4NDRB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit beta
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 93
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndrB00
4F6TB 4NDRA 1Z9DA 2WXBA 4AXSA 2X2WA 4JZ7A 3TVIA 1GSJA 2V5HA 1E19A 4A7XA 2BNFA 3WWMA 1GS5A 1OHAA 4USJA 1OHBA 4JZ9A 3EK5A 2OGXB 3C1MA 3K52A 2J0XA 2IJ9A 2HMFA 3ZZHA 3AB4A 4NDOB 3C20A 4NDPA 3QVHA 2BNDA 1YBDA 3U6UA 2J0WA 2J5TA 3NWYA 2WE5A 4I49A 2WE4A 1B7BA 3LL5A 3D2PA 2J5VA 4F6TA 1OH9A 3LKKA 3AB2A 2V4YA 4Q1TA 2BMUA 4OLCA 3S6HA 3L86A 3QUNA 4JZ8A 2A1FA 2OGXA 2BRXA 2BTYA 3ZZGA 3LL9A 4NDOA 2J4KA 3S6GA 2VA1A 2J4JA 2BNEA 2JJ4A 3S6KA 2JI5A 4NDQB 2CDQA 2BUFA 4NDRB 2W21A 3L76A 4KZTA 3AAWA 3C1NA 3KZFA 4AB7A 3WWNA 2AKOA 3EK6A 2BRIA 3D2MA 2R8VA 2J4LA 3K56A 3D41A 3ZZFA 4NDPB 2JJXA 3QVFA 3K4OA 2R98A 2AP9A 3B8GA 4A7WA 3K4YA 3T7BA 2E9YA 2RD5A 3QURA 3ZZIA 3QUOA 3D40A 4NDQA
chains in the Genus database with same CATH superfamily
4F6TB 4NDRA 1Z9DA 2WXBA 4AXSA 2X2WA 4JZ7A 3TVIA 1GSJA 2V5HA 1E19A 4A7XA 2BNFA 3WWMA 1GS5A 1OHAA 4USJA 1OHBA 4JZ9A 3EK5A 2OGXB 3C1MA 3K52A 2J0XA 2IJ9A 2HMFA 3ZZHA 3AB4A 4NDOB 3C20A 4NDPA 3QVHA 2BNDA 1YBDA 3U6UA 2J0WA 2J5TA 3NWYA 2WE5A 4I49A 2WE4A 1B7BA 3LL5A 3D2PA 2J5VA 4F6TA 1OH9A 3LKKA 3AB2A 2V4YA 4Q1TA 2BMUA 4OLCA 3S6HA 3L86A 3QUNA 4JZ8A 2A1FA 2OGXA 2BRXA 2BTYA 3ZZGA 3LL9A 4NDOA 2J4KA 3S6GA 2VA1A 2J4JA 2BNEA 2JJ4A 3S6KA 2JI5A 4NDQB 2CDQA 2BUFA 4NDRB 2W21A 3L76A 4KZTA 3AAWA 3C1NA 3KZFA 4AB7A 3WWNA 2AKOA 3EK6A 2BRIA 3D2MA 2R8VA 2J4LA 3K56A 3D41A 3ZZFA 4NDPB 2JJXA 3QVFA 3K4OA 2R98A 2AP9A 3B8GA 4A7WA 3K4YA 3T7BA 2E9YA 2RD5A 3QURA 3ZZIA 3QUOA 3D40A 4NDQA
chains in the Genus database with same CATH topology
4F6TB 4NDRA 1Z9DA 2WXBA 4AXSA 2X2WA 4JZ7A 3TVIA 1GSJA 2V5HA 1E19A 4A7XA 2BNFA 3WWMA 1GS5A 1OHAA 4USJA 1OHBA 4JZ9A 3EK5A 2OGXB 3C1MA 3K52A 2J0XA 2IJ9A 2HMFA 3ZZHA 3AB4A 4NDOB 3C20A 4NDPA 3QVHA 2BNDA 1YBDA 3U6UA 2J0WA 2J5TA 3NWYA 2WE5A 4I49A 2WE4A 1B7BA 3LL5A 3D2PA 2J5VA 4F6TA 1OH9A 3LKKA 3AB2A 2V4YA 4Q1TA 2BMUA 4OLCA 3S6HA 3L86A 3QUNA 4JZ8A 2A1FA 2OGXA 2BRXA 2BTYA 3ZZGA 3LL9A 4NDOA 2J4KA 3S6GA 2VA1A 2J4JA 2BNEA 2JJ4A 3S6KA 2JI5A 4NDQB 2CDQA 2BUFA 4NDRB 2W21A 3L76A 4KZTA 3AAWA 3C1NA 3KZFA 4AB7A 3WWNA 2AKOA 3EK6A 2BRIA 3D2MA 2R8VA 2J4LA 3K56A 3D41A 3ZZFA 4NDPB 2JJXA 3QVFA 3K4OA 2R98A 2AP9A 3B8GA 4A7WA 3K4YA 3T7BA 2E9YA 2RD5A 3QURA 3ZZIA 3QUOA 3D40A 4NDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F6T B;  4NDR A;  1Z9D A;  2WXB A;  4AXS A;  2X2W A;  4JZ7 A;  3TVI A;  1GSJ A;  2V5H A;  1E19 A;  4A7X A;  2BNF A;  3WWM A;  1GS5 A;  1OHA A;  4USJ A;  1OHB A;  4JZ9 A;  3EK5 A;  2OGX B;  3C1M A;  3K52 A;  2J0X A;  2IJ9 A;  2HMF A;  3ZZH A;  3AB4 A;  4NDO B;  3C20 A;  4NDP A;  3QVH A;  2BND A;  1YBD A;  3U6U A;  2J0W A;  2J5T A;  3NWY A;  2WE5 A;  4I49 A;  2WE4 A;  1B7B A;  3LL5 A;  3D2P A;  2J5V A;  4F6T A;  1OH9 A;  3LKK A;  3AB2 A;  2V4Y A;  4Q1T A;  2BMU A;  4OLC A;  3S6H A;  3L86 A;  3QUN A;  4JZ8 A;  2A1F A;  2OGX A;  2BRX A;  2BTY A;  3ZZG A;  3LL9 A;  4NDO A;  2J4K A;  3S6G A;  2VA1 A;  2J4J A;  2BNE A;  2JJ4 A;  3S6K A;  2JI5 A;  4NDQ B;  2CDQ A;  2BUF A;  4NDR B;  2W21 A;  3L76 A;  4KZT A;  3AAW A;  3C1N A;  3KZF A;  4AB7 A;  3WWN A;  2AKO A;  3EK6 A;  2BRI A;  3D2M A;  2R8V A;  2J4L A;  3K56 A;  3D41 A;  3ZZF A;  4NDP B;  2JJX A;  3QVF A;  3K4O A;  2R98 A;  2AP9 A;  3B8G A;  4A7W A;  3K4Y A;  3T7B A;  2E9Y A;  2RD5 A;  3QUR A;  3ZZI A;  3QUO A;  3D40 A;  4NDQ A; 
#chains in the Genus database with same CATH topology
 4F6T B;  4NDR A;  1Z9D A;  2WXB A;  4AXS A;  2X2W A;  4JZ7 A;  3TVI A;  1GSJ A;  2V5H A;  1E19 A;  4A7X A;  2BNF A;  3WWM A;  1GS5 A;  1OHA A;  4USJ A;  1OHB A;  4JZ9 A;  3EK5 A;  2OGX B;  3C1M A;  3K52 A;  2J0X A;  2IJ9 A;  2HMF A;  3ZZH A;  3AB4 A;  4NDO B;  3C20 A;  4NDP A;  3QVH A;  2BND A;  1YBD A;  3U6U A;  2J0W A;  2J5T A;  3NWY A;  2WE5 A;  4I49 A;  2WE4 A;  1B7B A;  3LL5 A;  3D2P A;  2J5V A;  4F6T A;  1OH9 A;  3LKK A;  3AB2 A;  2V4Y A;  4Q1T A;  2BMU A;  4OLC A;  3S6H A;  3L86 A;  3QUN A;  4JZ8 A;  2A1F A;  2OGX A;  2BRX A;  2BTY A;  3ZZG A;  3LL9 A;  4NDO A;  2J4K A;  3S6G A;  2VA1 A;  2J4J A;  2BNE A;  2JJ4 A;  3S6K A;  2JI5 A;  4NDQ B;  2CDQ A;  2BUF A;  4NDR B;  2W21 A;  3L76 A;  4KZT A;  3AAW A;  3C1N A;  3KZF A;  4AB7 A;  3WWN A;  2AKO A;  3EK6 A;  2BRI A;  3D2M A;  2R8V A;  2J4L A;  3K56 A;  3D41 A;  3ZZF A;  4NDP B;  2JJX A;  3QVF A;  3K4O A;  2R98 A;  2AP9 A;  3B8G A;  4A7W A;  3K4Y A;  3T7B A;  2E9Y A;  2RD5 A;  3QUR A;  3ZZI A;  3QUO A;  3D40 A;  4NDQ A; 
#chains in the Genus database with same CATH homology
 4F6T B;  4NDR A;  1Z9D A;  2WXB A;  4AXS A;  2X2W A;  4JZ7 A;  3TVI A;  1GSJ A;  2V5H A;  1E19 A;  4A7X A;  2BNF A;  3WWM A;  1GS5 A;  1OHA A;  4USJ A;  1OHB A;  4JZ9 A;  3EK5 A;  2OGX B;  3C1M A;  3K52 A;  2J0X A;  2IJ9 A;  2HMF A;  3ZZH A;  3AB4 A;  4NDO B;  3C20 A;  4NDP A;  3QVH A;  2BND A;  1YBD A;  3U6U A;  2J0W A;  2J5T A;  3NWY A;  2WE5 A;  4I49 A;  2WE4 A;  1B7B A;  3LL5 A;  3D2P A;  2J5V A;  4F6T A;  1OH9 A;  3LKK A;  3AB2 A;  2V4Y A;  4Q1T A;  2BMU A;  4OLC A;  3S6H A;  3L86 A;  3QUN A;  4JZ8 A;  2A1F A;  2OGX A;  2BRX A;  2BTY A;  3ZZG A;  3LL9 A;  4NDO A;  2J4K A;  3S6G A;  2VA1 A;  2J4J A;  2BNE A;  2JJ4 A;  3S6K A;  2JI5 A;  4NDQ B;  2CDQ A;  2BUF A;  4NDR B;  2W21 A;  3L76 A;  4KZT A;  3AAW A;  3C1N A;  3KZF A;  4AB7 A;  3WWN A;  2AKO A;  3EK6 A;  2BRI A;  3D2M A;  2R8V A;  2J4L A;  3K56 A;  3D41 A;  3ZZF A;  4NDP B;  2JJX A;  3QVF A;  3K4O A;  2R98 A;  2AP9 A;  3B8G A;  4A7W A;  3K4Y A;  3T7B A;  2E9Y A;  2RD5 A;  3QUR A;  3ZZI A;  3QUO A;  3D40 A;  4NDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...