1B7BA

Carbamate kinase from enterococcus faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
307
structure length
307
Chain Sequence
GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbamate kinase: New structural machinery for making carbamoyl phosphate, the common precursor of pyrimidines and arginine.
pubmed rcsb
molecule tags Transferase
molecule keywords CARBAMATE KINASE
total genus 97
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 1999-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 1b7bA00
2J4JA 1E19A 2V5HA 4Q1TA 2WXBA 3QUNA 4KZTA 3EK6A 2BRXA 3D2MA 3QURA 2A1FA 3K56A 3T7BA 3WWNA 2HMFA 3QVFA 4NDQA 2OGXB 3C1NA 2BUFA 1OHAA 4NDPB 3KZFA 4NDOA 4A7WA 3D2PA 1YBDA 2J4LA 2V4YA 2JJXA 2AP9A 3AAWA 3LKKA 3AB4A 3TVIA 2W21A 2CDQA 2BNFA 2J0XA 3L76A 2BTYA 2BRIA 2OGXA 4NDQB 4NDRA 4NDOB 1GS5A 3ZZGA 2R8VA 3NWYA 2BNEA 4OLCA 1GSJA 2J5VA 2WE4A 3ZZIA 1OHBA 3B8GA 2J4KA 3S6GA 2BMUA 3L86A 2IJ9A 3QVHA 4AXSA 1Z9DA 3K52A 2JI5A 4AB7A 2J5TA 4JZ8A 2BNDA 2R98A 2VA1A 3C1MA 4JZ7A 2AKOA 3C20A 4NDRB 4F6TA 3S6KA 2JJ4A 2X2WA 3AB2A 3U6UA 3D40A 3QUOA 3S6HA 3WWMA 2J0WA 3LL9A 1B7BA 2E9YA 2RD5A 2WE5A 3LL5A 3K4YA 4A7XA 1OH9A 4I49A 4USJA 3D41A 3K4OA 3ZZFA 3ZZHA 4NDPA 4F6TB 4JZ9A 3EK5A
chains in the Genus database with same CATH superfamily
2J4JA 1E19A 2V5HA 4Q1TA 2WXBA 3QUNA 4KZTA 3EK6A 2BRXA 3D2MA 3QURA 2A1FA 3K56A 3T7BA 3WWNA 2HMFA 3QVFA 4NDQA 2OGXB 3C1NA 2BUFA 1OHAA 4NDPB 3KZFA 4NDOA 4A7WA 3D2PA 1YBDA 2J4LA 2V4YA 2JJXA 2AP9A 3AAWA 3LKKA 3AB4A 3TVIA 2W21A 2CDQA 2BNFA 2J0XA 3L76A 2BTYA 2BRIA 2OGXA 4NDQB 4NDRA 4NDOB 1GS5A 3ZZGA 2R8VA 3NWYA 2BNEA 4OLCA 1GSJA 2J5VA 2WE4A 3ZZIA 1OHBA 3B8GA 2J4KA 3S6GA 2BMUA 3L86A 2IJ9A 3QVHA 4AXSA 1Z9DA 3K52A 2JI5A 4AB7A 2J5TA 4JZ8A 2BNDA 2R98A 2VA1A 3C1MA 4JZ7A 2AKOA 3C20A 4NDRB 4F6TA 3S6KA 2JJ4A 2X2WA 3AB2A 3U6UA 3D40A 3QUOA 3S6HA 3WWMA 2J0WA 3LL9A 1B7BA 2E9YA 2RD5A 2WE5A 3LL5A 3K4YA 4A7XA 1OH9A 4I49A 4USJA 3D41A 3K4OA 3ZZFA 3ZZHA 4NDPA 4F6TB 4JZ9A 3EK5A
chains in the Genus database with same CATH topology
2J4JA 1E19A 2V5HA 4Q1TA 2WXBA 3QUNA 4KZTA 3EK6A 2BRXA 3D2MA 3QURA 2A1FA 3K56A 3T7BA 3WWNA 2HMFA 3QVFA 4NDQA 2OGXB 3C1NA 2BUFA 1OHAA 4NDPB 3KZFA 4NDOA 4A7WA 3D2PA 1YBDA 2J4LA 2V4YA 2JJXA 2AP9A 3AAWA 3LKKA 3AB4A 3TVIA 2W21A 2CDQA 2BNFA 2J0XA 3L76A 2BTYA 2BRIA 2OGXA 4NDQB 4NDRA 4NDOB 1GS5A 3ZZGA 2R8VA 3NWYA 2BNEA 4OLCA 1GSJA 2J5VA 2WE4A 3ZZIA 1OHBA 3B8GA 2J4KA 3S6GA 2BMUA 3L86A 2IJ9A 3QVHA 4AXSA 1Z9DA 3K52A 2JI5A 4AB7A 2J5TA 4JZ8A 2BNDA 2R98A 2VA1A 3C1MA 4JZ7A 2AKOA 3C20A 4NDRB 4F6TA 3S6KA 2JJ4A 2X2WA 3AB2A 3U6UA 3D40A 3QUOA 3S6HA 3WWMA 2J0WA 3LL9A 1B7BA 2E9YA 2RD5A 2WE5A 3LL5A 3K4YA 4A7XA 1OH9A 4I49A 4USJA 3D41A 3K4OA 3ZZFA 3ZZHA 4NDPA 4F6TB 4JZ9A 3EK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J4J A;  1E19 A;  2V5H A;  4Q1T A;  2WXB A;  3QUN A;  4KZT A;  3EK6 A;  2BRX A;  3D2M A;  3QUR A;  2A1F A;  3K56 A;  3T7B A;  3WWN A;  2HMF A;  3QVF A;  4NDQ A;  2OGX B;  3C1N A;  2BUF A;  1OHA A;  4NDP B;  3KZF A;  4NDO A;  4A7W A;  3D2P A;  1YBD A;  2J4L A;  2V4Y A;  2JJX A;  2AP9 A;  3AAW A;  3LKK A;  3AB4 A;  3TVI A;  2W21 A;  2CDQ A;  2BNF A;  2J0X A;  3L76 A;  2BTY A;  2BRI A;  2OGX A;  4NDQ B;  4NDR A;  4NDO B;  1GS5 A;  3ZZG A;  2R8V A;  3NWY A;  2BNE A;  4OLC A;  1GSJ A;  2J5V A;  2WE4 A;  3ZZI A;  1OHB A;  3B8G A;  2J4K A;  3S6G A;  2BMU A;  3L86 A;  2IJ9 A;  3QVH A;  4AXS A;  1Z9D A;  3K52 A;  2JI5 A;  4AB7 A;  2J5T A;  4JZ8 A;  2BND A;  2R98 A;  2VA1 A;  3C1M A;  4JZ7 A;  2AKO A;  3C20 A;  4NDR B;  4F6T A;  3S6K A;  2JJ4 A;  2X2W A;  3AB2 A;  3U6U A;  3D40 A;  3QUO A;  3S6H A;  3WWM A;  2J0W A;  3LL9 A;  1B7B A;  2E9Y A;  2RD5 A;  2WE5 A;  3LL5 A;  3K4Y A;  4A7X A;  1OH9 A;  4I49 A;  4USJ A;  3D41 A;  3K4O A;  3ZZF A;  3ZZH A;  4NDP A;  4F6T B;  4JZ9 A;  3EK5 A; 
#chains in the Genus database with same CATH topology
 2J4J A;  1E19 A;  2V5H A;  4Q1T A;  2WXB A;  3QUN A;  4KZT A;  3EK6 A;  2BRX A;  3D2M A;  3QUR A;  2A1F A;  3K56 A;  3T7B A;  3WWN A;  2HMF A;  3QVF A;  4NDQ A;  2OGX B;  3C1N A;  2BUF A;  1OHA A;  4NDP B;  3KZF A;  4NDO A;  4A7W A;  3D2P A;  1YBD A;  2J4L A;  2V4Y A;  2JJX A;  2AP9 A;  3AAW A;  3LKK A;  3AB4 A;  3TVI A;  2W21 A;  2CDQ A;  2BNF A;  2J0X A;  3L76 A;  2BTY A;  2BRI A;  2OGX A;  4NDQ B;  4NDR A;  4NDO B;  1GS5 A;  3ZZG A;  2R8V A;  3NWY A;  2BNE A;  4OLC A;  1GSJ A;  2J5V A;  2WE4 A;  3ZZI A;  1OHB A;  3B8G A;  2J4K A;  3S6G A;  2BMU A;  3L86 A;  2IJ9 A;  3QVH A;  4AXS A;  1Z9D A;  3K52 A;  2JI5 A;  4AB7 A;  2J5T A;  4JZ8 A;  2BND A;  2R98 A;  2VA1 A;  3C1M A;  4JZ7 A;  2AKO A;  3C20 A;  4NDR B;  4F6T A;  3S6K A;  2JJ4 A;  2X2W A;  3AB2 A;  3U6U A;  3D40 A;  3QUO A;  3S6H A;  3WWM A;  2J0W A;  3LL9 A;  1B7B A;  2E9Y A;  2RD5 A;  2WE5 A;  3LL5 A;  3K4Y A;  4A7X A;  1OH9 A;  4I49 A;  4USJ A;  3D41 A;  3K4O A;  3ZZF A;  3ZZH A;  4NDP A;  4F6T B;  4JZ9 A;  3EK5 A; 
#chains in the Genus database with same CATH homology
 2J4J A;  1E19 A;  2V5H A;  4Q1T A;  2WXB A;  3QUN A;  4KZT A;  3EK6 A;  2BRX A;  3D2M A;  3QUR A;  2A1F A;  3K56 A;  3T7B A;  3WWN A;  2HMF A;  3QVF A;  4NDQ A;  2OGX B;  3C1N A;  2BUF A;  1OHA A;  4NDP B;  3KZF A;  4NDO A;  4A7W A;  3D2P A;  1YBD A;  2J4L A;  2V4Y A;  2JJX A;  2AP9 A;  3AAW A;  3LKK A;  3AB4 A;  3TVI A;  2W21 A;  2CDQ A;  2BNF A;  2J0X A;  3L76 A;  2BTY A;  2BRI A;  2OGX A;  4NDQ B;  4NDR A;  4NDO B;  1GS5 A;  3ZZG A;  2R8V A;  3NWY A;  2BNE A;  4OLC A;  1GSJ A;  2J5V A;  2WE4 A;  3ZZI A;  1OHB A;  3B8G A;  2J4K A;  3S6G A;  2BMU A;  3L86 A;  2IJ9 A;  3QVH A;  4AXS A;  1Z9D A;  3K52 A;  2JI5 A;  4AB7 A;  2J5T A;  4JZ8 A;  2BND A;  2R98 A;  2VA1 A;  3C1M A;  4JZ7 A;  2AKO A;  3C20 A;  4NDR B;  4F6T A;  3S6K A;  2JJ4 A;  2X2W A;  3AB2 A;  3U6U A;  3D40 A;  3QUO A;  3S6H A;  3WWM A;  2J0W A;  3LL9 A;  1B7B A;  2E9Y A;  2RD5 A;  2WE5 A;  3LL5 A;  3K4Y A;  4A7X A;  1OH9 A;  4I49 A;  4USJ A;  3D41 A;  3K4O A;  3ZZF A;  3ZZH A;  4NDP A;  4F6T B;  4JZ9 A;  3EK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...