4OC0A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with ccibzl, a urea-based inhibitor n~2~-[(1-carboxycyclopropyl)carbamoyl]-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc0A02
1JQGA 1R3NA 1YSJA 3PRTA 4ZX8A 3CT9A 1AMPA 2BOAA 2ZEDA 3KR4A 1YW6A 2DEAA 4AXVA 4UIAA 4OC1A 4P4JA 1ZLHA 3SJEA 3KL9A 2PJ7A 3V7ZA 3WT4A 2EWBA 4C9RA 2PIYA 3HLPA 4PXDA 2ZEGA 3NA6A 4FWUA 1CX8A 2QVPA 2JEWA 4DYOA 5HVGA 4PXCA 1BPNA 1WVMA 1DTDA 1VGYA 4FUUA 2V77A 4CDKA 1AYEA 4ZY2A 3B3SA 4NGTA 1TKFA 2VL1A 4R6TA 4OC4A 2GREA 3QNVA 2J9AA 3S9LA 4P44A 3D4UA 3ISXA 3RBUA 2C6CA 2ZEHA 2PE3A 3B3WA 3BI1A 1KWMA 1CPXA 2V8VA 4DJLA 4C84A 2FVGA 5JM6A 4C8UA 2EK8A 3B3CA 2PJCA 4MMOA 5IB9A 1BPMA 5LYFA 1ELMP 1LANA 4P10A 1Y0RA 1Z8LA 4P4EA 3N5FA 2XEFA 3IEHA 4C8AA 3ICUA 1FT7A 3VH9A 2GLJA 3D66A 2AFMA 3PB7X 1ELLP 1UWYA 4R76A 3PB4X 4R7MA 5CPAA 3PEIA 2AFWA 4PQAA 4WWVA 3FMCA 2POKA 3PFEA 4P6YA 4EWTA 1LAPA 4P4BA 3IFEA 3KQZA 2PRQA 2C1CA 3VATA 2WZNA 5K8PA 4MHYA 2ZEFA 4P4FA 2Q43A 1ZG9A 2PJ5A 2WYRA 4PXEA 1ARMA 2XEJA 2AFZA 4TNUA 1R43A 4NGNA 2NYQA 4OP4A 1CPSA 4A39A 1XJOA 3CPXA 3SI2A 3LMSA 4YN3A 2ZEPA 1PYTB 5J1QA 5HVHA 4OIWA 3I1UA 4G1PA 4OC2A 2PJAA 3KASA 1BAVA 5I4MA 4IHMA 3V38A 4TWEA 3B3TA 1YMEA 1HEEA 1CP6A 1LOKA 1TKJA 2PJ6A 4EMEA 4R8FA 3D7FA 1XMBA 3D7HA 4O23A 3NH5A 2PJ0A 5LRKA 3PB8X 1Y7EA 2Q4ZA 1TF9A 3K2KA 5DS0A 1F2OA 2PJ9A 5HVFA 4MHPA 3K9TA 4MCPA 3PB9X 4OMEA 1OBRA 4NGSA 5LRJA 1ZG8A 1QQ9A 1F57A 2AFXA 2ZENA 2EK9A 2OR4A 5D29A 4BD9A 1HDQA 3DGVA 2IQ6A 4P45A 1DE4C 1ARLA 3IC1A 1Y9ZA 3JRUA 2JBJA 2AFOA 2GU2A 4C8TA 2O4HA 2F7VA 5HXDA 2G9DA 2JBKA 4TJXA 5LYLA 4MXUA 4ONWA 4OC3A 2IMOA 3BI0A 4Z65A 3FEDA 4C86A 2AFUA 3WABA 1M4LA 3SI1A 3CPAA 1BLLE 4P4IA 4NGQA 5LRGA 2OOTA 4KNGE 2PIZA 4ZY1A 4ZI6A 1Z2LA 4EFDA 2C6PA 3GUXA 4NGPA 3CDXA 1Y0YA 3BHXA 4MRIA 4NGMA 2V8GA 3RZAA 1RTQA 3NFZA 3FF3A 3FX6A 4KSIA 3PB6X 3SJXA 4NJRA 1ZLIA 4OC5A 4GM5A 5JGFA 4UF4A 1XRYA 4NGRA 3S9MA 3ISZA 1XFOA 5K8MA 3MRUA 2ZEEA 4Q7AA 4IK2A 5F09A 4IAVA 3LWUA 5K8NA 2ANPA 1V6CA 4C99A 3WC5A 4MCSA 2QYVA 4MHNA 3TC8A 4UEEA 3SI0A 1PCAA 3IJ3A 2XEIA 1GYTA 3FECA 1LAMA 4JYWA 2CTBA 5THWA 1Z5RA 3S9NA 5LYIA 3B3VA 3TX8A 3PBBA 4FAIA 2ABZA 1ZG7A 1EE3P 4ZY0A 2O53A 2PJ4A 3WC7A 1H8LA 2HC9A 4ZYQA 1YLOA 2QJ8A 4FBEA 5JH9A 3FJUA 3L2NA 3RAMA 1VHOA 4CPAA 3IIBA 4X2TA 3SJFA 4C8FA 3FEEA 2Q51A 3KHXA 2ZELA 4W9YA 3GLJA 1XF1A 4K3NA 4P4DA 3MN8A 4ZX9A 2PJ3A 2PCUA 2RFHA 3I6SA 4H2KA 3D7GA 1CBXA 4MCQA 4F8ZA 2GLFA 1HDUA 1YW4A 4JZ0A 2PJ2A 3NH4A 4X3RA 4X8IA 5ELYA 1VIXA 3PBEA 4UIBA 4OC0A 3VARA 3FH4A 7CPAA 1TXRA 4F9UA 4C8PA 4C8CA 5CBMA 1Q7LA 4YU9A 4PXBA 2PVVA 4OIDA 4F9VA 1FNOA 2V8HA 3WC6A 3BXMA 3KR5A 2I3CA 4MCRA 1F2PA 5LYDA 4YWYA 3IWWA 1CP7A 4A94A 4CDJA 1NSAA 5K8OA 3KI9A 2XEGA 2PJ8A 2BCOA 3D7DA 3T8WA 2CTCA 4B6ZA 6CPAA 4UEFA 5D8NA 2CF4A 2C6GA 2CIJA 4C9VA 4RUHA 2ZOFA 3NH8A 4NFRA 4LQGA 3KGQA 1XBUA 3HUVA 1IGBA 3GB0A 4UEZA 3SJGA 8CPAA 1CG2A 3D68A 4C9UA 4MHZA 2PJ1A 1TF8A 4A38A 4C9EA 1LCPA 2ZEMA 4WJBA 3H8EA 2PJBA 2ZEOA 3D67A 3KQXA 1IY7A 4NJQA 1VHEA 3FVLA 2AFSA 2V8DA 3B2YA 4C85A 2IJZA 1QMUA 2PVWA 3VTAA 4OKOA 3DLJA 3IO1A 4PPZA 4DUKA 4TJVA 1LFWA 2ZOGA 3B35A 3B7IA 2NSMA 2BO9A 3KZWA 3I74A 3PFOA 3KHZA 2RB7A 4C9AA 3H8GA 3H8FA 3EIFA 4A37A 2F8HA 2HB6A 1TKHA
chains in the Genus database with same CATH superfamily
1JQGA 1R3NA 3IU1A 1YSJA 3PRTA 4ZX8A 3CT9A 3C8OA 1MJAA 1AMPA 1IIDA 2BOAA 2KCWA 2ZEDA 3RYOA 4NEXA 4INJA 4B11A 4M6GA 4MHDA 1P4NA 3KR4A 1YW6A 2DEAA 5G21A 4AXVA 4UIAA 4OC1A 3BJ8A 3JTKA 4P4JA 1ZLHA 3E0KA 3SJEA 3GKRA 2OZHA 3JUWA 3KL9A 4HPSA 2PJ7A 4M6HA 4CYPA 3V7ZA 4Y49B 2R7HA 4Y49C 3WT4A 2EWBA 4CGPA 3VRQA 4DNCA 4C9RA 3IGRA 2PIYA 5JQ4A 5JYBA 2XPLA 3F9KC 3HLPA 2DPTA 3TT2A 4PXDA 4MFPA 5KTDA 4CAFA 2WPWA 2ZEGA 3NA6A 4FWUA 4GS4A 4LX9A 1NSLA 4COBA 3VWDA 1SQHA 1CX8A 2QVPA 2JEWA 4KOTA 4DYOA 2WUUA 5HVGA 3OAKA 2CXAA 4PXCA 1BPNA 4A4BA 2G0BA 1DTDA 2ZW5A 2REEA 4CYOA 1WVMA 3KKWA 2CBLA 1VGYA 4FUUA 5A27A 5AG4A 2V77A 1M6VB 3PP9A 4ZGYB 1IOIA 1PUAA 1XIXA 2J8RA 4CDKA 1T36B 1AYEA 2GFQA 4FD6A 4ZY2A 1YX0A 3EZAA 3B3SA 4NGTA 1TKFA 2HQYA 3KRVA 2UV8G 1U6MA 2VL1A 2Z3MA 4KVME 4OC4A 4R6TA 2DXQA 4CAWA 5F46A 4KVOE 2GREA 4A4CA 4CAXA 3QNVA 1MJ9A 2J9AA 4E0AA 3S9LA 4P44A 4B12A 4A95A 4KOXA 3D4UA 3ISXA 5F9MA 3RBUA 3FYNA 2C6CA 4E5SA 2ZEHA 3D2MA 2PE3A 4GPLB 1KEEB 1C30B 3B3WA 3BI1A 3TCVA 1KWMA 1CPXA 2V8VA 4DJLA 4IIXA 4C84A 2FVGA 2Z3OA 2HROA 5JM6A 3H4QA 4C8UA 2EK8A 4QB9A 3B3CA 2Z3PA 2PJCA 3RO0A 1QSOA 4R3KA 4MMOA 4XPDC 4XPDB 5IB0A 2JEVA 5IB9A 1BPMA 2J8MA 5LYFA 4BTFA 1IYKA 1A9XB 5F13A 3VRRA 4BPWB 1ELMP 4M3SA 1LANA 4M85A 4CAVA 4P10A 3TFYA 4AG7A 4I49A 3VRPA 1Y7RA 4UFWA 1Y0RA 1R57A 5FVJA 1Z8LA 1YLEA 4P4EA 1QSRA 3N5FA 3R9GA 2XEFA 3IEHA 3R95A 3W91A 4C8AA 2DF5A 3OWCA 3D3SA 2BL1A 3ICUA 4JWPA 1FT7A 4K30A 2CNSA 2GLJA 3VH9A 4B5OA 5HMNA 1QSTA 1MK4A 3D66A 2B4DB 3NFQA 2AFMA 3PB7X 3SXOA 1ELLP 1UWYA 1IU8A 3DR6A 3P2FA 3VRNA 3PB4X 3BLNA 4R76A 4R7MA 5CPAA 4R3LA 3FXTA 3PEIA 4CYNA 4UWIA 2B3VA 3FBUA 3QAYA 2AFWA 4KUBA 2BUEA 4PQAA 4WWVA 5H84A 2EO8A 4ONUA 3FMCA 2AUNA 2POKA 3PFEA 4P6YA 1YR0A 5DWMA 1LAPA 4EWTA 4P4BA 2Y1NA 3IFEA 3T07A 3KQZA 3O8ZA 3EZEA 1NMTA 2PRQA 1J4JA 2C1CA 1R61A 3VATA 5C82A 1N71A 2WZNA 3S6FA 5K8PA 1C3OB 3GY9A 4MHYA 2ZEFA 4P4FA 5H86A 2Q43A 4A31A 1ZG9A 1PU9A 2PJ5A 4IF5A 2WYRA 4B13A 4PXEA 4CGOA 1ARMA 2XEJA 2Q4VA 2AFZA 4TNUA 1R43A 4NGNA 3OB1B 2NYQA 4OP4A 1CPSA 4U9YA 4A39A 1NE9A 1XJOA 3CPXA 3LMSA 3SI2A 3FNCA 4NCZA 4YN3A 5AGEA 2ZEPA 3TLGB 1IYLA 4MI4A 2HV2A 3T90A 2P6GA 3TOAA 1Z8TA 1Z9UA 1PYTB 3HPHE 3NE7A 4YGOA 2D0PA 1MJBA 5F47A 5J1QA 2Z3LA 4BPUB 5HVHA 4OIWA 3I1UA 3IWGA 4OC2A 1RO5A 2PJAA 4G1PA 5AG7A 4R87A 5F1YA 3KASA 1BAVA 3U88C 1VBHA 1AUGA 4UWJA 2C5QA 5I4MA 4IHMA 3BJ7A 2G3TA 3V38A 4TWEA 4KLVA 2HI6A 3VGOA 3B3TA 1YMEA 1HEEA 4QUSA 4E8OA 1CP6A 1LOKA 1TKJA 4EVYA 3G8WA 2EUIA 2PJ6A 1M1DA 4EMEA 2P6FA 4R8FA 2ATRA 3D7FA 4KLWA 3A9LA 4BMHA 2VI7A 2GE3A 1B6BA 3D2PA 2R98A 4U5YA 5I0CA 2OZUA 2R8VA 1XMBA 1S7FA 2I00A 3D7HA 3K9UA 4O23A 2BSWA 2FS5A 2PJ0A 3NH5A 3PB8X 3IU2A 1Y7EA 2D4OA 2Q4ZA 4C2XA 5LRKA 1CJWA 1TF9A 2D4PA 2QIRA 3K2KA 5DS0A 4UCPA 3ZNIA 4HNYB 2B0AA 2VEZA 1F2OA 2PJ9A 5HVFA 2D0OA 1KC7A 2OU2A 1QSNA 4MHPA 3K9TA 4JLYA 2Y1MA 5HKYA 4MCPA 3DSBA 5EBVA 1V0CA 3PB9X 2VZYA 3R1KA 4NF1A 4OMEA 1OBRA 1RXTA 4NGSA 1XF8A 4KOUA 5LRJA 3TO7A 2B4DA 4L89A 5JVLA 1S7KA 2PR1A 1CM0A 1ZG8A 3QB8A 4XNHC 4CRYB 1QQ9A 1F57A 2AFXA 2QECA 2ZENA 2EK9A 3UY5A 2VQYA 3EO4A 2GANA 2WSAA 2OR4A 1VI4A 5D29A 2H5MA 3CZXA 4BD9A 1HDQA 2PC1A 4XPLA 2AE6A 1WJTA 5J3XA 4MFJA 2XPPA 1WK4A 3DGVA 2IQ6A 1DE4C 4P45A 1ARLA 4BPXB 2REFA 3IC1A 3TE4A 3CXSA 2FE7A 2JBJA 3HMJG 2AFOA 2GU2A 3JRUA 1Y9ZA 2O4HA 4C8TA 4EYSA 2F7VA 1M4GA 1P0HA 5HXDA 4KOWA 1KZFA 4A33A 2R82A 2G9DA 4JVOA 5GCNA 2P0WA 2JBKA 2EZCA 5LYLA 4TJXA 4MXUA 2YNEA 4HKFA 4LUAA 3WR7A 4ONWA 4OC3A 2IMOA 2YNCA 4A32A 3BI0A 5ISVA 4Z65A 3FEDA 4C86A 2AFUA 3WABA 4J3GA 4AVCA 4F0XA 6CPAA 1M44A 1M4LA 3SI1A 2JLMA 1EZAA 3CPAA 2B4BA 2QMLA 4MI1A 1EO0A 4NSQA 1BLLE 3TLBA 3LD2A 3TLZA 4P4IA 4NGQA 2B58A 5LRGA 1Y9WA 2OOTA 2Q4YA 2PIZA 3LACA 3T9YA 1YVOA 1L0CA 3F8KA 4ZY1A 4H1HA 4ZI6A 4PK2A 1Z2LA 4EFDA 3TLEA 3TLGA 2C6PA 2F5IA 3S6KA 1Q2CA 4JXQA 3GUXA 4JXRA 1S3ZA 2VZZA 4L8AA 4J0NA 1YK3A 4NGPA 3GIUA 3CDXA 2K5TA 1Y0YA 1Z8XA 3BHXA 4MRIA 4UCMA 5CNPA 4NGMA 3F0AA 3T0TA 5KTAA 2VKZG 4AVAA 2V8GA 3RZAA 1RTQA 4CYQA 4HNWB 3NFZA 3FF3A 3FX6A 4KSIA 4M8DA 4E94A 1FY7A 4KOSA 3PB6X 3W6XA 2XPNA 3SJXA 3EY5A 1S5KA 4NJRA 1ZLIA 3HPGG 4OC5A 4GM5A 5J8CA 5JGFA 4UF4A 1XRYA 4NGRA 3TTHA 3S9MA 2N3AB 2WPXA 3ISZA 3T05A 1XFOA 5K8MA 3MRUA 2ZEEA 4Q7AA 1BO4A 4IK2A 5AG5A 3F5BA 5F09A 4IAVA 2FIAA 3LWUA 5K8NA 3DDDA 2ANPA 4AVBA 1V6CA 2FT0A 3H5ZA 1IB1E 4KOYA 3WC5A 1UFHA 5BWAB 1Q5XA 5IR2A 1Z4EA 4C99A 3DNSA 4MCSA 3PT1A 2P6EA 2QYVA 5C88A 2YNDA 2Q04A 4MHNA 4OAEA 3BUNB 3TC8A 4Q38A 4UEEA 3SI0A 4C7IA 2AUMA 3V8IA 1NBWA 1PCAA 3I6SA 4MY0A 5HKZA 4YRHA 1S7NA 3IJ3A 2XEIA 1GYTA 2YJVA 3FECA 1LAMA 4JYWA 2B4JC 2CTBA 2G3AA 5EC4A 5THWA 4C68A 1JDEA 1Z5RA 3S9NA 5LYIA 3B3VA 3TX8A 1Q2YA 2E28A 3PBBA 1YVHA 3GYAA 4FAIA 2YGWA 4HNXB 2ABZA 2HWGA 1ZG7A 2Z10A 1EE3P 1B87A 2B5GB 2ODFA 3U1BA 2FL4A 4ZY0A 2O53A 3R9FA 3SR3A 1GGOA 1B47A 5F5XA 2PJ4A 4Q36A 2CY2A 2J8NA 4QBJA 4KNGE 1YVKA 5F49A 1YQEA 3WC7A 1H8LA 1Z4RA 1IOFA 3W6SA 1X12A 2HC9A 4H6UA 4ZYQA 4E2AA 1YLOA 2Q0YA 2QJ8A 1JDBC 2Q7SA 3I9SA 4OLLA 4FBEA 5JH9A 3EC4A 3FJUA 3TLAA 3L2NA 3RAMA 3PGPA 1VHOA 4XPKA 3IIBA 4CPAA 2ZPAA 4H89A 4X2TA 3SJFA 4C8FA 1S60A 2NMTA 4MFQA 3FEEA 1I1DA 2Q51A 2VBQA 2DLAA 2ZELA 3KHXA 3S6HA 3TO6A 4W9YA 4OADA 4KVXA 4A30A 1XMTA 4CAEA 2EZBA 3TLYA 4CZ1A 4R9MA 4C2ZA 1IICA 3TO9A 3GLJA 3D8PA 1XF1A 4F6AA 1ON0A 1ZRSA 1K4JA 4M6IA 4K3NA 4P4DA 1WWZA 3MN8A 1XEBA 4MFKA 4ZX9A 3SHPA 2EZAA 2PJ3A 4UBRA 4B5PB 3OP0A 5EMIA 2FSRA 2PCUA 5KTCA 2RFHA 5DWNA 4H2KA 4KS9A 4PK3A 4AB7A 3PLFB 4AG9A 2OB0A 1S7LA 4IUSA 3D7GA 1CBXA 4MCQA 1TIQA 1Z8WA 4RR2B 1Y9KA 2GLFA 4FD5A 3SXNA 4F8ZA 1EZBA 3K4IA 1HDUA 1Q2DA 4XNHB 1XE4A 1YW4A 4JZ0A 1M4DA 1OZPA 2PJ2A 3NH4A 4MBUA 5HH1A 4X3RA 2YJTA 1BOBA 3RNZA 2OLSA 4X8IA 1ZO0A 2MP0A 1GHEA 5A28A 5ELYA 2EBJA 2ZW6A 5JPHA 4MFZA 1ZL0A 1X10A 4R57A 1VIXA 3EXNA 3PBEA 3PFVA 4MY3A 4II9A 4UIBA 4OC0A 3G3SA 3VARA 2PRBA 3FH4A 1KUXA 3DR8A 3TLCA 2HUZA 7CPAA 4MJ8A 1M4IA 1TXRA 4F9UA 4ZBGA 4C8PA 4C8CA 2B3UA 2BEIA 3N7ZA 5CBMA 1Q7LA 4YU9A 5AXIA 4PXBA 3BUOB 1Z9EA 2PVVA 4OIDA 3R9EA 4F9VA 1FNOA 2EVNA 2V8HA 4UFVA 3WC6A 1KUVA 3BXMA 3KR5A 4PSXA 2I3CA 4UFXA 1KBLA 4MCRA 5BY0A 3JVNA 4QC6A 1CE8B 1JWQA 3S6GA 3T5MA 2PR8A 4RI1A 4H6ZA 1F2PA 3BUMB 3VROA 5LYDA 4RN7A 2Q7BA 4YWYA 2PSWA 3IWWA 3LODA 5G1ZA 4CGNA 4NXYA 2FXFA 2PCNA 3VWEA 1CS0B 2ZW7A 2DIKA 4PV6A 4FD4A 4C9AA 4C7HA 5IX3A 4RS2A 1CP7A 2FCKA 2R1IA 4A94A 3NOJA 2B5GA 2FIWA 4CDJA 1NSAA 4KSFA 3G23A 5K8OA 5IV0A 4JJXA 3KI9A 4B14A 2A4NA 2XEGA 4YFJA 4CGMA 3CXPA 2Z0ZA 3BUWB 2PJ8A 4KUAA 2BCOA 2O28A 3D7DA 2AJ6A 1DIKA 2Q44A 1A2ZA 5E96A 2ZXVA 2CTCA 3T8WA 1VHSA 4B6ZA 3B8GA 4BINA 2I79A 4UEFA 5D8NA 2CF4A 1BXRB 4IIYA 2C6GA 2IL4A 2CIJA 5HKWA 3GJZA 4C9VA 4RUHA 2ZOFA 2C27A 2JDDA 3NH8A 4NFRA 4MJXA 4CO9A 4LQGA 1YREA 3KGQA 4C2YA 2RC4A 2X7BA 2XPOA 4COGA 3R96A 3MGDA 1XBUA 2X0SA 2Y0MA 3HUVA 3FRMA 3I3GA 3ZJ0A 1IGBA 2Z11A 1VKCA 3GB0A 3BUXB 1XOVA 4ORFA 2VXKA 3NE8A 3IWEA 4MFLA 4UA3A 4U9ZA 4UEZA 3SJGA 4BBHA 8CPAA 5K99A 1CG2A 2CNMA 3D68A 4B10A 2PDOA 4CGLA 1J3LA 4C9UA 4MHZA 2PJ1A 1TF8A 4KORA 4A38A 2DPSA 4C9EA 5FD8A 1LCPA 2ARHA 2ZEMA 4WJBA 4GXHA 3H8EA 3FB3A 2PJBA 2ZEOA 3D67A 4B5PA 3KQXA 4PSWA 1IY7A 1YGHA 4NJQA 5G20A 3PZJA 4LQ6A 4JD6A 1VHEA 2CNTA 3FVLA 2AFSA 2V8DA 3FIXA 4F0YA 3OB2B 1I21A 3B2YA 5F48A 4C85A 4CRZB 2JDCA 3C26A 5G22A 1NXJA 2IJZA 1QMUA 2PQ8A 1KUYA 2PVWA 2YNCC 4CS0B 2GP4A 5J8FA 2OH1A 3VTAA 4OKOA 3DLJA 3IO1A 3P2HA 4PPZA 1LRZA 4DUKA 4TJVA 1LFWA 2ZW4A 2Z3KA 3CXQA 2ZOGA 3B35A 3B7IA 2NSMA 2BO9A 1FBVA 3EFAA 1QSMA 3KZWA 4KZTA 4X5KA 4FD7A 3I74A 3PFOA 3TOBA 3EZBA 4KOVA 4KSAA 5AG6A 3KHZA 2FM4A 2RB7A 4A2ZA 1VBGA 1I12A 2GIVA 2Z3NA 3H8GA 3H8FA 4UCNA 1ZYMA 3EIFA 4A37A 3TYXA 2OZGA 2F8HA 4QVTA 2HB6A 3ZZIA 3QAHA 1TKHA
chains in the Genus database with same CATH topology
1JQGA 1R3NA 1YSJA 3PRTA 4ZX8A 3CT9A 1AMPA 2BOAA 2ZEDA 3KR4A 1YW6A 2DEAA 4AXVA 4UIAA 4OC1A 4P4JA 1ZLHA 3SJEA 3KL9A 2PJ7A 3V7ZA 3WT4A 2EWBA 4C9RA 2PIYA 3HLPA 4PXDA 2ZEGA 3NA6A 4FWUA 1CX8A 2QVPA 2JEWA 4DYOA 5HVGA 4PXCA 1BPNA 1WVMA 1DTDA 1VGYA 4FUUA 2V77A 4CDKA 1AYEA 4ZY2A 3B3SA 4NGTA 1TKFA 2VL1A 4R6TA 4OC4A 2GREA 3QNVA 2J9AA 3S9LA 4P44A 3D4UA 3ISXA 3RBUA 2C6CA 2ZEHA 2PE3A 3B3WA 3BI1A 1KWMA 1CPXA 2V8VA 4DJLA 4C84A 2FVGA 5JM6A 4C8UA 2EK8A 3B3CA 2PJCA 4MMOA 5IB9A 1BPMA 5LYFA 1ELMP 1LANA 4P10A 1Y0RA 1Z8LA 4P4EA 3N5FA 2XEFA 3IEHA 4C8AA 3ICUA 1FT7A 3VH9A 2GLJA 3D66A 2AFMA 3PB7X 1ELLP 1UWYA 4R76A 3PB4X 4R7MA 5CPAA 3PEIA 2AFWA 4PQAA 4WWVA 3FMCA 2POKA 3PFEA 4P6YA 4EWTA 1LAPA 4P4BA 3IFEA 3KQZA 2PRQA 2C1CA 3VATA 2WZNA 5K8PA 4MHYA 2ZEFA 4P4FA 2Q43A 1ZG9A 2PJ5A 2WYRA 4PXEA 1ARMA 2XEJA 2AFZA 4TNUA 1R43A 4NGNA 2NYQA 4OP4A 1CPSA 4A39A 1XJOA 3CPXA 3SI2A 3LMSA 4YN3A 2ZEPA 1PYTB 5J1QA 5HVHA 4OIWA 3I1UA 4G1PA 4OC2A 2PJAA 3KASA 1BAVA 2C5QA 5I4MA 4IHMA 3V38A 4TWEA 3B3TA 1YMEA 1HEEA 1CP6A 1LOKA 1TKJA 2PJ6A 4EMEA 4R8FA 3D7FA 1XMBA 3D7HA 4O23A 3NH5A 2PJ0A 5LRKA 3PB8X 1Y7EA 2Q4ZA 1TF9A 3K2KA 5DS0A 1F2OA 2PJ9A 5HVFA 4MHPA 3K9TA 4MCPA 3PB9X 4OMEA 1OBRA 4NGSA 5LRJA 1ZG8A 1QQ9A 1F57A 2AFXA 2ZENA 2EK9A 2OR4A 5D29A 4BD9A 1HDQA 3DGVA 2IQ6A 4P45A 1DE4C 1ARLA 3IC1A 1Y9ZA 3JRUA 2JBJA 2AFOA 2GU2A 4C8TA 2O4HA 2F7VA 5HXDA 2G9DA 2JBKA 4TJXA 5LYLA 4MXUA 4ONWA 4OC3A 2IMOA 3BI0A 4Z65A 3FEDA 4C86A 2AFUA 3WABA 1M4LA 3SI1A 3CPAA 1BLLE 4P4IA 4NGQA 5LRGA 2OOTA 4KNGE 2PIZA 4ZY1A 4ZI6A 1Z2LA 4EFDA 2C6PA 3GUXA 4NGPA 3CDXA 1Y0YA 3BHXA 4MRIA 4NGMA 2V8GA 3RZAA 1RTQA 3NFZA 3FF3A 3FX6A 4KSIA 3PB6X 3SJXA 4NJRA 1ZLIA 4OC5A 4GM5A 5JGFA 4UF4A 1XRYA 4NGRA 3S9MA 3ISZA 1XFOA 5K8MA 3MRUA 2ZEEA 4Q7AA 4IK2A 5F09A 4IAVA 3LWUA 5K8NA 2ANPA 1V6CA 4C99A 3WC5A 5IR2A 4MCSA 2QYVA 4MHNA 3TC8A 4UEEA 3SI0A 1PCAA 3IJ3A 2XEIA 1GYTA 3FECA 1LAMA 4JYWA 2CTBA 5THWA 1Z5RA 3S9NA 5LYIA 3B3VA 3TX8A 3PBBA 4FAIA 2ABZA 1ZG7A 1EE3P 4ZY0A 2O53A 2PJ4A 3WC7A 1H8LA 2HC9A 4ZYQA 1YLOA 2QJ8A 4FBEA 5JH9A 3FJUA 3L2NA 3RAMA 1VHOA 4CPAA 3IIBA 4X2TA 3SJFA 4C8FA 3FEEA 2Q51A 3KHXA 2ZELA 4W9YA 3GLJA 1XF1A 4K3NA 4P4DA 3MN8A 4ZX9A 2PJ3A 2PCUA 2RFHA 3I6SA 4H2KA 3D7GA 1CBXA 4MCQA 4F8ZA 2GLFA 1HDUA 1YW4A 4JZ0A 2PJ2A 3NH4A 4X3RA 4X8IA 5ELYA 1VIXA 3PBEA 4UIBA 4OC0A 3VARA 3FH4A 7CPAA 1TXRA 4F9UA 4C8PA 4C8CA 5CBMA 1Q7LA 4YU9A 4PXBA 2PVVA 4OIDA 4F9VA 1FNOA 2V8HA 3WC6A 3BXMA 3KR5A 2I3CA 4MCRA 1F2PA 5LYDA 4YWYA 3IWWA 1CP7A 4A94A 4CDJA 1NSAA 5K8OA 3KI9A 2XEGA 2PJ8A 2BCOA 3D7DA 3T8WA 2CTCA 4B6ZA 6CPAA 4UEFA 5D8NA 2CF4A 2C6GA 2CIJA 4C9VA 4RUHA 2ZOFA 3NH8A 4NFRA 4LQGA 3KGQA 1XBUA 3HUVA 1IGBA 3GB0A 4UEZA 3SJGA 8CPAA 1CG2A 3D68A 4C9UA 4MHZA 2PJ1A 1TF8A 4A38A 4C9EA 1LCPA 2ZEMA 4WJBA 3H8EA 2PJBA 2ZEOA 3D67A 3KQXA 1IY7A 4NJQA 1VHEA 3FVLA 2AFSA 2V8DA 3B2YA 4C85A 2IJZA 1QMUA 2GP4A 2PVWA 3VTAA 4OKOA 3DLJA 3IO1A 4PPZA 4DUKA 4TJVA 1LFWA 2ZOGA 3B35A 3B7IA 2NSMA 2BO9A 3KZWA 3I74A 3PFOA 3KHZA 2RB7A 4C9AA 3H8GA 3H8FA 3EIFA 4A37A 2F8HA 2HB6A 1TKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQG A;  1R3N A;  1YSJ A;  3PRT A;  4ZX8 A;  3CT9 A;  1AMP A;  2BOA A;  2ZED A;  3KR4 A;  1YW6 A;  2DEA A;  4AXV A;  4UIA A;  4OC1 A;  4P4J A;  1ZLH A;  3SJE A;  3KL9 A;  2PJ7 A;  3V7Z A;  3WT4 A;  2EWB A;  4C9R A;  2PIY A;  3HLP A;  4PXD A;  2ZEG A;  3NA6 A;  4FWU A;  1CX8 A;  2QVP A;  2JEW A;  4DYO A;  5HVG A;  4PXC A;  1BPN A;  1WVM A;  1DTD A;  1VGY A;  4FUU A;  2V77 A;  4CDK A;  1AYE A;  4ZY2 A;  3B3S A;  4NGT A;  1TKF A;  2VL1 A;  4R6T A;  4OC4 A;  2GRE A;  3QNV A;  2J9A A;  3S9L A;  4P44 A;  3D4U A;  3ISX A;  3RBU A;  2C6C A;  2ZEH A;  2PE3 A;  3B3W A;  3BI1 A;  1KWM A;  1CPX A;  2V8V A;  4DJL A;  4C84 A;  2FVG A;  5JM6 A;  4C8U A;  2EK8 A;  3B3C A;  2PJC A;  4MMO A;  5IB9 A;  1BPM A;  5LYF A;  1ELM P;  1LAN A;  4P10 A;  1Y0R A;  1Z8L A;  4P4E A;  3N5F A;  2XEF A;  3IEH A;  4C8A A;  3ICU A;  1FT7 A;  3VH9 A;  2GLJ A;  3D66 A;  2AFM A;  3PB7 X;  1ELL P;  1UWY A;  4R76 A;  3PB4 X;  4R7M A;  5CPA A;  3PEI A;  2AFW A;  4PQA A;  4WWV A;  3FMC A;  2POK A;  3PFE A;  4P6Y A;  4EWT A;  1LAP A;  4P4B A;  3IFE A;  3KQZ A;  2PRQ A;  2C1C A;  3VAT A;  2WZN A;  5K8P A;  4MHY A;  2ZEF A;  4P4F A;  2Q43 A;  1ZG9 A;  2PJ5 A;  2WYR A;  4PXE A;  1ARM A;  2XEJ A;  2AFZ A;  4TNU A;  1R43 A;  4NGN A;  2NYQ A;  4OP4 A;  1CPS A;  4A39 A;  1XJO A;  3CPX A;  3SI2 A;  3LMS A;  4YN3 A;  2ZEP A;  1PYT B;  5J1Q A;  5HVH A;  4OIW A;  3I1U A;  4G1P A;  4OC2 A;  2PJA A;  3KAS A;  1BAV A;  5I4M A;  4IHM A;  3V38 A;  4TWE A;  3B3T A;  1YME A;  1HEE A;  1CP6 A;  1LOK A;  1TKJ A;  2PJ6 A;  4EME A;  4R8F A;  3D7F A;  1XMB A;  3D7H A;  4O23 A;  3NH5 A;  2PJ0 A;  5LRK A;  3PB8 X;  1Y7E A;  2Q4Z A;  1TF9 A;  3K2K A;  5DS0 A;  1F2O A;  2PJ9 A;  5HVF A;  4MHP A;  3K9T A;  4MCP A;  3PB9 X;  4OME A;  1OBR A;  4NGS A;  5LRJ A;  1ZG8 A;  1QQ9 A;  1F57 A;  2AFX A;  2ZEN A;  2EK9 A;  2OR4 A;  5D29 A;  4BD9 A;  1HDQ A;  3DGV A;  2IQ6 A;  4P45 A;  1DE4 C;  1ARL A;  3IC1 A;  1Y9Z A;  3JRU A;  2JBJ A;  2AFO A;  2GU2 A;  4C8T A;  2O4H A;  2F7V A;  5HXD A;  2G9D A;  2JBK A;  4TJX A;  5LYL A;  4MXU A;  4ONW A;  4OC3 A;  2IMO A;  3BI0 A;  4Z65 A;  3FED A;  4C86 A;  2AFU A;  3WAB A;  1M4L A;  3SI1 A;  3CPA A;  1BLL E;  4P4I A;  4NGQ A;  5LRG A;  2OOT A;  4KNG E;  2PIZ A;  4ZY1 A;  4ZI6 A;  1Z2L A;  4EFD A;  2C6P A;  3GUX A;  4NGP A;  3CDX A;  1Y0Y A;  3BHX A;  4MRI A;  4NGM A;  2V8G A;  3RZA A;  1RTQ A;  3NFZ A;  3FF3 A;  3FX6 A;  4KSI A;  3PB6 X;  3SJX A;  4NJR A;  1ZLI A;  4OC5 A;  4GM5 A;  5JGF A;  4UF4 A;  1XRY A;  4NGR A;  3S9M A;  3ISZ A;  1XFO A;  5K8M A;  3MRU A;  2ZEE A;  4Q7A A;  4IK2 A;  5F09 A;  4IAV A;  3LWU A;  5K8N A;  2ANP A;  1V6C A;  4C99 A;  3WC5 A;  4MCS A;  2QYV A;  4MHN A;  3TC8 A;  4UEE A;  3SI0 A;  1PCA A;  3IJ3 A;  2XEI A;  1GYT A;  3FEC A;  1LAM A;  4JYW A;  2CTB A;  5THW A;  1Z5R A;  3S9N A;  5LYI A;  3B3V A;  3TX8 A;  3PBB A;  4FAI A;  2ABZ A;  1ZG7 A;  1EE3 P;  4ZY0 A;  2O53 A;  2PJ4 A;  3WC7 A;  1H8L A;  2HC9 A;  4ZYQ A;  1YLO A;  2QJ8 A;  4FBE A;  5JH9 A;  3FJU A;  3L2N A;  3RAM A;  1VHO A;  4CPA A;  3IIB A;  4X2T A;  3SJF A;  4C8F A;  3FEE A;  2Q51 A;  3KHX A;  2ZEL A;  4W9Y A;  3GLJ A;  1XF1 A;  4K3N A;  4P4D A;  3MN8 A;  4ZX9 A;  2PJ3 A;  2PCU A;  2RFH A;  3I6S A;  4H2K A;  3D7G A;  1CBX A;  4MCQ A;  4F8Z A;  2GLF A;  1HDU A;  1YW4 A;  4JZ0 A;  2PJ2 A;  3NH4 A;  4X3R A;  4X8I A;  5ELY A;  1VIX A;  3PBE A;  4UIB A;  4OC0 A;  3VAR A;  3FH4 A;  7CPA A;  1TXR A;  4F9U A;  4C8P A;  4C8C A;  5CBM A;  1Q7L A;  4YU9 A;  4PXB A;  2PVV A;  4OID A;  4F9V A;  1FNO A;  2V8H A;  3WC6 A;  3BXM A;  3KR5 A;  2I3C A;  4MCR A;  1F2P A;  5LYD A;  4YWY A;  3IWW A;  1CP7 A;  4A94 A;  4CDJ A;  1NSA A;  5K8O A;  3KI9 A;  2XEG A;  2PJ8 A;  2BCO A;  3D7D A;  3T8W A;  2CTC A;  4B6Z A;  6CPA A;  4UEF A;  5D8N A;  2CF4 A;  2C6G A;  2CIJ A;  4C9V A;  4RUH A;  2ZOF A;  3NH8 A;  4NFR A;  4LQG A;  3KGQ A;  1XBU A;  3HUV A;  1IGB A;  3GB0 A;  4UEZ A;  3SJG A;  8CPA A;  1CG2 A;  3D68 A;  4C9U A;  4MHZ A;  2PJ1 A;  1TF8 A;  4A38 A;  4C9E A;  1LCP A;  2ZEM A;  4WJB A;  3H8E A;  2PJB A;  2ZEO A;  3D67 A;  3KQX A;  1IY7 A;  4NJQ A;  1VHE A;  3FVL A;  2AFS A;  2V8D A;  3B2Y A;  4C85 A;  2IJZ A;  1QMU A;  2PVW A;  3VTA A;  4OKO A;  3DLJ A;  3IO1 A;  4PPZ A;  4DUK A;  4TJV A;  1LFW A;  2ZOG A;  3B35 A;  3B7I A;  2NSM A;  2BO9 A;  3KZW A;  3I74 A;  3PFO A;  3KHZ A;  2RB7 A;  4C9A A;  3H8G A;  3H8F A;  3EIF A;  4A37 A;  2F8H A;  2HB6 A;  1TKH A; 
#chains in the Genus database with same CATH topology
 1JQG A;  1R3N A;  3IU1 A;  1YSJ A;  3PRT A;  4ZX8 A;  3CT9 A;  3C8O A;  1MJA A;  1AMP A;  1IID A;  2BOA A;  2KCW A;  2ZED A;  3RYO A;  4NEX A;  4INJ A;  4B11 A;  4M6G A;  4MHD A;  1P4N A;  3KR4 A;  1YW6 A;  2DEA A;  5G21 A;  4AXV A;  4UIA A;  4OC1 A;  3BJ8 A;  3JTK A;  4P4J A;  1ZLH A;  3E0K A;  3SJE A;  3GKR A;  2OZH A;  3JUW A;  3KL9 A;  4HPS A;  2PJ7 A;  4M6H A;  4CYP A;  3V7Z A;  4Y49 B;  2R7H A;  4Y49 C;  3WT4 A;  2EWB A;  4CGP A;  3VRQ A;  4DNC A;  4C9R A;  3IGR A;  2PIY A;  5JQ4 A;  5JYB A;  2XPL A;  3F9K C;  3HLP A;  2DPT A;  3TT2 A;  4PXD A;  4MFP A;  5KTD A;  4CAF A;  2WPW A;  2ZEG A;  3NA6 A;  4FWU A;  4GS4 A;  4LX9 A;  1NSL A;  4COB A;  3VWD A;  1SQH A;  1CX8 A;  2QVP A;  2JEW A;  4KOT A;  4DYO A;  2WUU A;  5HVG A;  3OAK A;  2CXA A;  4PXC A;  1BPN A;  4A4B A;  2G0B A;  1DTD A;  2ZW5 A;  2REE A;  4CYO A;  1WVM A;  3KKW A;  2CBL A;  1VGY A;  4FUU A;  5A27 A;  5AG4 A;  2V77 A;  1M6V B;  3PP9 A;  4ZGY B;  1IOI A;  1PUA A;  1XIX A;  2J8R A;  4CDK A;  1T36 B;  1AYE A;  2GFQ A;  4FD6 A;  4ZY2 A;  1YX0 A;  3EZA A;  3B3S A;  4NGT A;  1TKF A;  2HQY A;  3KRV A;  2UV8 G;  1U6M A;  2VL1 A;  2Z3M A;  4KVM E;  4OC4 A;  4R6T A;  2DXQ A;  4CAW A;  5F46 A;  4KVO E;  2GRE A;  4A4C A;  4CAX A;  3QNV A;  1MJ9 A;  2J9A A;  4E0A A;  3S9L A;  4P44 A;  4B12 A;  4A95 A;  4KOX A;  3D4U A;  3ISX A;  5F9M A;  3RBU A;  3FYN A;  2C6C A;  4E5S A;  2ZEH A;  3D2M A;  2PE3 A;  4GPL B;  1KEE B;  1C30 B;  3B3W A;  3BI1 A;  3TCV A;  1KWM A;  1CPX A;  2V8V A;  4DJL A;  4IIX A;  4C84 A;  2FVG A;  2Z3O A;  2HRO A;  5JM6 A;  3H4Q A;  4C8U A;  2EK8 A;  4QB9 A;  3B3C A;  2Z3P A;  2PJC A;  3RO0 A;  1QSO A;  4R3K A;  4MMO A;  4XPD C;  4XPD B;  5IB0 A;  2JEV A;  5IB9 A;  1BPM A;  2J8M A;  5LYF A;  4BTF A;  1IYK A;  1A9X B;  5F13 A;  3VRR A;  4BPW B;  1ELM P;  4M3S A;  1LAN A;  4M85 A;  4CAV A;  4P10 A;  3TFY A;  4AG7 A;  4I49 A;  3VRP A;  1Y7R A;  4UFW A;  1Y0R A;  1R57 A;  5FVJ A;  1Z8L A;  1YLE A;  4P4E A;  1QSR A;  3N5F A;  3R9G A;  2XEF A;  3IEH A;  3R95 A;  3W91 A;  4C8A A;  2DF5 A;  3OWC A;  3D3S A;  2BL1 A;  3ICU A;  4JWP A;  1FT7 A;  4K30 A;  2CNS A;  2GLJ A;  3VH9 A;  4B5O A;  5HMN A;  1QST A;  1MK4 A;  3D66 A;  2B4D B;  3NFQ A;  2AFM A;  3PB7 X;  3SXO A;  1ELL P;  1UWY A;  1IU8 A;  3DR6 A;  3P2F A;  3VRN A;  3PB4 X;  3BLN A;  4R76 A;  4R7M A;  5CPA A;  4R3L A;  3FXT A;  3PEI A;  4CYN A;  4UWI A;  2B3V A;  3FBU A;  3QAY A;  2AFW A;  4KUB A;  2BUE A;  4PQA A;  4WWV A;  5H84 A;  2EO8 A;  4ONU A;  3FMC A;  2AUN A;  2POK A;  3PFE A;  4P6Y A;  1YR0 A;  5DWM A;  1LAP A;  4EWT A;  4P4B A;  2Y1N A;  3IFE A;  3T07 A;  3KQZ A;  3O8Z A;  3EZE A;  1NMT A;  2PRQ A;  1J4J A;  2C1C A;  1R61 A;  3VAT A;  5C82 A;  1N71 A;  2WZN A;  3S6F A;  5K8P A;  1C3O B;  3GY9 A;  4MHY A;  2ZEF A;  4P4F A;  5H86 A;  2Q43 A;  4A31 A;  1ZG9 A;  1PU9 A;  2PJ5 A;  4IF5 A;  2WYR A;  4B13 A;  4PXE A;  4CGO A;  1ARM A;  2XEJ A;  2Q4V A;  2AFZ A;  4TNU A;  1R43 A;  4NGN A;  3OB1 B;  2NYQ A;  4OP4 A;  1CPS A;  4U9Y A;  4A39 A;  1NE9 A;  1XJO A;  3CPX A;  3LMS A;  3SI2 A;  3FNC A;  4NCZ A;  4YN3 A;  5AGE A;  2ZEP A;  3TLG B;  1IYL A;  4MI4 A;  2HV2 A;  3T90 A;  2P6G A;  3TOA A;  1Z8T A;  1Z9U A;  1PYT B;  3HPH E;  3NE7 A;  4YGO A;  2D0P A;  1MJB A;  5F47 A;  5J1Q A;  2Z3L A;  4BPU B;  5HVH A;  4OIW A;  3I1U A;  3IWG A;  4OC2 A;  1RO5 A;  2PJA A;  4G1P A;  5AG7 A;  4R87 A;  5F1Y A;  3KAS A;  1BAV A;  3U88 C;  1VBH A;  1AUG A;  4UWJ A;  2C5Q A;  5I4M A;  4IHM A;  3BJ7 A;  2G3T A;  3V38 A;  4TWE A;  4KLV A;  2HI6 A;  3VGO A;  3B3T A;  1YME A;  1HEE A;  4QUS A;  4E8O A;  1CP6 A;  1LOK A;  1TKJ A;  4EVY A;  3G8W A;  2EUI A;  2PJ6 A;  1M1D A;  4EME A;  2P6F A;  4R8F A;  2ATR A;  3D7F A;  4KLW A;  3A9L A;  4BMH A;  2VI7 A;  2GE3 A;  1B6B A;  3D2P A;  2R98 A;  4U5Y A;  5I0C A;  2OZU A;  2R8V A;  1XMB A;  1S7F A;  2I00 A;  3D7H A;  3K9U A;  4O23 A;  2BSW A;  2FS5 A;  2PJ0 A;  3NH5 A;  3PB8 X;  3IU2 A;  1Y7E A;  2D4O A;  2Q4Z A;  4C2X A;  5LRK A;  1CJW A;  1TF9 A;  2D4P A;  2QIR A;  3K2K A;  5DS0 A;  4UCP A;  3ZNI A;  4HNY B;  2B0A A;  2VEZ A;  1F2O A;  2PJ9 A;  5HVF A;  2D0O A;  1KC7 A;  2OU2 A;  1QSN A;  4MHP A;  3K9T A;  4JLY A;  2Y1M A;  5HKY A;  4MCP A;  3DSB A;  5EBV A;  1V0C A;  3PB9 X;  2VZY A;  3R1K A;  4NF1 A;  4OME A;  1OBR A;  1RXT A;  4NGS A;  1XF8 A;  4KOU A;  5LRJ A;  3TO7 A;  2B4D A;  4L89 A;  5JVL A;  1S7K A;  2PR1 A;  1CM0 A;  1ZG8 A;  3QB8 A;  4XNH C;  4CRY B;  1QQ9 A;  1F57 A;  2AFX A;  2QEC A;  2ZEN A;  2EK9 A;  3UY5 A;  2VQY A;  3EO4 A;  2GAN A;  2WSA A;  2OR4 A;  1VI4 A;  5D29 A;  2H5M A;  3CZX A;  4BD9 A;  1HDQ A;  2PC1 A;  4XPL A;  2AE6 A;  1WJT A;  5J3X A;  4MFJ A;  2XPP A;  1WK4 A;  3DGV A;  2IQ6 A;  1DE4 C;  4P45 A;  1ARL A;  4BPX B;  2REF A;  3IC1 A;  3TE4 A;  3CXS A;  2FE7 A;  2JBJ A;  3HMJ G;  2AFO A;  2GU2 A;  3JRU A;  1Y9Z A;  2O4H A;  4C8T A;  4EYS A;  2F7V A;  1M4G A;  1P0H A;  5HXD A;  4KOW A;  1KZF A;  4A33 A;  2R82 A;  2G9D A;  4JVO A;  5GCN A;  2P0W A;  2JBK A;  2EZC A;  5LYL A;  4TJX A;  4MXU A;  2YNE A;  4HKF A;  4LUA A;  3WR7 A;  4ONW A;  4OC3 A;  2IMO A;  2YNC A;  4A32 A;  3BI0 A;  5ISV A;  4Z65 A;  3FED A;  4C86 A;  2AFU A;  3WAB A;  4J3G A;  4AVC A;  4F0X A;  6CPA A;  1M44 A;  1M4L A;  3SI1 A;  2JLM A;  1EZA A;  3CPA A;  2B4B A;  2QML A;  4MI1 A;  1EO0 A;  4NSQ A;  1BLL E;  3TLB A;  3LD2 A;  3TLZ A;  4P4I A;  4NGQ A;  2B58 A;  5LRG A;  1Y9W A;  2OOT A;  2Q4Y A;  2PIZ A;  3LAC A;  3T9Y A;  1YVO A;  1L0C A;  3F8K A;  4ZY1 A;  4H1H A;  4ZI6 A;  4PK2 A;  1Z2L A;  4EFD A;  3TLE A;  3TLG A;  2C6P A;  2F5I A;  3S6K A;  1Q2C A;  4JXQ A;  3GUX A;  4JXR A;  1S3Z A;  2VZZ A;  4L8A A;  4J0N A;  1YK3 A;  4NGP A;  3GIU A;  3CDX A;  2K5T A;  1Y0Y A;  1Z8X A;  3BHX A;  4MRI A;  4UCM A;  5CNP A;  4NGM A;  3F0A A;  3T0T A;  5KTA A;  2VKZ G;  4AVA A;  2V8G A;  3RZA A;  1RTQ A;  4CYQ A;  4HNW B;  3NFZ A;  3FF3 A;  3FX6 A;  4KSI A;  4M8D A;  4E94 A;  1FY7 A;  4KOS A;  3PB6 X;  3W6X A;  2XPN A;  3SJX A;  3EY5 A;  1S5K A;  4NJR A;  1ZLI A;  3HPG G;  4OC5 A;  4GM5 A;  5J8C A;  5JGF A;  4UF4 A;  1XRY A;  4NGR A;  3TTH A;  3S9M A;  2N3A B;  2WPX A;  3ISZ A;  3T05 A;  1XFO A;  5K8M A;  3MRU A;  2ZEE A;  4Q7A A;  1BO4 A;  4IK2 A;  5AG5 A;  3F5B A;  5F09 A;  4IAV A;  2FIA A;  3LWU A;  5K8N A;  3DDD A;  2ANP A;  4AVB A;  1V6C A;  2FT0 A;  3H5Z A;  1IB1 E;  4KOY A;  3WC5 A;  1UFH A;  5BWA B;  1Q5X A;  5IR2 A;  1Z4E A;  4C99 A;  3DNS A;  4MCS A;  3PT1 A;  2P6E A;  2QYV A;  5C88 A;  2YND A;  2Q04 A;  4MHN A;  4OAE A;  3BUN B;  3TC8 A;  4Q38 A;  4UEE A;  3SI0 A;  4C7I A;  2AUM A;  3V8I A;  1NBW A;  1PCA A;  3I6S A;  4MY0 A;  5HKZ A;  4YRH A;  1S7N A;  3IJ3 A;  2XEI A;  1GYT A;  2YJV A;  3FEC A;  1LAM A;  4JYW A;  2B4J C;  2CTB A;  2G3A A;  5EC4 A;  5THW A;  4C68 A;  1JDE A;  1Z5R A;  3S9N A;  5LYI A;  3B3V A;  3TX8 A;  1Q2Y A;  2E28 A;  3PBB A;  1YVH A;  3GYA A;  4FAI A;  2YGW A;  4HNX B;  2ABZ A;  2HWG A;  1ZG7 A;  2Z10 A;  1EE3 P;  1B87 A;  2B5G B;  2ODF A;  3U1B A;  2FL4 A;  4ZY0 A;  2O53 A;  3R9F A;  3SR3 A;  1GGO A;  1B47 A;  5F5X A;  2PJ4 A;  4Q36 A;  2CY2 A;  2J8N A;  4QBJ A;  4KNG E;  1YVK A;  5F49 A;  1YQE A;  3WC7 A;  1H8L A;  1Z4R A;  1IOF A;  3W6S A;  1X12 A;  2HC9 A;  4H6U A;  4ZYQ A;  4E2A A;  1YLO A;  2Q0Y A;  2QJ8 A;  1JDB C;  2Q7S A;  3I9S A;  4OLL A;  4FBE A;  5JH9 A;  3EC4 A;  3FJU A;  3TLA A;  3L2N A;  3RAM A;  3PGP A;  1VHO A;  4XPK A;  3IIB A;  4CPA A;  2ZPA A;  4H89 A;  4X2T A;  3SJF A;  4C8F A;  1S60 A;  2NMT A;  4MFQ A;  3FEE A;  1I1D A;  2Q51 A;  2VBQ A;  2DLA A;  2ZEL A;  3KHX A;  3S6H A;  3TO6 A;  4W9Y A;  4OAD A;  4KVX A;  4A30 A;  1XMT A;  4CAE A;  2EZB A;  3TLY A;  4CZ1 A;  4R9M A;  4C2Z A;  1IIC A;  3TO9 A;  3GLJ A;  3D8P A;  1XF1 A;  4F6A A;  1ON0 A;  1ZRS A;  1K4J A;  4M6I A;  4K3N A;  4P4D A;  1WWZ A;  3MN8 A;  1XEB A;  4MFK A;  4ZX9 A;  3SHP A;  2EZA A;  2PJ3 A;  4UBR A;  4B5P B;  3OP0 A;  5EMI A;  2FSR A;  2PCU A;  5KTC A;  2RFH A;  5DWN A;  4H2K A;  4KS9 A;  4PK3 A;  4AB7 A;  3PLF B;  4AG9 A;  2OB0 A;  1S7L A;  4IUS A;  3D7G A;  1CBX A;  4MCQ A;  1TIQ A;  1Z8W A;  4RR2 B;  1Y9K A;  2GLF A;  4FD5 A;  3SXN A;  4F8Z A;  1EZB A;  3K4I A;  1HDU A;  1Q2D A;  4XNH B;  1XE4 A;  1YW4 A;  4JZ0 A;  1M4D A;  1OZP A;  2PJ2 A;  3NH4 A;  4MBU A;  5HH1 A;  4X3R A;  2YJT A;  1BOB A;  3RNZ A;  2OLS A;  4X8I A;  1ZO0 A;  2MP0 A;  1GHE A;  5A28 A;  5ELY A;  2EBJ A;  2ZW6 A;  5JPH A;  4MFZ A;  1ZL0 A;  1X10 A;  4R57 A;  1VIX A;  3EXN A;  3PBE A;  3PFV A;  4MY3 A;  4II9 A;  4UIB A;  4OC0 A;  3G3S A;  3VAR A;  2PRB A;  3FH4 A;  1KUX A;  3DR8 A;  3TLC A;  2HUZ A;  7CPA A;  4MJ8 A;  1M4I A;  1TXR A;  4F9U A;  4ZBG A;  4C8P A;  4C8C A;  2B3U A;  2BEI A;  3N7Z A;  5CBM A;  1Q7L A;  4YU9 A;  5AXI A;  4PXB A;  3BUO B;  1Z9E A;  2PVV A;  4OID A;  3R9E A;  4F9V A;  1FNO A;  2EVN A;  2V8H A;  4UFV A;  3WC6 A;  1KUV A;  3BXM A;  3KR5 A;  4PSX A;  2I3C A;  4UFX A;  1KBL A;  4MCR A;  5BY0 A;  3JVN A;  4QC6 A;  1CE8 B;  1JWQ A;  3S6G A;  3T5M A;  2PR8 A;  4RI1 A;  4H6Z A;  1F2P A;  3BUM B;  3VRO A;  5LYD A;  4RN7 A;  2Q7B A;  4YWY A;  2PSW A;  3IWW A;  3LOD A;  5G1Z A;  4CGN A;  4NXY A;  2FXF A;  2PCN A;  3VWE A;  1CS0 B;  2ZW7 A;  2DIK A;  4PV6 A;  4FD4 A;  4C9A A;  4C7H A;  5IX3 A;  4RS2 A;  1CP7 A;  2FCK A;  2R1I A;  4A94 A;  3NOJ A;  2B5G A;  2FIW A;  4CDJ A;  1NSA A;  4KSF A;  3G23 A;  5K8O A;  5IV0 A;  4JJX A;  3KI9 A;  4B14 A;  2A4N A;  2XEG A;  4YFJ A;  4CGM A;  3CXP A;  2Z0Z A;  3BUW B;  2PJ8 A;  4KUA A;  2BCO A;  2O28 A;  3D7D A;  2AJ6 A;  1DIK A;  2Q44 A;  1A2Z A;  5E96 A;  2ZXV A;  2CTC A;  3T8W A;  1VHS A;  4B6Z A;  3B8G A;  4BIN A;  2I79 A;  4UEF A;  5D8N A;  2CF4 A;  1BXR B;  4IIY A;  2C6G A;  2IL4 A;  2CIJ A;  5HKW A;  3GJZ A;  4C9V A;  4RUH A;  2ZOF A;  2C27 A;  2JDD A;  3NH8 A;  4NFR A;  4MJX A;  4CO9 A;  4LQG A;  1YRE A;  3KGQ A;  4C2Y A;  2RC4 A;  2X7B A;  2XPO A;  4COG A;  3R96 A;  3MGD A;  1XBU A;  2X0S A;  2Y0M A;  3HUV A;  3FRM A;  3I3G A;  3ZJ0 A;  1IGB A;  2Z11 A;  1VKC A;  3GB0 A;  3BUX B;  1XOV A;  4ORF A;  2VXK A;  3NE8 A;  3IWE A;  4MFL A;  4UA3 A;  4U9Z A;  4UEZ A;  3SJG A;  4BBH A;  8CPA A;  5K99 A;  1CG2 A;  2CNM A;  3D68 A;  4B10 A;  2PDO A;  4CGL A;  1J3L A;  4C9U A;  4MHZ A;  2PJ1 A;  1TF8 A;  4KOR A;  4A38 A;  2DPS A;  4C9E A;  5FD8 A;  1LCP A;  2ARH A;  2ZEM A;  4WJB A;  4GXH A;  3H8E A;  3FB3 A;  2PJB A;  2ZEO A;  3D67 A;  4B5P A;  3KQX A;  4PSW A;  1IY7 A;  1YGH A;  4NJQ A;  5G20 A;  3PZJ A;  4LQ6 A;  4JD6 A;  1VHE A;  2CNT A;  3FVL A;  2AFS A;  2V8D A;  3FIX A;  4F0Y A;  3OB2 B;  1I21 A;  3B2Y A;  5F48 A;  4C85 A;  4CRZ B;  2JDC A;  3C26 A;  5G22 A;  1NXJ A;  2IJZ A;  1QMU A;  2PQ8 A;  1KUY A;  2PVW A;  2YNC C;  4CS0 B;  2GP4 A;  5J8F A;  2OH1 A;  3VTA A;  4OKO A;  3DLJ A;  3IO1 A;  3P2H A;  4PPZ A;  1LRZ A;  4DUK A;  4TJV A;  1LFW A;  2ZW4 A;  2Z3K A;  3CXQ A;  2ZOG A;  3B35 A;  3B7I A;  2NSM A;  2BO9 A;  1FBV A;  3EFA A;  1QSM A;  3KZW A;  4KZT A;  4X5K A;  4FD7 A;  3I74 A;  3PFO A;  3TOB A;  3EZB A;  4KOV A;  4KSA A;  5AG6 A;  3KHZ A;  2FM4 A;  2RB7 A;  4A2Z A;  1VBG A;  1I12 A;  2GIV A;  2Z3N A;  3H8G A;  3H8F A;  4UCN A;  1ZYM A;  3EIF A;  4A37 A;  3TYX A;  2OZG A;  2F8H A;  4QVT A;  2HB6 A;  3ZZI A;  3QAH A;  1TKH A; 
#chains in the Genus database with same CATH homology
 1JQG A;  1R3N A;  1YSJ A;  3PRT A;  4ZX8 A;  3CT9 A;  1AMP A;  2BOA A;  2ZED A;  3KR4 A;  1YW6 A;  2DEA A;  4AXV A;  4UIA A;  4OC1 A;  4P4J A;  1ZLH A;  3SJE A;  3KL9 A;  2PJ7 A;  3V7Z A;  3WT4 A;  2EWB A;  4C9R A;  2PIY A;  3HLP A;  4PXD A;  2ZEG A;  3NA6 A;  4FWU A;  1CX8 A;  2QVP A;  2JEW A;  4DYO A;  5HVG A;  4PXC A;  1BPN A;  1WVM A;  1DTD A;  1VGY A;  4FUU A;  2V77 A;  4CDK A;  1AYE A;  4ZY2 A;  3B3S A;  4NGT A;  1TKF A;  2VL1 A;  4R6T A;  4OC4 A;  2GRE A;  3QNV A;  2J9A A;  3S9L A;  4P44 A;  3D4U A;  3ISX A;  3RBU A;  2C6C A;  2ZEH A;  2PE3 A;  3B3W A;  3BI1 A;  1KWM A;  1CPX A;  2V8V A;  4DJL A;  4C84 A;  2FVG A;  5JM6 A;  4C8U A;  2EK8 A;  3B3C A;  2PJC A;  4MMO A;  5IB9 A;  1BPM A;  5LYF A;  1ELM P;  1LAN A;  4P10 A;  1Y0R A;  1Z8L A;  4P4E A;  3N5F A;  2XEF A;  3IEH A;  4C8A A;  3ICU A;  1FT7 A;  3VH9 A;  2GLJ A;  3D66 A;  2AFM A;  3PB7 X;  1ELL P;  1UWY A;  4R76 A;  3PB4 X;  4R7M A;  5CPA A;  3PEI A;  2AFW A;  4PQA A;  4WWV A;  3FMC A;  2POK A;  3PFE A;  4P6Y A;  4EWT A;  1LAP A;  4P4B A;  3IFE A;  3KQZ A;  2PRQ A;  2C1C A;  3VAT A;  2WZN A;  5K8P A;  4MHY A;  2ZEF A;  4P4F A;  2Q43 A;  1ZG9 A;  2PJ5 A;  2WYR A;  4PXE A;  1ARM A;  2XEJ A;  2AFZ A;  4TNU A;  1R43 A;  4NGN A;  2NYQ A;  4OP4 A;  1CPS A;  4A39 A;  1XJO A;  3CPX A;  3SI2 A;  3LMS A;  4YN3 A;  2ZEP A;  1PYT B;  5J1Q A;  5HVH A;  4OIW A;  3I1U A;  4G1P A;  4OC2 A;  2PJA A;  3KAS A;  1BAV A;  2C5Q A;  5I4M A;  4IHM A;  3V38 A;  4TWE A;  3B3T A;  1YME A;  1HEE A;  1CP6 A;  1LOK A;  1TKJ A;  2PJ6 A;  4EME A;  4R8F A;  3D7F A;  1XMB A;  3D7H A;  4O23 A;  3NH5 A;  2PJ0 A;  5LRK A;  3PB8 X;  1Y7E A;  2Q4Z A;  1TF9 A;  3K2K A;  5DS0 A;  1F2O A;  2PJ9 A;  5HVF A;  4MHP A;  3K9T A;  4MCP A;  3PB9 X;  4OME A;  1OBR A;  4NGS A;  5LRJ A;  1ZG8 A;  1QQ9 A;  1F57 A;  2AFX A;  2ZEN A;  2EK9 A;  2OR4 A;  5D29 A;  4BD9 A;  1HDQ A;  3DGV A;  2IQ6 A;  4P45 A;  1DE4 C;  1ARL A;  3IC1 A;  1Y9Z A;  3JRU A;  2JBJ A;  2AFO A;  2GU2 A;  4C8T A;  2O4H A;  2F7V A;  5HXD A;  2G9D A;  2JBK A;  4TJX A;  5LYL A;  4MXU A;  4ONW A;  4OC3 A;  2IMO A;  3BI0 A;  4Z65 A;  3FED A;  4C86 A;  2AFU A;  3WAB A;  1M4L A;  3SI1 A;  3CPA A;  1BLL E;  4P4I A;  4NGQ A;  5LRG A;  2OOT A;  4KNG E;  2PIZ A;  4ZY1 A;  4ZI6 A;  1Z2L A;  4EFD A;  2C6P A;  3GUX A;  4NGP A;  3CDX A;  1Y0Y A;  3BHX A;  4MRI A;  4NGM A;  2V8G A;  3RZA A;  1RTQ A;  3NFZ A;  3FF3 A;  3FX6 A;  4KSI A;  3PB6 X;  3SJX A;  4NJR A;  1ZLI A;  4OC5 A;  4GM5 A;  5JGF A;  4UF4 A;  1XRY A;  4NGR A;  3S9M A;  3ISZ A;  1XFO A;  5K8M A;  3MRU A;  2ZEE A;  4Q7A A;  4IK2 A;  5F09 A;  4IAV A;  3LWU A;  5K8N A;  2ANP A;  1V6C A;  4C99 A;  3WC5 A;  5IR2 A;  4MCS A;  2QYV A;  4MHN A;  3TC8 A;  4UEE A;  3SI0 A;  1PCA A;  3IJ3 A;  2XEI A;  1GYT A;  3FEC A;  1LAM A;  4JYW A;  2CTB A;  5THW A;  1Z5R A;  3S9N A;  5LYI A;  3B3V A;  3TX8 A;  3PBB A;  4FAI A;  2ABZ A;  1ZG7 A;  1EE3 P;  4ZY0 A;  2O53 A;  2PJ4 A;  3WC7 A;  1H8L A;  2HC9 A;  4ZYQ A;  1YLO A;  2QJ8 A;  4FBE A;  5JH9 A;  3FJU A;  3L2N A;  3RAM A;  1VHO A;  4CPA A;  3IIB A;  4X2T A;  3SJF A;  4C8F A;  3FEE A;  2Q51 A;  3KHX A;  2ZEL A;  4W9Y A;  3GLJ A;  1XF1 A;  4K3N A;  4P4D A;  3MN8 A;  4ZX9 A;  2PJ3 A;  2PCU A;  2RFH A;  3I6S A;  4H2K A;  3D7G A;  1CBX A;  4MCQ A;  4F8Z A;  2GLF A;  1HDU A;  1YW4 A;  4JZ0 A;  2PJ2 A;  3NH4 A;  4X3R A;  4X8I A;  5ELY A;  1VIX A;  3PBE A;  4UIB A;  4OC0 A;  3VAR A;  3FH4 A;  7CPA A;  1TXR A;  4F9U A;  4C8P A;  4C8C A;  5CBM A;  1Q7L A;  4YU9 A;  4PXB A;  2PVV A;  4OID A;  4F9V A;  1FNO A;  2V8H A;  3WC6 A;  3BXM A;  3KR5 A;  2I3C A;  4MCR A;  1F2P A;  5LYD A;  4YWY A;  3IWW A;  1CP7 A;  4A94 A;  4CDJ A;  1NSA A;  5K8O A;  3KI9 A;  2XEG A;  2PJ8 A;  2BCO A;  3D7D A;  3T8W A;  2CTC A;  4B6Z A;  6CPA A;  4UEF A;  5D8N A;  2CF4 A;  2C6G A;  2CIJ A;  4C9V A;  4RUH A;  2ZOF A;  3NH8 A;  4NFR A;  4LQG A;  3KGQ A;  1XBU A;  3HUV A;  1IGB A;  3GB0 A;  4UEZ A;  3SJG A;  8CPA A;  1CG2 A;  3D68 A;  4C9U A;  4MHZ A;  2PJ1 A;  1TF8 A;  4A38 A;  4C9E A;  1LCP A;  2ZEM A;  4WJB A;  3H8E A;  2PJB A;  2ZEO A;  3D67 A;  3KQX A;  1IY7 A;  4NJQ A;  1VHE A;  3FVL A;  2AFS A;  2V8D A;  3B2Y A;  4C85 A;  2IJZ A;  1QMU A;  2GP4 A;  2PVW A;  3VTA A;  4OKO A;  3DLJ A;  3IO1 A;  4PPZ A;  4DUK A;  4TJV A;  1LFW A;  2ZOG A;  3B35 A;  3B7I A;  2NSM A;  2BO9 A;  3KZW A;  3I74 A;  3PFO A;  3KHZ A;  2RB7 A;  4C9A A;  3H8G A;  3H8F A;  3EIF A;  4A37 A;  2F8H A;  2HB6 A;  1TKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...