2BRXA

Ump kinase from pyrococcus furiosus without ligands
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
226
structure length
218
Chain Sequence
b'HMRIVFDIGGSVLVPENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKSVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title The Crystal Structure of Pyrococcus Furiosus Ump Kinase Provides Insight Into Catalysis and Regulation in Microbial Pyrimidine Nucleotide Biosynthesis.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 77
structure length 218
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2brxA00
3KZFA 2RD5A 3C1NA 3ZZHA 3K4OA 4NDOA 2BNEA 3QVHA 4Q1TA 4AB7A 4A7WA 2W21A 3C1MA 4JZ8A 2J5TA 4F6TB 3S6HA 2A1FA 3S6KA 3D2MA 2JI5A 3WWMA 4AXSA 3NWYA 3EK5A 2J0XA 2V5HA 4I49A 1GS5A 2J4JA 3K4YA 3K52A 1B7BA 3D41A 1OH9A 2BNFA 4NDQA 2JJXA 3L76A 2WXBA 2WE4A 3QURA 4NDRA 3WWNA 3D2PA 4NDQB 4F6TA 3B8GA 4JZ7A 4NDPB 4NDRB 2AKOA 3T7BA 3LKKA 4JZ9A 2BRXA 3ZZFA 2VA1A 3TVIA 2R98A 3K56A 2J0WA 1OHBA 4NDPA 3EK6A 2BUFA 2BNDA 2OGXB 3D40A 4USJA 2J4KA 1OHAA 2J4LA 4KZTA 2J5VA 1YBDA 2BRIA 3AB2A 3QVFA 3LL9A 3LL5A 2V4YA 2JJ4A 3U6UA 4OLCA 2IJ9A 2BTYA 2R8VA 3QUOA 3ZZGA 2HMFA 3QUNA 2CDQA 4NDOB 2X2WA 2OGXA 3AB4A 2BMUA 3AAWA 4A7XA 1E19A 1Z9DA 3L86A 3S6GA 1GSJA 2WE5A 2AP9A 3ZZIA 2E9YA 3C20A
chains in the Genus database with same CATH superfamily
3KZFA 2RD5A 3C1NA 3ZZHA 3K4OA 4NDOA 2BNEA 3QVHA 4Q1TA 4AB7A 4A7WA 2W21A 3C1MA 4JZ8A 2J5TA 4F6TB 3S6HA 2A1FA 3S6KA 3D2MA 2JI5A 3WWMA 4AXSA 3NWYA 3EK5A 2J0XA 2V5HA 4I49A 1GS5A 2J4JA 3K4YA 3K52A 1B7BA 3D41A 1OH9A 2BNFA 4NDQA 2JJXA 3L76A 2WXBA 2WE4A 3QURA 4NDRA 3WWNA 3D2PA 4NDQB 4F6TA 3B8GA 4JZ7A 4NDPB 4NDRB 2AKOA 3T7BA 3LKKA 4JZ9A 2BRXA 3ZZFA 2VA1A 3TVIA 2R98A 3K56A 2J0WA 1OHBA 4NDPA 3EK6A 2BUFA 2BNDA 2OGXB 3D40A 4USJA 2J4KA 1OHAA 2J4LA 4KZTA 2J5VA 1YBDA 2BRIA 3AB2A 3QVFA 3LL9A 3LL5A 2V4YA 2JJ4A 3U6UA 4OLCA 2IJ9A 2BTYA 2R8VA 3QUOA 3ZZGA 2HMFA 3QUNA 2CDQA 4NDOB 2X2WA 2OGXA 3AB4A 2BMUA 3AAWA 4A7XA 1E19A 1Z9DA 3L86A 3S6GA 1GSJA 2WE5A 2AP9A 3ZZIA 2E9YA 3C20A
chains in the Genus database with same CATH topology
3KZFA 2RD5A 3C1NA 3ZZHA 3K4OA 4NDOA 2BNEA 3QVHA 4Q1TA 4AB7A 4A7WA 2W21A 3C1MA 4JZ8A 2J5TA 4F6TB 3S6HA 2A1FA 3S6KA 3D2MA 2JI5A 3WWMA 4AXSA 3NWYA 3EK5A 2J0XA 2V5HA 4I49A 1GS5A 2J4JA 3K4YA 3K52A 1B7BA 3D41A 1OH9A 2BNFA 4NDQA 2JJXA 3L76A 2WXBA 2WE4A 3QURA 4NDRA 3WWNA 3D2PA 4NDQB 4F6TA 3B8GA 4JZ7A 4NDPB 4NDRB 2AKOA 3T7BA 3LKKA 4JZ9A 2BRXA 3ZZFA 2VA1A 3TVIA 2R98A 3K56A 2J0WA 1OHBA 4NDPA 3EK6A 2BUFA 2BNDA 2OGXB 3D40A 4USJA 2J4KA 1OHAA 2J4LA 4KZTA 2J5VA 1YBDA 2BRIA 3AB2A 3QVFA 3LL9A 3LL5A 2V4YA 2JJ4A 3U6UA 4OLCA 2IJ9A 2BTYA 2R8VA 3QUOA 3ZZGA 2HMFA 3QUNA 2CDQA 4NDOB 2X2WA 2OGXA 3AB4A 2BMUA 3AAWA 4A7XA 1E19A 1Z9DA 3L86A 3S6GA 1GSJA 2WE5A 2AP9A 3ZZIA 2E9YA 3C20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZF A;  2RD5 A;  3C1N A;  3ZZH A;  3K4O A;  4NDO A;  2BNE A;  3QVH A;  4Q1T A;  4AB7 A;  4A7W A;  2W21 A;  3C1M A;  4JZ8 A;  2J5T A;  4F6T B;  3S6H A;  2A1F A;  3S6K A;  3D2M A;  2JI5 A;  3WWM A;  4AXS A;  3NWY A;  3EK5 A;  2J0X A;  2V5H A;  4I49 A;  1GS5 A;  2J4J A;  3K4Y A;  3K52 A;  1B7B A;  3D41 A;  1OH9 A;  2BNF A;  4NDQ A;  2JJX A;  3L76 A;  2WXB A;  2WE4 A;  3QUR A;  4NDR A;  3WWN A;  3D2P A;  4NDQ B;  4F6T A;  3B8G A;  4JZ7 A;  4NDP B;  4NDR B;  2AKO A;  3T7B A;  3LKK A;  4JZ9 A;  2BRX A;  3ZZF A;  2VA1 A;  3TVI A;  2R98 A;  3K56 A;  2J0W A;  1OHB A;  4NDP A;  3EK6 A;  2BUF A;  2BND A;  2OGX B;  3D40 A;  4USJ A;  2J4K A;  1OHA A;  2J4L A;  4KZT A;  2J5V A;  1YBD A;  2BRI A;  3AB2 A;  3QVF A;  3LL9 A;  3LL5 A;  2V4Y A;  2JJ4 A;  3U6U A;  4OLC A;  2IJ9 A;  2BTY A;  2R8V A;  3QUO A;  3ZZG A;  2HMF A;  3QUN A;  2CDQ A;  4NDO B;  2X2W A;  2OGX A;  3AB4 A;  2BMU A;  3AAW A;  4A7X A;  1E19 A;  1Z9D A;  3L86 A;  3S6G A;  1GSJ A;  2WE5 A;  2AP9 A;  3ZZI A;  2E9Y A;  3C20 A; 
#chains in the Genus database with same CATH topology
 3KZF A;  2RD5 A;  3C1N A;  3ZZH A;  3K4O A;  4NDO A;  2BNE A;  3QVH A;  4Q1T A;  4AB7 A;  4A7W A;  2W21 A;  3C1M A;  4JZ8 A;  2J5T A;  4F6T B;  3S6H A;  2A1F A;  3S6K A;  3D2M A;  2JI5 A;  3WWM A;  4AXS A;  3NWY A;  3EK5 A;  2J0X A;  2V5H A;  4I49 A;  1GS5 A;  2J4J A;  3K4Y A;  3K52 A;  1B7B A;  3D41 A;  1OH9 A;  2BNF A;  4NDQ A;  2JJX A;  3L76 A;  2WXB A;  2WE4 A;  3QUR A;  4NDR A;  3WWN A;  3D2P A;  4NDQ B;  4F6T A;  3B8G A;  4JZ7 A;  4NDP B;  4NDR B;  2AKO A;  3T7B A;  3LKK A;  4JZ9 A;  2BRX A;  3ZZF A;  2VA1 A;  3TVI A;  2R98 A;  3K56 A;  2J0W A;  1OHB A;  4NDP A;  3EK6 A;  2BUF A;  2BND A;  2OGX B;  3D40 A;  4USJ A;  2J4K A;  1OHA A;  2J4L A;  4KZT A;  2J5V A;  1YBD A;  2BRI A;  3AB2 A;  3QVF A;  3LL9 A;  3LL5 A;  2V4Y A;  2JJ4 A;  3U6U A;  4OLC A;  2IJ9 A;  2BTY A;  2R8V A;  3QUO A;  3ZZG A;  2HMF A;  3QUN A;  2CDQ A;  4NDO B;  2X2W A;  2OGX A;  3AB4 A;  2BMU A;  3AAW A;  4A7X A;  1E19 A;  1Z9D A;  3L86 A;  3S6G A;  1GSJ A;  2WE5 A;  2AP9 A;  3ZZI A;  2E9Y A;  3C20 A; 
#chains in the Genus database with same CATH homology
 3KZF A;  2RD5 A;  3C1N A;  3ZZH A;  3K4O A;  4NDO A;  2BNE A;  3QVH A;  4Q1T A;  4AB7 A;  4A7W A;  2W21 A;  3C1M A;  4JZ8 A;  2J5T A;  4F6T B;  3S6H A;  2A1F A;  3S6K A;  3D2M A;  2JI5 A;  3WWM A;  4AXS A;  3NWY A;  3EK5 A;  2J0X A;  2V5H A;  4I49 A;  1GS5 A;  2J4J A;  3K4Y A;  3K52 A;  1B7B A;  3D41 A;  1OH9 A;  2BNF A;  4NDQ A;  2JJX A;  3L76 A;  2WXB A;  2WE4 A;  3QUR A;  4NDR A;  3WWN A;  3D2P A;  4NDQ B;  4F6T A;  3B8G A;  4JZ7 A;  4NDP B;  4NDR B;  2AKO A;  3T7B A;  3LKK A;  4JZ9 A;  2BRX A;  3ZZF A;  2VA1 A;  3TVI A;  2R98 A;  3K56 A;  2J0W A;  1OHB A;  4NDP A;  3EK6 A;  2BUF A;  2BND A;  2OGX B;  3D40 A;  4USJ A;  2J4K A;  1OHA A;  2J4L A;  4KZT A;  2J5V A;  1YBD A;  2BRI A;  3AB2 A;  3QVF A;  3LL9 A;  3LL5 A;  2V4Y A;  2JJ4 A;  3U6U A;  4OLC A;  2IJ9 A;  2BTY A;  2R8V A;  3QUO A;  3ZZG A;  2HMF A;  3QUN A;  2CDQ A;  4NDO B;  2X2W A;  2OGX A;  3AB4 A;  2BMU A;  3AAW A;  4A7X A;  1E19 A;  1Z9D A;  3L86 A;  3S6G A;  1GSJ A;  2WE5 A;  2AP9 A;  3ZZI A;  2E9Y A;  3C20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...