2C6CA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with gpi-18431 (s)-2-(4-iodobenzylphosphonomethyl)-pentanedioic acid
Total Genus 249
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
249
sequence length
694
structure length
682
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
publication title Structure of Glutamate Carboxypeptidase II, a Drug Target in Neuronal Damage and Prostate Cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 249
structure length 682
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2c6cA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2c6cA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c6cA02
4OC5A 4C9VA 4X3RA 4UEEA 5CBMA 1KWMA 4OKOA 3S9MA 3GLJA 2ZOGA 4PXEA 1Y0RA 4MHNA 4FBEA 3BHXA 2Q4ZA 2V8VA 3KR4A 2CTCA 1F2PA 2GREA 1HDUA 4DUKA 2PJ8A 3PBBA 5J1QA 4NGPA 4A37A 2PJAA 3B3SA 4FWUA 2AFSA 4IK2A 5CPAA 2PJ4A 4EFDA 4P4JA 5HVFA 2ZEMA 4ZI6A 3D66A 2PJ7A 2ABZA 2PJ5A 3PFOA 4PXDA 4OIDA 2PVVA 4NGMA 3GB0A 1YMEA 3B3TA 1AMPA 4CDJA 4TNUA 1ZLIA 1XBUA 2GLFA 4NFRA 2CIJA 1CPSA 2J9AA 3D68A 1ARLA 2O4HA 3BI1A 4BD9A 4IAVA 2QJ8A 3I1UA 3D7DA 5THWA 3WC5A 3ISXA 1F2OA 4P6YA 1CPXA 5F09A 1XF1A 1AYEA 3NH5A 2Q51A 4C8UA 3VARA 2HC9A 4C9EA 4MHPA 2VL1A 4FAIA 1RTQA 3D7HA 2PJ3A 2Q43A 3ISZA 4K3NA 1TKFA 3PEIA 1EE3P 3SJGA 3B3CA 3HLPA 4R6TA 2ZEOA 5D29A 4C9UA 3PB8X 4OC3A 4ZY1A 2ANPA 3PB7X 3TX8A 5K8OA 2QVPA 4P10A 3FF3A 3KL9A 4OIWA 1GYTA 2ZEDA 1LFWA 1PYTB 2ZENA 4ZX9A 2ZEEA 1M4LA 2C6PA 1YLOA 4G1PA 3D4UA 2NSMA 3IIBA 3N5FA 3IO1A 2GU2A 4C8TA 2XEIA 3KGQA 4NGSA 2XEGA 3T8WA 2DEAA 4EWTA 1CP6A 3IEHA 4X8IA 3NH8A 4P4EA 3KQXA 4UEFA 1Z2LA 3PBEA 4UIAA 4UIBA 3IJ3A 4P45A 3LWUA 4C8PA 2PJ6A 1XMBA 3LMSA 1ZG9A 2ZEFA 4NGRA 4P4DA 1XRYA 2POKA 4KNGE 5IB9A 1YSJA 5K8MA 2BO9A 4UF4A 2WYRA 3NH4A 3WC6A 4F8ZA 4W9YA 2F7VA 2ZEHA 1CBXA 3S9LA 2JEWA 1HDQA 4MRIA 3WC7A 2AFZA 3FVLA 4O23A 4TWEA 4F9UA 2PIYA 1UWYA 4R76A 2IQ6A 4NGTA 4TJVA 1BPNA 3PB9X 2CTBA 1HEEA 2PJ1A 4MXUA 4B6ZA 3I74A 2V77A 4R8FA 3CT9A 5JH9A 2I3CA 2XEJA 2AFXA 2PCUA 1LANA 3CDXA 5LYDA 7CPAA 3B7IA 3B3WA 4C8FA 2XEFA 4ZY2A 2ZOFA 2EK9A 3FEEA 1QMUA 3SI1A 3NA6A 3D67A 3DLJA 1OBRA 4DYOA 5LRKA 4JZ0A 3FJUA 4A94A 4JYWA 5LYIA 1YW6A 3SJFA 1V6CA 3SI2A 1R43A 1IY7A 1FNOA 3SJXA 2PVWA 1ZG7A 4YWYA 1BLLE 3FH4A 3SI0A 2OR4A 2JBJA 3K9TA 1TKHA 1JQGA 4MCQA 5HVHA 2F8HA 3PB4X 1ARMA 4MHYA 4P4BA 4C86A 5DS0A 2ZEGA 2RB7A 2WZNA 3RBUA 4IHMA 4YN3A 1Z5RA 1XJOA 4C9AA 1BPMA 1LCPA 2EWBA 2V8DA 2AFOA 4F9VA 2HB6A 3VATA 4NGNA 3WABA 2QYVA 2PJCA 5LRJA 2ZELA 1LAPA 2C6GA 3VH9A 1WVMA 3PFEA 4YU9A 2GLJA 2NYQA 3B2YA 1XFOA 1TF8A 4X2TA 2PJ0A 3KASA 5I4MA 3I6SA 3KQZA 1TKJA 3GUXA 3RZAA 2OOTA 2ZEPA 2EK8A 4Z65A 2CF4A 3H8GA 3K2KA 3B35A 4EMEA 4A39A 4ZX8A 5D8NA 4DJLA 1VHOA 2O53A 2IMOA 4P4FA 3EIFA 3HUVA 3IWWA 5HXDA 1DTDA 4NGQA 3L2NA 4OC2A 1H8LA 3D7FA 2C6CA 5K8NA 4RUHA 4CDKA 4AXVA 3KHZA 5LRGA 3CPXA 5LYLA 4CPAA 4P4IA 4TJXA 3H8FA 3BXMA 3FEDA 1IGBA 4MCPA 3FX6A 4H2KA 3KI9A 3H8EA 3KZWA 3DGVA 4UEZA 3B3VA 1LAMA 3KHXA 1Y0YA 2BOAA 1CP7A 3BI0A 5JGFA 3MRUA 2AFMA 1Y9ZA 3MN8A 4FUUA 1PCAA 2G9DA 4C99A 4OC0A 4WWVA 5HVGA 1Q7LA 4ONWA 2PJ9A 2FVGA 4MCRA 3FMCA 2BCOA 4NJQA 1NSAA 4C8AA 3SJEA 1QQ9A 1CX8A 4OMEA 4R7MA 1TXRA 5ELYA 1BAVA 4LQGA 2AFWA 2C1CA 1ZG8A 4P44A 4OC4A 4C8CA 2PRQA 1ZLHA 4GM5A 4MCSA 3RAMA 3NFZA 1LOKA 3PRTA 1VGYA 4KSIA 4MHZA 4A38A 3IFEA 4MMOA 4Q7AA 2AFUA 1FT7A 4NJRA 4C85A 8CPAA 1VHEA 3V7ZA 3V38A 4C9RA 2PIZA 1Y7EA 4PXBA 4WJBA 4OC1A 1TF9A 4C84A 4OP4A 4ZYQA 4ZY0A 1CG2A 2RFHA 3ICUA 2PE3A 5JM6A 3JRUA 1DE4C 3WT4A 6CPAA 2V8GA 4PPZA 1Z8LA 1ELLP 2PJBA 5K8PA 1F57A 2V8HA 3CPAA 3QNVA 1ELMP 3TC8A 4PXCA 3S9NA 3KR5A 2PJ2A 1VIXA 5LYFA 3PB6X 2IJZA 3VTAA 2JBKA 3IC1A 1YW4A 3FECA 3D7GA 4PQAA 1R3NA
chains in the Genus database with same CATH superfamily
2I00A 4OC5A 2B5GA 1NXJA 5F47A 4AG9A 4C9VA 5CNPA 1Z4RA 4C68A 4CAEA 2B3UA 3TLBA 4X3RA 3IWEA 4UEEA 4QBJA 5CBMA 1KWMA 4OKOA 3VRRA 4MFZA 3BUNB 1BOBA 2Z3NA 2HI6A 5G22A 4PK2A 3S9MA 4U9ZA 4IUSA 3GLJA 4MJ8A 2B5GB 1S7FA 5HKYA 2Z3PA 4BINA 3FXTA 2ZOGA 4PXEA 1B47A 1N71A 1Y0RA 2Y0MA 4MHNA 3BHXA 4FBEA 2Q4ZA 1CM0A 2V8VA 3KR4A 4MFPA 2CTCA 1F2PA 2GREA 1HDUA 1J3LA 1B87A 4Y49B 4XPLA 1QSOA 4Q36A 4DUKA 2PJ8A 2BEIA 2EUIA 5FD8A 2JDCA 3PBBA 1YVHA 2ATRA 3LACA 5J1QA 4NGPA 2Z3OA 5H86A 4RR2B 1Z4EA 4A37A 2Y1NA 2PJAA 2P6FA 4KS9A 4MJXA 4AVBA 5K99A 4J3GA 3B3SA 4FWUA 2AFSA 4IK2A 3TO6A 3S6GA 5CPAA 2PJ4A 4UFXA 3T5MA 4B12A 4EFDA 1JDEA 4P4JA 5HVFA 4QB9A 2QIRA 2ZEMA 2FM4A 3BJ8A 1A9XB 4ZI6A 1IOIA 2VKZG 3D66A 3DDDA 3JTKA 3NE8A 1XF1A 2PJ7A 1YGHA 2ABZA 2PJ5A 3EO4A 3PFOA 4K30A 1KUXA 4HNXB 4PXDA 2HQYA 4OIDA 2PVVA 2X0SA 5DWNA 5DWMA 4NGMA 1JDBC 3GB0A 1YMEA 3B3TA 3QAHA 4CRZB 3T90A 1AMPA 2ZW6A 4CDJA 4TNUA 3FIXA 4KOUA 1ZLIA 4KOSA 2Q7BA 1WWZA 5EMIA 1XBUA 2Z0ZA 3OP0A 1XOVA 2GLFA 4NFRA 5AG7A 4R57A 2CIJA 1CPSA 3I3GA 2BUEA 4U5YA 3S6KA 1R57A 4CGPA 1Q2DA 3GYAA 3SXNA 5F9MA 2J9AA 1KC7A 3D68A 4UWJA 1ARLA 2O4HA 5JPHA 3BI1A 4BD9A 2C27A 4IAVA 2QJ8A 3I1UA 3D7DA 4RI1A 4C2YA 3JVNA 5THWA 3WC5A 4B10A 3ISXA 1F2OA 4P6YA 3HPHE 1CPXA 5F09A 1DIKA 1FY7A 2B3VA 4CGLA 1AYEA 2Q4VA 3NH5A 2Q51A 1AUGA 3WR7A 4C8UA 3VARA 2HC9A 2EO8A 4X5KA 4C9EA 4KZTA 2FT0A 4MHPA 3TOAA 2VL1A 4GS4A 1RTQA 3SXOA 4FAIA 3D7HA 2PJ3A 1VHSA 4NSQA 2PSWA 3C8OA 3OAKA 3G8WA 2Q43A 3ISZA 4K3NA 1TKFA 4CYQA 1S7KA 4YRHA 3PEIA 1B6BA 4QUSA 2ODFA 1C30B 4MY3A 4JXRA 3ZJ0A 2N3AB 1EE3P 3BUXB 4BTFA 1QSTA 4NXYA 3SJGA 4E94A 3B3CA 5JQ4A 4BPUB 3HLPA 5KTAA 4R6TA 2ZEOA 3CXQA 3TT2A 2G0BA 5D29A 4C9UA 3PB8X 4OC3A 4ZY1A 5J8CA 2ANPA 2Z3LA 1KUYA 4CAVA 3FNCA 4C2XA 1KBLA 1YK3A 2OB0A 3PB7X 3PZJA 3TLGA 4E5SA 1IICA 3TX8A 5K8OA 1NE9A 2QVPA 4P10A 3HMJG 4GXHA 3FF3A 5AGEA 4M6IA 5EBVA 5A27A 3KL9A 3P2HA 4OIWA 1BO4A 1GYTA 1YVOA 2ZEDA 1LFWA 1PYTB 2FE7A 2GIVA 2ZENA 4ZX9A 2ZEEA 1M4LA 4L8AA 2C6PA 1YLOA 4MY0A 4CYOA 2AUNA 4G1PA 2Q7SA 3BJ7A 1QSNA 2NSMA 3D4UA 3IIBA 3N5FA 3IO1A 1XE4A 5BWAB 2GU2A 4FD7A 4C8TA 3DNSA 4KSAA 2XEIA 2J8MA 3KGQA 4NGSA 3MGDA 2XEGA 3D2MA 4KOVA 2PDOA 4UFWA 3T8WA 2P0WA 1J4JA 2DEAA 3TO7A 4EWTA 4MFJA 1CP6A 3IEHA 1LRZA 4X8IA 1S7NA 3BUOB 3NH8A 4P4EA 3KQXA 4UEFA 1Z2LA 1YLEA 2FSRA 2P6GA 3PBEA 2YNDA 1IU8A 4MHDA 2ZW4A 2VZZA 2O28A 3TOBA 4UIAA 4H89A 4KUBA 3TE4A 1CJWA 3IJ3A 4UIBA 4P45A 3F9KC 3I9SA 4AB7A 1XIXA 5G1ZA 3LWUA 2G3TA 3BUMB 2R7HA 4B13A 4C8PA 4CGMA 2PJ6A 1XMBA 2FIAA 1Q2YA 4XPDB 3LMSA 1ZG9A 1VKCA 3LODA 4A33A 1U6MA 2ZEFA 4NGRA 4P4DA 1XRYA 2POKA 4KNGE 3SR3A 5EC4A 3CXSA 2JEVA 3GY9A 4LUAA 3T05A 5IB9A 1YSJA 3U88C 1S3ZA 4CS0B 5K8MA 3E0KA 5HMNA 4RS2A 1Z8TA 2BO9A 5GCNA 2D0OA 3VRQA 4KVME 4UF4A 2WYRA 3NH4A 3QAYA 1CS0B 3WC6A 4F8ZA 4W9YA 2F7VA 2ZEHA 1Z8WA 2Z3MA 3SHPA 4J0NA 1CBXA 3TO9A 3N7ZA 3H5ZA 5JVLA 3T9YA 3S9LA 2FL4A 3VGOA 1ZYMA 3VROA 1C3OB 2JEWA 1HDQA 4AVAA 3G23A 4MRIA 2FXFA 2CXAA 3WC7A 2AFZA 1S5KA 3EZBA 4KLVA 2Q44A 4R3KA 2OLSA 3FVLA 3D2PA 2AJ6A 4O23A 5E96A 1IIDA 4FD5A 4E2AA 1MJBA 3QB8A 4B5PA 4CAWA 4CGOA 4TWEA 4F9UA 4II9A 1CE8B 2PIYA 2QECA 1M4GA 1UWYA 4MFKA 4R76A 3R9GA 2IQ6A 3R9EA 4NGTA 2HV2A 1MK4A 4TJVA 1BPNA 5G20A 3PB9X 4H1HA 4UCNA 4JJXA 2CTBA 2Q04A 4KVXA 1HEEA 2PJ1A 4KOYA 4MXUA 4B6ZA 3I74A 4UCPA 2V77A 4R8FA 3CT9A 1NSLA 1T36B 2B58A 5JH9A 2I3CA 4CRYB 4KSFA 4JVOA 2PQ8A 1PUAA 3V8IA 1K4JA 2XEJA 3F0AA 1M44A 2AFXA 2JLMA 4B11A 1ZL0A 2PCUA 4LX9A 2NMTA 4LQ6A 1LANA 2F5IA 3CDXA 5AG6A 5LYDA 3FRMA 3TFYA 1XF8A 3RNZA 3OB1B 3R9FA 3EXNA 7CPAA 4NF1A 4E8OA 3B7IA 3B3WA 3FB3A 2DPSA 3U1BA 1GGOA 4C8FA 2XEFA 4COBA 4AVCA 4CYPA 3BUWB 2E28A 2VBQA 2R98A 4C2ZA 2YNCC 4CAXA 1Y7RA 4FD6A 4UBRA 4HPSA 4ZY2A 2ZOFA 1S60A 1YVKA 2EK9A 2KCWA 3FEEA 1M4DA 1NMTA 2PRBA 1QMUA 4XPDC 1Q5XA 2DXQA 3SI1A 5KTDA 3NA6A 2G3AA 3D67A 1OBRA 1MJAA 3DLJA 4HKFA 4UA3A 3W6SA 4A95A 2D4OA 4DYOA 5LRKA 4JZ0A 2DPTA 3FJUA 4M3SA 1EO0A 4QVTA 4CAFA 4DNCA 1Y9WA 3IWGA 4HNYB 4A94A 2A4NA 4JYWA 5LYIA 1YW6A 3OB2B 4JWPA 2Z11A 3SJFA 1RXTA 3SI2A 1V6CA 1R43A 4Y49C 4MI4A 3IU1A 2EZCA 1IY7A 1FNOA 3SJXA 4A2ZA 2PVWA 2WUUA 5C88A 1ZG7A 2Z3KA 2PR8A 4YWYA 1BLLE 4XNHB 4RN7A 3FH4A 2HUZA 5H84A 3G3SA 5F1YA 3SI0A 2OR4A 2DIKA 2XPOA 2FCKA 4Q38A 2JBJA 4FD4A 1Z9UA 3K9TA 1ON0A 1IYKA 1TKHA 4KORA 1JQGA 5FVJA 4BPXB 4MCQA 1I1DA 2BL1A 2F8HA 2IL4A 3PB4X 1ARMA 1UFHA 5HVHA 3O8ZA 4MHYA 4P4BA 3TLEA 1QSRA 3TLGB 3VRNA 4KOWA 4BMHA 4C86A 5DS0A 2ZEGA 4IIXA 2FIWA 4C7IA 4NCZA 1PU9A 4ORFA 3S6FA 2RB7A 4A30A 3BLNA 2D0PA 1MJ9A 2R8VA 2WZNA 3JUWA 4KUAA 1WJTA 3RBUA 3EC4A 5AG5A 1X10A 3EZAA 4ZGYB 2VZYA 3HPGG 4HNWB 3RO0A 2HROA 4IHMA 2DF5A 4ONUA 4YN3A 1Z5RA 1XJOA 4C9AA 4ZBGA 1BPMA 1LCPA 1TIQA 4JLYA 2EWBA 4MI1A 2VI7A 2V8DA 5J8FA 2AFOA 3A9LA 4F9VA 2HB6A 3VATA 2YJTA 5JYBA 4NGNA 3WABA 3NE7A 2B4DA 3K4IA 4EYSA 2QYVA 5F46A 2PJCA 4CZ1A 3W6XA 4A32A 4EVYA 2B0AA 5LRJA 2ZELA 2H5MA 4CYNA 3T07A 2ZPAA 2Y1MA 1LAPA 1KEEB 2C6GA 1X12A 3K9UA 3VH9A 1WVMA 3GJZA 2R1IA 2YNEA 3PFEA 4YU9A 5G21A 2R82A 2X7BA 2J8RA 1VBHA 3C26A 2GLJA 3D3SA 5HH1A 4MBUA 3D8PA 2UV8G 2NYQA 3R1KA 5IX3A 3B2YA 1XFOA 3S6HA 1TF8A 2GFQA 4X2TA 4B14A 2PJ0A 2YNCA 3KASA 5I4MA 1IB1E 4JD6A 3CXPA 1JWQA 3KQZA 1TKJA 3I6SA 3EFAA 3GUXA 3RZAA 2OOTA 1ZRSA 2ZEPA 3T0TA 2EK8A 4Z65A 2CF4A 4UWIA 3ZNIA 2P6EA 2CNTA 3H8GA 3K2KA 4MFLA 1IYLA 3B35A 2MP0A 4EMEA 4R87A 2PC1A 4A39A 4ZX8A 5D8NA 4DJLA 1YQEA 3F8KA 3LD2A 1RO5A 4NEXA 1VHOA 2O53A 2IMOA 4XNHC 2EZAA 4P4FA 3EIFA 2GE3A 3HUVA 3IWWA 1Z8XA 4YFJA 5HXDA 3H4QA 1IOFA 1DTDA 1V0CA 4NGQA 4BPWB 2GANA 3L2NA 4OC2A 3TLAA 1M4IA 1H8LA 3D7FA 2CNMA 1NBWA 2XPNA 2XPPA 2C6CA 1Z9EA 5K8NA 4L89A 4RUHA 2AUMA 4CDKA 4AXVA 1Y9KA 1Q2CA 3KHZA 1YR0A 5LRGA 3CPXA 3EZEA 4B5PB 5LYLA 2OH1A 4CPAA 4P4IA 3P2FA 2JDDA 2ZW5A 1L0CA 2ZXVA 3H8FA 2WPWA 4TJXA 5HKWA 3BXMA 3FEDA 1IGBA 4MCPA 3FX6A 4H2KA 3KI9A 3H8EA 1P0HA 3KZWA 2FS5A 5BY0A 2YGWA 2B4BA 1OZPA 3DGVA 4U9YA 4UEZA 4AG7A 3B3VA 1LAMA 3KHXA 1Y0YA 3TLCA 4B5OA 5J3XA 2EVNA 2HWGA 4INJA 4OLLA 3ZZIA 5HKZA 4F0YA 2BOAA 3OWCA 4OADA 2OZHA 1CP7A 3BI0A 1I21A 5ISVA 2CNSA 5JGFA 2Q4YA 2K5TA 2AE6A 1KZFA 2AFMA 2REEA 3MRUA 4C7HA 1Y9ZA 2XPLA 3MN8A 3DR8A 5AG4A 3VWDA 4PK3A 4FUUA 1PCAA 2G9DA 4JXQA 4C99A 3R96A 3KKWA 2OU2A 4OC0A 4WWVA 5HVGA 1Q7LA 1SQHA 4ONWA 2PJ9A 3PLFB 4BBHA 4H6ZA 1VI4A 2FVGA 4MCRA 3FMCA 2ZW7A 1ZO0A 4YGOA 2BCOA 3FYNA 1NSAA 2Q0YA 4NJQA 3SJEA 4C8AA 4IF5A 2ARHA 1QQ9A 5F49A 3TCVA 1EZAA 2VXKA 3RYOA 3EY5A 4KLWA 1CX8A 3GKRA 1S7LA 4OMEA 3FBUA 4R7MA 1M6VB 4KOXA 1R61A 1XMTA 1TXRA 3VWEA 1BXRB 5ELYA 2DLAA 1BAVA 4LQGA 2AFWA 2C1CA 2EBJA 1ZG8A 4P44A 4OC4A 3GIUA 1VBGA 2PRQA 5F48A 3TYXA 4C8CA 3DR6A 2PR1A 1ZLHA 4I49A 2J8NA 4GM5A 3IU2A 4MCSA 2WSAA 4A31A 3RAMA 3NFZA 1LOKA 3PRTA 1VGYA 4KSIA 4MHZA 1I12A 3IFEA 3CZXA 4A38A 1A2ZA 2VQYA 4MMOA 4Q7AA 4A4CA 2AFUA 1FT7A 5AXIA 4NJRA 4C85A 2BSWA 8CPAA 3VRPA 1VHEA 5I0CA 3NFQA 4CO9A 2PCNA 3V7ZA 1KUVA 3V38A 2YJVA 4C9RA 2PIZA 2GP4A 4IIYA 4R9MA 2B4JC 1Y7EA 4PXBA 2VEZA 4WJBA 5IR2A 3PP9A 3PFVA 4UFVA 4OC1A 4PSWA 2Z10A 1XEBA 4OAEA 1TF9A 5F13A 3NOJA 4OP4A 4F0XA 4ZYQA 4ZY0A 4C84A 1CG2A 2RFHA 1QSMA 3ICUA 2PE3A 5JM6A 1WK4A 4QC6A 3JRUA 4M6HA 4M8DA 2QMLA 2OZUA 1DE4C 3WT4A 3PGPA 2WPXA 4PV6A 3UY5A 1FBVA 5A28A 3TTHA 3IGRA 2V8GA 6CPAA 3R95A 2CBLA 4A4BA 4PPZA 4GPLB 1Z8LA 1ELLP 2C5QA 1EZBA 4H6UA 4F6AA 2PJBA 3KRVA 4UCMA 4M6GA 5IV0A 4PSXA 1F57A 2V8HA 3CPAA 5K8PA 3PT1A 3QNVA 1ELMP 1YREA 2REFA 4KVOE 4PXCA 4MFQA 3TC8A 3TLZA 3S9NA 2B4DB 2CY2A 1GHEA 2EZBA 3F5BA 4XPKA 3KR5A 2OZGA 4R3LA 5IB0A 2PJ2A 3B8GA 1VIXA 5LYFA 3PB6X 2D4PA 2IJZA 2JBKA 3DSBA 3IC1A 4KOTA 3VTAA 1YW4A 4E0AA 3FECA 3D7GA 2RC4A 5KTCA 5F5XA 3W91A 1YX0A 4PQAA 1P4NA 2I79A 1R3NA 4CGNA 1M1DA 4M85A 4COGA 5C82A 3TLYA
chains in the Genus database with same CATH topology
4OC5A 4C9VA 4X3RA 4UEEA 5CBMA 1KWMA 4OKOA 3S9MA 3GLJA 2ZOGA 4PXEA 1Y0RA 4MHNA 4FBEA 3BHXA 2Q4ZA 2V8VA 3KR4A 2CTCA 1F2PA 2GREA 1HDUA 4DUKA 2PJ8A 3PBBA 5J1QA 4NGPA 4A37A 2PJAA 3B3SA 4FWUA 2AFSA 4IK2A 5CPAA 2PJ4A 4EFDA 4P4JA 5HVFA 2ZEMA 4ZI6A 3D66A 2PJ7A 2ABZA 2PJ5A 3PFOA 4PXDA 4OIDA 2PVVA 4NGMA 3GB0A 1YMEA 3B3TA 1AMPA 4CDJA 4TNUA 1ZLIA 1XBUA 2GLFA 4NFRA 2CIJA 1CPSA 2J9AA 3D68A 1ARLA 2O4HA 3BI1A 4BD9A 4IAVA 2QJ8A 3I1UA 3D7DA 5THWA 3WC5A 3ISXA 1F2OA 4P6YA 1CPXA 5F09A 1XF1A 1AYEA 3NH5A 2Q51A 4C8UA 3VARA 2HC9A 4C9EA 4MHPA 2VL1A 4FAIA 1RTQA 3D7HA 2PJ3A 2Q43A 3ISZA 4K3NA 1TKFA 3PEIA 1EE3P 3SJGA 3B3CA 3HLPA 4R6TA 2ZEOA 5D29A 4C9UA 3PB8X 4OC3A 4ZY1A 2ANPA 3PB7X 3TX8A 5K8OA 2QVPA 4P10A 3FF3A 3KL9A 4OIWA 1GYTA 2ZEDA 1LFWA 1PYTB 2ZENA 4ZX9A 2ZEEA 1M4LA 2C6PA 1YLOA 4G1PA 3D4UA 2NSMA 3IIBA 3N5FA 3IO1A 2GU2A 4C8TA 2XEIA 3KGQA 4NGSA 2XEGA 3T8WA 2DEAA 4EWTA 1CP6A 3IEHA 4X8IA 3NH8A 4P4EA 3KQXA 4UEFA 1Z2LA 3PBEA 4UIAA 4UIBA 3IJ3A 4P45A 3LWUA 4C8PA 2PJ6A 1XMBA 3LMSA 1ZG9A 2ZEFA 4NGRA 4P4DA 1XRYA 2POKA 4KNGE 5IB9A 1YSJA 5K8MA 2BO9A 4UF4A 2WYRA 3NH4A 3WC6A 4F8ZA 4W9YA 2F7VA 2ZEHA 1CBXA 3S9LA 2JEWA 1HDQA 4MRIA 3WC7A 2AFZA 3FVLA 4O23A 4TWEA 4F9UA 2PIYA 1UWYA 4R76A 2IQ6A 4NGTA 4TJVA 1BPNA 3PB9X 2CTBA 1HEEA 2PJ1A 4MXUA 4B6ZA 3I74A 2V77A 4R8FA 3CT9A 5JH9A 2I3CA 2XEJA 2AFXA 2PCUA 1LANA 3CDXA 5LYDA 7CPAA 3B7IA 3B3WA 4C8FA 2XEFA 4ZY2A 2ZOFA 2EK9A 3FEEA 1QMUA 3SI1A 3NA6A 3D67A 3DLJA 1OBRA 4DYOA 5LRKA 4JZ0A 3FJUA 4A94A 4JYWA 5LYIA 1YW6A 3SJFA 1V6CA 3SI2A 1R43A 1IY7A 1FNOA 3SJXA 2PVWA 1ZG7A 4YWYA 1BLLE 3FH4A 3SI0A 2OR4A 2JBJA 3K9TA 1TKHA 1JQGA 4MCQA 5HVHA 2F8HA 3PB4X 1ARMA 4MHYA 4P4BA 4C86A 5DS0A 2ZEGA 2RB7A 2WZNA 3RBUA 4IHMA 4YN3A 1Z5RA 1XJOA 4C9AA 1BPMA 1LCPA 2EWBA 2V8DA 2AFOA 4F9VA 2HB6A 3VATA 4NGNA 3WABA 2QYVA 2PJCA 5LRJA 2ZELA 1LAPA 2C6GA 3VH9A 1WVMA 3PFEA 4YU9A 2GLJA 2NYQA 3B2YA 1XFOA 1TF8A 4X2TA 2PJ0A 3KASA 5I4MA 3I6SA 3KQZA 1TKJA 3GUXA 3RZAA 2OOTA 2ZEPA 2EK8A 4Z65A 2CF4A 3H8GA 3K2KA 3B35A 4EMEA 4A39A 4ZX8A 5D8NA 4DJLA 1VHOA 2O53A 2IMOA 4P4FA 3EIFA 3HUVA 3IWWA 5HXDA 1DTDA 4NGQA 3L2NA 4OC2A 1H8LA 3D7FA 2C6CA 5K8NA 4RUHA 4CDKA 4AXVA 3KHZA 5LRGA 3CPXA 5LYLA 4CPAA 4P4IA 4TJXA 3H8FA 3BXMA 3FEDA 1IGBA 4MCPA 3FX6A 4H2KA 3KI9A 3H8EA 3KZWA 3DGVA 4UEZA 3B3VA 1LAMA 3KHXA 1Y0YA 2BOAA 1CP7A 3BI0A 5JGFA 3MRUA 2AFMA 1Y9ZA 3MN8A 4FUUA 1PCAA 2G9DA 4C99A 4OC0A 4WWVA 5HVGA 1Q7LA 4ONWA 2PJ9A 2FVGA 4MCRA 3FMCA 2BCOA 4NJQA 1NSAA 4C8AA 3SJEA 1QQ9A 1CX8A 4OMEA 4R7MA 1TXRA 5ELYA 1BAVA 4LQGA 2AFWA 2C1CA 1ZG8A 4P44A 4OC4A 4C8CA 2PRQA 1ZLHA 4GM5A 4MCSA 3RAMA 3NFZA 1LOKA 3PRTA 1VGYA 4KSIA 4MHZA 4A38A 3IFEA 4MMOA 4Q7AA 2AFUA 1FT7A 4NJRA 4C85A 8CPAA 1VHEA 3V7ZA 3V38A 4C9RA 2PIZA 2GP4A 1Y7EA 4PXBA 4WJBA 5IR2A 4OC1A 1TF9A 4C84A 4OP4A 4ZYQA 4ZY0A 1CG2A 2RFHA 3ICUA 2PE3A 5JM6A 3JRUA 1DE4C 3WT4A 6CPAA 2V8GA 4PPZA 2C5QA 1Z8LA 1ELLP 2PJBA 5K8PA 1F57A 2V8HA 3CPAA 3QNVA 1ELMP 3TC8A 4PXCA 3S9NA 3KR5A 2PJ2A 1VIXA 5LYFA 3PB6X 2IJZA 3VTAA 2JBKA 3IC1A 1YW4A 3FECA 3D7GA 4PQAA 1R3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC5 A;  4C9V A;  4X3R A;  4UEE A;  5CBM A;  1KWM A;  4OKO A;  3S9M A;  3GLJ A;  2ZOG A;  4PXE A;  1Y0R A;  4MHN A;  4FBE A;  3BHX A;  2Q4Z A;  2V8V A;  3KR4 A;  2CTC A;  1F2P A;  2GRE A;  1HDU A;  4DUK A;  2PJ8 A;  3PBB A;  5J1Q A;  4NGP A;  4A37 A;  2PJA A;  3B3S A;  4FWU A;  2AFS A;  4IK2 A;  5CPA A;  2PJ4 A;  4EFD A;  4P4J A;  5HVF A;  2ZEM A;  4ZI6 A;  3D66 A;  2PJ7 A;  2ABZ A;  2PJ5 A;  3PFO A;  4PXD A;  4OID A;  2PVV A;  4NGM A;  3GB0 A;  1YME A;  3B3T A;  1AMP A;  4CDJ A;  4TNU A;  1ZLI A;  1XBU A;  2GLF A;  4NFR A;  2CIJ A;  1CPS A;  2J9A A;  3D68 A;  1ARL A;  2O4H A;  3BI1 A;  4BD9 A;  4IAV A;  2QJ8 A;  3I1U A;  3D7D A;  5THW A;  3WC5 A;  3ISX A;  1F2O A;  4P6Y A;  1CPX A;  5F09 A;  1XF1 A;  1AYE A;  3NH5 A;  2Q51 A;  4C8U A;  3VAR A;  2HC9 A;  4C9E A;  4MHP A;  2VL1 A;  4FAI A;  1RTQ A;  3D7H A;  2PJ3 A;  2Q43 A;  3ISZ A;  4K3N A;  1TKF A;  3PEI A;  1EE3 P;  3SJG A;  3B3C A;  3HLP A;  4R6T A;  2ZEO A;  5D29 A;  4C9U A;  3PB8 X;  4OC3 A;  4ZY1 A;  2ANP A;  3PB7 X;  3TX8 A;  5K8O A;  2QVP A;  4P10 A;  3FF3 A;  3KL9 A;  4OIW A;  1GYT A;  2ZED A;  1LFW A;  1PYT B;  2ZEN A;  4ZX9 A;  2ZEE A;  1M4L A;  2C6P A;  1YLO A;  4G1P A;  3D4U A;  2NSM A;  3IIB A;  3N5F A;  3IO1 A;  2GU2 A;  4C8T A;  2XEI A;  3KGQ A;  4NGS A;  2XEG A;  3T8W A;  2DEA A;  4EWT A;  1CP6 A;  3IEH A;  4X8I A;  3NH8 A;  4P4E A;  3KQX A;  4UEF A;  1Z2L A;  3PBE A;  4UIA A;  4UIB A;  3IJ3 A;  4P45 A;  3LWU A;  4C8P A;  2PJ6 A;  1XMB A;  3LMS A;  1ZG9 A;  2ZEF A;  4NGR A;  4P4D A;  1XRY A;  2POK A;  4KNG E;  5IB9 A;  1YSJ A;  5K8M A;  2BO9 A;  4UF4 A;  2WYR A;  3NH4 A;  3WC6 A;  4F8Z A;  4W9Y A;  2F7V A;  2ZEH A;  1CBX A;  3S9L A;  2JEW A;  1HDQ A;  4MRI A;  3WC7 A;  2AFZ A;  3FVL A;  4O23 A;  4TWE A;  4F9U A;  2PIY A;  1UWY A;  4R76 A;  2IQ6 A;  4NGT A;  4TJV A;  1BPN A;  3PB9 X;  2CTB A;  1HEE A;  2PJ1 A;  4MXU A;  4B6Z A;  3I74 A;  2V77 A;  4R8F A;  3CT9 A;  5JH9 A;  2I3C A;  2XEJ A;  2AFX A;  2PCU A;  1LAN A;  3CDX A;  5LYD A;  7CPA A;  3B7I A;  3B3W A;  4C8F A;  2XEF A;  4ZY2 A;  2ZOF A;  2EK9 A;  3FEE A;  1QMU A;  3SI1 A;  3NA6 A;  3D67 A;  3DLJ A;  1OBR A;  4DYO A;  5LRK A;  4JZ0 A;  3FJU A;  4A94 A;  4JYW A;  5LYI A;  1YW6 A;  3SJF A;  1V6C A;  3SI2 A;  1R43 A;  1IY7 A;  1FNO A;  3SJX A;  2PVW A;  1ZG7 A;  4YWY A;  1BLL E;  3FH4 A;  3SI0 A;  2OR4 A;  2JBJ A;  3K9T A;  1TKH A;  1JQG A;  4MCQ A;  5HVH A;  2F8H A;  3PB4 X;  1ARM A;  4MHY A;  4P4B A;  4C86 A;  5DS0 A;  2ZEG A;  2RB7 A;  2WZN A;  3RBU A;  4IHM A;  4YN3 A;  1Z5R A;  1XJO A;  4C9A A;  1BPM A;  1LCP A;  2EWB A;  2V8D A;  2AFO A;  4F9V A;  2HB6 A;  3VAT A;  4NGN A;  3WAB A;  2QYV A;  2PJC A;  5LRJ A;  2ZEL A;  1LAP A;  2C6G A;  3VH9 A;  1WVM A;  3PFE A;  4YU9 A;  2GLJ A;  2NYQ A;  3B2Y A;  1XFO A;  1TF8 A;  4X2T A;  2PJ0 A;  3KAS A;  5I4M A;  3I6S A;  3KQZ A;  1TKJ A;  3GUX A;  3RZA A;  2OOT A;  2ZEP A;  2EK8 A;  4Z65 A;  2CF4 A;  3H8G A;  3K2K A;  3B35 A;  4EME A;  4A39 A;  4ZX8 A;  5D8N A;  4DJL A;  1VHO A;  2O53 A;  2IMO A;  4P4F A;  3EIF A;  3HUV A;  3IWW A;  5HXD A;  1DTD A;  4NGQ A;  3L2N A;  4OC2 A;  1H8L A;  3D7F A;  2C6C A;  5K8N A;  4RUH A;  4CDK A;  4AXV A;  3KHZ A;  5LRG A;  3CPX A;  5LYL A;  4CPA A;  4P4I A;  4TJX A;  3H8F A;  3BXM A;  3FED A;  1IGB A;  4MCP A;  3FX6 A;  4H2K A;  3KI9 A;  3H8E A;  3KZW A;  3DGV A;  4UEZ A;  3B3V A;  1LAM A;  3KHX A;  1Y0Y A;  2BOA A;  1CP7 A;  3BI0 A;  5JGF A;  3MRU A;  2AFM A;  1Y9Z A;  3MN8 A;  4FUU A;  1PCA A;  2G9D A;  4C99 A;  4OC0 A;  4WWV A;  5HVG A;  1Q7L A;  4ONW A;  2PJ9 A;  2FVG A;  4MCR A;  3FMC A;  2BCO A;  4NJQ A;  1NSA A;  4C8A A;  3SJE A;  1QQ9 A;  1CX8 A;  4OME A;  4R7M A;  1TXR A;  5ELY A;  1BAV A;  4LQG A;  2AFW A;  2C1C A;  1ZG8 A;  4P44 A;  4OC4 A;  4C8C A;  2PRQ A;  1ZLH A;  4GM5 A;  4MCS A;  3RAM A;  3NFZ A;  1LOK A;  3PRT A;  1VGY A;  4KSI A;  4MHZ A;  4A38 A;  3IFE A;  4MMO A;  4Q7A A;  2AFU A;  1FT7 A;  4NJR A;  4C85 A;  8CPA A;  1VHE A;  3V7Z A;  3V38 A;  4C9R A;  2PIZ A;  1Y7E A;  4PXB A;  4WJB A;  4OC1 A;  1TF9 A;  4C84 A;  4OP4 A;  4ZYQ A;  4ZY0 A;  1CG2 A;  2RFH A;  3ICU A;  2PE3 A;  5JM6 A;  3JRU A;  1DE4 C;  3WT4 A;  6CPA A;  2V8G A;  4PPZ A;  1Z8L A;  1ELL P;  2PJB A;  5K8P A;  1F57 A;  2V8H A;  3CPA A;  3QNV A;  1ELM P;  3TC8 A;  4PXC A;  3S9N A;  3KR5 A;  2PJ2 A;  1VIX A;  5LYF A;  3PB6 X;  2IJZ A;  3VTA A;  2JBK A;  3IC1 A;  1YW4 A;  3FEC A;  3D7G A;  4PQA A;  1R3N A; 
#chains in the Genus database with same CATH topology
 2I00 A;  4OC5 A;  2B5G A;  1NXJ A;  5F47 A;  4AG9 A;  4C9V A;  5CNP A;  1Z4R A;  4C68 A;  4CAE A;  2B3U A;  3TLB A;  4X3R A;  3IWE A;  4UEE A;  4QBJ A;  5CBM A;  1KWM A;  4OKO A;  3VRR A;  4MFZ A;  3BUN B;  1BOB A;  2Z3N A;  2HI6 A;  5G22 A;  4PK2 A;  3S9M A;  4U9Z A;  4IUS A;  3GLJ A;  4MJ8 A;  2B5G B;  1S7F A;  5HKY A;  2Z3P A;  4BIN A;  3FXT A;  2ZOG A;  4PXE A;  1B47 A;  1N71 A;  1Y0R A;  2Y0M A;  4MHN A;  3BHX A;  4FBE A;  2Q4Z A;  1CM0 A;  2V8V A;  3KR4 A;  4MFP A;  2CTC A;  1F2P A;  2GRE A;  1HDU A;  1J3L A;  1B87 A;  4Y49 B;  4XPL A;  1QSO A;  4Q36 A;  4DUK A;  2PJ8 A;  2BEI A;  2EUI A;  5FD8 A;  2JDC A;  3PBB A;  1YVH A;  2ATR A;  3LAC A;  5J1Q A;  4NGP A;  2Z3O A;  5H86 A;  4RR2 B;  1Z4E A;  4A37 A;  2Y1N A;  2PJA A;  2P6F A;  4KS9 A;  4MJX A;  4AVB A;  5K99 A;  4J3G A;  3B3S A;  4FWU A;  2AFS A;  4IK2 A;  3TO6 A;  3S6G A;  5CPA A;  2PJ4 A;  4UFX A;  3T5M A;  4B12 A;  4EFD A;  1JDE A;  4P4J A;  5HVF A;  4QB9 A;  2QIR A;  2ZEM A;  2FM4 A;  3BJ8 A;  1A9X B;  4ZI6 A;  1IOI A;  2VKZ G;  3D66 A;  3DDD A;  3JTK A;  3NE8 A;  1XF1 A;  2PJ7 A;  1YGH A;  2ABZ A;  2PJ5 A;  3EO4 A;  3PFO A;  4K30 A;  1KUX A;  4HNX B;  4PXD A;  2HQY A;  4OID A;  2PVV A;  2X0S A;  5DWN A;  5DWM A;  4NGM A;  1JDB C;  3GB0 A;  1YME A;  3B3T A;  3QAH A;  4CRZ B;  3T90 A;  1AMP A;  2ZW6 A;  4CDJ A;  4TNU A;  3FIX A;  4KOU A;  1ZLI A;  4KOS A;  2Q7B A;  1WWZ A;  5EMI A;  1XBU A;  2Z0Z A;  3OP0 A;  1XOV A;  2GLF A;  4NFR A;  5AG7 A;  4R57 A;  2CIJ A;  1CPS A;  3I3G A;  2BUE A;  4U5Y A;  3S6K A;  1R57 A;  4CGP A;  1Q2D A;  3GYA A;  3SXN A;  5F9M A;  2J9A A;  1KC7 A;  3D68 A;  4UWJ A;  1ARL A;  2O4H A;  5JPH A;  3BI1 A;  4BD9 A;  2C27 A;  4IAV A;  2QJ8 A;  3I1U A;  3D7D A;  4RI1 A;  4C2Y A;  3JVN A;  5THW A;  3WC5 A;  4B10 A;  3ISX A;  1F2O A;  4P6Y A;  3HPH E;  1CPX A;  5F09 A;  1DIK A;  1FY7 A;  2B3V A;  4CGL A;  1AYE A;  2Q4V A;  3NH5 A;  2Q51 A;  1AUG A;  3WR7 A;  4C8U A;  3VAR A;  2HC9 A;  2EO8 A;  4X5K A;  4C9E A;  4KZT A;  2FT0 A;  4MHP A;  3TOA A;  2VL1 A;  4GS4 A;  1RTQ A;  3SXO A;  4FAI A;  3D7H A;  2PJ3 A;  1VHS A;  4NSQ A;  2PSW A;  3C8O A;  3OAK A;  3G8W A;  2Q43 A;  3ISZ A;  4K3N A;  1TKF A;  4CYQ A;  1S7K A;  4YRH A;  3PEI A;  1B6B A;  4QUS A;  2ODF A;  1C30 B;  4MY3 A;  4JXR A;  3ZJ0 A;  2N3A B;  1EE3 P;  3BUX B;  4BTF A;  1QST A;  4NXY A;  3SJG A;  4E94 A;  3B3C A;  5JQ4 A;  4BPU B;  3HLP A;  5KTA A;  4R6T A;  2ZEO A;  3CXQ A;  3TT2 A;  2G0B A;  5D29 A;  4C9U A;  3PB8 X;  4OC3 A;  4ZY1 A;  5J8C A;  2ANP A;  2Z3L A;  1KUY A;  4CAV A;  3FNC A;  4C2X A;  1KBL A;  1YK3 A;  2OB0 A;  3PB7 X;  3PZJ A;  3TLG A;  4E5S A;  1IIC A;  3TX8 A;  5K8O A;  1NE9 A;  2QVP A;  4P10 A;  3HMJ G;  4GXH A;  3FF3 A;  5AGE A;  4M6I A;  5EBV A;  5A27 A;  3KL9 A;  3P2H A;  4OIW A;  1BO4 A;  1GYT A;  1YVO A;  2ZED A;  1LFW A;  1PYT B;  2FE7 A;  2GIV A;  2ZEN A;  4ZX9 A;  2ZEE A;  1M4L A;  4L8A A;  2C6P A;  1YLO A;  4MY0 A;  4CYO A;  2AUN A;  4G1P A;  2Q7S A;  3BJ7 A;  1QSN A;  2NSM A;  3D4U A;  3IIB A;  3N5F A;  3IO1 A;  1XE4 A;  5BWA B;  2GU2 A;  4FD7 A;  4C8T A;  3DNS A;  4KSA A;  2XEI A;  2J8M A;  3KGQ A;  4NGS A;  3MGD A;  2XEG A;  3D2M A;  4KOV A;  2PDO A;  4UFW A;  3T8W A;  2P0W A;  1J4J A;  2DEA A;  3TO7 A;  4EWT A;  4MFJ A;  1CP6 A;  3IEH A;  1LRZ A;  4X8I A;  1S7N A;  3BUO B;  3NH8 A;  4P4E A;  3KQX A;  4UEF A;  1Z2L A;  1YLE A;  2FSR A;  2P6G A;  3PBE A;  2YND A;  1IU8 A;  4MHD A;  2ZW4 A;  2VZZ A;  2O28 A;  3TOB A;  4UIA A;  4H89 A;  4KUB A;  3TE4 A;  1CJW A;  3IJ3 A;  4UIB A;  4P45 A;  3F9K C;  3I9S A;  4AB7 A;  1XIX A;  5G1Z A;  3LWU A;  2G3T A;  3BUM B;  2R7H A;  4B13 A;  4C8P A;  4CGM A;  2PJ6 A;  1XMB A;  2FIA A;  1Q2Y A;  4XPD B;  3LMS A;  1ZG9 A;  1VKC A;  3LOD A;  4A33 A;  1U6M A;  2ZEF A;  4NGR A;  4P4D A;  1XRY A;  2POK A;  4KNG E;  3SR3 A;  5EC4 A;  3CXS A;  2JEV A;  3GY9 A;  4LUA A;  3T05 A;  5IB9 A;  1YSJ A;  3U88 C;  1S3Z A;  4CS0 B;  5K8M A;  3E0K A;  5HMN A;  4RS2 A;  1Z8T A;  2BO9 A;  5GCN A;  2D0O A;  3VRQ A;  4KVM E;  4UF4 A;  2WYR A;  3NH4 A;  3QAY A;  1CS0 B;  3WC6 A;  4F8Z A;  4W9Y A;  2F7V A;  2ZEH A;  1Z8W A;  2Z3M A;  3SHP A;  4J0N A;  1CBX A;  3TO9 A;  3N7Z A;  3H5Z A;  5JVL A;  3T9Y A;  3S9L A;  2FL4 A;  3VGO A;  1ZYM A;  3VRO A;  1C3O B;  2JEW A;  1HDQ A;  4AVA A;  3G23 A;  4MRI A;  2FXF A;  2CXA A;  3WC7 A;  2AFZ A;  1S5K A;  3EZB A;  4KLV A;  2Q44 A;  4R3K A;  2OLS A;  3FVL A;  3D2P A;  2AJ6 A;  4O23 A;  5E96 A;  1IID A;  4FD5 A;  4E2A A;  1MJB A;  3QB8 A;  4B5P A;  4CAW A;  4CGO A;  4TWE A;  4F9U A;  4II9 A;  1CE8 B;  2PIY A;  2QEC A;  1M4G A;  1UWY A;  4MFK A;  4R76 A;  3R9G A;  2IQ6 A;  3R9E A;  4NGT A;  2HV2 A;  1MK4 A;  4TJV A;  1BPN A;  5G20 A;  3PB9 X;  4H1H A;  4UCN A;  4JJX A;  2CTB A;  2Q04 A;  4KVX A;  1HEE A;  2PJ1 A;  4KOY A;  4MXU A;  4B6Z A;  3I74 A;  4UCP A;  2V77 A;  4R8F A;  3CT9 A;  1NSL A;  1T36 B;  2B58 A;  5JH9 A;  2I3C A;  4CRY B;  4KSF A;  4JVO A;  2PQ8 A;  1PUA A;  3V8I A;  1K4J A;  2XEJ A;  3F0A A;  1M44 A;  2AFX A;  2JLM A;  4B11 A;  1ZL0 A;  2PCU A;  4LX9 A;  2NMT A;  4LQ6 A;  1LAN A;  2F5I A;  3CDX A;  5AG6 A;  5LYD A;  3FRM A;  3TFY A;  1XF8 A;  3RNZ A;  3OB1 B;  3R9F A;  3EXN A;  7CPA A;  4NF1 A;  4E8O A;  3B7I A;  3B3W A;  3FB3 A;  2DPS A;  3U1B A;  1GGO A;  4C8F A;  2XEF A;  4COB A;  4AVC A;  4CYP A;  3BUW B;  2E28 A;  2VBQ A;  2R98 A;  4C2Z A;  2YNC C;  4CAX A;  1Y7R A;  4FD6 A;  4UBR A;  4HPS A;  4ZY2 A;  2ZOF A;  1S60 A;  1YVK A;  2EK9 A;  2KCW A;  3FEE A;  1M4D A;  1NMT A;  2PRB A;  1QMU A;  4XPD C;  1Q5X A;  2DXQ A;  3SI1 A;  5KTD A;  3NA6 A;  2G3A A;  3D67 A;  1OBR A;  1MJA A;  3DLJ A;  4HKF A;  4UA3 A;  3W6S A;  4A95 A;  2D4O A;  4DYO A;  5LRK A;  4JZ0 A;  2DPT A;  3FJU A;  4M3S A;  1EO0 A;  4QVT A;  4CAF A;  4DNC A;  1Y9W A;  3IWG A;  4HNY B;  4A94 A;  2A4N A;  4JYW A;  5LYI A;  1YW6 A;  3OB2 B;  4JWP A;  2Z11 A;  3SJF A;  1RXT A;  3SI2 A;  1V6C A;  1R43 A;  4Y49 C;  4MI4 A;  3IU1 A;  2EZC A;  1IY7 A;  1FNO A;  3SJX A;  4A2Z A;  2PVW A;  2WUU A;  5C88 A;  1ZG7 A;  2Z3K A;  2PR8 A;  4YWY A;  1BLL E;  4XNH B;  4RN7 A;  3FH4 A;  2HUZ A;  5H84 A;  3G3S A;  5F1Y A;  3SI0 A;  2OR4 A;  2DIK A;  2XPO A;  2FCK A;  4Q38 A;  2JBJ A;  4FD4 A;  1Z9U A;  3K9T A;  1ON0 A;  1IYK A;  1TKH A;  4KOR A;  1JQG A;  5FVJ A;  4BPX B;  4MCQ A;  1I1D A;  2BL1 A;  2F8H A;  2IL4 A;  3PB4 X;  1ARM A;  1UFH A;  5HVH A;  3O8Z A;  4MHY A;  4P4B A;  3TLE A;  1QSR A;  3TLG B;  3VRN A;  4KOW A;  4BMH A;  4C86 A;  5DS0 A;  2ZEG A;  4IIX A;  2FIW A;  4C7I A;  4NCZ A;  1PU9 A;  4ORF A;  3S6F A;  2RB7 A;  4A30 A;  3BLN A;  2D0P A;  1MJ9 A;  2R8V A;  2WZN A;  3JUW A;  4KUA A;  1WJT A;  3RBU A;  3EC4 A;  5AG5 A;  1X10 A;  3EZA A;  4ZGY B;  2VZY A;  3HPG G;  4HNW B;  3RO0 A;  2HRO A;  4IHM A;  2DF5 A;  4ONU A;  4YN3 A;  1Z5R A;  1XJO A;  4C9A A;  4ZBG A;  1BPM A;  1LCP A;  1TIQ A;  4JLY A;  2EWB A;  4MI1 A;  2VI7 A;  2V8D A;  5J8F A;  2AFO A;  3A9L A;  4F9V A;  2HB6 A;  3VAT A;  2YJT A;  5JYB A;  4NGN A;  3WAB A;  3NE7 A;  2B4D A;  3K4I A;  4EYS A;  2QYV A;  5F46 A;  2PJC A;  4CZ1 A;  3W6X A;  4A32 A;  4EVY A;  2B0A A;  5LRJ A;  2ZEL A;  2H5M A;  4CYN A;  3T07 A;  2ZPA A;  2Y1M A;  1LAP A;  1KEE B;  2C6G A;  1X12 A;  3K9U A;  3VH9 A;  1WVM A;  3GJZ A;  2R1I A;  2YNE A;  3PFE A;  4YU9 A;  5G21 A;  2R82 A;  2X7B A;  2J8R A;  1VBH A;  3C26 A;  2GLJ A;  3D3S A;  5HH1 A;  4MBU A;  3D8P A;  2UV8 G;  2NYQ A;  3R1K A;  5IX3 A;  3B2Y A;  1XFO A;  3S6H A;  1TF8 A;  2GFQ A;  4X2T A;  4B14 A;  2PJ0 A;  2YNC A;  3KAS A;  5I4M A;  1IB1 E;  4JD6 A;  3CXP A;  1JWQ A;  3KQZ A;  1TKJ A;  3I6S A;  3EFA A;  3GUX A;  3RZA A;  2OOT A;  1ZRS A;  2ZEP A;  3T0T A;  2EK8 A;  4Z65 A;  2CF4 A;  4UWI A;  3ZNI A;  2P6E A;  2CNT A;  3H8G A;  3K2K A;  4MFL A;  1IYL A;  3B35 A;  2MP0 A;  4EME A;  4R87 A;  2PC1 A;  4A39 A;  4ZX8 A;  5D8N A;  4DJL A;  1YQE A;  3F8K A;  3LD2 A;  1RO5 A;  4NEX A;  1VHO A;  2O53 A;  2IMO A;  4XNH C;  2EZA A;  4P4F A;  3EIF A;  2GE3 A;  3HUV A;  3IWW A;  1Z8X A;  4YFJ A;  5HXD A;  3H4Q A;  1IOF A;  1DTD A;  1V0C A;  4NGQ A;  4BPW B;  2GAN A;  3L2N A;  4OC2 A;  3TLA A;  1M4I A;  1H8L A;  3D7F A;  2CNM A;  1NBW A;  2XPN A;  2XPP A;  2C6C A;  1Z9E A;  5K8N A;  4L89 A;  4RUH A;  2AUM A;  4CDK A;  4AXV A;  1Y9K A;  1Q2C A;  3KHZ A;  1YR0 A;  5LRG A;  3CPX A;  3EZE A;  4B5P B;  5LYL A;  2OH1 A;  4CPA A;  4P4I A;  3P2F A;  2JDD A;  2ZW5 A;  1L0C A;  2ZXV A;  3H8F A;  2WPW A;  4TJX A;  5HKW A;  3BXM A;  3FED A;  1IGB A;  4MCP A;  3FX6 A;  4H2K A;  3KI9 A;  3H8E A;  1P0H A;  3KZW A;  2FS5 A;  5BY0 A;  2YGW A;  2B4B A;  1OZP A;  3DGV A;  4U9Y A;  4UEZ A;  4AG7 A;  3B3V A;  1LAM A;  3KHX A;  1Y0Y A;  3TLC A;  4B5O A;  5J3X A;  2EVN A;  2HWG A;  4INJ A;  4OLL A;  3ZZI A;  5HKZ A;  4F0Y A;  2BOA A;  3OWC A;  4OAD A;  2OZH A;  1CP7 A;  3BI0 A;  1I21 A;  5ISV A;  2CNS A;  5JGF A;  2Q4Y A;  2K5T A;  2AE6 A;  1KZF A;  2AFM A;  2REE A;  3MRU A;  4C7H A;  1Y9Z A;  2XPL A;  3MN8 A;  3DR8 A;  5AG4 A;  3VWD A;  4PK3 A;  4FUU A;  1PCA A;  2G9D A;  4JXQ A;  4C99 A;  3R96 A;  3KKW A;  2OU2 A;  4OC0 A;  4WWV A;  5HVG A;  1Q7L A;  1SQH A;  4ONW A;  2PJ9 A;  3PLF B;  4BBH A;  4H6Z A;  1VI4 A;  2FVG A;  4MCR A;  3FMC A;  2ZW7 A;  1ZO0 A;  4YGO A;  2BCO A;  3FYN A;  1NSA A;  2Q0Y A;  4NJQ A;  3SJE A;  4C8A A;  4IF5 A;  2ARH A;  1QQ9 A;  5F49 A;  3TCV A;  1EZA A;  2VXK A;  3RYO A;  3EY5 A;  4KLW A;  1CX8 A;  3GKR A;  1S7L A;  4OME A;  3FBU A;  4R7M A;  1M6V B;  4KOX A;  1R61 A;  1XMT A;  1TXR A;  3VWE A;  1BXR B;  5ELY A;  2DLA A;  1BAV A;  4LQG A;  2AFW A;  2C1C A;  2EBJ A;  1ZG8 A;  4P44 A;  4OC4 A;  3GIU A;  1VBG A;  2PRQ A;  5F48 A;  3TYX A;  4C8C A;  3DR6 A;  2PR1 A;  1ZLH A;  4I49 A;  2J8N A;  4GM5 A;  3IU2 A;  4MCS A;  2WSA A;  4A31 A;  3RAM A;  3NFZ A;  1LOK A;  3PRT A;  1VGY A;  4KSI A;  4MHZ A;  1I12 A;  3IFE A;  3CZX A;  4A38 A;  1A2Z A;  2VQY A;  4MMO A;  4Q7A A;  4A4C A;  2AFU A;  1FT7 A;  5AXI A;  4NJR A;  4C85 A;  2BSW A;  8CPA A;  3VRP A;  1VHE A;  5I0C A;  3NFQ A;  4CO9 A;  2PCN A;  3V7Z A;  1KUV A;  3V38 A;  2YJV A;  4C9R A;  2PIZ A;  2GP4 A;  4IIY A;  4R9M A;  2B4J C;  1Y7E A;  4PXB A;  2VEZ A;  4WJB A;  5IR2 A;  3PP9 A;  3PFV A;  4UFV A;  4OC1 A;  4PSW A;  2Z10 A;  1XEB A;  4OAE A;  1TF9 A;  5F13 A;  3NOJ A;  4OP4 A;  4F0X A;  4ZYQ A;  4ZY0 A;  4C84 A;  1CG2 A;  2RFH A;  1QSM A;  3ICU A;  2PE3 A;  5JM6 A;  1WK4 A;  4QC6 A;  3JRU A;  4M6H A;  4M8D A;  2QML A;  2OZU A;  1DE4 C;  3WT4 A;  3PGP A;  2WPX A;  4PV6 A;  3UY5 A;  1FBV A;  5A28 A;  3TTH A;  3IGR A;  2V8G A;  6CPA A;  3R95 A;  2CBL A;  4A4B A;  4PPZ A;  4GPL B;  1Z8L A;  1ELL P;  2C5Q A;  1EZB A;  4H6U A;  4F6A A;  2PJB A;  3KRV A;  4UCM A;  4M6G A;  5IV0 A;  4PSX A;  1F57 A;  2V8H A;  3CPA A;  5K8P A;  3PT1 A;  3QNV A;  1ELM P;  1YRE A;  2REF A;  4KVO E;  4PXC A;  4MFQ A;  3TC8 A;  3TLZ A;  3S9N A;  2B4D B;  2CY2 A;  1GHE A;  2EZB A;  3F5B A;  4XPK A;  3KR5 A;  2OZG A;  4R3L A;  5IB0 A;  2PJ2 A;  3B8G A;  1VIX A;  5LYF A;  3PB6 X;  2D4P A;  2IJZ A;  2JBK A;  3DSB A;  3IC1 A;  4KOT A;  3VTA A;  1YW4 A;  4E0A A;  3FEC A;  3D7G A;  2RC4 A;  5KTC A;  5F5X A;  3W91 A;  1YX0 A;  4PQA A;  1P4N A;  2I79 A;  1R3N A;  4CGN A;  1M1D A;  4M85 A;  4COG A;  5C82 A;  3TLY A; 
#chains in the Genus database with same CATH homology
 4OC5 A;  4C9V A;  4X3R A;  4UEE A;  5CBM A;  1KWM A;  4OKO A;  3S9M A;  3GLJ A;  2ZOG A;  4PXE A;  1Y0R A;  4MHN A;  4FBE A;  3BHX A;  2Q4Z A;  2V8V A;  3KR4 A;  2CTC A;  1F2P A;  2GRE A;  1HDU A;  4DUK A;  2PJ8 A;  3PBB A;  5J1Q A;  4NGP A;  4A37 A;  2PJA A;  3B3S A;  4FWU A;  2AFS A;  4IK2 A;  5CPA A;  2PJ4 A;  4EFD A;  4P4J A;  5HVF A;  2ZEM A;  4ZI6 A;  3D66 A;  2PJ7 A;  2ABZ A;  2PJ5 A;  3PFO A;  4PXD A;  4OID A;  2PVV A;  4NGM A;  3GB0 A;  1YME A;  3B3T A;  1AMP A;  4CDJ A;  4TNU A;  1ZLI A;  1XBU A;  2GLF A;  4NFR A;  2CIJ A;  1CPS A;  2J9A A;  3D68 A;  1ARL A;  2O4H A;  3BI1 A;  4BD9 A;  4IAV A;  2QJ8 A;  3I1U A;  3D7D A;  5THW A;  3WC5 A;  3ISX A;  1F2O A;  4P6Y A;  1CPX A;  5F09 A;  1XF1 A;  1AYE A;  3NH5 A;  2Q51 A;  4C8U A;  3VAR A;  2HC9 A;  4C9E A;  4MHP A;  2VL1 A;  4FAI A;  1RTQ A;  3D7H A;  2PJ3 A;  2Q43 A;  3ISZ A;  4K3N A;  1TKF A;  3PEI A;  1EE3 P;  3SJG A;  3B3C A;  3HLP A;  4R6T A;  2ZEO A;  5D29 A;  4C9U A;  3PB8 X;  4OC3 A;  4ZY1 A;  2ANP A;  3PB7 X;  3TX8 A;  5K8O A;  2QVP A;  4P10 A;  3FF3 A;  3KL9 A;  4OIW A;  1GYT A;  2ZED A;  1LFW A;  1PYT B;  2ZEN A;  4ZX9 A;  2ZEE A;  1M4L A;  2C6P A;  1YLO A;  4G1P A;  3D4U A;  2NSM A;  3IIB A;  3N5F A;  3IO1 A;  2GU2 A;  4C8T A;  2XEI A;  3KGQ A;  4NGS A;  2XEG A;  3T8W A;  2DEA A;  4EWT A;  1CP6 A;  3IEH A;  4X8I A;  3NH8 A;  4P4E A;  3KQX A;  4UEF A;  1Z2L A;  3PBE A;  4UIA A;  4UIB A;  3IJ3 A;  4P45 A;  3LWU A;  4C8P A;  2PJ6 A;  1XMB A;  3LMS A;  1ZG9 A;  2ZEF A;  4NGR A;  4P4D A;  1XRY A;  2POK A;  4KNG E;  5IB9 A;  1YSJ A;  5K8M A;  2BO9 A;  4UF4 A;  2WYR A;  3NH4 A;  3WC6 A;  4F8Z A;  4W9Y A;  2F7V A;  2ZEH A;  1CBX A;  3S9L A;  2JEW A;  1HDQ A;  4MRI A;  3WC7 A;  2AFZ A;  3FVL A;  4O23 A;  4TWE A;  4F9U A;  2PIY A;  1UWY A;  4R76 A;  2IQ6 A;  4NGT A;  4TJV A;  1BPN A;  3PB9 X;  2CTB A;  1HEE A;  2PJ1 A;  4MXU A;  4B6Z A;  3I74 A;  2V77 A;  4R8F A;  3CT9 A;  5JH9 A;  2I3C A;  2XEJ A;  2AFX A;  2PCU A;  1LAN A;  3CDX A;  5LYD A;  7CPA A;  3B7I A;  3B3W A;  4C8F A;  2XEF A;  4ZY2 A;  2ZOF A;  2EK9 A;  3FEE A;  1QMU A;  3SI1 A;  3NA6 A;  3D67 A;  3DLJ A;  1OBR A;  4DYO A;  5LRK A;  4JZ0 A;  3FJU A;  4A94 A;  4JYW A;  5LYI A;  1YW6 A;  3SJF A;  1V6C A;  3SI2 A;  1R43 A;  1IY7 A;  1FNO A;  3SJX A;  2PVW A;  1ZG7 A;  4YWY A;  1BLL E;  3FH4 A;  3SI0 A;  2OR4 A;  2JBJ A;  3K9T A;  1TKH A;  1JQG A;  4MCQ A;  5HVH A;  2F8H A;  3PB4 X;  1ARM A;  4MHY A;  4P4B A;  4C86 A;  5DS0 A;  2ZEG A;  2RB7 A;  2WZN A;  3RBU A;  4IHM A;  4YN3 A;  1Z5R A;  1XJO A;  4C9A A;  1BPM A;  1LCP A;  2EWB A;  2V8D A;  2AFO A;  4F9V A;  2HB6 A;  3VAT A;  4NGN A;  3WAB A;  2QYV A;  2PJC A;  5LRJ A;  2ZEL A;  1LAP A;  2C6G A;  3VH9 A;  1WVM A;  3PFE A;  4YU9 A;  2GLJ A;  2NYQ A;  3B2Y A;  1XFO A;  1TF8 A;  4X2T A;  2PJ0 A;  3KAS A;  5I4M A;  3I6S A;  3KQZ A;  1TKJ A;  3GUX A;  3RZA A;  2OOT A;  2ZEP A;  2EK8 A;  4Z65 A;  2CF4 A;  3H8G A;  3K2K A;  3B35 A;  4EME A;  4A39 A;  4ZX8 A;  5D8N A;  4DJL A;  1VHO A;  2O53 A;  2IMO A;  4P4F A;  3EIF A;  3HUV A;  3IWW A;  5HXD A;  1DTD A;  4NGQ A;  3L2N A;  4OC2 A;  1H8L A;  3D7F A;  2C6C A;  5K8N A;  4RUH A;  4CDK A;  4AXV A;  3KHZ A;  5LRG A;  3CPX A;  5LYL A;  4CPA A;  4P4I A;  4TJX A;  3H8F A;  3BXM A;  3FED A;  1IGB A;  4MCP A;  3FX6 A;  4H2K A;  3KI9 A;  3H8E A;  3KZW A;  3DGV A;  4UEZ A;  3B3V A;  1LAM A;  3KHX A;  1Y0Y A;  2BOA A;  1CP7 A;  3BI0 A;  5JGF A;  3MRU A;  2AFM A;  1Y9Z A;  3MN8 A;  4FUU A;  1PCA A;  2G9D A;  4C99 A;  4OC0 A;  4WWV A;  5HVG A;  1Q7L A;  4ONW A;  2PJ9 A;  2FVG A;  4MCR A;  3FMC A;  2BCO A;  4NJQ A;  1NSA A;  4C8A A;  3SJE A;  1QQ9 A;  1CX8 A;  4OME A;  4R7M A;  1TXR A;  5ELY A;  1BAV A;  4LQG A;  2AFW A;  2C1C A;  1ZG8 A;  4P44 A;  4OC4 A;  4C8C A;  2PRQ A;  1ZLH A;  4GM5 A;  4MCS A;  3RAM A;  3NFZ A;  1LOK A;  3PRT A;  1VGY A;  4KSI A;  4MHZ A;  4A38 A;  3IFE A;  4MMO A;  4Q7A A;  2AFU A;  1FT7 A;  4NJR A;  4C85 A;  8CPA A;  1VHE A;  3V7Z A;  3V38 A;  4C9R A;  2PIZ A;  2GP4 A;  1Y7E A;  4PXB A;  4WJB A;  5IR2 A;  4OC1 A;  1TF9 A;  4C84 A;  4OP4 A;  4ZYQ A;  4ZY0 A;  1CG2 A;  2RFH A;  3ICU A;  2PE3 A;  5JM6 A;  3JRU A;  1DE4 C;  3WT4 A;  6CPA A;  2V8G A;  4PPZ A;  2C5Q A;  1Z8L A;  1ELL P;  2PJB A;  5K8P A;  1F57 A;  2V8H A;  3CPA A;  3QNV A;  1ELM P;  3TC8 A;  4PXC A;  3S9N A;  3KR5 A;  2PJ2 A;  1VIX A;  5LYF A;  3PB6 X;  2IJZ A;  3VTA A;  2JBK A;  3IC1 A;  1YW4 A;  3FEC A;  3D7G A;  4PQA A;  1R3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...