2C6CA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with gpi-18431 (s)-2-(4-iodobenzylphosphonomethyl)-pentanedioic acid
Total Genus 249
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
249
sequence length
694
structure length
682
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
publication title Structure of Glutamate Carboxypeptidase II, a Drug Target in Neuronal Damage and Prostate Cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 249
structure length 682
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2c6cA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2c6cA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c6cA02
3SI2A 2PRQA 1CP6A 4EFDA 3FEDA 1UWYA 2QYVA 4YU9A 3B3CA 3IWWA 3KI9A 2PE3A 3WABA 3S9MA 2ZOFA 2V8HA 1DE4C 4OC4A 1LANA 3KR5A 2EK9A 4PPZA 3GUXA 2PIZA 2PJAA 5LYFA 2Q4ZA 2EK8A 2Q43A 4OC2A 5LRKA 3HLPA 4A94A 1HEEA 3NA6A 3ISXA 4NGTA 3V38A 3H8EA 2POKA 4MRIA 4NFRA 3D66A 3B2YA 2PJ8A 1AYEA 4R6TA 4IK2A 1XRYA 4ZY0A 4C8CA 5I4MA 5DS0A 4EWTA 2HB6A 3K9TA 4IHMA 3FVLA 3SJGA 4RUHA 2JBJA 4C85A 4C9RA 1BAVA 1YW4A 4ZX8A 3NH4A 4P4IA 1XBUA 1EE3P 1HDUA 3B3TA 4X8IA 2F7VA 1TF9A 1TXRA 3FF3A 4CDKA 1QMUA 2ZEDA 3KASA 1ELMP 2XEJA 4LQGA 3D4UA 2PIYA 4W9YA 3B7IA 3BXMA 3BHXA 1Z8LA 4DJLA 3GB0A 3VARA 3QNVA 2BOAA 3TC8A 3RAMA 2PJ3A 2ZEEA 3FH4A 4C8AA 3BI0A 1CX8A 3PB8X 4F9UA 2QVPA 3PFEA 4B6ZA 1YSJA 1Z2LA 4TNUA 2C1CA 5LYLA 3D67A 3VH9A 4KNGE 2OR4A 4ZY1A 2AFOA 2O53A 3IO1A 4NJQA 4MCQA 3MN8A 1YLOA 1BPMA 4CPAA 2AFZA 3KGQA 1ZG8A 2ABZA 1NSAA 2ANPA 2CTBA 2J9AA 2V8DA 3EIFA 2PJ7A 4K3NA 3JRUA 4BD9A 1Q7LA 1RTQA 4PQAA 4X2TA 4P44A 4PXCA 4MMOA 1ELLP 4UEFA 4OIWA 4R7MA 2ZELA 3FJUA 4ONWA 2O4HA 1ZG7A 4C9UA 4MCPA 2PCUA 5LYDA 2ZEPA 4NGPA 5K8PA 2CIJA 4A39A 1R3NA 4MHYA 3LMSA 4F9VA 1XFOA 1TKFA 3B3WA 3NFZA 2GU2A 3FX6A 3D7GA 3S9NA 4P4JA 1LAPA 1AMPA 3PB6X 4MCRA 5LRJA 5HVGA 3WT4A 3FEEA 3SJEA 4AXVA 3PRTA 1VGYA 3B3VA 2CF4A 4R8FA 4OC1A 2PJ2A 3I1UA 2XEGA 2AFSA 5HXDA 4P4BA 4G1PA 3VATA 2PJ6A 2G9DA 4JZ0A 3HUVA 1QQ9A 2C6CA 3PBEA 5F09A 2XEIA 4C9EA 1KWMA 1TKJA 4IAVA 2ZEHA 2PJ4A 1TF8A 5IB9A 2GLFA 4FWUA 3MRUA 4ZY2A 5JGFA 3T8WA 4MXUA 4TJVA 3PFOA 4TWEA 5ELYA 1JQGA 1XJOA 2C6GA 1OBRA 1F2PA 4DUKA 1F57A 1BPNA 5THWA 4A38A 1XMBA 3DLJA 2ZEOA 4C9AA 3H8FA 4OP4A 3PBBA 2V8VA 4UF4A 1Y7EA 3IC1A 3NH8A 1CPXA 2XEFA 2IMOA 1YMEA 2HC9A 4Q7AA 4C8PA 2QJ8A 4MHZA 1H8LA 3D68A 4MHPA 4MCSA 2GLJA 4A37A 1LCPA 3ISZA 1PCAA 5J1QA 2PVVA 2NSMA 2OOTA 1CBXA 1PYTB 3GLJA 2RB7A 2AFWA 2PJ5A 5JH9A 4CDJA 1FT7A 4DYOA 3SJXA 1LOKA 1CG2A 1HDQA 4C84A 2JEWA 3KR4A 3SJFA 4C8UA 4C9VA 2RFHA 2F8HA 4O23A 4P6YA 4OIDA 4P4DA 3IJ3A 3IIBA 4NGRA 1V6CA 2PJ1A 1ZLHA 4OC5A 1WVMA 4PXDA 1VHOA 3KHXA 3PB4X 3K2KA 4JYWA 4PXBA 3S9LA 1VIXA 1TKHA 3H8GA 3B35A 4EMEA 2V8GA 1YW6A 1VHEA 4YWYA 4NJRA 5HVFA 3RZAA 1ARLA 4UEEA 4R76A 2BCOA 4ZYQA 2C6PA 4OMEA 4P10A 1CP7A 4P45A 5K8OA 3KL9A 4C8TA 5JM6A 3I74A 2FVGA 4F8ZA 8CPAA 1Y0RA 5D8NA 2DEAA 2AFXA 4ZX9A 3FMCA 3KHZA 2ZEFA 3BI1A 4NGQA 2PVWA 3D7DA 4GM5A 4UIBA 4PXEA 4C99A 4H2KA 5LRGA 3KQXA 1DTDA 2IQ6A 4YN3A 2V77A 2ZENA 2PJ0A 1IGBA 3DGVA 3IFEA 4OC0A 5CBMA 2AFUA 3PB7X 1BLLE 2ZEGA 3VTAA 3WC5A 3LWUA 3WC7A 1Y0YA 4WJBA 3V7ZA 1Y9ZA 5D29A 3IEHA 5HVHA 1ARMA 5K8NA 2Q51A 1LAMA 4WWVA 2WYRA 3WC6A 3ICUA 4FUUA 2BO9A 4OKOA 3D7HA 3I6SA 1IY7A 2PJBA 1CPSA 1LFWA 4OC3A 4X3RA 3D7FA 3PB9X 1ZLIA 6CPAA 4P4FA 4C8FA 3FECA 2EWBA 4KSIA 2PJ9A 1ZG9A 4ZI6A 4MHNA 4P4EA 4TJXA 3CT9A 3CPAA 3KQZA 3PEIA 4Z65A 2WZNA 4FAIA 2GREA 4UEZA 2PJCA 7CPAA 2NYQA 2CTCA 3CDXA 4NGNA 1GYTA 3NH5A 2ZOGA 4NGMA 2VL1A 2ZEMA 5LYIA 3KZWA 3RBUA 1M4LA 2JBKA 5CPAA 3SI1A 4C86A 1FNOA 1Z5RA 3L2NA 4FBEA 3B3SA 1F2OA 1R43A 2IJZA 1XF1A 3N5FA 2AFMA 4NGSA 2I3CA 3TX8A 4UIAA 3CPXA 5K8MA 3SI0A
chains in the Genus database with same CATH superfamily
2CNTA 4LX9A 1S7KA 3SI2A 1KC7A 1MJ9A 1CP6A 2CNMA 2PRQA 3IWGA 2D4OA 3BJ8A 4EFDA 4Y49C 4KLVA 3FEDA 1UWYA 5BY0A 2QYVA 4CRYB 5A28A 4MFPA 1YREA 3B3CA 4YU9A 2J8MA 3RO0A 4A33A 4BINA 3IWWA 4HNYB 1Z4EA 2I79A 2PE3A 3KI9A 3WABA 3S9MA 5F49A 3OB1B 1EZAA 4GPLB 2ZOFA 2V8HA 1DE4C 1WK4A 5J8FA 4OC4A 1LANA 3KR5A 2EK9A 1YR0A 4UWJA 4R9MA 1ZL0A 3D2PA 4PPZA 1B87A 3GUXA 2PIZA 2R7HA 4IF5A 2Z3NA 2B0AA 4CZ1A 2PJAA 4J0NA 5LYFA 5JQ4A 2Q4ZA 4QBJA 2EK8A 4II9A 2Q43A 3HPGG 4OC2A 1IIDA 5LRKA 3HLPA 1VHSA 3RYOA 4A94A 2FE7A 1HEEA 2J8NA 2XPLA 4KOXA 4PSXA 4QUSA 3FNCA 2Q7SA 3NA6A 1Z4RA 3EC4A 3ISXA 4BBHA 4NGTA 5G20A 3BJ7A 3V38A 3K4IA 1RO5A 3H8EA 2UV8G 1P0HA 2POKA 1U6MA 4MRIA 4COGA 4NFRA 4ONUA 4MJXA 3D66A 3B2YA 3NE8A 4AG9A 3FYNA 2PJ8A 1AYEA 3VROA 4R6TA 2D0PA 2P6GA 2Q4YA 4IK2A 2FXFA 4A32A 4JWPA 1XRYA 4XPDB 4ZY0A 2DXQA 4BPWB 4C8CA 3TO7A 5I4MA 5DS0A 4EWTA 4JLYA 5F13A 3D3SA 1JDBC 3WR7A 3DR8A 2HB6A 3K9TA 3BUWB 1X12A 4JJXA 1MJBA 4IHMA 3R9GA 2G0BA 3FVLA 3SJGA 2G3TA 2JBJA 4RUHA 4C85A 3I9SA 2WPWA 4KUAA 4RN7A 3VRQA 4U9YA 5IV0A 2WUUA 3D8PA 2Z3OA 5AG5A 4C9RA 2AJ6A 1BAVA 2JEVA 4XPKA 1YW4A 4ZX8A 3NH4A 4P4IA 2G3AA 5C88A 1XBUA 1EE3P 5KTAA 1HDUA 3FBUA 4CAEA 3NE7A 1YX0A 4C7HA 3B3TA 2E28A 4X8IA 4QC6A 2F7VA 4KVXA 3ZNIA 1TF9A 1N71A 1TXRA 3FF3A 4CDKA 1QMUA 4KOUA 2ZW7A 2OH1A 2ZEDA 3KASA 5G21A 4B11A 4C2XA 3TLGB 1ELMP 1PUAA 2FSRA 4HNXB 1CJWA 4M85A 2XEJA 4JXRA 4LQGA 1Z8XA 3D4UA 2PIYA 3DNSA 4W9YA 2Z11A 2YNDA 1L0CA 2K5TA 1M4DA 3B7IA 3BXMA 3BHXA 1Z8LA 4H6ZA 4DJLA 2ZXVA 3C26A 3GB0A 3SXOA 3QB8A 1FY7A 2XPNA 1CM0A 4PK2A 2RC4A 4A4CA 3QNVA 3VARA 2BOAA 5KTDA 1YVHA 1KUXA 4CAFA 1FBVA 3TC8A 4A4BA 2GANA 4XNHC 2CBLA 3RAMA 2B58A 4F0YA 3TE4A 2VZZA 2PJ3A 2VZYA 1IOFA 2CY2A 3BI0A 5HKZA 1CX8A 2ZEEA 3DDDA 3F5BA 3FH4A 3PB8X 4MFLA 2YNCC 4I49A 2YNCA 4OLLA 1KBLA 4F9UA 4COBA 2QVPA 5K99A 3W6SA 3PFEA 1IOIA 1YSJA 4B6ZA 5AG4A 2VQYA 3IWEA 1Z2LA 4KUBA 1C3OB 5JYBA 2JDCA 2FL4A 4TNUA 5EBVA 2C1CA 3F0AA 1IU8A 5LYLA 2EZAA 4CYOA 2REFA 3D67A 3QAYA 3VH9A 4KNGE 2F5IA 2OR4A 3U88C 4CYNA 1A2ZA 2AFOA 4ZY1A 4MI1A 2O53A 2Y1NA 2DF5A 4ORFA 3IO1A 4DNCA 4M6IA 2B3VA 1XF8A 3SR3A 2Q0YA 4NJQA 4MCQA 3MN8A 1M4IA 1YLOA 1BPMA 4CPAA 2GP4A 4EYSA 2AFZA 3KGQA 1ZG8A 2ABZA 1Y9KA 3CZXA 3S6KA 3TOBA 1MJAA 1IB1E 1NSAA 2ANPA 1I1DA 4MHDA 4KORA 3TYXA 2CTBA 2J9AA 1YGHA 2V8DA 2NMTA 4R3KA 2WPXA 3EIFA 2X7BA 2PJ7A 3FXTA 4K3NA 3JRUA 4BD9A 5CNPA 1Q7LA 4FD6A 2X0SA 1RTQA 1Q2CA 4KLWA 3KRVA 2EVNA 4B14A 2Q7BA 4CS0B 4PQAA 2B4JC 4X2TA 1M6VB 4P44A 2AUMA 1YVOA 4PXCA 4MMOA 3TLCA 3IU1A 4FD5A 5DWMA 1ELLP 3NFQA 4UEFA 4OIWA 5IB0A 1RXTA 2XPPA 4R7MA 2ZELA 1YK3A 3FJUA 2O4HA 2OU2A 2PQ8A 4MFJA 4MFZA 1ZG7A 2VBQA 4MI4A 4PV6A 4MCPA 2PCUA 3MGDA 2ZEPA 5LYDA 4C9UA 4QVTA 4UCNA 4CAVA 4F6AA 4XPDC 1S3ZA 4NGPA 5K8PA 4OAEA 2CIJA 4A39A 1R3NA 4MHYA 4UFVA 1QSNA 1T36B 3GIUA 3R96A 3LMSA 4LQ6A 4FD7A 4F9VA 1VBHA 5F47A 1XFOA 2Q44A 1TKFA 3B3WA 3NFZA 1Q2DA 2GU2A 1M4GA 1X10A 3FX6A 1R61A 3D7GA 3S9NA 4P4JA 1LAPA 1A9XB 1AMPA 4MFQA 2Q04A 3PB6X 4MY0A 3D2MA 2R82A 2EBJA 5EC4A 4MCRA 5LRJA 4AVAA 4Q38A 5HVGA 3WT4A 3FEEA 3T07A 4CGNA 1NE9A 3SJEA 2PSWA 2FIAA 4AXVA 4B5PB 1VI4A 4INJA 3PLFB 3PRTA 3E0KA 5G22A 1VGYA 4IUSA 3B3VA 4IIXA 2CF4A 2H5MA 4R8FA 4XPLA 4YGOA 4OC1A 4KZTA 2ZPAA 3OB2B 1KUVA 1V0CA 4K30A 2PJ2A 4KVME 4R3LA 4CGLA 1KUYA 5ISVA 4C7IA 1UFHA 1IYKA 3I1UA 2XEGA 5AG7A 2C5QA 2AFSA 4ZBGA 4CYPA 3TLGA 2ATRA 1KZFA 2YJVA 3LD2A 2HI6A 1YQEA 5HXDA 1YLEA 5F46A 2MP0A 4P4BA 4G1PA 3VATA 4NF1A 2GE3A 3T5MA 3FB3A 2PJ6A 4U9ZA 2G9DA 4JZ0A 3TO9A 1NXJA 3B8GA 4BPUB 1GHEA 1QQ9A 3HUVA 5JVLA 2C6CA 4R87A 3PBEA 4CAXA 3H5ZA 4E0AA 5F09A 3EXNA 4E94A 2XEIA 3PP9A 5E96A 4C9EA 2N3AB 2PCNA 4HKFA 3BUMB 1KWMA 1TKJA 2PR8A 4IAVA 2ZEHA 4AVBA 2PJ4A 1TF8A 2D4PA 1MK4A 4GXHA 5IB9A 2GLFA 4FWUA 1VKCA 5AXIA 3MRUA 3OWCA 4H1HA 2Z3MA 1XEBA 3IGRA 4ZY2A 3VWEA 5JGFA 1OZPA 1Q2YA 3U1BA 4KSFA 3T8WA 4E5SA 4MXUA 4TJVA 3PFOA 4TWEA 5ELYA 1JQGA 3EO4A 1QSRA 1XJOA 4M8DA 4BPXB 2C6GA 2B5GA 1OBRA 1F2PA 2BEIA 2ODFA 5AGEA 4C8AA 1P4NA 2QIRA 5EMIA 4DUKA 3G3SA 2O28A 4KOWA 4MFKA 1PU9A 1S5KA 5H86A 3T9YA 3EZEA 3GYAA 3F9KC 1XE4A 1F57A 1BPNA 3VRNA 5THWA 4A31A 4A38A 1XMBA 4B12A 2B3UA 1LRZA 4J3GA 3DLJA 4UFXA 2ZEOA 5DWNA 3HPHE 4C9AA 3H8FA 4RS2A 4OP4A 3EZAA 3PBBA 1Y7RA 2V8VA 2Z10A 2EO8A 1Y7EA 1XMTA 4UF4A 3IC1A 2FS5A 3TCVA 3T0TA 3R9FA 2XPOA 2ARHA 2HV2A 1CPXA 3NH8A 1Z8WA 4KOVA 4RI1A 4B13A 1QSTA 5LYIA 4B10A 1BXRB 1J3LA 2XEFA 2BSWA 4UBRA 4MJ8A 3P2HA 2IMOA 2ZW5A 3V8IA 1YMEA 2HC9A 4Q7AA 4M3SA 1XIXA 1NSLA 4C8PA 1Z9UA 2QJ8A 1H8LA 1ON0A 3D68A 4JXQA 4MHZA 4UA3A 5AG6A 3VWDA 3CXQA 4MHPA 4BMHA 2ZW4A 4MCSA 2GLJA 4A37A 5JPHA 5HMNA 5BWAB 1LCPA 4B5OA 3ISZA 1PCAA 2QECA 5J1QA 2PVVA 1I12A 2NSMA 3SHPA 3TLYA 2OOTA 1CBXA 1PYTB 1IICA 3GLJA 4BTFA 2RB7A 2AFWA 1NMTA 4CGMA 4E8OA 5HH1A 2PJ5A 2PRBA 5IX3A 5JH9A 4CDJA 1FT7A 4HNWB 2JLMA 2FT0A 4C2ZA 3FIXA 2BL1A 3SJXA 1LOKA 2KCWA 4UFWA 4DYOA 5F1YA 3TLBA 1CG2A 3TLEA 3S6HA 1HDQA 4C84A 2JEWA 2Z3LA 3VRRA 3SJFA 3KR4A 3P2FA 3EFAA 4KS9A 4MY3A 1VBGA 2RFHA 4HPSA 4B5PA 3TLAA 4C8UA 4C9VA 3GKRA 4M6GA 2F8HA 4O23A 1WWZA 4LUAA 4EVYA 2I00A 1GGOA 4P6YA 1QSOA 4OIDA 3S6FA 4P4DA 3IJ3A 3IIBA 4NGRA 1V6CA 2Y0MA 2VKZG 2PJ1A 1ZLHA 3BLNA 1CE8B 1ZRSA 1JWQA 2R98A 5J3XA 4AG7A 3PGPA 4UWIA 4OC5A 1Y9WA 2GIVA 3N7ZA 1WVMA 2OLSA 4C8FA 4GS4A 3T05A 4PXDA 1VHOA 3PT1A 3DR6A 3BUXB 3KHXA 3FRMA 3PB4X 3K2KA 3R1KA 4JYWA 4PXBA 3S9LA 1VIXA 1TKHA 3H8GA 5FD8A 4H6UA 4KVOE 3B35A 4JVOA 1I21A 3TTHA 3BUOB 2B4BA 2V8GA 4EMEA 1Z8TA 2JDDA 5IR2A 4PSWA 3G23A 1YW6A 1VHEA 1R57A 4YWYA 3LACA 4NJRA 4IIYA 5HVFA 2QMLA 3UY5A 1BOBA 3RZAA 2J8RA 4E2AA 4AB7A 2PR1A 3JUWA 1ARLA 2HROA 4UEEA 4R76A 4CGOA 3S6GA 5I0CA 3HMJG 2BCOA 4ZYQA 2C6PA 1Z9EA 4OMEA 2B4DB 3H4QA 4P10A 1Q5XA 1CP7A 4P45A 5K8OA 1EZBA 3KL9A 3W91A 2FM4A 2EZCA 4C8TA 5JM6A 3I74A 2FVGA 3O8ZA 3JTKA 4F8ZA 8CPAA 1Y0RA 2WSAA 2DPTA 2Z3PA 1CS0B 2VXKA 4CO9A 1B6BA 2Z0ZA 4KOYA 5D8NA 1S7FA 2CXAA 4ONWA 4CGPA 2DEAA 2HUZA 2AFXA 2REEA 3LODA 2GFQA 4ZX9A 5A27A 5J8CA 3FMCA 3R95A 3KHZA 1WJTA 2ZEFA 5F5XA 3BI1A 4CRZB 4Y49B 1S7LA 4R57A 2D0OA 2VI7A 4NGQA 3EY5A 1K4JA 2C27A 5F9MA 4A95A 2PVWA 3D7DA 4GM5A 4UIBA 5HKYA 1BO4A 4PXEA 3JVNA 4AVCA 3OP0A 4C99A 3GY9A 4X5KA 4H2KA 5LRGA 4FD4A 3KQXA 4PK3A 1DTDA 2IQ6A 4JD6A 2A4NA 1DIKA 4YN3A 3OAKA 2V77A 5GCNA 2Z3KA 2YNEA 2ZENA 2PJ0A 3EZBA 4OADA 3TLZA 1IGBA 4MBUA 1AUGA 3CXPA 3KKWA 3PFVA 1EO0A 1YVKA 3DGVA 3IFEA 4YFJA 5KTCA 2R8VA 4OC0A 1S7NA 4L8AA 2AFUA 3PB7X 1BLLE 2ZEGA 5CBMA 3C8OA 3K9UA 1S60A 3WC5A 3VTAA 3LWUA 3WC7A 1Y0YA 4WJBA 3V7ZA 1Y9ZA 5D29A 3T90A 3IU2A 3IEHA 4L89A 3VGOA 5HVHA 4NEXA 1ARMA 4A30A 5H84A 2YJTA 5C82A 3RNZA 1C30B 1QSMA 5K8NA 1M44A 4KSAA 1J4JA 2Q51A 1LAMA 3SXNA 4WWVA 2WYRA 2BUEA 3WC6A 4C68A 3NOJA 5G1ZA 5F48A 3ICUA 2DPSA 2P6EA 4FUUA 2BO9A 4NSQA 4OKOA 2CNSA 3D7HA 3DSBA 1XOVA 2DIKA 4H89A 4YRHA 3I6SA 5HKWA 3G8WA 2PDOA 1IY7A 2DLAA 2OZUA 2Q4VA 2PJBA 1CPSA 1LFWA 3I3GA 4OC3A 4X3RA 1SQHA 3D7FA 3F8KA 4M6HA 4Q36A 3PB9X 3ZZIA 2FCKA 1ZLIA 5FVJA 1B47A 3TOAA 4C2YA 4KOSA 4P4FA 6CPAA 3FECA 2EWBA 2FIWA 3TFYA 4KSIA 2PJ9A 3PZJA 3TT2A 3QAHA 1NBWA 3GJZA 2OB0A 2EZBA 2Y1MA 1ZG9A 4ZI6A 2ZW6A 4MHNA 4CAWA 2EUIA 1M1DA 4P4EA 4TJXA 2AE6A 3CPAA 3CT9A 2OZHA 3KQZA 3PEIA 4CYQA 4Z65A 4NCZA 1ZYMA 3ZJ0A 4KOTA 1IYLA 2HWGA 2R1IA 4QB9A 2WZNA 4ZGYB 4FAIA 2GREA 4UEZA 1ZO0A 2B5GB 2PJCA 3A9LA 2P6FA 7CPAA 3VRPA 2NYQA 2CTCA 3CDXA 4NGNA 1GYTA 3NH5A 2OZGA 2ZOGA 4NGMA 2IL4A 4F0XA 2PC1A 2VL1A 2ZEMA 4U5YA 2B4DA 3KZWA 1M4LA 3RBUA 2JBKA 2HQYA 5CPAA 3TO6A 3SI1A 2YGWA 4C86A 2P0WA 3BUNB 1FNOA 1Z5RA 3L2NA 3R9EA 4FBEA 1KEEB 3B3SA 4A2ZA 1F2OA 1R43A 3CXSA 2IJZA 4NXYA 1JDEA 4RR2B 1XF1A 4UCPA 2VEZA 3N5FA 1TIQA 2AFMA 2AUNA 4UCMA 4XNHB 4NGSA 2I3CA 3TX8A 4UIAA 3CPXA 5K8MA 3SI0A 3W6XA
chains in the Genus database with same CATH topology
3SI2A 2PRQA 1CP6A 4EFDA 3FEDA 1UWYA 2QYVA 4YU9A 3B3CA 3IWWA 3KI9A 2PE3A 3WABA 3S9MA 2ZOFA 2V8HA 1DE4C 4OC4A 1LANA 3KR5A 2EK9A 4PPZA 3GUXA 2PIZA 2PJAA 5LYFA 2Q4ZA 2EK8A 2Q43A 4OC2A 5LRKA 3HLPA 4A94A 1HEEA 3NA6A 3ISXA 4NGTA 3V38A 3H8EA 2POKA 4MRIA 4NFRA 3D66A 3B2YA 2PJ8A 1AYEA 4R6TA 4IK2A 1XRYA 4ZY0A 4C8CA 5I4MA 5DS0A 4EWTA 2HB6A 3K9TA 4IHMA 3FVLA 3SJGA 4RUHA 2JBJA 4C85A 4C9RA 1BAVA 1YW4A 4ZX8A 3NH4A 4P4IA 1XBUA 1EE3P 1HDUA 3B3TA 4X8IA 2F7VA 1TF9A 1TXRA 3FF3A 4CDKA 1QMUA 2ZEDA 3KASA 1ELMP 2XEJA 4LQGA 3D4UA 2PIYA 4W9YA 3B7IA 3BXMA 3BHXA 1Z8LA 4DJLA 3GB0A 3VARA 3QNVA 2BOAA 3TC8A 3RAMA 2PJ3A 2ZEEA 3FH4A 4C8AA 3BI0A 1CX8A 3PB8X 4F9UA 2QVPA 3PFEA 4B6ZA 1YSJA 1Z2LA 4TNUA 2C1CA 5LYLA 3D67A 3VH9A 4KNGE 2OR4A 4ZY1A 2AFOA 2O53A 3IO1A 4NJQA 4MCQA 3MN8A 1YLOA 1BPMA 4CPAA 2GP4A 2AFZA 3KGQA 1ZG8A 2ABZA 1NSAA 2ANPA 2CTBA 2J9AA 2V8DA 3EIFA 2PJ7A 4K3NA 3JRUA 4BD9A 1Q7LA 1RTQA 4PQAA 4X2TA 4P44A 4PXCA 4MMOA 1ELLP 4UEFA 4OIWA 4R7MA 2ZELA 3FJUA 4ONWA 2O4HA 1ZG7A 4C9UA 4MCPA 2PCUA 5LYDA 2ZEPA 4NGPA 5K8PA 2CIJA 4A39A 1R3NA 4MHYA 3LMSA 4F9VA 1XFOA 1TKFA 3B3WA 3NFZA 2GU2A 3FX6A 3D7GA 3S9NA 4P4JA 1LAPA 1AMPA 3PB6X 4MCRA 5LRJA 5HVGA 3WT4A 3FEEA 3SJEA 4AXVA 3PRTA 1VGYA 3B3VA 2CF4A 4R8FA 4OC1A 2PJ2A 3I1UA 2C5QA 2XEGA 2AFSA 5HXDA 4P4BA 4G1PA 3VATA 2PJ6A 2G9DA 4JZ0A 3HUVA 1QQ9A 2C6CA 3PBEA 5F09A 2XEIA 4C9EA 1KWMA 1TKJA 4IAVA 2ZEHA 2PJ4A 1TF8A 5IB9A 2GLFA 4FWUA 3MRUA 4ZY2A 5JGFA 3T8WA 4MXUA 4TJVA 3PFOA 4TWEA 5ELYA 1JQGA 1XJOA 2C6GA 1OBRA 1F2PA 4DUKA 1F57A 1BPNA 5THWA 4A38A 1XMBA 3DLJA 2ZEOA 4C9AA 3H8FA 4OP4A 3PBBA 2V8VA 4UF4A 1Y7EA 3IC1A 3NH8A 1CPXA 2XEFA 2IMOA 1YMEA 2HC9A 4Q7AA 4C8PA 2QJ8A 4MHZA 1H8LA 3D68A 4MHPA 4MCSA 2GLJA 4A37A 1LCPA 3ISZA 1PCAA 5J1QA 2PVVA 2NSMA 2OOTA 1CBXA 1PYTB 3GLJA 2RB7A 2AFWA 2PJ5A 5JH9A 4CDJA 1FT7A 4DYOA 3SJXA 1LOKA 1CG2A 1HDQA 4C84A 2JEWA 3KR4A 3SJFA 4C8UA 4C9VA 2RFHA 2F8HA 4O23A 4P6YA 4OIDA 4P4DA 3IJ3A 3IIBA 4NGRA 1V6CA 2PJ1A 1ZLHA 4OC5A 1WVMA 4PXDA 1VHOA 3KHXA 3PB4X 3K2KA 4JYWA 4PXBA 3S9LA 1VIXA 1TKHA 3H8GA 3B35A 4EMEA 2V8GA 5IR2A 1YW6A 1VHEA 4YWYA 4NJRA 5HVFA 3RZAA 1ARLA 4UEEA 4R76A 2BCOA 4ZYQA 2C6PA 4OMEA 4P10A 1CP7A 4P45A 5K8OA 3KL9A 4C8TA 5JM6A 3I74A 2FVGA 4F8ZA 8CPAA 1Y0RA 5D8NA 2DEAA 2AFXA 4ZX9A 3FMCA 3KHZA 2ZEFA 3BI1A 4NGQA 2PVWA 3D7DA 4GM5A 4UIBA 4PXEA 4C99A 4H2KA 5LRGA 3KQXA 1DTDA 2IQ6A 4YN3A 2V77A 2ZENA 2PJ0A 1IGBA 3DGVA 3IFEA 4OC0A 5CBMA 2AFUA 3PB7X 1BLLE 2ZEGA 3VTAA 3WC5A 3LWUA 3WC7A 1Y0YA 4WJBA 3V7ZA 1Y9ZA 5D29A 3IEHA 5HVHA 1ARMA 5K8NA 2Q51A 1LAMA 4WWVA 2WYRA 3WC6A 3ICUA 4FUUA 2BO9A 4OKOA 3D7HA 3I6SA 1IY7A 2PJBA 1CPSA 1LFWA 4OC3A 4X3RA 3D7FA 3PB9X 1ZLIA 6CPAA 4P4FA 4C8FA 3FECA 2EWBA 4KSIA 2PJ9A 1ZG9A 4ZI6A 4MHNA 4P4EA 4TJXA 3CT9A 3CPAA 3KQZA 3PEIA 4Z65A 2WZNA 4FAIA 2GREA 4UEZA 2PJCA 7CPAA 2NYQA 2CTCA 3CDXA 4NGNA 1GYTA 3NH5A 2ZOGA 4NGMA 2VL1A 2ZEMA 5LYIA 3KZWA 3RBUA 1M4LA 2JBKA 5CPAA 3SI1A 4C86A 1FNOA 1Z5RA 3L2NA 4FBEA 3B3SA 1F2OA 1R43A 2IJZA 1XF1A 3N5FA 2AFMA 4NGSA 2I3CA 3TX8A 4UIAA 3CPXA 5K8MA 3SI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SI2 A;  2PRQ A;  1CP6 A;  4EFD A;  3FED A;  1UWY A;  2QYV A;  4YU9 A;  3B3C A;  3IWW A;  3KI9 A;  2PE3 A;  3WAB A;  3S9M A;  2ZOF A;  2V8H A;  1DE4 C;  4OC4 A;  1LAN A;  3KR5 A;  2EK9 A;  4PPZ A;  3GUX A;  2PIZ A;  2PJA A;  5LYF A;  2Q4Z A;  2EK8 A;  2Q43 A;  4OC2 A;  5LRK A;  3HLP A;  4A94 A;  1HEE A;  3NA6 A;  3ISX A;  4NGT A;  3V38 A;  3H8E A;  2POK A;  4MRI A;  4NFR A;  3D66 A;  3B2Y A;  2PJ8 A;  1AYE A;  4R6T A;  4IK2 A;  1XRY A;  4ZY0 A;  4C8C A;  5I4M A;  5DS0 A;  4EWT A;  2HB6 A;  3K9T A;  4IHM A;  3FVL A;  3SJG A;  4RUH A;  2JBJ A;  4C85 A;  4C9R A;  1BAV A;  1YW4 A;  4ZX8 A;  3NH4 A;  4P4I A;  1XBU A;  1EE3 P;  1HDU A;  3B3T A;  4X8I A;  2F7V A;  1TF9 A;  1TXR A;  3FF3 A;  4CDK A;  1QMU A;  2ZED A;  3KAS A;  1ELM P;  2XEJ A;  4LQG A;  3D4U A;  2PIY A;  4W9Y A;  3B7I A;  3BXM A;  3BHX A;  1Z8L A;  4DJL A;  3GB0 A;  3VAR A;  3QNV A;  2BOA A;  3TC8 A;  3RAM A;  2PJ3 A;  2ZEE A;  3FH4 A;  4C8A A;  3BI0 A;  1CX8 A;  3PB8 X;  4F9U A;  2QVP A;  3PFE A;  4B6Z A;  1YSJ A;  1Z2L A;  4TNU A;  2C1C A;  5LYL A;  3D67 A;  3VH9 A;  4KNG E;  2OR4 A;  4ZY1 A;  2AFO A;  2O53 A;  3IO1 A;  4NJQ A;  4MCQ A;  3MN8 A;  1YLO A;  1BPM A;  4CPA A;  2AFZ A;  3KGQ A;  1ZG8 A;  2ABZ A;  1NSA A;  2ANP A;  2CTB A;  2J9A A;  2V8D A;  3EIF A;  2PJ7 A;  4K3N A;  3JRU A;  4BD9 A;  1Q7L A;  1RTQ A;  4PQA A;  4X2T A;  4P44 A;  4PXC A;  4MMO A;  1ELL P;  4UEF A;  4OIW A;  4R7M A;  2ZEL A;  3FJU A;  4ONW A;  2O4H A;  1ZG7 A;  4C9U A;  4MCP A;  2PCU A;  5LYD A;  2ZEP A;  4NGP A;  5K8P A;  2CIJ A;  4A39 A;  1R3N A;  4MHY A;  3LMS A;  4F9V A;  1XFO A;  1TKF A;  3B3W A;  3NFZ A;  2GU2 A;  3FX6 A;  3D7G A;  3S9N A;  4P4J A;  1LAP A;  1AMP A;  3PB6 X;  4MCR A;  5LRJ A;  5HVG A;  3WT4 A;  3FEE A;  3SJE A;  4AXV A;  3PRT A;  1VGY A;  3B3V A;  2CF4 A;  4R8F A;  4OC1 A;  2PJ2 A;  3I1U A;  2XEG A;  2AFS A;  5HXD A;  4P4B A;  4G1P A;  3VAT A;  2PJ6 A;  2G9D A;  4JZ0 A;  3HUV A;  1QQ9 A;  2C6C A;  3PBE A;  5F09 A;  2XEI A;  4C9E A;  1KWM A;  1TKJ A;  4IAV A;  2ZEH A;  2PJ4 A;  1TF8 A;  5IB9 A;  2GLF A;  4FWU A;  3MRU A;  4ZY2 A;  5JGF A;  3T8W A;  4MXU A;  4TJV A;  3PFO A;  4TWE A;  5ELY A;  1JQG A;  1XJO A;  2C6G A;  1OBR A;  1F2P A;  4DUK A;  1F57 A;  1BPN A;  5THW A;  4A38 A;  1XMB A;  3DLJ A;  2ZEO A;  4C9A A;  3H8F A;  4OP4 A;  3PBB A;  2V8V A;  4UF4 A;  1Y7E A;  3IC1 A;  3NH8 A;  1CPX A;  2XEF A;  2IMO A;  1YME A;  2HC9 A;  4Q7A A;  4C8P A;  2QJ8 A;  4MHZ A;  1H8L A;  3D68 A;  4MHP A;  4MCS A;  2GLJ A;  4A37 A;  1LCP A;  3ISZ A;  1PCA A;  5J1Q A;  2PVV A;  2NSM A;  2OOT A;  1CBX A;  1PYT B;  3GLJ A;  2RB7 A;  2AFW A;  2PJ5 A;  5JH9 A;  4CDJ A;  1FT7 A;  4DYO A;  3SJX A;  1LOK A;  1CG2 A;  1HDQ A;  4C84 A;  2JEW A;  3KR4 A;  3SJF A;  4C8U A;  4C9V A;  2RFH A;  2F8H A;  4O23 A;  4P6Y A;  4OID A;  4P4D A;  3IJ3 A;  3IIB A;  4NGR A;  1V6C A;  2PJ1 A;  1ZLH A;  4OC5 A;  1WVM A;  4PXD A;  1VHO A;  3KHX A;  3PB4 X;  3K2K A;  4JYW A;  4PXB A;  3S9L A;  1VIX A;  1TKH A;  3H8G A;  3B35 A;  4EME A;  2V8G A;  1YW6 A;  1VHE A;  4YWY A;  4NJR A;  5HVF A;  3RZA A;  1ARL A;  4UEE A;  4R76 A;  2BCO A;  4ZYQ A;  2C6P A;  4OME A;  4P10 A;  1CP7 A;  4P45 A;  5K8O A;  3KL9 A;  4C8T A;  5JM6 A;  3I74 A;  2FVG A;  4F8Z A;  8CPA A;  1Y0R A;  5D8N A;  2DEA A;  2AFX A;  4ZX9 A;  3FMC A;  3KHZ A;  2ZEF A;  3BI1 A;  4NGQ A;  2PVW A;  3D7D A;  4GM5 A;  4UIB A;  4PXE A;  4C99 A;  4H2K A;  5LRG A;  3KQX A;  1DTD A;  2IQ6 A;  4YN3 A;  2V77 A;  2ZEN A;  2PJ0 A;  1IGB A;  3DGV A;  3IFE A;  4OC0 A;  5CBM A;  2AFU A;  3PB7 X;  1BLL E;  2ZEG A;  3VTA A;  3WC5 A;  3LWU A;  3WC7 A;  1Y0Y A;  4WJB A;  3V7Z A;  1Y9Z A;  5D29 A;  3IEH A;  5HVH A;  1ARM A;  5K8N A;  2Q51 A;  1LAM A;  4WWV A;  2WYR A;  3WC6 A;  3ICU A;  4FUU A;  2BO9 A;  4OKO A;  3D7H A;  3I6S A;  1IY7 A;  2PJB A;  1CPS A;  1LFW A;  4OC3 A;  4X3R A;  3D7F A;  3PB9 X;  1ZLI A;  6CPA A;  4P4F A;  4C8F A;  3FEC A;  2EWB A;  4KSI A;  2PJ9 A;  1ZG9 A;  4ZI6 A;  4MHN A;  4P4E A;  4TJX A;  3CT9 A;  3CPA A;  3KQZ A;  3PEI A;  4Z65 A;  2WZN A;  4FAI A;  2GRE A;  4UEZ A;  2PJC A;  7CPA A;  2NYQ A;  2CTC A;  3CDX A;  4NGN A;  1GYT A;  3NH5 A;  2ZOG A;  4NGM A;  2VL1 A;  2ZEM A;  5LYI A;  3KZW A;  3RBU A;  1M4L A;  2JBK A;  5CPA A;  3SI1 A;  4C86 A;  1FNO A;  1Z5R A;  3L2N A;  4FBE A;  3B3S A;  1F2O A;  1R43 A;  2IJZ A;  1XF1 A;  3N5F A;  2AFM A;  4NGS A;  2I3C A;  3TX8 A;  4UIA A;  3CPX A;  5K8M A;  3SI0 A; 
#chains in the Genus database with same CATH topology
 2CNT A;  4LX9 A;  1S7K A;  3SI2 A;  1KC7 A;  1MJ9 A;  1CP6 A;  2CNM A;  2PRQ A;  3IWG A;  2D4O A;  3BJ8 A;  4EFD A;  4Y49 C;  4KLV A;  3FED A;  1UWY A;  5BY0 A;  2QYV A;  4CRY B;  5A28 A;  4MFP A;  1YRE A;  3B3C A;  4YU9 A;  2J8M A;  3RO0 A;  4A33 A;  4BIN A;  3IWW A;  4HNY B;  1Z4E A;  2I79 A;  2PE3 A;  3KI9 A;  3WAB A;  3S9M A;  5F49 A;  3OB1 B;  1EZA A;  4GPL B;  2ZOF A;  2V8H A;  1DE4 C;  1WK4 A;  5J8F A;  4OC4 A;  1LAN A;  3KR5 A;  2EK9 A;  1YR0 A;  4UWJ A;  4R9M A;  1ZL0 A;  3D2P A;  4PPZ A;  1B87 A;  3GUX A;  2PIZ A;  2R7H A;  4IF5 A;  2Z3N A;  2B0A A;  4CZ1 A;  2PJA A;  4J0N A;  5LYF A;  5JQ4 A;  2Q4Z A;  4QBJ A;  2EK8 A;  4II9 A;  2Q43 A;  3HPG G;  4OC2 A;  1IID A;  5LRK A;  3HLP A;  1VHS A;  3RYO A;  4A94 A;  2FE7 A;  1HEE A;  2J8N A;  2XPL A;  4KOX A;  4PSX A;  4QUS A;  3FNC A;  2Q7S A;  3NA6 A;  1Z4R A;  3EC4 A;  3ISX A;  4BBH A;  4NGT A;  5G20 A;  3BJ7 A;  3V38 A;  3K4I A;  1RO5 A;  3H8E A;  2UV8 G;  1P0H A;  2POK A;  1U6M A;  4MRI A;  4COG A;  4NFR A;  4ONU A;  4MJX A;  3D66 A;  3B2Y A;  3NE8 A;  4AG9 A;  3FYN A;  2PJ8 A;  1AYE A;  3VRO A;  4R6T A;  2D0P A;  2P6G A;  2Q4Y A;  4IK2 A;  2FXF A;  4A32 A;  4JWP A;  1XRY A;  4XPD B;  4ZY0 A;  2DXQ A;  4BPW B;  4C8C A;  3TO7 A;  5I4M A;  5DS0 A;  4EWT A;  4JLY A;  5F13 A;  3D3S A;  1JDB C;  3WR7 A;  3DR8 A;  2HB6 A;  3K9T A;  3BUW B;  1X12 A;  4JJX A;  1MJB A;  4IHM A;  3R9G A;  2G0B A;  3FVL A;  3SJG A;  2G3T A;  2JBJ A;  4RUH A;  4C85 A;  3I9S A;  2WPW A;  4KUA A;  4RN7 A;  3VRQ A;  4U9Y A;  5IV0 A;  2WUU A;  3D8P A;  2Z3O A;  5AG5 A;  4C9R A;  2AJ6 A;  1BAV A;  2JEV A;  4XPK A;  1YW4 A;  4ZX8 A;  3NH4 A;  4P4I A;  2G3A A;  5C88 A;  1XBU A;  1EE3 P;  5KTA A;  1HDU A;  3FBU A;  4CAE A;  3NE7 A;  1YX0 A;  4C7H A;  3B3T A;  2E28 A;  4X8I A;  4QC6 A;  2F7V A;  4KVX A;  3ZNI A;  1TF9 A;  1N71 A;  1TXR A;  3FF3 A;  4CDK A;  1QMU A;  4KOU A;  2ZW7 A;  2OH1 A;  2ZED A;  3KAS A;  5G21 A;  4B11 A;  4C2X A;  3TLG B;  1ELM P;  1PUA A;  2FSR A;  4HNX B;  1CJW A;  4M85 A;  2XEJ A;  4JXR A;  4LQG A;  1Z8X A;  3D4U A;  2PIY A;  3DNS A;  4W9Y A;  2Z11 A;  2YND A;  1L0C A;  2K5T A;  1M4D A;  3B7I A;  3BXM A;  3BHX A;  1Z8L A;  4H6Z A;  4DJL A;  2ZXV A;  3C26 A;  3GB0 A;  3SXO A;  3QB8 A;  1FY7 A;  2XPN A;  1CM0 A;  4PK2 A;  2RC4 A;  4A4C A;  3QNV A;  3VAR A;  2BOA A;  5KTD A;  1YVH A;  1KUX A;  4CAF A;  1FBV A;  3TC8 A;  4A4B A;  2GAN A;  4XNH C;  2CBL A;  3RAM A;  2B58 A;  4F0Y A;  3TE4 A;  2VZZ A;  2PJ3 A;  2VZY A;  1IOF A;  2CY2 A;  3BI0 A;  5HKZ A;  1CX8 A;  2ZEE A;  3DDD A;  3F5B A;  3FH4 A;  3PB8 X;  4MFL A;  2YNC C;  4I49 A;  2YNC A;  4OLL A;  1KBL A;  4F9U A;  4COB A;  2QVP A;  5K99 A;  3W6S A;  3PFE A;  1IOI A;  1YSJ A;  4B6Z A;  5AG4 A;  2VQY A;  3IWE A;  1Z2L A;  4KUB A;  1C3O B;  5JYB A;  2JDC A;  2FL4 A;  4TNU A;  5EBV A;  2C1C A;  3F0A A;  1IU8 A;  5LYL A;  2EZA A;  4CYO A;  2REF A;  3D67 A;  3QAY A;  3VH9 A;  4KNG E;  2F5I A;  2OR4 A;  3U88 C;  4CYN A;  1A2Z A;  2AFO A;  4ZY1 A;  4MI1 A;  2O53 A;  2Y1N A;  2DF5 A;  4ORF A;  3IO1 A;  4DNC A;  4M6I A;  2B3V A;  1XF8 A;  3SR3 A;  2Q0Y A;  4NJQ A;  4MCQ A;  3MN8 A;  1M4I A;  1YLO A;  1BPM A;  4CPA A;  2GP4 A;  4EYS A;  2AFZ A;  3KGQ A;  1ZG8 A;  2ABZ A;  1Y9K A;  3CZX A;  3S6K A;  3TOB A;  1MJA A;  1IB1 E;  1NSA A;  2ANP A;  1I1D A;  4MHD A;  4KOR A;  3TYX A;  2CTB A;  2J9A A;  1YGH A;  2V8D A;  2NMT A;  4R3K A;  2WPX A;  3EIF A;  2X7B A;  2PJ7 A;  3FXT A;  4K3N A;  3JRU A;  4BD9 A;  5CNP A;  1Q7L A;  4FD6 A;  2X0S A;  1RTQ A;  1Q2C A;  4KLW A;  3KRV A;  2EVN A;  4B14 A;  2Q7B A;  4CS0 B;  4PQA A;  2B4J C;  4X2T A;  1M6V B;  4P44 A;  2AUM A;  1YVO A;  4PXC A;  4MMO A;  3TLC A;  3IU1 A;  4FD5 A;  5DWM A;  1ELL P;  3NFQ A;  4UEF A;  4OIW A;  5IB0 A;  1RXT A;  2XPP A;  4R7M A;  2ZEL A;  1YK3 A;  3FJU A;  2O4H A;  2OU2 A;  2PQ8 A;  4MFJ A;  4MFZ A;  1ZG7 A;  2VBQ A;  4MI4 A;  4PV6 A;  4MCP A;  2PCU A;  3MGD A;  2ZEP A;  5LYD A;  4C9U A;  4QVT A;  4UCN A;  4CAV A;  4F6A A;  4XPD C;  1S3Z A;  4NGP A;  5K8P A;  4OAE A;  2CIJ A;  4A39 A;  1R3N A;  4MHY A;  4UFV A;  1QSN A;  1T36 B;  3GIU A;  3R96 A;  3LMS A;  4LQ6 A;  4FD7 A;  4F9V A;  1VBH A;  5F47 A;  1XFO A;  2Q44 A;  1TKF A;  3B3W A;  3NFZ A;  1Q2D A;  2GU2 A;  1M4G A;  1X10 A;  3FX6 A;  1R61 A;  3D7G A;  3S9N A;  4P4J A;  1LAP A;  1A9X B;  1AMP A;  4MFQ A;  2Q04 A;  3PB6 X;  4MY0 A;  3D2M A;  2R82 A;  2EBJ A;  5EC4 A;  4MCR A;  5LRJ A;  4AVA A;  4Q38 A;  5HVG A;  3WT4 A;  3FEE A;  3T07 A;  4CGN A;  1NE9 A;  3SJE A;  2PSW A;  2FIA A;  4AXV A;  4B5P B;  1VI4 A;  4INJ A;  3PLF B;  3PRT A;  3E0K A;  5G22 A;  1VGY A;  4IUS A;  3B3V A;  4IIX A;  2CF4 A;  2H5M A;  4R8F A;  4XPL A;  4YGO A;  4OC1 A;  4KZT A;  2ZPA A;  3OB2 B;  1KUV A;  1V0C A;  4K30 A;  2PJ2 A;  4KVM E;  4R3L A;  4CGL A;  1KUY A;  5ISV A;  4C7I A;  1UFH A;  1IYK A;  3I1U A;  2XEG A;  5AG7 A;  2C5Q A;  2AFS A;  4ZBG A;  4CYP A;  3TLG A;  2ATR A;  1KZF A;  2YJV A;  3LD2 A;  2HI6 A;  1YQE A;  5HXD A;  1YLE A;  5F46 A;  2MP0 A;  4P4B A;  4G1P A;  3VAT A;  4NF1 A;  2GE3 A;  3T5M A;  3FB3 A;  2PJ6 A;  4U9Z A;  2G9D A;  4JZ0 A;  3TO9 A;  1NXJ A;  3B8G A;  4BPU B;  1GHE A;  1QQ9 A;  3HUV A;  5JVL A;  2C6C A;  4R87 A;  3PBE A;  4CAX A;  3H5Z A;  4E0A A;  5F09 A;  3EXN A;  4E94 A;  2XEI A;  3PP9 A;  5E96 A;  4C9E A;  2N3A B;  2PCN A;  4HKF A;  3BUM B;  1KWM A;  1TKJ A;  2PR8 A;  4IAV A;  2ZEH A;  4AVB A;  2PJ4 A;  1TF8 A;  2D4P A;  1MK4 A;  4GXH A;  5IB9 A;  2GLF A;  4FWU A;  1VKC A;  5AXI A;  3MRU A;  3OWC A;  4H1H A;  2Z3M A;  1XEB A;  3IGR A;  4ZY2 A;  3VWE A;  5JGF A;  1OZP A;  1Q2Y A;  3U1B A;  4KSF A;  3T8W A;  4E5S A;  4MXU A;  4TJV A;  3PFO A;  4TWE A;  5ELY A;  1JQG A;  3EO4 A;  1QSR A;  1XJO A;  4M8D A;  4BPX B;  2C6G A;  2B5G A;  1OBR A;  1F2P A;  2BEI A;  2ODF A;  5AGE A;  4C8A A;  1P4N A;  2QIR A;  5EMI A;  4DUK A;  3G3S A;  2O28 A;  4KOW A;  4MFK A;  1PU9 A;  1S5K A;  5H86 A;  3T9Y A;  3EZE A;  3GYA A;  3F9K C;  1XE4 A;  1F57 A;  1BPN A;  3VRN A;  5THW A;  4A31 A;  4A38 A;  1XMB A;  4B12 A;  2B3U A;  1LRZ A;  4J3G A;  3DLJ A;  4UFX A;  2ZEO A;  5DWN A;  3HPH E;  4C9A A;  3H8F A;  4RS2 A;  4OP4 A;  3EZA A;  3PBB A;  1Y7R A;  2V8V A;  2Z10 A;  2EO8 A;  1Y7E A;  1XMT A;  4UF4 A;  3IC1 A;  2FS5 A;  3TCV A;  3T0T A;  3R9F A;  2XPO A;  2ARH A;  2HV2 A;  1CPX A;  3NH8 A;  1Z8W A;  4KOV A;  4RI1 A;  4B13 A;  1QST A;  5LYI A;  4B10 A;  1BXR B;  1J3L A;  2XEF A;  2BSW A;  4UBR A;  4MJ8 A;  3P2H A;  2IMO A;  2ZW5 A;  3V8I A;  1YME A;  2HC9 A;  4Q7A A;  4M3S A;  1XIX A;  1NSL A;  4C8P A;  1Z9U A;  2QJ8 A;  1H8L A;  1ON0 A;  3D68 A;  4JXQ A;  4MHZ A;  4UA3 A;  5AG6 A;  3VWD A;  3CXQ A;  4MHP A;  4BMH A;  2ZW4 A;  4MCS A;  2GLJ A;  4A37 A;  5JPH A;  5HMN A;  5BWA B;  1LCP A;  4B5O A;  3ISZ A;  1PCA A;  2QEC A;  5J1Q A;  2PVV A;  1I12 A;  2NSM A;  3SHP A;  3TLY A;  2OOT A;  1CBX A;  1PYT B;  1IIC A;  3GLJ A;  4BTF A;  2RB7 A;  2AFW A;  1NMT A;  4CGM A;  4E8O A;  5HH1 A;  2PJ5 A;  2PRB A;  5IX3 A;  5JH9 A;  4CDJ A;  1FT7 A;  4HNW B;  2JLM A;  2FT0 A;  4C2Z A;  3FIX A;  2BL1 A;  3SJX A;  1LOK A;  2KCW A;  4UFW A;  4DYO A;  5F1Y A;  3TLB A;  1CG2 A;  3TLE A;  3S6H A;  1HDQ A;  4C84 A;  2JEW A;  2Z3L A;  3VRR A;  3SJF A;  3KR4 A;  3P2F A;  3EFA A;  4KS9 A;  4MY3 A;  1VBG A;  2RFH A;  4HPS A;  4B5P A;  3TLA A;  4C8U A;  4C9V A;  3GKR A;  4M6G A;  2F8H A;  4O23 A;  1WWZ A;  4LUA A;  4EVY A;  2I00 A;  1GGO A;  4P6Y A;  1QSO A;  4OID A;  3S6F A;  4P4D A;  3IJ3 A;  3IIB A;  4NGR A;  1V6C A;  2Y0M A;  2VKZ G;  2PJ1 A;  1ZLH A;  3BLN A;  1CE8 B;  1ZRS A;  1JWQ A;  2R98 A;  5J3X A;  4AG7 A;  3PGP A;  4UWI A;  4OC5 A;  1Y9W A;  2GIV A;  3N7Z A;  1WVM A;  2OLS A;  4C8F A;  4GS4 A;  3T05 A;  4PXD A;  1VHO A;  3PT1 A;  3DR6 A;  3BUX B;  3KHX A;  3FRM A;  3PB4 X;  3K2K A;  3R1K A;  4JYW A;  4PXB A;  3S9L A;  1VIX A;  1TKH A;  3H8G A;  5FD8 A;  4H6U A;  4KVO E;  3B35 A;  4JVO A;  1I21 A;  3TTH A;  3BUO B;  2B4B A;  2V8G A;  4EME A;  1Z8T A;  2JDD A;  5IR2 A;  4PSW A;  3G23 A;  1YW6 A;  1VHE A;  1R57 A;  4YWY A;  3LAC A;  4NJR A;  4IIY A;  5HVF A;  2QML A;  3UY5 A;  1BOB A;  3RZA A;  2J8R A;  4E2A A;  4AB7 A;  2PR1 A;  3JUW A;  1ARL A;  2HRO A;  4UEE A;  4R76 A;  4CGO A;  3S6G A;  5I0C A;  3HMJ G;  2BCO A;  4ZYQ A;  2C6P A;  1Z9E A;  4OME A;  2B4D B;  3H4Q A;  4P10 A;  1Q5X A;  1CP7 A;  4P45 A;  5K8O A;  1EZB A;  3KL9 A;  3W91 A;  2FM4 A;  2EZC A;  4C8T A;  5JM6 A;  3I74 A;  2FVG A;  3O8Z A;  3JTK A;  4F8Z A;  8CPA A;  1Y0R A;  2WSA A;  2DPT A;  2Z3P A;  1CS0 B;  2VXK A;  4CO9 A;  1B6B A;  2Z0Z A;  4KOY A;  5D8N A;  1S7F A;  2CXA A;  4ONW A;  4CGP A;  2DEA A;  2HUZ A;  2AFX A;  2REE A;  3LOD A;  2GFQ A;  4ZX9 A;  5A27 A;  5J8C A;  3FMC A;  3R95 A;  3KHZ A;  1WJT A;  2ZEF A;  5F5X A;  3BI1 A;  4CRZ B;  4Y49 B;  1S7L A;  4R57 A;  2D0O A;  2VI7 A;  4NGQ A;  3EY5 A;  1K4J A;  2C27 A;  5F9M A;  4A95 A;  2PVW A;  3D7D A;  4GM5 A;  4UIB A;  5HKY A;  1BO4 A;  4PXE A;  3JVN A;  4AVC A;  3OP0 A;  4C99 A;  3GY9 A;  4X5K A;  4H2K A;  5LRG A;  4FD4 A;  3KQX A;  4PK3 A;  1DTD A;  2IQ6 A;  4JD6 A;  2A4N A;  1DIK A;  4YN3 A;  3OAK A;  2V77 A;  5GCN A;  2Z3K A;  2YNE A;  2ZEN A;  2PJ0 A;  3EZB A;  4OAD A;  3TLZ A;  1IGB A;  4MBU A;  1AUG A;  3CXP A;  3KKW A;  3PFV A;  1EO0 A;  1YVK A;  3DGV A;  3IFE A;  4YFJ A;  5KTC A;  2R8V A;  4OC0 A;  1S7N A;  4L8A A;  2AFU A;  3PB7 X;  1BLL E;  2ZEG A;  5CBM A;  3C8O A;  3K9U A;  1S60 A;  3WC5 A;  3VTA A;  3LWU A;  3WC7 A;  1Y0Y A;  4WJB A;  3V7Z A;  1Y9Z A;  5D29 A;  3T90 A;  3IU2 A;  3IEH A;  4L89 A;  3VGO A;  5HVH A;  4NEX A;  1ARM A;  4A30 A;  5H84 A;  2YJT A;  5C82 A;  3RNZ A;  1C30 B;  1QSM A;  5K8N A;  1M44 A;  4KSA A;  1J4J A;  2Q51 A;  1LAM A;  3SXN A;  4WWV A;  2WYR A;  2BUE A;  3WC6 A;  4C68 A;  3NOJ A;  5G1Z A;  5F48 A;  3ICU A;  2DPS A;  2P6E A;  4FUU A;  2BO9 A;  4NSQ A;  4OKO A;  2CNS A;  3D7H A;  3DSB A;  1XOV A;  2DIK A;  4H89 A;  4YRH A;  3I6S A;  5HKW A;  3G8W A;  2PDO A;  1IY7 A;  2DLA A;  2OZU A;  2Q4V A;  2PJB A;  1CPS A;  1LFW A;  3I3G A;  4OC3 A;  4X3R A;  1SQH A;  3D7F A;  3F8K A;  4M6H A;  4Q36 A;  3PB9 X;  3ZZI A;  2FCK A;  1ZLI A;  5FVJ A;  1B47 A;  3TOA A;  4C2Y A;  4KOS A;  4P4F A;  6CPA A;  3FEC A;  2EWB A;  2FIW A;  3TFY A;  4KSI A;  2PJ9 A;  3PZJ A;  3TT2 A;  3QAH A;  1NBW A;  3GJZ A;  2OB0 A;  2EZB A;  2Y1M A;  1ZG9 A;  4ZI6 A;  2ZW6 A;  4MHN A;  4CAW A;  2EUI A;  1M1D A;  4P4E A;  4TJX A;  2AE6 A;  3CPA A;  3CT9 A;  2OZH A;  3KQZ A;  3PEI A;  4CYQ A;  4Z65 A;  4NCZ A;  1ZYM A;  3ZJ0 A;  4KOT A;  1IYL A;  2HWG A;  2R1I A;  4QB9 A;  2WZN A;  4ZGY B;  4FAI A;  2GRE A;  4UEZ A;  1ZO0 A;  2B5G B;  2PJC A;  3A9L A;  2P6F A;  7CPA A;  3VRP A;  2NYQ A;  2CTC A;  3CDX A;  4NGN A;  1GYT A;  3NH5 A;  2OZG A;  2ZOG A;  4NGM A;  2IL4 A;  4F0X A;  2PC1 A;  2VL1 A;  2ZEM A;  4U5Y A;  2B4D A;  3KZW A;  1M4L A;  3RBU A;  2JBK A;  2HQY A;  5CPA A;  3TO6 A;  3SI1 A;  2YGW A;  4C86 A;  2P0W A;  3BUN B;  1FNO A;  1Z5R A;  3L2N A;  3R9E A;  4FBE A;  1KEE B;  3B3S A;  4A2Z A;  1F2O A;  1R43 A;  3CXS A;  2IJZ A;  4NXY A;  1JDE A;  4RR2 B;  1XF1 A;  4UCP A;  2VEZ A;  3N5F A;  1TIQ A;  2AFM A;  2AUN A;  4UCM A;  4XNH B;  4NGS A;  2I3C A;  3TX8 A;  4UIA A;  3CPX A;  5K8M A;  3SI0 A;  3W6X A; 
#chains in the Genus database with same CATH homology
 3SI2 A;  2PRQ A;  1CP6 A;  4EFD A;  3FED A;  1UWY A;  2QYV A;  4YU9 A;  3B3C A;  3IWW A;  3KI9 A;  2PE3 A;  3WAB A;  3S9M A;  2ZOF A;  2V8H A;  1DE4 C;  4OC4 A;  1LAN A;  3KR5 A;  2EK9 A;  4PPZ A;  3GUX A;  2PIZ A;  2PJA A;  5LYF A;  2Q4Z A;  2EK8 A;  2Q43 A;  4OC2 A;  5LRK A;  3HLP A;  4A94 A;  1HEE A;  3NA6 A;  3ISX A;  4NGT A;  3V38 A;  3H8E A;  2POK A;  4MRI A;  4NFR A;  3D66 A;  3B2Y A;  2PJ8 A;  1AYE A;  4R6T A;  4IK2 A;  1XRY A;  4ZY0 A;  4C8C A;  5I4M A;  5DS0 A;  4EWT A;  2HB6 A;  3K9T A;  4IHM A;  3FVL A;  3SJG A;  4RUH A;  2JBJ A;  4C85 A;  4C9R A;  1BAV A;  1YW4 A;  4ZX8 A;  3NH4 A;  4P4I A;  1XBU A;  1EE3 P;  1HDU A;  3B3T A;  4X8I A;  2F7V A;  1TF9 A;  1TXR A;  3FF3 A;  4CDK A;  1QMU A;  2ZED A;  3KAS A;  1ELM P;  2XEJ A;  4LQG A;  3D4U A;  2PIY A;  4W9Y A;  3B7I A;  3BXM A;  3BHX A;  1Z8L A;  4DJL A;  3GB0 A;  3VAR A;  3QNV A;  2BOA A;  3TC8 A;  3RAM A;  2PJ3 A;  2ZEE A;  3FH4 A;  4C8A A;  3BI0 A;  1CX8 A;  3PB8 X;  4F9U A;  2QVP A;  3PFE A;  4B6Z A;  1YSJ A;  1Z2L A;  4TNU A;  2C1C A;  5LYL A;  3D67 A;  3VH9 A;  4KNG E;  2OR4 A;  4ZY1 A;  2AFO A;  2O53 A;  3IO1 A;  4NJQ A;  4MCQ A;  3MN8 A;  1YLO A;  1BPM A;  4CPA A;  2GP4 A;  2AFZ A;  3KGQ A;  1ZG8 A;  2ABZ A;  1NSA A;  2ANP A;  2CTB A;  2J9A A;  2V8D A;  3EIF A;  2PJ7 A;  4K3N A;  3JRU A;  4BD9 A;  1Q7L A;  1RTQ A;  4PQA A;  4X2T A;  4P44 A;  4PXC A;  4MMO A;  1ELL P;  4UEF A;  4OIW A;  4R7M A;  2ZEL A;  3FJU A;  4ONW A;  2O4H A;  1ZG7 A;  4C9U A;  4MCP A;  2PCU A;  5LYD A;  2ZEP A;  4NGP A;  5K8P A;  2CIJ A;  4A39 A;  1R3N A;  4MHY A;  3LMS A;  4F9V A;  1XFO A;  1TKF A;  3B3W A;  3NFZ A;  2GU2 A;  3FX6 A;  3D7G A;  3S9N A;  4P4J A;  1LAP A;  1AMP A;  3PB6 X;  4MCR A;  5LRJ A;  5HVG A;  3WT4 A;  3FEE A;  3SJE A;  4AXV A;  3PRT A;  1VGY A;  3B3V A;  2CF4 A;  4R8F A;  4OC1 A;  2PJ2 A;  3I1U A;  2C5Q A;  2XEG A;  2AFS A;  5HXD A;  4P4B A;  4G1P A;  3VAT A;  2PJ6 A;  2G9D A;  4JZ0 A;  3HUV A;  1QQ9 A;  2C6C A;  3PBE A;  5F09 A;  2XEI A;  4C9E A;  1KWM A;  1TKJ A;  4IAV A;  2ZEH A;  2PJ4 A;  1TF8 A;  5IB9 A;  2GLF A;  4FWU A;  3MRU A;  4ZY2 A;  5JGF A;  3T8W A;  4MXU A;  4TJV A;  3PFO A;  4TWE A;  5ELY A;  1JQG A;  1XJO A;  2C6G A;  1OBR A;  1F2P A;  4DUK A;  1F57 A;  1BPN A;  5THW A;  4A38 A;  1XMB A;  3DLJ A;  2ZEO A;  4C9A A;  3H8F A;  4OP4 A;  3PBB A;  2V8V A;  4UF4 A;  1Y7E A;  3IC1 A;  3NH8 A;  1CPX A;  2XEF A;  2IMO A;  1YME A;  2HC9 A;  4Q7A A;  4C8P A;  2QJ8 A;  4MHZ A;  1H8L A;  3D68 A;  4MHP A;  4MCS A;  2GLJ A;  4A37 A;  1LCP A;  3ISZ A;  1PCA A;  5J1Q A;  2PVV A;  2NSM A;  2OOT A;  1CBX A;  1PYT B;  3GLJ A;  2RB7 A;  2AFW A;  2PJ5 A;  5JH9 A;  4CDJ A;  1FT7 A;  4DYO A;  3SJX A;  1LOK A;  1CG2 A;  1HDQ A;  4C84 A;  2JEW A;  3KR4 A;  3SJF A;  4C8U A;  4C9V A;  2RFH A;  2F8H A;  4O23 A;  4P6Y A;  4OID A;  4P4D A;  3IJ3 A;  3IIB A;  4NGR A;  1V6C A;  2PJ1 A;  1ZLH A;  4OC5 A;  1WVM A;  4PXD A;  1VHO A;  3KHX A;  3PB4 X;  3K2K A;  4JYW A;  4PXB A;  3S9L A;  1VIX A;  1TKH A;  3H8G A;  3B35 A;  4EME A;  2V8G A;  5IR2 A;  1YW6 A;  1VHE A;  4YWY A;  4NJR A;  5HVF A;  3RZA A;  1ARL A;  4UEE A;  4R76 A;  2BCO A;  4ZYQ A;  2C6P A;  4OME A;  4P10 A;  1CP7 A;  4P45 A;  5K8O A;  3KL9 A;  4C8T A;  5JM6 A;  3I74 A;  2FVG A;  4F8Z A;  8CPA A;  1Y0R A;  5D8N A;  2DEA A;  2AFX A;  4ZX9 A;  3FMC A;  3KHZ A;  2ZEF A;  3BI1 A;  4NGQ A;  2PVW A;  3D7D A;  4GM5 A;  4UIB A;  4PXE A;  4C99 A;  4H2K A;  5LRG A;  3KQX A;  1DTD A;  2IQ6 A;  4YN3 A;  2V77 A;  2ZEN A;  2PJ0 A;  1IGB A;  3DGV A;  3IFE A;  4OC0 A;  5CBM A;  2AFU A;  3PB7 X;  1BLL E;  2ZEG A;  3VTA A;  3WC5 A;  3LWU A;  3WC7 A;  1Y0Y A;  4WJB A;  3V7Z A;  1Y9Z A;  5D29 A;  3IEH A;  5HVH A;  1ARM A;  5K8N A;  2Q51 A;  1LAM A;  4WWV A;  2WYR A;  3WC6 A;  3ICU A;  4FUU A;  2BO9 A;  4OKO A;  3D7H A;  3I6S A;  1IY7 A;  2PJB A;  1CPS A;  1LFW A;  4OC3 A;  4X3R A;  3D7F A;  3PB9 X;  1ZLI A;  6CPA A;  4P4F A;  4C8F A;  3FEC A;  2EWB A;  4KSI A;  2PJ9 A;  1ZG9 A;  4ZI6 A;  4MHN A;  4P4E A;  4TJX A;  3CT9 A;  3CPA A;  3KQZ A;  3PEI A;  4Z65 A;  2WZN A;  4FAI A;  2GRE A;  4UEZ A;  2PJC A;  7CPA A;  2NYQ A;  2CTC A;  3CDX A;  4NGN A;  1GYT A;  3NH5 A;  2ZOG A;  4NGM A;  2VL1 A;  2ZEM A;  5LYI A;  3KZW A;  3RBU A;  1M4L A;  2JBK A;  5CPA A;  3SI1 A;  4C86 A;  1FNO A;  1Z5R A;  3L2N A;  4FBE A;  3B3S A;  1F2O A;  1R43 A;  2IJZ A;  1XF1 A;  3N5F A;  2AFM A;  4NGS A;  2I3C A;  3TX8 A;  4UIA A;  3CPX A;  5K8M A;  3SI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...