1B7BA

Carbamate kinase from enterococcus faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
307
structure length
307
Chain Sequence
GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbamate kinase: New structural machinery for making carbamoyl phosphate, the common precursor of pyrimidines and arginine.
pubmed rcsb
molecule tags Transferase
molecule keywords CARBAMATE KINASE
total genus 97
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 1999-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 1b7bA00
4NDOA 3LKKA 3EK5A 1GSJA 4NDQA 3ZZIA 3AB4A 3KZFA 2X2WA 3C1NA 2WXBA 2J5VA 4OLCA 2AKOA 1OH9A 3ZZGA 2BNDA 3LL5A 3S6GA 3NWYA 4F6TA 4A7XA 4USJA 2J4KA 3LL9A 3QUOA 4I49A 3S6HA 2J4JA 3QVHA 2VA1A 3K4OA 3ZZHA 4AB7A 4NDQB 1GS5A 1OHAA 3C20A 4JZ8A 2BTYA 4Q1TA 3K52A 2R8VA 3D2PA 2BRXA 2OGXB 3K56A 2A1FA 3ZZFA 2AP9A 4JZ9A 3K4YA 3B8GA 3QURA 1Z9DA 3D41A 2J0XA 3T7BA 2IJ9A 2JJ4A 2WE5A 4NDRA 1OHBA 3S6KA 3AAWA 4NDRB 1B7BA 2JI5A 4NDPA 2J0WA 2WE4A 3AB2A 4F6TB 1YBDA 2V5HA 2J4LA 2J5TA 3D2MA 2E9YA 4JZ7A 2BUFA 2BNFA 3QVFA 3WWMA 2R98A 3L86A 2RD5A 1E19A 4A7WA 2JJXA 3U6UA 3QUNA 2BNEA 4KZTA 3EK6A 2BMUA 3WWNA 2BRIA 3C1MA 2W21A 2CDQA 3L76A 2HMFA 4NDOB 2V4YA 4AXSA 4NDPB 3TVIA 2OGXA 3D40A
chains in the Genus database with same CATH superfamily
4NDOA 3LKKA 3EK5A 1GSJA 4NDQA 3ZZIA 3AB4A 3KZFA 2X2WA 3C1NA 2WXBA 2J5VA 4OLCA 2AKOA 1OH9A 3ZZGA 2BNDA 3LL5A 3S6GA 3NWYA 4F6TA 4A7XA 4USJA 2J4KA 3LL9A 3QUOA 4I49A 3S6HA 2J4JA 3QVHA 2VA1A 3K4OA 3ZZHA 4AB7A 4NDQB 1GS5A 1OHAA 3C20A 4JZ8A 2BTYA 4Q1TA 3K52A 2R8VA 3D2PA 2BRXA 2OGXB 3K56A 2A1FA 3ZZFA 2AP9A 4JZ9A 3K4YA 3B8GA 3QURA 1Z9DA 3D41A 2J0XA 3T7BA 2IJ9A 2JJ4A 2WE5A 4NDRA 1OHBA 3S6KA 3AAWA 4NDRB 1B7BA 2JI5A 4NDPA 2J0WA 2WE4A 3AB2A 4F6TB 1YBDA 2V5HA 2J4LA 2J5TA 3D2MA 2E9YA 4JZ7A 2BUFA 2BNFA 3QVFA 3WWMA 2R98A 3L86A 2RD5A 1E19A 4A7WA 2JJXA 3U6UA 3QUNA 2BNEA 4KZTA 3EK6A 2BMUA 3WWNA 2BRIA 3C1MA 2W21A 2CDQA 3L76A 2HMFA 4NDOB 2V4YA 4AXSA 4NDPB 3TVIA 2OGXA 3D40A
chains in the Genus database with same CATH topology
4NDOA 3LKKA 3EK5A 1GSJA 4NDQA 3ZZIA 3AB4A 3KZFA 2X2WA 3C1NA 2WXBA 2J5VA 4OLCA 2AKOA 1OH9A 3ZZGA 2BNDA 3LL5A 3S6GA 3NWYA 4F6TA 4A7XA 4USJA 2J4KA 3LL9A 3QUOA 4I49A 3S6HA 2J4JA 3QVHA 2VA1A 3K4OA 3ZZHA 4AB7A 4NDQB 1GS5A 1OHAA 3C20A 4JZ8A 2BTYA 4Q1TA 3K52A 2R8VA 3D2PA 2BRXA 2OGXB 3K56A 2A1FA 3ZZFA 2AP9A 4JZ9A 3K4YA 3B8GA 3QURA 1Z9DA 3D41A 2J0XA 3T7BA 2IJ9A 2JJ4A 2WE5A 4NDRA 1OHBA 3S6KA 3AAWA 4NDRB 1B7BA 2JI5A 4NDPA 2J0WA 2WE4A 3AB2A 4F6TB 1YBDA 2V5HA 2J4LA 2J5TA 3D2MA 2E9YA 4JZ7A 2BUFA 2BNFA 3QVFA 3WWMA 2R98A 3L86A 2RD5A 1E19A 4A7WA 2JJXA 3U6UA 3QUNA 2BNEA 4KZTA 3EK6A 2BMUA 3WWNA 2BRIA 3C1MA 2W21A 2CDQA 3L76A 2HMFA 4NDOB 2V4YA 4AXSA 4NDPB 3TVIA 2OGXA 3D40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDO A;  3LKK A;  3EK5 A;  1GSJ A;  4NDQ A;  3ZZI A;  3AB4 A;  3KZF A;  2X2W A;  3C1N A;  2WXB A;  2J5V A;  4OLC A;  2AKO A;  1OH9 A;  3ZZG A;  2BND A;  3LL5 A;  3S6G A;  3NWY A;  4F6T A;  4A7X A;  4USJ A;  2J4K A;  3LL9 A;  3QUO A;  4I49 A;  3S6H A;  2J4J A;  3QVH A;  2VA1 A;  3K4O A;  3ZZH A;  4AB7 A;  4NDQ B;  1GS5 A;  1OHA A;  3C20 A;  4JZ8 A;  2BTY A;  4Q1T A;  3K52 A;  2R8V A;  3D2P A;  2BRX A;  2OGX B;  3K56 A;  2A1F A;  3ZZF A;  2AP9 A;  4JZ9 A;  3K4Y A;  3B8G A;  3QUR A;  1Z9D A;  3D41 A;  2J0X A;  3T7B A;  2IJ9 A;  2JJ4 A;  2WE5 A;  4NDR A;  1OHB A;  3S6K A;  3AAW A;  4NDR B;  1B7B A;  2JI5 A;  4NDP A;  2J0W A;  2WE4 A;  3AB2 A;  4F6T B;  1YBD A;  2V5H A;  2J4L A;  2J5T A;  3D2M A;  2E9Y A;  4JZ7 A;  2BUF A;  2BNF A;  3QVF A;  3WWM A;  2R98 A;  3L86 A;  2RD5 A;  1E19 A;  4A7W A;  2JJX A;  3U6U A;  3QUN A;  2BNE A;  4KZT A;  3EK6 A;  2BMU A;  3WWN A;  2BRI A;  3C1M A;  2W21 A;  2CDQ A;  3L76 A;  2HMF A;  4NDO B;  2V4Y A;  4AXS A;  4NDP B;  3TVI A;  2OGX A;  3D40 A; 
#chains in the Genus database with same CATH topology
 4NDO A;  3LKK A;  3EK5 A;  1GSJ A;  4NDQ A;  3ZZI A;  3AB4 A;  3KZF A;  2X2W A;  3C1N A;  2WXB A;  2J5V A;  4OLC A;  2AKO A;  1OH9 A;  3ZZG A;  2BND A;  3LL5 A;  3S6G A;  3NWY A;  4F6T A;  4A7X A;  4USJ A;  2J4K A;  3LL9 A;  3QUO A;  4I49 A;  3S6H A;  2J4J A;  3QVH A;  2VA1 A;  3K4O A;  3ZZH A;  4AB7 A;  4NDQ B;  1GS5 A;  1OHA A;  3C20 A;  4JZ8 A;  2BTY A;  4Q1T A;  3K52 A;  2R8V A;  3D2P A;  2BRX A;  2OGX B;  3K56 A;  2A1F A;  3ZZF A;  2AP9 A;  4JZ9 A;  3K4Y A;  3B8G A;  3QUR A;  1Z9D A;  3D41 A;  2J0X A;  3T7B A;  2IJ9 A;  2JJ4 A;  2WE5 A;  4NDR A;  1OHB A;  3S6K A;  3AAW A;  4NDR B;  1B7B A;  2JI5 A;  4NDP A;  2J0W A;  2WE4 A;  3AB2 A;  4F6T B;  1YBD A;  2V5H A;  2J4L A;  2J5T A;  3D2M A;  2E9Y A;  4JZ7 A;  2BUF A;  2BNF A;  3QVF A;  3WWM A;  2R98 A;  3L86 A;  2RD5 A;  1E19 A;  4A7W A;  2JJX A;  3U6U A;  3QUN A;  2BNE A;  4KZT A;  3EK6 A;  2BMU A;  3WWN A;  2BRI A;  3C1M A;  2W21 A;  2CDQ A;  3L76 A;  2HMF A;  4NDO B;  2V4Y A;  4AXS A;  4NDP B;  3TVI A;  2OGX A;  3D40 A; 
#chains in the Genus database with same CATH homology
 4NDO A;  3LKK A;  3EK5 A;  1GSJ A;  4NDQ A;  3ZZI A;  3AB4 A;  3KZF A;  2X2W A;  3C1N A;  2WXB A;  2J5V A;  4OLC A;  2AKO A;  1OH9 A;  3ZZG A;  2BND A;  3LL5 A;  3S6G A;  3NWY A;  4F6T A;  4A7X A;  4USJ A;  2J4K A;  3LL9 A;  3QUO A;  4I49 A;  3S6H A;  2J4J A;  3QVH A;  2VA1 A;  3K4O A;  3ZZH A;  4AB7 A;  4NDQ B;  1GS5 A;  1OHA A;  3C20 A;  4JZ8 A;  2BTY A;  4Q1T A;  3K52 A;  2R8V A;  3D2P A;  2BRX A;  2OGX B;  3K56 A;  2A1F A;  3ZZF A;  2AP9 A;  4JZ9 A;  3K4Y A;  3B8G A;  3QUR A;  1Z9D A;  3D41 A;  2J0X A;  3T7B A;  2IJ9 A;  2JJ4 A;  2WE5 A;  4NDR A;  1OHB A;  3S6K A;  3AAW A;  4NDR B;  1B7B A;  2JI5 A;  4NDP A;  2J0W A;  2WE4 A;  3AB2 A;  4F6T B;  1YBD A;  2V5H A;  2J4L A;  2J5T A;  3D2M A;  2E9Y A;  4JZ7 A;  2BUF A;  2BNF A;  3QVF A;  3WWM A;  2R98 A;  3L86 A;  2RD5 A;  1E19 A;  4A7W A;  2JJX A;  3U6U A;  3QUN A;  2BNE A;  4KZT A;  3EK6 A;  2BMU A;  3WWN A;  2BRI A;  3C1M A;  2W21 A;  2CDQ A;  3L76 A;  2HMF A;  4NDO B;  2V4Y A;  4AXS A;  4NDP B;  3TVI A;  2OGX A;  3D40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...