1B7BA

Carbamate kinase from enterococcus faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
307
structure length
307
Chain Sequence
GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBAMATE KINASE
publication title Carbamate kinase: New structural machinery for making carbamoyl phosphate, the common precursor of pyrimidines and arginine.
pubmed rcsb
molecule tags Transferase
total genus 97
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 1999-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 1b7bA00
4Q1TA 3ZZFA 4F6TA 2J4LA 2R8VA 2X2WA 2J4JA 4A7XA 2J5TA 3B8GA 3AAWA 3K52A 4I49A 4KZTA 2JJ4A 3K4OA 3LKKA 2E9YA 2A1FA 3L76A 3ZZIA 3S6KA 2HMFA 3QUOA 3QVFA 4JZ8A 3U6UA 2BMUA 2BNFA 3AB2A 2V4YA 2BNDA 3C1MA 1Z9DA 2J0WA 1E19A 3ZZGA 2JI5A 4NDOA 4NDPA 3ZZHA 2J4KA 3QUNA 4NDOB 3C1NA 3EK5A 4NDPB 3T7BA 1GS5A 2RD5A 2WE4A 1B7BA 2BNEA 3AB4A 2R98A 4NDRA 1YBDA 2BTYA 2J0XA 2BRXA 3D2PA 4NDRB 1OH9A 4USJA 2W21A 3LL9A 2V5HA 3WWMA 3NWYA 4NDQA 2AP9A 4NDQB 4JZ7A 3D40A 2OGXA 2BRIA 3D2MA 4OLCA 3S6GA 3WWNA 3K4YA 2OGXB 2WE5A 3D41A 1OHBA 4AXSA 3TVIA 2CDQA 3S6HA 2JJXA 3QURA 2IJ9A 4F6TB 3L86A 2AKOA 3EK6A 4JZ9A 3K56A 3C20A 3LL5A 2J5VA 1OHAA 3QVHA 1GSJA 4AB7A 3KZFA 2WXBA 2BUFA 4A7WA 2VA1A
chains in the Genus database with same CATH superfamily
4Q1TA 3ZZFA 4F6TA 2J4LA 2R8VA 2X2WA 2J4JA 4A7XA 2J5TA 3B8GA 3AAWA 3K52A 4I49A 4KZTA 2JJ4A 3K4OA 3LKKA 2E9YA 2A1FA 3L76A 3ZZIA 3S6KA 2HMFA 3QUOA 3QVFA 4JZ8A 3U6UA 2BMUA 2BNFA 3AB2A 2V4YA 2BNDA 3C1MA 1Z9DA 2J0WA 1E19A 3ZZGA 2JI5A 4NDOA 4NDPA 3ZZHA 2J4KA 3QUNA 4NDOB 3C1NA 3EK5A 4NDPB 3T7BA 1GS5A 2RD5A 2WE4A 1B7BA 2BNEA 3AB4A 2R98A 4NDRA 1YBDA 2BTYA 2J0XA 2BRXA 3D2PA 4NDRB 1OH9A 4USJA 2W21A 3LL9A 2V5HA 3WWMA 3NWYA 4NDQA 2AP9A 4NDQB 4JZ7A 3D40A 2OGXA 2BRIA 3D2MA 4OLCA 3S6GA 3WWNA 3K4YA 2OGXB 2WE5A 3D41A 1OHBA 4AXSA 3TVIA 2CDQA 3S6HA 2JJXA 3QURA 2IJ9A 4F6TB 3L86A 2AKOA 3EK6A 4JZ9A 3K56A 3C20A 3LL5A 2J5VA 1OHAA 3QVHA 1GSJA 4AB7A 3KZFA 2WXBA 2BUFA 4A7WA 2VA1A
chains in the Genus database with same CATH topology
4Q1TA 3ZZFA 4F6TA 2J4LA 2R8VA 2X2WA 2J4JA 4A7XA 2J5TA 3B8GA 3AAWA 3K52A 4I49A 4KZTA 2JJ4A 3K4OA 3LKKA 2E9YA 2A1FA 3L76A 3ZZIA 3S6KA 2HMFA 3QUOA 3QVFA 4JZ8A 3U6UA 2BMUA 2BNFA 3AB2A 2V4YA 2BNDA 3C1MA 1Z9DA 2J0WA 1E19A 3ZZGA 2JI5A 4NDOA 4NDPA 3ZZHA 2J4KA 3QUNA 4NDOB 3C1NA 3EK5A 4NDPB 3T7BA 1GS5A 2RD5A 2WE4A 1B7BA 2BNEA 3AB4A 2R98A 4NDRA 1YBDA 2BTYA 2J0XA 2BRXA 3D2PA 4NDRB 1OH9A 4USJA 2W21A 3LL9A 2V5HA 3WWMA 3NWYA 4NDQA 2AP9A 4NDQB 4JZ7A 3D40A 2OGXA 2BRIA 3D2MA 4OLCA 3S6GA 3WWNA 3K4YA 2OGXB 2WE5A 3D41A 1OHBA 4AXSA 3TVIA 2CDQA 3S6HA 2JJXA 3QURA 2IJ9A 4F6TB 3L86A 2AKOA 3EK6A 4JZ9A 3K56A 3C20A 3LL5A 2J5VA 1OHAA 3QVHA 1GSJA 4AB7A 3KZFA 2WXBA 2BUFA 4A7WA 2VA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q1T A;  3ZZF A;  4F6T A;  2J4L A;  2R8V A;  2X2W A;  2J4J A;  4A7X A;  2J5T A;  3B8G A;  3AAW A;  3K52 A;  4I49 A;  4KZT A;  2JJ4 A;  3K4O A;  3LKK A;  2E9Y A;  2A1F A;  3L76 A;  3ZZI A;  3S6K A;  2HMF A;  3QUO A;  3QVF A;  4JZ8 A;  3U6U A;  2BMU A;  2BNF A;  3AB2 A;  2V4Y A;  2BND A;  3C1M A;  1Z9D A;  2J0W A;  1E19 A;  3ZZG A;  2JI5 A;  4NDO A;  4NDP A;  3ZZH A;  2J4K A;  3QUN A;  4NDO B;  3C1N A;  3EK5 A;  4NDP B;  3T7B A;  1GS5 A;  2RD5 A;  2WE4 A;  1B7B A;  2BNE A;  3AB4 A;  2R98 A;  4NDR A;  1YBD A;  2BTY A;  2J0X A;  2BRX A;  3D2P A;  4NDR B;  1OH9 A;  4USJ A;  2W21 A;  3LL9 A;  2V5H A;  3WWM A;  3NWY A;  4NDQ A;  2AP9 A;  4NDQ B;  4JZ7 A;  3D40 A;  2OGX A;  2BRI A;  3D2M A;  4OLC A;  3S6G A;  3WWN A;  3K4Y A;  2OGX B;  2WE5 A;  3D41 A;  1OHB A;  4AXS A;  3TVI A;  2CDQ A;  3S6H A;  2JJX A;  3QUR A;  2IJ9 A;  4F6T B;  3L86 A;  2AKO A;  3EK6 A;  4JZ9 A;  3K56 A;  3C20 A;  3LL5 A;  2J5V A;  1OHA A;  3QVH A;  1GSJ A;  4AB7 A;  3KZF A;  2WXB A;  2BUF A;  4A7W A;  2VA1 A; 
#chains in the Genus database with same CATH topology
 4Q1T A;  3ZZF A;  4F6T A;  2J4L A;  2R8V A;  2X2W A;  2J4J A;  4A7X A;  2J5T A;  3B8G A;  3AAW A;  3K52 A;  4I49 A;  4KZT A;  2JJ4 A;  3K4O A;  3LKK A;  2E9Y A;  2A1F A;  3L76 A;  3ZZI A;  3S6K A;  2HMF A;  3QUO A;  3QVF A;  4JZ8 A;  3U6U A;  2BMU A;  2BNF A;  3AB2 A;  2V4Y A;  2BND A;  3C1M A;  1Z9D A;  2J0W A;  1E19 A;  3ZZG A;  2JI5 A;  4NDO A;  4NDP A;  3ZZH A;  2J4K A;  3QUN A;  4NDO B;  3C1N A;  3EK5 A;  4NDP B;  3T7B A;  1GS5 A;  2RD5 A;  2WE4 A;  1B7B A;  2BNE A;  3AB4 A;  2R98 A;  4NDR A;  1YBD A;  2BTY A;  2J0X A;  2BRX A;  3D2P A;  4NDR B;  1OH9 A;  4USJ A;  2W21 A;  3LL9 A;  2V5H A;  3WWM A;  3NWY A;  4NDQ A;  2AP9 A;  4NDQ B;  4JZ7 A;  3D40 A;  2OGX A;  2BRI A;  3D2M A;  4OLC A;  3S6G A;  3WWN A;  3K4Y A;  2OGX B;  2WE5 A;  3D41 A;  1OHB A;  4AXS A;  3TVI A;  2CDQ A;  3S6H A;  2JJX A;  3QUR A;  2IJ9 A;  4F6T B;  3L86 A;  2AKO A;  3EK6 A;  4JZ9 A;  3K56 A;  3C20 A;  3LL5 A;  2J5V A;  1OHA A;  3QVH A;  1GSJ A;  4AB7 A;  3KZF A;  2WXB A;  2BUF A;  4A7W A;  2VA1 A; 
#chains in the Genus database with same CATH homology
 4Q1T A;  3ZZF A;  4F6T A;  2J4L A;  2R8V A;  2X2W A;  2J4J A;  4A7X A;  2J5T A;  3B8G A;  3AAW A;  3K52 A;  4I49 A;  4KZT A;  2JJ4 A;  3K4O A;  3LKK A;  2E9Y A;  2A1F A;  3L76 A;  3ZZI A;  3S6K A;  2HMF A;  3QUO A;  3QVF A;  4JZ8 A;  3U6U A;  2BMU A;  2BNF A;  3AB2 A;  2V4Y A;  2BND A;  3C1M A;  1Z9D A;  2J0W A;  1E19 A;  3ZZG A;  2JI5 A;  4NDO A;  4NDP A;  3ZZH A;  2J4K A;  3QUN A;  4NDO B;  3C1N A;  3EK5 A;  4NDP B;  3T7B A;  1GS5 A;  2RD5 A;  2WE4 A;  1B7B A;  2BNE A;  3AB4 A;  2R98 A;  4NDR A;  1YBD A;  2BTY A;  2J0X A;  2BRX A;  3D2P A;  4NDR B;  1OH9 A;  4USJ A;  2W21 A;  3LL9 A;  2V5H A;  3WWM A;  3NWY A;  4NDQ A;  2AP9 A;  4NDQ B;  4JZ7 A;  3D40 A;  2OGX A;  2BRI A;  3D2M A;  4OLC A;  3S6G A;  3WWN A;  3K4Y A;  2OGX B;  2WE5 A;  3D41 A;  1OHB A;  4AXS A;  3TVI A;  2CDQ A;  3S6H A;  2JJX A;  3QUR A;  2IJ9 A;  4F6T B;  3L86 A;  2AKO A;  3EK6 A;  4JZ9 A;  3K56 A;  3C20 A;  3LL5 A;  2J5V A;  1OHA A;  3QVH A;  1GSJ A;  4AB7 A;  3KZF A;  2WXB A;  2BUF A;  4A7W A;  2VA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...