2WE5A

Carbamate kinase from enterococcus faecalis bound to mgadp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
309
structure length
309
Chain Sequence
GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Binding and Catalysis in Carbamate Kinase Ascertained by Crystallographic and Site- Directed Mutagenesis Studies. Movements and Significance of a Unique Globular Subdomain of This Key Enzyme for Fermentative ATP Production in Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords CARBAMATE KINASE 1
total genus 103
structure length 309
sequence length 309
chains with identical sequence B, C
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2we5A00
4NDQA 3K4OA 3ZZFA 4NDOB 3TVIA 3LL9A 3S6KA 2VA1A 2V5HA 2V4YA 1OHAA 2J0XA 3U6UA 3EK5A 2IJ9A 4NDRB 3ZZHA 4NDPB 3S6HA 2R98A 4JZ9A 2BNDA 3D41A 3D40A 2BNEA 1Z9DA 2WE4A 3AAWA 2J0WA 3D2PA 2J4LA 2X2WA 1OH9A 3AB4A 3WWNA 4KZTA 3WWMA 3ZZGA 2AP9A 3C1MA 3L86A 3K52A 3LL5A 2WE5A 2JJXA 4USJA 4AB7A 4F6TA 2BRXA 3C1NA 2HMFA 1OHBA 4JZ8A 4JZ7A 3QVFA 3K56A 3ZZIA 3KZFA 2E9YA 3C20A 4NDPA 2CDQA 2J5TA 1B7BA 3QUNA 4NDRA 2BUFA 4AXSA 3NWYA 2OGXA 4A7WA 2OGXB 2BMUA 4NDQB 2AKOA 3QURA 1GSJA 3AB2A 4NDOA 2JJ4A 2BRIA 2WXBA 1E19A 4OLCA 4Q1TA 2R8VA 3EK6A 2BTYA 3LKKA 2J5VA 2J4KA 3B8GA 2J4JA 1YBDA 4F6TB 3T7BA 3L76A 3QVHA 3QUOA 2BNFA 2W21A 3K4YA 3S6GA 3D2MA 4A7XA 2RD5A 2A1FA 2JI5A 4I49A 1GS5A
chains in the Genus database with same CATH superfamily
4NDQA 3K4OA 3ZZFA 4NDOB 3TVIA 3LL9A 3S6KA 2VA1A 2V5HA 2V4YA 1OHAA 2J0XA 3U6UA 3EK5A 2IJ9A 4NDRB 3ZZHA 4NDPB 3S6HA 2R98A 4JZ9A 2BNDA 3D41A 3D40A 2BNEA 1Z9DA 2WE4A 3AAWA 2J0WA 3D2PA 2J4LA 2X2WA 1OH9A 3AB4A 3WWNA 4KZTA 3WWMA 3ZZGA 2AP9A 3C1MA 3L86A 3K52A 3LL5A 2WE5A 2JJXA 4USJA 4AB7A 4F6TA 2BRXA 3C1NA 2HMFA 1OHBA 4JZ8A 4JZ7A 3QVFA 3K56A 3ZZIA 3KZFA 2E9YA 3C20A 4NDPA 2CDQA 2J5TA 1B7BA 3QUNA 4NDRA 2BUFA 4AXSA 3NWYA 2OGXA 4A7WA 2OGXB 2BMUA 4NDQB 2AKOA 3QURA 1GSJA 3AB2A 4NDOA 2JJ4A 2BRIA 2WXBA 1E19A 4OLCA 4Q1TA 2R8VA 3EK6A 2BTYA 3LKKA 2J5VA 2J4KA 3B8GA 2J4JA 1YBDA 4F6TB 3T7BA 3L76A 3QVHA 3QUOA 2BNFA 2W21A 3K4YA 3S6GA 3D2MA 4A7XA 2RD5A 2A1FA 2JI5A 4I49A 1GS5A
chains in the Genus database with same CATH topology
4NDQA 3K4OA 3ZZFA 4NDOB 3TVIA 3LL9A 3S6KA 2VA1A 2V5HA 2V4YA 1OHAA 2J0XA 3U6UA 3EK5A 2IJ9A 4NDRB 3ZZHA 4NDPB 3S6HA 2R98A 4JZ9A 2BNDA 3D41A 3D40A 2BNEA 1Z9DA 2WE4A 3AAWA 2J0WA 3D2PA 2J4LA 2X2WA 1OH9A 3AB4A 3WWNA 4KZTA 3WWMA 3ZZGA 2AP9A 3C1MA 3L86A 3K52A 3LL5A 2WE5A 2JJXA 4USJA 4AB7A 4F6TA 2BRXA 3C1NA 2HMFA 1OHBA 4JZ8A 4JZ7A 3QVFA 3K56A 3ZZIA 3KZFA 2E9YA 3C20A 4NDPA 2CDQA 2J5TA 1B7BA 3QUNA 4NDRA 2BUFA 4AXSA 3NWYA 2OGXA 4A7WA 2OGXB 2BMUA 4NDQB 2AKOA 3QURA 1GSJA 3AB2A 4NDOA 2JJ4A 2BRIA 2WXBA 1E19A 4OLCA 4Q1TA 2R8VA 3EK6A 2BTYA 3LKKA 2J5VA 2J4KA 3B8GA 2J4JA 1YBDA 4F6TB 3T7BA 3L76A 3QVHA 3QUOA 2BNFA 2W21A 3K4YA 3S6GA 3D2MA 4A7XA 2RD5A 2A1FA 2JI5A 4I49A 1GS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDQ A;  3K4O A;  3ZZF A;  4NDO B;  3TVI A;  3LL9 A;  3S6K A;  2VA1 A;  2V5H A;  2V4Y A;  1OHA A;  2J0X A;  3U6U A;  3EK5 A;  2IJ9 A;  4NDR B;  3ZZH A;  4NDP B;  3S6H A;  2R98 A;  4JZ9 A;  2BND A;  3D41 A;  3D40 A;  2BNE A;  1Z9D A;  2WE4 A;  3AAW A;  2J0W A;  3D2P A;  2J4L A;  2X2W A;  1OH9 A;  3AB4 A;  3WWN A;  4KZT A;  3WWM A;  3ZZG A;  2AP9 A;  3C1M A;  3L86 A;  3K52 A;  3LL5 A;  2WE5 A;  2JJX A;  4USJ A;  4AB7 A;  4F6T A;  2BRX A;  3C1N A;  2HMF A;  1OHB A;  4JZ8 A;  4JZ7 A;  3QVF A;  3K56 A;  3ZZI A;  3KZF A;  2E9Y A;  3C20 A;  4NDP A;  2CDQ A;  2J5T A;  1B7B A;  3QUN A;  4NDR A;  2BUF A;  4AXS A;  3NWY A;  2OGX A;  4A7W A;  2OGX B;  2BMU A;  4NDQ B;  2AKO A;  3QUR A;  1GSJ A;  3AB2 A;  4NDO A;  2JJ4 A;  2BRI A;  2WXB A;  1E19 A;  4OLC A;  4Q1T A;  2R8V A;  3EK6 A;  2BTY A;  3LKK A;  2J5V A;  2J4K A;  3B8G A;  2J4J A;  1YBD A;  4F6T B;  3T7B A;  3L76 A;  3QVH A;  3QUO A;  2BNF A;  2W21 A;  3K4Y A;  3S6G A;  3D2M A;  4A7X A;  2RD5 A;  2A1F A;  2JI5 A;  4I49 A;  1GS5 A; 
#chains in the Genus database with same CATH topology
 4NDQ A;  3K4O A;  3ZZF A;  4NDO B;  3TVI A;  3LL9 A;  3S6K A;  2VA1 A;  2V5H A;  2V4Y A;  1OHA A;  2J0X A;  3U6U A;  3EK5 A;  2IJ9 A;  4NDR B;  3ZZH A;  4NDP B;  3S6H A;  2R98 A;  4JZ9 A;  2BND A;  3D41 A;  3D40 A;  2BNE A;  1Z9D A;  2WE4 A;  3AAW A;  2J0W A;  3D2P A;  2J4L A;  2X2W A;  1OH9 A;  3AB4 A;  3WWN A;  4KZT A;  3WWM A;  3ZZG A;  2AP9 A;  3C1M A;  3L86 A;  3K52 A;  3LL5 A;  2WE5 A;  2JJX A;  4USJ A;  4AB7 A;  4F6T A;  2BRX A;  3C1N A;  2HMF A;  1OHB A;  4JZ8 A;  4JZ7 A;  3QVF A;  3K56 A;  3ZZI A;  3KZF A;  2E9Y A;  3C20 A;  4NDP A;  2CDQ A;  2J5T A;  1B7B A;  3QUN A;  4NDR A;  2BUF A;  4AXS A;  3NWY A;  2OGX A;  4A7W A;  2OGX B;  2BMU A;  4NDQ B;  2AKO A;  3QUR A;  1GSJ A;  3AB2 A;  4NDO A;  2JJ4 A;  2BRI A;  2WXB A;  1E19 A;  4OLC A;  4Q1T A;  2R8V A;  3EK6 A;  2BTY A;  3LKK A;  2J5V A;  2J4K A;  3B8G A;  2J4J A;  1YBD A;  4F6T B;  3T7B A;  3L76 A;  3QVH A;  3QUO A;  2BNF A;  2W21 A;  3K4Y A;  3S6G A;  3D2M A;  4A7X A;  2RD5 A;  2A1F A;  2JI5 A;  4I49 A;  1GS5 A; 
#chains in the Genus database with same CATH homology
 4NDQ A;  3K4O A;  3ZZF A;  4NDO B;  3TVI A;  3LL9 A;  3S6K A;  2VA1 A;  2V5H A;  2V4Y A;  1OHA A;  2J0X A;  3U6U A;  3EK5 A;  2IJ9 A;  4NDR B;  3ZZH A;  4NDP B;  3S6H A;  2R98 A;  4JZ9 A;  2BND A;  3D41 A;  3D40 A;  2BNE A;  1Z9D A;  2WE4 A;  3AAW A;  2J0W A;  3D2P A;  2J4L A;  2X2W A;  1OH9 A;  3AB4 A;  3WWN A;  4KZT A;  3WWM A;  3ZZG A;  2AP9 A;  3C1M A;  3L86 A;  3K52 A;  3LL5 A;  2WE5 A;  2JJX A;  4USJ A;  4AB7 A;  4F6T A;  2BRX A;  3C1N A;  2HMF A;  1OHB A;  4JZ8 A;  4JZ7 A;  3QVF A;  3K56 A;  3ZZI A;  3KZF A;  2E9Y A;  3C20 A;  4NDP A;  2CDQ A;  2J5T A;  1B7B A;  3QUN A;  4NDR A;  2BUF A;  4AXS A;  3NWY A;  2OGX A;  4A7W A;  2OGX B;  2BMU A;  4NDQ B;  2AKO A;  3QUR A;  1GSJ A;  3AB2 A;  4NDO A;  2JJ4 A;  2BRI A;  2WXB A;  1E19 A;  4OLC A;  4Q1T A;  2R8V A;  3EK6 A;  2BTY A;  3LKK A;  2J5V A;  2J4K A;  3B8G A;  2J4J A;  1YBD A;  4F6T B;  3T7B A;  3L76 A;  3QVH A;  3QUO A;  2BNF A;  2W21 A;  3K4Y A;  3S6G A;  3D2M A;  4A7X A;  2RD5 A;  2A1F A;  2JI5 A;  4I49 A;  1GS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...