2WE5A

Carbamate kinase from enterococcus faecalis bound to mgadp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
309
structure length
309
Chain Sequence
GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBAMATE KINASE 1
publication title Substrate Binding and Catalysis in Carbamate Kinase Ascertained by Crystallographic and Site- Directed Mutagenesis Studies. Movements and Significance of a Unique Globular Subdomain of This Key Enzyme for Fermentative ATP Production in Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 103
structure length 309
sequence length 309
chains with identical sequence B, C
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2we5A00
2HMFA 4NDOB 2J5TA 4NDPA 2R8VA 1GS5A 1B7BA 4JZ7A 2RD5A 3B8GA 2JJ4A 4F6TB 3U6UA 1E19A 2A1FA 2J0WA 2BRIA 2BUFA 4AB7A 2WE4A 3KZFA 4JZ9A 2IJ9A 2WXBA 3AB2A 3ZZIA 1OH9A 3L86A 1GSJA 3QVFA 2JI5A 3LL5A 4NDQB 4NDRA 3D2MA 4NDOA 3AB4A 4OLCA 3WWNA 3L76A 3TVIA 2CDQA 3EK5A 3S6KA 2BNEA 4F6TA 2R98A 3QURA 2JJXA 2J4JA 2BRXA 2J4KA 2V5HA 3K52A 2OGXB 2E9YA 3S6GA 4I49A 3ZZHA 2BTYA 3D41A 3K4YA 2WE5A 3LKKA 4NDQA 3QVHA 2J0XA 4JZ8A 2BNFA 1OHAA 3C1NA 3D40A 3AAWA 2BNDA 3K4OA 2VA1A 2AP9A 2J5VA 2V4YA 4A7XA 4NDPB 4A7WA 3QUNA 2OGXA 2BMUA 3K56A 3D2PA 1YBDA 4KZTA 3ZZFA 1OHBA 3C1MA 3T7BA 2AKOA 3LL9A 3NWYA 3QUOA 3S6HA 4AXSA 2J4LA 4USJA 3ZZGA 2W21A 1Z9DA 4Q1TA 3WWMA 3C20A 4NDRB 2X2WA 3EK6A
chains in the Genus database with same CATH superfamily
2HMFA 4NDOB 2J5TA 4NDPA 2R8VA 1GS5A 1B7BA 4JZ7A 2RD5A 3B8GA 2JJ4A 4F6TB 3U6UA 1E19A 2A1FA 2J0WA 2BRIA 2BUFA 4AB7A 2WE4A 3KZFA 4JZ9A 2IJ9A 2WXBA 3AB2A 3ZZIA 1OH9A 3L86A 1GSJA 3QVFA 2JI5A 3LL5A 4NDQB 4NDRA 3D2MA 4NDOA 3AB4A 4OLCA 3WWNA 3L76A 3TVIA 2CDQA 3EK5A 3S6KA 2BNEA 4F6TA 2R98A 3QURA 2JJXA 2J4JA 2BRXA 2J4KA 2V5HA 3K52A 2OGXB 2E9YA 3S6GA 4I49A 3ZZHA 2BTYA 3D41A 3K4YA 2WE5A 3LKKA 4NDQA 3QVHA 2J0XA 4JZ8A 2BNFA 1OHAA 3C1NA 3D40A 3AAWA 2BNDA 3K4OA 2VA1A 2AP9A 2J5VA 2V4YA 4A7XA 4NDPB 4A7WA 3QUNA 2OGXA 2BMUA 3K56A 3D2PA 1YBDA 4KZTA 3ZZFA 1OHBA 3C1MA 3T7BA 2AKOA 3LL9A 3NWYA 3QUOA 3S6HA 4AXSA 2J4LA 4USJA 3ZZGA 2W21A 1Z9DA 4Q1TA 3WWMA 3C20A 4NDRB 2X2WA 3EK6A
chains in the Genus database with same CATH topology
2HMFA 4NDOB 2J5TA 4NDPA 2R8VA 1GS5A 1B7BA 4JZ7A 2RD5A 3B8GA 2JJ4A 4F6TB 3U6UA 1E19A 2A1FA 2J0WA 2BRIA 2BUFA 4AB7A 2WE4A 3KZFA 4JZ9A 2IJ9A 2WXBA 3AB2A 3ZZIA 1OH9A 3L86A 1GSJA 3QVFA 2JI5A 3LL5A 4NDQB 4NDRA 3D2MA 4NDOA 3AB4A 4OLCA 3WWNA 3L76A 3TVIA 2CDQA 3EK5A 3S6KA 2BNEA 4F6TA 2R98A 3QURA 2JJXA 2J4JA 2BRXA 2J4KA 2V5HA 3K52A 2OGXB 2E9YA 3S6GA 4I49A 3ZZHA 2BTYA 3D41A 3K4YA 2WE5A 3LKKA 4NDQA 3QVHA 2J0XA 4JZ8A 2BNFA 1OHAA 3C1NA 3D40A 3AAWA 2BNDA 3K4OA 2VA1A 2AP9A 2J5VA 2V4YA 4A7XA 4NDPB 4A7WA 3QUNA 2OGXA 2BMUA 3K56A 3D2PA 1YBDA 4KZTA 3ZZFA 1OHBA 3C1MA 3T7BA 2AKOA 3LL9A 3NWYA 3QUOA 3S6HA 4AXSA 2J4LA 4USJA 3ZZGA 2W21A 1Z9DA 4Q1TA 3WWMA 3C20A 4NDRB 2X2WA 3EK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMF A;  4NDO B;  2J5T A;  4NDP A;  2R8V A;  1GS5 A;  1B7B A;  4JZ7 A;  2RD5 A;  3B8G A;  2JJ4 A;  4F6T B;  3U6U A;  1E19 A;  2A1F A;  2J0W A;  2BRI A;  2BUF A;  4AB7 A;  2WE4 A;  3KZF A;  4JZ9 A;  2IJ9 A;  2WXB A;  3AB2 A;  3ZZI A;  1OH9 A;  3L86 A;  1GSJ A;  3QVF A;  2JI5 A;  3LL5 A;  4NDQ B;  4NDR A;  3D2M A;  4NDO A;  3AB4 A;  4OLC A;  3WWN A;  3L76 A;  3TVI A;  2CDQ A;  3EK5 A;  3S6K A;  2BNE A;  4F6T A;  2R98 A;  3QUR A;  2JJX A;  2J4J A;  2BRX A;  2J4K A;  2V5H A;  3K52 A;  2OGX B;  2E9Y A;  3S6G A;  4I49 A;  3ZZH A;  2BTY A;  3D41 A;  3K4Y A;  2WE5 A;  3LKK A;  4NDQ A;  3QVH A;  2J0X A;  4JZ8 A;  2BNF A;  1OHA A;  3C1N A;  3D40 A;  3AAW A;  2BND A;  3K4O A;  2VA1 A;  2AP9 A;  2J5V A;  2V4Y A;  4A7X A;  4NDP B;  4A7W A;  3QUN A;  2OGX A;  2BMU A;  3K56 A;  3D2P A;  1YBD A;  4KZT A;  3ZZF A;  1OHB A;  3C1M A;  3T7B A;  2AKO A;  3LL9 A;  3NWY A;  3QUO A;  3S6H A;  4AXS A;  2J4L A;  4USJ A;  3ZZG A;  2W21 A;  1Z9D A;  4Q1T A;  3WWM A;  3C20 A;  4NDR B;  2X2W A;  3EK6 A; 
#chains in the Genus database with same CATH topology
 2HMF A;  4NDO B;  2J5T A;  4NDP A;  2R8V A;  1GS5 A;  1B7B A;  4JZ7 A;  2RD5 A;  3B8G A;  2JJ4 A;  4F6T B;  3U6U A;  1E19 A;  2A1F A;  2J0W A;  2BRI A;  2BUF A;  4AB7 A;  2WE4 A;  3KZF A;  4JZ9 A;  2IJ9 A;  2WXB A;  3AB2 A;  3ZZI A;  1OH9 A;  3L86 A;  1GSJ A;  3QVF A;  2JI5 A;  3LL5 A;  4NDQ B;  4NDR A;  3D2M A;  4NDO A;  3AB4 A;  4OLC A;  3WWN A;  3L76 A;  3TVI A;  2CDQ A;  3EK5 A;  3S6K A;  2BNE A;  4F6T A;  2R98 A;  3QUR A;  2JJX A;  2J4J A;  2BRX A;  2J4K A;  2V5H A;  3K52 A;  2OGX B;  2E9Y A;  3S6G A;  4I49 A;  3ZZH A;  2BTY A;  3D41 A;  3K4Y A;  2WE5 A;  3LKK A;  4NDQ A;  3QVH A;  2J0X A;  4JZ8 A;  2BNF A;  1OHA A;  3C1N A;  3D40 A;  3AAW A;  2BND A;  3K4O A;  2VA1 A;  2AP9 A;  2J5V A;  2V4Y A;  4A7X A;  4NDP B;  4A7W A;  3QUN A;  2OGX A;  2BMU A;  3K56 A;  3D2P A;  1YBD A;  4KZT A;  3ZZF A;  1OHB A;  3C1M A;  3T7B A;  2AKO A;  3LL9 A;  3NWY A;  3QUO A;  3S6H A;  4AXS A;  2J4L A;  4USJ A;  3ZZG A;  2W21 A;  1Z9D A;  4Q1T A;  3WWM A;  3C20 A;  4NDR B;  2X2W A;  3EK6 A; 
#chains in the Genus database with same CATH homology
 2HMF A;  4NDO B;  2J5T A;  4NDP A;  2R8V A;  1GS5 A;  1B7B A;  4JZ7 A;  2RD5 A;  3B8G A;  2JJ4 A;  4F6T B;  3U6U A;  1E19 A;  2A1F A;  2J0W A;  2BRI A;  2BUF A;  4AB7 A;  2WE4 A;  3KZF A;  4JZ9 A;  2IJ9 A;  2WXB A;  3AB2 A;  3ZZI A;  1OH9 A;  3L86 A;  1GSJ A;  3QVF A;  2JI5 A;  3LL5 A;  4NDQ B;  4NDR A;  3D2M A;  4NDO A;  3AB4 A;  4OLC A;  3WWN A;  3L76 A;  3TVI A;  2CDQ A;  3EK5 A;  3S6K A;  2BNE A;  4F6T A;  2R98 A;  3QUR A;  2JJX A;  2J4J A;  2BRX A;  2J4K A;  2V5H A;  3K52 A;  2OGX B;  2E9Y A;  3S6G A;  4I49 A;  3ZZH A;  2BTY A;  3D41 A;  3K4Y A;  2WE5 A;  3LKK A;  4NDQ A;  3QVH A;  2J0X A;  4JZ8 A;  2BNF A;  1OHA A;  3C1N A;  3D40 A;  3AAW A;  2BND A;  3K4O A;  2VA1 A;  2AP9 A;  2J5V A;  2V4Y A;  4A7X A;  4NDP B;  4A7W A;  3QUN A;  2OGX A;  2BMU A;  3K56 A;  3D2P A;  1YBD A;  4KZT A;  3ZZF A;  1OHB A;  3C1M A;  3T7B A;  2AKO A;  3LL9 A;  3NWY A;  3QUO A;  3S6H A;  4AXS A;  2J4L A;  4USJ A;  3ZZG A;  2W21 A;  1Z9D A;  4Q1T A;  3WWM A;  3C20 A;  4NDR B;  2X2W A;  3EK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...