4NDRB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Molybdenum storage protein subunit beta
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
total genus 93
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndrB00
1GSJA 2X2WA 4A7WA 4NDQB 4JZ7A 1OHAA 4AXSA 2BTYA 2J4JA 2J0WA 2OGXA 2V4YA 2VA1A 3C20A 4JZ9A 2RD5A 4F6TB 4NDPA 2JJ4A 2BNEA 1GS5A 2J4KA 3AB2A 2BRIA 4Q1TA 2WE5A 3U6UA 3LL9A 3NWYA 3QUOA 3KZFA 4JZ8A 3D2PA 2CDQA 2AP9A 2BUFA 3C1NA 3K4OA 3ZZFA 3WWNA 3LKKA 4NDRB 4NDQA 2J0XA 2JJXA 3S6HA 2J4LA 1Z9DA 3B8GA 3L86A 4F6TA 2BRXA 3L76A 3D40A 3K4YA 4OLCA 4AB7A 2E9YA 3QURA 2A1FA 3D2MA 3S6KA 4NDOB 3QUNA 3EK5A 3ZZHA 3QVFA 2HMFA 2J5TA 4NDRA 3K56A 2V5HA 3WWMA 1YBDA 2WE4A 1E19A 2BNDA 1OHBA 2J5VA 3LL5A 3QVHA 4A7XA 4USJA 2OGXB 3S6GA 4NDPB 3TVIA 3K52A 2BMUA 3C1MA 4KZTA 1OH9A 3T7BA 2W21A 3D41A 4NDOA 2IJ9A 3EK6A 2JI5A 3ZZGA 2AKOA 4I49A 3AB4A 3AAWA 2R8VA 2BNFA 1B7BA 2R98A 3ZZIA 2WXBA
chains in the Genus database with same CATH superfamily
1GSJA 2X2WA 4A7WA 4NDQB 4JZ7A 1OHAA 4AXSA 2BTYA 2J4JA 2J0WA 2OGXA 2V4YA 2VA1A 3C20A 4JZ9A 2RD5A 4F6TB 4NDPA 2JJ4A 2BNEA 1GS5A 2J4KA 3AB2A 2BRIA 4Q1TA 2WE5A 3U6UA 3LL9A 3NWYA 3QUOA 3KZFA 4JZ8A 3D2PA 2CDQA 2AP9A 2BUFA 3C1NA 3K4OA 3ZZFA 3WWNA 3LKKA 4NDRB 4NDQA 2J0XA 2JJXA 3S6HA 2J4LA 1Z9DA 3B8GA 3L86A 4F6TA 2BRXA 3L76A 3D40A 3K4YA 4OLCA 4AB7A 2E9YA 3QURA 2A1FA 3D2MA 3S6KA 4NDOB 3QUNA 3EK5A 3ZZHA 3QVFA 2HMFA 2J5TA 4NDRA 3K56A 2V5HA 3WWMA 1YBDA 2WE4A 1E19A 2BNDA 1OHBA 2J5VA 3LL5A 3QVHA 4A7XA 4USJA 2OGXB 3S6GA 4NDPB 3TVIA 3K52A 2BMUA 3C1MA 4KZTA 1OH9A 3T7BA 2W21A 3D41A 4NDOA 2IJ9A 3EK6A 2JI5A 3ZZGA 2AKOA 4I49A 3AB4A 3AAWA 2R8VA 2BNFA 1B7BA 2R98A 3ZZIA 2WXBA
chains in the Genus database with same CATH topology
1GSJA 2X2WA 4A7WA 4NDQB 4JZ7A 1OHAA 4AXSA 2BTYA 2J4JA 2J0WA 2OGXA 2V4YA 2VA1A 3C20A 4JZ9A 2RD5A 4F6TB 4NDPA 2JJ4A 2BNEA 1GS5A 2J4KA 3AB2A 2BRIA 4Q1TA 2WE5A 3U6UA 3LL9A 3NWYA 3QUOA 3KZFA 4JZ8A 3D2PA 2CDQA 2AP9A 2BUFA 3C1NA 3K4OA 3ZZFA 3WWNA 3LKKA 4NDRB 4NDQA 2J0XA 2JJXA 3S6HA 2J4LA 1Z9DA 3B8GA 3L86A 4F6TA 2BRXA 3L76A 3D40A 3K4YA 4OLCA 4AB7A 2E9YA 3QURA 2A1FA 3D2MA 3S6KA 4NDOB 3QUNA 3EK5A 3ZZHA 3QVFA 2HMFA 2J5TA 4NDRA 3K56A 2V5HA 3WWMA 1YBDA 2WE4A 1E19A 2BNDA 1OHBA 2J5VA 3LL5A 3QVHA 4A7XA 4USJA 2OGXB 3S6GA 4NDPB 3TVIA 3K52A 2BMUA 3C1MA 4KZTA 1OH9A 3T7BA 2W21A 3D41A 4NDOA 2IJ9A 3EK6A 2JI5A 3ZZGA 2AKOA 4I49A 3AB4A 3AAWA 2R8VA 2BNFA 1B7BA 2R98A 3ZZIA 2WXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSJ A;  2X2W A;  4A7W A;  4NDQ B;  4JZ7 A;  1OHA A;  4AXS A;  2BTY A;  2J4J A;  2J0W A;  2OGX A;  2V4Y A;  2VA1 A;  3C20 A;  4JZ9 A;  2RD5 A;  4F6T B;  4NDP A;  2JJ4 A;  2BNE A;  1GS5 A;  2J4K A;  3AB2 A;  2BRI A;  4Q1T A;  2WE5 A;  3U6U A;  3LL9 A;  3NWY A;  3QUO A;  3KZF A;  4JZ8 A;  3D2P A;  2CDQ A;  2AP9 A;  2BUF A;  3C1N A;  3K4O A;  3ZZF A;  3WWN A;  3LKK A;  4NDR B;  4NDQ A;  2J0X A;  2JJX A;  3S6H A;  2J4L A;  1Z9D A;  3B8G A;  3L86 A;  4F6T A;  2BRX A;  3L76 A;  3D40 A;  3K4Y A;  4OLC A;  4AB7 A;  2E9Y A;  3QUR A;  2A1F A;  3D2M A;  3S6K A;  4NDO B;  3QUN A;  3EK5 A;  3ZZH A;  3QVF A;  2HMF A;  2J5T A;  4NDR A;  3K56 A;  2V5H A;  3WWM A;  1YBD A;  2WE4 A;  1E19 A;  2BND A;  1OHB A;  2J5V A;  3LL5 A;  3QVH A;  4A7X A;  4USJ A;  2OGX B;  3S6G A;  4NDP B;  3TVI A;  3K52 A;  2BMU A;  3C1M A;  4KZT A;  1OH9 A;  3T7B A;  2W21 A;  3D41 A;  4NDO A;  2IJ9 A;  3EK6 A;  2JI5 A;  3ZZG A;  2AKO A;  4I49 A;  3AB4 A;  3AAW A;  2R8V A;  2BNF A;  1B7B A;  2R98 A;  3ZZI A;  2WXB A; 
#chains in the Genus database with same CATH topology
 1GSJ A;  2X2W A;  4A7W A;  4NDQ B;  4JZ7 A;  1OHA A;  4AXS A;  2BTY A;  2J4J A;  2J0W A;  2OGX A;  2V4Y A;  2VA1 A;  3C20 A;  4JZ9 A;  2RD5 A;  4F6T B;  4NDP A;  2JJ4 A;  2BNE A;  1GS5 A;  2J4K A;  3AB2 A;  2BRI A;  4Q1T A;  2WE5 A;  3U6U A;  3LL9 A;  3NWY A;  3QUO A;  3KZF A;  4JZ8 A;  3D2P A;  2CDQ A;  2AP9 A;  2BUF A;  3C1N A;  3K4O A;  3ZZF A;  3WWN A;  3LKK A;  4NDR B;  4NDQ A;  2J0X A;  2JJX A;  3S6H A;  2J4L A;  1Z9D A;  3B8G A;  3L86 A;  4F6T A;  2BRX A;  3L76 A;  3D40 A;  3K4Y A;  4OLC A;  4AB7 A;  2E9Y A;  3QUR A;  2A1F A;  3D2M A;  3S6K A;  4NDO B;  3QUN A;  3EK5 A;  3ZZH A;  3QVF A;  2HMF A;  2J5T A;  4NDR A;  3K56 A;  2V5H A;  3WWM A;  1YBD A;  2WE4 A;  1E19 A;  2BND A;  1OHB A;  2J5V A;  3LL5 A;  3QVH A;  4A7X A;  4USJ A;  2OGX B;  3S6G A;  4NDP B;  3TVI A;  3K52 A;  2BMU A;  3C1M A;  4KZT A;  1OH9 A;  3T7B A;  2W21 A;  3D41 A;  4NDO A;  2IJ9 A;  3EK6 A;  2JI5 A;  3ZZG A;  2AKO A;  4I49 A;  3AB4 A;  3AAW A;  2R8V A;  2BNF A;  1B7B A;  2R98 A;  3ZZI A;  2WXB A; 
#chains in the Genus database with same CATH homology
 1GSJ A;  2X2W A;  4A7W A;  4NDQ B;  4JZ7 A;  1OHA A;  4AXS A;  2BTY A;  2J4J A;  2J0W A;  2OGX A;  2V4Y A;  2VA1 A;  3C20 A;  4JZ9 A;  2RD5 A;  4F6T B;  4NDP A;  2JJ4 A;  2BNE A;  1GS5 A;  2J4K A;  3AB2 A;  2BRI A;  4Q1T A;  2WE5 A;  3U6U A;  3LL9 A;  3NWY A;  3QUO A;  3KZF A;  4JZ8 A;  3D2P A;  2CDQ A;  2AP9 A;  2BUF A;  3C1N A;  3K4O A;  3ZZF A;  3WWN A;  3LKK A;  4NDR B;  4NDQ A;  2J0X A;  2JJX A;  3S6H A;  2J4L A;  1Z9D A;  3B8G A;  3L86 A;  4F6T A;  2BRX A;  3L76 A;  3D40 A;  3K4Y A;  4OLC A;  4AB7 A;  2E9Y A;  3QUR A;  2A1F A;  3D2M A;  3S6K A;  4NDO B;  3QUN A;  3EK5 A;  3ZZH A;  3QVF A;  2HMF A;  2J5T A;  4NDR A;  3K56 A;  2V5H A;  3WWM A;  1YBD A;  2WE4 A;  1E19 A;  2BND A;  1OHB A;  2J5V A;  3LL5 A;  3QVH A;  4A7X A;  4USJ A;  2OGX B;  3S6G A;  4NDP B;  3TVI A;  3K52 A;  2BMU A;  3C1M A;  4KZT A;  1OH9 A;  3T7B A;  2W21 A;  3D41 A;  4NDO A;  2IJ9 A;  3EK6 A;  2JI5 A;  3ZZG A;  2AKO A;  4I49 A;  3AB4 A;  3AAW A;  2R8V A;  2BNF A;  1B7B A;  2R98 A;  3ZZI A;  2WXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...