4OC0A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with ccibzl, a urea-based inhibitor n~2~-[(1-carboxycyclopropyl)carbamoyl]-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc0A02
5ELYA 4MRIA 1XF1A 3RZAA 4EMEA 1IGBA 2POKA 4ZX8A 4C8CA 3D67A 1HDUA 1LCPA 1ZG8A 4UF4A 1TKJA 2QVPA 1YMEA 3FX6A 2QYVA 4X2TA 2CTCA 3KI9A 3NH5A 4P4FA 3I74A 1WVMA 1ELLP 1CPXA 2O53A 1Y0YA 3I6SA 2PJ2A 3PB9X 4C8FA 2PVWA 2RFHA 3RBUA 3MRUA 6CPAA 3CPXA 2PCUA 3H8FA 3FEEA 3B3SA 4ZX9A 3FJUA 3RAMA 3FH4A 5LYIA 1PCAA 5JH9A 4C9AA 2NSMA 2V77A 2C6CA 1TF9A 1XFOA 1RTQA 4UEZA 4CDJA 3DGVA 2ZEPA 4OIDA 3FEDA 1TXRA 1YLOA 4G1PA 2AFMA 4P4JA 4K3NA 2GLJA 4OKOA 3B3TA 1FT7A 4OIWA 4Z65A 3T8WA 3B3WA 5JM6A 3PFOA 3D7HA 5K8OA 3CPAA 3IFEA 3S9LA 4OC2A 5I4MA 1ZLHA 3IWWA 2V8VA 2AFOA 5LYFA 2PJAA 4CDKA 1BPNA 3V7ZA 3SI2A 3KHXA 4EFDA 4F8ZA 4UIAA 3NA6A 3KGQA 4DYOA 3LMSA 3VH9A 4A37A 5J1QA 4F9UA 2IQ6A 5K8MA 1VGYA 4C8PA 2ANPA 3EIFA 2PJ5A 4B6ZA 5LRGA 4P4BA 4UIBA 4P4IA 3L2NA 2GLFA 1DTDA 2ZOGA 2PJ7A 2V8HA 3QNVA 4MHPA 5THWA 1M4LA 2Q51A 1CPSA 3PBEA 4W9YA 4GM5A 2ZEGA 4PXEA 4PXBA 1DE4C 2WYRA 5CPAA 2EK9A 1BPMA 3SJXA 2CF4A 1YSJA 2ZEHA 3PBBA 3FVLA 4F9VA 2WZNA 5DS0A 3FMCA 1YW6A 5CBMA 3VARA 1XJOA 3IO1A 3WT4A 4TWEA 4NGSA 3KQZA 4NJRA 1Q7LA 2V8DA 3H8EA 4ZYQA 1LAPA 2ZEMA 5D8NA 4C9VA 3SI0A 3B35A 3LWUA 2HC9A 2Q4ZA 4MCPA 2PJ9A 3CT9A 4C8TA 5K8NA 4MXUA 2ZENA 2PJ4A 4OMEA 2PVVA 3BXMA 3H8GA 1TKFA 3B3CA 1LOKA 1VHEA 3IEHA 4TNUA 5LYLA 3JRUA 3D7GA 3HUVA 2OR4A 3SI1A 4MHNA 3ISZA 2PIZA 1PYTB 4OC3A 2BO9A 1VHOA 3KHZA 3SJEA 3MN8A 2AFWA 2QJ8A 2ZEDA 4X8IA 5JGFA 5LYDA 2AFXA 3D4UA 4P44A 4Q7AA 2FVGA 4FWUA 4C99A 1AYEA 4C85A 4C84A 4C8UA 4P4DA 5D29A 2C6GA 3KR5A 2PJ0A 4R8FA 1LAMA 4YU9A 4NFRA 2XEIA 3VTAA 1Y7EA 4PXCA 2I3CA 4MMOA 1QMUA 2IJZA 4IHMA 2XEGA 1UWYA 2PIYA 1AMPA 2EWBA 1ZLIA 1XMBA 3D7FA 2ZEFA 2PJ3A 2ZELA 4P45A 5HXDA 3GUXA 2GU2A 4TJVA 1HDQA 4NGPA 4NGTA 1CG2A 2PE3A 3CDXA 4C9EA 2NYQA 2ZEOA 1BAVA 4P10A 4C8AA 4ZY0A 4OC1A 1EE3P 1F2OA 4OC0A 2V8GA 2VL1A 3I1UA 2AFZA 3PFEA 3NH8A 3TC8A 5K8PA 4MHYA 1ARMA 1Y9ZA 4FBEA 2CTBA 2XEJA 3D66A 2JEWA 4WWVA 4C86A 1R43A 4PXDA 4EWTA 3B7IA 3D68A 4O23A 4MCSA 3S9NA 5HVHA 4C9UA 2CIJA 2C6PA 3B3VA 4AXVA 1BLLE 4NJQA 4H2KA 1OBRA 1F57A 2GREA 4MHZA 4CPAA 4X3RA 3PB8X 1TKHA 2PJBA 4DUKA 5LRKA 3BI1A 2BCOA 3WC5A 4YWYA 1Z8LA 3FECA 1IY7A 4ZY1A 1Z5RA 3KL9A 3D7DA 2O4HA 3DLJA 3WABA 2AFUA 2F7VA 1CP7A 4R6TA 4KSIA 2HB6A 2IMOA 2PJ6A 4RUHA 4PQAA 2ZOFA 2C1CA 4P4EA 1HEEA 3PB6X 4OP4A 4FAIA 1VIXA 4NGRA 3IIBA 3VATA 1CX8A 3K2KA 3ISXA 4ONWA 1ZG9A 1ARLA 2Q43A 4PPZA 2EK8A 2RB7A 4P6YA 5LRJA 3NFZA 4A94A 3PEIA 3K9TA 1ZG7A 4A38A 1QQ9A 1V6CA 1ELMP 5HVGA 3GLJA 4MCRA 5HVFA 8CPAA 1GYTA 1LANA 2ABZA 1JQGA 2F8HA 2G9DA 3WC7A 2DEAA 2ZEEA 1XRYA 3ICUA 3N5FA 3KASA 3B2YA 4R7MA 4TJXA 1H8LA 4R76A 3KZWA 3FF3A 4C9RA 2PRQA 4KNGE 4JYWA 1XBUA 3PRTA 4NGNA 3V38A 2JBJA 1Z2LA 4LQGA 1KWMA 7CPAA 5IB9A 4MCQA 3IJ3A 1LFWA 3TX8A 3S9MA 4BD9A 1FNOA 2PJCA 3KQXA 4UEFA 4NGMA 4OC4A 4FUUA 4DJLA 3WC6A 2AFSA 4YN3A 4OC5A 3GB0A 2JBKA 4NGQA 1TF8A 3NH4A 1NSAA 1Y0RA 2PJ1A 4IAVA 1CBXA 1R3NA 4ZI6A 4A39A 3SJFA 5F09A 1F2PA 4JZ0A 1CP6A 3PB7X 3SJGA 1YW4A 2PJ8A 3BHXA 4WJBA 4UEEA 2J9AA 2XEFA 4ZY2A 2BOAA 3PB4X 3KR4A 3HLPA 4IK2A 3IC1A 2OOTA 3BI0A
chains in the Genus database with same CATH superfamily
5ELYA 2CXAA 4KOSA 4A4BA 4MRIA 2VZZA 4FD5A 4CAXA 1XF1A 3RZAA 1A9XB 2AJ6A 4CGNA 2DF5A 4EMEA 2DPTA 1IGBA 1JWQA 2POKA 5KTAA 2EO8A 4CRZB 5KTDA 3FNCA 4ZX8A 3TFYA 3FIXA 1KUYA 4C8CA 3D67A 3SXOA 1KEEB 5A27A 4BTFA 1HDUA 3GJZA 1EZBA 1LCPA 3TCVA 1ZG8A 1S7NA 4UFVA 4UF4A 3RNZA 4GS4A 1TKJA 2HWGA 1PU9A 2QVPA 1YMEA 1NXJA 1IYLA 3FX6A 2QYVA 4MJ8A 2GIVA 4X2TA 2CTCA 3KI9A 2Z10A 3NH5A 3TO7A 4P4FA 3I74A 3F5BA 4U9ZA 4KOXA 1WVMA 1ELLP 1CPXA 1KZFA 2FIWA 2O53A 4E5SA 1K4JA 1Y0YA 2B5GB 2PJ2A 3FYNA 3I6SA 5HKWA 5J3XA 3PB9X 5FVJA 3TLGA 4C8FA 2PVWA 3N7ZA 4ZBGA 4XPLA 2RFHA 3RBUA 3MRUA 2Z3MA 3IU2A 6CPAA 3CPXA 4F0YA 2PCUA 3H8FA 1Z9UA 2QIRA 4IUSA 5AG5A 4B5PA 3FEEA 1OZPA 3B3SA 4ZX9A 4JXQA 4AVAA 4BINA 3FJUA 2HQYA 4CO9A 2EZAA 3RAMA 2AUMA 3QAHA 2VI7A 3FH4A 5DWNA 4INJA 4L89A 5LYIA 1PCAA 5JH9A 1DIKA 4C9AA 3VROA 2ZW7A 4IF5A 2NSMA 1JDBC 3JUWA 2V77A 2C6CA 1TF9A 1XFOA 1RTQA 1GGOA 4UEZA 4M8DA 1V0CA 3VWDA 2R7HA 4CDJA 2X7BA 1IB1E 3DGVA 4JLYA 2WPWA 4XNHC 4C8TA 4QUSA 2ZEPA 2FCKA 4OIDA 3FEDA 3NOJA 1TXRA 1YLOA 2HV2A 4G1PA 2AFMA 4P4JA 2DXQA 3G23A 2BSWA 2G3AA 3LACA 1VBGA 4K3NA 1EO0A 2EUIA 2H5MA 4NXYA 5JPHA 4CZ1A 2Z11A 3SXNA 2YJTA 2GLJA 4PSWA 4OKOA 2FXFA 3B3TA 1I12A 5JVLA 1FT7A 4OIWA 4Z65A 4KS9A 2YNEA 2XPPA 3T8WA 1MJBA 3B3WA 5JM6A 3CXPA 3PFOA 3F8KA 3D7HA 1YX0A 4JXRA 4UFWA 1Y7RA 3R95A 1CJWA 2YNDA 3CPAA 3IFEA 3S9LA 4OADA 1EZAA 4QB9A 4BBHA 4OC2A 2P6GA 5I4MA 1ZLHA 3U1BA 2D0OA 1WJTA 3PZJA 3TOAA 5AGEA 3IWWA 3DDDA 4A31A 1Q2DA 3PLFB 2D4PA 2AFOA 2V8VA 5G22A 2ZXVA 5LYFA 3FXTA 4MFKA 4UFXA 1Q2YA 4B5OA 5IR2A 1U6MA 4MFZA 2PJAA 4MFJA 4CDKA 4AB7A 4RR2B 1NMTA 4KLVA 3TLEA 2P6EA 2OLSA 1Z8TA 2EZCA 2VKZG 1BPNA 3V7ZA 2R8VA 3SI2A 3KHXA 4EFDA 4F8ZA 2OH1A 4R3LA 4UIAA 3S6GA 4C7IA 2PQ8A 3NA6A 3JVNA 3KGQA 3W6SA 4DYOA 2Q04A 3HPGG 2D0PA 1BOBA 2DIKA 4JVOA 2OZUA 3LMSA 4E2AA 3U88C 3VH9A 4RI1A 4A37A 4QC6A 3GY9A 3TLAA 1X10A 5J1QA 3PGPA 2VXKA 3BUNB 2C27A 4F9UA 2IQ6A 5EMIA 5K8MA 4MFQA 1VGYA 5F48A 4C8PA 2ANPA 1P0HA 2QMLA 4CGMA 2PJ5A 1L0CA 2FS5A 3QAYA 4B6ZA 5LRGA 4P4BA 4OLLA 4UIBA 3TTHA 2WSAA 1X12A 4Q36A 5A28A 2EBJA 4P4IA 3IWGA 2GLFA 3L2NA 4EVYA 1DTDA 2ZOGA 4A30A 4YFJA 2PJ7A 2V8HA 3QNVA 4MHPA 5THWA 3TLYA 1J4JA 1M4LA 2Q51A 1CPSA 5G1ZA 4B10A 1NE9A 3PBEA 1Q5XA 3ZNIA 3EZAA 1KUVA 4W9YA 1Z8WA 4GM5A 2ZEGA 4PXEA 4PXBA 4MFPA 1DE4C 3NE7A 2WYRA 3GIUA 5CPAA 2EK9A 2C5QA 3C8OA 3P2FA 2JDCA 1YVKA 3SR3A 2B3VA 1BPMA 3SJXA 4QVTA 1MK4A 1VHSA 2Q4VA 4BPUB 2K5TA 5AG6A 4LUAA 2CF4A 1YSJA 2ZEHA 4X5KA 3CXQA 3R9GA 3PBBA 3KRVA 3FVLA 2FL4A 2WZNA 4F9VA 3EIFA 5DS0A 1TIQA 3W6XA 3S6KA 3FMCA 1YW6A 4E0AA 5CBMA 5HMNA 3TT2A 1S5KA 2O28A 3VARA 4A95A 2ARHA 1XJOA 1R57A 2I00A 3IO1A 1YGHA 4BPWB 3WT4A 3EXNA 4TWEA 4LQ6A 1Y9WA 4NGSA 4C2XA 3KQZA 3C26A 4JWPA 2GE3A 5F13A 4M6GA 3DNSA 5AG4A 5JYBA 5F49A 3FB3A 4NJRA 1QSMA 2Z0ZA 1IU8A 1Q7LA 3DR8A 2V8DA 4CS0B 3O8ZA 3H8EA 4ZYQA 1LAPA 4ORFA 3TLCA 2ZEMA 5D8NA 4C9VA 5ISVA 3SI0A 1S7FA 1QSRA 3B35A 3LWUA 2HC9A 2Q4YA 2Q4ZA 4MCPA 1UFHA 3D8PA 2PJ9A 4H6UA 3CT9A 3VRNA 4AVCA 1Z8XA 5H86A 1M1DA 1JDEA 5K8NA 3R1KA 2ZENA 2PJ4A 1KUXA 4OMEA 2PVVA 4MXUA 1J3LA 4MHDA 3BXMA 3H8GA 1TKFA 3B3CA 1LOKA 2P0WA 2DLAA 1VHEA 4YGOA 3IEHA 5K8OA 4TNUA 4IIYA 4KOTA 4KVME 1I1DA 5LYLA 5E96A 3JRUA 3D7GA 5IV0A 2FIAA 2WPXA 3HUVA 2OZHA 4II9A 5GCNA 3RO0A 4CYQA 2OR4A 1S7KA 1WWZA 2PC1A 4RN7A 2XPNA 2PRBA 5F47A 3SI1A 3TO9A 4AG7A 1ZYMA 3D2PA 4MHNA 2MP0A 2B3UA 1Y9KA 2R1IA 3GKRA 4HKFA 3ISZA 4M3SA 3EZBA 3ZJ0A 2PIZA 1PYTB 1S7LA 3CZXA 2J8MA 4OC3A 4JJXA 1N71A 3W91A 3T9YA 2BO9A 1VHOA 3KHZA 4COBA 2I79A 3BJ8A 3SJEA 4OAEA 3G8WA 3MN8A 2AFWA 2EZBA 3SHPA 4MI1A 2QJ8A 2ZEDA 4X8IA 5JGFA 1YR0A 5LYDA 2AFXA 4CGOA 4B12A 3BUXB 2X0SA 2J8NA 3D4UA 4XNHB 4P44A 2G0BA 2J8RA 4Q7AA 1VBHA 2Z3OA 4A2ZA 1NSLA 2PSWA 1CM0A 4CGLA 2FVGA 2PR1A 4FWUA 1XEBA 2R82A 1AYEA 1PUAA 2ZPAA 1T36B 4C99A 2BUEA 2VBQA 4PK2A 5AG7A 4XPKA 4C84A 4C85A 4C8UA 1M4DA 4P4DA 5D29A 2C6GA 4KZTA 4CYPA 1IIDA 3KR5A 2PJ0A 4R8FA 4UWIA 1LAMA 4YU9A 5F9MA 4NFRA 4C7HA 4FD7A 3S6FA 2XEIA 2WUUA 4C68A 3VTAA 2PDOA 3IGRA 2CY2A 2E28A 4ZGYB 1S3ZA 1Y7EA 4PXCA 2AUNA 1AUGA 2I3CA 3PP9A 4MMOA 5K99A 3VRPA 3RYOA 4COGA 5CNPA 1Z4EA 1YVHA 4M6HA 5HKZA 1QMUA 4BPXB 4CAEA 2P6FA 2IJZA 1M6VB 4IHMA 2XEGA 1CE8B 1UWYA 1Z4RA 2R98A 4PV6A 4EYSA 5AXIA 4NF1A 2YNCC 2PIYA 4J0NA 1AMPA 3NE8A 2EWBA 2VQYA 1M4IA 1ZLIA 1XMBA 2B58A 3D7FA 2ZW6A 3GYAA 2ZEFA 2PJ3A 4MJXA 2ZELA 3OB1B 4P45A 3QB8A 5HXDA 4UCPA 3GUXA 2GU2A 4TJVA 1HDQA 4NGPA 2KCWA 3KKWA 4AG9A 4NGTA 5KTCA 1LRZA 1XF8A 3T07A 1CG2A 4L8AA 4F6AA 2PE3A 5I0CA 3CDXA 2QECA 5EBVA 3WR7A 5J8FA 1M44A 4C9EA 2FT0A 2NYQA 2ZEOA 1BAVA 2ODFA 4P10A 1NBWA 1C3OB 4C8AA 4KUAA 1IOFA 4KVOE 4ZY0A 4MI4A 3BUOB 4OC1A 1EE3P 1F2OA 2A4NA 1B47A 4OC0A 2V8GA 2BL1A 2VL1A 1KC7A 3I1UA 4KOVA 4NEXA 2AFZA 4B11A 3T0TA 4GPLB 4H6ZA 4U9YA 1B87A 1VKCA 3PFEA 3NH8A 3TC8A 5K8PA 1Q2CA 4MHYA 1ARMA 2BEIA 1Y9ZA 4FBEA 3UY5A 3VRRA 2CTBA 4KOUA 2XEJA 3D66A 4AVBA 2B0AA 2JEWA 3BLNA 2FE7A 4WWVA 3BUWB 3G3SA 1XOVA 4C86A 1R43A 4PXDA 4B13A 2CNSA 3B7IA 3D68A 4KSAA 4MCSA 3IWEA 4O23A 2B4BA 3S9NA 2Z3LA 3ZZIA 5HVHA 4C9UA 2CIJA 1FY7A 3TLGB 2C6PA 3B3VA 4AXVA 5C82A 1A2ZA 1RO5A 3A9LA 4BMHA 1ZRSA 1BLLE 4NJQA 3T5MA 4H2KA 1OBRA 1F57A 3FBUA 2GREA 4MHZA 2Q7SA 4CPAA 4X3RA 2AE6A 3DR6A 1TKHA 3PB8X 5JQ4A 1GHEA 1QSNA 2DPSA 5BWAB 5F46A 2PJBA 4DUKA 1KBLA 2UV8G 2Y1MA 5LRKA 3BI1A 4JD6A 2OU2A 3EO4A 4H89A 2HI6A 2GFQA 3DSBA 1YREA 1Z9EA 2BCOA 2YGWA 1SQHA 3TYXA 1CS0B 3WC5A 2Z3PA 3LD2A 4UBRA 2FSRA 4YWYA 5C88A 1Z8LA 3FECA 4A33A 1IY7A 4ZY1A 3T05A 2YJVA 5DWMA 1Z5RA 3KL9A 4CAWA 3D7DA 2O4HA 5IB0A 3DLJA 3WABA 2B4DA 1YVOA 2AFUA 2F7VA 1CP7A 2OB0A 5EC4A 4R6TA 4KSFA 4KSIA 2HB6A 2REFA 2IMOA 2PJ6A 4RUHA 2VZYA 3BJ7A 2HUZA 3EC4A 5G21A 5HH1A 4PQAA 4R9MA 2Z3NA 4RS2A 5G20A 2JLMA 2ZOFA 3HPHE 2C1CA 4P4EA 3EFAA 1HEEA 5F5XA 4KORA 3PB6X 3P2HA 4OP4A 4FAIA 1YLEA 1VIXA 4NGRA 3OB2B 3IIBA 3VATA 2XPOA 1CX8A 3K2KA 2B5GA 4PSXA 4CYNA 3ISXA 4ONWA 1VI4A 2FM4A 1ZG9A 3EY5A 2HROA 4HNXB 1ARLA 4MFLA 2GANA 2B4JC 4KLWA 2Q43A 1I21A 4I49A 4KVXA 4M85A 4PPZA 3B8GA 2EK8A 2RB7A 4P6YA 5LRJA 3TLZA 3NFZA 4HNWB 5HKYA 4UA3A 4A94A 1MJ9A 3PEIA 1S60A 3K9TA 5IX3A 2ZW5A 2CNTA 4UCMA 1ZG7A 4UCNA 4A4CA 1IICA 3JTKA 3TOBA 4A38A 4CAVA 1QQ9A 4NCZA 2PCNA 4ONUA 3S6HA 1V6CA 4R87A 1ELMP 5HVGA 3GLJA 1ZL0A 4FD4A 4MCRA 1QSOA 5HVFA 1GYTA 1LANA 8CPAA 3IU1A 5F1YA 3K4IA 2ABZA 1JQGA 1YQEA 1IOIA 2CNMA 2F8HA 2B4DB 2G9DA 4MBUA 1IYKA 3WC7A 2DEAA 2ZEEA 1XRYA 1BO4A 2GP4A 3ICUA 3N5FA 3KASA 3B2YA 4R7MA 3OAKA 4B5PB 2Y0MA 1H8LA 4TJXA 4LX9A 1RXTA 3FRMA 4R76A 3KZWA 3E0KA 3FF3A 4C9RA 3TE4A 2PRQA 1ZO0A 4KNGE 3F0AA 4JYWA 1XBUA 3PRTA 4NGNA 3V38A 2JBJA 1Z2LA 4LQGA 1KWMA 4B14A 2EVNA 4Q38A 7CPAA 5IB9A 4MCQA 3IJ3A 4MY3A 4Y49C 1YK3A 1LFWA 2G3TA 2NMTA 2Q7BA 2CBLA 3S9MA 3TX8A 3V8IA 4BD9A 4QBJA 3H5ZA 1FNOA 2RC4A 2PJCA 3NFQA 4FD6A 4KUBA 4M6IA 5H84A 4K30A 4XPDC 4YRHA 3KQXA 1M4GA 4UEFA 4NGMA 4OC4A 4FUUA 1ON0A 3R9EA 2JEVA 4CAFA 4DJLA 4Y49B 4F0XA 4R57A 4IIXA 3WC6A 2Q0YA 1R61A 2AFSA 4YN3A 4OC5A 3VGOA 3GB0A 4MY0A 2JBKA 3LODA 4NGQA 1TF8A 1XIXA 3F9KC 4C2YA 3NH4A 4GXHA 1NSAA 1Y0RA 2PJ1A 3TO6A 4IAVA 1C30B 1QSTA 1WK4A 4KOWA 4U5YA 2YNCA 4XPDB 1CBXA 1BXRB 3I3GA 1R3NA 4ZI6A 5FD8A 3OP0A 3SJFA 1MJAA 4NSQA 5F09A 1XE4A 3VWEA 4A39A 1F2PA 3MGDA 2XPLA 4CRYB 3PFVA 4JZ0A 1CP6A 2F5IA 2IL4A 2VEZA 3D2MA 3PB7X 3R96A 3HMJG 3K9UA 3CXSA 3BUMB 3TLBA 3SJGA 3PT1A 1YW4A 4UWJA 1P4NA 1XMTA 2ZW4A 3I9SA 2Q44A 3OWCA 4R3KA 4HNYB 4HPSA 2PJ8A 2D4OA 4EWTA 4KOYA 4H1HA 3BHXA 4WJBA 4UEEA 2N3AB 2JDDA 4C2ZA 2J9AA 2XEFA 4ZY2A 3T90A 2ATRA 4PK3A 3D3SA 2BOAA 3VRQA 1B6BA 4J3GA 3R9FA 3H4QA 3PB4X 4E8OA 1FBVA 4CGPA 4E94A 5BY0A 2OZGA 3KR4A 4CYOA 5J8CA 2Y1NA 2REEA 3HLPA 2PR8A 4IK2A 4A32A 3IC1A 2Z3KA 4DNCA 3EZEA 2OOTA 3BI0A
chains in the Genus database with same CATH topology
5ELYA 4MRIA 1XF1A 3RZAA 4EMEA 1IGBA 2POKA 4ZX8A 4C8CA 3D67A 1HDUA 1LCPA 1ZG8A 4UF4A 1TKJA 2QVPA 1YMEA 3FX6A 2QYVA 4X2TA 2CTCA 3KI9A 3NH5A 4P4FA 3I74A 1WVMA 1ELLP 1CPXA 2O53A 1Y0YA 3I6SA 2PJ2A 3PB9X 4C8FA 2PVWA 2RFHA 3RBUA 3MRUA 6CPAA 3CPXA 2PCUA 3H8FA 3FEEA 3B3SA 4ZX9A 3FJUA 3RAMA 3FH4A 5LYIA 1PCAA 5JH9A 4C9AA 2NSMA 2V77A 2C6CA 1TF9A 1XFOA 1RTQA 4UEZA 4CDJA 3DGVA 2ZEPA 4OIDA 3FEDA 1TXRA 1YLOA 4G1PA 2AFMA 4P4JA 4K3NA 2GLJA 4OKOA 3B3TA 1FT7A 4OIWA 4Z65A 3T8WA 3B3WA 5JM6A 3PFOA 3D7HA 5K8OA 3CPAA 3IFEA 3S9LA 4OC2A 5I4MA 1ZLHA 3IWWA 2V8VA 2AFOA 5LYFA 5IR2A 2PJAA 4CDKA 1BPNA 3V7ZA 3SI2A 3KHXA 4EFDA 4F8ZA 4UIAA 3NA6A 3KGQA 4DYOA 3LMSA 3VH9A 4A37A 5J1QA 4F9UA 2IQ6A 5K8MA 1VGYA 4C8PA 2ANPA 3EIFA 2PJ5A 4B6ZA 5LRGA 4P4BA 4UIBA 4P4IA 3L2NA 2GLFA 1DTDA 2ZOGA 2PJ7A 2V8HA 3QNVA 4MHPA 5THWA 1M4LA 2Q51A 1CPSA 3PBEA 4W9YA 4GM5A 2ZEGA 4PXEA 4PXBA 1DE4C 2WYRA 5CPAA 2EK9A 2C5QA 1BPMA 3SJXA 2CF4A 1YSJA 2ZEHA 3PBBA 3FVLA 4F9VA 2WZNA 5DS0A 3FMCA 1YW6A 5CBMA 3VARA 1XJOA 3IO1A 3WT4A 4TWEA 4NGSA 3KQZA 4NJRA 1Q7LA 2V8DA 3H8EA 4ZYQA 1LAPA 2ZEMA 5D8NA 4C9VA 3SI0A 3B35A 3LWUA 2HC9A 2Q4ZA 4MCPA 2PJ9A 3CT9A 4C8TA 5K8NA 4MXUA 2ZENA 2PJ4A 4OMEA 2PVVA 3BXMA 3H8GA 1TKFA 3B3CA 1LOKA 1VHEA 3IEHA 4TNUA 5LYLA 3JRUA 3D7GA 3HUVA 2OR4A 3SI1A 4MHNA 3ISZA 2PIZA 1PYTB 4OC3A 2BO9A 1VHOA 3KHZA 3SJEA 3MN8A 2AFWA 2QJ8A 2ZEDA 4X8IA 5JGFA 5LYDA 2AFXA 3D4UA 4P44A 4Q7AA 2FVGA 4FWUA 4C99A 1AYEA 4C85A 4C84A 4C8UA 4P4DA 5D29A 2C6GA 3KR5A 2PJ0A 4R8FA 1LAMA 4YU9A 4NFRA 2XEIA 3VTAA 1Y7EA 4PXCA 2I3CA 4MMOA 1QMUA 2IJZA 4IHMA 2XEGA 1UWYA 2PIYA 1AMPA 2EWBA 1ZLIA 1XMBA 3D7FA 2ZEFA 2PJ3A 2ZELA 4P45A 5HXDA 3GUXA 2GU2A 4TJVA 1HDQA 4NGPA 4NGTA 1CG2A 2PE3A 3CDXA 4C9EA 2NYQA 2ZEOA 1BAVA 4P10A 4C8AA 4ZY0A 4OC1A 1EE3P 1F2OA 4OC0A 2V8GA 2VL1A 3I1UA 2AFZA 3PFEA 3NH8A 3TC8A 5K8PA 4MHYA 1ARMA 1Y9ZA 4FBEA 2CTBA 2XEJA 3D66A 2JEWA 4WWVA 4C86A 1R43A 4PXDA 4EWTA 3B7IA 3D68A 4O23A 4MCSA 3S9NA 5HVHA 4C9UA 2CIJA 2C6PA 3B3VA 4AXVA 1BLLE 4NJQA 4H2KA 1OBRA 1F57A 2GREA 4MHZA 4CPAA 4X3RA 3PB8X 1TKHA 2PJBA 4DUKA 5LRKA 3BI1A 2BCOA 3WC5A 4YWYA 1Z8LA 3FECA 1IY7A 4ZY1A 1Z5RA 3KL9A 3D7DA 2O4HA 3DLJA 3WABA 2AFUA 2F7VA 1CP7A 4R6TA 4KSIA 2HB6A 2IMOA 2PJ6A 4RUHA 4PQAA 2ZOFA 2C1CA 4P4EA 1HEEA 3PB6X 4OP4A 4FAIA 1VIXA 4NGRA 3IIBA 3VATA 1CX8A 3K2KA 3ISXA 4ONWA 1ZG9A 1ARLA 2Q43A 4PPZA 2EK8A 2RB7A 4P6YA 5LRJA 3NFZA 4A94A 3PEIA 3K9TA 1ZG7A 4A38A 1QQ9A 1V6CA 1ELMP 5HVGA 3GLJA 4MCRA 5HVFA 8CPAA 1GYTA 1LANA 2ABZA 1JQGA 2F8HA 2G9DA 3WC7A 2DEAA 2ZEEA 1XRYA 2GP4A 3ICUA 3N5FA 3KASA 3B2YA 4R7MA 4TJXA 1H8LA 4R76A 3KZWA 3FF3A 4C9RA 2PRQA 4KNGE 4JYWA 1XBUA 3PRTA 4NGNA 3V38A 2JBJA 1Z2LA 4LQGA 1KWMA 7CPAA 5IB9A 4MCQA 3IJ3A 1LFWA 3TX8A 3S9MA 4BD9A 1FNOA 2PJCA 3KQXA 4UEFA 4NGMA 4OC4A 4FUUA 4DJLA 3WC6A 2AFSA 4YN3A 4OC5A 3GB0A 2JBKA 4NGQA 1TF8A 3NH4A 1NSAA 1Y0RA 2PJ1A 4IAVA 1CBXA 1R3NA 4ZI6A 4A39A 3SJFA 5F09A 1F2PA 4JZ0A 1CP6A 3PB7X 3SJGA 1YW4A 2PJ8A 3BHXA 4WJBA 4UEEA 2J9AA 2XEFA 4ZY2A 2BOAA 3PB4X 3KR4A 3HLPA 4IK2A 3IC1A 2OOTA 3BI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELY A;  4MRI A;  1XF1 A;  3RZA A;  4EME A;  1IGB A;  2POK A;  4ZX8 A;  4C8C A;  3D67 A;  1HDU A;  1LCP A;  1ZG8 A;  4UF4 A;  1TKJ A;  2QVP A;  1YME A;  3FX6 A;  2QYV A;  4X2T A;  2CTC A;  3KI9 A;  3NH5 A;  4P4F A;  3I74 A;  1WVM A;  1ELL P;  1CPX A;  2O53 A;  1Y0Y A;  3I6S A;  2PJ2 A;  3PB9 X;  4C8F A;  2PVW A;  2RFH A;  3RBU A;  3MRU A;  6CPA A;  3CPX A;  2PCU A;  3H8F A;  3FEE A;  3B3S A;  4ZX9 A;  3FJU A;  3RAM A;  3FH4 A;  5LYI A;  1PCA A;  5JH9 A;  4C9A A;  2NSM A;  2V77 A;  2C6C A;  1TF9 A;  1XFO A;  1RTQ A;  4UEZ A;  4CDJ A;  3DGV A;  2ZEP A;  4OID A;  3FED A;  1TXR A;  1YLO A;  4G1P A;  2AFM A;  4P4J A;  4K3N A;  2GLJ A;  4OKO A;  3B3T A;  1FT7 A;  4OIW A;  4Z65 A;  3T8W A;  3B3W A;  5JM6 A;  3PFO A;  3D7H A;  5K8O A;  3CPA A;  3IFE A;  3S9L A;  4OC2 A;  5I4M A;  1ZLH A;  3IWW A;  2V8V A;  2AFO A;  5LYF A;  2PJA A;  4CDK A;  1BPN A;  3V7Z A;  3SI2 A;  3KHX A;  4EFD A;  4F8Z A;  4UIA A;  3NA6 A;  3KGQ A;  4DYO A;  3LMS A;  3VH9 A;  4A37 A;  5J1Q A;  4F9U A;  2IQ6 A;  5K8M A;  1VGY A;  4C8P A;  2ANP A;  3EIF A;  2PJ5 A;  4B6Z A;  5LRG A;  4P4B A;  4UIB A;  4P4I A;  3L2N A;  2GLF A;  1DTD A;  2ZOG A;  2PJ7 A;  2V8H A;  3QNV A;  4MHP A;  5THW A;  1M4L A;  2Q51 A;  1CPS A;  3PBE A;  4W9Y A;  4GM5 A;  2ZEG A;  4PXE A;  4PXB A;  1DE4 C;  2WYR A;  5CPA A;  2EK9 A;  1BPM A;  3SJX A;  2CF4 A;  1YSJ A;  2ZEH A;  3PBB A;  3FVL A;  4F9V A;  2WZN A;  5DS0 A;  3FMC A;  1YW6 A;  5CBM A;  3VAR A;  1XJO A;  3IO1 A;  3WT4 A;  4TWE A;  4NGS A;  3KQZ A;  4NJR A;  1Q7L A;  2V8D A;  3H8E A;  4ZYQ A;  1LAP A;  2ZEM A;  5D8N A;  4C9V A;  3SI0 A;  3B35 A;  3LWU A;  2HC9 A;  2Q4Z A;  4MCP A;  2PJ9 A;  3CT9 A;  4C8T A;  5K8N A;  4MXU A;  2ZEN A;  2PJ4 A;  4OME A;  2PVV A;  3BXM A;  3H8G A;  1TKF A;  3B3C A;  1LOK A;  1VHE A;  3IEH A;  4TNU A;  5LYL A;  3JRU A;  3D7G A;  3HUV A;  2OR4 A;  3SI1 A;  4MHN A;  3ISZ A;  2PIZ A;  1PYT B;  4OC3 A;  2BO9 A;  1VHO A;  3KHZ A;  3SJE A;  3MN8 A;  2AFW A;  2QJ8 A;  2ZED A;  4X8I A;  5JGF A;  5LYD A;  2AFX A;  3D4U A;  4P44 A;  4Q7A A;  2FVG A;  4FWU A;  4C99 A;  1AYE A;  4C85 A;  4C84 A;  4C8U A;  4P4D A;  5D29 A;  2C6G A;  3KR5 A;  2PJ0 A;  4R8F A;  1LAM A;  4YU9 A;  4NFR A;  2XEI A;  3VTA A;  1Y7E A;  4PXC A;  2I3C A;  4MMO A;  1QMU A;  2IJZ A;  4IHM A;  2XEG A;  1UWY A;  2PIY A;  1AMP A;  2EWB A;  1ZLI A;  1XMB A;  3D7F A;  2ZEF A;  2PJ3 A;  2ZEL A;  4P45 A;  5HXD A;  3GUX A;  2GU2 A;  4TJV A;  1HDQ A;  4NGP A;  4NGT A;  1CG2 A;  2PE3 A;  3CDX A;  4C9E A;  2NYQ A;  2ZEO A;  1BAV A;  4P10 A;  4C8A A;  4ZY0 A;  4OC1 A;  1EE3 P;  1F2O A;  4OC0 A;  2V8G A;  2VL1 A;  3I1U A;  2AFZ A;  3PFE A;  3NH8 A;  3TC8 A;  5K8P A;  4MHY A;  1ARM A;  1Y9Z A;  4FBE A;  2CTB A;  2XEJ A;  3D66 A;  2JEW A;  4WWV A;  4C86 A;  1R43 A;  4PXD A;  4EWT A;  3B7I A;  3D68 A;  4O23 A;  4MCS A;  3S9N A;  5HVH A;  4C9U A;  2CIJ A;  2C6P A;  3B3V A;  4AXV A;  1BLL E;  4NJQ A;  4H2K A;  1OBR A;  1F57 A;  2GRE A;  4MHZ A;  4CPA A;  4X3R A;  3PB8 X;  1TKH A;  2PJB A;  4DUK A;  5LRK A;  3BI1 A;  2BCO A;  3WC5 A;  4YWY A;  1Z8L A;  3FEC A;  1IY7 A;  4ZY1 A;  1Z5R A;  3KL9 A;  3D7D A;  2O4H A;  3DLJ A;  3WAB A;  2AFU A;  2F7V A;  1CP7 A;  4R6T A;  4KSI A;  2HB6 A;  2IMO A;  2PJ6 A;  4RUH A;  4PQA A;  2ZOF A;  2C1C A;  4P4E A;  1HEE A;  3PB6 X;  4OP4 A;  4FAI A;  1VIX A;  4NGR A;  3IIB A;  3VAT A;  1CX8 A;  3K2K A;  3ISX A;  4ONW A;  1ZG9 A;  1ARL A;  2Q43 A;  4PPZ A;  2EK8 A;  2RB7 A;  4P6Y A;  5LRJ A;  3NFZ A;  4A94 A;  3PEI A;  3K9T A;  1ZG7 A;  4A38 A;  1QQ9 A;  1V6C A;  1ELM P;  5HVG A;  3GLJ A;  4MCR A;  5HVF A;  8CPA A;  1GYT A;  1LAN A;  2ABZ A;  1JQG A;  2F8H A;  2G9D A;  3WC7 A;  2DEA A;  2ZEE A;  1XRY A;  3ICU A;  3N5F A;  3KAS A;  3B2Y A;  4R7M A;  4TJX A;  1H8L A;  4R76 A;  3KZW A;  3FF3 A;  4C9R A;  2PRQ A;  4KNG E;  4JYW A;  1XBU A;  3PRT A;  4NGN A;  3V38 A;  2JBJ A;  1Z2L A;  4LQG A;  1KWM A;  7CPA A;  5IB9 A;  4MCQ A;  3IJ3 A;  1LFW A;  3TX8 A;  3S9M A;  4BD9 A;  1FNO A;  2PJC A;  3KQX A;  4UEF A;  4NGM A;  4OC4 A;  4FUU A;  4DJL A;  3WC6 A;  2AFS A;  4YN3 A;  4OC5 A;  3GB0 A;  2JBK A;  4NGQ A;  1TF8 A;  3NH4 A;  1NSA A;  1Y0R A;  2PJ1 A;  4IAV A;  1CBX A;  1R3N A;  4ZI6 A;  4A39 A;  3SJF A;  5F09 A;  1F2P A;  4JZ0 A;  1CP6 A;  3PB7 X;  3SJG A;  1YW4 A;  2PJ8 A;  3BHX A;  4WJB A;  4UEE A;  2J9A A;  2XEF A;  4ZY2 A;  2BOA A;  3PB4 X;  3KR4 A;  3HLP A;  4IK2 A;  3IC1 A;  2OOT A;  3BI0 A; 
#chains in the Genus database with same CATH topology
 5ELY A;  2CXA A;  4KOS A;  4A4B A;  4MRI A;  2VZZ A;  4FD5 A;  4CAX A;  1XF1 A;  3RZA A;  1A9X B;  2AJ6 A;  4CGN A;  2DF5 A;  4EME A;  2DPT A;  1IGB A;  1JWQ A;  2POK A;  5KTA A;  2EO8 A;  4CRZ B;  5KTD A;  3FNC A;  4ZX8 A;  3TFY A;  3FIX A;  1KUY A;  4C8C A;  3D67 A;  3SXO A;  1KEE B;  5A27 A;  4BTF A;  1HDU A;  3GJZ A;  1EZB A;  1LCP A;  3TCV A;  1ZG8 A;  1S7N A;  4UFV A;  4UF4 A;  3RNZ A;  4GS4 A;  1TKJ A;  2HWG A;  1PU9 A;  2QVP A;  1YME A;  1NXJ A;  1IYL A;  3FX6 A;  2QYV A;  4MJ8 A;  2GIV A;  4X2T A;  2CTC A;  3KI9 A;  2Z10 A;  3NH5 A;  3TO7 A;  4P4F A;  3I74 A;  3F5B A;  4U9Z A;  4KOX A;  1WVM A;  1ELL P;  1CPX A;  1KZF A;  2FIW A;  2O53 A;  4E5S A;  1K4J A;  1Y0Y A;  2B5G B;  2PJ2 A;  3FYN A;  3I6S A;  5HKW A;  5J3X A;  3PB9 X;  5FVJ A;  3TLG A;  4C8F A;  2PVW A;  3N7Z A;  4ZBG A;  4XPL A;  2RFH A;  3RBU A;  3MRU A;  2Z3M A;  3IU2 A;  6CPA A;  3CPX A;  4F0Y A;  2PCU A;  3H8F A;  1Z9U A;  2QIR A;  4IUS A;  5AG5 A;  4B5P A;  3FEE A;  1OZP A;  3B3S A;  4ZX9 A;  4JXQ A;  4AVA A;  4BIN A;  3FJU A;  2HQY A;  4CO9 A;  2EZA A;  3RAM A;  2AUM A;  3QAH A;  2VI7 A;  3FH4 A;  5DWN A;  4INJ A;  4L89 A;  5LYI A;  1PCA A;  5JH9 A;  1DIK A;  4C9A A;  3VRO A;  2ZW7 A;  4IF5 A;  2NSM A;  1JDB C;  3JUW A;  2V77 A;  2C6C A;  1TF9 A;  1XFO A;  1RTQ A;  1GGO A;  4UEZ A;  4M8D A;  1V0C A;  3VWD A;  2R7H A;  4CDJ A;  2X7B A;  1IB1 E;  3DGV A;  4JLY A;  2WPW A;  4XNH C;  4C8T A;  4QUS A;  2ZEP A;  2FCK A;  4OID A;  3FED A;  3NOJ A;  1TXR A;  1YLO A;  2HV2 A;  4G1P A;  2AFM A;  4P4J A;  2DXQ A;  3G23 A;  2BSW A;  2G3A A;  3LAC A;  1VBG A;  4K3N A;  1EO0 A;  2EUI A;  2H5M A;  4NXY A;  5JPH A;  4CZ1 A;  2Z11 A;  3SXN A;  2YJT A;  2GLJ A;  4PSW A;  4OKO A;  2FXF A;  3B3T A;  1I12 A;  5JVL A;  1FT7 A;  4OIW A;  4Z65 A;  4KS9 A;  2YNE A;  2XPP A;  3T8W A;  1MJB A;  3B3W A;  5JM6 A;  3CXP A;  3PFO A;  3F8K A;  3D7H A;  1YX0 A;  4JXR A;  4UFW A;  1Y7R A;  3R95 A;  1CJW A;  2YND A;  3CPA A;  3IFE A;  3S9L A;  4OAD A;  1EZA A;  4QB9 A;  4BBH A;  4OC2 A;  2P6G A;  5I4M A;  1ZLH A;  3U1B A;  2D0O A;  1WJT A;  3PZJ A;  3TOA A;  5AGE A;  3IWW A;  3DDD A;  4A31 A;  1Q2D A;  3PLF B;  2D4P A;  2AFO A;  2V8V A;  5G22 A;  2ZXV A;  5LYF A;  3FXT A;  4MFK A;  4UFX A;  1Q2Y A;  4B5O A;  5IR2 A;  1U6M A;  4MFZ A;  2PJA A;  4MFJ A;  4CDK A;  4AB7 A;  4RR2 B;  1NMT A;  4KLV A;  3TLE A;  2P6E A;  2OLS A;  1Z8T A;  2EZC A;  2VKZ G;  1BPN A;  3V7Z A;  2R8V A;  3SI2 A;  3KHX A;  4EFD A;  4F8Z A;  2OH1 A;  4R3L A;  4UIA A;  3S6G A;  4C7I A;  2PQ8 A;  3NA6 A;  3JVN A;  3KGQ A;  3W6S A;  4DYO A;  2Q04 A;  3HPG G;  2D0P A;  1BOB A;  2DIK A;  4JVO A;  2OZU A;  3LMS A;  4E2A A;  3U88 C;  3VH9 A;  4RI1 A;  4A37 A;  4QC6 A;  3GY9 A;  3TLA A;  1X10 A;  5J1Q A;  3PGP A;  2VXK A;  3BUN B;  2C27 A;  4F9U A;  2IQ6 A;  5EMI A;  5K8M A;  4MFQ A;  1VGY A;  5F48 A;  4C8P A;  2ANP A;  1P0H A;  2QML A;  4CGM A;  2PJ5 A;  1L0C A;  2FS5 A;  3QAY A;  4B6Z A;  5LRG A;  4P4B A;  4OLL A;  4UIB A;  3TTH A;  2WSA A;  1X12 A;  4Q36 A;  5A28 A;  2EBJ A;  4P4I A;  3IWG A;  2GLF A;  3L2N A;  4EVY A;  1DTD A;  2ZOG A;  4A30 A;  4YFJ A;  2PJ7 A;  2V8H A;  3QNV A;  4MHP A;  5THW A;  3TLY A;  1J4J A;  1M4L A;  2Q51 A;  1CPS A;  5G1Z A;  4B10 A;  1NE9 A;  3PBE A;  1Q5X A;  3ZNI A;  3EZA A;  1KUV A;  4W9Y A;  1Z8W A;  4GM5 A;  2ZEG A;  4PXE A;  4PXB A;  4MFP A;  1DE4 C;  3NE7 A;  2WYR A;  3GIU A;  5CPA A;  2EK9 A;  2C5Q A;  3C8O A;  3P2F A;  2JDC A;  1YVK A;  3SR3 A;  2B3V A;  1BPM A;  3SJX A;  4QVT A;  1MK4 A;  1VHS A;  2Q4V A;  4BPU B;  2K5T A;  5AG6 A;  4LUA A;  2CF4 A;  1YSJ A;  2ZEH A;  4X5K A;  3CXQ A;  3R9G A;  3PBB A;  3KRV A;  3FVL A;  2FL4 A;  2WZN A;  4F9V A;  3EIF A;  5DS0 A;  1TIQ A;  3W6X A;  3S6K A;  3FMC A;  1YW6 A;  4E0A A;  5CBM A;  5HMN A;  3TT2 A;  1S5K A;  2O28 A;  3VAR A;  4A95 A;  2ARH A;  1XJO A;  1R57 A;  2I00 A;  3IO1 A;  1YGH A;  4BPW B;  3WT4 A;  3EXN A;  4TWE A;  4LQ6 A;  1Y9W A;  4NGS A;  4C2X A;  3KQZ A;  3C26 A;  4JWP A;  2GE3 A;  5F13 A;  4M6G A;  3DNS A;  5AG4 A;  5JYB A;  5F49 A;  3FB3 A;  4NJR A;  1QSM A;  2Z0Z A;  1IU8 A;  1Q7L A;  3DR8 A;  2V8D A;  4CS0 B;  3O8Z A;  3H8E A;  4ZYQ A;  1LAP A;  4ORF A;  3TLC A;  2ZEM A;  5D8N A;  4C9V A;  5ISV A;  3SI0 A;  1S7F A;  1QSR A;  3B35 A;  3LWU A;  2HC9 A;  2Q4Y A;  2Q4Z A;  4MCP A;  1UFH A;  3D8P A;  2PJ9 A;  4H6U A;  3CT9 A;  3VRN A;  4AVC A;  1Z8X A;  5H86 A;  1M1D A;  1JDE A;  5K8N A;  3R1K A;  2ZEN A;  2PJ4 A;  1KUX A;  4OME A;  2PVV A;  4MXU A;  1J3L A;  4MHD A;  3BXM A;  3H8G A;  1TKF A;  3B3C A;  1LOK A;  2P0W A;  2DLA A;  1VHE A;  4YGO A;  3IEH A;  5K8O A;  4TNU A;  4IIY A;  4KOT A;  4KVM E;  1I1D A;  5LYL A;  5E96 A;  3JRU A;  3D7G A;  5IV0 A;  2FIA A;  2WPX A;  3HUV A;  2OZH A;  4II9 A;  5GCN A;  3RO0 A;  4CYQ A;  2OR4 A;  1S7K A;  1WWZ A;  2PC1 A;  4RN7 A;  2XPN A;  2PRB A;  5F47 A;  3SI1 A;  3TO9 A;  4AG7 A;  1ZYM A;  3D2P A;  4MHN A;  2MP0 A;  2B3U A;  1Y9K A;  2R1I A;  3GKR A;  4HKF A;  3ISZ A;  4M3S A;  3EZB A;  3ZJ0 A;  2PIZ A;  1PYT B;  1S7L A;  3CZX A;  2J8M A;  4OC3 A;  4JJX A;  1N71 A;  3W91 A;  3T9Y A;  2BO9 A;  1VHO A;  3KHZ A;  4COB A;  2I79 A;  3BJ8 A;  3SJE A;  4OAE A;  3G8W A;  3MN8 A;  2AFW A;  2EZB A;  3SHP A;  4MI1 A;  2QJ8 A;  2ZED A;  4X8I A;  5JGF A;  1YR0 A;  5LYD A;  2AFX A;  4CGO A;  4B12 A;  3BUX B;  2X0S A;  2J8N A;  3D4U A;  4XNH B;  4P44 A;  2G0B A;  2J8R A;  4Q7A A;  1VBH A;  2Z3O A;  4A2Z A;  1NSL A;  2PSW A;  1CM0 A;  4CGL A;  2FVG A;  2PR1 A;  4FWU A;  1XEB A;  2R82 A;  1AYE A;  1PUA A;  2ZPA A;  1T36 B;  4C99 A;  2BUE A;  2VBQ A;  4PK2 A;  5AG7 A;  4XPK A;  4C84 A;  4C85 A;  4C8U A;  1M4D A;  4P4D A;  5D29 A;  2C6G A;  4KZT A;  4CYP A;  1IID A;  3KR5 A;  2PJ0 A;  4R8F A;  4UWI A;  1LAM A;  4YU9 A;  5F9M A;  4NFR A;  4C7H A;  4FD7 A;  3S6F A;  2XEI A;  2WUU A;  4C68 A;  3VTA A;  2PDO A;  3IGR A;  2CY2 A;  2E28 A;  4ZGY B;  1S3Z A;  1Y7E A;  4PXC A;  2AUN A;  1AUG A;  2I3C A;  3PP9 A;  4MMO A;  5K99 A;  3VRP A;  3RYO A;  4COG A;  5CNP A;  1Z4E A;  1YVH A;  4M6H A;  5HKZ A;  1QMU A;  4BPX B;  4CAE A;  2P6F A;  2IJZ A;  1M6V B;  4IHM A;  2XEG A;  1CE8 B;  1UWY A;  1Z4R A;  2R98 A;  4PV6 A;  4EYS A;  5AXI A;  4NF1 A;  2YNC C;  2PIY A;  4J0N A;  1AMP A;  3NE8 A;  2EWB A;  2VQY A;  1M4I A;  1ZLI A;  1XMB A;  2B58 A;  3D7F A;  2ZW6 A;  3GYA A;  2ZEF A;  2PJ3 A;  4MJX A;  2ZEL A;  3OB1 B;  4P45 A;  3QB8 A;  5HXD A;  4UCP A;  3GUX A;  2GU2 A;  4TJV A;  1HDQ A;  4NGP A;  2KCW A;  3KKW A;  4AG9 A;  4NGT A;  5KTC A;  1LRZ A;  1XF8 A;  3T07 A;  1CG2 A;  4L8A A;  4F6A A;  2PE3 A;  5I0C A;  3CDX A;  2QEC A;  5EBV A;  3WR7 A;  5J8F A;  1M44 A;  4C9E A;  2FT0 A;  2NYQ A;  2ZEO A;  1BAV A;  2ODF A;  4P10 A;  1NBW A;  1C3O B;  4C8A A;  4KUA A;  1IOF A;  4KVO E;  4ZY0 A;  4MI4 A;  3BUO B;  4OC1 A;  1EE3 P;  1F2O A;  2A4N A;  1B47 A;  4OC0 A;  2V8G A;  2BL1 A;  2VL1 A;  1KC7 A;  3I1U A;  4KOV A;  4NEX A;  2AFZ A;  4B11 A;  3T0T A;  4GPL B;  4H6Z A;  4U9Y A;  1B87 A;  1VKC A;  3PFE A;  3NH8 A;  3TC8 A;  5K8P A;  1Q2C A;  4MHY A;  1ARM A;  2BEI A;  1Y9Z A;  4FBE A;  3UY5 A;  3VRR A;  2CTB A;  4KOU A;  2XEJ A;  3D66 A;  4AVB A;  2B0A A;  2JEW A;  3BLN A;  2FE7 A;  4WWV A;  3BUW B;  3G3S A;  1XOV A;  4C86 A;  1R43 A;  4PXD A;  4B13 A;  2CNS A;  3B7I A;  3D68 A;  4KSA A;  4MCS A;  3IWE A;  4O23 A;  2B4B A;  3S9N A;  2Z3L A;  3ZZI A;  5HVH A;  4C9U A;  2CIJ A;  1FY7 A;  3TLG B;  2C6P A;  3B3V A;  4AXV A;  5C82 A;  1A2Z A;  1RO5 A;  3A9L A;  4BMH A;  1ZRS A;  1BLL E;  4NJQ A;  3T5M A;  4H2K A;  1OBR A;  1F57 A;  3FBU A;  2GRE A;  4MHZ A;  2Q7S A;  4CPA A;  4X3R A;  2AE6 A;  3DR6 A;  1TKH A;  3PB8 X;  5JQ4 A;  1GHE A;  1QSN A;  2DPS A;  5BWA B;  5F46 A;  2PJB A;  4DUK A;  1KBL A;  2UV8 G;  2Y1M A;  5LRK A;  3BI1 A;  4JD6 A;  2OU2 A;  3EO4 A;  4H89 A;  2HI6 A;  2GFQ A;  3DSB A;  1YRE A;  1Z9E A;  2BCO A;  2YGW A;  1SQH A;  3TYX A;  1CS0 B;  3WC5 A;  2Z3P A;  3LD2 A;  4UBR A;  2FSR A;  4YWY A;  5C88 A;  1Z8L A;  3FEC A;  4A33 A;  1IY7 A;  4ZY1 A;  3T05 A;  2YJV A;  5DWM A;  1Z5R A;  3KL9 A;  4CAW A;  3D7D A;  2O4H A;  5IB0 A;  3DLJ A;  3WAB A;  2B4D A;  1YVO A;  2AFU A;  2F7V A;  1CP7 A;  2OB0 A;  5EC4 A;  4R6T A;  4KSF A;  4KSI A;  2HB6 A;  2REF A;  2IMO A;  2PJ6 A;  4RUH A;  2VZY A;  3BJ7 A;  2HUZ A;  3EC4 A;  5G21 A;  5HH1 A;  4PQA A;  4R9M A;  2Z3N A;  4RS2 A;  5G20 A;  2JLM A;  2ZOF A;  3HPH E;  2C1C A;  4P4E A;  3EFA A;  1HEE A;  5F5X A;  4KOR A;  3PB6 X;  3P2H A;  4OP4 A;  4FAI A;  1YLE A;  1VIX A;  4NGR A;  3OB2 B;  3IIB A;  3VAT A;  2XPO A;  1CX8 A;  3K2K A;  2B5G A;  4PSX A;  4CYN A;  3ISX A;  4ONW A;  1VI4 A;  2FM4 A;  1ZG9 A;  3EY5 A;  2HRO A;  4HNX B;  1ARL A;  4MFL A;  2GAN A;  2B4J C;  4KLW A;  2Q43 A;  1I21 A;  4I49 A;  4KVX A;  4M85 A;  4PPZ A;  3B8G A;  2EK8 A;  2RB7 A;  4P6Y A;  5LRJ A;  3TLZ A;  3NFZ A;  4HNW B;  5HKY A;  4UA3 A;  4A94 A;  1MJ9 A;  3PEI A;  1S60 A;  3K9T A;  5IX3 A;  2ZW5 A;  2CNT A;  4UCM A;  1ZG7 A;  4UCN A;  4A4C A;  1IIC A;  3JTK A;  3TOB A;  4A38 A;  4CAV A;  1QQ9 A;  4NCZ A;  2PCN A;  4ONU A;  3S6H A;  1V6C A;  4R87 A;  1ELM P;  5HVG A;  3GLJ A;  1ZL0 A;  4FD4 A;  4MCR A;  1QSO A;  5HVF A;  1GYT A;  1LAN A;  8CPA A;  3IU1 A;  5F1Y A;  3K4I A;  2ABZ A;  1JQG A;  1YQE A;  1IOI A;  2CNM A;  2F8H A;  2B4D B;  2G9D A;  4MBU A;  1IYK A;  3WC7 A;  2DEA A;  2ZEE A;  1XRY A;  1BO4 A;  2GP4 A;  3ICU A;  3N5F A;  3KAS A;  3B2Y A;  4R7M A;  3OAK A;  4B5P B;  2Y0M A;  1H8L A;  4TJX A;  4LX9 A;  1RXT A;  3FRM A;  4R76 A;  3KZW A;  3E0K A;  3FF3 A;  4C9R A;  3TE4 A;  2PRQ A;  1ZO0 A;  4KNG E;  3F0A A;  4JYW A;  1XBU A;  3PRT A;  4NGN A;  3V38 A;  2JBJ A;  1Z2L A;  4LQG A;  1KWM A;  4B14 A;  2EVN A;  4Q38 A;  7CPA A;  5IB9 A;  4MCQ A;  3IJ3 A;  4MY3 A;  4Y49 C;  1YK3 A;  1LFW A;  2G3T A;  2NMT A;  2Q7B A;  2CBL A;  3S9M A;  3TX8 A;  3V8I A;  4BD9 A;  4QBJ A;  3H5Z A;  1FNO A;  2RC4 A;  2PJC A;  3NFQ A;  4FD6 A;  4KUB A;  4M6I A;  5H84 A;  4K30 A;  4XPD C;  4YRH A;  3KQX A;  1M4G A;  4UEF A;  4NGM A;  4OC4 A;  4FUU A;  1ON0 A;  3R9E A;  2JEV A;  4CAF A;  4DJL A;  4Y49 B;  4F0X A;  4R57 A;  4IIX A;  3WC6 A;  2Q0Y A;  1R61 A;  2AFS A;  4YN3 A;  4OC5 A;  3VGO A;  3GB0 A;  4MY0 A;  2JBK A;  3LOD A;  4NGQ A;  1TF8 A;  1XIX A;  3F9K C;  4C2Y A;  3NH4 A;  4GXH A;  1NSA A;  1Y0R A;  2PJ1 A;  3TO6 A;  4IAV A;  1C30 B;  1QST A;  1WK4 A;  4KOW A;  4U5Y A;  2YNC A;  4XPD B;  1CBX A;  1BXR B;  3I3G A;  1R3N A;  4ZI6 A;  5FD8 A;  3OP0 A;  3SJF A;  1MJA A;  4NSQ A;  5F09 A;  1XE4 A;  3VWE A;  4A39 A;  1F2P A;  3MGD A;  2XPL A;  4CRY B;  3PFV A;  4JZ0 A;  1CP6 A;  2F5I A;  2IL4 A;  2VEZ A;  3D2M A;  3PB7 X;  3R96 A;  3HMJ G;  3K9U A;  3CXS A;  3BUM B;  3TLB A;  3SJG A;  3PT1 A;  1YW4 A;  4UWJ A;  1P4N A;  1XMT A;  2ZW4 A;  3I9S A;  2Q44 A;  3OWC A;  4R3K A;  4HNY B;  4HPS A;  2PJ8 A;  2D4O A;  4EWT A;  4KOY A;  4H1H A;  3BHX A;  4WJB A;  4UEE A;  2N3A B;  2JDD A;  4C2Z A;  2J9A A;  2XEF A;  4ZY2 A;  3T90 A;  2ATR A;  4PK3 A;  3D3S A;  2BOA A;  3VRQ A;  1B6B A;  4J3G A;  3R9F A;  3H4Q A;  3PB4 X;  4E8O A;  1FBV A;  4CGP A;  4E94 A;  5BY0 A;  2OZG A;  3KR4 A;  4CYO A;  5J8C A;  2Y1N A;  2REE A;  3HLP A;  2PR8 A;  4IK2 A;  4A32 A;  3IC1 A;  2Z3K A;  4DNC A;  3EZE A;  2OOT A;  3BI0 A; 
#chains in the Genus database with same CATH homology
 5ELY A;  4MRI A;  1XF1 A;  3RZA A;  4EME A;  1IGB A;  2POK A;  4ZX8 A;  4C8C A;  3D67 A;  1HDU A;  1LCP A;  1ZG8 A;  4UF4 A;  1TKJ A;  2QVP A;  1YME A;  3FX6 A;  2QYV A;  4X2T A;  2CTC A;  3KI9 A;  3NH5 A;  4P4F A;  3I74 A;  1WVM A;  1ELL P;  1CPX A;  2O53 A;  1Y0Y A;  3I6S A;  2PJ2 A;  3PB9 X;  4C8F A;  2PVW A;  2RFH A;  3RBU A;  3MRU A;  6CPA A;  3CPX A;  2PCU A;  3H8F A;  3FEE A;  3B3S A;  4ZX9 A;  3FJU A;  3RAM A;  3FH4 A;  5LYI A;  1PCA A;  5JH9 A;  4C9A A;  2NSM A;  2V77 A;  2C6C A;  1TF9 A;  1XFO A;  1RTQ A;  4UEZ A;  4CDJ A;  3DGV A;  2ZEP A;  4OID A;  3FED A;  1TXR A;  1YLO A;  4G1P A;  2AFM A;  4P4J A;  4K3N A;  2GLJ A;  4OKO A;  3B3T A;  1FT7 A;  4OIW A;  4Z65 A;  3T8W A;  3B3W A;  5JM6 A;  3PFO A;  3D7H A;  5K8O A;  3CPA A;  3IFE A;  3S9L A;  4OC2 A;  5I4M A;  1ZLH A;  3IWW A;  2V8V A;  2AFO A;  5LYF A;  5IR2 A;  2PJA A;  4CDK A;  1BPN A;  3V7Z A;  3SI2 A;  3KHX A;  4EFD A;  4F8Z A;  4UIA A;  3NA6 A;  3KGQ A;  4DYO A;  3LMS A;  3VH9 A;  4A37 A;  5J1Q A;  4F9U A;  2IQ6 A;  5K8M A;  1VGY A;  4C8P A;  2ANP A;  3EIF A;  2PJ5 A;  4B6Z A;  5LRG A;  4P4B A;  4UIB A;  4P4I A;  3L2N A;  2GLF A;  1DTD A;  2ZOG A;  2PJ7 A;  2V8H A;  3QNV A;  4MHP A;  5THW A;  1M4L A;  2Q51 A;  1CPS A;  3PBE A;  4W9Y A;  4GM5 A;  2ZEG A;  4PXE A;  4PXB A;  1DE4 C;  2WYR A;  5CPA A;  2EK9 A;  2C5Q A;  1BPM A;  3SJX A;  2CF4 A;  1YSJ A;  2ZEH A;  3PBB A;  3FVL A;  4F9V A;  2WZN A;  5DS0 A;  3FMC A;  1YW6 A;  5CBM A;  3VAR A;  1XJO A;  3IO1 A;  3WT4 A;  4TWE A;  4NGS A;  3KQZ A;  4NJR A;  1Q7L A;  2V8D A;  3H8E A;  4ZYQ A;  1LAP A;  2ZEM A;  5D8N A;  4C9V A;  3SI0 A;  3B35 A;  3LWU A;  2HC9 A;  2Q4Z A;  4MCP A;  2PJ9 A;  3CT9 A;  4C8T A;  5K8N A;  4MXU A;  2ZEN A;  2PJ4 A;  4OME A;  2PVV A;  3BXM A;  3H8G A;  1TKF A;  3B3C A;  1LOK A;  1VHE A;  3IEH A;  4TNU A;  5LYL A;  3JRU A;  3D7G A;  3HUV A;  2OR4 A;  3SI1 A;  4MHN A;  3ISZ A;  2PIZ A;  1PYT B;  4OC3 A;  2BO9 A;  1VHO A;  3KHZ A;  3SJE A;  3MN8 A;  2AFW A;  2QJ8 A;  2ZED A;  4X8I A;  5JGF A;  5LYD A;  2AFX A;  3D4U A;  4P44 A;  4Q7A A;  2FVG A;  4FWU A;  4C99 A;  1AYE A;  4C85 A;  4C84 A;  4C8U A;  4P4D A;  5D29 A;  2C6G A;  3KR5 A;  2PJ0 A;  4R8F A;  1LAM A;  4YU9 A;  4NFR A;  2XEI A;  3VTA A;  1Y7E A;  4PXC A;  2I3C A;  4MMO A;  1QMU A;  2IJZ A;  4IHM A;  2XEG A;  1UWY A;  2PIY A;  1AMP A;  2EWB A;  1ZLI A;  1XMB A;  3D7F A;  2ZEF A;  2PJ3 A;  2ZEL A;  4P45 A;  5HXD A;  3GUX A;  2GU2 A;  4TJV A;  1HDQ A;  4NGP A;  4NGT A;  1CG2 A;  2PE3 A;  3CDX A;  4C9E A;  2NYQ A;  2ZEO A;  1BAV A;  4P10 A;  4C8A A;  4ZY0 A;  4OC1 A;  1EE3 P;  1F2O A;  4OC0 A;  2V8G A;  2VL1 A;  3I1U A;  2AFZ A;  3PFE A;  3NH8 A;  3TC8 A;  5K8P A;  4MHY A;  1ARM A;  1Y9Z A;  4FBE A;  2CTB A;  2XEJ A;  3D66 A;  2JEW A;  4WWV A;  4C86 A;  1R43 A;  4PXD A;  4EWT A;  3B7I A;  3D68 A;  4O23 A;  4MCS A;  3S9N A;  5HVH A;  4C9U A;  2CIJ A;  2C6P A;  3B3V A;  4AXV A;  1BLL E;  4NJQ A;  4H2K A;  1OBR A;  1F57 A;  2GRE A;  4MHZ A;  4CPA A;  4X3R A;  3PB8 X;  1TKH A;  2PJB A;  4DUK A;  5LRK A;  3BI1 A;  2BCO A;  3WC5 A;  4YWY A;  1Z8L A;  3FEC A;  1IY7 A;  4ZY1 A;  1Z5R A;  3KL9 A;  3D7D A;  2O4H A;  3DLJ A;  3WAB A;  2AFU A;  2F7V A;  1CP7 A;  4R6T A;  4KSI A;  2HB6 A;  2IMO A;  2PJ6 A;  4RUH A;  4PQA A;  2ZOF A;  2C1C A;  4P4E A;  1HEE A;  3PB6 X;  4OP4 A;  4FAI A;  1VIX A;  4NGR A;  3IIB A;  3VAT A;  1CX8 A;  3K2K A;  3ISX A;  4ONW A;  1ZG9 A;  1ARL A;  2Q43 A;  4PPZ A;  2EK8 A;  2RB7 A;  4P6Y A;  5LRJ A;  3NFZ A;  4A94 A;  3PEI A;  3K9T A;  1ZG7 A;  4A38 A;  1QQ9 A;  1V6C A;  1ELM P;  5HVG A;  3GLJ A;  4MCR A;  5HVF A;  8CPA A;  1GYT A;  1LAN A;  2ABZ A;  1JQG A;  2F8H A;  2G9D A;  3WC7 A;  2DEA A;  2ZEE A;  1XRY A;  2GP4 A;  3ICU A;  3N5F A;  3KAS A;  3B2Y A;  4R7M A;  4TJX A;  1H8L A;  4R76 A;  3KZW A;  3FF3 A;  4C9R A;  2PRQ A;  4KNG E;  4JYW A;  1XBU A;  3PRT A;  4NGN A;  3V38 A;  2JBJ A;  1Z2L A;  4LQG A;  1KWM A;  7CPA A;  5IB9 A;  4MCQ A;  3IJ3 A;  1LFW A;  3TX8 A;  3S9M A;  4BD9 A;  1FNO A;  2PJC A;  3KQX A;  4UEF A;  4NGM A;  4OC4 A;  4FUU A;  4DJL A;  3WC6 A;  2AFS A;  4YN3 A;  4OC5 A;  3GB0 A;  2JBK A;  4NGQ A;  1TF8 A;  3NH4 A;  1NSA A;  1Y0R A;  2PJ1 A;  4IAV A;  1CBX A;  1R3N A;  4ZI6 A;  4A39 A;  3SJF A;  5F09 A;  1F2P A;  4JZ0 A;  1CP6 A;  3PB7 X;  3SJG A;  1YW4 A;  2PJ8 A;  3BHX A;  4WJB A;  4UEE A;  2J9A A;  2XEF A;  4ZY2 A;  2BOA A;  3PB4 X;  3KR4 A;  3HLP A;  4IK2 A;  3IC1 A;  2OOT A;  3BI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...