2WE5A

Carbamate kinase from enterococcus faecalis bound to mgadp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
309
structure length
309
Chain Sequence
GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CARBAMATE KINASE 1
publication title Substrate Binding and Catalysis in Carbamate Kinase Ascertained by Crystallographic and Site- Directed Mutagenesis Studies. Movements and Significance of a Unique Globular Subdomain of This Key Enzyme for Fermentative ATP Production in Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 103
structure length 309
sequence length 309
chains with identical sequence B, C
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2we5A00
3D41A 4A7WA 4Q1TA 1GS5A 3TVIA 3ZZGA 2J0WA 2RD5A 2WE4A 3AB2A 3QVFA 1Z9DA 3EK6A 2BNDA 2A1FA 2JJXA 2BTYA 3C20A 3LL9A 4NDRA 3AAWA 2J4KA 2V4YA 4NDRB 4JZ9A 2R8VA 3EK5A 2E9YA 3U6UA 2J4LA 4AB7A 2BRIA 3C1MA 4AXSA 4JZ8A 1OH9A 2J4JA 3D2PA 2BNFA 3T7BA 3K4YA 4F6TA 3QURA 4JZ7A 4NDPB 4NDOB 4F6TB 4I49A 2AKOA 3S6KA 2OGXB 3S6GA 3LL5A 3QVHA 2V5HA 1E19A 2J0XA 3WWMA 2R98A 3AB4A 2X2WA 2WE5A 3ZZIA 3L86A 1OHAA 3L76A 4NDQA 2J5VA 2AP9A 2VA1A 4NDQB 4NDPA 4NDOA 1B7BA 4KZTA 2J5TA 4A7XA 2HMFA 3QUNA 2W21A 2OGXA 1GSJA 3D40A 2CDQA 3K4OA 1YBDA 3ZZHA 1OHBA 3WWNA 2BMUA 3S6HA 2IJ9A 2BNEA 3KZFA 2BUFA 2WXBA 3LKKA 3K52A 3QUOA 3ZZFA 2BRXA 2JI5A 2JJ4A 4OLCA 4USJA 3D2MA 3B8GA 3K56A 3NWYA 3C1NA
chains in the Genus database with same CATH superfamily
3D41A 4A7WA 4Q1TA 1GS5A 3TVIA 3ZZGA 2J0WA 2RD5A 2WE4A 3AB2A 3QVFA 1Z9DA 3EK6A 2BNDA 2A1FA 2JJXA 2BTYA 3C20A 3LL9A 4NDRA 3AAWA 2J4KA 2V4YA 4NDRB 4JZ9A 2R8VA 3EK5A 2E9YA 3U6UA 2J4LA 4AB7A 2BRIA 3C1MA 4AXSA 4JZ8A 1OH9A 2J4JA 3D2PA 2BNFA 3T7BA 3K4YA 4F6TA 3QURA 4JZ7A 4NDPB 4NDOB 4F6TB 4I49A 2AKOA 3S6KA 2OGXB 3S6GA 3LL5A 3QVHA 2V5HA 1E19A 2J0XA 3WWMA 2R98A 3AB4A 2X2WA 2WE5A 3ZZIA 3L86A 1OHAA 3L76A 4NDQA 2J5VA 2AP9A 2VA1A 4NDQB 4NDPA 4NDOA 1B7BA 4KZTA 2J5TA 4A7XA 2HMFA 3QUNA 2W21A 2OGXA 1GSJA 3D40A 2CDQA 3K4OA 1YBDA 3ZZHA 1OHBA 3WWNA 2BMUA 3S6HA 2IJ9A 2BNEA 3KZFA 2BUFA 2WXBA 3LKKA 3K52A 3QUOA 3ZZFA 2BRXA 2JI5A 2JJ4A 4OLCA 4USJA 3D2MA 3B8GA 3K56A 3NWYA 3C1NA
chains in the Genus database with same CATH topology
3D41A 4A7WA 4Q1TA 1GS5A 3TVIA 3ZZGA 2J0WA 2RD5A 2WE4A 3AB2A 3QVFA 1Z9DA 3EK6A 2BNDA 2A1FA 2JJXA 2BTYA 3C20A 3LL9A 4NDRA 3AAWA 2J4KA 2V4YA 4NDRB 4JZ9A 2R8VA 3EK5A 2E9YA 3U6UA 2J4LA 4AB7A 2BRIA 3C1MA 4AXSA 4JZ8A 1OH9A 2J4JA 3D2PA 2BNFA 3T7BA 3K4YA 4F6TA 3QURA 4JZ7A 4NDPB 4NDOB 4F6TB 4I49A 2AKOA 3S6KA 2OGXB 3S6GA 3LL5A 3QVHA 2V5HA 1E19A 2J0XA 3WWMA 2R98A 3AB4A 2X2WA 2WE5A 3ZZIA 3L86A 1OHAA 3L76A 4NDQA 2J5VA 2AP9A 2VA1A 4NDQB 4NDPA 4NDOA 1B7BA 4KZTA 2J5TA 4A7XA 2HMFA 3QUNA 2W21A 2OGXA 1GSJA 3D40A 2CDQA 3K4OA 1YBDA 3ZZHA 1OHBA 3WWNA 2BMUA 3S6HA 2IJ9A 2BNEA 3KZFA 2BUFA 2WXBA 3LKKA 3K52A 3QUOA 3ZZFA 2BRXA 2JI5A 2JJ4A 4OLCA 4USJA 3D2MA 3B8GA 3K56A 3NWYA 3C1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D41 A;  4A7W A;  4Q1T A;  1GS5 A;  3TVI A;  3ZZG A;  2J0W A;  2RD5 A;  2WE4 A;  3AB2 A;  3QVF A;  1Z9D A;  3EK6 A;  2BND A;  2A1F A;  2JJX A;  2BTY A;  3C20 A;  3LL9 A;  4NDR A;  3AAW A;  2J4K A;  2V4Y A;  4NDR B;  4JZ9 A;  2R8V A;  3EK5 A;  2E9Y A;  3U6U A;  2J4L A;  4AB7 A;  2BRI A;  3C1M A;  4AXS A;  4JZ8 A;  1OH9 A;  2J4J A;  3D2P A;  2BNF A;  3T7B A;  3K4Y A;  4F6T A;  3QUR A;  4JZ7 A;  4NDP B;  4NDO B;  4F6T B;  4I49 A;  2AKO A;  3S6K A;  2OGX B;  3S6G A;  3LL5 A;  3QVH A;  2V5H A;  1E19 A;  2J0X A;  3WWM A;  2R98 A;  3AB4 A;  2X2W A;  2WE5 A;  3ZZI A;  3L86 A;  1OHA A;  3L76 A;  4NDQ A;  2J5V A;  2AP9 A;  2VA1 A;  4NDQ B;  4NDP A;  4NDO A;  1B7B A;  4KZT A;  2J5T A;  4A7X A;  2HMF A;  3QUN A;  2W21 A;  2OGX A;  1GSJ A;  3D40 A;  2CDQ A;  3K4O A;  1YBD A;  3ZZH A;  1OHB A;  3WWN A;  2BMU A;  3S6H A;  2IJ9 A;  2BNE A;  3KZF A;  2BUF A;  2WXB A;  3LKK A;  3K52 A;  3QUO A;  3ZZF A;  2BRX A;  2JI5 A;  2JJ4 A;  4OLC A;  4USJ A;  3D2M A;  3B8G A;  3K56 A;  3NWY A;  3C1N A; 
#chains in the Genus database with same CATH topology
 3D41 A;  4A7W A;  4Q1T A;  1GS5 A;  3TVI A;  3ZZG A;  2J0W A;  2RD5 A;  2WE4 A;  3AB2 A;  3QVF A;  1Z9D A;  3EK6 A;  2BND A;  2A1F A;  2JJX A;  2BTY A;  3C20 A;  3LL9 A;  4NDR A;  3AAW A;  2J4K A;  2V4Y A;  4NDR B;  4JZ9 A;  2R8V A;  3EK5 A;  2E9Y A;  3U6U A;  2J4L A;  4AB7 A;  2BRI A;  3C1M A;  4AXS A;  4JZ8 A;  1OH9 A;  2J4J A;  3D2P A;  2BNF A;  3T7B A;  3K4Y A;  4F6T A;  3QUR A;  4JZ7 A;  4NDP B;  4NDO B;  4F6T B;  4I49 A;  2AKO A;  3S6K A;  2OGX B;  3S6G A;  3LL5 A;  3QVH A;  2V5H A;  1E19 A;  2J0X A;  3WWM A;  2R98 A;  3AB4 A;  2X2W A;  2WE5 A;  3ZZI A;  3L86 A;  1OHA A;  3L76 A;  4NDQ A;  2J5V A;  2AP9 A;  2VA1 A;  4NDQ B;  4NDP A;  4NDO A;  1B7B A;  4KZT A;  2J5T A;  4A7X A;  2HMF A;  3QUN A;  2W21 A;  2OGX A;  1GSJ A;  3D40 A;  2CDQ A;  3K4O A;  1YBD A;  3ZZH A;  1OHB A;  3WWN A;  2BMU A;  3S6H A;  2IJ9 A;  2BNE A;  3KZF A;  2BUF A;  2WXB A;  3LKK A;  3K52 A;  3QUO A;  3ZZF A;  2BRX A;  2JI5 A;  2JJ4 A;  4OLC A;  4USJ A;  3D2M A;  3B8G A;  3K56 A;  3NWY A;  3C1N A; 
#chains in the Genus database with same CATH homology
 3D41 A;  4A7W A;  4Q1T A;  1GS5 A;  3TVI A;  3ZZG A;  2J0W A;  2RD5 A;  2WE4 A;  3AB2 A;  3QVF A;  1Z9D A;  3EK6 A;  2BND A;  2A1F A;  2JJX A;  2BTY A;  3C20 A;  3LL9 A;  4NDR A;  3AAW A;  2J4K A;  2V4Y A;  4NDR B;  4JZ9 A;  2R8V A;  3EK5 A;  2E9Y A;  3U6U A;  2J4L A;  4AB7 A;  2BRI A;  3C1M A;  4AXS A;  4JZ8 A;  1OH9 A;  2J4J A;  3D2P A;  2BNF A;  3T7B A;  3K4Y A;  4F6T A;  3QUR A;  4JZ7 A;  4NDP B;  4NDO B;  4F6T B;  4I49 A;  2AKO A;  3S6K A;  2OGX B;  3S6G A;  3LL5 A;  3QVH A;  2V5H A;  1E19 A;  2J0X A;  3WWM A;  2R98 A;  3AB4 A;  2X2W A;  2WE5 A;  3ZZI A;  3L86 A;  1OHA A;  3L76 A;  4NDQ A;  2J5V A;  2AP9 A;  2VA1 A;  4NDQ B;  4NDP A;  4NDO A;  1B7B A;  4KZT A;  2J5T A;  4A7X A;  2HMF A;  3QUN A;  2W21 A;  2OGX A;  1GSJ A;  3D40 A;  2CDQ A;  3K4O A;  1YBD A;  3ZZH A;  1OHB A;  3WWN A;  2BMU A;  3S6H A;  2IJ9 A;  2BNE A;  3KZF A;  2BUF A;  2WXB A;  3LKK A;  3K52 A;  3QUO A;  3ZZF A;  2BRX A;  2JI5 A;  2JJ4 A;  4OLC A;  4USJ A;  3D2M A;  3B8G A;  3K56 A;  3NWY A;  3C1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...