1B7BA

Carbamate kinase from enterococcus faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
307
structure length
307
Chain Sequence
GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbamate kinase: New structural machinery for making carbamoyl phosphate, the common precursor of pyrimidines and arginine.
pubmed rcsb
molecule keywords CARBAMATE KINASE
molecule tags Transferase
total genus 97
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 1999-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 1b7bA00
3S6KA 3NWYA 4JZ8A 3ZZHA 4OLCA 2J0XA 4I49A 3AB2A 2AP9A 2WXBA 2BTYA 2WE5A 4KZTA 3K52A 4NDQA 2JI5A 2J4LA 2BMUA 3AAWA 3ZZIA 3QUNA 4NDQB 3EK6A 3K4YA 3D2PA 2IJ9A 3S6GA 1B7BA 3AB4A 1E19A 2BNEA 3QUOA 4JZ7A 4Q1TA 4NDRA 2W21A 4NDOB 2CDQA 2R98A 2BNFA 3U6UA 4NDRB 3WWNA 2E9YA 2JJ4A 2J4KA 2J5TA 3C1NA 2V5HA 4AB7A 3KZFA 3S6HA 4NDPA 3LKKA 4F6TB 3ZZFA 2BRXA 3L86A 2JJXA 2X2WA 3D41A 4JZ9A 4A7WA 3K56A 3D40A 4NDPB 2BNDA 2RD5A 4NDOA 3QURA 2A1FA 2OGXA 4USJA 4F6TA 3EK5A 2HMFA 1GSJA 2OGXB 3D2MA 2AKOA 2J5VA 1OHAA 2BRIA 3LL9A 3TVIA 2BUFA 2WE4A 3ZZGA 1OH9A 2J0WA 3C1MA 3QVFA 3LL5A 3C20A 4AXSA 2J4JA 3K4OA 1OHBA 2V4YA 3WWMA 3L76A 3T7BA 1Z9DA 3B8GA 4A7XA 1GS5A 3QVHA 2R8VA 1YBDA 2VA1A
chains in the Genus database with same CATH superfamily
3S6KA 3NWYA 4JZ8A 3ZZHA 4OLCA 2J0XA 4I49A 3AB2A 2AP9A 2WXBA 2BTYA 2WE5A 4KZTA 3K52A 4NDQA 2JI5A 2J4LA 2BMUA 3AAWA 3ZZIA 3QUNA 4NDQB 3EK6A 3K4YA 3D2PA 2IJ9A 3S6GA 1B7BA 3AB4A 1E19A 2BNEA 3QUOA 4JZ7A 4Q1TA 4NDRA 2W21A 4NDOB 2CDQA 2R98A 2BNFA 3U6UA 4NDRB 3WWNA 2E9YA 2JJ4A 2J4KA 2J5TA 3C1NA 2V5HA 4AB7A 3KZFA 3S6HA 4NDPA 3LKKA 4F6TB 3ZZFA 2BRXA 3L86A 2JJXA 2X2WA 3D41A 4JZ9A 4A7WA 3K56A 3D40A 4NDPB 2BNDA 2RD5A 4NDOA 3QURA 2A1FA 2OGXA 4USJA 4F6TA 3EK5A 2HMFA 1GSJA 2OGXB 3D2MA 2AKOA 2J5VA 1OHAA 2BRIA 3LL9A 3TVIA 2BUFA 2WE4A 3ZZGA 1OH9A 2J0WA 3C1MA 3QVFA 3LL5A 3C20A 4AXSA 2J4JA 3K4OA 1OHBA 2V4YA 3WWMA 3L76A 3T7BA 1Z9DA 3B8GA 4A7XA 1GS5A 3QVHA 2R8VA 1YBDA 2VA1A
chains in the Genus database with same CATH topology
3S6KA 3NWYA 4JZ8A 3ZZHA 4OLCA 2J0XA 4I49A 3AB2A 2AP9A 2WXBA 2BTYA 2WE5A 4KZTA 3K52A 4NDQA 2JI5A 2J4LA 2BMUA 3AAWA 3ZZIA 3QUNA 4NDQB 3EK6A 3K4YA 3D2PA 2IJ9A 3S6GA 1B7BA 3AB4A 1E19A 2BNEA 3QUOA 4JZ7A 4Q1TA 4NDRA 2W21A 4NDOB 2CDQA 2R98A 2BNFA 3U6UA 4NDRB 3WWNA 2E9YA 2JJ4A 2J4KA 2J5TA 3C1NA 2V5HA 4AB7A 3KZFA 3S6HA 4NDPA 3LKKA 4F6TB 3ZZFA 2BRXA 3L86A 2JJXA 2X2WA 3D41A 4JZ9A 4A7WA 3K56A 3D40A 4NDPB 2BNDA 2RD5A 4NDOA 3QURA 2A1FA 2OGXA 4USJA 4F6TA 3EK5A 2HMFA 1GSJA 2OGXB 3D2MA 2AKOA 2J5VA 1OHAA 2BRIA 3LL9A 3TVIA 2BUFA 2WE4A 3ZZGA 1OH9A 2J0WA 3C1MA 3QVFA 3LL5A 3C20A 4AXSA 2J4JA 3K4OA 1OHBA 2V4YA 3WWMA 3L76A 3T7BA 1Z9DA 3B8GA 4A7XA 1GS5A 3QVHA 2R8VA 1YBDA 2VA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6K A;  3NWY A;  4JZ8 A;  3ZZH A;  4OLC A;  2J0X A;  4I49 A;  3AB2 A;  2AP9 A;  2WXB A;  2BTY A;  2WE5 A;  4KZT A;  3K52 A;  4NDQ A;  2JI5 A;  2J4L A;  2BMU A;  3AAW A;  3ZZI A;  3QUN A;  4NDQ B;  3EK6 A;  3K4Y A;  3D2P A;  2IJ9 A;  3S6G A;  1B7B A;  3AB4 A;  1E19 A;  2BNE A;  3QUO A;  4JZ7 A;  4Q1T A;  4NDR A;  2W21 A;  4NDO B;  2CDQ A;  2R98 A;  2BNF A;  3U6U A;  4NDR B;  3WWN A;  2E9Y A;  2JJ4 A;  2J4K A;  2J5T A;  3C1N A;  2V5H A;  4AB7 A;  3KZF A;  3S6H A;  4NDP A;  3LKK A;  4F6T B;  3ZZF A;  2BRX A;  3L86 A;  2JJX A;  2X2W A;  3D41 A;  4JZ9 A;  4A7W A;  3K56 A;  3D40 A;  4NDP B;  2BND A;  2RD5 A;  4NDO A;  3QUR A;  2A1F A;  2OGX A;  4USJ A;  4F6T A;  3EK5 A;  2HMF A;  1GSJ A;  2OGX B;  3D2M A;  2AKO A;  2J5V A;  1OHA A;  2BRI A;  3LL9 A;  3TVI A;  2BUF A;  2WE4 A;  3ZZG A;  1OH9 A;  2J0W A;  3C1M A;  3QVF A;  3LL5 A;  3C20 A;  4AXS A;  2J4J A;  3K4O A;  1OHB A;  2V4Y A;  3WWM A;  3L76 A;  3T7B A;  1Z9D A;  3B8G A;  4A7X A;  1GS5 A;  3QVH A;  2R8V A;  1YBD A;  2VA1 A; 
#chains in the Genus database with same CATH topology
 3S6K A;  3NWY A;  4JZ8 A;  3ZZH A;  4OLC A;  2J0X A;  4I49 A;  3AB2 A;  2AP9 A;  2WXB A;  2BTY A;  2WE5 A;  4KZT A;  3K52 A;  4NDQ A;  2JI5 A;  2J4L A;  2BMU A;  3AAW A;  3ZZI A;  3QUN A;  4NDQ B;  3EK6 A;  3K4Y A;  3D2P A;  2IJ9 A;  3S6G A;  1B7B A;  3AB4 A;  1E19 A;  2BNE A;  3QUO A;  4JZ7 A;  4Q1T A;  4NDR A;  2W21 A;  4NDO B;  2CDQ A;  2R98 A;  2BNF A;  3U6U A;  4NDR B;  3WWN A;  2E9Y A;  2JJ4 A;  2J4K A;  2J5T A;  3C1N A;  2V5H A;  4AB7 A;  3KZF A;  3S6H A;  4NDP A;  3LKK A;  4F6T B;  3ZZF A;  2BRX A;  3L86 A;  2JJX A;  2X2W A;  3D41 A;  4JZ9 A;  4A7W A;  3K56 A;  3D40 A;  4NDP B;  2BND A;  2RD5 A;  4NDO A;  3QUR A;  2A1F A;  2OGX A;  4USJ A;  4F6T A;  3EK5 A;  2HMF A;  1GSJ A;  2OGX B;  3D2M A;  2AKO A;  2J5V A;  1OHA A;  2BRI A;  3LL9 A;  3TVI A;  2BUF A;  2WE4 A;  3ZZG A;  1OH9 A;  2J0W A;  3C1M A;  3QVF A;  3LL5 A;  3C20 A;  4AXS A;  2J4J A;  3K4O A;  1OHB A;  2V4Y A;  3WWM A;  3L76 A;  3T7B A;  1Z9D A;  3B8G A;  4A7X A;  1GS5 A;  3QVH A;  2R8V A;  1YBD A;  2VA1 A; 
#chains in the Genus database with same CATH homology
 3S6K A;  3NWY A;  4JZ8 A;  3ZZH A;  4OLC A;  2J0X A;  4I49 A;  3AB2 A;  2AP9 A;  2WXB A;  2BTY A;  2WE5 A;  4KZT A;  3K52 A;  4NDQ A;  2JI5 A;  2J4L A;  2BMU A;  3AAW A;  3ZZI A;  3QUN A;  4NDQ B;  3EK6 A;  3K4Y A;  3D2P A;  2IJ9 A;  3S6G A;  1B7B A;  3AB4 A;  1E19 A;  2BNE A;  3QUO A;  4JZ7 A;  4Q1T A;  4NDR A;  2W21 A;  4NDO B;  2CDQ A;  2R98 A;  2BNF A;  3U6U A;  4NDR B;  3WWN A;  2E9Y A;  2JJ4 A;  2J4K A;  2J5T A;  3C1N A;  2V5H A;  4AB7 A;  3KZF A;  3S6H A;  4NDP A;  3LKK A;  4F6T B;  3ZZF A;  2BRX A;  3L86 A;  2JJX A;  2X2W A;  3D41 A;  4JZ9 A;  4A7W A;  3K56 A;  3D40 A;  4NDP B;  2BND A;  2RD5 A;  4NDO A;  3QUR A;  2A1F A;  2OGX A;  4USJ A;  4F6T A;  3EK5 A;  2HMF A;  1GSJ A;  2OGX B;  3D2M A;  2AKO A;  2J5V A;  1OHA A;  2BRI A;  3LL9 A;  3TVI A;  2BUF A;  2WE4 A;  3ZZG A;  1OH9 A;  2J0W A;  3C1M A;  3QVF A;  3LL5 A;  3C20 A;  4AXS A;  2J4J A;  3K4O A;  1OHB A;  2V4Y A;  3WWM A;  3L76 A;  3T7B A;  1Z9D A;  3B8G A;  4A7X A;  1GS5 A;  3QVH A;  2R8V A;  1YBD A;  2VA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...