4OC0A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with ccibzl, a urea-based inhibitor n~2~-[(1-carboxycyclopropyl)carbamoyl]-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc0A02
2V77A 3ICUA 3D66A 2AFZA 3CT9A 3PB7X 4R8FA 5K8PA 1VHOA 3SJEA 1ZLIA 2PJ4A 3H8FA 3HUVA 3NH5A 4YU9A 2EK9A 4C9EA 2CTCA 3T8WA 2BO9A 1HDQA 3FEEA 1M4LA 5D29A 4NGNA 4MHNA 2IJZA 2Q51A 3D7GA 2Q43A 4OIWA 4R7MA 3TX8A 4YWYA 2PJBA 3B3CA 3ISXA 3I74A 3B2YA 4PXEA 4F8ZA 4RUHA 2GLFA 3CDXA 1F57A 3S9NA 5JM6A 2PJ9A 2PJ6A 1VGYA 2EK8A 5ELYA 3SI1A 1BPNA 3PEIA 3PB8X 3SJXA 3NH4A 5LYDA 1ZG9A 1PCAA 2AFUA 7CPAA 3MN8A 4EWTA 3IJ3A 4OC4A 4OKOA 3IFEA 1CG2A 4MCRA 2XEGA 2BOAA 2V8DA 5I4MA 4IK2A 2OOTA 2VL1A 5IB9A 4DYOA 5LRJA 4P4EA 3PB9X 4IHMA 3SI0A 2ZEHA 5THWA 3V38A 3VTAA 4MXUA 2QYVA 1Y7EA 2PJ0A 4OC1A 1AMPA 4NJQA 2DEAA 4OC2A 2JEWA 3B3VA 1ZLHA 4NGMA 2PJ3A 1UWYA 1H8LA 4C99A 1LCPA 5JH9A 3FJUA 4OC0A 4C84A 4P6YA 5J1QA 4BD9A 4C86A 4YN3A 1YW4A 4OP4A 4C8AA 2CIJA 1NSAA 5CBMA 4P4BA 1TKFA 3DLJA 1ARMA 3NFZA 4A94A 4P10A 2IQ6A 1Z8LA 3LWUA 4JZ0A 4X8IA 4UEEA 2G9DA 3KR4A 2PIZA 4PPZA 4CPAA 5DS0A 4C85A 4C9RA 2ZEDA 1CBXA 4JYWA 2CF4A 3KQZA 2AFMA 3BI1A 3KASA 1LANA 4WWVA 4FBEA 5F09A 3NA6A 1XMBA 4OC5A 1DTDA 2IMOA 3KQXA 2ZENA 1BAVA 4TNUA 2ZEMA 3PBEA 4C9AA 4EMEA 3EIFA 1XBUA 4C8TA 3KHXA 2PCUA 4LQGA 1Z2LA 4ONWA 4A38A 3KZWA 4ZY2A 3HLPA 3CPXA 3KI9A 1Q7LA 1F2OA 3BHXA 2Q4ZA 4IAVA 1CPXA 4ZX9A 4W9YA 2O4HA 4NFRA 3WC6A 4MHPA 3WC5A 3SJFA 3FEDA 4P4IA 4CDJA 4MRIA 3PFEA 5LYLA 2GLJA 4NGSA 5JGFA 2XEFA 4FAIA 2GU2A 3I6SA 1YW6A 5HXDA 4NGRA 4P4DA 1JQGA 4DJLA 4KSIA 4C9VA 2PRQA 2ZOFA 4PQAA 2BCOA 4UEFA 1ELMP 3L2NA 5HVFA 4FUUA 4UEZA 1R43A 2AFWA 1CX8A 3S9LA 4X2TA 3WT4A 3WC7A 5K8MA 4C8PA 2C6GA 2QJ8A 3VARA 4KNGE 4F9UA 4EFDA 4OMEA 3B35A 3NH8A 1CPSA 2ZEGA 3PFOA 3H8EA 4P4FA 3QNVA 3D67A 2JBKA 4PXDA 3WABA 3IC1A 1LOKA 4DUKA 2C1CA 1Y9ZA 3FMCA 4OC3A 4NJRA 3IO1A 3IWWA 4AXVA 1Y0YA 4PXCA 2CTBA 3GB0A 2PJAA 2F7VA 4UF4A 2XEJA 3BXMA 4MMOA 3FX6A 4NGPA 1V6CA 1XJOA 3SI2A 3MRUA 1GYTA 1YSJA 3KR5A 1XFOA 2NYQA 1XF1A 2FVGA 3H8GA 4MCSA 1IY7A 3GUXA 3K9TA 4WJBA 1HDUA 2GREA 4MHZA 4P44A 2I3CA 3B7IA 2PVVA 3PBBA 2ZEOA 2POKA 2PJCA 2PJ2A 3TC8A 4TJVA 2V8VA 2WYRA 1EE3P 2ANPA 3K2KA 4OIDA 1IGBA 3V7ZA 1AYEA 5D8NA 4ZX8A 2J9AA 4F9VA 4R76A 2HB6A 5K8NA 2ZOGA 2PJ7A 1TKJA 4C9UA 2PE3A 3FECA 2QVPA 3CPAA 2XEIA 8CPAA 6CPAA 3VATA 4NGTA 2AFOA 3FVLA 2O53A 3D4UA 4ZY0A 3BI0A 1CP6A 4P45A 4UIAA 5LRKA 3D7DA 5LYIA 4O23A 3B3TA 2AFSA 1HEEA 1TF8A 4C8UA 5HVGA 4G1PA 3DGVA 3B3SA 2V8GA 2OR4A 2PVWA 5CPAA 3KGQA 2F8HA 1ARLA 1VIXA 2V8HA 1FNOA 1LAMA 3FF3A 3IIBA 1F2PA 4C8CA 2RB7A 3KHZA 1QMUA 2HC9A 1LAPA 3SJGA 1BPMA 4UIBA 2ZEPA 1YMEA 3I1UA 4Z65A 4X3RA 4A39A 1DE4C 3GLJA 1XRYA 1WVMA 2PJ1A 1OBRA 1ELLP 4P4JA 5K8OA 4C8FA 4MCQA 4ZI6A 3RBUA 1TXRA 3PB4X 2C6PA 3JRUA 4NGQA 2ZELA 2PIYA 1LFWA 4CDKA 2EWBA 2PJ5A 2ABZA 2RFHA 1TKHA 1VHEA 4MHYA 4B6ZA 1ZG7A 1Z5RA 3S9MA 3PRTA 4GM5A 3VH9A 4R6TA 3PB6X 4TWEA 3B3WA 4K3NA 1Y0RA 3D7HA 3KL9A 3FH4A 1CP7A 4PXBA 4A37A 2AFXA 2WZNA 4H2KA 2ZEFA 3RAMA 3LMSA 2C6CA 4ZY1A 3D7FA 3ISZA 3N5FA 5LYFA 3RZAA 1PYTB 1YLOA 1KWMA 3IEHA 3D68A 4Q7AA 2PJ8A 4MCPA 4TJXA 1RTQA 1TF9A 1R3NA 5HVHA 2JBJA 5LRGA 1BLLE 2NSMA 4ZYQA 1FT7A 2ZEEA 4FWUA 1QQ9A 1ZG8A
chains in the Genus database with same CATH superfamily
2Z3KA 4AG9A 4CAVA 3OAKA 2V77A 3ICUA 3D66A 5G20A 4CYPA 1RO5A 1ZL0A 3CXSA 1Z4RA 2AFZA 3SXNA 1YVHA 2G3TA 3CT9A 5G21A 4BBHA 3PB7X 4IIXA 4XPDB 4R8FA 5K8PA 2ARHA 1EZAA 1VHOA 3SJEA 1ZLIA 2PJ4A 3H8FA 3HUVA 3TTHA 3NH5A 5IB0A 4KOWA 2DXQA 4YU9A 3QB8A 1JDBC 2EK9A 4XPDC 4C9EA 2P6GA 1S60A 2CTCA 2D0PA 3GKRA 3T8WA 1S7LA 2BO9A 5AG6A 1HDQA 3FEEA 1M4LA 2VI7A 5D29A 3IWGA 5F1YA 2NMTA 2XPNA 4CRZB 4NGNA 2JDDA 4MHNA 2IJZA 2Q51A 4QB9A 3PT1A 4F0YA 5C88A 3K4IA 3ZJ0A 2A4NA 1EZBA 4ZBGA 3D7GA 1C3OB 2REEA 2Q43A 4M6IA 4OIWA 2B5GA 2VZZA 3BJ7A 4R7MA 4XNHC 3TX8A 4YWYA 4CYOA 2PJBA 3B3CA 4B13A 1S3ZA 2DF5A 3ISXA 1P0HA 3I74A 3B2YA 4PXEA 4F8ZA 2Q7BA 4RUHA 1NBWA 2GLFA 2PR1A 3CDXA 4CYNA 3HMJG 4H6ZA 1F57A 3S9NA 3RNZA 2D0OA 4MY0A 5JM6A 2PJ9A 2PJ6A 3SXOA 2GP4A 1VGYA 1CM0A 3GYAA 3SHPA 2EK8A 5ELYA 1QSTA 2JEVA 4BMHA 3EFAA 2ZPAA 2OZGA 2P6EA 1B47A 1BPNA 2PRBA 3PEIA 3PB8X 3SJXA 3NH4A 1CS0B 4E5SA 4CGOA 2QMLA 4KZTA 1J4JA 2WPWA 2ZW6A 5LYDA 1ZG9A 1PCAA 2AFUA 5HH1A 3MN8A 4EWTA 7CPAA 3G23A 4M3SA 1XMTA 3IJ3A 1UFHA 4OC4A 2FCKA 3IFEA 4BPXB 4OKOA 1A9XB 4ONUA 1CG2A 4MCRA 1WWZA 4LQ6A 2XEGA 2BOAA 2V8DA 5I4MA 4IK2A 2OOTA 1QSOA 3NE8A 4A30A 1RXTA 1TIQA 2B4DA 2R7HA 5H84A 2VBQA 2VL1A 5G22A 5IB9A 5H86A 4DYOA 3H5ZA 5LRJA 2CNTA 4P4EA 3PB9X 4IHMA 3SI0A 1Y9WA 4X5KA 3IU2A 3F9KC 1YK3A 2ZEHA 2GFQA 3BUXB 3MGDA 4LX9A 4Y49C 5I0CA 2D4OA 3G3SA 5THWA 3PLFB 3T5MA 4COBA 3U88C 2GANA 3V38A 3VTAA 4MXUA 2QYVA 1XEBA 4A31A 3FIXA 1KUXA 1YREA 4C68A 1Y7EA 2PJ0A 4OC1A 3D8PA 4QC6A 3SI1A 3W91A 1ZO0A 2CXAA 1AMPA 2R98A 2C27A 1Z8TA 2OB0A 3JVNA 4NJQA 3FB3A 4B12A 2DEAA 4H6UA 4PSXA 1BOBA 4OC2A 2JEWA 3B3VA 2XPOA 4KUAA 3TLAA 4UFVA 3R95A 2H5MA 3D2PA 1KUVA 1ZLHA 4IF5A 2B0AA 4NGMA 3TLZA 4KOUA 5JYBA 3BLNA 3A9LA 2YJTA 2PJ3A 1UWYA 4KOXA 4YRHA 3E0KA 1H8LA 5AG4A 2DPTA 2J8NA 3VROA 2FT0A 2PSWA 4C99A 4MFQA 2WSAA 3OP0A 1LCPA 5C82A 4XPKA 5JH9A 3FJUA 4OC0A 4C84A 3VRPA 1MJ9A 4P6YA 5J1QA 4BD9A 4C86A 4YN3A 5DWMA 3CXPA 1YW4A 4OP4A 4C8AA 5BY0A 2CIJA 1NSAA 4KSAA 3TT2A 2EBJA 2ATRA 1R57A 4MFLA 4UBRA 4CGNA 5CBMA 4P4BA 3F0AA 2ZEEA 4UFXA 3DNSA 1TKFA 3DLJA 2HV2A 2FM4A 1ARMA 3TCVA 3NFZA 4CGMA 4A94A 4E94A 2WPXA 4P10A 2J8RA 2IQ6A 2BSWA 1Z8LA 1KZFA 3LWUA 2BEIA 2ODFA 4JZ0A 4MFPA 2CNSA 4MY3A 1V0CA 2G9DA 4UEEA 3KR4A 4X8IA 4CAFA 5A28A 2EZAA 2PIZA 4PPZA 4A95A 4CPAA 2BL1A 3CXQA 5DS0A 3SR3A 4C85A 2Z0ZA 3NE7A 4C9RA 2ZEDA 2E28A 5JPHA 1U6MA 1IICA 4PV6A 1CBXA 3WR7A 4MHDA 4JYWA 3TLGA 4INJA 2CBLA 2XPPA 1YGHA 2CF4A 1Z9EA 2UV8G 2AFMA 3KQZA 3BI1A 2Z11A 5EMIA 2HI6A 5BWAB 4CO9A 3KASA 2Z3LA 1LANA 4RS2A 3PGPA 4CGPA 4WWVA 4FBEA 4Q38A 5KTAA 5F09A 3NA6A 3NFQA 1M6VB 1XMBA 4OC5A 1DTDA 4A2ZA 2IMOA 1Q2DA 5F48A 4II9A 2K5TA 3KQXA 1M4GA 2R82A 4H89A 1NMTA 2ZENA 1BAVA 4TNUA 3I9SA 2ZEMA 3PBEA 5F9MA 5J3XA 4C9AA 4EMEA 3EIFA 3DR6A 4KUBA 5G1ZA 1XBUA 4C8TA 3KHXA 1MJBA 2PCUA 2QIRA 4L89A 2YJVA 4CAEA 5IX3A 2DLAA 4U9ZA 4LQGA 1Z2LA 4ONWA 5AGEA 4JWPA 4UCMA 4A38A 3KZWA 4JXQA 5K99A 3V8IA 4M6HA 2QECA 1IB1E 4ZY2A 3HLPA 5FVJA 3CPXA 1Y7RA 3KI9A 1Q7LA 1F2OA 3IWEA 3HPHE 2HROA 3BHXA 2Q4ZA 4IAVA 1CPXA 4ZX9A 1K4JA 2N3AB 2B4JC 4W9YA 2O4HA 4NFRA 4GS4A 1VBGA 5F5XA 2YNCA 4KLWA 1X12A 3WC6A 4C2YA 3T07A 1MK4A 4UWIA 4MHPA 3C26A 4A32A 3TO7A 3CZXA 3WC5A 1IIDA 2FSRA 3KKWA 2PR8A 4MI4A 4B5OA 3SJFA 3FEDA 4P4IA 4XPLA 2KCWA 4K30A 3S6HA 3S6GA 4CDJA 4MRIA 2BUEA 3PFEA 5LYLA 2F5IA 1EO0A 2GLJA 4NGSA 4OLLA 4HNXB 3B8GA 5E96A 5JGFA 1Q5XA 2DPSA 2XEFA 4FAIA 5HKYA 2GU2A 4F0XA 3QAYA 4F6AA 4LUAA 4MFJA 3I6SA 1Z8XA 2FIWA 1IOIA 1YW6A 4KVME 4OADA 4B5PA 5HXDA 4NGRA 4P4DA 4RR2B 3VRQA 1JQGA 4FD7A 4KSIA 3W6XA 2I00A 4DJLA 4L8AA 1Q2YA 4IUSA 1IOFA 1SQHA 2JDCA 4RI1A 3FBUA 2P0WA 4C9VA 2PRQA 2ZOFA 4CS0B 5F46A 4NEXA 4PQAA 2FXFA 4KOTA 2BCOA 4UEFA 1ELMP 3L2NA 5IR2A 5HVFA 4FUUA 4UEZA 1R43A 2AFWA 3FYNA 1CX8A 3VGOA 3S9LA 4CGLA 2YNEA 3I3GA 1Z9UA 1XF8A 4X2TA 3WT4A 3OB1B 1S5KA 4JVOA 3OB2B 3PZJA 3W6SA 3WC7A 1VBHA 1M1DA 3BUWB 5K8MA 1JWQA 5AG5A 2AUMA 5F13A 4C8PA 2B5GB 2C6GA 4KVOE 2QJ8A 3VARA 4EVYA 4KNGE 2PC1A 4F9UA 4KLVA 3DR8A 3F8KA 4EFDA 4R57A 3TLCA 4E2AA 4OMEA 1J3LA 3B35A 3NH8A 1CPSA 2OH1A 2ZEGA 4BPUB 4BTFA 1WK4A 2OU2A 3PFOA 4BINA 4M8DA 3H8EA 4P4FA 3QNVA 1C30B 1Q2CA 3D67A 2JBKA 1OZPA 3C8OA 4PXDA 3WABA 3IC1A 4RN7A 5HMNA 1LOKA 3JTKA 4DUKA 1BXRB 2EZCA 4MFZA 3VRNA 4GXHA 4AG7A 5KTCA 2C1CA 3TFYA 1X10A 1Y9ZA 3FMCA 4OC3A 2HQYA 2Q4YA 3DSBA 3IU1A 4NJRA 3H4QA 3S6FA 4MBUA 2X7BA 1FBVA 1NE9A 4U5YA 3IO1A 3IWWA 4KSFA 5EBVA 4CZ1A 4AXVA 2Z10A 3KRVA 2B3VA 1M44A 1Y0YA 1GHEA 2B4DB 4PXCA 3FXTA 2CTBA 3GB0A 4Q36A 4IIYA 2OLSA 1CJWA 2PJAA 4B5PB 2F7VA 2B4BA 1QSRA 5HKZA 2XEJA 4UF4A 5F49A 3BXMA 1S7NA 4NSQA 4MMOA 4C7HA 2EUIA 4NGPA 3FX6A 4M6GA 1V6CA 1XJOA 3SI2A 1GYTA 2P6FA 3MRUA 1A2ZA 1YSJA 3EY5A 3KR5A 1XFOA 2NYQA 4KORA 4NCZA 4B11A 1XF1A 3EZBA 3PFVA 5JQ4A 1ON0A 2FVGA 1VHSA 4MCSA 1YVKA 3H8GA 1M4DA 4FD4A 4YGOA 2REFA 1NSLA 3UY5A 3VWEA 4B14A 1I1DA 1QSMA 1IY7A 3GY9A 3U1BA 3GUXA 3K9TA 4WJBA 4YFJA 1HDUA 4JJXA 5DWNA 2GREA 1BO4A 4MHZA 4P44A 4H1HA 2FIAA 2I3CA 3B7IA 5GCNA 4R9MA 2PVVA 3PBBA 2ZEOA 2POKA 2PJCA 2PJ2A 3TC8A 4E8OA 4TJVA 1KC7A 2V8VA 3P2FA 4HNYB 2WYRA 1EE3P 2ANPA 3K2KA 2G3AA 4OIDA 1IGBA 4UCNA 1IYKA 1PU9A 3V7ZA 1ZYMA 1I21A 1AYEA 4M85A 5D8NA 4AVBA 3TO6A 4ZX8A 2J9AA 4F9VA 4R76A 2HB6A 5K8NA 4J3GA 1YQEA 1Z8WA 2ZOGA 2PJ7A 1TKJA 2YNDA 4AB7A 3NOJA 4C9UA 2PE3A 2D4PA 5J8FA 3FECA 5FD8A 1NXJA 4MJXA 3DDDA 2QVPA 3CPAA 2XEIA 8CPAA 2XPLA 3QAHA 6CPAA 4MFKA 4NGTA 2AFOA 3FVLA 2O53A 3VATA 2G0BA 2O28A 1VI4A 3OWCA 2AUNA 3EZEA 4MJ8A 5J8CA 3D4UA 2Y1NA 1WJTA 2ZW4A 4ZY0A 3BI0A 1CP6A 4P45A 4HNWB 3T9YA 4UIAA 5LRKA 4E0AA 1GGOA 1N71A 4KOSA 4XNHB 1XE4A 3D7DA 4UCPA 4JLYA 5LYIA 4O23A 3GJZA 2AFSA 1HEEA 3B3TA 3BJ8A 3P2HA 4GPLB 1TF8A 2Z3MA 4UWJA 4U9YA 4C8UA 3R1KA 2AJ6A 3R96A 3TOBA 2WUUA 1P4NA 5HVGA 2HWGA 2IL4A 3T0TA 2CY2A 3T90A 4G1PA 4HKFA 2I79A 2FL4A 3DGVA 2Z3OA 3TLBA 3B3SA 2V8GA 4CAWA 1KEEB 3TLEA 5JVLA 4JD6A 3TLGB 3TO9A 3TOAA 5EC4A 3FNCA 4AVCA 2OR4A 1B6BA 2PVWA 3O8ZA 1IU8A 5CPAA 3KGQA 3BUNB 5ISVA 2F8HA 3EC4A 3R9EA 2FE7A 1IYLA 4CYQA 4A4CA 2ZW5A 1ARLA 4B10A 1I12A 3D2MA 1VIXA 5KTDA 1CE8B 2V8HA 3LD2A 2Q44A 2Q4VA 1FNOA 1S7FA 3ZZIA 2PQ8A 2B3UA 1LAMA 3FF3A 4QVTA 3IIBA 1F2PA 3LACA 4C8CA 2RB7A 3KHZA 1QMUA 2HC9A 1LAPA 3SJGA 1BPMA 1YVOA 4NF1A 1KUYA 1YX0A 2ZEPA 1YMEA 3I1UA 4UIBA 3N7ZA 3TLYA 4EYSA 4Z65A 4X3RA 1B87A 4QUSA 4A39A 1DE4C 3GLJA 5CNPA 2MP0A 1XRYA 3EZAA 5AG7A 1WVMA 2PJ1A 4Y49B 1OBRA 4J0NA 1MJAA 2Q0YA 3T05A 4QBJA 1ELLP 2Q04A 2HUZA 2VKZG 1S7KA 3F5BA 4P4JA 4C2XA 5K8OA 1DIKA 4MCQA 4FD5A 4ZI6A 4C8FA 3RBUA 1FY7A 4A4BA 1TXRA 3PB4X 2C6PA 3S6KA 5IV0A 5F47A 3JRUA 4NGQA 2ZELA 4ORFA 3GIUA 2PIYA 1LFWA 4CDKA 3BUMB 1AUGA 2B58A 2EWBA 3TYXA 3VWDA 3G8WA 2VQYA 4PK2A 1T36B 2OZUA 2YGWA 3EXNA 1YLEA 2PJ5A 2ABZA 2RFHA 1TKHA 1VKCA 2GIVA 1VHEA 2EVNA 2PDOA 2Z3NA 4MHYA 2YNCC 4R3KA 4BPWB 4B6ZA 1ZG7A 1Z5RA 3R9GA 3S9MA 2DIKA 3PRTA 4MI1A 4CRYB 2VZYA 2JLMA 4GM5A 2Q7SA 4R3LA 1Y9KA 3VH9A 4CAXA 2GE3A 4R6TA 1XOVA 1R61A 3PB6X 3FRMA 3JUWA 4TWEA 3B3WA 5HKWA 4K3NA 3RYOA 4C2ZA 1LRZA 1Y0RA 2J8MA 3D7HA 4OAEA 3VRRA 2C5QA 2PCNA 3KL9A 3IGRA 1L0CA 3BUOB 4KVXA 3FH4A 1CP7A 4I49A 4PXBA 3K9UA 4A37A 4DNCA 2X0SA 1XIXA 2AFXA 1YR0A 2FS5A 1Z4EA 2WZNA 4H2KA 4C7IA 2ZEFA 3EO4A 2EO8A 3RAMA 3LMSA 2C6CA 5A27A 4ZY1A 4KS9A 4UA3A 4HPSA 3ZNIA 3LODA 3D7FA 2Z3PA 3ISZA 3N5FA 2RC4A 2ZXVA 4PSWA 5LYFA 4FD6A 3RZAA 1PYTB 3TE4A 2AE6A 1YLOA 1QSNA 1KWMA 2VXKA 4COGA 2Y0MA 3IEHA 3D68A 3PP9A 2ZW7A 2EZBA 4Q7AA 3HPGG 1M4IA 2PJ8A 1PUAA 4MCPA 4KOVA 4NXYA 3D3SA 4A33A 2R8VA 1ZRSA 1KBLA 2VEZA 4TJXA 1RTQA 1TF9A 4R87A 1R3NA 2CNMA 2OZHA 5HVHA 2JBJA 2R1IA 4UFWA 4JXRA 1JDEA 3R9FA 5LRGA 4ZGYB 1BLLE 3RO0A 4KOYA 2NSMA 4ZYQA 2Y1MA 1FT7A 4AVAA 5AXIA 4FWUA 1QQ9A 4PK3A 1ZG8A
chains in the Genus database with same CATH topology
2V77A 3ICUA 3D66A 2AFZA 3CT9A 3PB7X 4R8FA 5K8PA 1VHOA 3SJEA 1ZLIA 2PJ4A 3H8FA 3HUVA 3NH5A 4YU9A 2EK9A 4C9EA 2CTCA 3T8WA 2BO9A 1HDQA 3FEEA 1M4LA 5D29A 4NGNA 4MHNA 2IJZA 2Q51A 3D7GA 2Q43A 4OIWA 4R7MA 3TX8A 4YWYA 2PJBA 3B3CA 3ISXA 3I74A 3B2YA 4PXEA 4F8ZA 4RUHA 2GLFA 3CDXA 1F57A 3S9NA 5JM6A 2PJ9A 2PJ6A 2GP4A 1VGYA 2EK8A 5ELYA 3SI1A 1BPNA 3PEIA 3PB8X 3SJXA 3NH4A 5LYDA 1ZG9A 1PCAA 2AFUA 7CPAA 3MN8A 4EWTA 3IJ3A 4OC4A 4OKOA 3IFEA 1CG2A 4MCRA 2XEGA 2BOAA 2V8DA 5I4MA 4IK2A 2OOTA 2VL1A 5IB9A 4DYOA 5LRJA 4P4EA 3PB9X 4IHMA 3SI0A 2ZEHA 5THWA 3V38A 3VTAA 4MXUA 2QYVA 1Y7EA 2PJ0A 4OC1A 1AMPA 4NJQA 2DEAA 4OC2A 2JEWA 3B3VA 1ZLHA 4NGMA 2PJ3A 1UWYA 1H8LA 4C99A 1LCPA 5JH9A 3FJUA 4OC0A 4C84A 4P6YA 5J1QA 4BD9A 4C86A 4YN3A 1YW4A 4OP4A 4C8AA 2CIJA 1NSAA 5CBMA 4P4BA 1TKFA 3DLJA 1ARMA 3NFZA 4A94A 4P10A 2IQ6A 1Z8LA 3LWUA 4JZ0A 4X8IA 4UEEA 2G9DA 3KR4A 2PIZA 4PPZA 4CPAA 5DS0A 4C85A 4C9RA 2ZEDA 1CBXA 4JYWA 2CF4A 3KQZA 2AFMA 3BI1A 3KASA 1LANA 4WWVA 4FBEA 5F09A 3NA6A 1XMBA 4OC5A 1DTDA 2IMOA 3KQXA 2ZENA 1BAVA 4TNUA 2ZEMA 3PBEA 4C9AA 4EMEA 3EIFA 1XBUA 4C8TA 3KHXA 2PCUA 4LQGA 1Z2LA 4ONWA 4A38A 3KZWA 4ZY2A 3HLPA 3CPXA 3KI9A 1Q7LA 1F2OA 3BHXA 2Q4ZA 4IAVA 1CPXA 4ZX9A 4W9YA 2O4HA 4NFRA 3WC6A 4MHPA 3WC5A 3SJFA 3FEDA 4P4IA 4CDJA 4MRIA 3PFEA 5LYLA 2GLJA 4NGSA 5JGFA 2XEFA 4FAIA 2GU2A 3I6SA 1YW6A 5HXDA 4NGRA 4P4DA 1JQGA 4DJLA 4KSIA 4C9VA 2PRQA 2ZOFA 4PQAA 2BCOA 4UEFA 1ELMP 3L2NA 5IR2A 5HVFA 4FUUA 4UEZA 1R43A 2AFWA 1CX8A 3S9LA 4X2TA 3WT4A 3WC7A 5K8MA 4C8PA 2C6GA 2QJ8A 3VARA 4KNGE 4F9UA 4EFDA 4OMEA 3B35A 3NH8A 1CPSA 2ZEGA 3PFOA 3H8EA 4P4FA 3QNVA 3D67A 2JBKA 4PXDA 3WABA 3IC1A 1LOKA 4DUKA 2C1CA 1Y9ZA 3FMCA 4OC3A 4NJRA 3IO1A 3IWWA 4AXVA 1Y0YA 4PXCA 2CTBA 3GB0A 2PJAA 2F7VA 4UF4A 2XEJA 3BXMA 4MMOA 3FX6A 4NGPA 1V6CA 1XJOA 3SI2A 3MRUA 1GYTA 1YSJA 3KR5A 1XFOA 2NYQA 1XF1A 2FVGA 3H8GA 4MCSA 1IY7A 3GUXA 3K9TA 4WJBA 1HDUA 2GREA 4MHZA 4P44A 2I3CA 3B7IA 2PVVA 3PBBA 2ZEOA 2POKA 2PJCA 2PJ2A 3TC8A 4TJVA 2V8VA 2WYRA 1EE3P 2ANPA 3K2KA 4OIDA 1IGBA 3V7ZA 1AYEA 5D8NA 4ZX8A 2J9AA 4F9VA 4R76A 2HB6A 5K8NA 2ZOGA 2PJ7A 1TKJA 4C9UA 2PE3A 3FECA 2QVPA 3CPAA 2XEIA 8CPAA 6CPAA 3VATA 4NGTA 2AFOA 3FVLA 2O53A 3D4UA 4ZY0A 3BI0A 1CP6A 4P45A 4UIAA 5LRKA 3D7DA 5LYIA 4O23A 3B3TA 2AFSA 1HEEA 1TF8A 4C8UA 5HVGA 4G1PA 3DGVA 3B3SA 2V8GA 2OR4A 2PVWA 5CPAA 3KGQA 2F8HA 1ARLA 1VIXA 2V8HA 1FNOA 1LAMA 3FF3A 3IIBA 1F2PA 4C8CA 2RB7A 3KHZA 1QMUA 2HC9A 1LAPA 3SJGA 1BPMA 4UIBA 2ZEPA 1YMEA 3I1UA 4Z65A 4X3RA 4A39A 1DE4C 3GLJA 1XRYA 1WVMA 2PJ1A 1OBRA 1ELLP 4P4JA 5K8OA 4C8FA 4MCQA 4ZI6A 3RBUA 1TXRA 3PB4X 2C6PA 3JRUA 4NGQA 2ZELA 2PIYA 1LFWA 4CDKA 2EWBA 2PJ5A 2ABZA 2RFHA 1TKHA 1VHEA 4MHYA 4B6ZA 1ZG7A 1Z5RA 3S9MA 3PRTA 4GM5A 3VH9A 4R6TA 3PB6X 4TWEA 3B3WA 4K3NA 1Y0RA 3D7HA 2C5QA 3KL9A 3FH4A 1CP7A 4PXBA 4A37A 2AFXA 2WZNA 4H2KA 2ZEFA 3RAMA 3LMSA 2C6CA 4ZY1A 3D7FA 3ISZA 3N5FA 5LYFA 3RZAA 1PYTB 1YLOA 1KWMA 3IEHA 3D68A 4Q7AA 2PJ8A 4MCPA 4TJXA 1RTQA 1TF9A 1R3NA 5HVHA 2JBJA 5LRGA 1BLLE 2NSMA 4ZYQA 1FT7A 2ZEEA 4FWUA 1QQ9A 1ZG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V77 A;  3ICU A;  3D66 A;  2AFZ A;  3CT9 A;  3PB7 X;  4R8F A;  5K8P A;  1VHO A;  3SJE A;  1ZLI A;  2PJ4 A;  3H8F A;  3HUV A;  3NH5 A;  4YU9 A;  2EK9 A;  4C9E A;  2CTC A;  3T8W A;  2BO9 A;  1HDQ A;  3FEE A;  1M4L A;  5D29 A;  4NGN A;  4MHN A;  2IJZ A;  2Q51 A;  3D7G A;  2Q43 A;  4OIW A;  4R7M A;  3TX8 A;  4YWY A;  2PJB A;  3B3C A;  3ISX A;  3I74 A;  3B2Y A;  4PXE A;  4F8Z A;  4RUH A;  2GLF A;  3CDX A;  1F57 A;  3S9N A;  5JM6 A;  2PJ9 A;  2PJ6 A;  1VGY A;  2EK8 A;  5ELY A;  3SI1 A;  1BPN A;  3PEI A;  3PB8 X;  3SJX A;  3NH4 A;  5LYD A;  1ZG9 A;  1PCA A;  2AFU A;  7CPA A;  3MN8 A;  4EWT A;  3IJ3 A;  4OC4 A;  4OKO A;  3IFE A;  1CG2 A;  4MCR A;  2XEG A;  2BOA A;  2V8D A;  5I4M A;  4IK2 A;  2OOT A;  2VL1 A;  5IB9 A;  4DYO A;  5LRJ A;  4P4E A;  3PB9 X;  4IHM A;  3SI0 A;  2ZEH A;  5THW A;  3V38 A;  3VTA A;  4MXU A;  2QYV A;  1Y7E A;  2PJ0 A;  4OC1 A;  1AMP A;  4NJQ A;  2DEA A;  4OC2 A;  2JEW A;  3B3V A;  1ZLH A;  4NGM A;  2PJ3 A;  1UWY A;  1H8L A;  4C99 A;  1LCP A;  5JH9 A;  3FJU A;  4OC0 A;  4C84 A;  4P6Y A;  5J1Q A;  4BD9 A;  4C86 A;  4YN3 A;  1YW4 A;  4OP4 A;  4C8A A;  2CIJ A;  1NSA A;  5CBM A;  4P4B A;  1TKF A;  3DLJ A;  1ARM A;  3NFZ A;  4A94 A;  4P10 A;  2IQ6 A;  1Z8L A;  3LWU A;  4JZ0 A;  4X8I A;  4UEE A;  2G9D A;  3KR4 A;  2PIZ A;  4PPZ A;  4CPA A;  5DS0 A;  4C85 A;  4C9R A;  2ZED A;  1CBX A;  4JYW A;  2CF4 A;  3KQZ A;  2AFM A;  3BI1 A;  3KAS A;  1LAN A;  4WWV A;  4FBE A;  5F09 A;  3NA6 A;  1XMB A;  4OC5 A;  1DTD A;  2IMO A;  3KQX A;  2ZEN A;  1BAV A;  4TNU A;  2ZEM A;  3PBE A;  4C9A A;  4EME A;  3EIF A;  1XBU A;  4C8T A;  3KHX A;  2PCU A;  4LQG A;  1Z2L A;  4ONW A;  4A38 A;  3KZW A;  4ZY2 A;  3HLP A;  3CPX A;  3KI9 A;  1Q7L A;  1F2O A;  3BHX A;  2Q4Z A;  4IAV A;  1CPX A;  4ZX9 A;  4W9Y A;  2O4H A;  4NFR A;  3WC6 A;  4MHP A;  3WC5 A;  3SJF A;  3FED A;  4P4I A;  4CDJ A;  4MRI A;  3PFE A;  5LYL A;  2GLJ A;  4NGS A;  5JGF A;  2XEF A;  4FAI A;  2GU2 A;  3I6S A;  1YW6 A;  5HXD A;  4NGR A;  4P4D A;  1JQG A;  4DJL A;  4KSI A;  4C9V A;  2PRQ A;  2ZOF A;  4PQA A;  2BCO A;  4UEF A;  1ELM P;  3L2N A;  5HVF A;  4FUU A;  4UEZ A;  1R43 A;  2AFW A;  1CX8 A;  3S9L A;  4X2T A;  3WT4 A;  3WC7 A;  5K8M A;  4C8P A;  2C6G A;  2QJ8 A;  3VAR A;  4KNG E;  4F9U A;  4EFD A;  4OME A;  3B35 A;  3NH8 A;  1CPS A;  2ZEG A;  3PFO A;  3H8E A;  4P4F A;  3QNV A;  3D67 A;  2JBK A;  4PXD A;  3WAB A;  3IC1 A;  1LOK A;  4DUK A;  2C1C A;  1Y9Z A;  3FMC A;  4OC3 A;  4NJR A;  3IO1 A;  3IWW A;  4AXV A;  1Y0Y A;  4PXC A;  2CTB A;  3GB0 A;  2PJA A;  2F7V A;  4UF4 A;  2XEJ A;  3BXM A;  4MMO A;  3FX6 A;  4NGP A;  1V6C A;  1XJO A;  3SI2 A;  3MRU A;  1GYT A;  1YSJ A;  3KR5 A;  1XFO A;  2NYQ A;  1XF1 A;  2FVG A;  3H8G A;  4MCS A;  1IY7 A;  3GUX A;  3K9T A;  4WJB A;  1HDU A;  2GRE A;  4MHZ A;  4P44 A;  2I3C A;  3B7I A;  2PVV A;  3PBB A;  2ZEO A;  2POK A;  2PJC A;  2PJ2 A;  3TC8 A;  4TJV A;  2V8V A;  2WYR A;  1EE3 P;  2ANP A;  3K2K A;  4OID A;  1IGB A;  3V7Z A;  1AYE A;  5D8N A;  4ZX8 A;  2J9A A;  4F9V A;  4R76 A;  2HB6 A;  5K8N A;  2ZOG A;  2PJ7 A;  1TKJ A;  4C9U A;  2PE3 A;  3FEC A;  2QVP A;  3CPA A;  2XEI A;  8CPA A;  6CPA A;  3VAT A;  4NGT A;  2AFO A;  3FVL A;  2O53 A;  3D4U A;  4ZY0 A;  3BI0 A;  1CP6 A;  4P45 A;  4UIA A;  5LRK A;  3D7D A;  5LYI A;  4O23 A;  3B3T A;  2AFS A;  1HEE A;  1TF8 A;  4C8U A;  5HVG A;  4G1P A;  3DGV A;  3B3S A;  2V8G A;  2OR4 A;  2PVW A;  5CPA A;  3KGQ A;  2F8H A;  1ARL A;  1VIX A;  2V8H A;  1FNO A;  1LAM A;  3FF3 A;  3IIB A;  1F2P A;  4C8C A;  2RB7 A;  3KHZ A;  1QMU A;  2HC9 A;  1LAP A;  3SJG A;  1BPM A;  4UIB A;  2ZEP A;  1YME A;  3I1U A;  4Z65 A;  4X3R A;  4A39 A;  1DE4 C;  3GLJ A;  1XRY A;  1WVM A;  2PJ1 A;  1OBR A;  1ELL P;  4P4J A;  5K8O A;  4C8F A;  4MCQ A;  4ZI6 A;  3RBU A;  1TXR A;  3PB4 X;  2C6P A;  3JRU A;  4NGQ A;  2ZEL A;  2PIY A;  1LFW A;  4CDK A;  2EWB A;  2PJ5 A;  2ABZ A;  2RFH A;  1TKH A;  1VHE A;  4MHY A;  4B6Z A;  1ZG7 A;  1Z5R A;  3S9M A;  3PRT A;  4GM5 A;  3VH9 A;  4R6T A;  3PB6 X;  4TWE A;  3B3W A;  4K3N A;  1Y0R A;  3D7H A;  3KL9 A;  3FH4 A;  1CP7 A;  4PXB A;  4A37 A;  2AFX A;  2WZN A;  4H2K A;  2ZEF A;  3RAM A;  3LMS A;  2C6C A;  4ZY1 A;  3D7F A;  3ISZ A;  3N5F A;  5LYF A;  3RZA A;  1PYT B;  1YLO A;  1KWM A;  3IEH A;  3D68 A;  4Q7A A;  2PJ8 A;  4MCP A;  4TJX A;  1RTQ A;  1TF9 A;  1R3N A;  5HVH A;  2JBJ A;  5LRG A;  1BLL E;  2NSM A;  4ZYQ A;  1FT7 A;  2ZEE A;  4FWU A;  1QQ9 A;  1ZG8 A; 
#chains in the Genus database with same CATH topology
 2Z3K A;  4AG9 A;  4CAV A;  3OAK A;  2V77 A;  3ICU A;  3D66 A;  5G20 A;  4CYP A;  1RO5 A;  1ZL0 A;  3CXS A;  1Z4R A;  2AFZ A;  3SXN A;  1YVH A;  2G3T A;  3CT9 A;  5G21 A;  4BBH A;  3PB7 X;  4IIX A;  4XPD B;  4R8F A;  5K8P A;  2ARH A;  1EZA A;  1VHO A;  3SJE A;  1ZLI A;  2PJ4 A;  3H8F A;  3HUV A;  3TTH A;  3NH5 A;  5IB0 A;  4KOW A;  2DXQ A;  4YU9 A;  3QB8 A;  1JDB C;  2EK9 A;  4XPD C;  4C9E A;  2P6G A;  1S60 A;  2CTC A;  2D0P A;  3GKR A;  3T8W A;  1S7L A;  2BO9 A;  5AG6 A;  1HDQ A;  3FEE A;  1M4L A;  2VI7 A;  5D29 A;  3IWG A;  5F1Y A;  2NMT A;  2XPN A;  4CRZ B;  4NGN A;  2JDD A;  4MHN A;  2IJZ A;  2Q51 A;  4QB9 A;  3PT1 A;  4F0Y A;  5C88 A;  3K4I A;  3ZJ0 A;  2A4N A;  1EZB A;  4ZBG A;  3D7G A;  1C3O B;  2REE A;  2Q43 A;  4M6I A;  4OIW A;  2B5G A;  2VZZ A;  3BJ7 A;  4R7M A;  4XNH C;  3TX8 A;  4YWY A;  4CYO A;  2PJB A;  3B3C A;  4B13 A;  1S3Z A;  2DF5 A;  3ISX A;  1P0H A;  3I74 A;  3B2Y A;  4PXE A;  4F8Z A;  2Q7B A;  4RUH A;  1NBW A;  2GLF A;  2PR1 A;  3CDX A;  4CYN A;  3HMJ G;  4H6Z A;  1F57 A;  3S9N A;  3RNZ A;  2D0O A;  4MY0 A;  5JM6 A;  2PJ9 A;  2PJ6 A;  3SXO A;  2GP4 A;  1VGY A;  1CM0 A;  3GYA A;  3SHP A;  2EK8 A;  5ELY A;  1QST A;  2JEV A;  4BMH A;  3EFA A;  2ZPA A;  2OZG A;  2P6E A;  1B47 A;  1BPN A;  2PRB A;  3PEI A;  3PB8 X;  3SJX A;  3NH4 A;  1CS0 B;  4E5S A;  4CGO A;  2QML A;  4KZT A;  1J4J A;  2WPW A;  2ZW6 A;  5LYD A;  1ZG9 A;  1PCA A;  2AFU A;  5HH1 A;  3MN8 A;  4EWT A;  7CPA A;  3G23 A;  4M3S A;  1XMT A;  3IJ3 A;  1UFH A;  4OC4 A;  2FCK A;  3IFE A;  4BPX B;  4OKO A;  1A9X B;  4ONU A;  1CG2 A;  4MCR A;  1WWZ A;  4LQ6 A;  2XEG A;  2BOA A;  2V8D A;  5I4M A;  4IK2 A;  2OOT A;  1QSO A;  3NE8 A;  4A30 A;  1RXT A;  1TIQ A;  2B4D A;  2R7H A;  5H84 A;  2VBQ A;  2VL1 A;  5G22 A;  5IB9 A;  5H86 A;  4DYO A;  3H5Z A;  5LRJ A;  2CNT A;  4P4E A;  3PB9 X;  4IHM A;  3SI0 A;  1Y9W A;  4X5K A;  3IU2 A;  3F9K C;  1YK3 A;  2ZEH A;  2GFQ A;  3BUX B;  3MGD A;  4LX9 A;  4Y49 C;  5I0C A;  2D4O A;  3G3S A;  5THW A;  3PLF B;  3T5M A;  4COB A;  3U88 C;  2GAN A;  3V38 A;  3VTA A;  4MXU A;  2QYV A;  1XEB A;  4A31 A;  3FIX A;  1KUX A;  1YRE A;  4C68 A;  1Y7E A;  2PJ0 A;  4OC1 A;  3D8P A;  4QC6 A;  3SI1 A;  3W91 A;  1ZO0 A;  2CXA A;  1AMP A;  2R98 A;  2C27 A;  1Z8T A;  2OB0 A;  3JVN A;  4NJQ A;  3FB3 A;  4B12 A;  2DEA A;  4H6U A;  4PSX A;  1BOB A;  4OC2 A;  2JEW A;  3B3V A;  2XPO A;  4KUA A;  3TLA A;  4UFV A;  3R95 A;  2H5M A;  3D2P A;  1KUV A;  1ZLH A;  4IF5 A;  2B0A A;  4NGM A;  3TLZ A;  4KOU A;  5JYB A;  3BLN A;  3A9L A;  2YJT A;  2PJ3 A;  1UWY A;  4KOX A;  4YRH A;  3E0K A;  1H8L A;  5AG4 A;  2DPT A;  2J8N A;  3VRO A;  2FT0 A;  2PSW A;  4C99 A;  4MFQ A;  2WSA A;  3OP0 A;  1LCP A;  5C82 A;  4XPK A;  5JH9 A;  3FJU A;  4OC0 A;  4C84 A;  3VRP A;  1MJ9 A;  4P6Y A;  5J1Q A;  4BD9 A;  4C86 A;  4YN3 A;  5DWM A;  3CXP A;  1YW4 A;  4OP4 A;  4C8A A;  5BY0 A;  2CIJ A;  1NSA A;  4KSA A;  3TT2 A;  2EBJ A;  2ATR A;  1R57 A;  4MFL A;  4UBR A;  4CGN A;  5CBM A;  4P4B A;  3F0A A;  2ZEE A;  4UFX A;  3DNS A;  1TKF A;  3DLJ A;  2HV2 A;  2FM4 A;  1ARM A;  3TCV A;  3NFZ A;  4CGM A;  4A94 A;  4E94 A;  2WPX A;  4P10 A;  2J8R A;  2IQ6 A;  2BSW A;  1Z8L A;  1KZF A;  3LWU A;  2BEI A;  2ODF A;  4JZ0 A;  4MFP A;  2CNS A;  4MY3 A;  1V0C A;  2G9D A;  4UEE A;  3KR4 A;  4X8I A;  4CAF A;  5A28 A;  2EZA A;  2PIZ A;  4PPZ A;  4A95 A;  4CPA A;  2BL1 A;  3CXQ A;  5DS0 A;  3SR3 A;  4C85 A;  2Z0Z A;  3NE7 A;  4C9R A;  2ZED A;  2E28 A;  5JPH A;  1U6M A;  1IIC A;  4PV6 A;  1CBX A;  3WR7 A;  4MHD A;  4JYW A;  3TLG A;  4INJ A;  2CBL A;  2XPP A;  1YGH A;  2CF4 A;  1Z9E A;  2UV8 G;  2AFM A;  3KQZ A;  3BI1 A;  2Z11 A;  5EMI A;  2HI6 A;  5BWA B;  4CO9 A;  3KAS A;  2Z3L A;  1LAN A;  4RS2 A;  3PGP A;  4CGP A;  4WWV A;  4FBE A;  4Q38 A;  5KTA A;  5F09 A;  3NA6 A;  3NFQ A;  1M6V B;  1XMB A;  4OC5 A;  1DTD A;  4A2Z A;  2IMO A;  1Q2D A;  5F48 A;  4II9 A;  2K5T A;  3KQX A;  1M4G A;  2R82 A;  4H89 A;  1NMT A;  2ZEN A;  1BAV A;  4TNU A;  3I9S A;  2ZEM A;  3PBE A;  5F9M A;  5J3X A;  4C9A A;  4EME A;  3EIF A;  3DR6 A;  4KUB A;  5G1Z A;  1XBU A;  4C8T A;  3KHX A;  1MJB A;  2PCU A;  2QIR A;  4L89 A;  2YJV A;  4CAE A;  5IX3 A;  2DLA A;  4U9Z A;  4LQG A;  1Z2L A;  4ONW A;  5AGE A;  4JWP A;  4UCM A;  4A38 A;  3KZW A;  4JXQ A;  5K99 A;  3V8I A;  4M6H A;  2QEC A;  1IB1 E;  4ZY2 A;  3HLP A;  5FVJ A;  3CPX A;  1Y7R A;  3KI9 A;  1Q7L A;  1F2O A;  3IWE A;  3HPH E;  2HRO A;  3BHX A;  2Q4Z A;  4IAV A;  1CPX A;  4ZX9 A;  1K4J A;  2N3A B;  2B4J C;  4W9Y A;  2O4H A;  4NFR A;  4GS4 A;  1VBG A;  5F5X A;  2YNC A;  4KLW A;  1X12 A;  3WC6 A;  4C2Y A;  3T07 A;  1MK4 A;  4UWI A;  4MHP A;  3C26 A;  4A32 A;  3TO7 A;  3CZX A;  3WC5 A;  1IID A;  2FSR A;  3KKW A;  2PR8 A;  4MI4 A;  4B5O A;  3SJF A;  3FED A;  4P4I A;  4XPL A;  2KCW A;  4K30 A;  3S6H A;  3S6G A;  4CDJ A;  4MRI A;  2BUE A;  3PFE A;  5LYL A;  2F5I A;  1EO0 A;  2GLJ A;  4NGS A;  4OLL A;  4HNX B;  3B8G A;  5E96 A;  5JGF A;  1Q5X A;  2DPS A;  2XEF A;  4FAI A;  5HKY A;  2GU2 A;  4F0X A;  3QAY A;  4F6A A;  4LUA A;  4MFJ A;  3I6S A;  1Z8X A;  2FIW A;  1IOI A;  1YW6 A;  4KVM E;  4OAD A;  4B5P A;  5HXD A;  4NGR A;  4P4D A;  4RR2 B;  3VRQ A;  1JQG A;  4FD7 A;  4KSI A;  3W6X A;  2I00 A;  4DJL A;  4L8A A;  1Q2Y A;  4IUS A;  1IOF A;  1SQH A;  2JDC A;  4RI1 A;  3FBU A;  2P0W A;  4C9V A;  2PRQ A;  2ZOF A;  4CS0 B;  5F46 A;  4NEX A;  4PQA A;  2FXF A;  4KOT A;  2BCO A;  4UEF A;  1ELM P;  3L2N A;  5IR2 A;  5HVF A;  4FUU A;  4UEZ A;  1R43 A;  2AFW A;  3FYN A;  1CX8 A;  3VGO A;  3S9L A;  4CGL A;  2YNE A;  3I3G A;  1Z9U A;  1XF8 A;  4X2T A;  3WT4 A;  3OB1 B;  1S5K A;  4JVO A;  3OB2 B;  3PZJ A;  3W6S A;  3WC7 A;  1VBH A;  1M1D A;  3BUW B;  5K8M A;  1JWQ A;  5AG5 A;  2AUM A;  5F13 A;  4C8P A;  2B5G B;  2C6G A;  4KVO E;  2QJ8 A;  3VAR A;  4EVY A;  4KNG E;  2PC1 A;  4F9U A;  4KLV A;  3DR8 A;  3F8K A;  4EFD A;  4R57 A;  3TLC A;  4E2A A;  4OME A;  1J3L A;  3B35 A;  3NH8 A;  1CPS A;  2OH1 A;  2ZEG A;  4BPU B;  4BTF A;  1WK4 A;  2OU2 A;  3PFO A;  4BIN A;  4M8D A;  3H8E A;  4P4F A;  3QNV A;  1C30 B;  1Q2C A;  3D67 A;  2JBK A;  1OZP A;  3C8O A;  4PXD A;  3WAB A;  3IC1 A;  4RN7 A;  5HMN A;  1LOK A;  3JTK A;  4DUK A;  1BXR B;  2EZC A;  4MFZ A;  3VRN A;  4GXH A;  4AG7 A;  5KTC A;  2C1C A;  3TFY A;  1X10 A;  1Y9Z A;  3FMC A;  4OC3 A;  2HQY A;  2Q4Y A;  3DSB A;  3IU1 A;  4NJR A;  3H4Q A;  3S6F A;  4MBU A;  2X7B A;  1FBV A;  1NE9 A;  4U5Y A;  3IO1 A;  3IWW A;  4KSF A;  5EBV A;  4CZ1 A;  4AXV A;  2Z10 A;  3KRV A;  2B3V A;  1M44 A;  1Y0Y A;  1GHE A;  2B4D B;  4PXC A;  3FXT A;  2CTB A;  3GB0 A;  4Q36 A;  4IIY A;  2OLS A;  1CJW A;  2PJA A;  4B5P B;  2F7V A;  2B4B A;  1QSR A;  5HKZ A;  2XEJ A;  4UF4 A;  5F49 A;  3BXM A;  1S7N A;  4NSQ A;  4MMO A;  4C7H A;  2EUI A;  4NGP A;  3FX6 A;  4M6G A;  1V6C A;  1XJO A;  3SI2 A;  1GYT A;  2P6F A;  3MRU A;  1A2Z A;  1YSJ A;  3EY5 A;  3KR5 A;  1XFO A;  2NYQ A;  4KOR A;  4NCZ A;  4B11 A;  1XF1 A;  3EZB A;  3PFV A;  5JQ4 A;  1ON0 A;  2FVG A;  1VHS A;  4MCS A;  1YVK A;  3H8G A;  1M4D A;  4FD4 A;  4YGO A;  2REF A;  1NSL A;  3UY5 A;  3VWE A;  4B14 A;  1I1D A;  1QSM A;  1IY7 A;  3GY9 A;  3U1B A;  3GUX A;  3K9T A;  4WJB A;  4YFJ A;  1HDU A;  4JJX A;  5DWN A;  2GRE A;  1BO4 A;  4MHZ A;  4P44 A;  4H1H A;  2FIA A;  2I3C A;  3B7I A;  5GCN A;  4R9M A;  2PVV A;  3PBB A;  2ZEO A;  2POK A;  2PJC A;  2PJ2 A;  3TC8 A;  4E8O A;  4TJV A;  1KC7 A;  2V8V A;  3P2F A;  4HNY B;  2WYR A;  1EE3 P;  2ANP A;  3K2K A;  2G3A A;  4OID A;  1IGB A;  4UCN A;  1IYK A;  1PU9 A;  3V7Z A;  1ZYM A;  1I21 A;  1AYE A;  4M85 A;  5D8N A;  4AVB A;  3TO6 A;  4ZX8 A;  2J9A A;  4F9V A;  4R76 A;  2HB6 A;  5K8N A;  4J3G A;  1YQE A;  1Z8W A;  2ZOG A;  2PJ7 A;  1TKJ A;  2YND A;  4AB7 A;  3NOJ A;  4C9U A;  2PE3 A;  2D4P A;  5J8F A;  3FEC A;  5FD8 A;  1NXJ A;  4MJX A;  3DDD A;  2QVP A;  3CPA A;  2XEI A;  8CPA A;  2XPL A;  3QAH A;  6CPA A;  4MFK A;  4NGT A;  2AFO A;  3FVL A;  2O53 A;  3VAT A;  2G0B A;  2O28 A;  1VI4 A;  3OWC A;  2AUN A;  3EZE A;  4MJ8 A;  5J8C A;  3D4U A;  2Y1N A;  1WJT A;  2ZW4 A;  4ZY0 A;  3BI0 A;  1CP6 A;  4P45 A;  4HNW B;  3T9Y A;  4UIA A;  5LRK A;  4E0A A;  1GGO A;  1N71 A;  4KOS A;  4XNH B;  1XE4 A;  3D7D A;  4UCP A;  4JLY A;  5LYI A;  4O23 A;  3GJZ A;  2AFS A;  1HEE A;  3B3T A;  3BJ8 A;  3P2H A;  4GPL B;  1TF8 A;  2Z3M A;  4UWJ A;  4U9Y A;  4C8U A;  3R1K A;  2AJ6 A;  3R96 A;  3TOB A;  2WUU A;  1P4N A;  5HVG A;  2HWG A;  2IL4 A;  3T0T A;  2CY2 A;  3T90 A;  4G1P A;  4HKF A;  2I79 A;  2FL4 A;  3DGV A;  2Z3O A;  3TLB A;  3B3S A;  2V8G A;  4CAW A;  1KEE B;  3TLE A;  5JVL A;  4JD6 A;  3TLG B;  3TO9 A;  3TOA A;  5EC4 A;  3FNC A;  4AVC A;  2OR4 A;  1B6B A;  2PVW A;  3O8Z A;  1IU8 A;  5CPA A;  3KGQ A;  3BUN B;  5ISV A;  2F8H A;  3EC4 A;  3R9E A;  2FE7 A;  1IYL A;  4CYQ A;  4A4C A;  2ZW5 A;  1ARL A;  4B10 A;  1I12 A;  3D2M A;  1VIX A;  5KTD A;  1CE8 B;  2V8H A;  3LD2 A;  2Q44 A;  2Q4V A;  1FNO A;  1S7F A;  3ZZI A;  2PQ8 A;  2B3U A;  1LAM A;  3FF3 A;  4QVT A;  3IIB A;  1F2P A;  3LAC A;  4C8C A;  2RB7 A;  3KHZ A;  1QMU A;  2HC9 A;  1LAP A;  3SJG A;  1BPM A;  1YVO A;  4NF1 A;  1KUY A;  1YX0 A;  2ZEP A;  1YME A;  3I1U A;  4UIB A;  3N7Z A;  3TLY A;  4EYS A;  4Z65 A;  4X3R A;  1B87 A;  4QUS A;  4A39 A;  1DE4 C;  3GLJ A;  5CNP A;  2MP0 A;  1XRY A;  3EZA A;  5AG7 A;  1WVM A;  2PJ1 A;  4Y49 B;  1OBR A;  4J0N A;  1MJA A;  2Q0Y A;  3T05 A;  4QBJ A;  1ELL P;  2Q04 A;  2HUZ A;  2VKZ G;  1S7K A;  3F5B A;  4P4J A;  4C2X A;  5K8O A;  1DIK A;  4MCQ A;  4FD5 A;  4ZI6 A;  4C8F A;  3RBU A;  1FY7 A;  4A4B A;  1TXR A;  3PB4 X;  2C6P A;  3S6K A;  5IV0 A;  5F47 A;  3JRU A;  4NGQ A;  2ZEL A;  4ORF A;  3GIU A;  2PIY A;  1LFW A;  4CDK A;  3BUM B;  1AUG A;  2B58 A;  2EWB A;  3TYX A;  3VWD A;  3G8W A;  2VQY A;  4PK2 A;  1T36 B;  2OZU A;  2YGW A;  3EXN A;  1YLE A;  2PJ5 A;  2ABZ A;  2RFH A;  1TKH A;  1VKC A;  2GIV A;  1VHE A;  2EVN A;  2PDO A;  2Z3N A;  4MHY A;  2YNC C;  4R3K A;  4BPW B;  4B6Z A;  1ZG7 A;  1Z5R A;  3R9G A;  3S9M A;  2DIK A;  3PRT A;  4MI1 A;  4CRY B;  2VZY A;  2JLM A;  4GM5 A;  2Q7S A;  4R3L A;  1Y9K A;  3VH9 A;  4CAX A;  2GE3 A;  4R6T A;  1XOV A;  1R61 A;  3PB6 X;  3FRM A;  3JUW A;  4TWE A;  3B3W A;  5HKW A;  4K3N A;  3RYO A;  4C2Z A;  1LRZ A;  1Y0R A;  2J8M A;  3D7H A;  4OAE A;  3VRR A;  2C5Q A;  2PCN A;  3KL9 A;  3IGR A;  1L0C A;  3BUO B;  4KVX A;  3FH4 A;  1CP7 A;  4I49 A;  4PXB A;  3K9U A;  4A37 A;  4DNC A;  2X0S A;  1XIX A;  2AFX A;  1YR0 A;  2FS5 A;  1Z4E A;  2WZN A;  4H2K A;  4C7I A;  2ZEF A;  3EO4 A;  2EO8 A;  3RAM A;  3LMS A;  2C6C A;  5A27 A;  4ZY1 A;  4KS9 A;  4UA3 A;  4HPS A;  3ZNI A;  3LOD A;  3D7F A;  2Z3P A;  3ISZ A;  3N5F A;  2RC4 A;  2ZXV A;  4PSW A;  5LYF A;  4FD6 A;  3RZA A;  1PYT B;  3TE4 A;  2AE6 A;  1YLO A;  1QSN A;  1KWM A;  2VXK A;  4COG A;  2Y0M A;  3IEH A;  3D68 A;  3PP9 A;  2ZW7 A;  2EZB A;  4Q7A A;  3HPG G;  1M4I A;  2PJ8 A;  1PUA A;  4MCP A;  4KOV A;  4NXY A;  3D3S A;  4A33 A;  2R8V A;  1ZRS A;  1KBL A;  2VEZ A;  4TJX A;  1RTQ A;  1TF9 A;  4R87 A;  1R3N A;  2CNM A;  2OZH A;  5HVH A;  2JBJ A;  2R1I A;  4UFW A;  4JXR A;  1JDE A;  3R9F A;  5LRG A;  4ZGY B;  1BLL E;  3RO0 A;  4KOY A;  2NSM A;  4ZYQ A;  2Y1M A;  1FT7 A;  4AVA A;  5AXI A;  4FWU A;  1QQ9 A;  4PK3 A;  1ZG8 A; 
#chains in the Genus database with same CATH homology
 2V77 A;  3ICU A;  3D66 A;  2AFZ A;  3CT9 A;  3PB7 X;  4R8F A;  5K8P A;  1VHO A;  3SJE A;  1ZLI A;  2PJ4 A;  3H8F A;  3HUV A;  3NH5 A;  4YU9 A;  2EK9 A;  4C9E A;  2CTC A;  3T8W A;  2BO9 A;  1HDQ A;  3FEE A;  1M4L A;  5D29 A;  4NGN A;  4MHN A;  2IJZ A;  2Q51 A;  3D7G A;  2Q43 A;  4OIW A;  4R7M A;  3TX8 A;  4YWY A;  2PJB A;  3B3C A;  3ISX A;  3I74 A;  3B2Y A;  4PXE A;  4F8Z A;  4RUH A;  2GLF A;  3CDX A;  1F57 A;  3S9N A;  5JM6 A;  2PJ9 A;  2PJ6 A;  2GP4 A;  1VGY A;  2EK8 A;  5ELY A;  3SI1 A;  1BPN A;  3PEI A;  3PB8 X;  3SJX A;  3NH4 A;  5LYD A;  1ZG9 A;  1PCA A;  2AFU A;  7CPA A;  3MN8 A;  4EWT A;  3IJ3 A;  4OC4 A;  4OKO A;  3IFE A;  1CG2 A;  4MCR A;  2XEG A;  2BOA A;  2V8D A;  5I4M A;  4IK2 A;  2OOT A;  2VL1 A;  5IB9 A;  4DYO A;  5LRJ A;  4P4E A;  3PB9 X;  4IHM A;  3SI0 A;  2ZEH A;  5THW A;  3V38 A;  3VTA A;  4MXU A;  2QYV A;  1Y7E A;  2PJ0 A;  4OC1 A;  1AMP A;  4NJQ A;  2DEA A;  4OC2 A;  2JEW A;  3B3V A;  1ZLH A;  4NGM A;  2PJ3 A;  1UWY A;  1H8L A;  4C99 A;  1LCP A;  5JH9 A;  3FJU A;  4OC0 A;  4C84 A;  4P6Y A;  5J1Q A;  4BD9 A;  4C86 A;  4YN3 A;  1YW4 A;  4OP4 A;  4C8A A;  2CIJ A;  1NSA A;  5CBM A;  4P4B A;  1TKF A;  3DLJ A;  1ARM A;  3NFZ A;  4A94 A;  4P10 A;  2IQ6 A;  1Z8L A;  3LWU A;  4JZ0 A;  4X8I A;  4UEE A;  2G9D A;  3KR4 A;  2PIZ A;  4PPZ A;  4CPA A;  5DS0 A;  4C85 A;  4C9R A;  2ZED A;  1CBX A;  4JYW A;  2CF4 A;  3KQZ A;  2AFM A;  3BI1 A;  3KAS A;  1LAN A;  4WWV A;  4FBE A;  5F09 A;  3NA6 A;  1XMB A;  4OC5 A;  1DTD A;  2IMO A;  3KQX A;  2ZEN A;  1BAV A;  4TNU A;  2ZEM A;  3PBE A;  4C9A A;  4EME A;  3EIF A;  1XBU A;  4C8T A;  3KHX A;  2PCU A;  4LQG A;  1Z2L A;  4ONW A;  4A38 A;  3KZW A;  4ZY2 A;  3HLP A;  3CPX A;  3KI9 A;  1Q7L A;  1F2O A;  3BHX A;  2Q4Z A;  4IAV A;  1CPX A;  4ZX9 A;  4W9Y A;  2O4H A;  4NFR A;  3WC6 A;  4MHP A;  3WC5 A;  3SJF A;  3FED A;  4P4I A;  4CDJ A;  4MRI A;  3PFE A;  5LYL A;  2GLJ A;  4NGS A;  5JGF A;  2XEF A;  4FAI A;  2GU2 A;  3I6S A;  1YW6 A;  5HXD A;  4NGR A;  4P4D A;  1JQG A;  4DJL A;  4KSI A;  4C9V A;  2PRQ A;  2ZOF A;  4PQA A;  2BCO A;  4UEF A;  1ELM P;  3L2N A;  5IR2 A;  5HVF A;  4FUU A;  4UEZ A;  1R43 A;  2AFW A;  1CX8 A;  3S9L A;  4X2T A;  3WT4 A;  3WC7 A;  5K8M A;  4C8P A;  2C6G A;  2QJ8 A;  3VAR A;  4KNG E;  4F9U A;  4EFD A;  4OME A;  3B35 A;  3NH8 A;  1CPS A;  2ZEG A;  3PFO A;  3H8E A;  4P4F A;  3QNV A;  3D67 A;  2JBK A;  4PXD A;  3WAB A;  3IC1 A;  1LOK A;  4DUK A;  2C1C A;  1Y9Z A;  3FMC A;  4OC3 A;  4NJR A;  3IO1 A;  3IWW A;  4AXV A;  1Y0Y A;  4PXC A;  2CTB A;  3GB0 A;  2PJA A;  2F7V A;  4UF4 A;  2XEJ A;  3BXM A;  4MMO A;  3FX6 A;  4NGP A;  1V6C A;  1XJO A;  3SI2 A;  3MRU A;  1GYT A;  1YSJ A;  3KR5 A;  1XFO A;  2NYQ A;  1XF1 A;  2FVG A;  3H8G A;  4MCS A;  1IY7 A;  3GUX A;  3K9T A;  4WJB A;  1HDU A;  2GRE A;  4MHZ A;  4P44 A;  2I3C A;  3B7I A;  2PVV A;  3PBB A;  2ZEO A;  2POK A;  2PJC A;  2PJ2 A;  3TC8 A;  4TJV A;  2V8V A;  2WYR A;  1EE3 P;  2ANP A;  3K2K A;  4OID A;  1IGB A;  3V7Z A;  1AYE A;  5D8N A;  4ZX8 A;  2J9A A;  4F9V A;  4R76 A;  2HB6 A;  5K8N A;  2ZOG A;  2PJ7 A;  1TKJ A;  4C9U A;  2PE3 A;  3FEC A;  2QVP A;  3CPA A;  2XEI A;  8CPA A;  6CPA A;  3VAT A;  4NGT A;  2AFO A;  3FVL A;  2O53 A;  3D4U A;  4ZY0 A;  3BI0 A;  1CP6 A;  4P45 A;  4UIA A;  5LRK A;  3D7D A;  5LYI A;  4O23 A;  3B3T A;  2AFS A;  1HEE A;  1TF8 A;  4C8U A;  5HVG A;  4G1P A;  3DGV A;  3B3S A;  2V8G A;  2OR4 A;  2PVW A;  5CPA A;  3KGQ A;  2F8H A;  1ARL A;  1VIX A;  2V8H A;  1FNO A;  1LAM A;  3FF3 A;  3IIB A;  1F2P A;  4C8C A;  2RB7 A;  3KHZ A;  1QMU A;  2HC9 A;  1LAP A;  3SJG A;  1BPM A;  4UIB A;  2ZEP A;  1YME A;  3I1U A;  4Z65 A;  4X3R A;  4A39 A;  1DE4 C;  3GLJ A;  1XRY A;  1WVM A;  2PJ1 A;  1OBR A;  1ELL P;  4P4J A;  5K8O A;  4C8F A;  4MCQ A;  4ZI6 A;  3RBU A;  1TXR A;  3PB4 X;  2C6P A;  3JRU A;  4NGQ A;  2ZEL A;  2PIY A;  1LFW A;  4CDK A;  2EWB A;  2PJ5 A;  2ABZ A;  2RFH A;  1TKH A;  1VHE A;  4MHY A;  4B6Z A;  1ZG7 A;  1Z5R A;  3S9M A;  3PRT A;  4GM5 A;  3VH9 A;  4R6T A;  3PB6 X;  4TWE A;  3B3W A;  4K3N A;  1Y0R A;  3D7H A;  2C5Q A;  3KL9 A;  3FH4 A;  1CP7 A;  4PXB A;  4A37 A;  2AFX A;  2WZN A;  4H2K A;  2ZEF A;  3RAM A;  3LMS A;  2C6C A;  4ZY1 A;  3D7F A;  3ISZ A;  3N5F A;  5LYF A;  3RZA A;  1PYT B;  1YLO A;  1KWM A;  3IEH A;  3D68 A;  4Q7A A;  2PJ8 A;  4MCP A;  4TJX A;  1RTQ A;  1TF9 A;  1R3N A;  5HVH A;  2JBJ A;  5LRG A;  1BLL E;  2NSM A;  4ZYQ A;  1FT7 A;  2ZEE A;  4FWU A;  1QQ9 A;  1ZG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...