4NDRB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit beta
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 93
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndrB00
3ZZIA 3K52A 2OGXB 3T7BA 3LL5A 4F6TA 3QURA 3U6UA 3B8GA 2BNFA 4NDRB 2OGXA 3D2PA 3LKKA 2WE5A 2JJ4A 2AP9A 1GSJA 3L86A 3EK6A 2V5HA 3QUNA 2J4LA 4A7WA 3D41A 4F6TB 2BNDA 2WXBA 1E19A 2IJ9A 2J4JA 3K56A 3K4YA 2R98A 4USJA 2RD5A 2JJXA 1OHBA 3QUOA 1YBDA 3D40A 1OHAA 3TVIA 2X2WA 2HMFA 3D2MA 3ZZGA 3ZZHA 1GS5A 2BRXA 4NDQB 4AB7A 4KZTA 4JZ7A 3LL9A 2R8VA 3NWYA 3WWMA 1OH9A 4AXSA 2BRIA 4NDQA 2BTYA 3WWNA 1Z9DA 3AAWA 4OLCA 3C1NA 2BUFA 2WE4A 4A7XA 3AB2A 3K4OA 2BNEA 2J0WA 2E9YA 2V4YA 2BMUA 3C20A 3EK5A 3KZFA 4JZ9A 2J4KA 4Q1TA 4NDPB 3S6HA 2AKOA 2CDQA 3AB4A 3L76A 2JI5A 4I49A 4NDPA 3QVFA 4NDOB 3S6GA 2VA1A 4NDRA 2W21A 2A1FA 2J0XA 2J5VA 4JZ8A 3S6KA 2J5TA 4NDOA 1B7BA 3C1MA 3ZZFA 3QVHA
chains in the Genus database with same CATH superfamily
3ZZIA 3K52A 2OGXB 3T7BA 3LL5A 4F6TA 3QURA 3U6UA 3B8GA 2BNFA 4NDRB 2OGXA 3D2PA 3LKKA 2WE5A 2JJ4A 2AP9A 1GSJA 3L86A 3EK6A 2V5HA 3QUNA 2J4LA 4A7WA 3D41A 4F6TB 2BNDA 2WXBA 1E19A 2IJ9A 2J4JA 3K56A 3K4YA 2R98A 4USJA 2RD5A 2JJXA 1OHBA 3QUOA 1YBDA 3D40A 1OHAA 3TVIA 2X2WA 2HMFA 3D2MA 3ZZGA 3ZZHA 1GS5A 2BRXA 4NDQB 4AB7A 4KZTA 4JZ7A 3LL9A 2R8VA 3NWYA 3WWMA 1OH9A 4AXSA 2BRIA 4NDQA 2BTYA 3WWNA 1Z9DA 3AAWA 4OLCA 3C1NA 2BUFA 2WE4A 4A7XA 3AB2A 3K4OA 2BNEA 2J0WA 2E9YA 2V4YA 2BMUA 3C20A 3EK5A 3KZFA 4JZ9A 2J4KA 4Q1TA 4NDPB 3S6HA 2AKOA 2CDQA 3AB4A 3L76A 2JI5A 4I49A 4NDPA 3QVFA 4NDOB 3S6GA 2VA1A 4NDRA 2W21A 2A1FA 2J0XA 2J5VA 4JZ8A 3S6KA 2J5TA 4NDOA 1B7BA 3C1MA 3ZZFA 3QVHA
chains in the Genus database with same CATH topology
3ZZIA 3K52A 2OGXB 3T7BA 3LL5A 4F6TA 3QURA 3U6UA 3B8GA 2BNFA 4NDRB 2OGXA 3D2PA 3LKKA 2WE5A 2JJ4A 2AP9A 1GSJA 3L86A 3EK6A 2V5HA 3QUNA 2J4LA 4A7WA 3D41A 4F6TB 2BNDA 2WXBA 1E19A 2IJ9A 2J4JA 3K56A 3K4YA 2R98A 4USJA 2RD5A 2JJXA 1OHBA 3QUOA 1YBDA 3D40A 1OHAA 3TVIA 2X2WA 2HMFA 3D2MA 3ZZGA 3ZZHA 1GS5A 2BRXA 4NDQB 4AB7A 4KZTA 4JZ7A 3LL9A 2R8VA 3NWYA 3WWMA 1OH9A 4AXSA 2BRIA 4NDQA 2BTYA 3WWNA 1Z9DA 3AAWA 4OLCA 3C1NA 2BUFA 2WE4A 4A7XA 3AB2A 3K4OA 2BNEA 2J0WA 2E9YA 2V4YA 2BMUA 3C20A 3EK5A 3KZFA 4JZ9A 2J4KA 4Q1TA 4NDPB 3S6HA 2AKOA 2CDQA 3AB4A 3L76A 2JI5A 4I49A 4NDPA 3QVFA 4NDOB 3S6GA 2VA1A 4NDRA 2W21A 2A1FA 2J0XA 2J5VA 4JZ8A 3S6KA 2J5TA 4NDOA 1B7BA 3C1MA 3ZZFA 3QVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZI A;  3K52 A;  2OGX B;  3T7B A;  3LL5 A;  4F6T A;  3QUR A;  3U6U A;  3B8G A;  2BNF A;  4NDR B;  2OGX A;  3D2P A;  3LKK A;  2WE5 A;  2JJ4 A;  2AP9 A;  1GSJ A;  3L86 A;  3EK6 A;  2V5H A;  3QUN A;  2J4L A;  4A7W A;  3D41 A;  4F6T B;  2BND A;  2WXB A;  1E19 A;  2IJ9 A;  2J4J A;  3K56 A;  3K4Y A;  2R98 A;  4USJ A;  2RD5 A;  2JJX A;  1OHB A;  3QUO A;  1YBD A;  3D40 A;  1OHA A;  3TVI A;  2X2W A;  2HMF A;  3D2M A;  3ZZG A;  3ZZH A;  1GS5 A;  2BRX A;  4NDQ B;  4AB7 A;  4KZT A;  4JZ7 A;  3LL9 A;  2R8V A;  3NWY A;  3WWM A;  1OH9 A;  4AXS A;  2BRI A;  4NDQ A;  2BTY A;  3WWN A;  1Z9D A;  3AAW A;  4OLC A;  3C1N A;  2BUF A;  2WE4 A;  4A7X A;  3AB2 A;  3K4O A;  2BNE A;  2J0W A;  2E9Y A;  2V4Y A;  2BMU A;  3C20 A;  3EK5 A;  3KZF A;  4JZ9 A;  2J4K A;  4Q1T A;  4NDP B;  3S6H A;  2AKO A;  2CDQ A;  3AB4 A;  3L76 A;  2JI5 A;  4I49 A;  4NDP A;  3QVF A;  4NDO B;  3S6G A;  2VA1 A;  4NDR A;  2W21 A;  2A1F A;  2J0X A;  2J5V A;  4JZ8 A;  3S6K A;  2J5T A;  4NDO A;  1B7B A;  3C1M A;  3ZZF A;  3QVH A; 
#chains in the Genus database with same CATH topology
 3ZZI A;  3K52 A;  2OGX B;  3T7B A;  3LL5 A;  4F6T A;  3QUR A;  3U6U A;  3B8G A;  2BNF A;  4NDR B;  2OGX A;  3D2P A;  3LKK A;  2WE5 A;  2JJ4 A;  2AP9 A;  1GSJ A;  3L86 A;  3EK6 A;  2V5H A;  3QUN A;  2J4L A;  4A7W A;  3D41 A;  4F6T B;  2BND A;  2WXB A;  1E19 A;  2IJ9 A;  2J4J A;  3K56 A;  3K4Y A;  2R98 A;  4USJ A;  2RD5 A;  2JJX A;  1OHB A;  3QUO A;  1YBD A;  3D40 A;  1OHA A;  3TVI A;  2X2W A;  2HMF A;  3D2M A;  3ZZG A;  3ZZH A;  1GS5 A;  2BRX A;  4NDQ B;  4AB7 A;  4KZT A;  4JZ7 A;  3LL9 A;  2R8V A;  3NWY A;  3WWM A;  1OH9 A;  4AXS A;  2BRI A;  4NDQ A;  2BTY A;  3WWN A;  1Z9D A;  3AAW A;  4OLC A;  3C1N A;  2BUF A;  2WE4 A;  4A7X A;  3AB2 A;  3K4O A;  2BNE A;  2J0W A;  2E9Y A;  2V4Y A;  2BMU A;  3C20 A;  3EK5 A;  3KZF A;  4JZ9 A;  2J4K A;  4Q1T A;  4NDP B;  3S6H A;  2AKO A;  2CDQ A;  3AB4 A;  3L76 A;  2JI5 A;  4I49 A;  4NDP A;  3QVF A;  4NDO B;  3S6G A;  2VA1 A;  4NDR A;  2W21 A;  2A1F A;  2J0X A;  2J5V A;  4JZ8 A;  3S6K A;  2J5T A;  4NDO A;  1B7B A;  3C1M A;  3ZZF A;  3QVH A; 
#chains in the Genus database with same CATH homology
 3ZZI A;  3K52 A;  2OGX B;  3T7B A;  3LL5 A;  4F6T A;  3QUR A;  3U6U A;  3B8G A;  2BNF A;  4NDR B;  2OGX A;  3D2P A;  3LKK A;  2WE5 A;  2JJ4 A;  2AP9 A;  1GSJ A;  3L86 A;  3EK6 A;  2V5H A;  3QUN A;  2J4L A;  4A7W A;  3D41 A;  4F6T B;  2BND A;  2WXB A;  1E19 A;  2IJ9 A;  2J4J A;  3K56 A;  3K4Y A;  2R98 A;  4USJ A;  2RD5 A;  2JJX A;  1OHB A;  3QUO A;  1YBD A;  3D40 A;  1OHA A;  3TVI A;  2X2W A;  2HMF A;  3D2M A;  3ZZG A;  3ZZH A;  1GS5 A;  2BRX A;  4NDQ B;  4AB7 A;  4KZT A;  4JZ7 A;  3LL9 A;  2R8V A;  3NWY A;  3WWM A;  1OH9 A;  4AXS A;  2BRI A;  4NDQ A;  2BTY A;  3WWN A;  1Z9D A;  3AAW A;  4OLC A;  3C1N A;  2BUF A;  2WE4 A;  4A7X A;  3AB2 A;  3K4O A;  2BNE A;  2J0W A;  2E9Y A;  2V4Y A;  2BMU A;  3C20 A;  3EK5 A;  3KZF A;  4JZ9 A;  2J4K A;  4Q1T A;  4NDP B;  3S6H A;  2AKO A;  2CDQ A;  3AB4 A;  3L76 A;  2JI5 A;  4I49 A;  4NDP A;  3QVF A;  4NDO B;  3S6G A;  2VA1 A;  4NDR A;  2W21 A;  2A1F A;  2J0X A;  2J5V A;  4JZ8 A;  3S6K A;  2J5T A;  4NDO A;  1B7B A;  3C1M A;  3ZZF A;  3QVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...