA 1XRYA 5JGFA 1WVMA 2ZEEA 3H8GA 5LYDA 2PJ2A 2PJ4A 2EWBA 2ZEMA 3S9NA 2OOTA 2ZEFA 4OC5A 2PJ9A 3KI9A 4C9UA 4C8UA 2GP4A 2AFXA 5CBMA 1CPSA 1ZLIA 3LMSA 4C9AA 2IJZA 1LANA 4C85A 3NFZA 3FMCA 2EK8A 4A39A 1DE4C 4YWYA 3CPAA 4DJLA 4AXVA 3PFEA 1YW4A 4MHPA 4C8PA 4GM5A 4KNGE 5CPAA 1F2PA 3H8EA 4C8FA 2F8HA 1UWYA 3D7FA 2QVPA 4YN3A 4ZY2A 4WJBA 4JZ0A 4X2TA 3FECA 5LRGA 4CDJA 1YMEA 3PB4X 4P4DA 3VATA 1XBUA 3B7IA 3IC1A 1ZG9A 2BO9A 2DEAA 4ZI6A 2WYRA 3B3TA 4OIDA 2CTBA 3S9MA 4FBEA 5K8PA 4C9VA 3IWWA 4PXEA 4MCSA 5JM6A 3KASA 3WC6A 4F9UA 5HVHA 4PXBA 4C84A 1YSJA 1XFOA 4Q7AA 1AYEA 2Q43A 3ISXA 3NH8A 2GLFA 4R6TA 4NGTA 3RBUA 2C1CA 2V8HA 4C9RA 3D7DA 5K8MA 4C86A 4BD9A 4MHYA 2GREA 2ZELA 3K2KA 2PJ7A 1PYTB 2BOAA 2PJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KR5 A;  3WAB A;  3I6S A;  3LWU A;  3I1U A;  2V8D A;  4UIB A;  2PJC A;  4K3N A;  2AFW A;  4C8A A;  3SI0 A;  1BAV A;  2PIZ A;  3KHZ A;  2JBJ A;  4P4I A;  1NSA A;  1OBR A;  3WT4 A;  4O23 A;  2PE3 A;  4MCQ A;  3CPX A;  2PJA A;  5LYI A;  2PJ0 A;  2O53 A;  3DGV A;  1Z8L A;  1XF1 A;  2AFU A;  3KL9 A;  3D67 A;  4A94 A;  4F9V A;  2WZN A;  1CPX A;  3D4U A;  1Z2L A;  5LRK A;  4P4E A;  1IY7 A;  1AMP A;  3ISZ A;  4OIW A;  4IAV A;  1CP7 A;  5J1Q A;  4NGS A;  1CX8 A;  2V8V A;  1TXR A;  3FEE A;  1VIX A;  3KZW A;  4IK2 A;  4NJQ A;  3TC8 A;  4A38 A;  1XJO A;  4OC0 A;  3ICU A;  1ELM P;  3BI1 A;  3PB6 X;  4C99 A;  3KQX A;  2PJ3 A;  3SJE A;  1ZLH A;  1V6C A;  4MMO A;  3VH9 A;  2PJ8 A;  3KGQ A;  2JBK A;  4FWU A;  3B35 A;  2FVG A;  4MHN A;  1Y0Y A;  1BLL E;  4P10 A;  2PCU A;  3PB8 X;  3K9T A;  2C6P A;  3VTA A;  2HC9 A;  2AFZ A;  1CP6 A;  4FUU A;  1HEE A;  4X3R A;  2XEG A;  2F7V A;  4OC2 A;  2PIY A;  5DS0 A;  3PEI A;  2O4H A;  2HB6 A;  3B2Y A;  1ZG7 A;  3HLP A;  1TKH A;  2I3C A;  4OKO A;  3V38 A;  4RUH A;  1HDQ A;  1ARM A;  1TKJ A;  2EK9 A;  4F8Z A;  2BCO A;  2Q4Z A;  3IJ3 A;  4G1P A;  5ELY A;  3I74 A;  1BPN A;  3SI1 A;  2CF4 A;  3GUX A;  5THW A;  3RZA A;  1Y9Z A;  4ZX9 A;  4R76 A;  1PCA A;  3BI0 A;  3RAM A;  3NH4 A;  4C8C A;  4OC1 A;  1TF9 A;  2POK A;  2GLJ A;  1KWM A;  3KQZ A;  3D7G A;  3PB7 X;  4TJX A;  5K8N A;  4MXU A;  1QQ9 A;  3D7H A;  4OC3 A;  2V8G A;  4EFD A;  4OC4 A;  3D66 A;  3H8F A;  4TWE A;  2AFS A;  4JYW A;  3MN8 A;  3IFE A;  5HXD A;  4H2K A;  3FJU A;  2JEW A;  2ABZ A;  3VAR A;  1H8L A;  4UF4 A;  3N5F A;  1YLO A;  4W9Y A;  3B3S A;  6CPA A;  4UEE A;  4P4J A;  1M4L A;  3EIF A;  1FT7 A;  2V77 A;  2RB7 A;  3CDX A;  4ONW A;  2OR4 A;  3DLJ A;  3FX6 A;  5LRJ A;  4DUK A;  3FH4 A;  4NGP A;  5HVF A;  5K8O A;  2ZEP A;  4UIA A;  2G9D A;  1LOK A;  4TNU A;  4P44 A;  2ZOF A;  3TX8 A;  1F2O A;  2XEF A;  4Z65 A;  2CIJ A;  4P4B A;  2AFM A;  3QNV A;  1Y0R A;  2IQ6 A;  3IO1 A;  2PVV A;  3T8W A;  2C6C A;  3B3C A;  1Y7E A;  3PFO A;  1RTQ A;  3KR4 A;  3PBB A;  4NGN A;  7CPA A;  1ELL P;  2IMO A;  3GLJ A;  2XEI A;  2J9A A;  3PBE A;  4NJR A;  2VL1 A;  1TF8 A;  1LFW A;  4NGQ A;  4UEF A;  3MRU A;  3SJF A;  4MCP A;  1VHO A;  4FAI A;  5F09 A;  2GU2 A;  8CPA A;  4KSI A;  4CPA A;  2ZEN A;  4LQG A;  4MRI A;  4UEZ A;  2C6G A;  3KHX A;  2PVW A;  4NGM A;  4P6Y A;  5LYL A;  3B3V A;  2Q51 A;  3BHX A;  1DTD A;  1LAP A;  2PJ5 A;  3SJX A;  4OME A;  1YW6 A;  4DYO A;  5JH9 A;  1EE3 P;  1Q7L A;  3WC5 A;  4C8T A;  1VGY A;  5D29 A;  2NYQ A;  3FVL A;  4OP4 A;  1LCP A;  4A37 A;  1ARL A;  2ZED A;  1TKF A;  1ZG8 A;  1R43 A;  4EWT A;  4EME A;  3PRT A;  3WC7 A;  4MHZ A;  3IIB A;  4WWV A;  1QMU A;  1IGB A;  3JRU A;  4ZY0 A;  1JQG A;  4ZX8 A;  4PXD A;  3BXM A;  2QYV A;  1F57 A;  2ZEO A;  3GB0 A;  4MCR A;  1CBX A;  2PJ1 A;  3PB9 X;  1BPM A;  5HVG A;  4R7M A;  2RFH A;  3SI2 A;  4B6Z A;  4C9E A;  5D8N A;  4X8I A;  2XEJ A;  3NH5 A;  4CDK A;  1R3N A;  4R8F A;  4TJV A;  3IEH A;  2AFO A;  2ANP A;  3V7Z A;  1CG2 A;  2PRQ A;  3D68 A;  2PJ6 A;  2NSM A;  3B3W A;  2ZEH A;  4IHM A;  3SJG A;  4PPZ A;  3HUV A;  3S9L A;  5LYF A;  4NFR A;  2CTC A;  4P4F A;  4YU9 A;  4PXC A;  1VHE A;  2ZOG A;  3FED A;  3FF3 A;  4NGR A;  3NA6 A;  4ZY1 A;  4PQA A;  3L2N A;  1XMB A;  4P45 A;  2QJ8 A;  1GYT A;  1HDU A;  2ZEG A;  5I4M A;  5IB9 A;  4ZYQ A;  1Z5R A;  3CT9 A;  1FNO A;  1LAM A;  1XRY A;  5JGF A;  1WVM A;  2ZEE A;  3H8G A;  5LYD A;  2PJ2 A;  2PJ4 A;  2EWB A;  2ZEM A;  3S9N A;  2OOT A;  2ZEF A;  4OC5 A;  2PJ9 A;  3KI9 A;  4C9U A;  4C8U A;  2AFX A;  5CBM A;  1CPS A;  1ZLI A;  3LMS A;  4C9A A;  2IJZ A;  1LAN A;  4C85 A;  3NFZ A;  3FMC A;  2EK8 A;  4A39 A;  1DE4 C;  4YWY A;  3CPA A;  4DJL A;  4AXV A;  3PFE A;  1YW4 A;  4MHP A;  4C8P A;  4GM5 A;  4KNG E;  5CPA A;  1F2P A;  3H8E A;  4C8F A;  2F8H A;  1UWY A;  3D7F A;  2QVP A;  4YN3 A;  4ZY2 A;  4WJB A;  4JZ0 A;  4X2T A;  3FEC A;  5LRG A;  4CDJ A;  1YME A;  3PB4 X;  4P4D A;  3VAT A;  1XBU A;  3B7I A;  3IC1 A;  1ZG9 A;  2BO9 A;  2DEA A;  4ZI6 A;  2WYR A;  3B3T A;  4OID A;  2CTB A;  3S9M A;  4FBE A;  5K8P A;  4C9V A;  3IWW A;  4PXE A;  4MCS A;  5JM6 A;  3KAS A;  3WC6 A;  4F9U A;  5HVH A;  4PXB A;  4C84 A;  1YSJ A;  1XFO A;  4Q7A A;  1AYE A;  2Q43 A;  3ISX A;  3NH8 A;  2GLF A;  4R6T A;  4NGT A;  3RBU A;  2C1C A;  2V8H A;  4C9R A;  3D7D A;  5K8M A;  4C86 A;  4BD9 A;  4MHY A;  2GRE A;  2ZEL A;  3K2K A;  2PJ7 A;  1PYT B;  2BOA A;  2PJB A; 
#chains in the Genus database with same CATH topology
 4CAW A;  3VGO A;  3TOB A;  3KR5 A;  3WAB A;  5KTC A;  3I6S A;  3LWU A;  3I1U A;  1YGH A;  1J3L A;  1YRE A;  2V8D A;  4UFW A;  4UIB A;  2G0B A;  2HQY A;  2BL1 A;  3TYX A;  1X10 A;  3VRP A;  2PJC A;  5FVJ A;  4K3N A;  5G1Z A;  3PGP A;  2AFW A;  4HNX B;  4C8A A;  5G21 A;  3S6F A;  2K5T A;  2OZG A;  3QAH A;  3SI0 A;  4FD6 A;  4QB9 A;  3SHP A;  1BAV A;  1M44 A;  2PIZ A;  3KHZ A;  2JBJ A;  2B0A A;  4P4I A;  4IIX A;  1NSA A;  1OBR A;  1IU8 A;  1VBH A;  4B14 A;  3WT4 A;  1Z9U A;  4O23 A;  3C8O A;  1UFH A;  2PE3 A;  4MCQ A;  4A95 A;  4KVX A;  1VKC A;  1YLE A;  2YJT A;  3SR3 A;  2P6E A;  3CPX A;  3RO0 A;  1XMT A;  2PJA A;  1P4N A;  1ZYM A;  5LYI A;  4RN7 A;  4UFX A;  2PJ0 A;  3R9E A;  2O53 A;  3TTH A;  3DDD A;  1Z8L A;  3DGV A;  4R57 A;  5KTA A;  1XF1 A;  3ZNI A;  4MY0 A;  3BUO B;  4E0A A;  1Z8X A;  2AFU A;  4XNH B;  4R9M A;  1XIX A;  3P2F A;  3KL9 A;  3D67 A;  4L8A A;  4A94 A;  4F9V A;  2WZN A;  4EYS A;  2XPL A;  2FCK A;  2Z10 A;  3EO4 A;  1CPX A;  4E8O A;  3K4I A;  4I49 A;  3D4U A;  5HKY A;  1Z2L A;  4CAF A;  5LRK A;  4P4E A;  1IY7 A;  5IX3 A;  1AMP A;  3ISZ A;  2Z3O A;  4OIW A;  3TLG A;  4IAV A;  1BOB A;  2JDC A;  1CP7 A;  3D2M A;  5J1Q A;  4NGS A;  1BO4 A;  1CX8 A;  4CYP A;  2NMT A;  2V8V A;  2ZW4 A;  3BUW B;  4YRH A;  3VRN A;  4IF5 A;  1TXR A;  3FEE A;  1VIX A;  3KZW A;  4IK2 A;  4NJQ A;  3TC8 A;  3V8I A;  1S5K A;  1XJO A;  4UWI A;  4A38 A;  5K99 A;  1BXR B;  4OC0 A;  2YNC C;  4CGL A;  3TLY A;  5C88 A;  3ICU A;  1ELM P;  3BI1 A;  3DR8 A;  3TT2 A;  1Q2C A;  3PB6 X;  4C2Y A;  4C99 A;  4GXH A;  3KRV A;  3KQX A;  2PJ3 A;  3SJE A;  1ZLH A;  1V6C A;  4MMO A;  2Q4Y A;  3LOD A;  2CXA A;  2P0W A;  3VH9 A;  2Z3M A;  2PJ8 A;  4UCP A;  3EZA A;  2R1I A;  3KGQ A;  2JBK A;  3IGR A;  4L89 A;  4FWU A;  3ZJ0 A;  1FY7 A;  3EZE A;  1PUA A;  2EO8 A;  3B35 A;  2FVG A;  4MHN A;  1M4G A;  1Y0Y A;  2FIA A;  1ZRS A;  1NXJ A;  5GCN A;  1BLL E;  2HWG A;  4P10 A;  2PCU A;  3PB8 X;  1S3Z A;  5I0C A;  4CO9 A;  3K9T A;  2C6P A;  3VTA A;  2HC9 A;  2AFZ A;  1CP6 A;  4JD6 A;  4FUU A;  4MFK A;  4CS0 B;  1HEE A;  1Y9Z A;  4X3R A;  4Q36 A;  2ZXV A;  2XEG A;  2F7V A;  4PK2 A;  3TO6 A;  4COG A;  1Z4R A;  4OC2 A;  4EVY A;  2ZPA A;  2VQY A;  2CY2 A;  2P6F A;  4KLW A;  3CXS A;  4C2Z A;  3G23 A;  1KEE B;  2GIV A;  2PIY A;  1KUY A;  2EZB A;  1R57 A;  3T9Y A;  5J3X A;  2AUM A;  2Q0Y A;  4A4B A;  1QSM A;  3I3G A;  5DS0 A;  3PEI A;  4CGP A;  2O4H A;  1I1D A;  1YK3 A;  4GPL B;  2HB6 A;  3B2Y A;  2OU2 A;  3CXP A;  3S6H A;  1ZG7 A;  1TKH A;  2I3C A;  3HLP A;  4OKO A;  2PC1 A;  3V38 A;  4RUH A;  1HDQ A;  2EUI A;  1ARM A;  1TKJ A;  2B3U A;  2EK9 A;  4F8Z A;  4A32 A;  4CZ1 A;  1XE4 A;  5HKW A;  2BCO A;  2Q4Z A;  3IJ3 A;  4G1P A;  5ELY A;  4NSQ A;  3I74 A;  1BPN A;  4UWJ A;  2VXK A;  3SI1 A;  2CF4 A;  3GUX A;  5THW A;  1KUX A;  3LAC A;  4ZX9 A;  3RZA A;  4R76 A;  2KCW A;  4AG9 A;  1PCA A;  3BI0 A;  3VWE A;  3RAM A;  3NH4 A;  1A2Z A;  4C7I A;  4C8C A;  4OC1 A;  1TF9 A;  2Y0M A;  3FNC A;  2POK A;  3UY5 A;  2GLJ A;  4AVB A;  2ODF A;  1GGO A;  2XPO A;  1YQE A;  2VI7 A;  1KWM A;  4OAE A;  3KQZ A;  3R1K A;  3D7G A;  3PB7 X;  4TJX A;  5K8N A;  5KTD A;  4LQ6 A;  4MXU A;  3HMJ G;  2D4P A;  3FXT A;  1KUV A;  1QQ9 A;  4JWP A;  3D7H A;  4MFQ A;  5HH1 A;  2MP0 A;  2CNT A;  5J8C A;  3W91 A;  4KLV A;  2ZW7 A;  4CYO A;  4OC3 A;  2Z3N A;  3QAY A;  2WUU A;  5IB0 A;  3EFA A;  2V8G A;  3TCV A;  4EFD A;  4OC4 A;  5C82 A;  2FXF A;  5IR2 A;  3TLE A;  3D66 A;  3G3S A;  3T07 A;  2FS5 A;  3H8F A;  4MFP A;  2N3A B;  2AFS A;  4TWE A;  2QIR A;  3JUW A;  4JYW A;  4BTF A;  4UBR A;  4J0N A;  3MN8 A;  4HPS A;  4AVA A;  3IFE A;  2YJV A;  3NOJ A;  2DLA A;  1IOF A;  5HXD A;  2B4B A;  1IYK A;  2ATR A;  4H2K A;  4HNY B;  3FB3 A;  3FJU A;  2JEW A;  2ABZ A;  1EZA A;  3VAR A;  1MJB A;  2REE A;  1H8L A;  1IID A;  4UF4 A;  2Q4V A;  3N5F A;  3OP0 A;  1YLO A;  4W9Y A;  3B3S A;  6CPA A;  1FBV A;  2X7B A;  4UEE A;  4P4J A;  2QML A;  1WJT A;  1M4L A;  3F8K A;  1FT7 A;  3EIF A;  5JPH A;  4MJX A;  2V77 A;  2RB7 A;  1S7L A;  3SXN A;  1C3O B;  4M6G A;  2HI6 A;  5J8F A;  4B10 A;  1GHE A;  3D3S A;  3CDX A;  4ONW A;  2Y1M A;  2Q44 A;  2OR4 A;  3DLJ A;  3FX6 A;  5LRJ A;  4DUK A;  3FH4 A;  4NGP A;  5HVF A;  1IIC A;  5K8O A;  3U1B A;  2ZEP A;  4JXQ A;  1JWQ A;  5F9M A;  4UIA A;  2G9D A;  1LOK A;  2P6G A;  4PSX A;  4TNU A;  1EO0 A;  3R9G A;  4JLY A;  4P44 A;  2ZOF A;  3B8G A;  3TX8 A;  1F2O A;  4H6U A;  4Q38 A;  1IOI A;  5AG6 A;  2XEF A;  4KVO E;  2DF5 A;  2FSR A;  1KZF A;  4JJX A;  1Z9E A;  1KBL A;  4Z65 A;  2J8N A;  4KOR A;  2CIJ A;  4P4B A;  2AFM A;  3QNV A;  3A9L A;  1U6M A;  1Y0R A;  2IQ6 A;  3GIU A;  3IO1 A;  3G8W A;  2PVV A;  1AUG A;  3T8W A;  1M6V B;  2C6C A;  2R98 A;  1P0H A;  3B3C A;  1Y7E A;  3I9S A;  4NEX A;  3PFO A;  1I12 A;  1WWZ A;  1RTQ A;  4XPK A;  3KR4 A;  3PBB A;  4NGN A;  4NF1 A;  3U88 C;  4CRY B;  7CPA A;  1ELL P;  2IMO A;  3IWE A;  4LX9 A;  5G20 A;  4QBJ A;  3EXN A;  3GLJ A;  2XEI A;  4KOX A;  2J9A A;  3PBE A;  1SQH A;  4E5S A;  4NJR A;  2VL1 A;  3IU2 A;  2EZC A;  1TF8 A;  1LFW A;  4NGQ A;  4UEF A;  5E96 A;  2JDD A;  3MRU A;  3SJF A;  1Y7R A;  4A30 A;  4A2Z A;  4CAV A;  3TE4 A;  4MCP A;  2FM4 A;  1VHO A;  4C2X A;  4FAI A;  1NMT A;  5H86 A;  5F09 A;  3KKW A;  2YNE A;  1NE9 A;  3P2H A;  2GU2 A;  8CPA A;  4HNW B;  4KSI A;  4CPA A;  4M6I A;  1XF8 A;  4KS9 A;  3GY9 A;  2ZEN A;  2R82 A;  4KOV A;  4LQG A;  5FD8 A;  3PT1 A;  4MRI A;  2R7H A;  2GE3 A;  4UEZ A;  3R9F A;  1JDE A;  3DSB A;  4B5P B;  3HPG G;  1YVK A;  2C6G A;  2Z11 A;  3S6K A;  4H1H A;  3KHX A;  3MGD A;  2PVW A;  4NGM A;  4P6Y A;  4QUS A;  2VKZ G;  2PDO A;  5EBV A;  4F0Y A;  5LYL A;  2XPN A;  3OWC A;  3R95 A;  3B3V A;  2E28 A;  3IWG A;  4RI1 A;  2Q51 A;  2YGW A;  3BHX A;  1DTD A;  1LAP A;  2PJ5 A;  3SJX A;  4OME A;  1M1D A;  1YW6 A;  5DWM A;  4U5Y A;  3FBU A;  1EE3 P;  4DYO A;  1Q7L A;  5JH9 A;  3WC5 A;  4C8T A;  1VGY A;  2ZW5 A;  5D29 A;  1XOV A;  1S7K A;  2NYQ A;  3RYO A;  4II9 A;  2CNS A;  3PFV A;  3FVL A;  4OP4 A;  4QVT A;  1LCP A;  2J8R A;  4MFL A;  4A33 A;  4A37 A;  4FD4 A;  2Z3P A;  1ARL A;  1L0C A;  1YR0 A;  1QSO A;  2AE6 A;  2F5I A;  2Q04 A;  2ZED A;  3F0A A;  4OLL A;  4KUA A;  1TKF A;  1ZG8 A;  3TFY A;  2CBL A;  1R43 A;  4EWT A;  5BY0 A;  1Y9K A;  4ONU A;  4EME A;  2O28 A;  2PR8 A;  5F47 A;  2G3A A;  4KOU A;  3PRT A;  3WC7 A;  4MHZ A;  3IIB A;  2AUN A;  4WWV A;  1QMU A;  1IGB A;  5F1Y A;  2H5M A;  5CNP A;  3JRU A;  4AG7 A;  1OZP A;  4ZY0 A;  4MY3 A;  4R3L A;  1JQG A;  5ISV A;  4ZX8 A;  3CZX A;  5F13 A;  4PXD A;  3BXM A;  3LD2 A;  2QYV A;  4ZGY B;  3EY5 A;  2DXQ A;  1F57 A;  2A4N A;  1B47 A;  2ZEO A;  4ZBG A;  2OH1 A;  3FIX A;  3GJZ A;  3GB0 A;  1N71 A;  4MCR A;  4XNH C;  4AVC A;  1CBX A;  3OAK A;  4COB A;  4JVO A;  2REF A;  2PJ1 A;  5BWA B;  4UCM A;  5DWN A;  4CYN A;  3PB9 X;  1BPM A;  5HVG A;  3T0T A;  4E94 A;  4R7M A;  2RFH A;  4LUA A;  3W6S A;  3SI2 A;  3BJ8 A;  3TLZ A;  4H6Z A;  3BUN B;  4B6Z A;  4C9E A;  2UV8 G;  2B4J C;  5D8N A;  2JEV A;  4MFJ A;  4XPD C;  4BPX B;  3GKR A;  4X8I A;  2XEJ A;  2C27 A;  3NH5 A;  3VRQ A;  4CDK A;  1R3N A;  4R8F A;  4CGM A;  1Q5X A;  3IEH A;  4TJV A;  2AFO A;  2ANP A;  3V7Z A;  4U9Z A;  1T36 B;  3R96 A;  1CG2 A;  3BUX B;  2PRQ A;  3EC4 A;  3D68 A;  4B13 A;  3DR6 A;  5AG7 A;  1ON0 A;  2PJ6 A;  4K30 A;  4KUB A;  4Y49 C;  4E2A A;  1M4D A;  4MJ8 A;  4QC6 A;  4B5O A;  2B5G A;  5HKZ A;  4YFJ A;  3OB2 B;  3HPH E;  2NSM A;  4NCZ A;  3B3W A;  4MBU A;  2ZEH A;  2BEI A;  4IHM A;  2EBJ A;  3SJG A;  4PPZ A;  1IYL A;  2Z3K A;  3VRO A;  3S9L A;  2WSA A;  3FRM A;  3FYN A;  3HUV A;  4NFR A;  5LYF A;  4PSW A;  2BSW A;  4P4F A;  2CTC A;  4YU9 A;  4C7H A;  4PXC A;  1VHE A;  2ZOG A;  1YVH A;  4M8D A;  1M4I A;  3FED A;  1QSR A;  5AG5 A;  2D0P A;  3FF3 A;  2FE7 A;  4MI1 A;  4NGR A;  3NA6 A;  2OLS A;  4FD5 A;  4ZY1 A;  4PQA A;  5JVL A;  3L2N A;  4PK3 A;  1XMB A;  4P45 A;  3TLB A;  2R8V A;  2QJ8 A;  1GYT A;  1HDU A;  2ZEG A;  4NXY A;  3T5M A;  3H5Z A;  5I4M A;  1QST A;  5IB9 A;  3RNZ A;  3NE7 A;  4ZYQ A;  1TIQ A;  4B11 A;  1Q2D A;  2FL4 A;  4BIN A;  3NFQ A;  4YGO A;  2D0O A;  1Z5R A;  3CT9 A;  3O8Z A;  1FNO A;  2Q7S A;  2PCN A;  4OAD A;  4A4C A;  1LAM A;  2C5Q A;  2VZY A;  1XRY A;  2RC4 A;  3D8P A;  2OZU A;  5JGF A;  2ZEE A;  3H8G A;  5LYD A;  1WVM A;  2PJ2 A;  2YND A;  3JVN A;  4MFZ A;  2Q7B A;  3SXO A;  1Z8T A;  2EWB A;  2PJ4 A;  2ZEM A;  4INJ A;  3S9N A;  4CYQ A;  1CJW A;  2OOT A;  2ZEF A;  4B5P A;  1JDB C;  2D4O A;  2I00 A;  3ZZI A;  4OC5 A;  1CM0 A;  2PJ9 A;  3KI9 A;  4R3K A;  4X5K A;  4XPL A;  4C8U A;  1Z8W A;  4RS2 A;  5F46 A;  1KC7 A;  2X0S A;  5A28 A;  2PSW A;  3BJ7 A;  2B4D B;  5AG4 A;  2GP4 A;  1I21 A;  2HV2 A;  2XPP A;  1S60 A;  2B4D A;  4KZT A;  4H89 A;  2AFX A;  5CBM A;  1YVO A;  4C9U A;  1MK4 A;  3S6G A;  1K4J A;  3N7Z A;  4J3G A;  3W6X A;  1CPS A;  1ZLI A;  3LMS A;  4UCN A;  3T05 A;  1ZO0 A;  4FD7 A;  4RR2 B;  1NBW A;  2IJZ A;  4C9A A;  1Y9W A;  3OB1 B;  2B3V A;  2Z0Z A;  3BUM B;  4CGO A;  1A9X B;  2B5G B;  2DIK A;  3TLA A;  2VBQ A;  1LAN A;  3GYA A;  4C85 A;  3NFZ A;  3FMC A;  4MHD A;  2EK8 A;  5F49 A;  4BBH A;  4A39 A;  1DE4 C;  3DNS A;  3CPA A;  4YWY A;  4AXV A;  3PFE A;  1YW4 A;  4DJL A;  1CS0 B;  1R61 A;  2DPT A;  2FIW A;  4JXR A;  4MHP A;  4C8P A;  3VRR A;  2ARH A;  3C26 A;  3JTK A;  4GM5 A;  2J8M A;  4A31 A;  2Y1N A;  5F48 A;  5IV0 A;  4KNG E;  5CPA A;  4CRZ B;  1IB1 E;  2Z3L A;  3E0K A;  1QSN A;  1F2P A;  1J4J A;  3EZB A;  2EVN A;  3H8E A;  4M3S A;  4R87 A;  3TOA A;  1WK4 A;  3H4Q A;  3PP9 A;  2OB0 A;  4C8F A;  3VWD A;  5JYB A;  2F8H A;  1UWY A;  3D7F A;  2I79 A;  1VHS A;  2QVP A;  1DIK A;  4YN3 A;  5JQ4 A;  4ZY2 A;  4ORF A;  4WJB A;  3TO7 A;  1CE8 B;  3F5B A;  5AGE A;  4JZ0 A;  2YNC A;  4X2T A;  3FEC A;  3PLF B;  5LRG A;  4DNC A;  5F5X A;  3TLC A;  4Y49 B;  3WR7 A;  4CDJ A;  1YME A;  3PB4 X;  2GFQ A;  2QEC A;  4P4D A;  2IL4 A;  3VAT A;  4KSF A;  1NSL A;  1B87 A;  1XBU A;  2CNM A;  4PV6 A;  1VI4 A;  3B7I A;  4KSA A;  3IC1 A;  4F6A A;  5G22 A;  1ZG9 A;  2BO9 A;  2DEA A;  4ZI6 A;  3K9U A;  2DPS A;  2WYR A;  2VZZ A;  3CXQ A;  3D2P A;  4KOY A;  4XPD B;  5H84 A;  3QB8 A;  3B3T A;  4OID A;  3F9K C;  4C68 A;  2JLM A;  4UFV A;  2AJ6 A;  1ZL0 A;  2CTB A;  3S9M A;  4FBE A;  5K8P A;  1X12 A;  4C9V A;  1MJ9 A;  4GS4 A;  3IWW A;  2G3T A;  2ZW6 A;  1B6B A;  5A27 A;  4PXE A;  1V0C A;  4M6H A;  4BPW B;  1VBG A;  5EMI A;  5HMN A;  2HRO A;  4KOT A;  4MCS A;  1MJA A;  4KOW A;  2PRB A;  5JM6 A;  3KAS A;  4KOS A;  3PZJ A;  2WPX A;  4MI4 A;  3NE8 A;  3WC6 A;  4B12 A;  3IU1 A;  4F9U A;  4IIY A;  5HVH A;  1XEB A;  4PXB A;  4C84 A;  1YSJ A;  3TO9 A;  1XFO A;  4Q7A A;  1AYE A;  2GAN A;  2OZH A;  2Q43 A;  3ISX A;  4F0X A;  2VEZ A;  3NH8 A;  2GLF A;  4KVM E;  1Q2Y A;  2HUZ A;  4AB7 A;  4R6T A;  1S7N A;  4NGT A;  3RBU A;  4BPU B;  1YX0 A;  1Z4E A;  2PR1 A;  4BMH A;  4CAX A;  2C1C A;  4CAE A;  4HKF A;  1RXT A;  1C30 B;  2B58 A;  2V8H A;  1EZB A;  3T90 A;  3BLN A;  3D7D A;  4CGN A;  4C9R A;  1RO5 A;  1LRZ A;  2PQ8 A;  5K8M A;  4BD9 A;  5AXI A;  4C86 A;  4IUS A;  2EZA A;  4MHY A;  2BUE A;  2GRE A;  2ZEL A;  3K2K A;  1PU9 A;  3TLG B;  2WPW A;  5EC4 A;  2PJ7 A;  1S7F A;  4U9Y A;  4M85 A;  1PYT B;  2BOA A;  2PJB A;  2FT0 A;  4UA3 A; 
#chains in the Genus database with same CATH homology
 3KR5 A;  3WAB A;  3I6S A;  3LWU A;  3I1U A;  2V8D A;  4UIB A;  2PJC A;  4K3N A;  2AFW A;  4C8A A;  3SI0 A;  1BAV A;  2PIZ A;  3KHZ A;  2JBJ A;  4P4I A;  1NSA A;  1OBR A;  3WT4 A;  4O23 A;  2PE3 A;  4MCQ A;  3CPX A;  2PJA A;  5LYI A;  2PJ0 A;  2O53 A;  3DGV A;  1Z8L A;  1XF1 A;  2AFU A;  3KL9 A;  3D67 A;  4A94 A;  4F9V A;  2WZN A;  1CPX A;  3D4U A;  1Z2L A;  5LRK A;  4P4E A;  1IY7 A;  1AMP A;  3ISZ A;  4OIW A;  4IAV A;  1CP7 A;  5J1Q A;  4NGS A;  1CX8 A;  2V8V A;  1TXR A;  3FEE A;  1VIX A;  3KZW A;  4IK2 A;  4NJQ A;  3TC8 A;  4A38 A;  1XJO A;  4OC0 A;  3ICU A;  1ELM P;  3BI1 A;  3PB6 X;  4C99 A;  3KQX A;  2PJ3 A;  3SJE A;  1ZLH A;  1V6C A;  4MMO A;  3VH9 A;  2PJ8 A;  3KGQ A;  2JBK A;  4FWU A;  3B35 A;  2FVG A;  4MHN A;  1Y0Y A;  1BLL E;  4P10 A;  2PCU A;  3PB8 X;  3K9T A;  2C6P A;  3VTA A;  2HC9 A;  2AFZ A;  1CP6 A;  4FUU A;  1HEE A;  4X3R A;  2XEG A;  2F7V A;  4OC2 A;  2PIY A;  5DS0 A;  3PEI A;  2O4H A;  2HB6 A;  3B2Y A;  1ZG7 A;  3HLP A;  1TKH A;  2I3C A;  4OKO A;  3V38 A;  4RUH A;  1HDQ A;  1ARM A;  1TKJ A;  2EK9 A;  4F8Z A;  2BCO A;  2Q4Z A;  3IJ3 A;  4G1P A;  5ELY A;  3I74 A;  1BPN A;  3SI1 A;  2CF4 A;  3GUX A;  5THW A;  3RZA A;  1Y9Z A;  4ZX9 A;  4R76 A;  1PCA A;  3BI0 A;  3RAM A;  3NH4 A;  4C8C A;  4OC1 A;  1TF9 A;  2POK A;  2GLJ A;  1KWM A;  3KQZ A;  3D7G A;  3PB7 X;  4TJX A;  5K8N A;  4MXU A;  1QQ9 A;  3D7H A;  4OC3 A;  2V8G A;  4EFD A;  5IR2 A;  4OC4 A;  3D66 A;  3H8F A;  4TWE A;  2AFS A;  4JYW A;  3MN8 A;  3IFE A;  5HXD A;  4H2K A;  3FJU A;  2JEW A;  2ABZ A;  3VAR A;  1H8L A;  4UF4 A;  3N5F A;  1YLO A;  4W9Y A;  3B3S A;  6CPA A;  4UEE A;  4P4J A;  1M4L A;  3EIF A;  1FT7 A;  2V77 A;  2RB7 A;  3CDX A;  4ONW A;  2OR4 A;  3DLJ A;  3FX6 A;  5LRJ A;  4DUK A;  3FH4 A;  4NGP A;  5HVF A;  5K8O A;  2ZEP A;  4UIA A;  2G9D A;  1LOK A;  4TNU A;  4P44 A;  2ZOF A;  3TX8 A;  1F2O A;  2XEF A;  4Z65 A;  2CIJ A;  4P4B A;  2AFM A;  3QNV A;  1Y0R A;  2IQ6 A;  3IO1 A;  2PVV A;  3T8W A;  2C6C A;  3B3C A;  1Y7E A;  3PFO A;  1RTQ A;  3KR4 A;  3PBB A;  4NGN A;  7CPA A;  1ELL P;  2IMO A;  3GLJ A;  2XEI A;  2J9A A;  3PBE A;  4NJR A;  2VL1 A;  1TF8 A;  1LFW A;  4NGQ A;  4UEF A;  3MRU A;  3SJF A;  4MCP A;  1VHO A;  4FAI A;  5F09 A;  2GU2 A;  8CPA A;  4KSI A;  4CPA A;  2ZEN A;  4LQG A;  4MRI A;  4UEZ A;  2C6G A;  3KHX A;  2PVW A;  4NGM A;  4P6Y A;  5LYL A;  3B3V A;  2Q51 A;  3BHX A;  1DTD A;  1LAP A;  2PJ5 A;  3SJX A;  4OME A;  1YW6 A;  4DYO A;  5JH9 A;  1EE3 P;  1Q7L A;  3WC5 A;  4C8T A;  1VGY A;  5D29 A;  2NYQ A;  3FVL A;  4OP4 A;  1LCP A;  4A37 A;  1ARL A;  2ZED A;  1TKF A;  1ZG8 A;  1R43 A;  4EWT A;  4EME A;  3PRT A;  3WC7 A;  4MHZ A;  3IIB A;  4WWV A;  1QMU A;  1IGB A;  3JRU A;  4ZY0 A;  1JQG A;  4ZX8 A;  4PXD A;  3BXM A;  2QYV A;  1F57 A;  2ZEO A;  3GB0 A;  4MCR A;  1CBX A;  2PJ1 A;  3PB9 X;  1BPM A;  5HVG A;  4R7M A;  2RFH A;  3SI2 A;  4B6Z A;  4C9E A;  5D8N A;  4X8I A;  2XEJ A;  3NH5 A;  4CDK A;  1R3N A;  4R8F A;  4TJV A;  3IEH A;  2AFO A;  2ANP A;  3V7Z A;  1CG2 A;  2PRQ A;  3D68 A;  2PJ6 A;  2NSM A;  3B3W A;  2ZEH A;  4IHM A;  3SJG A;  4PPZ A;  3HUV A;  3S9L A;  5LYF A;  4NFR A;  2CTC A;  4P4F A;  4YU9 A;  4PXC A;  1VHE A;  2ZOG A;  3FED A;  3FF3 A;  4NGR A;  3NA6 A;  4ZY1 A;  4PQA A;  3L2N A;  1XMB A;  4P45 A;  2QJ8 A;  1GYT A;  1HDU A;  2ZEG A;  5I4M A;  5IB9 A;  4ZYQ A;  1Z5R A;  3CT9 A;  1FNO A;  2C5Q A;  1LAM A;  1XRY A;  5JGF A;  1WVM A;  2ZEE A;  3H8G A;  5LYD A;  2PJ2 A;  2PJ4 A;  2EWB A;  2ZEM A;  3S9N A;  2OOT A;  2ZEF A;  4OC5 A;  2PJ9 A;  3KI9 A;  4C9U A;  4C8U A;  2GP4 A;  2AFX A;  5CBM A;  1CPS A;  1ZLI A;  3LMS A;  4C9A A;  2IJZ A;  1LAN A;  4C85 A;  3NFZ A;  3FMC A;  2EK8 A;  4A39 A;  1DE4 C;  4YWY A;  3CPA A;  4DJL A;  4AXV A;  3PFE A;  1YW4 A;  4MHP A;  4C8P A;  4GM5 A;  4KNG E;  5CPA A;  1F2P A;  3H8E A;  4C8F A;  2F8H A;  1UWY A;  3D7F A;  2QVP A;  4YN3 A;  4ZY2 A;  4WJB A;  4JZ0 A;  4X2T A;  3FEC A;  5LRG A;  4CDJ A;  1YME A;  3PB4 X;  4P4D A;  3VAT A;  1XBU A;  3B7I A;  3IC1 A;  1ZG9 A;  2BO9 A;  2DEA A;  4ZI6 A;  2WYR A;  3B3T A;  4OID A;  2CTB A;  3S9M A;  4FBE A;  5K8P A;  4C9V A;  3IWW A;  4PXE A;  4MCS A;  5JM6 A;  3KAS A;  3WC6 A;  4F9U A;  5HVH A;  4PXB A;  4C84 A;  1YSJ A;  1XFO A;  4Q7A A;  1AYE A;  2Q43 A;  3ISX A;  3NH8 A;  2GLF A;  4R6T A;  4NGT A;  3RBU A;  2C1C A;  2V8H A;  4C9R A;  3D7D A;  5K8M A;  4C86 A;  4BD9 A;  4MHY A;  2GRE A;  2ZEL A;  3K2K A;  2PJ7 A;  1PYT B;  2BOA A;  2PJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...