2BRXA

Ump kinase from pyrococcus furiosus without ligands
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
226
structure length
218
Chain Sequence
HMRIVFDIGGSVLVPENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKSVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords URIDYLATE KINASE
publication title The Crystal Structure of Pyrococcus Furiosus Ump Kinase Provides Insight Into Catalysis and Regulation in Microbial Pyrimidine Nucleotide Biosynthesis.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 77
structure length 218
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2brxA00
2JJXA 2WE4A 2BNDA 3C1NA 3ZZFA 2W21A 4A7WA 3L76A 1OH9A 2OGXA 3WWMA 2V5HA 4JZ7A 4AXSA 2BRIA 2A1FA 2OGXB 3AB4A 3T7BA 1E19A 2JJ4A 3WWNA 1GSJA 2J0XA 4NDRA 1OHAA 3S6GA 3QVFA 3D41A 4I49A 4JZ9A 2AP9A 2RD5A 3LL5A 4NDQA 3K4OA 3QURA 4JZ8A 2BNFA 4NDRB 3ZZIA 2BTYA 2E9YA 1Z9DA 4USJA 2WXBA 3LKKA 2R8VA 2J4LA 3S6HA 4KZTA 2JI5A 1GS5A 3EK5A 4Q1TA 2AKOA 2VA1A 1B7BA 2J5TA 3NWYA 1YBDA 2V4YA 2X2WA 3AAWA 2R98A 3D2MA 3K52A 4A7XA 3QVHA 3TVIA 2BMUA 4AB7A 3ZZHA 4NDQB 3C1MA 3D2PA 4F6TA 2J4KA 2J4JA 3S6KA 3B8GA 4F6TB 3K4YA 3ZZGA 2BNEA 4NDOA 2J0WA 3LL9A 3C20A 3AB2A 3QUNA 4NDOB 2J5VA 2HMFA 4NDPA 1OHBA 2BUFA 3L86A 2BRXA 3D40A 4NDPB 2IJ9A 4OLCA 2CDQA 3KZFA 3U6UA 3EK6A 3K56A 3QUOA 2WE5A
chains in the Genus database with same CATH superfamily
2JJXA 2WE4A 2BNDA 3C1NA 3ZZFA 2W21A 4A7WA 3L76A 1OH9A 2OGXA 3WWMA 2V5HA 4JZ7A 4AXSA 2BRIA 2A1FA 2OGXB 3AB4A 3T7BA 1E19A 2JJ4A 3WWNA 1GSJA 2J0XA 4NDRA 1OHAA 3S6GA 3QVFA 3D41A 4I49A 4JZ9A 2AP9A 2RD5A 3LL5A 4NDQA 3K4OA 3QURA 4JZ8A 2BNFA 4NDRB 3ZZIA 2BTYA 2E9YA 1Z9DA 4USJA 2WXBA 3LKKA 2R8VA 2J4LA 3S6HA 4KZTA 2JI5A 1GS5A 3EK5A 4Q1TA 2AKOA 2VA1A 1B7BA 2J5TA 3NWYA 1YBDA 2V4YA 2X2WA 3AAWA 2R98A 3D2MA 3K52A 4A7XA 3QVHA 3TVIA 2BMUA 4AB7A 3ZZHA 4NDQB 3C1MA 3D2PA 4F6TA 2J4KA 2J4JA 3S6KA 3B8GA 4F6TB 3K4YA 3ZZGA 2BNEA 4NDOA 2J0WA 3LL9A 3C20A 3AB2A 3QUNA 4NDOB 2J5VA 2HMFA 4NDPA 1OHBA 2BUFA 3L86A 2BRXA 3D40A 4NDPB 2IJ9A 4OLCA 2CDQA 3KZFA 3U6UA 3EK6A 3K56A 3QUOA 2WE5A
chains in the Genus database with same CATH topology
2JJXA 2WE4A 2BNDA 3C1NA 3ZZFA 2W21A 4A7WA 3L76A 1OH9A 2OGXA 3WWMA 2V5HA 4JZ7A 4AXSA 2BRIA 2A1FA 2OGXB 3AB4A 3T7BA 1E19A 2JJ4A 3WWNA 1GSJA 2J0XA 4NDRA 1OHAA 3S6GA 3QVFA 3D41A 4I49A 4JZ9A 2AP9A 2RD5A 3LL5A 4NDQA 3K4OA 3QURA 4JZ8A 2BNFA 4NDRB 3ZZIA 2BTYA 2E9YA 1Z9DA 4USJA 2WXBA 3LKKA 2R8VA 2J4LA 3S6HA 4KZTA 2JI5A 1GS5A 3EK5A 4Q1TA 2AKOA 2VA1A 1B7BA 2J5TA 3NWYA 1YBDA 2V4YA 2X2WA 3AAWA 2R98A 3D2MA 3K52A 4A7XA 3QVHA 3TVIA 2BMUA 4AB7A 3ZZHA 4NDQB 3C1MA 3D2PA 4F6TA 2J4KA 2J4JA 3S6KA 3B8GA 4F6TB 3K4YA 3ZZGA 2BNEA 4NDOA 2J0WA 3LL9A 3C20A 3AB2A 3QUNA 4NDOB 2J5VA 2HMFA 4NDPA 1OHBA 2BUFA 3L86A 2BRXA 3D40A 4NDPB 2IJ9A 4OLCA 2CDQA 3KZFA 3U6UA 3EK6A 3K56A 3QUOA 2WE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJX A;  2WE4 A;  2BND A;  3C1N A;  3ZZF A;  2W21 A;  4A7W A;  3L76 A;  1OH9 A;  2OGX A;  3WWM A;  2V5H A;  4JZ7 A;  4AXS A;  2BRI A;  2A1F A;  2OGX B;  3AB4 A;  3T7B A;  1E19 A;  2JJ4 A;  3WWN A;  1GSJ A;  2J0X A;  4NDR A;  1OHA A;  3S6G A;  3QVF A;  3D41 A;  4I49 A;  4JZ9 A;  2AP9 A;  2RD5 A;  3LL5 A;  4NDQ A;  3K4O A;  3QUR A;  4JZ8 A;  2BNF A;  4NDR B;  3ZZI A;  2BTY A;  2E9Y A;  1Z9D A;  4USJ A;  2WXB A;  3LKK A;  2R8V A;  2J4L A;  3S6H A;  4KZT A;  2JI5 A;  1GS5 A;  3EK5 A;  4Q1T A;  2AKO A;  2VA1 A;  1B7B A;  2J5T A;  3NWY A;  1YBD A;  2V4Y A;  2X2W A;  3AAW A;  2R98 A;  3D2M A;  3K52 A;  4A7X A;  3QVH A;  3TVI A;  2BMU A;  4AB7 A;  3ZZH A;  4NDQ B;  3C1M A;  3D2P A;  4F6T A;  2J4K A;  2J4J A;  3S6K A;  3B8G A;  4F6T B;  3K4Y A;  3ZZG A;  2BNE A;  4NDO A;  2J0W A;  3LL9 A;  3C20 A;  3AB2 A;  3QUN A;  4NDO B;  2J5V A;  2HMF A;  4NDP A;  1OHB A;  2BUF A;  3L86 A;  2BRX A;  3D40 A;  4NDP B;  2IJ9 A;  4OLC A;  2CDQ A;  3KZF A;  3U6U A;  3EK6 A;  3K56 A;  3QUO A;  2WE5 A; 
#chains in the Genus database with same CATH topology
 2JJX A;  2WE4 A;  2BND A;  3C1N A;  3ZZF A;  2W21 A;  4A7W A;  3L76 A;  1OH9 A;  2OGX A;  3WWM A;  2V5H A;  4JZ7 A;  4AXS A;  2BRI A;  2A1F A;  2OGX B;  3AB4 A;  3T7B A;  1E19 A;  2JJ4 A;  3WWN A;  1GSJ A;  2J0X A;  4NDR A;  1OHA A;  3S6G A;  3QVF A;  3D41 A;  4I49 A;  4JZ9 A;  2AP9 A;  2RD5 A;  3LL5 A;  4NDQ A;  3K4O A;  3QUR A;  4JZ8 A;  2BNF A;  4NDR B;  3ZZI A;  2BTY A;  2E9Y A;  1Z9D A;  4USJ A;  2WXB A;  3LKK A;  2R8V A;  2J4L A;  3S6H A;  4KZT A;  2JI5 A;  1GS5 A;  3EK5 A;  4Q1T A;  2AKO A;  2VA1 A;  1B7B A;  2J5T A;  3NWY A;  1YBD A;  2V4Y A;  2X2W A;  3AAW A;  2R98 A;  3D2M A;  3K52 A;  4A7X A;  3QVH A;  3TVI A;  2BMU A;  4AB7 A;  3ZZH A;  4NDQ B;  3C1M A;  3D2P A;  4F6T A;  2J4K A;  2J4J A;  3S6K A;  3B8G A;  4F6T B;  3K4Y A;  3ZZG A;  2BNE A;  4NDO A;  2J0W A;  3LL9 A;  3C20 A;  3AB2 A;  3QUN A;  4NDO B;  2J5V A;  2HMF A;  4NDP A;  1OHB A;  2BUF A;  3L86 A;  2BRX A;  3D40 A;  4NDP B;  2IJ9 A;  4OLC A;  2CDQ A;  3KZF A;  3U6U A;  3EK6 A;  3K56 A;  3QUO A;  2WE5 A; 
#chains in the Genus database with same CATH homology
 2JJX A;  2WE4 A;  2BND A;  3C1N A;  3ZZF A;  2W21 A;  4A7W A;  3L76 A;  1OH9 A;  2OGX A;  3WWM A;  2V5H A;  4JZ7 A;  4AXS A;  2BRI A;  2A1F A;  2OGX B;  3AB4 A;  3T7B A;  1E19 A;  2JJ4 A;  3WWN A;  1GSJ A;  2J0X A;  4NDR A;  1OHA A;  3S6G A;  3QVF A;  3D41 A;  4I49 A;  4JZ9 A;  2AP9 A;  2RD5 A;  3LL5 A;  4NDQ A;  3K4O A;  3QUR A;  4JZ8 A;  2BNF A;  4NDR B;  3ZZI A;  2BTY A;  2E9Y A;  1Z9D A;  4USJ A;  2WXB A;  3LKK A;  2R8V A;  2J4L A;  3S6H A;  4KZT A;  2JI5 A;  1GS5 A;  3EK5 A;  4Q1T A;  2AKO A;  2VA1 A;  1B7B A;  2J5T A;  3NWY A;  1YBD A;  2V4Y A;  2X2W A;  3AAW A;  2R98 A;  3D2M A;  3K52 A;  4A7X A;  3QVH A;  3TVI A;  2BMU A;  4AB7 A;  3ZZH A;  4NDQ B;  3C1M A;  3D2P A;  4F6T A;  2J4K A;  2J4J A;  3S6K A;  3B8G A;  4F6T B;  3K4Y A;  3ZZG A;  2BNE A;  4NDO A;  2J0W A;  3LL9 A;  3C20 A;  3AB2 A;  3QUN A;  4NDO B;  2J5V A;  2HMF A;  4NDP A;  1OHB A;  2BUF A;  3L86 A;  2BRX A;  3D40 A;  4NDP B;  2IJ9 A;  4OLC A;  2CDQ A;  3KZF A;  3U6U A;  3EK6 A;  3K56 A;  3QUO A;  2WE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...