2C6CA

Membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with gpi-18431 (s)-2-(4-iodobenzylphosphonomethyl)-pentanedioic acid
Total Genus 249
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
249
sequence length
694
structure length
682
Chain Sequence
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Glutamate Carboxypeptidase II, a Drug Target in Neuronal Damage and Prostate Cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE II
total genus 249
structure length 682
sequence length 694
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2c6cA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2c6cA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2c6cA02
2PJ5A 1KWMA 3CT9A 3SI2A 2IMOA 2ZEHA 3L2NA 4Q7AA 2OOTA 1R43A 2PIZA 3LMSA 4OIDA 3WABA 3CPAA 1XFOA 3VARA 3FVLA 3KR4A 3GUXA 5JGFA 2ZELA 3HUVA 4C8TA 4X3RA 3D7GA 4MCSA 3FEDA 3PB8X 4RUHA 3D7HA 4MRIA 4C8PA 4CDJA 4R8FA 2PJAA 3RAMA 2PJ6A 3VTAA 1IGBA 4P10A 4DYOA 2O53A 4K3NA 1TXRA 1LAMA 1PCAA 2PJ1A 5HXDA 4R7MA 1TF9A 3KHZA 2AFSA 3T8WA 3S9LA 1XMBA 3KZWA 2F8HA 2GREA 3GLJA 3DLJA 2Q43A 2QJ8A 5CBMA 1R3NA 3KGQA 1YLOA 4OIWA 2EWBA 4C9EA 3KL9A 8CPAA 4AXVA 3HLPA 2XEIA 2WYRA 4NGQA 3D7FA 2PJ7A 5JH9A 2RFHA 1RTQA 4PXBA 5K8MA 4P4EA 2JBJA 1VHEA 2QVPA 3VH9A 3I74A 2PJBA 3NH8A 1LCPA 2Q51A 4TJVA 2ZOFA 3PBBA 3KR5A 2ZEMA 2HB6A 4NGRA 3B7IA 1F2OA 3B3SA 1YMEA 4C9UA 3LWUA 1F2PA 4MHZA 4TJXA 4P4FA 4ZY0A 5HVGA 3PFEA 4WWVA 3RBUA 2RB7A 3ICUA 1CG2A 4OC2A 5HVFA 3IJ3A 5JM6A 1LFWA 1DE4C 1YW4A 3KASA 4ZI6A 3NA6A 3B3VA 4PQAA 1NSAA 4NGSA 1LOKA 3QNVA 2BOAA 3IC1A 4DUKA 2EK8A 3IIBA 4GM5A 4C9RA 4OC1A 4C85A 4EMEA 3B3TA 3DGVA 4H2KA 3FEEA 4CDKA 1BAVA 1H8LA 2CIJA 1LAPA 1ARLA 4FUUA 4FAIA 3I1UA 3S9MA 4R76A 4NGTA 1TKFA 4NFRA 4JYWA 3RZAA 2HC9A 2PJ0A 2GLJA 3I6SA 1AMPA 3SJGA 4P44A 1QMUA 2BCOA 1TKJA 5K8NA 3BI0A 2V8DA 3BI1A 4IK2A 4ZY1A 4PXEA 2BO9A 3SI0A 2PJ8A 2AFWA 2ZEDA 3GB0A 2EK9A 2CF4A 5LRJA 1ZLIA 1VGYA 2C1CA 4OC4A 3D66A 3PB7X 2CTCA 2AFXA 4IHMA 2JEWA 3K2KA 4MMOA 5LYIA 4MCQA 2PJCA 1EE3P 4C9AA 5D29A 1CPXA 3PFOA 1VHOA 1UWYA 3CDXA 4UIAA 2PJ9A 1ELMP 1HEEA 4F9UA 1ARMA 3CPXA 4CPAA 2ZEPA 2PIYA 3FJUA 1JQGA 3V38A 4C8UA 2ZENA 1VIXA 3ISXA 4NGNA 3D67A 2Q4ZA 4LQGA 1CP7A 1Y7EA 2AFZA 4UIBA 4C8FA 1Y9ZA 3FX6A 3WT4A 3PB4X 1ZLHA 4C9VA 5CPAA 3FECA 1FT7A 1PYTB 4OP4A 3H8FA 3PB6X 2AFUA 3WC5A 3ISZA 3JRUA 1OBRA 4MHYA 4OC5A 1BPNA 3IFEA 3SI1A 4P4BA 4MXUA 4A37A 4X2TA 4ZY2A 2ZEGA 5IB9A 4TNUA 1Z8LA 1CX8A 3NH4A 3B2YA 4C99A 3WC7A 5HVHA 3BXMA 1YW6A 4ZYQA 2XEFA 3IEHA 4UEEA 2ABZA 3D68A 4G1PA 3FH4A 4WJBA 2WZNA 4EWTA 3SJXA 2JBKA 1XJOA 4OC0A 4UF4A 2NYQA 2O4HA 3KQZA 5THWA 1Y0RA 5J1QA 1HDUA 3MRUA 1AYEA 1XBUA 4EFDA 3MN8A 4C8AA 4NJQA 3B3CA 2J9AA 5F09A 1YSJA 3IWWA 1TKHA 1ZG8A 4NGMA 2IQ6A 4MHPA 2OR4A 3NFZA 2XEJA 2ZEEA 6CPAA 2AFOA 5I4MA 5LRGA 2PRQA 4YN3A 2V8GA 4W9YA 1HDQA 3IO1A 1Z2LA 2NSMA 3TC8A 5ELYA 4OMEA 4UEFA 4DJLA 4MCRA 4FWUA 4X8IA 7CPAA 2C6PA 3D7DA 4YWYA 4OC3A 4R6TA 4P45A 3V7ZA 2I3CA 1Z5RA 3NH5A 2ZOGA 1LANA 3H8GA 4B6ZA 3EIFA 2PJ2A 3SJEA 2PE3A 3PRTA 1FNOA 4A94A 1CP6A 3TX8A 4O23A 3BHXA 4C86A 3D4UA 4MCPA 2IJZA 3H8EA 5D8NA 1ELLP 4IAVA 4ONWA 4F8ZA 3PB9X 2PVWA 4BD9A 3FF3A 4NGPA 2PCUA 4C8CA 4MHNA 2V8VA 3B35A 4ZX9A 4F9VA 3FMCA 5K8PA 1BPMA 1IY7A 3S9NA 3KQXA 4UEZA 4TWEA 1M4LA 2POKA 3KI9A 3N5FA 4OKOA 3K9TA 2PJ3A 1TF8A 2G9DA 2F7VA 1CBXA 2ANPA 4KNGE 3KHXA 1Q7LA 2ZEOA 4JZ0A 5LYFA 3SJFA 2FVGA 2C6CA 2VL1A 2V77A 2V8HA 3PEIA 4P4IA 4P6YA 3B3WA 5K8OA 4YU9A 2CTBA 2GU2A 4P4JA 2PVVA 5LYDA 1DTDA 1ZG7A 2ZEFA 2AFMA 4PXCA 1ZG9A 4FBEA 1F57A 4NJRA 2GLFA 1CPSA 2QYVA 4P4DA 1XRYA 5DS0A 4PPZA 5LYLA 4Z65A 2PJ4A 4A38A 5LRKA 3VATA 4A39A 4C84A 2XEGA 3WC6A 1GYTA 2C6GA 1V6CA 2DEAA 4PXDA 1Y0YA 1XF1A 1BLLE 1QQ9A 1WVMA 3PBEA 4KSIA 4ZX8A
chains in the Genus database with same CATH superfamily
1Y9WA 2PJ5A 4E94A 2Z11A 1KWMA 3D3SA 1Z8WA 4XPKA 3CT9A 3SI2A 3DDDA 2IMOA 5G22A 2QMLA 3T9YA 4ONUA 2OLSA 2ZEHA 5F1YA 1BOBA 3TE4A 4EYSA 2FIWA 2D0OA 3L2NA 2R1IA 4Q7AA 2OOTA 1R43A 4KVME 3TLCA 1UFHA 2PIZA 2Q0YA 4M3SA 3LMSA 3S6KA 3MGDA 4MJXA 5HH1A 4AB7A 2CNSA 4NF1A 4OIDA 2VEZA 3WABA 4DNCA 3TLGB 3CPAA 1XFOA 1RO5A 4CAXA 2PRBA 3GIUA 2GE3A 2GFQA 3VARA 3FVLA 3UY5A 4RS2A 5IV0A 3KR4A 1NBWA 5AXIA 3GUXA 5JGFA 3BLNA 2ZELA 3D2MA 3QB8A 3HUVA 4C8TA 4X3RA 3BUOB 1IYKA 2K5TA 2P6FA 4GS4A 3D7GA 4MCSA 1BXRB 3FEDA 2I79A 3PB8X 4CGOA 2EVNA 3H4QA 4CAVA 4RUHA 4M6HA 3D7HA 5A28A 4A32A 2X0SA 5JQ4A 5F5XA 1J4JA 1PUAA 4JLYA 4MRIA 3S6HA 1AUGA 4C8PA 2YNEA 4KORA 4CDJA 2P0WA 2OZGA 5DWMA 5G20A 2BL1A 4R8FA 4C7IA 2HQYA 2PJAA 3RAMA 5F48A 2YGWA 2PJ6A 3P2FA 3VTAA 2H5MA 3A9LA 1IGBA 4P10A 4F0XA 4DYOA 1VKCA 1CM0A 2O53A 4NSQA 3GKRA 4K3NA 4CYOA 3FB3A 2R98A 3JVNA 3GYAA 1TXRA 1LAMA 3G8WA 5C82A 1M4GA 1PCAA 2PJ1A 3EFAA 3P2HA 4B5OA 5HXDA 3VRNA 4U5YA 2Y1NA 2RC4A 4R7MA 4BMHA 4H6UA 2YJVA 1TF9A 1B6BA 4KOUA 1KC7A 2B5GA 1KUYA 3KHZA 1Q2YA 2AFSA 4R9MA 3T8WA 3S9LA 2Q04A 2DLAA 1XMBA 3JUWA 3KZWA 4R3LA 3OB1B 5HMNA 2F8HA 2GREA 2JEVA 2PC1A 2VXKA 3GLJA 4UA3A 3DLJA 4KOWA 2J8NA 2Q43A 2QJ8A 5G1ZA 4AG9A 1R3NA 5CBMA 3KGQA 4LUAA 3T90A 4MFQA 1YLOA 4M8DA 4OIWA 1ZYMA 3BUWB 2EWBA 4C9EA 2NMTA 3KL9A 1IIDA 8CPAA 4KUAA 4MFLA 4J3GA 3S6GA 4AXVA 3VROA 2EO8A 3HLPA 4OLLA 2XEIA 4COBA 2PR8A 3LACA 2WYRA 4NGQA 1Y9KA 3D7FA 3TCVA 4AG7A 1M1DA 4KLWA 2PJ7A 5JH9A 2RFHA 1RTQA 4PXBA 5K8MA 4P4EA 2JBJA 4YFJA 5J8FA 1VHEA 1MJ9A 2QVPA 4GPLB 1FY7A 4FD5A 3VH9A 1VI4A 5C88A 1IB1E 3TLEA 4UFVA 4C7HA 2I00A 3I74A 2PJBA 3TO7A 3NH8A 1LCPA 1Z9EA 2Q51A 5KTDA 4TJVA 2ZOFA 3PBBA 5BWAB 3NFQA 3KR5A 2ZEMA 2B5GB 3R9EA 3W91A 1YVKA 4IIYA 4Y49C 2Q7BA 2HB6A 4NGRA 3B7IA 2WUUA 5GCNA 1F2OA 4C8UA 1YVHA 3B3SA 4UFWA 1YMEA 5AG7A 4C9UA 3LWUA 2ODFA 1F2PA 4MHZA 1L0CA 4MY3A 4TJXA 1PU9A 4P4FA 5HKZA 4ZY0A 3NOJA 3T07A 5HVGA 4FD7A 3PFEA 4WWVA 4K30A 3RBUA 4BTFA 3K4IA 1X10A 2RB7A 3ICUA 1CG2A 4OC2A 3IWEA 5HVFA 2Z3KA 3IJ3A 5EC4A 5JM6A 1LFWA 1YREA 5F49A 2J8RA 1DE4C 1KZFA 1Q5XA 1B47A 1YW4A 5G21A 2X7BA 3KASA 4CAWA 4ZI6A 2XPLA 1KUXA 1JDBC 4KOYA 5J8CA 2AE6A 2VBQA 3KKWA 2OZUA 4JXRA 1KBLA 3FIXA 1X12A 2F5IA 3NA6A 3B3VA 2EZCA 4PQAA 2Y1MA 1NSAA 4YGOA 3PLFB 4NGSA 1LOKA 3QNVA 2BOAA 1YR0A 3IC1A 4YRHA 4DUKA 2EK8A 3IIBA 3QAYA 3R9GA 4GM5A 3TO6A 4C9RA 4OC1A 1J3LA 4KZTA 4II9A 4C85A 5JYBA 3RYOA 3D2PA 1CS0B 5JVLA 4EMEA 1M6VB 3GJZA 3B3TA 3DGVA 4UWIA 5IR2A 4H2KA 3FEEA 4CDKA 4M85A 4MJ8A 3TOBA 3T05A 1BAVA 2CBLA 1H8LA 3TT2A 3EZAA 2CIJA 1LAPA 4UFXA 4MI1A 2B4BA 4JJXA 1ARLA 4FUUA 3EO4A 4Y49B 5BY0A 1I1DA 1I21A 4FAIA 3I1UA 3S9MA 1N71A 2C27A 2P6EA 3FNCA 1ZL0A 1S7LA 4R76A 4NGTA 1S3ZA 1TKFA 2Q4YA 4NFRA 4A95A 1EZAA 3TLYA 4JYWA 1Z4EA 2FIAA 3RZAA 2HC9A 2PJ0A 4ZGYB 2GLJA 4RI1A 1XEBA 3I6SA 1AMPA 1M44A 4E8OA 3SJGA 5K99A 2B4DA 4IUSA 4QVTA 4U9YA 4P44A 4MFZA 4EVYA 1QMUA 3E0KA 1NSLA 4B14A 2BCOA 1TKJA 4MFPA 5K8NA 5F46A 2OH1A 3BI0A 2V8DA 4C68A 3BI1A 4A4CA 4IK2A 4PXEA 4ZY1A 1LRZA 2BO9A 2ZXVA 4CGLA 5KTAA 3SI0A 2PJ8A 4B11A 2AFWA 2ZEDA 3GB0A 2VKZG 2CF4A 2EK9A 4UCMA 5LRJA 1ZLIA 4F0YA 2FXFA 4HPSA 1VGYA 4L89A 3C8OA 3SXOA 2C1CA 3G23A 4OC4A 3D66A 3PB7X 4PSXA 3HPHE 2CTCA 4X5KA 2AFXA 4IHMA 2YJTA 1K4JA 4MY0A 2E28A 2JEWA 4CGMA 1WJTA 3K2KA 2JLMA 3FBUA 4MMOA 1S7KA 1NE9A 4FD4A 1QSRA 4KVXA 5LYIA 4E2AA 4KSAA 2VZZA 4MCQA 2PJCA 2FL4A 1MJAA 2C5QA 3OAKA 2DXQA 1EE3P 3R9FA 4JD6A 4CYPA 4C9AA 5D29A 1CPXA 1VHOA 4BPXB 3PFOA 5I0CA 1UWYA 3CDXA 4CAFA 3TLBA 5ISVA 2ATRA 2PJ9A 4UIAA 5THWA 1ELMP 4RN7A 1HEEA 5DWNA 4F9UA 1ARMA 4Q38A 5A27A 3CPXA 4CPAA 2XPOA 2ZEPA 3R96A 2PIYA 3FJUA 3RNZA 2CXAA 1VBGA 4CRZB 3PT1A 2CY2A 1JQGA 5AG4A 3V38A 1YGHA 4IIXA 2ZENA 1VIXA 3ISXA 4MFKA 4NGNA 4A4BA 2Q4ZA 3D67A 4LQGA 4XNHB 3ZZIA 4A30A 3G3SA 1CP7A 1Y7EA 2AFZA 2EUIA 1IOIA 1S5KA 1QSTA 4UIBA 4CYQA 2ZW4A 4LX9A 3FX6A 1Y9ZA 2HWGA 4C8FA 3WT4A 3PB4X 1ZLHA 4C9VA 5CPAA 4U9ZA 3FECA 5H84A 3TLZA 1FT7A 1PYTB 2ZW7A 4OP4A 4XPLA 3H8FA 3PB6X 2AFUA 2R8VA 3WC5A 1XIXA 3H5ZA 4MHDA 2FM4A 4CZ1A 3ISZA 4CS0B 1T36B 1ZRSA 2PDOA 2FCKA 3JTKA 1IICA 4UBRA 5KTCA 2CNMA 1QSNA 1Q2DA 1OBRA 3JRUA 2GIVA 1YLEA 2Y0MA 4MHYA 2P6GA 4OC5A 3VRRA 2GANA 2HUZA 3IWGA 1BPNA 1RXTA 2G3TA 3IFEA 3DSBA 4L8AA 2R82A 3SI1A 3EXNA 3EC4A 4P4BA 4MXUA 2Q7SA 3BUXB 4BPWB 4A37A 4UCPA 4X2TA 4ZY2A 1ZO0A 1MK4A 2ZEGA 5IB9A 2HI6A 4TNUA 1Z8LA 2Z3OA 1CX8A 2IL4A 3NH4A 5F9MA 4KLVA 4QBJA 3B2YA 4HNXB 1A2ZA 3ZNIA 2D4PA 4AVBA 4QUSA 3WC7A 3OP0A 4C99A 5HVHA 3BXMA 2B3UA 2ZW6A 3F5BA 1YW6A 2WSAA 2XEFA 4ZYQA 5JPHA 4UWJA 2EZAA 5J3XA 3IEHA 2YNCC 4UEEA 2ABZA 5EMIA 4CYNA 4R57A 4I49A 4NCZA 3D68A 3I3GA 4ZBGA 4PV6A 3TTHA 4C2ZA 1IOFA 2MP0A 4G1PA 4INJA 3TLGA 3FH4A 3EZBA 3BUMB 1Z9UA 1QSOA 4LQ6A 4WJBA 2REEA 2JDCA 4NEXA 2WZNA 4EWTA 4PK3A 4KVOE 1S7NA 2DPTA 2GP4A 2Z10A 5EBVA 1XE4A 3CXQA 3T5MA 3SJXA 3VWEA 1TIQA 2JBKA 2WPWA 3DR6A 1XJOA 3PFVA 3PP9A 4OC0A 4UF4A 1A9XB 1OZPA 3T0TA 2NYQA 4ORFA 4J0NA 5FVJA 2O4HA 1YX0A 4BBHA 3TLAA 1BO4A 3OWCA 2DF5A 4KOXA 3KQZA 2O28A 4JWPA 1Y0RA 2YNCA 3U88C 1HDUA 2Q4VA 3D8PA 2BSWA 3MRUA 1AYEA 2QIRA 3F8KA 3NE8A 4B12A 1XBUA 2ARHA 3VRQA 3VRPA 1XMTA 4EFDA 3EZEA 3MN8A 3OB2B 4C8AA 1GHEA 3R1KA 4NJQA 3F0AA 1Q2CA 3B3CA 4CGNA 1Z4RA 1M4IA 2J9AA 5F09A 4H89A 4XPDC 1YSJA 2Q44A 2D0PA 3IWWA 5FD8A 1TKHA 1ZG8A 1YQEA 3PZJA 4C2XA 1EO0A 4NGMA 2IQ6A 4MHPA 2OR4A 3C26A 1GGOA 3LODA 3O8ZA 2FE7A 3BUNB 2YNDA 2XEJA 3NFZA 4Q36A 2ZEEA 3W6XA 2B58A 2AFOA 4CAEA 6CPAA 4XNHC 5HKYA 5I4MA 3U1BA 2VQYA 5LRGA 2PRQA 5IX3A 3SR3A 4COGA 4YN3A 4FD6A 2XPPA 3GY9A 4HNYB 2PQ8A 2Z3LA 2FT0A 2V8GA 2Z3MA 4KOVA 2B4JC 4W9YA 4NXYA 3WR7A 4AVAA 1KUVA 2Z3NA 2OU2A 1HDQA 3HMJG 1MJBA 3CZXA 3FXTA 3IO1A 1Y7RA 3K9UA 2N3AB 2UV8G 3HPGG 2VI7A 3CXSA 5IB0A 1YK3A 1Z2LA 3LD2A 2NSMA 4KOSA 3TC8A 2Z0ZA 3R95A 2J8MA 5ELYA 4MFJA 4OMEA 4UEFA 1IYLA 2QECA 4MCRA 4FWUA 3V8IA 4DJLA 4X8IA 4A2ZA 1U6MA 3TO9A 2C6PA 3D7DA 4CRYB 4YWYA 7CPAA 1VBHA 2D4OA 1WK4A 4OC3A 3I9SA 4KS9A 4P45A 4R6TA 4E0AA 3V7ZA 1SQHA 1Z5RA 2I3CA 1FBVA 3NH5A 4XPDB 4C2YA 2ZOGA 1LANA 3NE7A 3H8GA 1C30B 4B6ZA 1NXJA 2EBJA 3EIFA 1XOVA 2PJ2A 3SJEA 2PE3A 3PRTA 5HKWA 1FNOA 4IF5A 4R87A 4A94A 4B5PA 1CP6A 3TX8A 4O23A 3BHXA 4BPUB 3CXPA 3D4UA 4JXQA 4MCPA 1ON0A 1IU8A 3PGPA 4C86A 2IJZA 3H8EA 5D8NA 1NMTA 2OB0A 1ELLP 4OAEA 3SHPA 4F6AA 4IAVA 4ONWA 3KRVA 2B4DB 2PR1A 2HV2A 4F8ZA 4CO9A 3PB9X 2PVWA 4B5PB 3SXNA 4BINA 4BD9A 3FF3A 4NGPA 2PCUA 1KEEB 4GXHA 2DIKA 2Z3PA 2AUNA 4C8CA 4MHNA 5AG5A 2V8VA 3B35A 4ZX9A 5F47A 3FMCA 4F9VA 5K8PA 1S60A 1BPMA 2JDDA 4HNWB 1IY7A 3S9NA 3TYXA 4M6GA 3KQXA 4UEZA 1JWQA 4HKFA 4TWEA 3W6SA 4H1HA 1M4LA 2PSWA 2CNTA 2POKA 2G3AA 2B0AA 3KI9A 3TFYA 3EY5A 3N5FA 2AUMA 4OKOA 2HROA 3K9TA 2PJ3A 4A33A 4R3KA 1TF8A 2G9DA 1B87A 1CBXA 2F7VA 3QAHA 2ANPA 5AGEA 1JDEA 4KNGE 3BJ8A 2BUEA 4M6IA 3KHXA 3ZJ0A 1V0CA 3S6FA 2PCNA 1Z8TA 1Q7LA 3FYNA 5H86A 3TOAA 4JVOA 4E5SA 2FSRA 4JZ0A 2ZEOA 5LYFA 4KOTA 3SJFA 2FVGA 2C6CA 2VL1A 2R7HA 2V77A 2V8HA 3PEIA 1DIKA 1P0HA 2VZYA 2BEIA 4CGPA 4P4IA 1I12A 1VHSA 5AG6A 4P6YA 3F9KC 3B3WA 5K8OA 4YU9A 1CJWA 2CTBA 2FS5A 1Z8XA 2ZW5A 2XPNA 1S7FA 4B13A 2GU2A 2KCWA 4P4JA 2PVVA 1XF8A 5LYDA 2WPXA 1DTDA 1ZG7A 2ZEFA 2AFMA 1CE8B 4PXCA 3FRMA 1ZG9A 1R57A 1YVOA 4FBEA 5CNPA 4AVCA 1F57A 4NJRA 4QB9A 4H6ZA 3BJ7A 2GLFA 1CPSA 2QYVA 5E96A 4P4DA 3VWDA 4QC6A 1XRYA 1M4DA 2OZHA 2ZPAA 4MBUA 5DS0A 4PPZA 5LYLA 4OADA 3DNSA 4Z65A 2AJ6A 2PJ4A 2G0BA 3VATA 4A38A 5LRKA 4PSWA 5J1QA 4KSFA 3RO0A 4A39A 2DPSA 4C84A 3VGOA 3IGRA 2XEGA 3WC6A 1GYTA 2C6GA 1V6CA 3B8GA 4KUBA 1P4NA 4RR2B 2DEAA 4PXDA 4B10A 1Y0YA 1QSMA 4A31A 1C3OB 1XF1A 1BLLE 2EZBA 2B3VA 2A4NA 1R61A 3N7ZA 1QQ9A 1WWZA 4PK2A 3PBEA 1WVMA 4MI4A 4KSIA 4UCNA 2REFA 3DR8A 5F13A 4ZX8A 1EZBA 3IU1A 3IU2A
chains in the Genus database with same CATH topology
2PJ5A 1KWMA 3CT9A 3SI2A 2IMOA 2ZEHA 3L2NA 4Q7AA 2OOTA 1R43A 2PIZA 3LMSA 4OIDA 3WABA 3CPAA 1XFOA 3VARA 3FVLA 3KR4A 3GUXA 5JGFA 2ZELA 3HUVA 4C8TA 4X3RA 3D7GA 4MCSA 3FEDA 3PB8X 4RUHA 3D7HA 4MRIA 4C8PA 4CDJA 4R8FA 2PJAA 3RAMA 2PJ6A 3VTAA 1IGBA 4P10A 4DYOA 2O53A 4K3NA 1TXRA 1LAMA 1PCAA 2PJ1A 5HXDA 4R7MA 1TF9A 3KHZA 2AFSA 3T8WA 3S9LA 1XMBA 3KZWA 2F8HA 2GREA 3GLJA 3DLJA 2Q43A 2QJ8A 5CBMA 1R3NA 3KGQA 1YLOA 4OIWA 2EWBA 4C9EA 3KL9A 8CPAA 4AXVA 3HLPA 2XEIA 2WYRA 4NGQA 3D7FA 2PJ7A 5JH9A 2RFHA 1RTQA 4PXBA 5K8MA 4P4EA 2JBJA 1VHEA 2QVPA 3VH9A 3I74A 2PJBA 3NH8A 1LCPA 2Q51A 4TJVA 2ZOFA 3PBBA 3KR5A 2ZEMA 2HB6A 4NGRA 3B7IA 1F2OA 3B3SA 1YMEA 4C9UA 3LWUA 1F2PA 4MHZA 4TJXA 4P4FA 4ZY0A 5HVGA 3PFEA 4WWVA 3RBUA 2RB7A 3ICUA 1CG2A 4OC2A 5HVFA 3IJ3A 5JM6A 1LFWA 1DE4C 1YW4A 3KASA 4ZI6A 3NA6A 3B3VA 4PQAA 1NSAA 4NGSA 1LOKA 3QNVA 2BOAA 3IC1A 4DUKA 2EK8A 3IIBA 4GM5A 4C9RA 4OC1A 4C85A 4EMEA 3B3TA 3DGVA 5IR2A 4H2KA 3FEEA 4CDKA 1BAVA 1H8LA 2CIJA 1LAPA 1ARLA 4FUUA 4FAIA 3I1UA 3S9MA 4R76A 4NGTA 1TKFA 4NFRA 4JYWA 3RZAA 2HC9A 2PJ0A 2GLJA 3I6SA 1AMPA 3SJGA 4P44A 1QMUA 2BCOA 1TKJA 5K8NA 3BI0A 2V8DA 3BI1A 4IK2A 4ZY1A 4PXEA 2BO9A 3SI0A 2PJ8A 2AFWA 2ZEDA 3GB0A 2EK9A 2CF4A 5LRJA 1ZLIA 1VGYA 2C1CA 4OC4A 3D66A 3PB7X 2CTCA 2AFXA 4IHMA 2JEWA 3K2KA 4MMOA 5LYIA 4MCQA 2PJCA 2C5QA 1EE3P 4C9AA 5D29A 1CPXA 3PFOA 1VHOA 1UWYA 3CDXA 4UIAA 2PJ9A 1ELMP 1HEEA 4F9UA 1ARMA 3CPXA 4CPAA 2ZEPA 2PIYA 3FJUA 1JQGA 3V38A 4C8UA 2ZENA 1VIXA 3ISXA 4NGNA 3D67A 2Q4ZA 4LQGA 1CP7A 1Y7EA 2AFZA 4UIBA 4C8FA 1Y9ZA 3FX6A 3WT4A 3PB4X 1ZLHA 4C9VA 5CPAA 3FECA 1FT7A 1PYTB 4OP4A 3H8FA 3PB6X 2AFUA 3WC5A 3ISZA 3JRUA 1OBRA 4MHYA 4OC5A 1BPNA 3IFEA 3SI1A 4P4BA 4MXUA 4A37A 4X2TA 4ZY2A 2ZEGA 5IB9A 4TNUA 1Z8LA 1CX8A 3NH4A 3B2YA 4C99A 3WC7A 5HVHA 3BXMA 1YW6A 4ZYQA 2XEFA 3IEHA 4UEEA 2ABZA 3D68A 4G1PA 3FH4A 4WJBA 2WZNA 4EWTA 2GP4A 3SJXA 2JBKA 1XJOA 4OC0A 4UF4A 2NYQA 2O4HA 3KQZA 5THWA 1Y0RA 5J1QA 1HDUA 3MRUA 1AYEA 1XBUA 4EFDA 3MN8A 4C8AA 4NJQA 3B3CA 2J9AA 5F09A 1YSJA 3IWWA 1TKHA 1ZG8A 4NGMA 2IQ6A 4MHPA 2OR4A 3NFZA 2XEJA 2ZEEA 6CPAA 2AFOA 5I4MA 5LRGA 2PRQA 4YN3A 2V8GA 4W9YA 1HDQA 3IO1A 1Z2LA 2NSMA 3TC8A 5ELYA 4OMEA 4UEFA 4DJLA 4MCRA 4FWUA 4X8IA 7CPAA 2C6PA 3D7DA 4YWYA 4OC3A 4R6TA 4P45A 3V7ZA 2I3CA 1Z5RA 3NH5A 2ZOGA 1LANA 3H8GA 4B6ZA 3EIFA 2PJ2A 3SJEA 2PE3A 3PRTA 1FNOA 4A94A 1CP6A 3TX8A 4O23A 3BHXA 4C86A 3D4UA 4MCPA 2IJZA 3H8EA 5D8NA 1ELLP 4IAVA 4ONWA 4F8ZA 3PB9X 2PVWA 4BD9A 3FF3A 4NGPA 2PCUA 4C8CA 4MHNA 2V8VA 3B35A 4ZX9A 4F9VA 3FMCA 5K8PA 1BPMA 1IY7A 3S9NA 3KQXA 4UEZA 4TWEA 1M4LA 2POKA 3KI9A 3N5FA 4OKOA 3K9TA 2PJ3A 1TF8A 2G9DA 2F7VA 1CBXA 2ANPA 4KNGE 3KHXA 1Q7LA 2ZEOA 4JZ0A 5LYFA 3SJFA 2FVGA 2C6CA 2VL1A 2V77A 2V8HA 3PEIA 4P4IA 4P6YA 3B3WA 5K8OA 4YU9A 2CTBA 2GU2A 4P4JA 2PVVA 5LYDA 1DTDA 1ZG7A 2ZEFA 2AFMA 4PXCA 1ZG9A 4FBEA 1F57A 4NJRA 2GLFA 1CPSA 2QYVA 4P4DA 1XRYA 5DS0A 4PPZA 5LYLA 4Z65A 2PJ4A 4A38A 5LRKA 3VATA 4A39A 4C84A 2XEGA 3WC6A 1GYTA 2C6GA 1V6CA 2DEAA 4PXDA 1Y0YA 1XF1A 1BLLE 1QQ9A 1WVMA 3PBEA 4KSIA 4ZX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ5 A;  1KWM A;  3CT9 A;  3SI2 A;  2IMO A;  2ZEH A;  3L2N A;  4Q7A A;  2OOT A;  1R43 A;  2PIZ A;  3LMS A;  4OID A;  3WAB A;  3CPA A;  1XFO A;  3VAR A;  3FVL A;  3KR4 A;  3GUX A;  5JGF A;  2ZEL A;  3HUV A;  4C8T A;  4X3R A;  3D7G A;  4MCS A;  3FED A;  3PB8 X;  4RUH A;  3D7H A;  4MRI A;  4C8P A;  4CDJ A;  4R8F A;  2PJA A;  3RAM A;  2PJ6 A;  3VTA A;  1IGB A;  4P10 A;  4DYO A;  2O53 A;  4K3N A;  1TXR A;  1LAM A;  1PCA A;  2PJ1 A;  5HXD A;  4R7M A;  1TF9 A;  3KHZ A;  2AFS A;  3T8W A;  3S9L A;  1XMB A;  3KZW A;  2F8H A;  2GRE A;  3GLJ A;  3DLJ A;  2Q43 A;  2QJ8 A;  5CBM A;  1R3N A;  3KGQ A;  1YLO A;  4OIW A;  2EWB A;  4C9E A;  3KL9 A;  8CPA A;  4AXV A;  3HLP A;  2XEI A;  2WYR A;  4NGQ A;  3D7F A;  2PJ7 A;  5JH9 A;  2RFH A;  1RTQ A;  4PXB A;  5K8M A;  4P4E A;  2JBJ A;  1VHE A;  2QVP A;  3VH9 A;  3I74 A;  2PJB A;  3NH8 A;  1LCP A;  2Q51 A;  4TJV A;  2ZOF A;  3PBB A;  3KR5 A;  2ZEM A;  2HB6 A;  4NGR A;  3B7I A;  1F2O A;  3B3S A;  1YME A;  4C9U A;  3LWU A;  1F2P A;  4MHZ A;  4TJX A;  4P4F A;  4ZY0 A;  5HVG A;  3PFE A;  4WWV A;  3RBU A;  2RB7 A;  3ICU A;  1CG2 A;  4OC2 A;  5HVF A;  3IJ3 A;  5JM6 A;  1LFW A;  1DE4 C;  1YW4 A;  3KAS A;  4ZI6 A;  3NA6 A;  3B3V A;  4PQA A;  1NSA A;  4NGS A;  1LOK A;  3QNV A;  2BOA A;  3IC1 A;  4DUK A;  2EK8 A;  3IIB A;  4GM5 A;  4C9R A;  4OC1 A;  4C85 A;  4EME A;  3B3T A;  3DGV A;  4H2K A;  3FEE A;  4CDK A;  1BAV A;  1H8L A;  2CIJ A;  1LAP A;  1ARL A;  4FUU A;  4FAI A;  3I1U A;  3S9M A;  4R76 A;  4NGT A;  1TKF A;  4NFR A;  4JYW A;  3RZA A;  2HC9 A;  2PJ0 A;  2GLJ A;  3I6S A;  1AMP A;  3SJG A;  4P44 A;  1QMU A;  2BCO A;  1TKJ A;  5K8N A;  3BI0 A;  2V8D A;  3BI1 A;  4IK2 A;  4ZY1 A;  4PXE A;  2BO9 A;  3SI0 A;  2PJ8 A;  2AFW A;  2ZED A;  3GB0 A;  2EK9 A;  2CF4 A;  5LRJ A;  1ZLI A;  1VGY A;  2C1C A;  4OC4 A;  3D66 A;  3PB7 X;  2CTC A;  2AFX A;  4IHM A;  2JEW A;  3K2K A;  4MMO A;  5LYI A;  4MCQ A;  2PJC A;  1EE3 P;  4C9A A;  5D29 A;  1CPX A;  3PFO A;  1VHO A;  1UWY A;  3CDX A;  4UIA A;  2PJ9 A;  1ELM P;  1HEE A;  4F9U A;  1ARM A;  3CPX A;  4CPA A;  2ZEP A;  2PIY A;  3FJU A;  1JQG A;  3V38 A;  4C8U A;  2ZEN A;  1VIX A;  3ISX A;  4NGN A;  3D67 A;  2Q4Z A;  4LQG A;  1CP7 A;  1Y7E A;  2AFZ A;  4UIB A;  4C8F A;  1Y9Z A;  3FX6 A;  3WT4 A;  3PB4 X;  1ZLH A;  4C9V A;  5CPA A;  3FEC A;  1FT7 A;  1PYT B;  4OP4 A;  3H8F A;  3PB6 X;  2AFU A;  3WC5 A;  3ISZ A;  3JRU A;  1OBR A;  4MHY A;  4OC5 A;  1BPN A;  3IFE A;  3SI1 A;  4P4B A;  4MXU A;  4A37 A;  4X2T A;  4ZY2 A;  2ZEG A;  5IB9 A;  4TNU A;  1Z8L A;  1CX8 A;  3NH4 A;  3B2Y A;  4C99 A;  3WC7 A;  5HVH A;  3BXM A;  1YW6 A;  4ZYQ A;  2XEF A;  3IEH A;  4UEE A;  2ABZ A;  3D68 A;  4G1P A;  3FH4 A;  4WJB A;  2WZN A;  4EWT A;  3SJX A;  2JBK A;  1XJO A;  4OC0 A;  4UF4 A;  2NYQ A;  2O4H A;  3KQZ A;  5THW A;  1Y0R A;  5J1Q A;  1HDU A;  3MRU A;  1AYE A;  1XBU A;  4EFD A;  3MN8 A;  4C8A A;  4NJQ A;  3B3C A;  2J9A A;  5F09 A;  1YSJ A;  3IWW A;  1TKH A;  1ZG8 A;  4NGM A;  2IQ6 A;  4MHP A;  2OR4 A;  3NFZ A;  2XEJ A;  2ZEE A;  6CPA A;  2AFO A;  5I4M A;  5LRG A;  2PRQ A;  4YN3 A;  2V8G A;  4W9Y A;  1HDQ A;  3IO1 A;  1Z2L A;  2NSM A;  3TC8 A;  5ELY A;  4OME A;  4UEF A;  4DJL A;  4MCR A;  4FWU A;  4X8I A;  7CPA A;  2C6P A;  3D7D A;  4YWY A;  4OC3 A;  4R6T A;  4P45 A;  3V7Z A;  2I3C A;  1Z5R A;  3NH5 A;  2ZOG A;  1LAN A;  3H8G A;  4B6Z A;  3EIF A;  2PJ2 A;  3SJE A;  2PE3 A;  3PRT A;  1FNO A;  4A94 A;  1CP6 A;  3TX8 A;  4O23 A;  3BHX A;  4C86 A;  3D4U A;  4MCP A;  2IJZ A;  3H8E A;  5D8N A;  1ELL P;  4IAV A;  4ONW A;  4F8Z A;  3PB9 X;  2PVW A;  4BD9 A;  3FF3 A;  4NGP A;  2PCU A;  4C8C A;  4MHN A;  2V8V A;  3B35 A;  4ZX9 A;  4F9V A;  3FMC A;  5K8P A;  1BPM A;  1IY7 A;  3S9N A;  3KQX A;  4UEZ A;  4TWE A;  1M4L A;  2POK A;  3KI9 A;  3N5F A;  4OKO A;  3K9T A;  2PJ3 A;  1TF8 A;  2G9D A;  2F7V A;  1CBX A;  2ANP A;  4KNG E;  3KHX A;  1Q7L A;  2ZEO A;  4JZ0 A;  5LYF A;  3SJF A;  2FVG A;  2C6C A;  2VL1 A;  2V77 A;  2V8H A;  3PEI A;  4P4I A;  4P6Y A;  3B3W A;  5K8O A;  4YU9 A;  2CTB A;  2GU2 A;  4P4J A;  2PVV A;  5LYD A;  1DTD A;  1ZG7 A;  2ZEF A;  2AFM A;  4PXC A;  1ZG9 A;  4FBE A;  1F57 A;  4NJR A;  2GLF A;  1CPS A;  2QYV A;  4P4D A;  1XRY A;  5DS0 A;  4PPZ A;  5LYL A;  4Z65 A;  2PJ4 A;  4A38 A;  5LRK A;  3VAT A;  4A39 A;  4C84 A;  2XEG A;  3WC6 A;  1GYT A;  2C6G A;  1V6C A;  2DEA A;  4PXD A;  1Y0Y A;  1XF1 A;  1BLL E;  1QQ9 A;  1WVM A;  3PBE A;  4KSI A;  4ZX8 A; 
#chains in the Genus database with same CATH topology
 1Y9W A;  2PJ5 A;  4E94 A;  2Z11 A;  1KWM A;  3D3S A;  1Z8W A;  4XPK A;  3CT9 A;  3SI2 A;  3DDD A;  2IMO A;  5G22 A;  2QML A;  3T9Y A;  4ONU A;  2OLS A;  2ZEH A;  5F1Y A;  1BOB A;  3TE4 A;  4EYS A;  2FIW A;  2D0O A;  3L2N A;  2R1I A;  4Q7A A;  2OOT A;  1R43 A;  4KVM E;  3TLC A;  1UFH A;  2PIZ A;  2Q0Y A;  4M3S A;  3LMS A;  3S6K A;  3MGD A;  4MJX A;  5HH1 A;  4AB7 A;  2CNS A;  4NF1 A;  4OID A;  2VEZ A;  3WAB A;  4DNC A;  3TLG B;  3CPA A;  1XFO A;  1RO5 A;  4CAX A;  2PRB A;  3GIU A;  2GE3 A;  2GFQ A;  3VAR A;  3FVL A;  3UY5 A;  4RS2 A;  5IV0 A;  3KR4 A;  1NBW A;  5AXI A;  3GUX A;  5JGF A;  3BLN A;  2ZEL A;  3D2M A;  3QB8 A;  3HUV A;  4C8T A;  4X3R A;  3BUO B;  1IYK A;  2K5T A;  2P6F A;  4GS4 A;  3D7G A;  4MCS A;  1BXR B;  3FED A;  2I79 A;  3PB8 X;  4CGO A;  2EVN A;  3H4Q A;  4CAV A;  4RUH A;  4M6H A;  3D7H A;  5A28 A;  4A32 A;  2X0S A;  5JQ4 A;  5F5X A;  1J4J A;  1PUA A;  4JLY A;  4MRI A;  3S6H A;  1AUG A;  4C8P A;  2YNE A;  4KOR A;  4CDJ A;  2P0W A;  2OZG A;  5DWM A;  5G20 A;  2BL1 A;  4R8F A;  4C7I A;  2HQY A;  2PJA A;  3RAM A;  5F48 A;  2YGW A;  2PJ6 A;  3P2F A;  3VTA A;  2H5M A;  3A9L A;  1IGB A;  4P10 A;  4F0X A;  4DYO A;  1VKC A;  1CM0 A;  2O53 A;  4NSQ A;  3GKR A;  4K3N A;  4CYO A;  3FB3 A;  2R98 A;  3JVN A;  3GYA A;  1TXR A;  1LAM A;  3G8W A;  5C82 A;  1M4G A;  1PCA A;  2PJ1 A;  3EFA A;  3P2H A;  4B5O A;  5HXD A;  3VRN A;  4U5Y A;  2Y1N A;  2RC4 A;  4R7M A;  4BMH A;  4H6U A;  2YJV A;  1TF9 A;  1B6B A;  4KOU A;  1KC7 A;  2B5G A;  1KUY A;  3KHZ A;  1Q2Y A;  2AFS A;  4R9M A;  3T8W A;  3S9L A;  2Q04 A;  2DLA A;  1XMB A;  3JUW A;  3KZW A;  4R3L A;  3OB1 B;  5HMN A;  2F8H A;  2GRE A;  2JEV A;  2PC1 A;  2VXK A;  3GLJ A;  4UA3 A;  3DLJ A;  4KOW A;  2J8N A;  2Q43 A;  2QJ8 A;  5G1Z A;  4AG9 A;  1R3N A;  5CBM A;  3KGQ A;  4LUA A;  3T90 A;  4MFQ A;  1YLO A;  4M8D A;  4OIW A;  1ZYM A;  3BUW B;  2EWB A;  4C9E A;  2NMT A;  3KL9 A;  1IID A;  8CPA A;  4KUA A;  4MFL A;  4J3G A;  3S6G A;  4AXV A;  3VRO A;  2EO8 A;  3HLP A;  4OLL A;  2XEI A;  4COB A;  2PR8 A;  3LAC A;  2WYR A;  4NGQ A;  1Y9K A;  3D7F A;  3TCV A;  4AG7 A;  1M1D A;  4KLW A;  2PJ7 A;  5JH9 A;  2RFH A;  1RTQ A;  4PXB A;  5K8M A;  4P4E A;  2JBJ A;  4YFJ A;  5J8F A;  1VHE A;  1MJ9 A;  2QVP A;  4GPL B;  1FY7 A;  4FD5 A;  3VH9 A;  1VI4 A;  5C88 A;  1IB1 E;  3TLE A;  4UFV A;  4C7H A;  2I00 A;  3I74 A;  2PJB A;  3TO7 A;  3NH8 A;  1LCP A;  1Z9E A;  2Q51 A;  5KTD A;  4TJV A;  2ZOF A;  3PBB A;  5BWA B;  3NFQ A;  3KR5 A;  2ZEM A;  2B5G B;  3R9E A;  3W91 A;  1YVK A;  4IIY A;  4Y49 C;  2Q7B A;  2HB6 A;  4NGR A;  3B7I A;  2WUU A;  5GCN A;  1F2O A;  4C8U A;  1YVH A;  3B3S A;  4UFW A;  1YME A;  5AG7 A;  4C9U A;  3LWU A;  2ODF A;  1F2P A;  4MHZ A;  1L0C A;  4MY3 A;  4TJX A;  1PU9 A;  4P4F A;  5HKZ A;  4ZY0 A;  3NOJ A;  3T07 A;  5HVG A;  4FD7 A;  3PFE A;  4WWV A;  4K30 A;  3RBU A;  4BTF A;  3K4I A;  1X10 A;  2RB7 A;  3ICU A;  1CG2 A;  4OC2 A;  3IWE A;  5HVF A;  2Z3K A;  3IJ3 A;  5EC4 A;  5JM6 A;  1LFW A;  1YRE A;  5F49 A;  2J8R A;  1DE4 C;  1KZF A;  1Q5X A;  1B47 A;  1YW4 A;  5G21 A;  2X7B A;  3KAS A;  4CAW A;  4ZI6 A;  2XPL A;  1KUX A;  1JDB C;  4KOY A;  5J8C A;  2AE6 A;  2VBQ A;  3KKW A;  2OZU A;  4JXR A;  1KBL A;  3FIX A;  1X12 A;  2F5I A;  3NA6 A;  3B3V A;  2EZC A;  4PQA A;  2Y1M A;  1NSA A;  4YGO A;  3PLF B;  4NGS A;  1LOK A;  3QNV A;  2BOA A;  1YR0 A;  3IC1 A;  4YRH A;  4DUK A;  2EK8 A;  3IIB A;  3QAY A;  3R9G A;  4GM5 A;  3TO6 A;  4C9R A;  4OC1 A;  1J3L A;  4KZT A;  4II9 A;  4C85 A;  5JYB A;  3RYO A;  3D2P A;  1CS0 B;  5JVL A;  4EME A;  1M6V B;  3GJZ A;  3B3T A;  3DGV A;  4UWI A;  5IR2 A;  4H2K A;  3FEE A;  4CDK A;  4M85 A;  4MJ8 A;  3TOB A;  3T05 A;  1BAV A;  2CBL A;  1H8L A;  3TT2 A;  3EZA A;  2CIJ A;  1LAP A;  4UFX A;  4MI1 A;  2B4B A;  4JJX A;  1ARL A;  4FUU A;  3EO4 A;  4Y49 B;  5BY0 A;  1I1D A;  1I21 A;  4FAI A;  3I1U A;  3S9M A;  1N71 A;  2C27 A;  2P6E A;  3FNC A;  1ZL0 A;  1S7L A;  4R76 A;  4NGT A;  1S3Z A;  1TKF A;  2Q4Y A;  4NFR A;  4A95 A;  1EZA A;  3TLY A;  4JYW A;  1Z4E A;  2FIA A;  3RZA A;  2HC9 A;  2PJ0 A;  4ZGY B;  2GLJ A;  4RI1 A;  1XEB A;  3I6S A;  1AMP A;  1M44 A;  4E8O A;  3SJG A;  5K99 A;  2B4D A;  4IUS A;  4QVT A;  4U9Y A;  4P44 A;  4MFZ A;  4EVY A;  1QMU A;  3E0K A;  1NSL A;  4B14 A;  2BCO A;  1TKJ A;  4MFP A;  5K8N A;  5F46 A;  2OH1 A;  3BI0 A;  2V8D A;  4C68 A;  3BI1 A;  4A4C A;  4IK2 A;  4PXE A;  4ZY1 A;  1LRZ A;  2BO9 A;  2ZXV A;  4CGL A;  5KTA A;  3SI0 A;  2PJ8 A;  4B11 A;  2AFW A;  2ZED A;  3GB0 A;  2VKZ G;  2CF4 A;  2EK9 A;  4UCM A;  5LRJ A;  1ZLI A;  4F0Y A;  2FXF A;  4HPS A;  1VGY A;  4L89 A;  3C8O A;  3SXO A;  2C1C A;  3G23 A;  4OC4 A;  3D66 A;  3PB7 X;  4PSX A;  3HPH E;  2CTC A;  4X5K A;  2AFX A;  4IHM A;  2YJT A;  1K4J A;  4MY0 A;  2E28 A;  2JEW A;  4CGM A;  1WJT A;  3K2K A;  2JLM A;  3FBU A;  4MMO A;  1S7K A;  1NE9 A;  4FD4 A;  1QSR A;  4KVX A;  5LYI A;  4E2A A;  4KSA A;  2VZZ A;  4MCQ A;  2PJC A;  2FL4 A;  1MJA A;  2C5Q A;  3OAK A;  2DXQ A;  1EE3 P;  3R9F A;  4JD6 A;  4CYP A;  4C9A A;  5D29 A;  1CPX A;  1VHO A;  4BPX B;  3PFO A;  5I0C A;  1UWY A;  3CDX A;  4CAF A;  3TLB A;  5ISV A;  2ATR A;  2PJ9 A;  4UIA A;  5THW A;  1ELM P;  4RN7 A;  1HEE A;  5DWN A;  4F9U A;  1ARM A;  4Q38 A;  5A27 A;  3CPX A;  4CPA A;  2XPO A;  2ZEP A;  3R96 A;  2PIY A;  3FJU A;  3RNZ A;  2CXA A;  1VBG A;  4CRZ B;  3PT1 A;  2CY2 A;  1JQG A;  5AG4 A;  3V38 A;  1YGH A;  4IIX A;  2ZEN A;  1VIX A;  3ISX A;  4MFK A;  4NGN A;  4A4B A;  2Q4Z A;  3D67 A;  4LQG A;  4XNH B;  3ZZI A;  4A30 A;  3G3S A;  1CP7 A;  1Y7E A;  2AFZ A;  2EUI A;  1IOI A;  1S5K A;  1QST A;  4UIB A;  4CYQ A;  2ZW4 A;  4LX9 A;  3FX6 A;  1Y9Z A;  2HWG A;  4C8F A;  3WT4 A;  3PB4 X;  1ZLH A;  4C9V A;  5CPA A;  4U9Z A;  3FEC A;  5H84 A;  3TLZ A;  1FT7 A;  1PYT B;  2ZW7 A;  4OP4 A;  4XPL A;  3H8F A;  3PB6 X;  2AFU A;  2R8V A;  3WC5 A;  1XIX A;  3H5Z A;  4MHD A;  2FM4 A;  4CZ1 A;  3ISZ A;  4CS0 B;  1T36 B;  1ZRS A;  2PDO A;  2FCK A;  3JTK A;  1IIC A;  4UBR A;  5KTC A;  2CNM A;  1QSN A;  1Q2D A;  1OBR A;  3JRU A;  2GIV A;  1YLE A;  2Y0M A;  4MHY A;  2P6G A;  4OC5 A;  3VRR A;  2GAN A;  2HUZ A;  3IWG A;  1BPN A;  1RXT A;  2G3T A;  3IFE A;  3DSB A;  4L8A A;  2R82 A;  3SI1 A;  3EXN A;  3EC4 A;  4P4B A;  4MXU A;  2Q7S A;  3BUX B;  4BPW B;  4A37 A;  4UCP A;  4X2T A;  4ZY2 A;  1ZO0 A;  1MK4 A;  2ZEG A;  5IB9 A;  2HI6 A;  4TNU A;  1Z8L A;  2Z3O A;  1CX8 A;  2IL4 A;  3NH4 A;  5F9M A;  4KLV A;  4QBJ A;  3B2Y A;  4HNX B;  1A2Z A;  3ZNI A;  2D4P A;  4AVB A;  4QUS A;  3WC7 A;  3OP0 A;  4C99 A;  5HVH A;  3BXM A;  2B3U A;  2ZW6 A;  3F5B A;  1YW6 A;  2WSA A;  2XEF A;  4ZYQ A;  5JPH A;  4UWJ A;  2EZA A;  5J3X A;  3IEH A;  2YNC C;  4UEE A;  2ABZ A;  5EMI A;  4CYN A;  4R57 A;  4I49 A;  4NCZ A;  3D68 A;  3I3G A;  4ZBG A;  4PV6 A;  3TTH A;  4C2Z A;  1IOF A;  2MP0 A;  4G1P A;  4INJ A;  3TLG A;  3FH4 A;  3EZB A;  3BUM B;  1Z9U A;  1QSO A;  4LQ6 A;  4WJB A;  2REE A;  2JDC A;  4NEX A;  2WZN A;  4EWT A;  4PK3 A;  4KVO E;  1S7N A;  2DPT A;  2GP4 A;  2Z10 A;  5EBV A;  1XE4 A;  3CXQ A;  3T5M A;  3SJX A;  3VWE A;  1TIQ A;  2JBK A;  2WPW A;  3DR6 A;  1XJO A;  3PFV A;  3PP9 A;  4OC0 A;  4UF4 A;  1A9X B;  1OZP A;  3T0T A;  2NYQ A;  4ORF A;  4J0N A;  5FVJ A;  2O4H A;  1YX0 A;  4BBH A;  3TLA A;  1BO4 A;  3OWC A;  2DF5 A;  4KOX A;  3KQZ A;  2O28 A;  4JWP A;  1Y0R A;  2YNC A;  3U88 C;  1HDU A;  2Q4V A;  3D8P A;  2BSW A;  3MRU A;  1AYE A;  2QIR A;  3F8K A;  3NE8 A;  4B12 A;  1XBU A;  2ARH A;  3VRQ A;  3VRP A;  1XMT A;  4EFD A;  3EZE A;  3MN8 A;  3OB2 B;  4C8A A;  1GHE A;  3R1K A;  4NJQ A;  3F0A A;  1Q2C A;  3B3C A;  4CGN A;  1Z4R A;  1M4I A;  2J9A A;  5F09 A;  4H89 A;  4XPD C;  1YSJ A;  2Q44 A;  2D0P A;  3IWW A;  5FD8 A;  1TKH A;  1ZG8 A;  1YQE A;  3PZJ A;  4C2X A;  1EO0 A;  4NGM A;  2IQ6 A;  4MHP A;  2OR4 A;  3C26 A;  1GGO A;  3LOD A;  3O8Z A;  2FE7 A;  3BUN B;  2YND A;  2XEJ A;  3NFZ A;  4Q36 A;  2ZEE A;  3W6X A;  2B58 A;  2AFO A;  4CAE A;  6CPA A;  4XNH C;  5HKY A;  5I4M A;  3U1B A;  2VQY A;  5LRG A;  2PRQ A;  5IX3 A;  3SR3 A;  4COG A;  4YN3 A;  4FD6 A;  2XPP A;  3GY9 A;  4HNY B;  2PQ8 A;  2Z3L A;  2FT0 A;  2V8G A;  2Z3M A;  4KOV A;  2B4J C;  4W9Y A;  4NXY A;  3WR7 A;  4AVA A;  1KUV A;  2Z3N A;  2OU2 A;  1HDQ A;  3HMJ G;  1MJB A;  3CZX A;  3FXT A;  3IO1 A;  1Y7R A;  3K9U A;  2N3A B;  2UV8 G;  3HPG G;  2VI7 A;  3CXS A;  5IB0 A;  1YK3 A;  1Z2L A;  3LD2 A;  2NSM A;  4KOS A;  3TC8 A;  2Z0Z A;  3R95 A;  2J8M A;  5ELY A;  4MFJ A;  4OME A;  4UEF A;  1IYL A;  2QEC A;  4MCR A;  4FWU A;  3V8I A;  4DJL A;  4X8I A;  4A2Z A;  1U6M A;  3TO9 A;  2C6P A;  3D7D A;  4CRY B;  4YWY A;  7CPA A;  1VBH A;  2D4O A;  1WK4 A;  4OC3 A;  3I9S A;  4KS9 A;  4P45 A;  4R6T A;  4E0A A;  3V7Z A;  1SQH A;  1Z5R A;  2I3C A;  1FBV A;  3NH5 A;  4XPD B;  4C2Y A;  2ZOG A;  1LAN A;  3NE7 A;  3H8G A;  1C30 B;  4B6Z A;  1NXJ A;  2EBJ A;  3EIF A;  1XOV A;  2PJ2 A;  3SJE A;  2PE3 A;  3PRT A;  5HKW A;  1FNO A;  4IF5 A;  4R87 A;  4A94 A;  4B5P A;  1CP6 A;  3TX8 A;  4O23 A;  3BHX A;  4BPU B;  3CXP A;  3D4U A;  4JXQ A;  4MCP A;  1ON0 A;  1IU8 A;  3PGP A;  4C86 A;  2IJZ A;  3H8E A;  5D8N A;  1NMT A;  2OB0 A;  1ELL P;  4OAE A;  3SHP A;  4F6A A;  4IAV A;  4ONW A;  3KRV A;  2B4D B;  2PR1 A;  2HV2 A;  4F8Z A;  4CO9 A;  3PB9 X;  2PVW A;  4B5P B;  3SXN A;  4BIN A;  4BD9 A;  3FF3 A;  4NGP A;  2PCU A;  1KEE B;  4GXH A;  2DIK A;  2Z3P A;  2AUN A;  4C8C A;  4MHN A;  5AG5 A;  2V8V A;  3B35 A;  4ZX9 A;  5F47 A;  3FMC A;  4F9V A;  5K8P A;  1S60 A;  1BPM A;  2JDD A;  4HNW B;  1IY7 A;  3S9N A;  3TYX A;  4M6G A;  3KQX A;  4UEZ A;  1JWQ A;  4HKF A;  4TWE A;  3W6S A;  4H1H A;  1M4L A;  2PSW A;  2CNT A;  2POK A;  2G3A A;  2B0A A;  3KI9 A;  3TFY A;  3EY5 A;  3N5F A;  2AUM A;  4OKO A;  2HRO A;  3K9T A;  2PJ3 A;  4A33 A;  4R3K A;  1TF8 A;  2G9D A;  1B87 A;  1CBX A;  2F7V A;  3QAH A;  2ANP A;  5AGE A;  1JDE A;  4KNG E;  3BJ8 A;  2BUE A;  4M6I A;  3KHX A;  3ZJ0 A;  1V0C A;  3S6F A;  2PCN A;  1Z8T A;  1Q7L A;  3FYN A;  5H86 A;  3TOA A;  4JVO A;  4E5S A;  2FSR A;  4JZ0 A;  2ZEO A;  5LYF A;  4KOT A;  3SJF A;  2FVG A;  2C6C A;  2VL1 A;  2R7H A;  2V77 A;  2V8H A;  3PEI A;  1DIK A;  1P0H A;  2VZY A;  2BEI A;  4CGP A;  4P4I A;  1I12 A;  1VHS A;  5AG6 A;  4P6Y A;  3F9K C;  3B3W A;  5K8O A;  4YU9 A;  1CJW A;  2CTB A;  2FS5 A;  1Z8X A;  2ZW5 A;  2XPN A;  1S7F A;  4B13 A;  2GU2 A;  2KCW A;  4P4J A;  2PVV A;  1XF8 A;  5LYD A;  2WPX A;  1DTD A;  1ZG7 A;  2ZEF A;  2AFM A;  1CE8 B;  4PXC A;  3FRM A;  1ZG9 A;  1R57 A;  1YVO A;  4FBE A;  5CNP A;  4AVC A;  1F57 A;  4NJR A;  4QB9 A;  4H6Z A;  3BJ7 A;  2GLF A;  1CPS A;  2QYV A;  5E96 A;  4P4D A;  3VWD A;  4QC6 A;  1XRY A;  1M4D A;  2OZH A;  2ZPA A;  4MBU A;  5DS0 A;  4PPZ A;  5LYL A;  4OAD A;  3DNS A;  4Z65 A;  2AJ6 A;  2PJ4 A;  2G0B A;  3VAT A;  4A38 A;  5LRK A;  4PSW A;  5J1Q A;  4KSF A;  3RO0 A;  4A39 A;  2DPS A;  4C84 A;  3VGO A;  3IGR A;  2XEG A;  3WC6 A;  1GYT A;  2C6G A;  1V6C A;  3B8G A;  4KUB A;  1P4N A;  4RR2 B;  2DEA A;  4PXD A;  4B10 A;  1Y0Y A;  1QSM A;  4A31 A;  1C3O B;  1XF1 A;  1BLL E;  2EZB A;  2B3V A;  2A4N A;  1R61 A;  3N7Z A;  1QQ9 A;  1WWZ A;  4PK2 A;  3PBE A;  1WVM A;  4MI4 A;  4KSI A;  4UCN A;  2REF A;  3DR8 A;  5F13 A;  4ZX8 A;  1EZB A;  3IU1 A;  3IU2 A; 
#chains in the Genus database with same CATH homology
 2PJ5 A;  1KWM A;  3CT9 A;  3SI2 A;  2IMO A;  2ZEH A;  3L2N A;  4Q7A A;  2OOT A;  1R43 A;  2PIZ A;  3LMS A;  4OID A;  3WAB A;  3CPA A;  1XFO A;  3VAR A;  3FVL A;  3KR4 A;  3GUX A;  5JGF A;  2ZEL A;  3HUV A;  4C8T A;  4X3R A;  3D7G A;  4MCS A;  3FED A;  3PB8 X;  4RUH A;  3D7H A;  4MRI A;  4C8P A;  4CDJ A;  4R8F A;  2PJA A;  3RAM A;  2PJ6 A;  3VTA A;  1IGB A;  4P10 A;  4DYO A;  2O53 A;  4K3N A;  1TXR A;  1LAM A;  1PCA A;  2PJ1 A;  5HXD A;  4R7M A;  1TF9 A;  3KHZ A;  2AFS A;  3T8W A;  3S9L A;  1XMB A;  3KZW A;  2F8H A;  2GRE A;  3GLJ A;  3DLJ A;  2Q43 A;  2QJ8 A;  5CBM A;  1R3N A;  3KGQ A;  1YLO A;  4OIW A;  2EWB A;  4C9E A;  3KL9 A;  8CPA A;  4AXV A;  3HLP A;  2XEI A;  2WYR A;  4NGQ A;  3D7F A;  2PJ7 A;  5JH9 A;  2RFH A;  1RTQ A;  4PXB A;  5K8M A;  4P4E A;  2JBJ A;  1VHE A;  2QVP A;  3VH9 A;  3I74 A;  2PJB A;  3NH8 A;  1LCP A;  2Q51 A;  4TJV A;  2ZOF A;  3PBB A;  3KR5 A;  2ZEM A;  2HB6 A;  4NGR A;  3B7I A;  1F2O A;  3B3S A;  1YME A;  4C9U A;  3LWU A;  1F2P A;  4MHZ A;  4TJX A;  4P4F A;  4ZY0 A;  5HVG A;  3PFE A;  4WWV A;  3RBU A;  2RB7 A;  3ICU A;  1CG2 A;  4OC2 A;  5HVF A;  3IJ3 A;  5JM6 A;  1LFW A;  1DE4 C;  1YW4 A;  3KAS A;  4ZI6 A;  3NA6 A;  3B3V A;  4PQA A;  1NSA A;  4NGS A;  1LOK A;  3QNV A;  2BOA A;  3IC1 A;  4DUK A;  2EK8 A;  3IIB A;  4GM5 A;  4C9R A;  4OC1 A;  4C85 A;  4EME A;  3B3T A;  3DGV A;  5IR2 A;  4H2K A;  3FEE A;  4CDK A;  1BAV A;  1H8L A;  2CIJ A;  1LAP A;  1ARL A;  4FUU A;  4FAI A;  3I1U A;  3S9M A;  4R76 A;  4NGT A;  1TKF A;  4NFR A;  4JYW A;  3RZA A;  2HC9 A;  2PJ0 A;  2GLJ A;  3I6S A;  1AMP A;  3SJG A;  4P44 A;  1QMU A;  2BCO A;  1TKJ A;  5K8N A;  3BI0 A;  2V8D A;  3BI1 A;  4IK2 A;  4ZY1 A;  4PXE A;  2BO9 A;  3SI0 A;  2PJ8 A;  2AFW A;  2ZED A;  3GB0 A;  2EK9 A;  2CF4 A;  5LRJ A;  1ZLI A;  1VGY A;  2C1C A;  4OC4 A;  3D66 A;  3PB7 X;  2CTC A;  2AFX A;  4IHM A;  2JEW A;  3K2K A;  4MMO A;  5LYI A;  4MCQ A;  2PJC A;  2C5Q A;  1EE3 P;  4C9A A;  5D29 A;  1CPX A;  3PFO A;  1VHO A;  1UWY A;  3CDX A;  4UIA A;  2PJ9 A;  1ELM P;  1HEE A;  4F9U A;  1ARM A;  3CPX A;  4CPA A;  2ZEP A;  2PIY A;  3FJU A;  1JQG A;  3V38 A;  4C8U A;  2ZEN A;  1VIX A;  3ISX A;  4NGN A;  3D67 A;  2Q4Z A;  4LQG A;  1CP7 A;  1Y7E A;  2AFZ A;  4UIB A;  4C8F A;  1Y9Z A;  3FX6 A;  3WT4 A;  3PB4 X;  1ZLH A;  4C9V A;  5CPA A;  3FEC A;  1FT7 A;  1PYT B;  4OP4 A;  3H8F A;  3PB6 X;  2AFU A;  3WC5 A;  3ISZ A;  3JRU A;  1OBR A;  4MHY A;  4OC5 A;  1BPN A;  3IFE A;  3SI1 A;  4P4B A;  4MXU A;  4A37 A;  4X2T A;  4ZY2 A;  2ZEG A;  5IB9 A;  4TNU A;  1Z8L A;  1CX8 A;  3NH4 A;  3B2Y A;  4C99 A;  3WC7 A;  5HVH A;  3BXM A;  1YW6 A;  4ZYQ A;  2XEF A;  3IEH A;  4UEE A;  2ABZ A;  3D68 A;  4G1P A;  3FH4 A;  4WJB A;  2WZN A;  4EWT A;  2GP4 A;  3SJX A;  2JBK A;  1XJO A;  4OC0 A;  4UF4 A;  2NYQ A;  2O4H A;  3KQZ A;  5THW A;  1Y0R A;  5J1Q A;  1HDU A;  3MRU A;  1AYE A;  1XBU A;  4EFD A;  3MN8 A;  4C8A A;  4NJQ A;  3B3C A;  2J9A A;  5F09 A;  1YSJ A;  3IWW A;  1TKH A;  1ZG8 A;  4NGM A;  2IQ6 A;  4MHP A;  2OR4 A;  3NFZ A;  2XEJ A;  2ZEE A;  6CPA A;  2AFO A;  5I4M A;  5LRG A;  2PRQ A;  4YN3 A;  2V8G A;  4W9Y A;  1HDQ A;  3IO1 A;  1Z2L A;  2NSM A;  3TC8 A;  5ELY A;  4OME A;  4UEF A;  4DJL A;  4MCR A;  4FWU A;  4X8I A;  7CPA A;  2C6P A;  3D7D A;  4YWY A;  4OC3 A;  4R6T A;  4P45 A;  3V7Z A;  2I3C A;  1Z5R A;  3NH5 A;  2ZOG A;  1LAN A;  3H8G A;  4B6Z A;  3EIF A;  2PJ2 A;  3SJE A;  2PE3 A;  3PRT A;  1FNO A;  4A94 A;  1CP6 A;  3TX8 A;  4O23 A;  3BHX A;  4C86 A;  3D4U A;  4MCP A;  2IJZ A;  3H8E A;  5D8N A;  1ELL P;  4IAV A;  4ONW A;  4F8Z A;  3PB9 X;  2PVW A;  4BD9 A;  3FF3 A;  4NGP A;  2PCU A;  4C8C A;  4MHN A;  2V8V A;  3B35 A;  4ZX9 A;  4F9V A;  3FMC A;  5K8P A;  1BPM A;  1IY7 A;  3S9N A;  3KQX A;  4UEZ A;  4TWE A;  1M4L A;  2POK A;  3KI9 A;  3N5F A;  4OKO A;  3K9T A;  2PJ3 A;  1TF8 A;  2G9D A;  2F7V A;  1CBX A;  2ANP A;  4KNG E;  3KHX A;  1Q7L A;  2ZEO A;  4JZ0 A;  5LYF A;  3SJF A;  2FVG A;  2C6C A;  2VL1 A;  2V77 A;  2V8H A;  3PEI A;  4P4I A;  4P6Y A;  3B3W A;  5K8O A;  4YU9 A;  2CTB A;  2GU2 A;  4P4J A;  2PVV A;  5LYD A;  1DTD A;  1ZG7 A;  2ZEF A;  2AFM A;  4PXC A;  1ZG9 A;  4FBE A;  1F57 A;  4NJR A;  2GLF A;  1CPS A;  2QYV A;  4P4D A;  1XRY A;  5DS0 A;  4PPZ A;  5LYL A;  4Z65 A;  2PJ4 A;  4A38 A;  5LRK A;  3VAT A;  4A39 A;  4C84 A;  2XEG A;  3WC6 A;  1GYT A;  2C6G A;  1V6C A;  2DEA A;  4PXD A;  1Y0Y A;  1XF1 A;  1BLL E;  1QQ9 A;  1WVM A;  3PBE A;  4KSI A;  4ZX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...