2BRXA

Ump kinase from pyrococcus furiosus without ligands
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
226
structure length
218
Chain Sequence
HMRIVFDIGGSVLVPENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKSVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title The Crystal Structure of Pyrococcus Furiosus Ump Kinase Provides Insight Into Catalysis and Regulation in Microbial Pyrimidine Nucleotide Biosynthesis.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 77
structure length 218
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2brxA00
2OGXB 3AB2A 3QVHA 2A1FA 3D41A 4NDPB 2AP9A 2J4LA 4F6TB 2J4JA 1OHBA 3L76A 2WE4A 2AKOA 3U6UA 3WWMA 2BRXA 3LL9A 4A7WA 1B7BA 2BNDA 2J5VA 3D40A 4AXSA 3EK5A 2CDQA 2BTYA 3NWYA 4A7XA 2BRIA 3ZZFA 2X2WA 3LL5A 4KZTA 2VA1A 3L86A 2BUFA 2J0XA 3AB4A 3KZFA 3AAWA 4AB7A 2V5HA 3S6GA 2E9YA 3K4YA 2J4KA 3QVFA 4NDRB 4NDOB 1GSJA 3D2PA 1OH9A 4JZ9A 3S6KA 4NDQA 2WXBA 3QUNA 4JZ8A 3WWNA 2OGXA 2BMUA 3C1NA 3ZZHA 4NDPA 2RD5A 4F6TA 2R98A 4I49A 3D2MA 4USJA 3LKKA 3T7BA 4Q1TA 1GS5A 2HMFA 2BNFA 3K4OA 3K52A 2W21A 3QURA 1OHAA 1E19A 4JZ7A 1Z9DA 1YBDA 3ZZIA 2WE5A 3C20A 3TVIA 3C1MA 3QUOA 2V4YA 3EK6A 2J5TA 2JJ4A 2R8VA 2JI5A 3S6HA 2JJXA 4NDQB 2J0WA 3ZZGA 3K56A 3B8GA 2IJ9A 4OLCA 2BNEA 4NDRA 4NDOA
chains in the Genus database with same CATH superfamily
2OGXB 3AB2A 3QVHA 2A1FA 3D41A 4NDPB 2AP9A 2J4LA 4F6TB 2J4JA 1OHBA 3L76A 2WE4A 2AKOA 3U6UA 3WWMA 2BRXA 3LL9A 4A7WA 1B7BA 2BNDA 2J5VA 3D40A 4AXSA 3EK5A 2CDQA 2BTYA 3NWYA 4A7XA 2BRIA 3ZZFA 2X2WA 3LL5A 4KZTA 2VA1A 3L86A 2BUFA 2J0XA 3AB4A 3KZFA 3AAWA 4AB7A 2V5HA 3S6GA 2E9YA 3K4YA 2J4KA 3QVFA 4NDRB 4NDOB 1GSJA 3D2PA 1OH9A 4JZ9A 3S6KA 4NDQA 2WXBA 3QUNA 4JZ8A 3WWNA 2OGXA 2BMUA 3C1NA 3ZZHA 4NDPA 2RD5A 4F6TA 2R98A 4I49A 3D2MA 4USJA 3LKKA 3T7BA 4Q1TA 1GS5A 2HMFA 2BNFA 3K4OA 3K52A 2W21A 3QURA 1OHAA 1E19A 4JZ7A 1Z9DA 1YBDA 3ZZIA 2WE5A 3C20A 3TVIA 3C1MA 3QUOA 2V4YA 3EK6A 2J5TA 2JJ4A 2R8VA 2JI5A 3S6HA 2JJXA 4NDQB 2J0WA 3ZZGA 3K56A 3B8GA 2IJ9A 4OLCA 2BNEA 4NDRA 4NDOA
chains in the Genus database with same CATH topology
2OGXB 3AB2A 3QVHA 2A1FA 3D41A 4NDPB 2AP9A 2J4LA 4F6TB 2J4JA 1OHBA 3L76A 2WE4A 2AKOA 3U6UA 3WWMA 2BRXA 3LL9A 4A7WA 1B7BA 2BNDA 2J5VA 3D40A 4AXSA 3EK5A 2CDQA 2BTYA 3NWYA 4A7XA 2BRIA 3ZZFA 2X2WA 3LL5A 4KZTA 2VA1A 3L86A 2BUFA 2J0XA 3AB4A 3KZFA 3AAWA 4AB7A 2V5HA 3S6GA 2E9YA 3K4YA 2J4KA 3QVFA 4NDRB 4NDOB 1GSJA 3D2PA 1OH9A 4JZ9A 3S6KA 4NDQA 2WXBA 3QUNA 4JZ8A 3WWNA 2OGXA 2BMUA 3C1NA 3ZZHA 4NDPA 2RD5A 4F6TA 2R98A 4I49A 3D2MA 4USJA 3LKKA 3T7BA 4Q1TA 1GS5A 2HMFA 2BNFA 3K4OA 3K52A 2W21A 3QURA 1OHAA 1E19A 4JZ7A 1Z9DA 1YBDA 3ZZIA 2WE5A 3C20A 3TVIA 3C1MA 3QUOA 2V4YA 3EK6A 2J5TA 2JJ4A 2R8VA 2JI5A 3S6HA 2JJXA 4NDQB 2J0WA 3ZZGA 3K56A 3B8GA 2IJ9A 4OLCA 2BNEA 4NDRA 4NDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OGX B;  3AB2 A;  3QVH A;  2A1F A;  3D41 A;  4NDP B;  2AP9 A;  2J4L A;  4F6T B;  2J4J A;  1OHB A;  3L76 A;  2WE4 A;  2AKO A;  3U6U A;  3WWM A;  2BRX A;  3LL9 A;  4A7W A;  1B7B A;  2BND A;  2J5V A;  3D40 A;  4AXS A;  3EK5 A;  2CDQ A;  2BTY A;  3NWY A;  4A7X A;  2BRI A;  3ZZF A;  2X2W A;  3LL5 A;  4KZT A;  2VA1 A;  3L86 A;  2BUF A;  2J0X A;  3AB4 A;  3KZF A;  3AAW A;  4AB7 A;  2V5H A;  3S6G A;  2E9Y A;  3K4Y A;  2J4K A;  3QVF A;  4NDR B;  4NDO B;  1GSJ A;  3D2P A;  1OH9 A;  4JZ9 A;  3S6K A;  4NDQ A;  2WXB A;  3QUN A;  4JZ8 A;  3WWN A;  2OGX A;  2BMU A;  3C1N A;  3ZZH A;  4NDP A;  2RD5 A;  4F6T A;  2R98 A;  4I49 A;  3D2M A;  4USJ A;  3LKK A;  3T7B A;  4Q1T A;  1GS5 A;  2HMF A;  2BNF A;  3K4O A;  3K52 A;  2W21 A;  3QUR A;  1OHA A;  1E19 A;  4JZ7 A;  1Z9D A;  1YBD A;  3ZZI A;  2WE5 A;  3C20 A;  3TVI A;  3C1M A;  3QUO A;  2V4Y A;  3EK6 A;  2J5T A;  2JJ4 A;  2R8V A;  2JI5 A;  3S6H A;  2JJX A;  4NDQ B;  2J0W A;  3ZZG A;  3K56 A;  3B8G A;  2IJ9 A;  4OLC A;  2BNE A;  4NDR A;  4NDO A; 
#chains in the Genus database with same CATH topology
 2OGX B;  3AB2 A;  3QVH A;  2A1F A;  3D41 A;  4NDP B;  2AP9 A;  2J4L A;  4F6T B;  2J4J A;  1OHB A;  3L76 A;  2WE4 A;  2AKO A;  3U6U A;  3WWM A;  2BRX A;  3LL9 A;  4A7W A;  1B7B A;  2BND A;  2J5V A;  3D40 A;  4AXS A;  3EK5 A;  2CDQ A;  2BTY A;  3NWY A;  4A7X A;  2BRI A;  3ZZF A;  2X2W A;  3LL5 A;  4KZT A;  2VA1 A;  3L86 A;  2BUF A;  2J0X A;  3AB4 A;  3KZF A;  3AAW A;  4AB7 A;  2V5H A;  3S6G A;  2E9Y A;  3K4Y A;  2J4K A;  3QVF A;  4NDR B;  4NDO B;  1GSJ A;  3D2P A;  1OH9 A;  4JZ9 A;  3S6K A;  4NDQ A;  2WXB A;  3QUN A;  4JZ8 A;  3WWN A;  2OGX A;  2BMU A;  3C1N A;  3ZZH A;  4NDP A;  2RD5 A;  4F6T A;  2R98 A;  4I49 A;  3D2M A;  4USJ A;  3LKK A;  3T7B A;  4Q1T A;  1GS5 A;  2HMF A;  2BNF A;  3K4O A;  3K52 A;  2W21 A;  3QUR A;  1OHA A;  1E19 A;  4JZ7 A;  1Z9D A;  1YBD A;  3ZZI A;  2WE5 A;  3C20 A;  3TVI A;  3C1M A;  3QUO A;  2V4Y A;  3EK6 A;  2J5T A;  2JJ4 A;  2R8V A;  2JI5 A;  3S6H A;  2JJX A;  4NDQ B;  2J0W A;  3ZZG A;  3K56 A;  3B8G A;  2IJ9 A;  4OLC A;  2BNE A;  4NDR A;  4NDO A; 
#chains in the Genus database with same CATH homology
 2OGX B;  3AB2 A;  3QVH A;  2A1F A;  3D41 A;  4NDP B;  2AP9 A;  2J4L A;  4F6T B;  2J4J A;  1OHB A;  3L76 A;  2WE4 A;  2AKO A;  3U6U A;  3WWM A;  2BRX A;  3LL9 A;  4A7W A;  1B7B A;  2BND A;  2J5V A;  3D40 A;  4AXS A;  3EK5 A;  2CDQ A;  2BTY A;  3NWY A;  4A7X A;  2BRI A;  3ZZF A;  2X2W A;  3LL5 A;  4KZT A;  2VA1 A;  3L86 A;  2BUF A;  2J0X A;  3AB4 A;  3KZF A;  3AAW A;  4AB7 A;  2V5H A;  3S6G A;  2E9Y A;  3K4Y A;  2J4K A;  3QVF A;  4NDR B;  4NDO B;  1GSJ A;  3D2P A;  1OH9 A;  4JZ9 A;  3S6K A;  4NDQ A;  2WXB A;  3QUN A;  4JZ8 A;  3WWN A;  2OGX A;  2BMU A;  3C1N A;  3ZZH A;  4NDP A;  2RD5 A;  4F6T A;  2R98 A;  4I49 A;  3D2M A;  4USJ A;  3LKK A;  3T7B A;  4Q1T A;  1GS5 A;  2HMF A;  2BNF A;  3K4O A;  3K52 A;  2W21 A;  3QUR A;  1OHA A;  1E19 A;  4JZ7 A;  1Z9D A;  1YBD A;  3ZZI A;  2WE5 A;  3C20 A;  3TVI A;  3C1M A;  3QUO A;  2V4Y A;  3EK6 A;  2J5T A;  2JJ4 A;  2R8V A;  2JI5 A;  3S6H A;  2JJX A;  4NDQ B;  2J0W A;  3ZZG A;  3K56 A;  3B8G A;  2IJ9 A;  4OLC A;  2BNE A;  4NDR A;  4NDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...