1B7BA

Carbamate kinase from enterococcus faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
307
structure length
307
Chain Sequence
b'GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBAMATE KINASE
publication title Carbamate kinase: New structural machinery for making carbamoyl phosphate, the common precursor of pyrimidines and arginine.
pubmed rcsb
molecule tags Transferase
total genus 97
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 1999-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 1b7bA00
2J4JA 2OGXB 3LL9A 3EK5A 3ZZFA 2J4KA 4KZTA 3C1MA 3EK6A 3S6GA 3AB2A 2BNEA 3KZFA 2BUFA 1OHAA 2BNDA 2OGXA 2RD5A 3AB4A 2IJ9A 2JJ4A 3S6HA 4OLCA 2BNFA 2J5VA 3K4OA 1B7BA 3T7BA 3ZZIA 3L76A 3QUOA 2AKOA 1GSJA 4NDRB 4JZ7A 3AAWA 3L86A 3K4YA 4F6TA 3QUNA 4NDRA 3B8GA 2E9YA 2AP9A 2BMUA 2BRXA 2X2WA 2R98A 2VA1A 4AB7A 3K52A 3NWYA 4F6TB 3ZZGA 3D40A 4A7WA 1OH9A 2BRIA 1Z9DA 2J0XA 3C1NA 3K56A 2WXBA 3U6UA 3D2MA 4NDOA 2R8VA 4JZ8A 2HMFA 3D2PA 4NDQA 3WWMA 3WWNA 4Q1TA 3TVIA 3LKKA 1GS5A 4NDPB 3QURA 3QVHA 4A7XA 3QVFA 2WE4A 3LL5A 1YBDA 2V5HA 4USJA 4JZ9A 4NDOB 2W21A 4NDPA 4NDQB 2J5TA 4AXSA 3ZZHA 2V4YA 2J4LA 2J0WA 2A1FA 2WE5A 1OHBA 4I49A 2JI5A 3C20A 1E19A 2CDQA 3S6KA 2BTYA 2JJXA 3D41A
chains in the Genus database with same CATH superfamily
2J4JA 2OGXB 3LL9A 3EK5A 3ZZFA 2J4KA 4KZTA 3C1MA 3EK6A 3S6GA 3AB2A 2BNEA 3KZFA 2BUFA 1OHAA 2BNDA 2OGXA 2RD5A 3AB4A 2IJ9A 2JJ4A 3S6HA 4OLCA 2BNFA 2J5VA 3K4OA 1B7BA 3T7BA 3ZZIA 3L76A 3QUOA 2AKOA 1GSJA 4NDRB 4JZ7A 3AAWA 3L86A 3K4YA 4F6TA 3QUNA 4NDRA 3B8GA 2E9YA 2AP9A 2BMUA 2BRXA 2X2WA 2R98A 2VA1A 4AB7A 3K52A 3NWYA 4F6TB 3ZZGA 3D40A 4A7WA 1OH9A 2BRIA 1Z9DA 2J0XA 3C1NA 3K56A 2WXBA 3U6UA 3D2MA 4NDOA 2R8VA 4JZ8A 2HMFA 3D2PA 4NDQA 3WWMA 3WWNA 4Q1TA 3TVIA 3LKKA 1GS5A 4NDPB 3QURA 3QVHA 4A7XA 3QVFA 2WE4A 3LL5A 1YBDA 2V5HA 4USJA 4JZ9A 4NDOB 2W21A 4NDPA 4NDQB 2J5TA 4AXSA 3ZZHA 2V4YA 2J4LA 2J0WA 2A1FA 2WE5A 1OHBA 4I49A 2JI5A 3C20A 1E19A 2CDQA 3S6KA 2BTYA 2JJXA 3D41A
chains in the Genus database with same CATH topology
2J4JA 2OGXB 3LL9A 3EK5A 3ZZFA 2J4KA 4KZTA 3C1MA 3EK6A 3S6GA 3AB2A 2BNEA 3KZFA 2BUFA 1OHAA 2BNDA 2OGXA 2RD5A 3AB4A 2IJ9A 2JJ4A 3S6HA 4OLCA 2BNFA 2J5VA 3K4OA 1B7BA 3T7BA 3ZZIA 3L76A 3QUOA 2AKOA 1GSJA 4NDRB 4JZ7A 3AAWA 3L86A 3K4YA 4F6TA 3QUNA 4NDRA 3B8GA 2E9YA 2AP9A 2BMUA 2BRXA 2X2WA 2R98A 2VA1A 4AB7A 3K52A 3NWYA 4F6TB 3ZZGA 3D40A 4A7WA 1OH9A 2BRIA 1Z9DA 2J0XA 3C1NA 3K56A 2WXBA 3U6UA 3D2MA 4NDOA 2R8VA 4JZ8A 2HMFA 3D2PA 4NDQA 3WWMA 3WWNA 4Q1TA 3TVIA 3LKKA 1GS5A 4NDPB 3QURA 3QVHA 4A7XA 3QVFA 2WE4A 3LL5A 1YBDA 2V5HA 4USJA 4JZ9A 4NDOB 2W21A 4NDPA 4NDQB 2J5TA 4AXSA 3ZZHA 2V4YA 2J4LA 2J0WA 2A1FA 2WE5A 1OHBA 4I49A 2JI5A 3C20A 1E19A 2CDQA 3S6KA 2BTYA 2JJXA 3D41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J4J A;  2OGX B;  3LL9 A;  3EK5 A;  3ZZF A;  2J4K A;  4KZT A;  3C1M A;  3EK6 A;  3S6G A;  3AB2 A;  2BNE A;  3KZF A;  2BUF A;  1OHA A;  2BND A;  2OGX A;  2RD5 A;  3AB4 A;  2IJ9 A;  2JJ4 A;  3S6H A;  4OLC A;  2BNF A;  2J5V A;  3K4O A;  1B7B A;  3T7B A;  3ZZI A;  3L76 A;  3QUO A;  2AKO A;  1GSJ A;  4NDR B;  4JZ7 A;  3AAW A;  3L86 A;  3K4Y A;  4F6T A;  3QUN A;  4NDR A;  3B8G A;  2E9Y A;  2AP9 A;  2BMU A;  2BRX A;  2X2W A;  2R98 A;  2VA1 A;  4AB7 A;  3K52 A;  3NWY A;  4F6T B;  3ZZG A;  3D40 A;  4A7W A;  1OH9 A;  2BRI A;  1Z9D A;  2J0X A;  3C1N A;  3K56 A;  2WXB A;  3U6U A;  3D2M A;  4NDO A;  2R8V A;  4JZ8 A;  2HMF A;  3D2P A;  4NDQ A;  3WWM A;  3WWN A;  4Q1T A;  3TVI A;  3LKK A;  1GS5 A;  4NDP B;  3QUR A;  3QVH A;  4A7X A;  3QVF A;  2WE4 A;  3LL5 A;  1YBD A;  2V5H A;  4USJ A;  4JZ9 A;  4NDO B;  2W21 A;  4NDP A;  4NDQ B;  2J5T A;  4AXS A;  3ZZH A;  2V4Y A;  2J4L A;  2J0W A;  2A1F A;  2WE5 A;  1OHB A;  4I49 A;  2JI5 A;  3C20 A;  1E19 A;  2CDQ A;  3S6K A;  2BTY A;  2JJX A;  3D41 A; 
#chains in the Genus database with same CATH topology
 2J4J A;  2OGX B;  3LL9 A;  3EK5 A;  3ZZF A;  2J4K A;  4KZT A;  3C1M A;  3EK6 A;  3S6G A;  3AB2 A;  2BNE A;  3KZF A;  2BUF A;  1OHA A;  2BND A;  2OGX A;  2RD5 A;  3AB4 A;  2IJ9 A;  2JJ4 A;  3S6H A;  4OLC A;  2BNF A;  2J5V A;  3K4O A;  1B7B A;  3T7B A;  3ZZI A;  3L76 A;  3QUO A;  2AKO A;  1GSJ A;  4NDR B;  4JZ7 A;  3AAW A;  3L86 A;  3K4Y A;  4F6T A;  3QUN A;  4NDR A;  3B8G A;  2E9Y A;  2AP9 A;  2BMU A;  2BRX A;  2X2W A;  2R98 A;  2VA1 A;  4AB7 A;  3K52 A;  3NWY A;  4F6T B;  3ZZG A;  3D40 A;  4A7W A;  1OH9 A;  2BRI A;  1Z9D A;  2J0X A;  3C1N A;  3K56 A;  2WXB A;  3U6U A;  3D2M A;  4NDO A;  2R8V A;  4JZ8 A;  2HMF A;  3D2P A;  4NDQ A;  3WWM A;  3WWN A;  4Q1T A;  3TVI A;  3LKK A;  1GS5 A;  4NDP B;  3QUR A;  3QVH A;  4A7X A;  3QVF A;  2WE4 A;  3LL5 A;  1YBD A;  2V5H A;  4USJ A;  4JZ9 A;  4NDO B;  2W21 A;  4NDP A;  4NDQ B;  2J5T A;  4AXS A;  3ZZH A;  2V4Y A;  2J4L A;  2J0W A;  2A1F A;  2WE5 A;  1OHB A;  4I49 A;  2JI5 A;  3C20 A;  1E19 A;  2CDQ A;  3S6K A;  2BTY A;  2JJX A;  3D41 A; 
#chains in the Genus database with same CATH homology
 2J4J A;  2OGX B;  3LL9 A;  3EK5 A;  3ZZF A;  2J4K A;  4KZT A;  3C1M A;  3EK6 A;  3S6G A;  3AB2 A;  2BNE A;  3KZF A;  2BUF A;  1OHA A;  2BND A;  2OGX A;  2RD5 A;  3AB4 A;  2IJ9 A;  2JJ4 A;  3S6H A;  4OLC A;  2BNF A;  2J5V A;  3K4O A;  1B7B A;  3T7B A;  3ZZI A;  3L76 A;  3QUO A;  2AKO A;  1GSJ A;  4NDR B;  4JZ7 A;  3AAW A;  3L86 A;  3K4Y A;  4F6T A;  3QUN A;  4NDR A;  3B8G A;  2E9Y A;  2AP9 A;  2BMU A;  2BRX A;  2X2W A;  2R98 A;  2VA1 A;  4AB7 A;  3K52 A;  3NWY A;  4F6T B;  3ZZG A;  3D40 A;  4A7W A;  1OH9 A;  2BRI A;  1Z9D A;  2J0X A;  3C1N A;  3K56 A;  2WXB A;  3U6U A;  3D2M A;  4NDO A;  2R8V A;  4JZ8 A;  2HMF A;  3D2P A;  4NDQ A;  3WWM A;  3WWN A;  4Q1T A;  3TVI A;  3LKK A;  1GS5 A;  4NDP B;  3QUR A;  3QVH A;  4A7X A;  3QVF A;  2WE4 A;  3LL5 A;  1YBD A;  2V5H A;  4USJ A;  4JZ9 A;  4NDO B;  2W21 A;  4NDP A;  4NDQ B;  2J5T A;  4AXS A;  3ZZH A;  2V4Y A;  2J4L A;  2J0W A;  2A1F A;  2WE5 A;  1OHB A;  4I49 A;  2JI5 A;  3C20 A;  1E19 A;  2CDQ A;  3S6K A;  2BTY A;  2JJX A;  3D41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...