2WE5A

Carbamate kinase from enterococcus faecalis bound to mgadp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
309
structure length
309
Chain Sequence
GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Binding and Catalysis in Carbamate Kinase Ascertained by Crystallographic and Site- Directed Mutagenesis Studies. Movements and Significance of a Unique Globular Subdomain of This Key Enzyme for Fermentative ATP Production in Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords CARBAMATE KINASE 1
total genus 103
structure length 309
sequence length 309
chains with identical sequence B, C
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2we5A00
4USJA 2WE4A 4NDRB 3C1NA 3ZZGA 3LL5A 2J4JA 1YBDA 3LKKA 3S6HA 3ZZHA 4NDRA 2OGXA 3D2PA 1B7BA 4F6TB 2RD5A 2E9YA 4NDQB 1OHBA 4NDOB 3AAWA 3S6KA 2J5TA 2X2WA 2J0WA 2IJ9A 3B8GA 2BUFA 4JZ7A 2V5HA 3TVIA 3D41A 4F6TA 1OHAA 3T7BA 2BNDA 2JJ4A 4I49A 4NDQA 3QVFA 4NDPB 4NDOA 3WWMA 2W21A 2BNFA 3QUOA 3LL9A 1GSJA 3D2MA 2J4LA 3U6UA 4AXSA 3EK5A 3K4OA 4JZ9A 1OH9A 3C1MA 3L86A 2AKOA 4A7XA 2BMUA 2WE5A 2J4KA 3QVHA 4A7WA 4AB7A 2V4YA 3C20A 4OLCA 3AB2A 2BNEA 2JJXA 2HMFA 1E19A 3ZZIA 1GS5A 2R8VA 3K4YA 3K56A 3NWYA 3EK6A 2J5VA 4NDPA 4Q1TA 2BRIA 2OGXB 2J0XA 3L76A 3K52A 3QURA 3QUNA 4KZTA 2BRXA 4JZ8A 3WWNA 2CDQA 3D40A 3ZZFA 2AP9A 3KZFA 2A1FA 2BTYA 2R98A 2VA1A 3AB4A 2WXBA 2JI5A 3S6GA 1Z9DA
chains in the Genus database with same CATH superfamily
4USJA 2WE4A 4NDRB 3C1NA 3ZZGA 3LL5A 2J4JA 1YBDA 3LKKA 3S6HA 3ZZHA 4NDRA 2OGXA 3D2PA 1B7BA 4F6TB 2RD5A 2E9YA 4NDQB 1OHBA 4NDOB 3AAWA 3S6KA 2J5TA 2X2WA 2J0WA 2IJ9A 3B8GA 2BUFA 4JZ7A 2V5HA 3TVIA 3D41A 4F6TA 1OHAA 3T7BA 2BNDA 2JJ4A 4I49A 4NDQA 3QVFA 4NDPB 4NDOA 3WWMA 2W21A 2BNFA 3QUOA 3LL9A 1GSJA 3D2MA 2J4LA 3U6UA 4AXSA 3EK5A 3K4OA 4JZ9A 1OH9A 3C1MA 3L86A 2AKOA 4A7XA 2BMUA 2WE5A 2J4KA 3QVHA 4A7WA 4AB7A 2V4YA 3C20A 4OLCA 3AB2A 2BNEA 2JJXA 2HMFA 1E19A 3ZZIA 1GS5A 2R8VA 3K4YA 3K56A 3NWYA 3EK6A 2J5VA 4NDPA 4Q1TA 2BRIA 2OGXB 2J0XA 3L76A 3K52A 3QURA 3QUNA 4KZTA 2BRXA 4JZ8A 3WWNA 2CDQA 3D40A 3ZZFA 2AP9A 3KZFA 2A1FA 2BTYA 2R98A 2VA1A 3AB4A 2WXBA 2JI5A 3S6GA 1Z9DA
chains in the Genus database with same CATH topology
4USJA 2WE4A 4NDRB 3C1NA 3ZZGA 3LL5A 2J4JA 1YBDA 3LKKA 3S6HA 3ZZHA 4NDRA 2OGXA 3D2PA 1B7BA 4F6TB 2RD5A 2E9YA 4NDQB 1OHBA 4NDOB 3AAWA 3S6KA 2J5TA 2X2WA 2J0WA 2IJ9A 3B8GA 2BUFA 4JZ7A 2V5HA 3TVIA 3D41A 4F6TA 1OHAA 3T7BA 2BNDA 2JJ4A 4I49A 4NDQA 3QVFA 4NDPB 4NDOA 3WWMA 2W21A 2BNFA 3QUOA 3LL9A 1GSJA 3D2MA 2J4LA 3U6UA 4AXSA 3EK5A 3K4OA 4JZ9A 1OH9A 3C1MA 3L86A 2AKOA 4A7XA 2BMUA 2WE5A 2J4KA 3QVHA 4A7WA 4AB7A 2V4YA 3C20A 4OLCA 3AB2A 2BNEA 2JJXA 2HMFA 1E19A 3ZZIA 1GS5A 2R8VA 3K4YA 3K56A 3NWYA 3EK6A 2J5VA 4NDPA 4Q1TA 2BRIA 2OGXB 2J0XA 3L76A 3K52A 3QURA 3QUNA 4KZTA 2BRXA 4JZ8A 3WWNA 2CDQA 3D40A 3ZZFA 2AP9A 3KZFA 2A1FA 2BTYA 2R98A 2VA1A 3AB4A 2WXBA 2JI5A 3S6GA 1Z9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USJ A;  2WE4 A;  4NDR B;  3C1N A;  3ZZG A;  3LL5 A;  2J4J A;  1YBD A;  3LKK A;  3S6H A;  3ZZH A;  4NDR A;  2OGX A;  3D2P A;  1B7B A;  4F6T B;  2RD5 A;  2E9Y A;  4NDQ B;  1OHB A;  4NDO B;  3AAW A;  3S6K A;  2J5T A;  2X2W A;  2J0W A;  2IJ9 A;  3B8G A;  2BUF A;  4JZ7 A;  2V5H A;  3TVI A;  3D41 A;  4F6T A;  1OHA A;  3T7B A;  2BND A;  2JJ4 A;  4I49 A;  4NDQ A;  3QVF A;  4NDP B;  4NDO A;  3WWM A;  2W21 A;  2BNF A;  3QUO A;  3LL9 A;  1GSJ A;  3D2M A;  2J4L A;  3U6U A;  4AXS A;  3EK5 A;  3K4O A;  4JZ9 A;  1OH9 A;  3C1M A;  3L86 A;  2AKO A;  4A7X A;  2BMU A;  2WE5 A;  2J4K A;  3QVH A;  4A7W A;  4AB7 A;  2V4Y A;  3C20 A;  4OLC A;  3AB2 A;  2BNE A;  2JJX A;  2HMF A;  1E19 A;  3ZZI A;  1GS5 A;  2R8V A;  3K4Y A;  3K56 A;  3NWY A;  3EK6 A;  2J5V A;  4NDP A;  4Q1T A;  2BRI A;  2OGX B;  2J0X A;  3L76 A;  3K52 A;  3QUR A;  3QUN A;  4KZT A;  2BRX A;  4JZ8 A;  3WWN A;  2CDQ A;  3D40 A;  3ZZF A;  2AP9 A;  3KZF A;  2A1F A;  2BTY A;  2R98 A;  2VA1 A;  3AB4 A;  2WXB A;  2JI5 A;  3S6G A;  1Z9D A; 
#chains in the Genus database with same CATH topology
 4USJ A;  2WE4 A;  4NDR B;  3C1N A;  3ZZG A;  3LL5 A;  2J4J A;  1YBD A;  3LKK A;  3S6H A;  3ZZH A;  4NDR A;  2OGX A;  3D2P A;  1B7B A;  4F6T B;  2RD5 A;  2E9Y A;  4NDQ B;  1OHB A;  4NDO B;  3AAW A;  3S6K A;  2J5T A;  2X2W A;  2J0W A;  2IJ9 A;  3B8G A;  2BUF A;  4JZ7 A;  2V5H A;  3TVI A;  3D41 A;  4F6T A;  1OHA A;  3T7B A;  2BND A;  2JJ4 A;  4I49 A;  4NDQ A;  3QVF A;  4NDP B;  4NDO A;  3WWM A;  2W21 A;  2BNF A;  3QUO A;  3LL9 A;  1GSJ A;  3D2M A;  2J4L A;  3U6U A;  4AXS A;  3EK5 A;  3K4O A;  4JZ9 A;  1OH9 A;  3C1M A;  3L86 A;  2AKO A;  4A7X A;  2BMU A;  2WE5 A;  2J4K A;  3QVH A;  4A7W A;  4AB7 A;  2V4Y A;  3C20 A;  4OLC A;  3AB2 A;  2BNE A;  2JJX A;  2HMF A;  1E19 A;  3ZZI A;  1GS5 A;  2R8V A;  3K4Y A;  3K56 A;  3NWY A;  3EK6 A;  2J5V A;  4NDP A;  4Q1T A;  2BRI A;  2OGX B;  2J0X A;  3L76 A;  3K52 A;  3QUR A;  3QUN A;  4KZT A;  2BRX A;  4JZ8 A;  3WWN A;  2CDQ A;  3D40 A;  3ZZF A;  2AP9 A;  3KZF A;  2A1F A;  2BTY A;  2R98 A;  2VA1 A;  3AB4 A;  2WXB A;  2JI5 A;  3S6G A;  1Z9D A; 
#chains in the Genus database with same CATH homology
 4USJ A;  2WE4 A;  4NDR B;  3C1N A;  3ZZG A;  3LL5 A;  2J4J A;  1YBD A;  3LKK A;  3S6H A;  3ZZH A;  4NDR A;  2OGX A;  3D2P A;  1B7B A;  4F6T B;  2RD5 A;  2E9Y A;  4NDQ B;  1OHB A;  4NDO B;  3AAW A;  3S6K A;  2J5T A;  2X2W A;  2J0W A;  2IJ9 A;  3B8G A;  2BUF A;  4JZ7 A;  2V5H A;  3TVI A;  3D41 A;  4F6T A;  1OHA A;  3T7B A;  2BND A;  2JJ4 A;  4I49 A;  4NDQ A;  3QVF A;  4NDP B;  4NDO A;  3WWM A;  2W21 A;  2BNF A;  3QUO A;  3LL9 A;  1GSJ A;  3D2M A;  2J4L A;  3U6U A;  4AXS A;  3EK5 A;  3K4O A;  4JZ9 A;  1OH9 A;  3C1M A;  3L86 A;  2AKO A;  4A7X A;  2BMU A;  2WE5 A;  2J4K A;  3QVH A;  4A7W A;  4AB7 A;  2V4Y A;  3C20 A;  4OLC A;  3AB2 A;  2BNE A;  2JJX A;  2HMF A;  1E19 A;  3ZZI A;  1GS5 A;  2R8V A;  3K4Y A;  3K56 A;  3NWY A;  3EK6 A;  2J5V A;  4NDP A;  4Q1T A;  2BRI A;  2OGX B;  2J0X A;  3L76 A;  3K52 A;  3QUR A;  3QUN A;  4KZT A;  2BRX A;  4JZ8 A;  3WWN A;  2CDQ A;  3D40 A;  3ZZF A;  2AP9 A;  3KZF A;  2A1F A;  2BTY A;  2R98 A;  2VA1 A;  3AB4 A;  2WXB A;  2JI5 A;  3S6G A;  1Z9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...