2C6CA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with gpi-18431 (s)-2-(4-iodobenzylphosphonomethyl)-pentanedioic acid
Total Genus 249
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
249
sequence length
694
structure length
682
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
publication title Structure of Glutamate Carboxypeptidase II, a Drug Target in Neuronal Damage and Prostate Cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 249
structure length 682
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2c6cA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2c6cA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c6cA02
1XF1A 4AXVA 3D7DA 3TX8A 1DE4C 2EK9A 2PJ1A 2BO9A 2VL1A 3VARA 2Q51A 3B3CA 4C8FA 3NH5A 4UIAA 4P4JA 4X8IA 4JYWA 2CTCA 3S9MA 1CP6A 4WWVA 5LRJA 3MN8A 4C9VA 1ARLA 2ZOFA 4TJVA 4B6ZA 5IB9A 1DTDA 5K8NA 3D7HA 2AFZA 4F9VA 3D7FA 2PJ9A 5D29A 5LYDA 4OC5A 3K9TA 4P4DA 3KHXA 1HEEA 4ZY1A 1HDQA 1BPMA 3NA6A 5THWA 4NGTA 3SJEA 2ZEOA 5HVFA 1CG2A 2PE3A 1GYTA 2C6GA 4C84A 3QNVA 4MMOA 3PFOA 2AFUA 1TF8A 2HB6A 4C8UA 3KR5A 2JBKA 2PIZA 5LYFA 3KZWA 4PXCA 1YSJA 2PJ0A 5K8PA 3V38A 3D67A 4OIWA 4NGPA 3JRUA 4UEEA 1R3NA 4JZ0A 2F8HA 4OC1A 5F09A 4H2KA 5J1QA 2C6CA 3WC7A 4EFDA 5CBMA 1XJOA 4FBEA 3PFEA 4NJRA 4IAVA 4CDJA 3RZAA 2PJ3A 5K8OA 3SI0A 2ZELA 1OBRA 3I6SA 3SJFA 4PPZA 3DLJA 3H8EA 3KGQA 4FUUA 1IY7A 3HUVA 4RUHA 4C9AA 4UIBA 4P4IA 3VATA 4NFRA 4ZI6A 3PBBA 1EE3P 1TXRA 5LYIA 3L2NA 3PB9X 4R6TA 4A94A 3FX6A 1IGBA 3FH4A 4MCRA 2F7VA 7CPAA 3DGVA 3CPAA 1Y0RA 3BXMA 2CTBA 4CDKA 4NGRA 3LWUA 2PVVA 1CPSA 4MCQA 3IIBA 2V77A 2GU2A 2J9AA 4DYOA 2V8HA 3TC8A 4KSIA 4C8PA 2BOAA 3BI1A 2ANPA 5LRGA 1Z8LA 4LQGA 2EWBA 5JM6A 2PJ5A 2WZNA 4TNUA 3GUXA 1UWYA 1ZG8A 3B3VA 1KWMA 2AFOA 4MRIA 2ZEDA 3I74A 3V7ZA 1VIXA 1ZLIA 4P4FA 4NGNA 1F2PA 2JBJA 3B3SA 2RFHA 5HXDA 2FVGA 2Q43A 3B7IA 4DJLA 2POKA 1XMBA 2PJCA 2V8VA 4TJXA 5HVHA 4P10A 3S9LA 1F2OA 1H8LA 2XEIA 1V6CA 5DS0A 4C9EA 2BCOA 2PIYA 1CBXA 4X3RA 3FMCA 1QMUA 1Z5RA 3CT9A 4R76A 1XRYA 3GB0A 3SI1A 2ABZA 1PYTB 3GLJA 2IJZA 3FECA 2OOTA 2AFMA 1FT7A 2O4HA 1WVMA 5JH9A 4C9UA 2JEWA 4X2TA 2HC9A 4NGQA 2XEFA 4ZY2A 1BLLE 1NSAA 1Z2LA 1ZG7A 3PB8X 4OP4A 5LRKA 3RBUA 1Q7LA 3NH8A 1TKJA 4MHPA 2PJ8A 3PEIA 2PJ6A 4BD9A 2C6PA 4F9UA 2ZEMA 3FF3A 1ZLHA 6CPAA 1PCAA 3IC1A 2GLJA 1Y9ZA 1RTQA 2ZEGA 1ZG9A 2ZEFA 4EWTA 3B35A 3BI0A 2AFWA 2PJAA 5ELYA 1YMEA 4CPAA 1QQ9A 3FEDA 3KQZA 3PBEA 2XEJA 2NSMA 2CIJA 1YW4A 1Y0YA 3WC5A 3PRTA 4UF4A 2C1CA 2ZEEA 2PCUA 3S9NA 4P44A 1ELLP 4W9YA 3KQXA 4KNGE 3KASA 8CPAA 2G9DA 3D66A 4ZX8A 5HVGA 3NFZA 4FAIA 3SJXA 1YW6A 4G1PA 4C9RA 4DUKA 3H8GA 4MXUA 4O23A 2ZEHA 4OC3A 1LOKA 4C85A 1XBUA 4K3NA 1BPNA 5K8MA 4MHYA 4A39A 5JGFA 3MRUA 4R7MA 3B2YA 2OR4A 4EMEA 3VTAA 4PXBA 2V8GA 3HLPA 4C86A 3VH9A 1VHOA 4P4BA 1R43A 1CX8A 2PVWA 4MHZA 4UEZA 4WJBA 1YLOA 2DEAA 4P45A 1LAMA 3EIFA 3IWWA 3SJGA 3PB6X 1AMPA 2PJ7A 4C8TA 1LANA 3ISZA 2NYQA 2EK8A 2V8DA 1ELMP 3FJUA 2O53A 4MCPA 3KI9A 4OC2A 3D4UA 4OKOA 1LFWA 4IHMA 2AFXA 3T8WA 4IK2A 2ZEPA 4ZY0A 3SI2A 1FNOA 4UEFA 4OC0A 3RAMA 2QYVA 3ICUA 4NGMA 2XEGA 4F8ZA 3IEHA 3KHZA 3D68A 2I3CA 2PRQA 2PJBA 4Z65A 3D7GA 3LMSA 4C99A 4A38A 3IFEA 3ISXA 3B3WA 1CP7A 4NJQA 1TF9A 4PXEA 3KR4A 4ONWA 2CF4A 3IJ3A 2Q4ZA 3PB7X 1TKFA 4ZYQA 3IO1A 2AFSA 2ZENA 2GLFA 4ZX9A 3H8FA 5LYLA 1VHEA 2RB7A 1CPXA 3PB4X 2PJ4A 3FVLA 1VGYA 1F57A 4PXDA 3NH4A 2IMOA 4OC4A 2GREA 4R8FA 1TKHA 1LAPA 4P4EA 2ZOGA 1HDUA 4OMEA 3WT4A 1Y7EA 3CDXA 3I1UA 4GM5A 4YN3A 4PQAA 4A37A 4TWEA 1AYEA 3KL9A 4MCSA 4YU9A 3BHXA 1LCPA 4MHNA 2PJ2A 3K2KA 4C8CA 4P6YA 4FWUA 2IQ6A 1XFOA 3FEEA 3N5FA 4OIDA 1M4LA 5D8NA 2WYRA 2QJ8A 4Q7AA 4YWYA 3WABA 5CPAA 1JQGA 3CPXA 4C8AA 1BAVA 3B3TA 2QVPA 1ARMA 4NGSA 5I4MA 3WC6A
chains in the Genus database with same CATH superfamily
1XF1A 4IIXA 1YR0A 4NEXA 3RYOA 3TTHA 4AXVA 4KOXA 3D7DA 3TX8A 2PCNA 1DE4C 2EK9A 2PJ1A 2BO9A 2VL1A 4QUSA 4R57A 4UFWA 2Q51A 3B3CA 3VARA 4E8OA 4C8FA 3NH5A 4UWIA 1AUGA 2VZYA 4UIAA 3DDDA 4A4BA 4B5PA 4P4JA 2I79A 2VKZG 3DNSA 2C27A 4X8IA 4JYWA 2CTCA 4CRYB 3S9MA 1CP6A 2FCKA 4WWVA 3R95A 3TLGA 1A2ZA 3MN8A 4OAEA 5LRJA 3EXNA 4C9VA 1ARLA 4U5YA 2ZOFA 4TJVA 3BLNA 2CNTA 3G23A 4LUAA 3WR7A 4B6ZA 3H5ZA 5IB9A 1DTDA 3SXOA 5K8NA 3D7HA 2AFZA 5JVLA 3U1BA 2FS5A 3D7FA 4F9VA 4INJA 2PJ9A 2WPWA 5AG5A 5D29A 5LYDA 4OC5A 3K9TA 4P4DA 3W6XA 1QSRA 2REEA 3SR3A 3KHXA 1HEEA 4JXRA 4YRHA 2YJTA 4ZY1A 3PT1A 1HDQA 4UBRA 3VRQA 1BPMA 5A28A 3NA6A 1I12A 1Z4EA 4PSWA 5THWA 3TO9A 4NGTA 3SJEA 1X12A 2Q04A 2ZEOA 1L0CA 4NCZA 1N71A 5HVFA 4Q36A 1CG2A 2PE3A 1GYTA 3IWGA 3R96A 2B58A 4ONUA 2C6GA 3P2FA 4C84A 3QNVA 3OP0A 4A4CA 4MMOA 2FL4A 3GJZA 1YX0A 3PFOA 2AFUA 4EVYA 5KTDA 1IIDA 1TF8A 2HB6A 2Z3MA 3DSBA 4C8UA 3KR5A 2JBKA 4R3LA 2PIZA 2Z11A 5LYFA 2UV8G 2ZPAA 3KZWA 4PXCA 1YSJA 4K30A 1Z8TA 1M6VB 4CAEA 3VROA 2PJ0A 4C7IA 2JEVA 5K8PA 3V38A 3D67A 4E5SA 4OIWA 4NGPA 3JRUA 1KZFA 2XPOA 2FXFA 1VKCA 4UEEA 1R3NA 3NE7A 1Z9UA 1ZL0A 2AJ6A 4BPUB 2Q4VA 1BXRB 4JZ0A 5IX3A 2Q4YA 4F0XA 4OADA 2F8HA 4OC1A 3IWEA 5F09A 4HPSA 4H2KA 4CGOA 1ZYMA 4CGLA 1VBHA 3G8WA 2C6CA 4UFXA 5J1QA 3WC7A 2MP0A 4EFDA 2QECA 4M3SA 1P4NA 2GANA 1RO5A 2CNMA 2D4OA 5IV0A 1C30B 5CBMA 1M44A 1XJOA 3JUWA 1EO0A 2Z3OA 2BL1A 4FBEA 3TE4A 3PFEA 3I6SA 4NJRA 3W91A 2GFQA 4IAVA 4CDJA 3LACA 4H89A 2OH1A 4JLYA 3RZAA 1TIQA 2PJ3A 5K8OA 3SI0A 2ZELA 2DPSA 1OBRA 3ZJ0A 4QBJA 4E94A 2Q7SA 1GHEA 2WPXA 3SJFA 3K9UA 4PPZA 3DLJA 3NFQA 3H8EA 3KGQA 4FUUA 1IY7A 3HUVA 4RUHA 4C9AA 2DIKA 4UIBA 3PFVA 2FSRA 4P4IA 4XNHC 3VATA 2D0OA 5AGEA 5JYBA 3S6HA 1FBVA 2Z0ZA 1WWZA 4CAFA 4NFRA 3NE8A 4ZI6A 3PBBA 1EE3P 4CAVA 1TXRA 4J3GA 5LYIA 2B4DA 3TO7A 2D4PA 2PR1A 4ZBGA 4DNCA 3L2NA 2OU2A 4AG9A 4L89A 3PB9X 1NXJA 4R6TA 4A94A 5JPHA 3FX6A 1IGBA 3PP9A 4KORA 3FH4A 5EMIA 1T36B 4MCRA 4KVXA 2I00A 2WSAA 2F7VA 1MJAA 2HUZA 7CPAA 3DGVA 2A4NA 4M85A 3CPAA 3BJ8A 1Y0RA 5KTAA 2KCWA 3BXMA 2CTBA 1SQHA 4CDKA 3UY5A 5J8FA 2B3VA 4C2ZA 2J8RA 4NGRA 2B5GB 1S7KA 4KVME 3LWUA 1GGOA 2PVVA 3TLZA 3HPHE 1CPSA 2ZW6A 3TLYA 4MCQA 3R1KA 3GY9A 4COBA 1IYKA 3IIBA 3KKWA 4KS9A 2V77A 3EZAA 2GU2A 1XE4A 2J9AA 3R9FA 5C88A 4DYOA 2V8HA 3FYNA 4KSIA 3TC8A 2EZCA 3GIUA 1S60A 1WJTA 3F9KC 1YK3A 3S6KA 2B4BA 1Z8XA 3T05A 2FE7A 4C8PA 2BOAA 3CXPA 3BI1A 2HROA 2Y0MA 1I21A 4MFLA 2ANPA 5LRGA 1Z8LA 1YVKA 2G3TA 1IYLA 4LQGA 4FD7A 2EWBA 5JM6A 3D3SA 2PJ5A 2WZNA 4TNUA 1KEEB 3B8GA 1UWYA 3GUXA 4PSXA 3ZZIA 4GPLB 2H5MA 1S7LA 1QSMA 4MJ8A 4C2YA 1ZG8A 1P0HA 1NE9A 3U88C 3OB1B 1B47A 1KWMA 2AFOA 3B3VA 4GXHA 4MRIA 3O8ZA 3IU1A 4UA3A 2ZEDA 1MJBA 3TOAA 4XPDC 5HKZA 3C26A 5KTCA 1VHSA 4NXYA 1UFHA 1VIXA 2Y1MA 1ZLIA 2DF5A 5F49A 2R7HA 2Q7BA 3V7ZA 5IR2A 4P4FA 4R87A 4NGNA 2ZW4A 3QAYA 5ISVA 2GP4A 2WUUA 1M4GA 3TLCA 1F2PA 2JBJA 1QSTA 3B3SA 4QVTA 3FBUA 2RFHA 1S3ZA 4KVOE 5AXIA 2REFA 3R9GA 3VWEA 4M6HA 4UCNA 5F13A 5HXDA 2Z3PA 1XF8A 1PU9A 2FVGA 2Q43A 3EY5A 3B7IA 2P6FA 2POKA 1XMBA 5F48A 2PJCA 2V8VA 4A2ZA 4DJLA 5HVHA 1J3LA 4TJXA 1B87A 4P10A 3S9LA 3RNZA 1F2OA 3EC4A 5BWAB 2VEZA 4F6AA 5HH1A 1H8LA 1NSLA 2XEIA 2B3UA 4B5OA 2AUNA 2YNEA 1V6CA 1Z8WA 3TLAA 5DS0A 1Z4RA 4II9A 4C9EA 2BCOA 2PIYA 1EZBA 1CBXA 4B13A 4X3RA 4U9ZA 3FMCA 1QMUA 4CRZB 1Z5RA 3C8OA 1IB1E 3CT9A 4R76A 4AVCA 4F0YA 1XRYA 3GB0A 4CGNA 3V8IA 1CE8B 1JDEA 2XPPA 3F0AA 3SI1A 3EZBA 4COGA 2ABZA 1IOFA 1PYTB 1QSOA 3GLJA 4RS2A 5E96A 5G20A 2IJZA 3FECA 2E28A 2HWGA 2QIRA 5AG4A 4BBHA 2NMTA 4FD5A 2OOTA 2P6GA 4CGMA 2AFMA 4AB7A 1FT7A 3I74A 4NSQA 3BUMB 2XPNA 2O4HA 3OAKA 5GCNA 4B14A 5JH9A 1WVMA 4C9UA 2JEWA 4X2TA 4HNXB 4H6UA 2HC9A 3A9LA 4NGQA 2J8MA 2XEFA 4XPLA 4B5PB 4CYPA 3I3GA 4ZY2A 1BLLE 1QSNA 4H1HA 2VZZA 2ZW7A 3MGDA 1XMTA 1NSAA 2VXKA 1Z2LA 4R9MA 1ZG7A 3PB8X 4OP4A 3TLGB 4RR2B 5LRKA 5FD8A 3KRVA 2Y1NA 3RBUA 1Q7LA 3NH8A 3LD2A 5EC4A 2AUMA 2J8NA 2R98A 4MFJA 1TKJA 4MHPA 1K4JA 1CJWA 2PJ8A 3D2PA 3PEIA 2PJ6A 4MY0A 4BD9A 1JDBC 4CZ1A 5CNPA 4XNHB 2C6PA 3LODA 4F9UA 3QB8A 2ZEMA 1LRZA 3FF3A 1ZLHA 1BO4A 1ZO0A 3TCVA 6CPAA 2N3AB 1PCAA 2JLMA 3IC1A 2GLJA 1Y9ZA 1RTQA 4A31A 2JDDA 2ZEGA 1ZG9A 5K99A 4GS4A 2ZEFA 1Y7RA 5G1ZA 4CYOA 3B35A 3BI0A 4EWTA 2AFWA 1M1DA 5ELYA 2PJAA 3BUWB 3IGRA 1YMEA 2D0PA 2FIWA 2YGWA 1KC7A 4AVAA 4CPAA 4KSFA 1QQ9A 3FEDA 3KQZA 3OWCA 1S7NA 2B4JC 2XEJA 3PBEA 4PV6A 2NSMA 4B12A 2CIJA 2EZBA 3OB2B 3BUXB 2Z3KA 1YW4A 5F9MA 2XPLA 1Y0YA 1B6BA 3WC5A 3PRTA 4UF4A 2DXQA 3BJ7A 2C1CA 3F8KA 1XOVA 2ZEEA 2PCUA 3S9NA 3VRPA 3FIXA 4P44A 2G0BA 1ELLP 3ZNIA 4W9YA 2ZXVA 3KQXA 3PGPA 3KASA 4UCMA 4Y49B 4KNGE 1FY7A 2IL4A 8CPAA 2X0SA 3T07A 4EYSA 2G9DA 3D66A 4ZX8A 5HVGA 2QMLA 3NFZA 4FAIA 4JJXA 3VGOA 2O28A 2CXAA 3SJXA 2F5IA 1Q2DA 2EVNA 4CGPA 1KUVA 1YW6A 4G1PA 3R9EA 5IB0A 1VBGA 4C9RA 4DUKA 1ZRSA 2OLSA 3H8GA 4CAWA 4KOSA 3HMJG 2G3AA 2P0WA 4FD6A 4MXUA 3HPGG 4O23A 2YNCA 2ZEHA 3TOBA 5F5XA 4QC6A 4OC3A 3NOJA 1LOKA 3FB3A 2K5TA 1NBWA 2PRBA 2OZGA 1XBUA 3FRMA 2FM4A 5F1YA 4C85A 1PUAA 4XPKA 4K3NA 1BPNA 2EBJA 5K8MA 4BMHA 4M6IA 4MHYA 2EZAA 1R61A 4KLVA 4A39A 4KUAA 2R1IA 3SXNA 4C7HA 5JGFA 5JQ4A 1YLEA 3MRUA 3K4IA 4R7MA 3JVNA 4OLLA 5DWNA 1KBLA 3S6GA 3B2YA 4XPDB 2OR4A 1IU8A 4B11A 1OZPA 4MI4A 2R82A 3TT2A 1V0CA 4EMEA 3VTAA 1I1DA 2BEIA 4PXBA 4A95A 4AG7A 2V8GA 2Q44A 3HLPA 4Q38A 1Y9WA 4ZGYB 4PK2A 4C86A 2OZHA 2EUIA 5I0CA 4A33A 3VH9A 1VHOA 4P4BA 1R43A 4E2AA 1CX8A 2YNDA 3T90A 4ORFA 5C82A 3DR6A 2PC1A 2PVWA 4MI1A 1S7FA 4MHZA 3QAHA 1U6MA 2B4DB 4UEZA 4WJBA 1Y9KA 4KLWA 4MY3A 1YLOA 4BINA 3T0TA 2DEAA 2PQ8A 3CXQA 2VQYA 4P45A 1M4IA 1CS0B 1LAMA 4L8AA 1YVHA 3IWWA 3SJGA 3PB6X 1AMPA 3EIFA 2PJ7A 4C8TA 1Q2CA 4H6ZA 1LANA 3ISZA 2NYQA 4M6GA 4BPXB 2EK8A 5G21A 3TO6A 5A27A 2V8DA 4IF5A 2B0AA 2CNSA 1ELMP 3P2HA 5FVJA 5HKYA 3F5BA 1IICA 3FJUA 4MFKA 3PLFB 2O53A 2OZUA 4KOYA 4MCPA 3KI9A 4CAXA 4OC2A 3D4UA 1NMTA 4OKOA 2GIVA 3DR8A 1LFWA 2PSWA 5EBVA 3T5MA 4IHMA 2X7BA 2AFXA 2JDCA 3JTKA 3T8WA 4IK2A 2BUEA 3VRNA 4AVBA 2ZEPA 4ZY0A 1BOBA 3SI2A 1FNOA 4CO9A 2AE6A 4UEFA 1R57A 4OC0A 4KUBA 3RAMA 1XEBA 2QYVA 3ICUA 2CY2A 4NGMA 1IOIA 2XEGA 2ZW5A 4F8ZA 2DPTA 3IEHA 3KHZA 2PDOA 2PR8A 3D68A 4MHDA 2I3CA 2PRQA 3GKRA 4X5KA 2DLAA 5F47A 2PJBA 3TLEA 4Z65A 2YNCC 3EZEA 3D7GA 2FT0A 3LMSA 4C99A 4A38A 1EZAA 1A9XB 3IFEA 3ISXA 5H84A 1XIXA 3I9SA 3B3WA 2YJVA 3RO0A 3S6FA 1CP7A 3BUOB 2ODFA 4NJQA 3VRRA 1TF9A 3CXSA 4KOVA 4BPWB 4PXEA 2B5GA 3KR4A 4HNWB 4ONWA 2CF4A 3IJ3A 2FIAA 5AG6A 2Q4ZA 3PB7X 1TKFA 1YGHA 4FD4A 4ZYQA 2R8VA 3IO1A 4J0NA 1M4DA 2CBLA 2BSWA 2AFSA 2OB0A 2ZENA 2GLFA 4RN7A 4UCPA 4MBUA 3H8FA 4ZX9A 4E0AA 2HV2A 2Z3NA 5LYLA 3BUNB 1VHEA 3TYXA 2Z10A 4A30A 2RB7A 4M8DA 5J8CA 1CPXA 2Z3LA 4MFQA 2C5QA 3SHPA 1DIKA 2ARHA 4KOUA 3PB4X 2PJ4A 3H4QA 3FVLA 1VGYA 3PZJA 1F57A 3E0KA 1ON0A 2Q0YA 4YGOA 4PXDA 3FNCA 3NH4A 3EO4A 1CM0A 1YQEA 4I49A 4KSAA 2RC4A 1Q5XA 4A32A 1KUYA 2IMOA 4OC4A 2GREA 4QB9A 4IIYA 1X10A 1TKHA 1LAPA 4P4EA 5J3XA 4R8FA 1MJ9A 5HKWA 4UWJA 3TFYA 1C3OB 2ZOGA 3W6SA 1HDUA 4CYQA 4OMEA 1RXTA 4LX9A 3WT4A 2P6EA 4JXQA 1JWQA 1Y7EA 5G22A 2VBQA 3CDXA 3I1UA 4GM5A 2HQYA 4YN3A 1VI4A 4PQAA 4BTFA 4TWEA 4A37A 1AYEA 3G3SA 3KL9A 4MCSA 4U9YA 1Z9EA 3T9YA 4B10A 3IU2A 3N7ZA 3BHXA 1Q2YA 1LCPA 4YU9A 1YVOA 4MHNA 4C2XA 2PJ2A 3K2KA 3TLBA 4C8CA 4P6YA 3CZXA 4C68A 4FWUA 5AG7A 2IQ6A 5DWMA 1XFOA 4LQ6A 3FEEA 1KUXA 4HNYB 3VWDA 3D2MA 3N5FA 4JWPA 4MFPA 1YREA 4OIDA 4MFZA 1M4LA 1S5KA 4JD6A 5D8NA 4CS0B 2ATRA 2WYRA 2GE3A 2QJ8A 3D8PA 3FXTA 4PK3A 4Q7AA 4YWYA 4JVOA 3EFAA 3WABA 5BY0A 4YFJA 4R3KA 4CYNA 4KZTA 5CPAA 1JQGA 4RI1A 1WK4A 2EO8A 4NF1A 3CPXA 4C8AA 4KOWA 5H86A 1BAVA 3B3TA 3GYAA 1MK4A 4IUSA 5F46A 5HMNA 4MJXA 2QVPA 2VI7A 1ARMA 4Y49C 4NGSA 4UFVA 3WC6A 5I4MA 1J4JA 4KOTA 2HI6A 4HKFA
chains in the Genus database with same CATH topology
1XF1A 4AXVA 3D7DA 3TX8A 1DE4C 2EK9A 2PJ1A 2BO9A 2VL1A 3VARA 2Q51A 3B3CA 4C8FA 3NH5A 4UIAA 4P4JA 4X8IA 4JYWA 2CTCA 3S9MA 1CP6A 4WWVA 5LRJA 3MN8A 4C9VA 1ARLA 2ZOFA 4TJVA 4B6ZA 5IB9A 1DTDA 5K8NA 3D7HA 2AFZA 4F9VA 3D7FA 2PJ9A 5D29A 5LYDA 4OC5A 3K9TA 4P4DA 3KHXA 1HEEA 4ZY1A 1HDQA 1BPMA 3NA6A 5THWA 4NGTA 3SJEA 2ZEOA 5HVFA 1CG2A 2PE3A 1GYTA 2C6GA 4C84A 3QNVA 4MMOA 3PFOA 2AFUA 1TF8A 2HB6A 4C8UA 3KR5A 2JBKA 2PIZA 5LYFA 3KZWA 4PXCA 1YSJA 2PJ0A 5K8PA 3V38A 3D67A 4OIWA 4NGPA 3JRUA 4UEEA 1R3NA 4JZ0A 2F8HA 4OC1A 5F09A 4H2KA 5J1QA 2C6CA 3WC7A 4EFDA 5CBMA 1XJOA 4FBEA 3PFEA 4NJRA 4IAVA 4CDJA 3RZAA 2PJ3A 5K8OA 3SI0A 2ZELA 1OBRA 3I6SA 3SJFA 4PPZA 3DLJA 3H8EA 3KGQA 4FUUA 1IY7A 3HUVA 4RUHA 4C9AA 4UIBA 4P4IA 3VATA 4NFRA 4ZI6A 3PBBA 1EE3P 1TXRA 5LYIA 3L2NA 3PB9X 4R6TA 4A94A 3FX6A 1IGBA 3FH4A 4MCRA 2F7VA 7CPAA 3DGVA 3CPAA 1Y0RA 3BXMA 2CTBA 4CDKA 4NGRA 3LWUA 2PVVA 1CPSA 4MCQA 3IIBA 2V77A 2GU2A 2J9AA 4DYOA 2V8HA 3TC8A 4KSIA 4C8PA 2BOAA 3BI1A 2ANPA 5LRGA 1Z8LA 4LQGA 2EWBA 5JM6A 2PJ5A 2WZNA 4TNUA 3GUXA 1UWYA 1ZG8A 3B3VA 1KWMA 2AFOA 4MRIA 2ZEDA 3I74A 3V7ZA 1VIXA 1ZLIA 5IR2A 4P4FA 2GP4A 4NGNA 1F2PA 2JBJA 3B3SA 2RFHA 5HXDA 2FVGA 2Q43A 3B7IA 4DJLA 2POKA 1XMBA 2PJCA 2V8VA 4TJXA 5HVHA 4P10A 3S9LA 1F2OA 1H8LA 2XEIA 1V6CA 5DS0A 4C9EA 2BCOA 2PIYA 1CBXA 4X3RA 3FMCA 1QMUA 1Z5RA 3CT9A 4R76A 1XRYA 3GB0A 3SI1A 2ABZA 1PYTB 3GLJA 2IJZA 3FECA 2OOTA 2AFMA 1FT7A 2O4HA 1WVMA 5JH9A 4C9UA 2JEWA 4X2TA 2HC9A 4NGQA 2XEFA 4ZY2A 1BLLE 1NSAA 1Z2LA 1ZG7A 3PB8X 4OP4A 5LRKA 3RBUA 1Q7LA 3NH8A 1TKJA 4MHPA 2PJ8A 3PEIA 2PJ6A 4BD9A 2C6PA 4F9UA 2ZEMA 3FF3A 1ZLHA 6CPAA 1PCAA 3IC1A 2GLJA 1Y9ZA 1RTQA 2ZEGA 1ZG9A 2ZEFA 4EWTA 3B35A 3BI0A 2AFWA 2PJAA 5ELYA 1YMEA 4CPAA 1QQ9A 3FEDA 3KQZA 3PBEA 2XEJA 2NSMA 2CIJA 1YW4A 1Y0YA 3WC5A 3PRTA 4UF4A 2C1CA 2ZEEA 2PCUA 3S9NA 4P44A 1ELLP 4W9YA 3KQXA 4KNGE 3KASA 8CPAA 2G9DA 3D66A 4ZX8A 5HVGA 3NFZA 4FAIA 3SJXA 1YW6A 4G1PA 4C9RA 4DUKA 3H8GA 4MXUA 4O23A 2ZEHA 4OC3A 1LOKA 4C85A 1XBUA 4K3NA 1BPNA 5K8MA 4MHYA 4A39A 5JGFA 3MRUA 4R7MA 3B2YA 2OR4A 4EMEA 3VTAA 4PXBA 2V8GA 3HLPA 4C86A 3VH9A 1VHOA 4P4BA 1R43A 1CX8A 2PVWA 4MHZA 4UEZA 4WJBA 1YLOA 2DEAA 4P45A 1LAMA 3EIFA 3IWWA 3SJGA 3PB6X 1AMPA 2PJ7A 4C8TA 1LANA 3ISZA 2NYQA 2EK8A 2V8DA 1ELMP 3FJUA 2O53A 4MCPA 3KI9A 4OC2A 3D4UA 4OKOA 1LFWA 4IHMA 2AFXA 3T8WA 4IK2A 2ZEPA 4ZY0A 3SI2A 1FNOA 4UEFA 4OC0A 3RAMA 2QYVA 3ICUA 4NGMA 2XEGA 4F8ZA 3IEHA 3KHZA 3D68A 2I3CA 2PRQA 2PJBA 4Z65A 3D7GA 3LMSA 4C99A 4A38A 3IFEA 3ISXA 3B3WA 1CP7A 4NJQA 1TF9A 4PXEA 3KR4A 4ONWA 2CF4A 3IJ3A 2Q4ZA 3PB7X 1TKFA 4ZYQA 3IO1A 2AFSA 2ZENA 2GLFA 4ZX9A 3H8FA 5LYLA 1VHEA 2RB7A 1CPXA 2C5QA 3PB4X 2PJ4A 3FVLA 1VGYA 1F57A 4PXDA 3NH4A 2IMOA 4OC4A 2GREA 4R8FA 1TKHA 1LAPA 4P4EA 2ZOGA 1HDUA 4OMEA 3WT4A 1Y7EA 3CDXA 3I1UA 4GM5A 4YN3A 4PQAA 4A37A 4TWEA 1AYEA 3KL9A 4MCSA 4YU9A 3BHXA 1LCPA 4MHNA 2PJ2A 3K2KA 4C8CA 4P6YA 4FWUA 2IQ6A 1XFOA 3FEEA 3N5FA 4OIDA 1M4LA 5D8NA 2WYRA 2QJ8A 4Q7AA 4YWYA 3WABA 5CPAA 1JQGA 3CPXA 4C8AA 1BAVA 3B3TA 2QVPA 1ARMA 4NGSA 5I4MA 3WC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XF1 A;  4AXV A;  3D7D A;  3TX8 A;  1DE4 C;  2EK9 A;  2PJ1 A;  2BO9 A;  2VL1 A;  3VAR A;  2Q51 A;  3B3C A;  4C8F A;  3NH5 A;  4UIA A;  4P4J A;  4X8I A;  4JYW A;  2CTC A;  3S9M A;  1CP6 A;  4WWV A;  5LRJ A;  3MN8 A;  4C9V A;  1ARL A;  2ZOF A;  4TJV A;  4B6Z A;  5IB9 A;  1DTD A;  5K8N A;  3D7H A;  2AFZ A;  4F9V A;  3D7F A;  2PJ9 A;  5D29 A;  5LYD A;  4OC5 A;  3K9T A;  4P4D A;  3KHX A;  1HEE A;  4ZY1 A;  1HDQ A;  1BPM A;  3NA6 A;  5THW A;  4NGT A;  3SJE A;  2ZEO A;  5HVF A;  1CG2 A;  2PE3 A;  1GYT A;  2C6G A;  4C84 A;  3QNV A;  4MMO A;  3PFO A;  2AFU A;  1TF8 A;  2HB6 A;  4C8U A;  3KR5 A;  2JBK A;  2PIZ A;  5LYF A;  3KZW A;  4PXC A;  1YSJ A;  2PJ0 A;  5K8P A;  3V38 A;  3D67 A;  4OIW A;  4NGP A;  3JRU A;  4UEE A;  1R3N A;  4JZ0 A;  2F8H A;  4OC1 A;  5F09 A;  4H2K A;  5J1Q A;  2C6C A;  3WC7 A;  4EFD A;  5CBM A;  1XJO A;  4FBE A;  3PFE A;  4NJR A;  4IAV A;  4CDJ A;  3RZA A;  2PJ3 A;  5K8O A;  3SI0 A;  2ZEL A;  1OBR A;  3I6S A;  3SJF A;  4PPZ A;  3DLJ A;  3H8E A;  3KGQ A;  4FUU A;  1IY7 A;  3HUV A;  4RUH A;  4C9A A;  4UIB A;  4P4I A;  3VAT A;  4NFR A;  4ZI6 A;  3PBB A;  1EE3 P;  1TXR A;  5LYI A;  3L2N A;  3PB9 X;  4R6T A;  4A94 A;  3FX6 A;  1IGB A;  3FH4 A;  4MCR A;  2F7V A;  7CPA A;  3DGV A;  3CPA A;  1Y0R A;  3BXM A;  2CTB A;  4CDK A;  4NGR A;  3LWU A;  2PVV A;  1CPS A;  4MCQ A;  3IIB A;  2V77 A;  2GU2 A;  2J9A A;  4DYO A;  2V8H A;  3TC8 A;  4KSI A;  4C8P A;  2BOA A;  3BI1 A;  2ANP A;  5LRG A;  1Z8L A;  4LQG A;  2EWB A;  5JM6 A;  2PJ5 A;  2WZN A;  4TNU A;  3GUX A;  1UWY A;  1ZG8 A;  3B3V A;  1KWM A;  2AFO A;  4MRI A;  2ZED A;  3I74 A;  3V7Z A;  1VIX A;  1ZLI A;  4P4F A;  4NGN A;  1F2P A;  2JBJ A;  3B3S A;  2RFH A;  5HXD A;  2FVG A;  2Q43 A;  3B7I A;  4DJL A;  2POK A;  1XMB A;  2PJC A;  2V8V A;  4TJX A;  5HVH A;  4P10 A;  3S9L A;  1F2O A;  1H8L A;  2XEI A;  1V6C A;  5DS0 A;  4C9E A;  2BCO A;  2PIY A;  1CBX A;  4X3R A;  3FMC A;  1QMU A;  1Z5R A;  3CT9 A;  4R76 A;  1XRY A;  3GB0 A;  3SI1 A;  2ABZ A;  1PYT B;  3GLJ A;  2IJZ A;  3FEC A;  2OOT A;  2AFM A;  1FT7 A;  2O4H A;  1WVM A;  5JH9 A;  4C9U A;  2JEW A;  4X2T A;  2HC9 A;  4NGQ A;  2XEF A;  4ZY2 A;  1BLL E;  1NSA A;  1Z2L A;  1ZG7 A;  3PB8 X;  4OP4 A;  5LRK A;  3RBU A;  1Q7L A;  3NH8 A;  1TKJ A;  4MHP A;  2PJ8 A;  3PEI A;  2PJ6 A;  4BD9 A;  2C6P A;  4F9U A;  2ZEM A;  3FF3 A;  1ZLH A;  6CPA A;  1PCA A;  3IC1 A;  2GLJ A;  1Y9Z A;  1RTQ A;  2ZEG A;  1ZG9 A;  2ZEF A;  4EWT A;  3B35 A;  3BI0 A;  2AFW A;  2PJA A;  5ELY A;  1YME A;  4CPA A;  1QQ9 A;  3FED A;  3KQZ A;  3PBE A;  2XEJ A;  2NSM A;  2CIJ A;  1YW4 A;  1Y0Y A;  3WC5 A;  3PRT A;  4UF4 A;  2C1C A;  2ZEE A;  2PCU A;  3S9N A;  4P44 A;  1ELL P;  4W9Y A;  3KQX A;  4KNG E;  3KAS A;  8CPA A;  2G9D A;  3D66 A;  4ZX8 A;  5HVG A;  3NFZ A;  4FAI A;  3SJX A;  1YW6 A;  4G1P A;  4C9R A;  4DUK A;  3H8G A;  4MXU A;  4O23 A;  2ZEH A;  4OC3 A;  1LOK A;  4C85 A;  1XBU A;  4K3N A;  1BPN A;  5K8M A;  4MHY A;  4A39 A;  5JGF A;  3MRU A;  4R7M A;  3B2Y A;  2OR4 A;  4EME A;  3VTA A;  4PXB A;  2V8G A;  3HLP A;  4C86 A;  3VH9 A;  1VHO A;  4P4B A;  1R43 A;  1CX8 A;  2PVW A;  4MHZ A;  4UEZ A;  4WJB A;  1YLO A;  2DEA A;  4P45 A;  1LAM A;  3EIF A;  3IWW A;  3SJG A;  3PB6 X;  1AMP A;  2PJ7 A;  4C8T A;  1LAN A;  3ISZ A;  2NYQ A;  2EK8 A;  2V8D A;  1ELM P;  3FJU A;  2O53 A;  4MCP A;  3KI9 A;  4OC2 A;  3D4U A;  4OKO A;  1LFW A;  4IHM A;  2AFX A;  3T8W A;  4IK2 A;  2ZEP A;  4ZY0 A;  3SI2 A;  1FNO A;  4UEF A;  4OC0 A;  3RAM A;  2QYV A;  3ICU A;  4NGM A;  2XEG A;  4F8Z A;  3IEH A;  3KHZ A;  3D68 A;  2I3C A;  2PRQ A;  2PJB A;  4Z65 A;  3D7G A;  3LMS A;  4C99 A;  4A38 A;  3IFE A;  3ISX A;  3B3W A;  1CP7 A;  4NJQ A;  1TF9 A;  4PXE A;  3KR4 A;  4ONW A;  2CF4 A;  3IJ3 A;  2Q4Z A;  3PB7 X;  1TKF A;  4ZYQ A;  3IO1 A;  2AFS A;  2ZEN A;  2GLF A;  4ZX9 A;  3H8F A;  5LYL A;  1VHE A;  2RB7 A;  1CPX A;  3PB4 X;  2PJ4 A;  3FVL A;  1VGY A;  1F57 A;  4PXD A;  3NH4 A;  2IMO A;  4OC4 A;  2GRE A;  4R8F A;  1TKH A;  1LAP A;  4P4E A;  2ZOG A;  1HDU A;  4OME A;  3WT4 A;  1Y7E A;  3CDX A;  3I1U A;  4GM5 A;  4YN3 A;  4PQA A;  4A37 A;  4TWE A;  1AYE A;  3KL9 A;  4MCS A;  4YU9 A;  3BHX A;  1LCP A;  4MHN A;  2PJ2 A;  3K2K A;  4C8C A;  4P6Y A;  4FWU A;  2IQ6 A;  1XFO A;  3FEE A;  3N5F A;  4OID A;  1M4L A;  5D8N A;  2WYR A;  2QJ8 A;  4Q7A A;  4YWY A;  3WAB A;  5CPA A;  1JQG A;  3CPX A;  4C8A A;  1BAV A;  3B3T A;  2QVP A;  1ARM A;  4NGS A;  5I4M A;  3WC6 A; 
#chains in the Genus database with same CATH topology
 1XF1 A;  4IIX A;  1YR0 A;  4NEX A;  3RYO A;  3TTH A;  4AXV A;  4KOX A;  3D7D A;  3TX8 A;  2PCN A;  1DE4 C;  2EK9 A;  2PJ1 A;  2BO9 A;  2VL1 A;  4QUS A;  4R57 A;  4UFW A;  2Q51 A;  3B3C A;  3VAR A;  4E8O A;  4C8F A;  3NH5 A;  4UWI A;  1AUG A;  2VZY A;  4UIA A;  3DDD A;  4A4B A;  4B5P A;  4P4J A;  2I79 A;  2VKZ G;  3DNS A;  2C27 A;  4X8I A;  4JYW A;  2CTC A;  4CRY B;  3S9M A;  1CP6 A;  2FCK A;  4WWV A;  3R95 A;  3TLG A;  1A2Z A;  3MN8 A;  4OAE A;  5LRJ A;  3EXN A;  4C9V A;  1ARL A;  4U5Y A;  2ZOF A;  4TJV A;  3BLN A;  2CNT A;  3G23 A;  4LUA A;  3WR7 A;  4B6Z A;  3H5Z A;  5IB9 A;  1DTD A;  3SXO A;  5K8N A;  3D7H A;  2AFZ A;  5JVL A;  3U1B A;  2FS5 A;  3D7F A;  4F9V A;  4INJ A;  2PJ9 A;  2WPW A;  5AG5 A;  5D29 A;  5LYD A;  4OC5 A;  3K9T A;  4P4D A;  3W6X A;  1QSR A;  2REE A;  3SR3 A;  3KHX A;  1HEE A;  4JXR A;  4YRH A;  2YJT A;  4ZY1 A;  3PT1 A;  1HDQ A;  4UBR A;  3VRQ A;  1BPM A;  5A28 A;  3NA6 A;  1I12 A;  1Z4E A;  4PSW A;  5THW A;  3TO9 A;  4NGT A;  3SJE A;  1X12 A;  2Q04 A;  2ZEO A;  1L0C A;  4NCZ A;  1N71 A;  5HVF A;  4Q36 A;  1CG2 A;  2PE3 A;  1GYT A;  3IWG A;  3R96 A;  2B58 A;  4ONU A;  2C6G A;  3P2F A;  4C84 A;  3QNV A;  3OP0 A;  4A4C A;  4MMO A;  2FL4 A;  3GJZ A;  1YX0 A;  3PFO A;  2AFU A;  4EVY A;  5KTD A;  1IID A;  1TF8 A;  2HB6 A;  2Z3M A;  3DSB A;  4C8U A;  3KR5 A;  2JBK A;  4R3L A;  2PIZ A;  2Z11 A;  5LYF A;  2UV8 G;  2ZPA A;  3KZW A;  4PXC A;  1YSJ A;  4K30 A;  1Z8T A;  1M6V B;  4CAE A;  3VRO A;  2PJ0 A;  4C7I A;  2JEV A;  5K8P A;  3V38 A;  3D67 A;  4E5S A;  4OIW A;  4NGP A;  3JRU A;  1KZF A;  2XPO A;  2FXF A;  1VKC A;  4UEE A;  1R3N A;  3NE7 A;  1Z9U A;  1ZL0 A;  2AJ6 A;  4BPU B;  2Q4V A;  1BXR B;  4JZ0 A;  5IX3 A;  2Q4Y A;  4F0X A;  4OAD A;  2F8H A;  4OC1 A;  3IWE A;  5F09 A;  4HPS A;  4H2K A;  4CGO A;  1ZYM A;  4CGL A;  1VBH A;  3G8W A;  2C6C A;  4UFX A;  5J1Q A;  3WC7 A;  2MP0 A;  4EFD A;  2QEC A;  4M3S A;  1P4N A;  2GAN A;  1RO5 A;  2CNM A;  2D4O A;  5IV0 A;  1C30 B;  5CBM A;  1M44 A;  1XJO A;  3JUW A;  1EO0 A;  2Z3O A;  2BL1 A;  4FBE A;  3TE4 A;  3PFE A;  3I6S A;  4NJR A;  3W91 A;  2GFQ A;  4IAV A;  4CDJ A;  3LAC A;  4H89 A;  2OH1 A;  4JLY A;  3RZA A;  1TIQ A;  2PJ3 A;  5K8O A;  3SI0 A;  2ZEL A;  2DPS A;  1OBR A;  3ZJ0 A;  4QBJ A;  4E94 A;  2Q7S A;  1GHE A;  2WPX A;  3SJF A;  3K9U A;  4PPZ A;  3DLJ A;  3NFQ A;  3H8E A;  3KGQ A;  4FUU A;  1IY7 A;  3HUV A;  4RUH A;  4C9A A;  2DIK A;  4UIB A;  3PFV A;  2FSR A;  4P4I A;  4XNH C;  3VAT A;  2D0O A;  5AGE A;  5JYB A;  3S6H A;  1FBV A;  2Z0Z A;  1WWZ A;  4CAF A;  4NFR A;  3NE8 A;  4ZI6 A;  3PBB A;  1EE3 P;  4CAV A;  1TXR A;  4J3G A;  5LYI A;  2B4D A;  3TO7 A;  2D4P A;  2PR1 A;  4ZBG A;  4DNC A;  3L2N A;  2OU2 A;  4AG9 A;  4L89 A;  3PB9 X;  1NXJ A;  4R6T A;  4A94 A;  5JPH A;  3FX6 A;  1IGB A;  3PP9 A;  4KOR A;  3FH4 A;  5EMI A;  1T36 B;  4MCR A;  4KVX A;  2I00 A;  2WSA A;  2F7V A;  1MJA A;  2HUZ A;  7CPA A;  3DGV A;  2A4N A;  4M85 A;  3CPA A;  3BJ8 A;  1Y0R A;  5KTA A;  2KCW A;  3BXM A;  2CTB A;  1SQH A;  4CDK A;  3UY5 A;  5J8F A;  2B3V A;  4C2Z A;  2J8R A;  4NGR A;  2B5G B;  1S7K A;  4KVM E;  3LWU A;  1GGO A;  2PVV A;  3TLZ A;  3HPH E;  1CPS A;  2ZW6 A;  3TLY A;  4MCQ A;  3R1K A;  3GY9 A;  4COB A;  1IYK A;  3IIB A;  3KKW A;  4KS9 A;  2V77 A;  3EZA A;  2GU2 A;  1XE4 A;  2J9A A;  3R9F A;  5C88 A;  4DYO A;  2V8H A;  3FYN A;  4KSI A;  3TC8 A;  2EZC A;  3GIU A;  1S60 A;  1WJT A;  3F9K C;  1YK3 A;  3S6K A;  2B4B A;  1Z8X A;  3T05 A;  2FE7 A;  4C8P A;  2BOA A;  3CXP A;  3BI1 A;  2HRO A;  2Y0M A;  1I21 A;  4MFL A;  2ANP A;  5LRG A;  1Z8L A;  1YVK A;  2G3T A;  1IYL A;  4LQG A;  4FD7 A;  2EWB A;  5JM6 A;  3D3S A;  2PJ5 A;  2WZN A;  4TNU A;  1KEE B;  3B8G A;  1UWY A;  3GUX A;  4PSX A;  3ZZI A;  4GPL B;  2H5M A;  1S7L A;  1QSM A;  4MJ8 A;  4C2Y A;  1ZG8 A;  1P0H A;  1NE9 A;  3U88 C;  3OB1 B;  1B47 A;  1KWM A;  2AFO A;  3B3V A;  4GXH A;  4MRI A;  3O8Z A;  3IU1 A;  4UA3 A;  2ZED A;  1MJB A;  3TOA A;  4XPD C;  5HKZ A;  3C26 A;  5KTC A;  1VHS A;  4NXY A;  1UFH A;  1VIX A;  2Y1M A;  1ZLI A;  2DF5 A;  5F49 A;  2R7H A;  2Q7B A;  3V7Z A;  5IR2 A;  4P4F A;  4R87 A;  4NGN A;  2ZW4 A;  3QAY A;  5ISV A;  2GP4 A;  2WUU A;  1M4G A;  3TLC A;  1F2P A;  2JBJ A;  1QST A;  3B3S A;  4QVT A;  3FBU A;  2RFH A;  1S3Z A;  4KVO E;  5AXI A;  2REF A;  3R9G A;  3VWE A;  4M6H A;  4UCN A;  5F13 A;  5HXD A;  2Z3P A;  1XF8 A;  1PU9 A;  2FVG A;  2Q43 A;  3EY5 A;  3B7I A;  2P6F A;  2POK A;  1XMB A;  5F48 A;  2PJC A;  2V8V A;  4A2Z A;  4DJL A;  5HVH A;  1J3L A;  4TJX A;  1B87 A;  4P10 A;  3S9L A;  3RNZ A;  1F2O A;  3EC4 A;  5BWA B;  2VEZ A;  4F6A A;  5HH1 A;  1H8L A;  1NSL A;  2XEI A;  2B3U A;  4B5O A;  2AUN A;  2YNE A;  1V6C A;  1Z8W A;  3TLA A;  5DS0 A;  1Z4R A;  4II9 A;  4C9E A;  2BCO A;  2PIY A;  1EZB A;  1CBX A;  4B13 A;  4X3R A;  4U9Z A;  3FMC A;  1QMU A;  4CRZ B;  1Z5R A;  3C8O A;  1IB1 E;  3CT9 A;  4R76 A;  4AVC A;  4F0Y A;  1XRY A;  3GB0 A;  4CGN A;  3V8I A;  1CE8 B;  1JDE A;  2XPP A;  3F0A A;  3SI1 A;  3EZB A;  4COG A;  2ABZ A;  1IOF A;  1PYT B;  1QSO A;  3GLJ A;  4RS2 A;  5E96 A;  5G20 A;  2IJZ A;  3FEC A;  2E28 A;  2HWG A;  2QIR A;  5AG4 A;  4BBH A;  2NMT A;  4FD5 A;  2OOT A;  2P6G A;  4CGM A;  2AFM A;  4AB7 A;  1FT7 A;  3I74 A;  4NSQ A;  3BUM B;  2XPN A;  2O4H A;  3OAK A;  5GCN A;  4B14 A;  5JH9 A;  1WVM A;  4C9U A;  2JEW A;  4X2T A;  4HNX B;  4H6U A;  2HC9 A;  3A9L A;  4NGQ A;  2J8M A;  2XEF A;  4XPL A;  4B5P B;  4CYP A;  3I3G A;  4ZY2 A;  1BLL E;  1QSN A;  4H1H A;  2VZZ A;  2ZW7 A;  3MGD A;  1XMT A;  1NSA A;  2VXK A;  1Z2L A;  4R9M A;  1ZG7 A;  3PB8 X;  4OP4 A;  3TLG B;  4RR2 B;  5LRK A;  5FD8 A;  3KRV A;  2Y1N A;  3RBU A;  1Q7L A;  3NH8 A;  3LD2 A;  5EC4 A;  2AUM A;  2J8N A;  2R98 A;  4MFJ A;  1TKJ A;  4MHP A;  1K4J A;  1CJW A;  2PJ8 A;  3D2P A;  3PEI A;  2PJ6 A;  4MY0 A;  4BD9 A;  1JDB C;  4CZ1 A;  5CNP A;  4XNH B;  2C6P A;  3LOD A;  4F9U A;  3QB8 A;  2ZEM A;  1LRZ A;  3FF3 A;  1ZLH A;  1BO4 A;  1ZO0 A;  3TCV A;  6CPA A;  2N3A B;  1PCA A;  2JLM A;  3IC1 A;  2GLJ A;  1Y9Z A;  1RTQ A;  4A31 A;  2JDD A;  2ZEG A;  1ZG9 A;  5K99 A;  4GS4 A;  2ZEF A;  1Y7R A;  5G1Z A;  4CYO A;  3B35 A;  3BI0 A;  4EWT A;  2AFW A;  1M1D A;  5ELY A;  2PJA A;  3BUW B;  3IGR A;  1YME A;  2D0P A;  2FIW A;  2YGW A;  1KC7 A;  4AVA A;  4CPA A;  4KSF A;  1QQ9 A;  3FED A;  3KQZ A;  3OWC A;  1S7N A;  2B4J C;  2XEJ A;  3PBE A;  4PV6 A;  2NSM A;  4B12 A;  2CIJ A;  2EZB A;  3OB2 B;  3BUX B;  2Z3K A;  1YW4 A;  5F9M A;  2XPL A;  1Y0Y A;  1B6B A;  3WC5 A;  3PRT A;  4UF4 A;  2DXQ A;  3BJ7 A;  2C1C A;  3F8K A;  1XOV A;  2ZEE A;  2PCU A;  3S9N A;  3VRP A;  3FIX A;  4P44 A;  2G0B A;  1ELL P;  3ZNI A;  4W9Y A;  2ZXV A;  3KQX A;  3PGP A;  3KAS A;  4UCM A;  4Y49 B;  4KNG E;  1FY7 A;  2IL4 A;  8CPA A;  2X0S A;  3T07 A;  4EYS A;  2G9D A;  3D66 A;  4ZX8 A;  5HVG A;  2QML A;  3NFZ A;  4FAI A;  4JJX A;  3VGO A;  2O28 A;  2CXA A;  3SJX A;  2F5I A;  1Q2D A;  2EVN A;  4CGP A;  1KUV A;  1YW6 A;  4G1P A;  3R9E A;  5IB0 A;  1VBG A;  4C9R A;  4DUK A;  1ZRS A;  2OLS A;  3H8G A;  4CAW A;  4KOS A;  3HMJ G;  2G3A A;  2P0W A;  4FD6 A;  4MXU A;  3HPG G;  4O23 A;  2YNC A;  2ZEH A;  3TOB A;  5F5X A;  4QC6 A;  4OC3 A;  3NOJ A;  1LOK A;  3FB3 A;  2K5T A;  1NBW A;  2PRB A;  2OZG A;  1XBU A;  3FRM A;  2FM4 A;  5F1Y A;  4C85 A;  1PUA A;  4XPK A;  4K3N A;  1BPN A;  2EBJ A;  5K8M A;  4BMH A;  4M6I A;  4MHY A;  2EZA A;  1R61 A;  4KLV A;  4A39 A;  4KUA A;  2R1I A;  3SXN A;  4C7H A;  5JGF A;  5JQ4 A;  1YLE A;  3MRU A;  3K4I A;  4R7M A;  3JVN A;  4OLL A;  5DWN A;  1KBL A;  3S6G A;  3B2Y A;  4XPD B;  2OR4 A;  1IU8 A;  4B11 A;  1OZP A;  4MI4 A;  2R82 A;  3TT2 A;  1V0C A;  4EME A;  3VTA A;  1I1D A;  2BEI A;  4PXB A;  4A95 A;  4AG7 A;  2V8G A;  2Q44 A;  3HLP A;  4Q38 A;  1Y9W A;  4ZGY B;  4PK2 A;  4C86 A;  2OZH A;  2EUI A;  5I0C A;  4A33 A;  3VH9 A;  1VHO A;  4P4B A;  1R43 A;  4E2A A;  1CX8 A;  2YND A;  3T90 A;  4ORF A;  5C82 A;  3DR6 A;  2PC1 A;  2PVW A;  4MI1 A;  1S7F A;  4MHZ A;  3QAH A;  1U6M A;  2B4D B;  4UEZ A;  4WJB A;  1Y9K A;  4KLW A;  4MY3 A;  1YLO A;  4BIN A;  3T0T A;  2DEA A;  2PQ8 A;  3CXQ A;  2VQY A;  4P45 A;  1M4I A;  1CS0 B;  1LAM A;  4L8A A;  1YVH A;  3IWW A;  3SJG A;  3PB6 X;  1AMP A;  3EIF A;  2PJ7 A;  4C8T A;  1Q2C A;  4H6Z A;  1LAN A;  3ISZ A;  2NYQ A;  4M6G A;  4BPX B;  2EK8 A;  5G21 A;  3TO6 A;  5A27 A;  2V8D A;  4IF5 A;  2B0A A;  2CNS A;  1ELM P;  3P2H A;  5FVJ A;  5HKY A;  3F5B A;  1IIC A;  3FJU A;  4MFK A;  3PLF B;  2O53 A;  2OZU A;  4KOY A;  4MCP A;  3KI9 A;  4CAX A;  4OC2 A;  3D4U A;  1NMT A;  4OKO A;  2GIV A;  3DR8 A;  1LFW A;  2PSW A;  5EBV A;  3T5M A;  4IHM A;  2X7B A;  2AFX A;  2JDC A;  3JTK A;  3T8W A;  4IK2 A;  2BUE A;  3VRN A;  4AVB A;  2ZEP A;  4ZY0 A;  1BOB A;  3SI2 A;  1FNO A;  4CO9 A;  2AE6 A;  4UEF A;  1R57 A;  4OC0 A;  4KUB A;  3RAM A;  1XEB A;  2QYV A;  3ICU A;  2CY2 A;  4NGM A;  1IOI A;  2XEG A;  2ZW5 A;  4F8Z A;  2DPT A;  3IEH A;  3KHZ A;  2PDO A;  2PR8 A;  3D68 A;  4MHD A;  2I3C A;  2PRQ A;  3GKR A;  4X5K A;  2DLA A;  5F47 A;  2PJB A;  3TLE A;  4Z65 A;  2YNC C;  3EZE A;  3D7G A;  2FT0 A;  3LMS A;  4C99 A;  4A38 A;  1EZA A;  1A9X B;  3IFE A;  3ISX A;  5H84 A;  1XIX A;  3I9S A;  3B3W A;  2YJV A;  3RO0 A;  3S6F A;  1CP7 A;  3BUO B;  2ODF A;  4NJQ A;  3VRR A;  1TF9 A;  3CXS A;  4KOV A;  4BPW B;  4PXE A;  2B5G A;  3KR4 A;  4HNW B;  4ONW A;  2CF4 A;  3IJ3 A;  2FIA A;  5AG6 A;  2Q4Z A;  3PB7 X;  1TKF A;  1YGH A;  4FD4 A;  4ZYQ A;  2R8V A;  3IO1 A;  4J0N A;  1M4D A;  2CBL A;  2BSW A;  2AFS A;  2OB0 A;  2ZEN A;  2GLF A;  4RN7 A;  4UCP A;  4MBU A;  3H8F A;  4ZX9 A;  4E0A A;  2HV2 A;  2Z3N A;  5LYL A;  3BUN B;  1VHE A;  3TYX A;  2Z10 A;  4A30 A;  2RB7 A;  4M8D A;  5J8C A;  1CPX A;  2Z3L A;  4MFQ A;  2C5Q A;  3SHP A;  1DIK A;  2ARH A;  4KOU A;  3PB4 X;  2PJ4 A;  3H4Q A;  3FVL A;  1VGY A;  3PZJ A;  1F57 A;  3E0K A;  1ON0 A;  2Q0Y A;  4YGO A;  4PXD A;  3FNC A;  3NH4 A;  3EO4 A;  1CM0 A;  1YQE A;  4I49 A;  4KSA A;  2RC4 A;  1Q5X A;  4A32 A;  1KUY A;  2IMO A;  4OC4 A;  2GRE A;  4QB9 A;  4IIY A;  1X10 A;  1TKH A;  1LAP A;  4P4E A;  5J3X A;  4R8F A;  1MJ9 A;  5HKW A;  4UWJ A;  3TFY A;  1C3O B;  2ZOG A;  3W6S A;  1HDU A;  4CYQ A;  4OME A;  1RXT A;  4LX9 A;  3WT4 A;  2P6E A;  4JXQ A;  1JWQ A;  1Y7E A;  5G22 A;  2VBQ A;  3CDX A;  3I1U A;  4GM5 A;  2HQY A;  4YN3 A;  1VI4 A;  4PQA A;  4BTF A;  4TWE A;  4A37 A;  1AYE A;  3G3S A;  3KL9 A;  4MCS A;  4U9Y A;  1Z9E A;  3T9Y A;  4B10 A;  3IU2 A;  3N7Z A;  3BHX A;  1Q2Y A;  1LCP A;  4YU9 A;  1YVO A;  4MHN A;  4C2X A;  2PJ2 A;  3K2K A;  3TLB A;  4C8C A;  4P6Y A;  3CZX A;  4C68 A;  4FWU A;  5AG7 A;  2IQ6 A;  5DWM A;  1XFO A;  4LQ6 A;  3FEE A;  1KUX A;  4HNY B;  3VWD A;  3D2M A;  3N5F A;  4JWP A;  4MFP A;  1YRE A;  4OID A;  4MFZ A;  1M4L A;  1S5K A;  4JD6 A;  5D8N A;  4CS0 B;  2ATR A;  2WYR A;  2GE3 A;  2QJ8 A;  3D8P A;  3FXT A;  4PK3 A;  4Q7A A;  4YWY A;  4JVO A;  3EFA A;  3WAB A;  5BY0 A;  4YFJ A;  4R3K A;  4CYN A;  4KZT A;  5CPA A;  1JQG A;  4RI1 A;  1WK4 A;  2EO8 A;  4NF1 A;  3CPX A;  4C8A A;  4KOW A;  5H86 A;  1BAV A;  3B3T A;  3GYA A;  1MK4 A;  4IUS A;  5F46 A;  5HMN A;  4MJX A;  2QVP A;  2VI7 A;  1ARM A;  4Y49 C;  4NGS A;  4UFV A;  3WC6 A;  5I4M A;  1J4J A;  4KOT A;  2HI6 A;  4HKF A; 
#chains in the Genus database with same CATH homology
 1XF1 A;  4AXV A;  3D7D A;  3TX8 A;  1DE4 C;  2EK9 A;  2PJ1 A;  2BO9 A;  2VL1 A;  3VAR A;  2Q51 A;  3B3C A;  4C8F A;  3NH5 A;  4UIA A;  4P4J A;  4X8I A;  4JYW A;  2CTC A;  3S9M A;  1CP6 A;  4WWV A;  5LRJ A;  3MN8 A;  4C9V A;  1ARL A;  2ZOF A;  4TJV A;  4B6Z A;  5IB9 A;  1DTD A;  5K8N A;  3D7H A;  2AFZ A;  4F9V A;  3D7F A;  2PJ9 A;  5D29 A;  5LYD A;  4OC5 A;  3K9T A;  4P4D A;  3KHX A;  1HEE A;  4ZY1 A;  1HDQ A;  1BPM A;  3NA6 A;  5THW A;  4NGT A;  3SJE A;  2ZEO A;  5HVF A;  1CG2 A;  2PE3 A;  1GYT A;  2C6G A;  4C84 A;  3QNV A;  4MMO A;  3PFO A;  2AFU A;  1TF8 A;  2HB6 A;  4C8U A;  3KR5 A;  2JBK A;  2PIZ A;  5LYF A;  3KZW A;  4PXC A;  1YSJ A;  2PJ0 A;  5K8P A;  3V38 A;  3D67 A;  4OIW A;  4NGP A;  3JRU A;  4UEE A;  1R3N A;  4JZ0 A;  2F8H A;  4OC1 A;  5F09 A;  4H2K A;  5J1Q A;  2C6C A;  3WC7 A;  4EFD A;  5CBM A;  1XJO A;  4FBE A;  3PFE A;  4NJR A;  4IAV A;  4CDJ A;  3RZA A;  2PJ3 A;  5K8O A;  3SI0 A;  2ZEL A;  1OBR A;  3I6S A;  3SJF A;  4PPZ A;  3DLJ A;  3H8E A;  3KGQ A;  4FUU A;  1IY7 A;  3HUV A;  4RUH A;  4C9A A;  4UIB A;  4P4I A;  3VAT A;  4NFR A;  4ZI6 A;  3PBB A;  1EE3 P;  1TXR A;  5LYI A;  3L2N A;  3PB9 X;  4R6T A;  4A94 A;  3FX6 A;  1IGB A;  3FH4 A;  4MCR A;  2F7V A;  7CPA A;  3DGV A;  3CPA A;  1Y0R A;  3BXM A;  2CTB A;  4CDK A;  4NGR A;  3LWU A;  2PVV A;  1CPS A;  4MCQ A;  3IIB A;  2V77 A;  2GU2 A;  2J9A A;  4DYO A;  2V8H A;  3TC8 A;  4KSI A;  4C8P A;  2BOA A;  3BI1 A;  2ANP A;  5LRG A;  1Z8L A;  4LQG A;  2EWB A;  5JM6 A;  2PJ5 A;  2WZN A;  4TNU A;  3GUX A;  1UWY A;  1ZG8 A;  3B3V A;  1KWM A;  2AFO A;  4MRI A;  2ZED A;  3I74 A;  3V7Z A;  1VIX A;  1ZLI A;  5IR2 A;  4P4F A;  2GP4 A;  4NGN A;  1F2P A;  2JBJ A;  3B3S A;  2RFH A;  5HXD A;  2FVG A;  2Q43 A;  3B7I A;  4DJL A;  2POK A;  1XMB A;  2PJC A;  2V8V A;  4TJX A;  5HVH A;  4P10 A;  3S9L A;  1F2O A;  1H8L A;  2XEI A;  1V6C A;  5DS0 A;  4C9E A;  2BCO A;  2PIY A;  1CBX A;  4X3R A;  3FMC A;  1QMU A;  1Z5R A;  3CT9 A;  4R76 A;  1XRY A;  3GB0 A;  3SI1 A;  2ABZ A;  1PYT B;  3GLJ A;  2IJZ A;  3FEC A;  2OOT A;  2AFM A;  1FT7 A;  2O4H A;  1WVM A;  5JH9 A;  4C9U A;  2JEW A;  4X2T A;  2HC9 A;  4NGQ A;  2XEF A;  4ZY2 A;  1BLL E;  1NSA A;  1Z2L A;  1ZG7 A;  3PB8 X;  4OP4 A;  5LRK A;  3RBU A;  1Q7L A;  3NH8 A;  1TKJ A;  4MHP A;  2PJ8 A;  3PEI A;  2PJ6 A;  4BD9 A;  2C6P A;  4F9U A;  2ZEM A;  3FF3 A;  1ZLH A;  6CPA A;  1PCA A;  3IC1 A;  2GLJ A;  1Y9Z A;  1RTQ A;  2ZEG A;  1ZG9 A;  2ZEF A;  4EWT A;  3B35 A;  3BI0 A;  2AFW A;  2PJA A;  5ELY A;  1YME A;  4CPA A;  1QQ9 A;  3FED A;  3KQZ A;  3PBE A;  2XEJ A;  2NSM A;  2CIJ A;  1YW4 A;  1Y0Y A;  3WC5 A;  3PRT A;  4UF4 A;  2C1C A;  2ZEE A;  2PCU A;  3S9N A;  4P44 A;  1ELL P;  4W9Y A;  3KQX A;  4KNG E;  3KAS A;  8CPA A;  2G9D A;  3D66 A;  4ZX8 A;  5HVG A;  3NFZ A;  4FAI A;  3SJX A;  1YW6 A;  4G1P A;  4C9R A;  4DUK A;  3H8G A;  4MXU A;  4O23 A;  2ZEH A;  4OC3 A;  1LOK A;  4C85 A;  1XBU A;  4K3N A;  1BPN A;  5K8M A;  4MHY A;  4A39 A;  5JGF A;  3MRU A;  4R7M A;  3B2Y A;  2OR4 A;  4EME A;  3VTA A;  4PXB A;  2V8G A;  3HLP A;  4C86 A;  3VH9 A;  1VHO A;  4P4B A;  1R43 A;  1CX8 A;  2PVW A;  4MHZ A;  4UEZ A;  4WJB A;  1YLO A;  2DEA A;  4P45 A;  1LAM A;  3EIF A;  3IWW A;  3SJG A;  3PB6 X;  1AMP A;  2PJ7 A;  4C8T A;  1LAN A;  3ISZ A;  2NYQ A;  2EK8 A;  2V8D A;  1ELM P;  3FJU A;  2O53 A;  4MCP A;  3KI9 A;  4OC2 A;  3D4U A;  4OKO A;  1LFW A;  4IHM A;  2AFX A;  3T8W A;  4IK2 A;  2ZEP A;  4ZY0 A;  3SI2 A;  1FNO A;  4UEF A;  4OC0 A;  3RAM A;  2QYV A;  3ICU A;  4NGM A;  2XEG A;  4F8Z A;  3IEH A;  3KHZ A;  3D68 A;  2I3C A;  2PRQ A;  2PJB A;  4Z65 A;  3D7G A;  3LMS A;  4C99 A;  4A38 A;  3IFE A;  3ISX A;  3B3W A;  1CP7 A;  4NJQ A;  1TF9 A;  4PXE A;  3KR4 A;  4ONW A;  2CF4 A;  3IJ3 A;  2Q4Z A;  3PB7 X;  1TKF A;  4ZYQ A;  3IO1 A;  2AFS A;  2ZEN A;  2GLF A;  4ZX9 A;  3H8F A;  5LYL A;  1VHE A;  2RB7 A;  1CPX A;  2C5Q A;  3PB4 X;  2PJ4 A;  3FVL A;  1VGY A;  1F57 A;  4PXD A;  3NH4 A;  2IMO A;  4OC4 A;  2GRE A;  4R8F A;  1TKH A;  1LAP A;  4P4E A;  2ZOG A;  1HDU A;  4OME A;  3WT4 A;  1Y7E A;  3CDX A;  3I1U A;  4GM5 A;  4YN3 A;  4PQA A;  4A37 A;  4TWE A;  1AYE A;  3KL9 A;  4MCS A;  4YU9 A;  3BHX A;  1LCP A;  4MHN A;  2PJ2 A;  3K2K A;  4C8C A;  4P6Y A;  4FWU A;  2IQ6 A;  1XFO A;  3FEE A;  3N5F A;  4OID A;  1M4L A;  5D8N A;  2WYR A;  2QJ8 A;  4Q7A A;  4YWY A;  3WAB A;  5CPA A;  1JQG A;  3CPX A;  4C8A A;  1BAV A;  3B3T A;  2QVP A;  1ARM A;  4NGS A;  5I4M A;  3WC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...