4OC0A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with ccibzl, a urea-based inhibitor n~2~-[(1-carboxycyclopropyl)carbamoyl]-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc0A02
4C8FA 4R8FA 1AYEA 3NH4A 2AFZA 4YU9A 4MHZA 3ICUA 3D4UA 3IJ3A 3I74A 2XEFA 4OC4A 3H8GA 3TX8A 2V8DA 3RZAA 1F57A 4UEZA 4EMEA 5LYLA 5K8MA 3HUVA 4KSIA 2EK9A 3ISZA 1M4LA 2AFMA 2PJ9A 4EWTA 4NGQA 3NH5A 3QNVA 3N5FA 2WYRA 3PFOA 1TXRA 1YLOA 3B3TA 3PB9X 4IAVA 3BI0A 1Z8LA 3HLPA 2O4HA 5JH9A 5HVGA 1BPMA 3VTAA 1Y0YA 1ZG8A 1FNOA 2V8GA 4JYWA 4C8TA 4FWUA 2RFHA 2FVGA 5HXDA 5LYFA 4CDJA 4R7MA 3DLJA 4C8AA 4C8CA 5IB9A 4MHNA 1LFWA 3KR5A 1NSAA 4W9YA 3WT4A 2ZEOA 3WABA 3KL9A 2GU2A 2AFSA 2ZEMA 2PJBA 5J1QA 3VATA 4MCQA 2ZEDA 4LQGA 5I4MA 1PYTB 1H8LA 1PCAA 1FT7A 1QQ9A 4P4BA 4EFDA 1BLLE 2ZOGA 4OIWA 4OMEA 4NGMA 1Q7LA 4DUKA 4MRIA 4RUHA 4JZ0A 2ZEGA 4UEFA 1HDQA 1KWMA 4OC2A 1ELLP 5LRKA 3SJEA 1CBXA 4MXUA 4ONWA 4KNGE 4P4EA 3NH8A 2AFXA 3K2KA 2VL1A 3D67A 1CP7A 3T8WA 1OBRA 2JBKA 2QVPA 2XEIA 1IGBA 4UIBA 3B3WA 4G1PA 5K8OA 4OIDA 3RAMA 2J9AA 2JBJA 1QMUA 2CTCA 3PB6X 4CDKA 2QJ8A 2XEJA 1DE4C 3FEEA 4P4JA 1TF9A 3KR4A 2RB7A 3MRUA 4YN3A 4TJVA 4MCRA 4TNUA 5F09A 1XRYA 4X3RA 2PJ4A 4C8UA 3PB8X 4TWEA 4ZY1A 2C1CA 1AMPA 1TF8A 2IMOA 1ZG9A 3IC1A 2IQ6A 3FVLA 5LYDA 4P6YA 2NSMA 4C9EA 4X8IA 2OR4A 5CBMA 2OOTA 2ZOFA 4O23A 3KHZA 4WJBA 4FAIA 3SJGA 2ABZA 1CPXA 3MN8A 5HVHA 1XMBA 2ZEHA 8CPAA 2PRQA 3FJUA 5K8NA 1JQGA 1XJOA 3VARA 5LRJA 2AFOA 2DEAA 3WC7A 1TKJA 3FF3A 4NJQA 4ZX8A 3H8EA 2XEGA 1CPSA 1R43A 4P45A 1GYTA 4R6TA 3B3VA 2BOAA 2GLFA 3B35A 3FX6A 4ZYQA 2C6CA 2PIYA 2PVVA 1Z2LA 2PJ2A 2Q4ZA 1HEEA 4PXDA 2EWBA 3SI1A 1YMEA 4X2TA 4PXBA 3KGQA 1XBUA 2ZELA 4C9VA 3V38A 4H2KA 2ZEEA 2AFUA 2PJ3A 2PJ8A 2GLJA 1LOKA 2C6GA 1LANA 5ELYA 4IHMA 4UIAA 5JGFA 5K8PA 1BPNA 2PJCA 4NFRA 2PVWA 4PQAA 3IWWA 1VGYA 2PJ0A 1YW6A 3FMCA 4PXEA 3KHXA 2POKA 2I3CA 4A39A 1CG2A 4MCSA 3SI0A 2G9DA 4YWYA 4OC0A 3FECA 2ANPA 3CT9A 5LRGA 3IFEA 4TJXA 4C9RA 3D7GA 3WC6A 2NYQA 3S9MA 4P44A 4AXVA 3IO1A 1TKHA 3KASA 3I1UA 4UF4A 2EK8A 4PPZA 5CPAA 3KQZA 3V7ZA 4OC1A 1R3NA 4NJRA 4ZI6A 2CF4A 4A37A 2O53A 2IJZA 4K3NA 4A94A 4CPAA 1ARMA 3NFZA 2HC9A 4WWVA 4OP4A 3B3CA 1ZLIA 2PJ1A 4OKOA 4BD9A 1XF1A 3PB7X 1TKFA 3FH4A 2PJ5A 2PJ7A 3IEHA 3PBBA 3KQXA 1DTDA 3CPAA 4C9AA 4MCPA 3S9LA 4MHYA 3K9TA 4OC3A 2V8HA 4GM5A 4P10A 1LAPA 1YW4A 5THWA 4OC5A 4IK2A 4B6ZA 3JRUA 1VIXA 1BAVA 3CPXA 3CDXA 2Q43A 3PB4X 1Y7EA 4ZX9A 3D7HA 3D7DA 4NGSA 2JEWA 3FEDA 1XFOA 2GREA 2V77A 1VHOA 4P4FA 4NGNA 1ZLHA 3TC8A 3BHXA 5D29A 1V6CA 4MMOA 5LYIA 1CP6A 2PJAA 2CIJA 4NGRA 4PXCA 7CPAA 4MHPA 1VHEA 3PBEA 1CX8A 3DGVA 3SJFA 2PJ6A 3ISXA 1RTQA 3LMSA 4Z65A 2F8HA 3PEIA 4C8PA 1LAMA 2PCUA 5DS0A 3S9NA 1F2OA 1EE3P 4C84A 2HB6A 3PRTA 3B7IA 3EIFA 3VH9A 3BXMA 3PFEA 2PIZA 4C99A 2F7VA 1ELMP 4C9UA 2CTBA 2ZEPA 3D66A 3B3SA 3KZWA 4F9UA 4Q7AA 4UEEA 3RBUA 4FUUA 2ZENA 4ZY2A 3GUXA 3KI9A 4A38A 1WVMA 1ARLA 1UWYA 4NGPA 4F9VA 1LCPA 3WC5A 4P4IA 4R76A 3SI2A 4C86A 1IY7A 3LWUA 2C6PA 1Z5RA 2BO9A 3GB0A 4F8ZA 5JM6A 2Q51A 4ZY0A 3D7FA 3B2YA 2V8VA 1Y0RA 1F2PA 3BI1A 5D8NA 2PE3A 2ZEFA 1Y9ZA 3D68A 1HDUA 4DJLA 1ZG7A 5HVFA 3H8FA 4C85A 4DYOA 3NA6A 4FBEA 3SJXA 3GLJA 6CPAA 2AFWA 4NGTA 3I6SA 2QYVA 4P4DA 1YSJA 3IIBA 2WZNA 3L2NA 2BCOA
chains in the Genus database with same CATH superfamily
4KZTA 4C8FA 4KOYA 4R8FA 1AYEA 2ATRA 4BPWB 2WPWA 3SXOA 4MJXA 2GFQA 4CGMA 1YVHA 4YFJA 4F8ZA 3TTHA 1M1DA 3NH4A 2AFZA 3H5ZA 4UCMA 4YU9A 4MHZA 3ICUA 3D4UA 2FM4A 4JLYA 3IJ3A 1BXRB 3DSBA 3QAYA 2J8NA 4M6HA 4C68A 3I74A 3TCVA 2XEFA 4OC4A 1YX0A 3H8GA 2Q44A 3TX8A 3R96A 4NEXA 4M3SA 2V8DA 4KORA 3RZAA 1F57A 3RO0A 4UEZA 4EMEA 3KKWA 5LYLA 1VI4A 1M44A 5K8MA 2DF5A 3HUVA 1Z9EA 4KSIA 1IOIA 3PT1A 2EK9A 3UY5A 3FYNA 2R82A 3ISZA 1M4LA 4R9MA 4CGNA 2DPTA 2AFMA 2PJ9A 1KBLA 4AG7A 4KLWA 4FD6A 4EWTA 4M8DA 4NGQA 3NH5A 3QNVA 3N5FA 4KOWA 2WYRA 3PFOA 1TXRA 4B5OA 1YLOA 2Z0ZA 3B3TA 3PB9X 5FD8A 1XMTA 5IV0A 4IAVA 4IIYA 1Z8LA 3BI0A 1S7KA 3HLPA 2O4HA 5JH9A 3W6XA 4F0XA 5HVGA 1VBHA 1BPMA 2B4DB 4HKFA 2VKZG 1Y0YA 4KOVA 5G21A 3VTAA 2B4JC 1ZG8A 4II9A 3FIXA 2DLAA 1FNOA 5EC4A 2V8GA 3VGOA 4M85A 4JYWA 2Z3LA 4FWUA 4R87A 4C8TA 1FY7A 1M4GA 2RFHA 4LX9A 2FVGA 4LQ6A 4B5PA 5HXDA 2YJVA 5LYFA 3TLAA 2J8RA 4CDJA 4R7MA 3DLJA 4C8AA 3S6KA 4C2YA 3P2FA 2P0WA 4C8CA 3HMJG 4Q36A 4UWJA 4KSFA 5IB9A 4MHNA 1LFWA 2HUZA 3KR5A 1NSAA 3OB1B 4W9YA 2R98A 3WT4A 2ZEOA 4H6ZA 4HNWB 3WABA 3KL9A 3EC4A 3TT2A 2Z3NA 3I6SA 2GU2A 4CZ1A 4FD7A 2AFSA 2ZEMA 2PJBA 4K30A 3VATA 5J1QA 4MCQA 4CO9A 2ZEDA 1JDBC 5AXIA 5A27A 3BJ7A 5AG7A 4LQGA 3WR7A 1PYTB 5I4MA 4CGLA 1H8LA 1PCAA 1FT7A 4AG9A 1QQ9A 4P4BA 1YQEA 4EFDA 5JYBA 1BLLE 4J3GA 3TLZA 3LACA 1S60A 2ZOGA 4PK2A 3K4IA 2PSWA 3A9LA 4OIWA 4OMEA 2KCWA 4NGMA 1Q7LA 4PSWA 4HPSA 4DUKA 4MRIA 4RUHA 4JZ0A 1X10A 2ZEGA 4HNYB 4UEFA 2ODFA 3IGRA 1HDQA 2OZHA 1KWMA 1Y9KA 4MY3A 2B0AA 4COBA 4A4CA 3FNCA 2OH1A 5IR2A 1ON0A 1M4IA 2OZUA 2REFA 4OADA 4ORFA 4R3LA 4OC2A 1ELLP 2YNCC 1YREA 1VHSA 1IYKA 5LRKA 3SJEA 1CBXA 1S5KA 1ZO0A 2FS5A 2H5MA 4P4EA 1FBVA 4MXUA 3NH8A 2AFXA 3K2KA 1CE8B 4KNGE 4A31A 2VL1A 4UCNA 5EBVA 3NOJA 3EZBA 3EO4A 3D67A 1CP7A 1S7FA 3H4QA 3T8WA 4CGOA 4E0AA 1OBRA 3PP9A 3C26A 4B10A 2PC1A 4OLLA 2JBKA 2QVPA 2Y0MA 4CAFA 2XEIA 1LRZA 4E5SA 1IGBA 3EY5A 4M6GA 4UIBA 3T07A 3B3WA 2EZBA 4IIXA 2CNMA 4G1PA 4KUAA 2EZAA 5K8OA 4OIDA 1JWQA 4BINA 2B4BA 3RAMA 4DNCA 2J9AA 2VEZA 3VRQA 3EZAA 4PK3A 2FXFA 2JBJA 1QMUA 2B4DA 2CTCA 3PB6X 1A9XB 4A33A 4AB7A 3TLBA 4CDKA 2BL1A 2XEJA 2Y1MA 1PU9A 2QJ8A 1DE4C 3PZJA 3R1KA 4A95A 1EZAA 3FEEA 3F9KC 1L0CA 4UBRA 4P4JA 2I79A 1TF9A 3ZJ0A 4ZBGA 3KR4A 3BUWB 4CYOA 2K5TA 3LD2A 1J3LA 1NBWA 2RB7A 3MRUA 4IF5A 2REEA 4YN3A 2GE3A 3IU1A 4LUAA 3BLNA 3D2PA 2XPNA 3K9UA 3FBUA 4TJVA 3U88C 2VZZA 4MCRA 4TNUA 1YR0A 5F09A 2VQYA 1XRYA 4X3RA 2PJ4A 4BPXB 3B8GA 4C8UA 3PB8X 2E28A 2FIWA 4TWEA 4XNHC 1ZL0A 3TOAA 4ZY1A 5BWAB 4RS2A 1R61A 1IICA 2P6GA 4KS9A 2C1CA 1AMPA 2WUUA 1TF8A 4MFPA 1WVMA 2IMOA 5GCNA 3E0KA 1ZG9A 2F5IA 2IQ6A 3FRMA 3IC1A 3DDDA 3FVLA 5LYDA 1KC7A 2ZW6A 1Z8TA 2YJTA 4P6YA 2NSMA 4C9EA 4X8IA 2N3AB 2OR4A 5CBMA 2OOTA 4C7IA 1SQHA 1NXJA 1V0CA 3I3GA 3EXNA 2FCKA 5DWNA 2HI6A 2ZOFA 1I1DA 1YVOA 2Z10A 3KHZA 4O23A 4WJBA 3T90A 2UV8G 2JEVA 3NE7A 4FAIA 3SJGA 4RI1A 2ABZA 1CPXA 3MN8A 2Q7BA 5HVHA 1XMBA 1S7NA 2EZCA 2ZEHA 3OWCA 1EZBA 8CPAA 2PRQA 3FJUA 4L89A 1Z4RA 5K8NA 1JQGA 3BUXB 1MK4A 3D2MA 4Y49C 5AG5A 1Z4EA 1ZYMA 1XJOA 3VARA 3HPGG 5LRJA 3ZZIA 2EVNA 2AFOA 4A32A 2DEAA 3WC7A 5F46A 1TKJA 3RYOA 4AVBA 4NCZA 5E96A 4J0NA 1MJBA 3FF3A 4NJQA 2CNSA 4ZX8A 4CAEA 4AVCA 5F5XA 1KZFA 3H8EA 4F6AA 2AJ6A 2XEGA 1CPSA 1R43A 1MJAA 4P45A 2D4OA 1GYTA 4R6TA 4U9ZA 3B3VA 2G3AA 4F0YA 3NFQA 3FB3A 4E8OA 2BOAA 1QSRA 2GLFA 3B35A 3FX6A 4ZYQA 2CXAA 1KUYA 4CGPA 2C6CA 3G8WA 4JD6A 2D0PA 2VBQA 2VXKA 1MJ9A 2PIYA 3I9SA 4YRHA 4M6IA 2PVVA 3QAHA 2BUEA 3TLGB 2ARHA 4ONWA 1RXTA 1Y9WA 1N71A 1S3ZA 4C2XA 2DPSA 1Z2LA 3RNZA 5JPHA 2PJ2A 2HQYA 2Q4ZA 1HEEA 1CM0A 2EWBA 4PXDA 3G23A 3SI1A 1Q5XA 4RN7A 1YMEA 4X2TA 4CAXA 1M6VB 1BOBA 2Q04A 2YNDA 4H6UA 4PXBA 3KGQA 1XBUA 2G0BA 2ZELA 4JJXA 3TO6A 3V38A 4OAEA 4H2KA 2OB0A 2ZEEA 4C9VA 4XNHB 1YLEA 5F9MA 2AFUA 1NMTA 4AVAA 4CYNA 2PJ3A 2PJ8A 2QIRA 4R57A 2GLJA 4KLVA 3VRRA 3W91A 1LOKA 2C6GA 1LANA 5F13A 5HKZA 3IWEA 4UCPA 4A30A 5KTCA 4GS4A 3TLEA 2HROA 5ELYA 1CJWA 4IHMA 5F49A 4UIAA 2Q4YA 5CNPA 5JGFA 4COGA 1AUGA 3PGPA 5K8PA 1BPNA 2P6FA 2GIVA 2PJCA 4NFRA 3VWDA 3CXQA 2PVWA 4PQAA 3IWWA 1T36B 2BEIA 1VGYA 3IU2A 2B5GB 2PJ0A 4NXYA 1YW6A 3FMCA 4PXEA 1DIKA 3KHXA 4UFWA 1R57A 2POKA 1IOFA 2I3CA 1CG2A 4MCSA 2PR8A 2VI7A 4QB9A 3SI0A 4A39A 5KTAA 2G9DA 4MY0A 2ZXVA 4YWYA 2HWGA 2C27A 3MGDA 4OC0A 1S7LA 3FECA 3VRNA 2ANPA 4JXQA 3CT9A 4U5YA 3G3SA 5LRGA 3IFEA 4Y49B 3VWEA 4MI1A 4TJXA 4C9RA 3D7GA 3WC6A 2X0SA 2Q7SA 2NYQA 1Z8WA 2VZYA 3S9MA 4Q38A 1Y7RA 1M4DA 4P44A 3P2HA 2OZGA 2B58A 4AXVA 1XE4A 3IO1A 1TKHA 3F0AA 3KASA 3I1UA 2PQ8A 1B6BA 4KVME 2EK8A 4H89A 4PPZA 4UF4A 5CPAA 5HH1A 4UWIA 1NE9A 2Q4VA 3LODA 1IYLA 2EUIA 3KQZA 1VBGA 4BMHA 3V7ZA 4OC1A 3TLYA 1R3NA 4NJRA 4FD4A 4ZI6A 3PFVA 2CF4A 3BJ8A 2O53A 4A37A 2DIKA 4INJA 1I12A 2IJZA 2WSAA 4K3NA 5G22A 4A94A 4B11A 4CPAA 5F1YA 3TLCA 1ARMA 3NFZA 2HC9A 2XPPA 1KUXA 4WWVA 3CXPA 2A4NA 4OP4A 1K4JA 2IL4A 3BUNB 3B3CA 3SHPA 1B47A 3OP0A 1ZLIA 2PJ1A 4OKOA 4BD9A 2CNTA 4MFKA 3PB7X 1IIDA 1TKFA 4NSQA 3FH4A 3GIUA 1XF1A 2PJ5A 2MP0A 5JVLA 1OZPA 2PJ7A 3SR3A 4MBUA 5I0CA 2RC4A 4HNXB 3IEHA 3R9EA 3PBBA 2QECA 3KQXA 1DTDA 3CPAA 4C9AA 4MCPA 3S9LA 4KUBA 2FT0A 3TLGA 4CS0B 2AUMA 2DXQA 4MHYA 3K9TA 2Z11A 4OC3A 1XEBA 2V8HA 4GM5A 5J3XA 4P10A 1LAPA 1YW4A 5THWA 4OC5A 4IK2A 4B6ZA 2Q0YA 3JRUA 1U6MA 1VIXA 4QBJA 1BAVA 2PR1A 2YGWA 1WWZA 2NMTA 3CPXA 2ZW7A 3CDXA 4XPDC 2Q43A 2JDCA 3PB4X 4MHDA 4CYPA 3T5MA 1QSNA 1QSTA 1RO5A 4H1HA 4KVXA 1Y7EA 2Z3KA 3D7HA 3D7DA 2X7BA 4ZX9A 4B13A 4NGSA 2JEWA 3FEDA 4CAWA 2XPOA 3D8PA 1XFOA 2GREA 2V77A 3FXTA 4JXRA 1VHOA 2EBJA 4P4FA 4NGNA 1A2ZA 1P4NA 1ZLHA 2EO8A 2J8MA 5G1ZA 3BHXA 3R9GA 1PUAA 5D29A 2GANA 4MMOA 3TC8A 3TE4A 1V6CA 4ZGYB 3F5BA 5LYIA 4QC6A 2R1IA 1CP6A 5AG6A 4PV6A 2FSRA 2PJAA 2CIJA 4NGRA 4UA3A 3IWGA 4PXCA 2O28A 4UFVA 7CPAA 2B5GA 5JM6A 4MHPA 3DNSA 1J4JA 2D4PA 1VHEA 3PBEA 4MI4A 4E2AA 4BTFA 1CX8A 3DGVA 2AUNA 2HV2A 4R3KA 3SJFA 2B3UA 5H86A 3D3SA 2JDDA 2PJ6A 3ISXA 1IU8A 4MFLA 1RTQA 4KOUA 3LMSA 4Z65A 3GY9A 2F8HA 3PEIA 5DWMA 3CZXA 2PCNA 4JVOA 4NF1A 4CRYB 1C30B 1P0HA 2XPLA 5F48A 4C8PA 1LAMA 2PCUA 5IB0A 5DS0A 3S9NA 1F2OA 1TIQA 3GYAA 5IX3A 1Q2CA 4CRZB 5F47A 4XPKA 1YGHA 2B3VA 3S6HA 1C3OB 1EE3P 5BY0A 4RR2B 1WK4A 2HB6A 4I49A 3PRTA 4B14A 4C84A 4C2ZA 1XOVA 3B7IA 2P6EA 5C82A 3T05A 3EIFA 3VH9A 3BXMA 4MFJA 3F8KA 3PFEA 2PIZA 3T9YA 4C99A 2F7VA 1ELMP 3QB8A 2CTBA 5ISVA 4QUSA 2ZEPA 2ZW4A 4KOSA 3S6GA 4A4BA 4C9UA 2QMLA 2JLMA 4PSXA 3D66A 1GHEA 2ZPAA 3B3SA 2ZW5A 3KZWA 4CYQA 4F9UA 4KOXA 5J8FA 5KTDA 5HKYA 4KOTA 1Z8XA 3VROA 4Q7AA 2G3TA 4UEEA 3TYXA 3RBUA 5A28A 3GJZA 2Z3PA 4FUUA 2ZENA 4KVOE 3GUXA 3KI9A 4ZY2A 2PRBA 1XIXA 4A38A 1ARLA 1JDEA 1UWYA 4NGPA 2R8VA 3DR6A 5H84A 4JWPA 1LCPA 3WC5A 4F9VA 1GGOA 4P4IA 3JTKA 3BUMB 2AE6A 2OU2A 1X12A 4MFQA 4R76A 4EYSA 3GKRA 3SI2A 4C86A 2PDOA 4XPDB 3TFYA 1IY7A 1CS0B 2CBLA 3LWUA 3O8ZA 4MFZA 5HKWA 3EFAA 2C6PA 4C7HA 5JQ4A 1Z5RA 2BO9A 3GB0A 4U9YA 3JVNA 2YNEA 3ZNIA 2Q51A 3V8IA 2FIAA 4EVYA 3D7FA 4ZY0A 3B2YA 2V8VA 3T0TA 3U1BA 1VKCA 2FE7A 1Y0RA 1F2PA 1I21A 3EZEA 2FL4A 4ONUA 3BI1A 1B87A 4B12A 2GP4A 3SXNA 1Z9UA 1UFHA 5D8NA 3TOBA 2PE3A 5HMNA 2ZEFA 1Y9ZA 3D68A 1HDUA 1YVKA 3JUWA 4QVTA 3TO7A 3NE8A 4DJLA 1ZG7A 2YNCA 5HVFA 3H8FA 1BO4A 3HPHE 1QSMA 2I00A 4L8AA 1ZRSA 3VRPA 3N7ZA 4A2ZA 3BUOB 3OB2B 3DR8A 4B5PB 4C85A 1NSLA 5AG4A 1KEEB 4KSAA 4DYOA 3NA6A 2R7HA 4FBEA 1EO0A 1KUVA 4CAVA 5K99A 1IB1E 2OLSA 3R95A 3OAKA 1YK3A 2WPXA 2D0OA 3S6FA 1QSOA 1Q2YA 3W6SA 2C5QA 3SJXA 3TO9A 2Y1NA 3GLJA 5AGEA 1Q2DA 5G20A 5C88A 2AFWA 4NGTA 6CPAA 4BBHA 4E94A 1WJTA 2Z3OA 4GXHA 4YGOA 3R9FA 2QYVA 4GPLB 4P4DA 2Z3MA 1XF8A 1YSJA 3C8OA 4BPUB 2CY2A 4UFXA 4XPLA 4X5KA 3IIBA 2WZNA 3KRVA 2BSWA 5J8CA 4IUSA 3PLFB 3L2NA 4MJ8A 5EMIA 3CXSA 4FD5A 2BCOA 5FVJA
chains in the Genus database with same CATH topology
4C8FA 4R8FA 1AYEA 3NH4A 2AFZA 4YU9A 4MHZA 3ICUA 3D4UA 3IJ3A 3I74A 2XEFA 4OC4A 3H8GA 3TX8A 2V8DA 3RZAA 1F57A 4UEZA 4EMEA 5LYLA 5K8MA 3HUVA 4KSIA 2EK9A 3ISZA 1M4LA 2AFMA 2PJ9A 4EWTA 4NGQA 3NH5A 3QNVA 3N5FA 2WYRA 3PFOA 1TXRA 1YLOA 3B3TA 3PB9X 4IAVA 3BI0A 1Z8LA 3HLPA 2O4HA 5JH9A 5HVGA 1BPMA 3VTAA 1Y0YA 1ZG8A 1FNOA 2V8GA 4JYWA 4C8TA 4FWUA 2RFHA 2FVGA 5HXDA 5LYFA 4CDJA 4R7MA 3DLJA 4C8AA 4C8CA 5IB9A 4MHNA 1LFWA 3KR5A 1NSAA 4W9YA 3WT4A 2ZEOA 3WABA 3KL9A 2GU2A 2AFSA 2ZEMA 2PJBA 5J1QA 3VATA 4MCQA 2ZEDA 4LQGA 5I4MA 1PYTB 1H8LA 1PCAA 1FT7A 1QQ9A 4P4BA 4EFDA 1BLLE 2ZOGA 4OIWA 4OMEA 4NGMA 1Q7LA 4DUKA 4MRIA 4RUHA 4JZ0A 2ZEGA 4UEFA 1HDQA 1KWMA 5IR2A 4OC2A 1ELLP 5LRKA 3SJEA 1CBXA 4MXUA 4ONWA 4KNGE 4P4EA 3NH8A 2AFXA 3K2KA 2VL1A 3D67A 1CP7A 3T8WA 1OBRA 2JBKA 2QVPA 2XEIA 1IGBA 4UIBA 3B3WA 4G1PA 5K8OA 4OIDA 3RAMA 2J9AA 2JBJA 1QMUA 2CTCA 3PB6X 4CDKA 2QJ8A 2XEJA 1DE4C 3FEEA 4P4JA 1TF9A 3KR4A 2RB7A 3MRUA 4YN3A 4TJVA 4MCRA 4TNUA 5F09A 1XRYA 4X3RA 2PJ4A 4C8UA 3PB8X 4TWEA 4ZY1A 2C1CA 1AMPA 1TF8A 2IMOA 1ZG9A 3IC1A 2IQ6A 3FVLA 5LYDA 4P6YA 2NSMA 4C9EA 4X8IA 2OR4A 5CBMA 2OOTA 2ZOFA 4O23A 3KHZA 4WJBA 4FAIA 3SJGA 2ABZA 1CPXA 3MN8A 5HVHA 1XMBA 2ZEHA 8CPAA 2PRQA 3FJUA 5K8NA 1JQGA 1XJOA 3VARA 5LRJA 2AFOA 2DEAA 3WC7A 1TKJA 3FF3A 4NJQA 4ZX8A 3H8EA 2XEGA 1CPSA 1R43A 4P45A 1GYTA 4R6TA 3B3VA 2BOAA 2GLFA 3B35A 3FX6A 4ZYQA 2C6CA 2PIYA 2PVVA 1Z2LA 2PJ2A 2Q4ZA 1HEEA 4PXDA 2EWBA 3SI1A 1YMEA 4X2TA 4PXBA 3KGQA 1XBUA 2ZELA 4C9VA 3V38A 4H2KA 2ZEEA 2AFUA 2PJ3A 2PJ8A 2GLJA 1LOKA 2C6GA 1LANA 5ELYA 4IHMA 4UIAA 5JGFA 5K8PA 1BPNA 2PJCA 4NFRA 2PVWA 4PQAA 3IWWA 1VGYA 2PJ0A 1YW6A 3FMCA 4PXEA 3KHXA 2POKA 2I3CA 4A39A 1CG2A 4MCSA 3SI0A 2G9DA 4YWYA 4OC0A 3FECA 2ANPA 3CT9A 5LRGA 3IFEA 4TJXA 4C9RA 3D7GA 3WC6A 2NYQA 3S9MA 4P44A 4AXVA 3IO1A 1TKHA 3KASA 3I1UA 4UF4A 2EK8A 4PPZA 5CPAA 3KQZA 3V7ZA 4OC1A 1R3NA 4NJRA 4ZI6A 2CF4A 4A37A 2O53A 2IJZA 4K3NA 4A94A 4CPAA 1ARMA 3NFZA 2HC9A 4WWVA 4OP4A 3B3CA 1ZLIA 2PJ1A 4OKOA 4BD9A 1XF1A 3PB7X 1TKFA 3FH4A 2PJ5A 2PJ7A 3IEHA 3PBBA 3KQXA 1DTDA 3CPAA 4C9AA 4MCPA 3S9LA 4MHYA 3K9TA 4OC3A 2V8HA 4GM5A 4P10A 1LAPA 1YW4A 5THWA 4OC5A 4IK2A 4B6ZA 3JRUA 1VIXA 1BAVA 3CPXA 3CDXA 2Q43A 3PB4X 1Y7EA 4ZX9A 3D7HA 3D7DA 4NGSA 2JEWA 3FEDA 1XFOA 2GREA 2V77A 1VHOA 4P4FA 4NGNA 2C5QA 1ZLHA 3TC8A 3BHXA 5D29A 1V6CA 4MMOA 5LYIA 1CP6A 2PJAA 2CIJA 4NGRA 4PXCA 7CPAA 4MHPA 1VHEA 3PBEA 1CX8A 3DGVA 3SJFA 2PJ6A 3ISXA 1RTQA 3LMSA 4Z65A 2F8HA 3PEIA 4C8PA 1LAMA 2PCUA 5DS0A 3S9NA 1F2OA 1EE3P 4C84A 2HB6A 3PRTA 3B7IA 3EIFA 3VH9A 3BXMA 3PFEA 2PIZA 4C99A 2F7VA 1ELMP 4C9UA 2CTBA 2ZEPA 3D66A 3B3SA 3KZWA 4F9UA 4Q7AA 4UEEA 3RBUA 4FUUA 2ZENA 4ZY2A 3GUXA 3KI9A 4A38A 1WVMA 1ARLA 1UWYA 4NGPA 4F9VA 1LCPA 3WC5A 4P4IA 4R76A 3SI2A 4C86A 1IY7A 3LWUA 2C6PA 1Z5RA 2BO9A 3GB0A 4F8ZA 5JM6A 2Q51A 4ZY0A 3D7FA 3B2YA 2V8VA 1Y0RA 1F2PA 3BI1A 2GP4A 5D8NA 2PE3A 2ZEFA 1Y9ZA 3D68A 1HDUA 4DJLA 1ZG7A 5HVFA 3H8FA 4C85A 4DYOA 3NA6A 4FBEA 3SJXA 3GLJA 6CPAA 2AFWA 4NGTA 3I6SA 2QYVA 4P4DA 1YSJA 3IIBA 2WZNA 3L2NA 2BCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8F A;  4R8F A;  1AYE A;  3NH4 A;  2AFZ A;  4YU9 A;  4MHZ A;  3ICU A;  3D4U A;  3IJ3 A;  3I74 A;  2XEF A;  4OC4 A;  3H8G A;  3TX8 A;  2V8D A;  3RZA A;  1F57 A;  4UEZ A;  4EME A;  5LYL A;  5K8M A;  3HUV A;  4KSI A;  2EK9 A;  3ISZ A;  1M4L A;  2AFM A;  2PJ9 A;  4EWT A;  4NGQ A;  3NH5 A;  3QNV A;  3N5F A;  2WYR A;  3PFO A;  1TXR A;  1YLO A;  3B3T A;  3PB9 X;  4IAV A;  3BI0 A;  1Z8L A;  3HLP A;  2O4H A;  5JH9 A;  5HVG A;  1BPM A;  3VTA A;  1Y0Y A;  1ZG8 A;  1FNO A;  2V8G A;  4JYW A;  4C8T A;  4FWU A;  2RFH A;  2FVG A;  5HXD A;  5LYF A;  4CDJ A;  4R7M A;  3DLJ A;  4C8A A;  4C8C A;  5IB9 A;  4MHN A;  1LFW A;  3KR5 A;  1NSA A;  4W9Y A;  3WT4 A;  2ZEO A;  3WAB A;  3KL9 A;  2GU2 A;  2AFS A;  2ZEM A;  2PJB A;  5J1Q A;  3VAT A;  4MCQ A;  2ZED A;  4LQG A;  5I4M A;  1PYT B;  1H8L A;  1PCA A;  1FT7 A;  1QQ9 A;  4P4B A;  4EFD A;  1BLL E;  2ZOG A;  4OIW A;  4OME A;  4NGM A;  1Q7L A;  4DUK A;  4MRI A;  4RUH A;  4JZ0 A;  2ZEG A;  4UEF A;  1HDQ A;  1KWM A;  4OC2 A;  1ELL P;  5LRK A;  3SJE A;  1CBX A;  4MXU A;  4ONW A;  4KNG E;  4P4E A;  3NH8 A;  2AFX A;  3K2K A;  2VL1 A;  3D67 A;  1CP7 A;  3T8W A;  1OBR A;  2JBK A;  2QVP A;  2XEI A;  1IGB A;  4UIB A;  3B3W A;  4G1P A;  5K8O A;  4OID A;  3RAM A;  2J9A A;  2JBJ A;  1QMU A;  2CTC A;  3PB6 X;  4CDK A;  2QJ8 A;  2XEJ A;  1DE4 C;  3FEE A;  4P4J A;  1TF9 A;  3KR4 A;  2RB7 A;  3MRU A;  4YN3 A;  4TJV A;  4MCR A;  4TNU A;  5F09 A;  1XRY A;  4X3R A;  2PJ4 A;  4C8U A;  3PB8 X;  4TWE A;  4ZY1 A;  2C1C A;  1AMP A;  1TF8 A;  2IMO A;  1ZG9 A;  3IC1 A;  2IQ6 A;  3FVL A;  5LYD A;  4P6Y A;  2NSM A;  4C9E A;  4X8I A;  2OR4 A;  5CBM A;  2OOT A;  2ZOF A;  4O23 A;  3KHZ A;  4WJB A;  4FAI A;  3SJG A;  2ABZ A;  1CPX A;  3MN8 A;  5HVH A;  1XMB A;  2ZEH A;  8CPA A;  2PRQ A;  3FJU A;  5K8N A;  1JQG A;  1XJO A;  3VAR A;  5LRJ A;  2AFO A;  2DEA A;  3WC7 A;  1TKJ A;  3FF3 A;  4NJQ A;  4ZX8 A;  3H8E A;  2XEG A;  1CPS A;  1R43 A;  4P45 A;  1GYT A;  4R6T A;  3B3V A;  2BOA A;  2GLF A;  3B35 A;  3FX6 A;  4ZYQ A;  2C6C A;  2PIY A;  2PVV A;  1Z2L A;  2PJ2 A;  2Q4Z A;  1HEE A;  4PXD A;  2EWB A;  3SI1 A;  1YME A;  4X2T A;  4PXB A;  3KGQ A;  1XBU A;  2ZEL A;  4C9V A;  3V38 A;  4H2K A;  2ZEE A;  2AFU A;  2PJ3 A;  2PJ8 A;  2GLJ A;  1LOK A;  2C6G A;  1LAN A;  5ELY A;  4IHM A;  4UIA A;  5JGF A;  5K8P A;  1BPN A;  2PJC A;  4NFR A;  2PVW A;  4PQA A;  3IWW A;  1VGY A;  2PJ0 A;  1YW6 A;  3FMC A;  4PXE A;  3KHX A;  2POK A;  2I3C A;  4A39 A;  1CG2 A;  4MCS A;  3SI0 A;  2G9D A;  4YWY A;  4OC0 A;  3FEC A;  2ANP A;  3CT9 A;  5LRG A;  3IFE A;  4TJX A;  4C9R A;  3D7G A;  3WC6 A;  2NYQ A;  3S9M A;  4P44 A;  4AXV A;  3IO1 A;  1TKH A;  3KAS A;  3I1U A;  4UF4 A;  2EK8 A;  4PPZ A;  5CPA A;  3KQZ A;  3V7Z A;  4OC1 A;  1R3N A;  4NJR A;  4ZI6 A;  2CF4 A;  4A37 A;  2O53 A;  2IJZ A;  4K3N A;  4A94 A;  4CPA A;  1ARM A;  3NFZ A;  2HC9 A;  4WWV A;  4OP4 A;  3B3C A;  1ZLI A;  2PJ1 A;  4OKO A;  4BD9 A;  1XF1 A;  3PB7 X;  1TKF A;  3FH4 A;  2PJ5 A;  2PJ7 A;  3IEH A;  3PBB A;  3KQX A;  1DTD A;  3CPA A;  4C9A A;  4MCP A;  3S9L A;  4MHY A;  3K9T A;  4OC3 A;  2V8H A;  4GM5 A;  4P10 A;  1LAP A;  1YW4 A;  5THW A;  4OC5 A;  4IK2 A;  4B6Z A;  3JRU A;  1VIX A;  1BAV A;  3CPX A;  3CDX A;  2Q43 A;  3PB4 X;  1Y7E A;  4ZX9 A;  3D7H A;  3D7D A;  4NGS A;  2JEW A;  3FED A;  1XFO A;  2GRE A;  2V77 A;  1VHO A;  4P4F A;  4NGN A;  1ZLH A;  3TC8 A;  3BHX A;  5D29 A;  1V6C A;  4MMO A;  5LYI A;  1CP6 A;  2PJA A;  2CIJ A;  4NGR A;  4PXC A;  7CPA A;  4MHP A;  1VHE A;  3PBE A;  1CX8 A;  3DGV A;  3SJF A;  2PJ6 A;  3ISX A;  1RTQ A;  3LMS A;  4Z65 A;  2F8H A;  3PEI A;  4C8P A;  1LAM A;  2PCU A;  5DS0 A;  3S9N A;  1F2O A;  1EE3 P;  4C84 A;  2HB6 A;  3PRT A;  3B7I A;  3EIF A;  3VH9 A;  3BXM A;  3PFE A;  2PIZ A;  4C99 A;  2F7V A;  1ELM P;  4C9U A;  2CTB A;  2ZEP A;  3D66 A;  3B3S A;  3KZW A;  4F9U A;  4Q7A A;  4UEE A;  3RBU A;  4FUU A;  2ZEN A;  4ZY2 A;  3GUX A;  3KI9 A;  4A38 A;  1WVM A;  1ARL A;  1UWY A;  4NGP A;  4F9V A;  1LCP A;  3WC5 A;  4P4I A;  4R76 A;  3SI2 A;  4C86 A;  1IY7 A;  3LWU A;  2C6P A;  1Z5R A;  2BO9 A;  3GB0 A;  4F8Z A;  5JM6 A;  2Q51 A;  4ZY0 A;  3D7F A;  3B2Y A;  2V8V A;  1Y0R A;  1F2P A;  3BI1 A;  5D8N A;  2PE3 A;  2ZEF A;  1Y9Z A;  3D68 A;  1HDU A;  4DJL A;  1ZG7 A;  5HVF A;  3H8F A;  4C85 A;  4DYO A;  3NA6 A;  4FBE A;  3SJX A;  3GLJ A;  6CPA A;  2AFW A;  4NGT A;  3I6S A;  2QYV A;  4P4D A;  1YSJ A;  3IIB A;  2WZN A;  3L2N A;  2BCO A; 
#chains in the Genus database with same CATH topology
 4KZT A;  4C8F A;  4KOY A;  4R8F A;  1AYE A;  2ATR A;  4BPW B;  2WPW A;  3SXO A;  4MJX A;  2GFQ A;  4CGM A;  1YVH A;  4YFJ A;  4F8Z A;  3TTH A;  1M1D A;  3NH4 A;  2AFZ A;  3H5Z A;  4UCM A;  4YU9 A;  4MHZ A;  3ICU A;  3D4U A;  2FM4 A;  4JLY A;  3IJ3 A;  1BXR B;  3DSB A;  3QAY A;  2J8N A;  4M6H A;  4C68 A;  3I74 A;  3TCV A;  2XEF A;  4OC4 A;  1YX0 A;  3H8G A;  2Q44 A;  3TX8 A;  3R96 A;  4NEX A;  4M3S A;  2V8D A;  4KOR A;  3RZA A;  1F57 A;  3RO0 A;  4UEZ A;  4EME A;  3KKW A;  5LYL A;  1VI4 A;  1M44 A;  5K8M A;  2DF5 A;  3HUV A;  1Z9E A;  4KSI A;  1IOI A;  3PT1 A;  2EK9 A;  3UY5 A;  3FYN A;  2R82 A;  3ISZ A;  1M4L A;  4R9M A;  4CGN A;  2DPT A;  2AFM A;  2PJ9 A;  1KBL A;  4AG7 A;  4KLW A;  4FD6 A;  4EWT A;  4M8D A;  4NGQ A;  3NH5 A;  3QNV A;  3N5F A;  4KOW A;  2WYR A;  3PFO A;  1TXR A;  4B5O A;  1YLO A;  2Z0Z A;  3B3T A;  3PB9 X;  5FD8 A;  1XMT A;  5IV0 A;  4IAV A;  4IIY A;  1Z8L A;  3BI0 A;  1S7K A;  3HLP A;  2O4H A;  5JH9 A;  3W6X A;  4F0X A;  5HVG A;  1VBH A;  1BPM A;  2B4D B;  4HKF A;  2VKZ G;  1Y0Y A;  4KOV A;  5G21 A;  3VTA A;  2B4J C;  1ZG8 A;  4II9 A;  3FIX A;  2DLA A;  1FNO A;  5EC4 A;  2V8G A;  3VGO A;  4M85 A;  4JYW A;  2Z3L A;  4FWU A;  4R87 A;  4C8T A;  1FY7 A;  1M4G A;  2RFH A;  4LX9 A;  2FVG A;  4LQ6 A;  4B5P A;  5HXD A;  2YJV A;  5LYF A;  3TLA A;  2J8R A;  4CDJ A;  4R7M A;  3DLJ A;  4C8A A;  3S6K A;  4C2Y A;  3P2F A;  2P0W A;  4C8C A;  3HMJ G;  4Q36 A;  4UWJ A;  4KSF A;  5IB9 A;  4MHN A;  1LFW A;  2HUZ A;  3KR5 A;  1NSA A;  3OB1 B;  4W9Y A;  2R98 A;  3WT4 A;  2ZEO A;  4H6Z A;  4HNW B;  3WAB A;  3KL9 A;  3EC4 A;  3TT2 A;  2Z3N A;  3I6S A;  2GU2 A;  4CZ1 A;  4FD7 A;  2AFS A;  2ZEM A;  2PJB A;  4K30 A;  3VAT A;  5J1Q A;  4MCQ A;  4CO9 A;  2ZED A;  1JDB C;  5AXI A;  5A27 A;  3BJ7 A;  5AG7 A;  4LQG A;  3WR7 A;  1PYT B;  5I4M A;  4CGL A;  1H8L A;  1PCA A;  1FT7 A;  4AG9 A;  1QQ9 A;  4P4B A;  1YQE A;  4EFD A;  5JYB A;  1BLL E;  4J3G A;  3TLZ A;  3LAC A;  1S60 A;  2ZOG A;  4PK2 A;  3K4I A;  2PSW A;  3A9L A;  4OIW A;  4OME A;  2KCW A;  4NGM A;  1Q7L A;  4PSW A;  4HPS A;  4DUK A;  4MRI A;  4RUH A;  4JZ0 A;  1X10 A;  2ZEG A;  4HNY B;  4UEF A;  2ODF A;  3IGR A;  1HDQ A;  2OZH A;  1KWM A;  1Y9K A;  4MY3 A;  2B0A A;  4COB A;  4A4C A;  3FNC A;  2OH1 A;  5IR2 A;  1ON0 A;  1M4I A;  2OZU A;  2REF A;  4OAD A;  4ORF A;  4R3L A;  4OC2 A;  1ELL P;  2YNC C;  1YRE A;  1VHS A;  1IYK A;  5LRK A;  3SJE A;  1CBX A;  1S5K A;  1ZO0 A;  2FS5 A;  2H5M A;  4P4E A;  1FBV A;  4MXU A;  3NH8 A;  2AFX A;  3K2K A;  1CE8 B;  4KNG E;  4A31 A;  2VL1 A;  4UCN A;  5EBV A;  3NOJ A;  3EZB A;  3EO4 A;  3D67 A;  1CP7 A;  1S7F A;  3H4Q A;  3T8W A;  4CGO A;  4E0A A;  1OBR A;  3PP9 A;  3C26 A;  4B10 A;  2PC1 A;  4OLL A;  2JBK A;  2QVP A;  2Y0M A;  4CAF A;  2XEI A;  1LRZ A;  4E5S A;  1IGB A;  3EY5 A;  4M6G A;  4UIB A;  3T07 A;  3B3W A;  2EZB A;  4IIX A;  2CNM A;  4G1P A;  4KUA A;  2EZA A;  5K8O A;  4OID A;  1JWQ A;  4BIN A;  2B4B A;  3RAM A;  4DNC A;  2J9A A;  2VEZ A;  3VRQ A;  3EZA A;  4PK3 A;  2FXF A;  2JBJ A;  1QMU A;  2B4D A;  2CTC A;  3PB6 X;  1A9X B;  4A33 A;  4AB7 A;  3TLB A;  4CDK A;  2BL1 A;  2XEJ A;  2Y1M A;  1PU9 A;  2QJ8 A;  1DE4 C;  3PZJ A;  3R1K A;  4A95 A;  1EZA A;  3FEE A;  3F9K C;  1L0C A;  4UBR A;  4P4J A;  2I79 A;  1TF9 A;  3ZJ0 A;  4ZBG A;  3KR4 A;  3BUW B;  4CYO A;  2K5T A;  3LD2 A;  1J3L A;  1NBW A;  2RB7 A;  3MRU A;  4IF5 A;  2REE A;  4YN3 A;  2GE3 A;  3IU1 A;  4LUA A;  3BLN A;  3D2P A;  2XPN A;  3K9U A;  3FBU A;  4TJV A;  3U88 C;  2VZZ A;  4MCR A;  4TNU A;  1YR0 A;  5F09 A;  2VQY A;  1XRY A;  4X3R A;  2PJ4 A;  4BPX B;  3B8G A;  4C8U A;  3PB8 X;  2E28 A;  2FIW A;  4TWE A;  4XNH C;  1ZL0 A;  3TOA A;  4ZY1 A;  5BWA B;  4RS2 A;  1R61 A;  1IIC A;  2P6G A;  4KS9 A;  2C1C A;  1AMP A;  2WUU A;  1TF8 A;  4MFP A;  1WVM A;  2IMO A;  5GCN A;  3E0K A;  1ZG9 A;  2F5I A;  2IQ6 A;  3FRM A;  3IC1 A;  3DDD A;  3FVL A;  5LYD A;  1KC7 A;  2ZW6 A;  1Z8T A;  2YJT A;  4P6Y A;  2NSM A;  4C9E A;  4X8I A;  2N3A B;  2OR4 A;  5CBM A;  2OOT A;  4C7I A;  1SQH A;  1NXJ A;  1V0C A;  3I3G A;  3EXN A;  2FCK A;  5DWN A;  2HI6 A;  2ZOF A;  1I1D A;  1YVO A;  2Z10 A;  3KHZ A;  4O23 A;  4WJB A;  3T90 A;  2UV8 G;  2JEV A;  3NE7 A;  4FAI A;  3SJG A;  4RI1 A;  2ABZ A;  1CPX A;  3MN8 A;  2Q7B A;  5HVH A;  1XMB A;  1S7N A;  2EZC A;  2ZEH A;  3OWC A;  1EZB A;  8CPA A;  2PRQ A;  3FJU A;  4L89 A;  1Z4R A;  5K8N A;  1JQG A;  3BUX B;  1MK4 A;  3D2M A;  4Y49 C;  5AG5 A;  1Z4E A;  1ZYM A;  1XJO A;  3VAR A;  3HPG G;  5LRJ A;  3ZZI A;  2EVN A;  2AFO A;  4A32 A;  2DEA A;  3WC7 A;  5F46 A;  1TKJ A;  3RYO A;  4AVB A;  4NCZ A;  5E96 A;  4J0N A;  1MJB A;  3FF3 A;  4NJQ A;  2CNS A;  4ZX8 A;  4CAE A;  4AVC A;  5F5X A;  1KZF A;  3H8E A;  4F6A A;  2AJ6 A;  2XEG A;  1CPS A;  1R43 A;  1MJA A;  4P45 A;  2D4O A;  1GYT A;  4R6T A;  4U9Z A;  3B3V A;  2G3A A;  4F0Y A;  3NFQ A;  3FB3 A;  4E8O A;  2BOA A;  1QSR A;  2GLF A;  3B35 A;  3FX6 A;  4ZYQ A;  2CXA A;  1KUY A;  4CGP A;  2C6C A;  3G8W A;  4JD6 A;  2D0P A;  2VBQ A;  2VXK A;  1MJ9 A;  2PIY A;  3I9S A;  4YRH A;  4M6I A;  2PVV A;  3QAH A;  2BUE A;  3TLG B;  2ARH A;  4ONW A;  1RXT A;  1Y9W A;  1N71 A;  1S3Z A;  4C2X A;  2DPS A;  1Z2L A;  3RNZ A;  5JPH A;  2PJ2 A;  2HQY A;  2Q4Z A;  1HEE A;  1CM0 A;  2EWB A;  4PXD A;  3G23 A;  3SI1 A;  1Q5X A;  4RN7 A;  1YME A;  4X2T A;  4CAX A;  1M6V B;  1BOB A;  2Q04 A;  2YND A;  4H6U A;  4PXB A;  3KGQ A;  1XBU A;  2G0B A;  2ZEL A;  4JJX A;  3TO6 A;  3V38 A;  4OAE A;  4H2K A;  2OB0 A;  2ZEE A;  4C9V A;  4XNH B;  1YLE A;  5F9M A;  2AFU A;  1NMT A;  4AVA A;  4CYN A;  2PJ3 A;  2PJ8 A;  2QIR A;  4R57 A;  2GLJ A;  4KLV A;  3VRR A;  3W91 A;  1LOK A;  2C6G A;  1LAN A;  5F13 A;  5HKZ A;  3IWE A;  4UCP A;  4A30 A;  5KTC A;  4GS4 A;  3TLE A;  2HRO A;  5ELY A;  1CJW A;  4IHM A;  5F49 A;  4UIA A;  2Q4Y A;  5CNP A;  5JGF A;  4COG A;  1AUG A;  3PGP A;  5K8P A;  1BPN A;  2P6F A;  2GIV A;  2PJC A;  4NFR A;  3VWD A;  3CXQ A;  2PVW A;  4PQA A;  3IWW A;  1T36 B;  2BEI A;  1VGY A;  3IU2 A;  2B5G B;  2PJ0 A;  4NXY A;  1YW6 A;  3FMC A;  4PXE A;  1DIK A;  3KHX A;  4UFW A;  1R57 A;  2POK A;  1IOF A;  2I3C A;  1CG2 A;  4MCS A;  2PR8 A;  2VI7 A;  4QB9 A;  3SI0 A;  4A39 A;  5KTA A;  2G9D A;  4MY0 A;  2ZXV A;  4YWY A;  2HWG A;  2C27 A;  3MGD A;  4OC0 A;  1S7L A;  3FEC A;  3VRN A;  2ANP A;  4JXQ A;  3CT9 A;  4U5Y A;  3G3S A;  5LRG A;  3IFE A;  4Y49 B;  3VWE A;  4MI1 A;  4TJX A;  4C9R A;  3D7G A;  3WC6 A;  2X0S A;  2Q7S A;  2NYQ A;  1Z8W A;  2VZY A;  3S9M A;  4Q38 A;  1Y7R A;  1M4D A;  4P44 A;  3P2H A;  2OZG A;  2B58 A;  4AXV A;  1XE4 A;  3IO1 A;  1TKH A;  3F0A A;  3KAS A;  3I1U A;  2PQ8 A;  1B6B A;  4KVM E;  2EK8 A;  4H89 A;  4PPZ A;  4UF4 A;  5CPA A;  5HH1 A;  4UWI A;  1NE9 A;  2Q4V A;  3LOD A;  1IYL A;  2EUI A;  3KQZ A;  1VBG A;  4BMH A;  3V7Z A;  4OC1 A;  3TLY A;  1R3N A;  4NJR A;  4FD4 A;  4ZI6 A;  3PFV A;  2CF4 A;  3BJ8 A;  2O53 A;  4A37 A;  2DIK A;  4INJ A;  1I12 A;  2IJZ A;  2WSA A;  4K3N A;  5G22 A;  4A94 A;  4B11 A;  4CPA A;  5F1Y A;  3TLC A;  1ARM A;  3NFZ A;  2HC9 A;  2XPP A;  1KUX A;  4WWV A;  3CXP A;  2A4N A;  4OP4 A;  1K4J A;  2IL4 A;  3BUN B;  3B3C A;  3SHP A;  1B47 A;  3OP0 A;  1ZLI A;  2PJ1 A;  4OKO A;  4BD9 A;  2CNT A;  4MFK A;  3PB7 X;  1IID A;  1TKF A;  4NSQ A;  3FH4 A;  3GIU A;  1XF1 A;  2PJ5 A;  2MP0 A;  5JVL A;  1OZP A;  2PJ7 A;  3SR3 A;  4MBU A;  5I0C A;  2RC4 A;  4HNX B;  3IEH A;  3R9E A;  3PBB A;  2QEC A;  3KQX A;  1DTD A;  3CPA A;  4C9A A;  4MCP A;  3S9L A;  4KUB A;  2FT0 A;  3TLG A;  4CS0 B;  2AUM A;  2DXQ A;  4MHY A;  3K9T A;  2Z11 A;  4OC3 A;  1XEB A;  2V8H A;  4GM5 A;  5J3X A;  4P10 A;  1LAP A;  1YW4 A;  5THW A;  4OC5 A;  4IK2 A;  4B6Z A;  2Q0Y A;  3JRU A;  1U6M A;  1VIX A;  4QBJ A;  1BAV A;  2PR1 A;  2YGW A;  1WWZ A;  2NMT A;  3CPX A;  2ZW7 A;  3CDX A;  4XPD C;  2Q43 A;  2JDC A;  3PB4 X;  4MHD A;  4CYP A;  3T5M A;  1QSN A;  1QST A;  1RO5 A;  4H1H A;  4KVX A;  1Y7E A;  2Z3K A;  3D7H A;  3D7D A;  2X7B A;  4ZX9 A;  4B13 A;  4NGS A;  2JEW A;  3FED A;  4CAW A;  2XPO A;  3D8P A;  1XFO A;  2GRE A;  2V77 A;  3FXT A;  4JXR A;  1VHO A;  2EBJ A;  4P4F A;  4NGN A;  1A2Z A;  1P4N A;  1ZLH A;  2EO8 A;  2J8M A;  5G1Z A;  3BHX A;  3R9G A;  1PUA A;  5D29 A;  2GAN A;  4MMO A;  3TC8 A;  3TE4 A;  1V6C A;  4ZGY B;  3F5B A;  5LYI A;  4QC6 A;  2R1I A;  1CP6 A;  5AG6 A;  4PV6 A;  2FSR A;  2PJA A;  2CIJ A;  4NGR A;  4UA3 A;  3IWG A;  4PXC A;  2O28 A;  4UFV A;  7CPA A;  2B5G A;  5JM6 A;  4MHP A;  3DNS A;  1J4J A;  2D4P A;  1VHE A;  3PBE A;  4MI4 A;  4E2A A;  4BTF A;  1CX8 A;  3DGV A;  2AUN A;  2HV2 A;  4R3K A;  3SJF A;  2B3U A;  5H86 A;  3D3S A;  2JDD A;  2PJ6 A;  3ISX A;  1IU8 A;  4MFL A;  1RTQ A;  4KOU A;  3LMS A;  4Z65 A;  3GY9 A;  2F8H A;  3PEI A;  5DWM A;  3CZX A;  2PCN A;  4JVO A;  4NF1 A;  4CRY B;  1C30 B;  1P0H A;  2XPL A;  5F48 A;  4C8P A;  1LAM A;  2PCU A;  5IB0 A;  5DS0 A;  3S9N A;  1F2O A;  1TIQ A;  3GYA A;  5IX3 A;  1Q2C A;  4CRZ B;  5F47 A;  4XPK A;  1YGH A;  2B3V A;  3S6H A;  1C3O B;  1EE3 P;  5BY0 A;  4RR2 B;  1WK4 A;  2HB6 A;  4I49 A;  3PRT A;  4B14 A;  4C84 A;  4C2Z A;  1XOV A;  3B7I A;  2P6E A;  5C82 A;  3T05 A;  3EIF A;  3VH9 A;  3BXM A;  4MFJ A;  3F8K A;  3PFE A;  2PIZ A;  3T9Y A;  4C99 A;  2F7V A;  1ELM P;  3QB8 A;  2CTB A;  5ISV A;  4QUS A;  2ZEP A;  2ZW4 A;  4KOS A;  3S6G A;  4A4B A;  4C9U A;  2QML A;  2JLM A;  4PSX A;  3D66 A;  1GHE A;  2ZPA A;  3B3S A;  2ZW5 A;  3KZW A;  4CYQ A;  4F9U A;  4KOX A;  5J8F A;  5KTD A;  5HKY A;  4KOT A;  1Z8X A;  3VRO A;  4Q7A A;  2G3T A;  4UEE A;  3TYX A;  3RBU A;  5A28 A;  3GJZ A;  2Z3P A;  4FUU A;  2ZEN A;  4KVO E;  3GUX A;  3KI9 A;  4ZY2 A;  2PRB A;  1XIX A;  4A38 A;  1ARL A;  1JDE A;  1UWY A;  4NGP A;  2R8V A;  3DR6 A;  5H84 A;  4JWP A;  1LCP A;  3WC5 A;  4F9V A;  1GGO A;  4P4I A;  3JTK A;  3BUM B;  2AE6 A;  2OU2 A;  1X12 A;  4MFQ A;  4R76 A;  4EYS A;  3GKR A;  3SI2 A;  4C86 A;  2PDO A;  4XPD B;  3TFY A;  1IY7 A;  1CS0 B;  2CBL A;  3LWU A;  3O8Z A;  4MFZ A;  5HKW A;  3EFA A;  2C6P A;  4C7H A;  5JQ4 A;  1Z5R A;  2BO9 A;  3GB0 A;  4U9Y A;  3JVN A;  2YNE A;  3ZNI A;  2Q51 A;  3V8I A;  2FIA A;  4EVY A;  3D7F A;  4ZY0 A;  3B2Y A;  2V8V A;  3T0T A;  3U1B A;  1VKC A;  2FE7 A;  1Y0R A;  1F2P A;  1I21 A;  3EZE A;  2FL4 A;  4ONU A;  3BI1 A;  1B87 A;  4B12 A;  2GP4 A;  3SXN A;  1Z9U A;  1UFH A;  5D8N A;  3TOB A;  2PE3 A;  5HMN A;  2ZEF A;  1Y9Z A;  3D68 A;  1HDU A;  1YVK A;  3JUW A;  4QVT A;  3TO7 A;  3NE8 A;  4DJL A;  1ZG7 A;  2YNC A;  5HVF A;  3H8F A;  1BO4 A;  3HPH E;  1QSM A;  2I00 A;  4L8A A;  1ZRS A;  3VRP A;  3N7Z A;  4A2Z A;  3BUO B;  3OB2 B;  3DR8 A;  4B5P B;  4C85 A;  1NSL A;  5AG4 A;  1KEE B;  4KSA A;  4DYO A;  3NA6 A;  2R7H A;  4FBE A;  1EO0 A;  1KUV A;  4CAV A;  5K99 A;  1IB1 E;  2OLS A;  3R95 A;  3OAK A;  1YK3 A;  2WPX A;  2D0O A;  3S6F A;  1QSO A;  1Q2Y A;  3W6S A;  2C5Q A;  3SJX A;  3TO9 A;  2Y1N A;  3GLJ A;  5AGE A;  1Q2D A;  5G20 A;  5C88 A;  2AFW A;  4NGT A;  6CPA A;  4BBH A;  4E94 A;  1WJT A;  2Z3O A;  4GXH A;  4YGO A;  3R9F A;  2QYV A;  4GPL B;  4P4D A;  2Z3M A;  1XF8 A;  1YSJ A;  3C8O A;  4BPU B;  2CY2 A;  4UFX A;  4XPL A;  4X5K A;  3IIB A;  2WZN A;  3KRV A;  2BSW A;  5J8C A;  4IUS A;  3PLF B;  3L2N A;  4MJ8 A;  5EMI A;  3CXS A;  4FD5 A;  2BCO A;  5FVJ A; 
#chains in the Genus database with same CATH homology
 4C8F A;  4R8F A;  1AYE A;  3NH4 A;  2AFZ A;  4YU9 A;  4MHZ A;  3ICU A;  3D4U A;  3IJ3 A;  3I74 A;  2XEF A;  4OC4 A;  3H8G A;  3TX8 A;  2V8D A;  3RZA A;  1F57 A;  4UEZ A;  4EME A;  5LYL A;  5K8M A;  3HUV A;  4KSI A;  2EK9 A;  3ISZ A;  1M4L A;  2AFM A;  2PJ9 A;  4EWT A;  4NGQ A;  3NH5 A;  3QNV A;  3N5F A;  2WYR A;  3PFO A;  1TXR A;  1YLO A;  3B3T A;  3PB9 X;  4IAV A;  3BI0 A;  1Z8L A;  3HLP A;  2O4H A;  5JH9 A;  5HVG A;  1BPM A;  3VTA A;  1Y0Y A;  1ZG8 A;  1FNO A;  2V8G A;  4JYW A;  4C8T A;  4FWU A;  2RFH A;  2FVG A;  5HXD A;  5LYF A;  4CDJ A;  4R7M A;  3DLJ A;  4C8A A;  4C8C A;  5IB9 A;  4MHN A;  1LFW A;  3KR5 A;  1NSA A;  4W9Y A;  3WT4 A;  2ZEO A;  3WAB A;  3KL9 A;  2GU2 A;  2AFS A;  2ZEM A;  2PJB A;  5J1Q A;  3VAT A;  4MCQ A;  2ZED A;  4LQG A;  5I4M A;  1PYT B;  1H8L A;  1PCA A;  1FT7 A;  1QQ9 A;  4P4B A;  4EFD A;  1BLL E;  2ZOG A;  4OIW A;  4OME A;  4NGM A;  1Q7L A;  4DUK A;  4MRI A;  4RUH A;  4JZ0 A;  2ZEG A;  4UEF A;  1HDQ A;  1KWM A;  5IR2 A;  4OC2 A;  1ELL P;  5LRK A;  3SJE A;  1CBX A;  4MXU A;  4ONW A;  4KNG E;  4P4E A;  3NH8 A;  2AFX A;  3K2K A;  2VL1 A;  3D67 A;  1CP7 A;  3T8W A;  1OBR A;  2JBK A;  2QVP A;  2XEI A;  1IGB A;  4UIB A;  3B3W A;  4G1P A;  5K8O A;  4OID A;  3RAM A;  2J9A A;  2JBJ A;  1QMU A;  2CTC A;  3PB6 X;  4CDK A;  2QJ8 A;  2XEJ A;  1DE4 C;  3FEE A;  4P4J A;  1TF9 A;  3KR4 A;  2RB7 A;  3MRU A;  4YN3 A;  4TJV A;  4MCR A;  4TNU A;  5F09 A;  1XRY A;  4X3R A;  2PJ4 A;  4C8U A;  3PB8 X;  4TWE A;  4ZY1 A;  2C1C A;  1AMP A;  1TF8 A;  2IMO A;  1ZG9 A;  3IC1 A;  2IQ6 A;  3FVL A;  5LYD A;  4P6Y A;  2NSM A;  4C9E A;  4X8I A;  2OR4 A;  5CBM A;  2OOT A;  2ZOF A;  4O23 A;  3KHZ A;  4WJB A;  4FAI A;  3SJG A;  2ABZ A;  1CPX A;  3MN8 A;  5HVH A;  1XMB A;  2ZEH A;  8CPA A;  2PRQ A;  3FJU A;  5K8N A;  1JQG A;  1XJO A;  3VAR A;  5LRJ A;  2AFO A;  2DEA A;  3WC7 A;  1TKJ A;  3FF3 A;  4NJQ A;  4ZX8 A;  3H8E A;  2XEG A;  1CPS A;  1R43 A;  4P45 A;  1GYT A;  4R6T A;  3B3V A;  2BOA A;  2GLF A;  3B35 A;  3FX6 A;  4ZYQ A;  2C6C A;  2PIY A;  2PVV A;  1Z2L A;  2PJ2 A;  2Q4Z A;  1HEE A;  4PXD A;  2EWB A;  3SI1 A;  1YME A;  4X2T A;  4PXB A;  3KGQ A;  1XBU A;  2ZEL A;  4C9V A;  3V38 A;  4H2K A;  2ZEE A;  2AFU A;  2PJ3 A;  2PJ8 A;  2GLJ A;  1LOK A;  2C6G A;  1LAN A;  5ELY A;  4IHM A;  4UIA A;  5JGF A;  5K8P A;  1BPN A;  2PJC A;  4NFR A;  2PVW A;  4PQA A;  3IWW A;  1VGY A;  2PJ0 A;  1YW6 A;  3FMC A;  4PXE A;  3KHX A;  2POK A;  2I3C A;  4A39 A;  1CG2 A;  4MCS A;  3SI0 A;  2G9D A;  4YWY A;  4OC0 A;  3FEC A;  2ANP A;  3CT9 A;  5LRG A;  3IFE A;  4TJX A;  4C9R A;  3D7G A;  3WC6 A;  2NYQ A;  3S9M A;  4P44 A;  4AXV A;  3IO1 A;  1TKH A;  3KAS A;  3I1U A;  4UF4 A;  2EK8 A;  4PPZ A;  5CPA A;  3KQZ A;  3V7Z A;  4OC1 A;  1R3N A;  4NJR A;  4ZI6 A;  2CF4 A;  4A37 A;  2O53 A;  2IJZ A;  4K3N A;  4A94 A;  4CPA A;  1ARM A;  3NFZ A;  2HC9 A;  4WWV A;  4OP4 A;  3B3C A;  1ZLI A;  2PJ1 A;  4OKO A;  4BD9 A;  1XF1 A;  3PB7 X;  1TKF A;  3FH4 A;  2PJ5 A;  2PJ7 A;  3IEH A;  3PBB A;  3KQX A;  1DTD A;  3CPA A;  4C9A A;  4MCP A;  3S9L A;  4MHY A;  3K9T A;  4OC3 A;  2V8H A;  4GM5 A;  4P10 A;  1LAP A;  1YW4 A;  5THW A;  4OC5 A;  4IK2 A;  4B6Z A;  3JRU A;  1VIX A;  1BAV A;  3CPX A;  3CDX A;  2Q43 A;  3PB4 X;  1Y7E A;  4ZX9 A;  3D7H A;  3D7D A;  4NGS A;  2JEW A;  3FED A;  1XFO A;  2GRE A;  2V77 A;  1VHO A;  4P4F A;  4NGN A;  2C5Q A;  1ZLH A;  3TC8 A;  3BHX A;  5D29 A;  1V6C A;  4MMO A;  5LYI A;  1CP6 A;  2PJA A;  2CIJ A;  4NGR A;  4PXC A;  7CPA A;  4MHP A;  1VHE A;  3PBE A;  1CX8 A;  3DGV A;  3SJF A;  2PJ6 A;  3ISX A;  1RTQ A;  3LMS A;  4Z65 A;  2F8H A;  3PEI A;  4C8P A;  1LAM A;  2PCU A;  5DS0 A;  3S9N A;  1F2O A;  1EE3 P;  4C84 A;  2HB6 A;  3PRT A;  3B7I A;  3EIF A;  3VH9 A;  3BXM A;  3PFE A;  2PIZ A;  4C99 A;  2F7V A;  1ELM P;  4C9U A;  2CTB A;  2ZEP A;  3D66 A;  3B3S A;  3KZW A;  4F9U A;  4Q7A A;  4UEE A;  3RBU A;  4FUU A;  2ZEN A;  4ZY2 A;  3GUX A;  3KI9 A;  4A38 A;  1WVM A;  1ARL A;  1UWY A;  4NGP A;  4F9V A;  1LCP A;  3WC5 A;  4P4I A;  4R76 A;  3SI2 A;  4C86 A;  1IY7 A;  3LWU A;  2C6P A;  1Z5R A;  2BO9 A;  3GB0 A;  4F8Z A;  5JM6 A;  2Q51 A;  4ZY0 A;  3D7F A;  3B2Y A;  2V8V A;  1Y0R A;  1F2P A;  3BI1 A;  2GP4 A;  5D8N A;  2PE3 A;  2ZEF A;  1Y9Z A;  3D68 A;  1HDU A;  4DJL A;  1ZG7 A;  5HVF A;  3H8F A;  4C85 A;  4DYO A;  3NA6 A;  4FBE A;  3SJX A;  3GLJ A;  6CPA A;  2AFW A;  4NGT A;  3I6S A;  2QYV A;  4P4D A;  1YSJ A;  3IIB A;  2WZN A;  3L2N A;  2BCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...