4NDRB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
b'NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit beta
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 93
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndrB00
3C1MA 2IJ9A 3EK5A 4A7WA 1GSJA 3QURA 4I49A 2AKOA 2JJXA 3TVIA 4NDOA 3WWMA 4NDPB 1B7BA 3S6KA 2BUFA 4KZTA 2BMUA 4USJA 4JZ9A 4NDPA 2JI5A 4OLCA 2RD5A 3AAWA 4JZ8A 3LL9A 2WXBA 2J4LA 3U6UA 4JZ7A 4F6TB 3LKKA 2R8VA 2R98A 2AP9A 2J0XA 1GS5A 2JJ4A 3ZZFA 2J0WA 3D40A 2WE4A 2A1FA 3K52A 4F6TA 1Z9DA 3ZZGA 3QUNA 4AXSA 2BNFA 2OGXB 3T7BA 2V4YA 2VA1A 4NDQB 3WWNA 4AB7A 2BRXA 3QVHA 2HMFA 2OGXA 1E19A 3K4YA 4NDQA 3LL5A 3AB4A 3S6GA 3D2PA 3AB2A 3KZFA 2J4JA 2J5TA 2BNEA 1OHBA 3K56A 2BNDA 3NWYA 3L76A 2V5HA 2WE5A 2E9YA 1OHAA 2CDQA 3C1NA 3D41A 2BTYA 3QUOA 4NDOB 3D2MA 2J5VA 3EK6A 3L86A 3ZZIA 4NDRB 3C20A 3K4OA 3QVFA 2W21A 2J4KA 2X2WA 2BRIA 4NDRA 3S6HA 4A7XA 3ZZHA 4Q1TA 1YBDA 1OH9A 3B8GA
chains in the Genus database with same CATH superfamily
3C1MA 2IJ9A 3EK5A 4A7WA 1GSJA 3QURA 4I49A 2AKOA 2JJXA 3TVIA 4NDOA 3WWMA 4NDPB 1B7BA 3S6KA 2BUFA 4KZTA 2BMUA 4USJA 4JZ9A 4NDPA 2JI5A 4OLCA 2RD5A 3AAWA 4JZ8A 3LL9A 2WXBA 2J4LA 3U6UA 4JZ7A 4F6TB 3LKKA 2R8VA 2R98A 2AP9A 2J0XA 1GS5A 2JJ4A 3ZZFA 2J0WA 3D40A 2WE4A 2A1FA 3K52A 4F6TA 1Z9DA 3ZZGA 3QUNA 4AXSA 2BNFA 2OGXB 3T7BA 2V4YA 2VA1A 4NDQB 3WWNA 4AB7A 2BRXA 3QVHA 2HMFA 2OGXA 1E19A 3K4YA 4NDQA 3LL5A 3AB4A 3S6GA 3D2PA 3AB2A 3KZFA 2J4JA 2J5TA 2BNEA 1OHBA 3K56A 2BNDA 3NWYA 3L76A 2V5HA 2WE5A 2E9YA 1OHAA 2CDQA 3C1NA 3D41A 2BTYA 3QUOA 4NDOB 3D2MA 2J5VA 3EK6A 3L86A 3ZZIA 4NDRB 3C20A 3K4OA 3QVFA 2W21A 2J4KA 2X2WA 2BRIA 4NDRA 3S6HA 4A7XA 3ZZHA 4Q1TA 1YBDA 1OH9A 3B8GA
chains in the Genus database with same CATH topology
3C1MA 2IJ9A 3EK5A 4A7WA 1GSJA 3QURA 4I49A 2AKOA 2JJXA 3TVIA 4NDOA 3WWMA 4NDPB 1B7BA 3S6KA 2BUFA 4KZTA 2BMUA 4USJA 4JZ9A 4NDPA 2JI5A 4OLCA 2RD5A 3AAWA 4JZ8A 3LL9A 2WXBA 2J4LA 3U6UA 4JZ7A 4F6TB 3LKKA 2R8VA 2R98A 2AP9A 2J0XA 1GS5A 2JJ4A 3ZZFA 2J0WA 3D40A 2WE4A 2A1FA 3K52A 4F6TA 1Z9DA 3ZZGA 3QUNA 4AXSA 2BNFA 2OGXB 3T7BA 2V4YA 2VA1A 4NDQB 3WWNA 4AB7A 2BRXA 3QVHA 2HMFA 2OGXA 1E19A 3K4YA 4NDQA 3LL5A 3AB4A 3S6GA 3D2PA 3AB2A 3KZFA 2J4JA 2J5TA 2BNEA 1OHBA 3K56A 2BNDA 3NWYA 3L76A 2V5HA 2WE5A 2E9YA 1OHAA 2CDQA 3C1NA 3D41A 2BTYA 3QUOA 4NDOB 3D2MA 2J5VA 3EK6A 3L86A 3ZZIA 4NDRB 3C20A 3K4OA 3QVFA 2W21A 2J4KA 2X2WA 2BRIA 4NDRA 3S6HA 4A7XA 3ZZHA 4Q1TA 1YBDA 1OH9A 3B8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1M A;  2IJ9 A;  3EK5 A;  4A7W A;  1GSJ A;  3QUR A;  4I49 A;  2AKO A;  2JJX A;  3TVI A;  4NDO A;  3WWM A;  4NDP B;  1B7B A;  3S6K A;  2BUF A;  4KZT A;  2BMU A;  4USJ A;  4JZ9 A;  4NDP A;  2JI5 A;  4OLC A;  2RD5 A;  3AAW A;  4JZ8 A;  3LL9 A;  2WXB A;  2J4L A;  3U6U A;  4JZ7 A;  4F6T B;  3LKK A;  2R8V A;  2R98 A;  2AP9 A;  2J0X A;  1GS5 A;  2JJ4 A;  3ZZF A;  2J0W A;  3D40 A;  2WE4 A;  2A1F A;  3K52 A;  4F6T A;  1Z9D A;  3ZZG A;  3QUN A;  4AXS A;  2BNF A;  2OGX B;  3T7B A;  2V4Y A;  2VA1 A;  4NDQ B;  3WWN A;  4AB7 A;  2BRX A;  3QVH A;  2HMF A;  2OGX A;  1E19 A;  3K4Y A;  4NDQ A;  3LL5 A;  3AB4 A;  3S6G A;  3D2P A;  3AB2 A;  3KZF A;  2J4J A;  2J5T A;  2BNE A;  1OHB A;  3K56 A;  2BND A;  3NWY A;  3L76 A;  2V5H A;  2WE5 A;  2E9Y A;  1OHA A;  2CDQ A;  3C1N A;  3D41 A;  2BTY A;  3QUO A;  4NDO B;  3D2M A;  2J5V A;  3EK6 A;  3L86 A;  3ZZI A;  4NDR B;  3C20 A;  3K4O A;  3QVF A;  2W21 A;  2J4K A;  2X2W A;  2BRI A;  4NDR A;  3S6H A;  4A7X A;  3ZZH A;  4Q1T A;  1YBD A;  1OH9 A;  3B8G A; 
#chains in the Genus database with same CATH topology
 3C1M A;  2IJ9 A;  3EK5 A;  4A7W A;  1GSJ A;  3QUR A;  4I49 A;  2AKO A;  2JJX A;  3TVI A;  4NDO A;  3WWM A;  4NDP B;  1B7B A;  3S6K A;  2BUF A;  4KZT A;  2BMU A;  4USJ A;  4JZ9 A;  4NDP A;  2JI5 A;  4OLC A;  2RD5 A;  3AAW A;  4JZ8 A;  3LL9 A;  2WXB A;  2J4L A;  3U6U A;  4JZ7 A;  4F6T B;  3LKK A;  2R8V A;  2R98 A;  2AP9 A;  2J0X A;  1GS5 A;  2JJ4 A;  3ZZF A;  2J0W A;  3D40 A;  2WE4 A;  2A1F A;  3K52 A;  4F6T A;  1Z9D A;  3ZZG A;  3QUN A;  4AXS A;  2BNF A;  2OGX B;  3T7B A;  2V4Y A;  2VA1 A;  4NDQ B;  3WWN A;  4AB7 A;  2BRX A;  3QVH A;  2HMF A;  2OGX A;  1E19 A;  3K4Y A;  4NDQ A;  3LL5 A;  3AB4 A;  3S6G A;  3D2P A;  3AB2 A;  3KZF A;  2J4J A;  2J5T A;  2BNE A;  1OHB A;  3K56 A;  2BND A;  3NWY A;  3L76 A;  2V5H A;  2WE5 A;  2E9Y A;  1OHA A;  2CDQ A;  3C1N A;  3D41 A;  2BTY A;  3QUO A;  4NDO B;  3D2M A;  2J5V A;  3EK6 A;  3L86 A;  3ZZI A;  4NDR B;  3C20 A;  3K4O A;  3QVF A;  2W21 A;  2J4K A;  2X2W A;  2BRI A;  4NDR A;  3S6H A;  4A7X A;  3ZZH A;  4Q1T A;  1YBD A;  1OH9 A;  3B8G A; 
#chains in the Genus database with same CATH homology
 3C1M A;  2IJ9 A;  3EK5 A;  4A7W A;  1GSJ A;  3QUR A;  4I49 A;  2AKO A;  2JJX A;  3TVI A;  4NDO A;  3WWM A;  4NDP B;  1B7B A;  3S6K A;  2BUF A;  4KZT A;  2BMU A;  4USJ A;  4JZ9 A;  4NDP A;  2JI5 A;  4OLC A;  2RD5 A;  3AAW A;  4JZ8 A;  3LL9 A;  2WXB A;  2J4L A;  3U6U A;  4JZ7 A;  4F6T B;  3LKK A;  2R8V A;  2R98 A;  2AP9 A;  2J0X A;  1GS5 A;  2JJ4 A;  3ZZF A;  2J0W A;  3D40 A;  2WE4 A;  2A1F A;  3K52 A;  4F6T A;  1Z9D A;  3ZZG A;  3QUN A;  4AXS A;  2BNF A;  2OGX B;  3T7B A;  2V4Y A;  2VA1 A;  4NDQ B;  3WWN A;  4AB7 A;  2BRX A;  3QVH A;  2HMF A;  2OGX A;  1E19 A;  3K4Y A;  4NDQ A;  3LL5 A;  3AB4 A;  3S6G A;  3D2P A;  3AB2 A;  3KZF A;  2J4J A;  2J5T A;  2BNE A;  1OHB A;  3K56 A;  2BND A;  3NWY A;  3L76 A;  2V5H A;  2WE5 A;  2E9Y A;  1OHA A;  2CDQ A;  3C1N A;  3D41 A;  2BTY A;  3QUO A;  4NDO B;  3D2M A;  2J5V A;  3EK6 A;  3L86 A;  3ZZI A;  4NDR B;  3C20 A;  3K4O A;  3QVF A;  2W21 A;  2J4K A;  2X2W A;  2BRI A;  4NDR A;  3S6H A;  4A7X A;  3ZZH A;  4Q1T A;  1YBD A;  1OH9 A;  3B8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...